2EIRA

Design of disulfide-linked thioredoxin dimers and multimers through analysis of crystal contacts
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKCFLDCNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Thioredoxin 1
publication title Design of Disulfide-linked Thioredoxin Dimers and Multimers Through Analysis of Crystal Contacts
pubmed doi rcsb
source organism Escherichia coli
total genus 27
structure length 107
sequence length 107
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2eirA00
3FK8A 3HZ8A 2JACA 3QPMA 1A0RP 5D8IA 3KP9A 1J0FA 3VPQA 3EC3A 1WE0A 5COHA 4WF4A 4HEA2 5F0GA 1EV4A 5F05A 1AQXA 3CSHA 4F9ZA 4V1Ap 1K0AA 3D4MA 3Q18A 4EKZA 5DQSA 5EY6A 5HFGA 1ERVA 4JRRA 4FIWA 1SU9A 4ECBA 2YV9A 1YKAA 3HJMA 3EWLA 1FO5A 2LRNA 4F2IA 2H1DA 2I3YA 2OBKA 3O3TA 2ZUPA 1DUGA 3F4SA 3WYWA 1O8XA 4IQ1A 4GSTA 4WBRD 2YV7A 1A2LA 1SL2B 4O7HA 1V58A 3TJFA 1ERWA 1FVKA 2LEGA 2VL9A 2H71A 3ZIJA 1X5DA 2GTUA 2XC2A 2WFCA 2TIRA 2EC4A 1HNBA 2DJJA 1KTEA 1ST9A 2AJQB 1Z5YE 1KNGA 5HR2A 2O85A 5CAXA 1SJ6A 3DXBA 3G7IA 5G2ZA 1Y6EA 3QD9A 2WRTA 2YCDA 2IPAA 4NHWA 4OFMA 3LYKA 4ZBAA 2IFQB 1X9WB 2MMNA 7GSSA 4IBPA 2NVLA 4MJCA 3F4TA 1SYXA 2GVPA 4HS1A 3CXGA 5AISA 1TK5B 4JR6A 1B4PA 4K7NA 3QAGA 4FYCA 3CTGA 1Z7PA 1U3IA 2MZCA 3KJYA 3ZFLA 5GSTA 5IPHA 3Q6OA 2NDOA 2P0GA 2C80A 3UEMA 4TVEA 1R4WA 1MD3A 5FT3A 2V6KA 1WP0A 4BVXA 5D9WA 1M0UA 3RDWA 2YN1A 5JCGA 5DALA 3L9UA 4PNGA 2CA8A 4WR5A 5JWQB 4N30A 2AHEA 4CHSA 1WRYA 4MZCA 2WDUA 2L59A 1CQHA 3GKMA 4LA1A 2H66A 5KN3A 3KP8A 3D6IA 4XS4B 1VGLA 1AUCA 2H6ZA 1A0FA 2JADA 4Z7XA 4PX1A 1QK8A 1VRSD 3IE3A 1X9SB 5G31A 4HJMA 8GSSA 3ZLPA 1OVNA 1JLWA 4IJIA 1UC7A 1XWGA 1NHYA 2AB6A 3TOUA 3FKFA 4TXVA 3ISOA 2VLUA 1A2MA 4HU7A 2GT5A 2H6YA 2GQKA 4ILFA 2MMZA 2K8VA 1MEKA 3UJ1A 5IPGA 2LUSA 3TKSC 3MNGA 3J7Yk 2GQMA 5GSSA 4MZWA 2NPBA 1VF1A 1PX6A 16GSA 1GTBA 2PWJA 3M1GA 2H8LA 1X5EA 3VURA 2PGTA 1GRXA 2H76A 3IAM2 4KSMA 4XRAA 2CV4A 3ZZXA 4ML1A 2IIYA 3RHCA 5IIZA 1F2EA 4NAXA 5F8BA 3DVXA 3KCMA 3VFIA 1I5GA 3HKRA 3UARA 2K6VA 2X8HA 3QDNA 1YEPA 4KA0A 1TDIA 2H1AA 1M9BA 1TOFA 3UMAA 1ERTA 1MDJA 2PVOC 3GV1A 6GSSA 1AXDA 5IQYA 14GSA 5G5FA 2BTOT 4CDOA 1PN9A 4PNFA 5HQPA 3IK9A 3ME8A 1SD9A 3ZREA 1TW9A 4IP6A 1UN2A 1XBSA 5H5QA 4MH2A 4PGTA 1TRWA 2MBTA 4L5OA 3VI5A 3GL3A 4BPYA 1A24A 1TI1A 2F8FA 2LTKA 3CBUA 3GIXA 3TUEA 3DIEA 2OA7A 2J9HA 3C1SA 2F51A 1PKWA 4MJEA 4EL1A 1GUHA 4MK3A 4N0ZA 1VF4A 4G2EA 2DIYA 1O81A 3BOAA 4DSSA 1GNWA 1Z3EA 1DE2A 3CYNA 1GULA 2H6XA 3LWAA 3IR4A 4TR0A 2MBSA 3EMPA 4QL7A 2LQOA 3TB2A 1B48A 3KEBA 4K7OA 3G7YA 2OE1A 5CNWA 1V98A 1TKDB 1G7OA 1F9MA 5DAKA 4J2FA 3KZQA 1XCCA 5D9XA 1V2AA 1R26A 5IOXA 4J57E 2FLSA 4NXIA 20GSA 1K0NA 4X43A 4RI7A 1SK0A 4G19A 1OC8A 3ZRDA 2IWTA 4YQUA 3F3QA 3KH7A 2E0QA 3F3RA 5D93A 2A4VA 2ON7A 2GT6A 3VWVA 2ZNMA 2IMDA 3KIJA 2IN3A 1BYEA 3QFAC 1TI3A 3HXSA 3F9UA 2B5XA 4GSNA 1PL2A 5GAND 4HQZA 4WETA 2GDRA 3F6FA 4MA9A 2KHPA 2F8AA 5ECSA 1OC9A 1M2AA 2XHFA 2G2QA 2IMKA 2YJ7A 3DRNA 3LGCA 2GGTA 2YWOA 1ZL9A 1GUMA 4MMMA 5J4UA 3N5OA 2B6MA 1JHBA 9GSSA 5G30A 1PKZA 2H0GA 2QKEA 3TKPA 4POLA 4L5LA 5CRDA 5ID2B 4OO5A 1EOHA 4ZL7A 5A5KA 3O6TA 1HNAA 3ME7A 3VK9A 4O5RA 1T4YA 3LQ7A 1DSBA 2GZZA 5ECHB 17GSA 2HLSA 1XW9A 1WIKA 5CRWA 4OFTA 3FR9A 1E2YA 1O8WA 3F0IA 5G5EA 2C3QA 2QGVA 1W4VA 3PGTA 3ZIVA 2V41A 3TRXA 1AAZA 1ML6A 3IC4A 3TJJA 4IS0A 1UVZA 1PGTA 2B7KA 1XOBA 2VUPA 1K3YA 3L78A 1V40A 1M2BA 2L6CA 5DDLA 4KCEA 3I69A 4YQVA 5AGYA 2H19A 4K0GA 3A5WA 5DCHA 1SL0B 2DBCA 2VLTA 4TR1A 5DVBA 4MJBA 5CP1A 2PBJA 1MTCA 3E9JB 4ISDA 1ZYEA 4EDYA 3ZL5A 4IGJA 5ECQB 4ZB8A 4DSQA 4OWYA 2NTOA 5IMZA 3HA9A 1ZOFA 2H0HA 4AJ6A 3APOA 3VPTA 3ERFA 3LORA 1SD8A 4MF6A 2CZ2A 2LJAA 2H73A 3H93A 3L0HA 3CRUA 1TTZA 4MH3A 1HNCA 4F0BA 4KSOA 2GSRA 4HU9A 2VM2A 1PMTA 2N5FA 1MD4A 5C04A 4RQRA 1DE1A 4GQFA 1HQOA 4KW6A 3APQA 2YJHA 3ZMKA 2X64A 2VCWA 5JWRB 5E4WA 2C8UA 2CT6A 2LSTA 5INYA 1SK1A 2C1YA 2V32A 2DJKA 4DVCA 2HSHA 3KTLA 3BD2A 2LRCA 1SENA 5EPFA 3NIVA 3FW2A 1GUKA 3TJBA 2HSYA 1S3DA 3IDVA 1YY7A 5L71A 2I9HA 2M72A 2KLXA 1YF1A 4Q5RA 1AQVA 3FZ5A 4P3YB 3VWXA 5ECIB 3UL3A 1BX9A 5DALB 1Q98A 3KH9A 2GSTA 2HZFA 2RLIA 2XBIA 2HT9A 3E3EA 2REMA 1SJIA 3M9KA 2VL3A 4KDXA 4MJAA 1F3AA 3FR3A 2VCVA 2X99A 1GTAA 2B5EA 2I4AA 4PUAA 3A2WA 3U5RE 2E2MA 2JZRA 1XWKA 3GMFA 1Q4JA 4GQCA 2I1UA 4PQHA 3GSSA 4I5QA 4JZQA 2YWMA 5CRGA 2LNSA 5G1LA 2C4JA 4ZXGA 3J7Yb 5IMVA 4V2NA 3F4RA 1AC1A 2J23A 3ZYWA 2XPDA 3O76A 3KTBA 3UOMA 3GA4A 3ED3A 1K0OA 5DQYA 4TR4A 1OKTA 5CREA 3FRCA 2H1BA 2WJUA 2KP1A 3P8WA 4LL1B 2R3XA 2H0IA 1XVQA 4AJ7A 2PU9C 4K6XA 3GL5A 4POMA 1WPIA 2RIIA 4HZ4A 1NW2A 2IMEA 4OCEA 1KEBA 4MABA 1OC3A 4O92A 4ZBBA 4F82A 1RW1A 4ACSA 3IHQA 5D73A 1VF3A 1TP9A 1V57A 3ERWA 1T4ZA 1GLPA 2DMMA 2FWHA 3UVHA 2FUG2 2VCZA 1PD21 4MF5A 1QMVA 2AAWA 2B5YA 4MDCA 4EO3A 1TU8A 1EWXA 3IAS2 3Q74A 4KUNA 1E6BA 4XIHA 5EVOA 4V2LA 3D21A 5A4UA 2ES7A 1I9DA 3M3MA 1HYUA 2CVKA 5DBQA 2H01A 1EGOA 4YH2A 3D22A 3ZITA 1TK0B 5IOWA 2VCQA 1AIUA 1V9WA 3NOFA 4PURA 4RUVA 3MWHA 1OKDA 2AUVA 3GH9A 2YNXA 2K9FA 2IFQA 1SL1B 2D2ZA 5AIXA 3DKSA 1U88A 1NHOA 2VLVA 2R5GA 5DJLA 3TJKA 2CAIA 2GSSA 3L9VA 1ERUA 2FWGA 1JLVA 3SBCA 3KMOA 4FO5A 4DSSB 2HRFA 22GSA 1OYJA 2F9SA 1SKWB 2O89A 3GN3A 6GSYA 4ML6A 3WGEA 4FH8A 1M9AA 2LNTA 1A8LA 1CQGA 2HFDA 3P2AA 4ECIA 4GSSA 2HXKA 4RI6A 1R5AA 4V2MA 5HR1A 3BCIA 4QQ7A 2BJXA 3CSIA 1JZRA 1FG4A 1U6TA 3QAWA 3GKXA 2WZ9A 1YJ6A 2H74A 3DVWA 3TCOA 2JZTA 4K7IA 3U6VA 1QGVA 2VIMA 3TKRA 5ECNB 2VCTA 4G9HA 2K8SA 2B1KA 1JZOA 1F37A 5LD0A 5IMAA 2H70A 2X8CA 4X0XA 2AYTA 2EIQA 1WMJA 1K3OA 1FAAA 1TRVA 2GZYA 4QL9A 1GH2A 3FEUA 3F63A 1F3BA 2VM1A 1K0CA 3GTUB 3IOSA 3WT2A 4RQXA 1N2AA 2IJYA 1B8XA 4O32A 5AN1A 2I81A 2KUCA 4L0UA 2A2RA 2C0EA 4BA7A 3IBHA 1TRUA 5AIVA 2HI7A 1GP1A 2VAFA 5JCUA 1JFUA 4Q5NA 1WWJA 3G7JA 3DYRA 1FHEA 2WULA 3WGDA 3VI7A 5IO0A 2RM5A 3HVXA 1ZYQB 2QSIA 3RPPA 2WCIA 2DJ3A 4TW5A 5F06A 2YWIA 2L5OA 4GRFA 3R2QA 3QR6A 5D9VA 3L4NA 4OFNA 5FWGA 3W8JA 3LYPA 3US3A 2G0FA 2MMOA 2L6DA 5GZZB 1TK8B 2H1GA 2JSZA 2RUEA 4PQIA 4MPFA 1BJXA 3CMIA 3ZFBA 3ZVJD 4ECCA 4J56E 1GL8A 4TKYA 3RPNA 3TRPA 2TRCP 3H79A 2LRTA 4LL4B 3TRQA 1TRSA 2VCXA 4YQMA 2GQLA 1BQ7A 3H1NA 2DMLA 1X0RA 3A2VA 4BL7A 1EEJA 2OKAA 4N10A 1FB0A 3QMXA 2PERA 1PQNA 2FWEA 2OACA 3W8SA 3IA1A 1Z6MA 1YDKA 4NV5A 1O85A 4TR1B 5ECPB 1ILOA 4L0WA 4L8EA 4CW9A 2YOIA 2LV3A 4XRDA 1SJZA 3GX0A 4E8EA 3D5JA 2YANA 2O87A 2B1LA 5H5RA 1X9MB 5ELAA 5KN2A 3EU3A 1ACVA 5CRHA 3QFBC 6GSUA 3GKNA 1K0MA 5CYYA 3MDKA 2FY6A 1BG5A 4IVFA 1GSSA 3HCZA 2FHEA 3S9FA 4AGSA 2KP2A 3M0FA 4GF0A 4KGIA 3TKQA 3N9JA 4KE3A 3PH9A 3OR5A 2V1MA 1BEDA 1QUWA 1GSUA 2DJ0A 3FZ9A 1R7HA 2R2JA 4FYBA 2FA8A 5ECRB 3PR8A 1VF2A 2R37A 2N5BA 1SK2A 1BAYA 1Y25A 4NWYA 1TJDA 3TGZA 3P90A 1PRXA 5D96A 3JCML 1EOGA 4K1FA 1N8JA 5B6NA 4KDUA 4IQAA 4WEYA 4IKHA 4EF0A 4POBA 3BBYA 4PQ1A 1XW6A 1RQMA 4MP4A 2DC5A 4XS6A 5HR0A 4KH7A 1ZZYA 4KX4A 3EE2A 3QCPA 4TN8A 2FA4A 1LJRA 2L57A 1R5PA 2WB9A 2XPEA 3ZMLA 3KXOA 5GAPD 3PINA 1OAZA 1TXXA 4YAVA 2YPMA 1ON4A 2L5LA 3UAPA 5ECLB 1XPVA 4K8MA 10GSA 5ID2A 2FCHA 3H8QA 1O73A 2OADA 4N11A 5CO3A 2YZHA 2V6OA 1THOA 2Z9SA 3HZ4A 1IYIA 5J5NA 2YZUA 4I2UA 2F3MA 4AF2A 2CVDA 1B4QA 1XIYA 2FGXA 3FZAA 1S3AA 5ECKB 1G6WA 3KM6A 3GKKA 4K0NA 2JU5A 1XXUA 2DIZA 2DLXA 4X1UA 1USBA 3D0ZA 1F6MC 4D73A 5C00A 4TR3A 4H86A 1K0DA 3GX8A 5KN0A 3AY8A 3FYGA 3C71A 1T8EB 3QAVA 5KN1A 2HZEA 3ZVJA 4NMUA 2LKUA 3F8UA 5FHIA 4AJ8A 4ZBDA 5JCWA 3GSTA 5F07A 1AW9A 4TXOA 2PMTA 3EMXA 4ZIJA 4PXOA 3TJGA 3RHBA 2EIRA 2E2GA 1UA5A 2B3SA 1LU4A 3C8EA 4FYUA 3EYTA 1GWCA 2H72A 5ELGA 3UBKA 1WJKA 5DJMA 3WGXA 4KNDA 1FVJA 1PA3A 3VWWA 1JZDA 3ERGA 4Q5QA 4MPGA 2CVBA 3IK7A 1MDIA 5A4WA 3HY2A 3I9V2 3Q19A 3C73A 1FOVA 1T1VA 4V1Ag 3KGKA 5B6MA 4HI7A 1QXHA 4ZB9A 1LBKA 1O7UA 1Z6NA 1G6YA 5LNKe 3HVSA 1T7PB 3MSZA 3LSZA 3GH6A 1EP8A 3A3TA 3TDGA 1EGRA 2VL2A 2LJKA 5J9CA 3WT1A 3VLNA 3DMLA 2PN8A 4IN0A 2HE3A 2A2SA 4ZB6A 2HNLA 5ENUA 2R6KA 4JE1A 3I6AA 2HYXA 3D4TA 4EC0A 2IMIA 3P7XA 4N0VA 1GSYA 1XFLA 5D9TA 2VO4A 2CX4A 2K18A 2WGRA 1T00A 3IV4A 4NV2A 4BWQA 3GUSA 3LFLA 2DJ2A 2P5RA 1B9YC 1EEMA 4KCAA 1Z9HA 2ON5A 3BCKA 3K8NA 1JZWA 2JL4A 5J3RA 2H30A 2VD1A 5ABRA 3DD3A 4F03A 3UVTA 1A23A 2FNOA 1FW1A 2GS3A 2YWNA 1NM3A 5J41A 1YEXA 4WR4A 5LCZA 5IO2A 5IMCA 3RAZA 2O8VB 1URMA 3H4KA 1YKCA 4HJ2A 3CRTA 3L9SA 2HRNA 1XZOA 2QC7A 3GYKA 1KBNA 4TOPA 5J9BA 2RUFA 3GRXA 4HQSA 4GCIA 2N5AA 2CAQA 1ZGNA 12GSA 1XWBA 4BVYA 2CX3A 1GSDA 3M8NA 2AV4A 4ID0A 2ZCTA 4LMWA 4XHMA 3EVIA 2R4VA 2X8GA 1U87A 3GFKA 6GSXA 1ZCPA 2L4QA 3V1WA 1RK4A 2B7JA 2C0FA 3M9JA 2IMFA 4I8BA 1K3LA 5IMFA 3C1RA 6GSWA 2GZPA 1SKRB 2GLRA 5DAKB 3GNJA 1GSQA 2JZSA 2L4CA 1XWCA 1YZXA 3WD6A 2PPTA 1O6JA 2V2GA 1EV9A 3KD0A 3G9BA 4ZL9A 4YAPA 5EL8A 4K2DA 3DGQA 19GSA 4ZL8A 4DSRA 2PVQA 4XS4A 1PL1A 3VWUA 1M99A 5HFIA 4IW9A 1QQ2A 4EUYA 3HJOA 4BWSA 3FZ4A 3TOTA 4WKWA 4MF7A 3HDCA 13GSA 2ALBA 2DSAA 2FWFA 1X5CA 3TKSE 2WS2A 4KB3A 4OCFA 1OC9B 1B9XC 5A4VA 4I6XA 4GWRA 1Z7RA 3F6DA 3NZNA 3UIWA 2O7KA 4XTSA 4EXJA 1XVWA 3IXRA 4XCSA 3HYPA 2VD0A 4HDEA 1GLQA 4KDYA 4JBBA 4EDZA 5IM9A 4IJ3A 4F0CA 1XWAA 5JWOB 2IL3A 3RBTA 1U3AA 2BMXA 2MMAA 1S3CA 3APSA 4LLRA 4MLYA 2C0GA 3DWVA 1YF0A 18GSA 4E8HA 1G7EA 1H75A 1WOUA 3UBLA 4TRXA 5B7CA 1QFNA 4NHZA 1DBYA 4JR4A 1PSQA 2LS5A 5B8AA 1K0BA 2GSQA 4MCUA 4GXZA 4KAEA 6GSTA 1GSFA 4EE0A 4HZ2A 3MAKA 2VL2C 1C72A 1G0TA 3EURA 3GHAA 4ZILA 2M46A 1GNEA 5HR3A 2E7PA 4ECJA 2FD3A 6GSVA 3FR6A 4HOJA 2M80A 4GTUA 4NPBA 3ZTLA 1ZMAA 1J9BA 4PUFC 1XOAA 3IPZA 4POKA 3LEFA 5IMDA 3BJ5A 4WXTA 1THXA 2MYGA 3GTUA 1NSWA 2TRXA 4DEJA 3I43A 2P5QA 3HVVA 1AQWA 4XS1A 4OD7A 1HD2A 2OE0A 4Q5FA 2C3TA 1GTUA 1TU7A 4I97A 5KEJA 4I2TA 2KOKA 5DCGA 3GURA 4IHUA 2JSYA 3SWLA 2YP6A 4JEDA 4WF5A 3EU4A 3HHVA 2CQ9A 2OJLA 3LJRA 1EZKA 1EP7A 5B8BA 1A8YA 3A2XA 2OBIA 2DJ1A 5ECMB 4WBJA 4IELA 5H5SA 2XBQA 4D73B 3HD5A 2P31A 3FHKA 1FB6A 3W6GA 4OMVA 1MDKA 4IP1A 2NBSA 1SKSB 2PUKC 2OE3A 2HZEB 2VOCA 4G10A 4LMVA 4ULXA 3LG6A 5HFKA 3E0UA 3LXTA 4TXOB 5G1KA 3TKSA 1IYHA 3IRAA 2CZ3A 4K9ZA 1GSEA 1W89A 3CSJA 1XW5A 1M7TA 5ECOB 3QOUA 1PX7A 1ABAA 2RM6A 4JU5A 2C3NA 3CTFA 2C0DA 1YQ1A 1T3BA 3FY7A 3LXZA 4EVMA 1OE8A 3EINA 2EIOA 1OE7A 2LJRA 5E59A 1GTIA 4MZBA 1SYRA 1H4OA 1A2JA 1J08A 1M2DA 2H75A 3HJPA 4HUAA 11GSA 2LQQA 4GLTA 3C7MA 3KMNA 4OO4A 3DEXA
chains in the Genus database with same CATH superfamily
1FOHA 3FK8A 3HZ8A 2JACA 3QPMA 1A0RP 5D8IA 3KP9A 1J0FA 3VPQA 3EC3A 1WE0A 5COHA 3A5IA 4WF4A 4HEA2 5F0GA 1EV4A 5F05A 2QA1A 1AQXA 3CSHA 4F9ZA 4V1Ap 1XG8A 1K0AA 4O5UA 3D4MA 3Q18A 4EKZA 4O5QA 5DQSA 5EY6A 5HFGA 1ERVA 3IC8A 4FIWA 4JRRA 1SU9A 4ECBA 2YV9A 1YKAA 3HJMA 3EWLA 1FO5A 2LRNA 4F2IA 2H1DA 2I3YA 2OBKA 3O3TA 2ZUPA 1DUGA 3F4SA 3WYWA 1O8XA 4IQ1A 4GSTA 4WBRD 2YV7A 1A2LA 1SL2B 4O7HA 1V58A 3TJFA 1ERWA 1FVKA 2LEGA 2VL9A 2H71A 3ZIJA 1X5DA 2GTUA 2XC2A 4K2XA 2WFCA 2TIRA 2EC4A 1HNBA 2DJJA 1KTEA 1ST9A 2AJQB 1Z5YE 1KNGA 5HR2A 2O85A 5CAXA 1SJ6A 3DXBA 3G7IA 5G2ZA 1Y6EA 3QD9A 2WRTA 2YCDA 2IPAA 4NHWA 4OFMA 3LYKA 4ZBAA 2IFQB 1X9WB 2MMNA 7GSSA 4IBPA 2NVLA 4MJCA 3F4TA 1SYXA 2GVPA 4HS1A 3CXGA 5AISA 1TK5B 4JR6A 1B4PA 4K7NA 3QAGA 4FYCA 3CTGA 1Z7PA 1U3IA 2MZCA 3KJYA 3ZFLA 5GSTA 3FMWA 4A5PA 5IPHA 3Q6OA 2NDOA 2P0GA 2C80A 3UEMA 4TVEA 1R4WA 1MD3A 5FT3A 2V6KA 1WP0A 4BVXA 5D9WA 1M0UA 3RDWA 2YN1A 5JCGA 5DALA 3L9UA 4PNGA 2CA8A 4WR5A 5JWQB 4N30A 2AHEA 4CHSA 1WRYA 4MZCA 2WDUA 2L59A 1CQHA 3GKMA 4LA1A 2H66A 5KN3A 3KP8A 3D6IA 4XS4B 1VGLA 1AUCA 2H6ZA 1A0FA 2JADA 4Z7XA 4PX1A 1QK8A 1VRSD 3IE3A 1X9SB 5G31A 4HJMA 8GSSA 3ZLPA 1OVNA 1JLWA 4IJIA 1UC7A 1XWGA 1NHYA 2AB6A 3TOUA 3FKFA 4TXVA 3ISOA 2VLUA 1A2MA 4HU7A 2GT5A 2X49A 2H6YA 2GQKA 4ILFA 2MMZA 2K8VA 1MEKA 3UJ1A 5IPGA 2LUSA 3TKSC 3MNGA 3J7Yk 2GQMA 5GSSA 4MZWA 2NPBA 1VF1A 1PX6A 16GSA 1GTBA 2PWJA 3M1GA 2H8LA 1X5EA 3VURA 2PGTA 1GRXA 2H76A 3IAM2 4KSMA 4XRAA 2CV4A 3ZZXA 4ML1A 2IIYA 3RHCA 5IIZA 1F2EA 4NAXA 5F8BA 3DVXA 3KCMA 3VFIA 1I5GA 3HKRA 3UARA 2K6VA 2X8HA 3QDNA 1YEPA 5KOWA 4KA0A 1TDIA 2H1AA 1M9BA 1TOFA 3UMAA 1ERTA 1MDJA 2PVOC 3GV1A 6GSSA 1AXDA 5IQYA 4K5SA 14GSA 4FQUA 5G5FA 2BTOT 4CDOA 1PN9A 4PNFA 5HQPA 3IK9A 3ME8A 1SD9A 3ZREA 1TW9A 4IP6A 1UN2A 4BL7B 1XBSA 5H5QA 4MH2A 4PGTA 1TRWA 2MBTA 4L5OA 3VI5A 3GL3A 4BPYA 1A24A 1TI1A 2F8FA 1M3IA 2LTKA 3CBUA 3GIXA 3TUEA 3DIEA 2OA7A 2J9HA 3C1SA 2F51A 1PKWA 4MJEA 4EL1A 1GUHA 4MK3A 4N0ZA 1VF4A 4G2EA 2DIYA 1O81A 3BOAA 4DSSA 1GNWA 1Z3EA 1DE2A 3CYNA 1GULA 2H6XA 3LWAA 3IR4A 4TR0A 2MBSA 3MYDA 3EMPA 4QL7A 2LQOA 3TB2A 1B48A 3KEBA 4K7OA 3G7YA 2OE1A 5CNWA 1V98A 1TKDB 1G7OA 1F9MA 4J2FA 5DAKA 3KZQA 1XCCA 5D9XA 1V2AA 1R26A 5IOXA 4J57E 2FLSA 4NXIA 20GSA 1K0NA 4X43A 4RI7A 1SK0A 4G19A 1OC8A 3ZRDA 2IWTA 4YQUA 3F3QA 3KH7A 2E0QA 3F3RA 5D93A 2A4VA 2ON7A 2GT6A 3VWVA 2ZNMA 2IMDA 3KIJA 2IN3A 1BYEA 3QFAC 1TI3A 3HXSA 3F9UA 3EPTA 2B5XA 4GSNA 1PL2A 5GAND 4HQZA 4WETA 2GDRA 3F6FA 4MA9A 2KHPA 2F8AA 5ECSA 2UZ8A 1OC9A 1M2AA 2XHFA 2G2QA 2IMKA 2YJ7A 3DRNA 3LGCA 2GGTA 2YWOA 1ZL9A 1GUMA 4MMMA 5J4UA 3N5OA 2B6MA 1JHBA 9GSSA 5G30A 1PKZA 2H0GA 2QKEA 3TKPA 4POLA 4L5LA 5CRDA 5ID2B 4OO5A 1EOHA 4ZL7A 5A5KA 3O6TA 1HNAA 3ME7A 3VK9A 4O5RA 1T4YA 3LQ7A 1DSBA 2GZZA 5ECHB 17GSA 2HLSA 1XW9A 1WIKA 5CRWA 2R0CA 4OFTA 3FR9A 1E2YA 4USSA 1O8WA 3F0IA 5G5EA 2C3QA 2QGVA 1W4VA 3PGTA 3ZIVA 2V41A 3TRXA 1AAZA 1ML6A 3IC4A 3TJJA 4IS0A 1UVZA 1PGTA 2B7KA 1XOBA 2VUPA 1K3YA 3L78A 1V40A 1M2BA 2L6CA 5DDLA 4KCEA 3I69A 4YQVA 5AGYA 2H19A 4K0GA 3A5WA 5DCHA 1SL0B 2DBCA 2VLTA 4TR1A 5DVBA 4MJBA 5CP1A 2PBJA 1MTCA 3E9JB 4ISDA 1ZYEA 4EDYA 3ZL5A 4IGJA 5ECQB 4ZB8A 4DSQA 4OWYA 2NTOA 5IMZA 3HA9A 1ZOFA 2H0HA 4AJ6A 3APOA 3VPTA 3ERFA 3LORA 1SD8A 4MF6A 3MIXA 2CZ2A 2LJAA 2H73A 3H93A 3L0HA 3CRUA 1TTZA 4MH3A 1HNCA 4F0BA 2QA2A 4KSOA 2GSRA 4HU9A 2VM2A 1PMTA 2N5FA 1MD4A 5C04A 4RQRA 1DE1A 4GQFA 1HQOA 4KW6A 3APQA 4G0IA 2YJHA 3ZMKA 2X64A 2VCWA 5JWRB 5E4WA 2C8UA 2CT6A 2LSTA 5INYA 1SK1A 2C1YA 2V32A 2DJKA 4DVCA 2HSHA 3KTLA 3BD2A 2LRCA 1SENA 5EPFA 3NIVA 3FW2A 1GUKA 3TJBA 2HSYA 1S3DA 3IDVA 1YY7A 5L71A 2I9HA 2M72A 2KLXA 1YF1A 4Q5RA 1AQVA 3R3EA 3FZ5A 4P3YB 3VWXA 5ECIB 3UL3A 1BX9A 5DALB 1Q98A 3KH9A 2GSTA 2HZFA 2RLIA 2XBIA 2HT9A 3E3EA 2REMA 1SJIA 5BMUA 3M9KA 2VL3A 4KDXA 4MJAA 1F3AA 3FR3A 2VCVA 2X99A 1GTAA 2B5EA 2I4AA 4PUAA 3A2WA 3U5RE 2E2MA 2JZRA 1XWKA 3GMFA 1Q4JA 4GQCA 4YKGA 2I1UA 4PQHA 3GSSA 4I5QA 4JZQA 2YWMA 5CRGA 2LNSA 5G1LA 2C4JA 4ZXGA 3J7Yb 5IMVA 4V2NA 3F4RA 1AC1A 2J23A 3ZYWA 4CY8A 2XPDA 3O76A 3KTBA 4BVYB 3UOMA 3GA4A 3ED3A 1K0OA 5DQYA 4TR4A 1OKTA 5CREA 5KOXA 3FRCA 2H1BA 2WJUA 2KP1A 3P8WA 4LL1B 2R3XA 2H0IA 1XVQA 4AJ7A 2PU9C 4K6XA 3GL5A 4POMA 1WPIA 2RIIA 4HZ4A 1NW2A 2IMEA 4OCEA 1KEBA 4MABA 1OC3A 4O92A 4ZBBA 4F82A 1RW1A 4ACSA 3IHQA 5D73A 1VF3A 1TP9A 1V57A 3ERWA 1T4ZA 1GLPA 2DMMA 2FWHA 4EIPA 3UVHA 2FUG2 2VCZA 1PD21 4MF5A 1QMVA 2AAWA 2B5YA 4MDCA 4EO3A 1TU8A 1EWXA 3IAS2 3Q74A 4KUNA 1E6BA 4XIHA 5EVOA 4V2LA 3D21A 5A4UA 2ES7A 1I9DA 3M3MA 1HYUA 2CVKA 5DBQA 2H01A 1EGOA 4YH2A 3D22A 3ZITA 1TK0B 5IOWA 2VCQA 1AIUA 1V9WA 3NOFA 4PURA 4RUVA 3MWHA 1OKDA 2AUVA 3GH9A 2YNXA 2K9FA 1PN0A 2IFQA 1SL1B 2D2ZA 5AIXA 3DKSA 1U88A 1NHOA 2VLVA 2R5GA 5DJLA 3TJKA 2CAIA 2GSSA 3L9VA 1ERUA 2FWGA 1JLVA 3SBCA 3KMOA 4FO5A 4DSSB 2HRFA 22GSA 1OYJA 4G0LA 2F9SA 1SKWB 2O89A 3GN3A 6GSYA 4ML6A 3WGEA 4FH8A 1M9AA 2LNTA 1A8LA 1CQGA 2HFDA 3P2AA 4ECIA 4GSSA 2HXKA 4RI6A 1R5AA 4V2MA 5HR1A 3BCIA 3HVNA 4QQ7A 2BJXA 3CSIA 1JZRA 1FG4A 1U6TA 3QAWA 3GKXA 2WZ9A 1YJ6A 2H74A 3DVWA 3TCOA 2JZTA 4K7IA 3U6VA 1QGVA 2VIMA 3TKRA 5ECNB 2VCTA 4G9HA 2K8SA 2B1KA 1JZOA 1F37A 5LD0A 5IMAA 2H70A 2X8CA 4X0XA 2AYTA 2EIQA 1WMJA 1K3OA 1FAAA 1TRVA 2GZYA 4QL9A 1GH2A 3FEUA 3F63A 1F3BA 2VM1A 1K0CA 3GTUB 3IOSA 3WT2A 4RQXA 1N2AA 2IJYA 1B8XA 4O32A 5AN1A 2I81A 2KUCA 4L0UA 2A2RA 2C0EA 4BA7A 3IBHA 1TRUA 5AIVA 2HI7A 1GP1A 2VAFA 5JCUA 1JFUA 4Q5NA 1WWJA 3G7JA 3DYRA 1FHEA 2WULA 3WGDA 3VI7A 5IO0A 2RM5A 3HVXA 1ZYQB 2QSIA 3RPPA 2WCIA 2DJ3A 4TW5A 5F06A 2YWIA 2L5OA 4GRFA 3R2QA 3QR6A 5D9VA 3L4NA 4OFNA 4EIQA 5FWGA 4Z2TA 3W8JA 3LYPA 3US3A 2G0FA 2MMOA 2L6DA 5GZZB 1TK8B 2H1GA 2JSZA 2RUEA 2DKHA 4MPFA 4PQIA 1BJXA 3CMIA 3ZFBA 3ZVJD 4ECCA 4J56E 1GL8A 4TKYA 3RPNA 3TRPA 2TRCP 3H79A 2LRTA 4LL4B 3TRQA 1TRSA 2VCXA 4YQMA 2GQLA 1BQ7A 3H1NA 2DMLA 1X0RA 3A2VA 4BL7A 1EEJA 2OKAA 4N10A 1FB0A 3QMXA 2PERA 1PQNA 2FWEA 2OACA 3W8SA 3IA1A 1Z6MA 1YDKA 4NV5A 1O85A 4TR1B 5ECPB 1ILOA 4L0WA 4L8EA 4CW9A 2YOIA 2LV3A 4XRDA 1SJZA 3GX0A 4E8EA 3D5JA 2YANA 2O87A 2B1LA 5H5RA 1X9MB 5ELAA 5KN2A 3EU3A 4KF9A 1ACVA 2R0PA 5CRHA 3QFBC 6GSUA 3GKNA 1K0MA 5CYYA 3MDKA 2FY6A 1BG5A 4IVFA 1GSSA 3HCZA 2FHEA 3S9FA 4AGSA 2KP2A 3M0FA 4GF0A 4KGIA 3TKQA 3N9JA 4KE3A 3PH9A 3OR5A 2V1MA 1BEDA 1QUWA 1GSUA 2DJ0A 3FZ9A 1R7HA 2R2JA 4FYBA 2DKIA 2FA8A 5ECRB 3PR8A 1VF2A 2R37A 2N5BA 1SK2A 1BAYA 1Y25A 4NWYA 1TJDA 2A4HA 3TGZA 3P90A 1PRXA 5D96A 3JCML 1EOGA 4K1FA 1N8JA 5B6NA 4KDUA 4IQAA 4WEYA 4IKHA 4EF0A 4POBA 3BBYA 4PQ1A 1XW6A 1RQMA 4MP4A 2DC5A 4XS6A 5HR0A 4KH7A 1ZZYA 4KX4A 3EE2A 3QCPA 4TN8A 2FA4A 4YKFA 1LJRA 2L57A 1R5PA 2WB9A 2XPEA 3ZMLA 3KXOA 1ZYNA 5GAPD 3PINA 1OAZA 1TXXA 2HSMA 4YAVA 2YPMA 1ON4A 2L5LA 3UAPA 5ECLB 1XPVA 4K8MA 10GSA 5ID2A 2FCHA 3H8QA 1O73A 2OADA 4N11A 5CO3A 2YZHA 2V6OA 1THOA 2Z9SA 3HZ4A 1IYIA 5J5NA 2YZUA 4I2UA 2F3MA 4AF2A 2CVDA 5BRTA 1B4QA 1XIYA 2FGXA 3LW9A 3FZAA 1S3AA 5ECKB 1G6WA 3KM6A 3GKKA 4K0NA 2JU5A 1XXUA 2DIZA 2DLXA 4X1UA 1USBA 3D0ZA 1F6MC 4D73A 5C00A 4TR3A 4H86A 1K0DA 3GX8A 5KN0A 3AY8A 3FYGA 3C71A 1T8EB 3QAVA 5KN1A 2HZEA 3ZVJA 4BVXB 4NMUA 2LKUA 3F8UA 5FHIA 4AJ8A 4ZBDA 5JCWA 3GSTA 5F07A 1AW9A 4TXOA 2PMTA 3EMXA 4ZIJA 4PXOA 3TJGA 4MNNA 3RHBA 2HRKA 2EIRA 2E2GA 1UA5A 2B3SA 1LU4A 3C8EA 4FYUA 3EYTA 1GWCA 2H72A 5ELGA 3UBKA 1WJKA 5DJMA 3WGXA 4KNDA 1FVJA 1PA3A 2X4AA 2HRAA 3VWWA 1JZDA 3ERGA 4Q5QA 4MPGA 2CVBA 3IK7A 1MDIA 5A4WA 3HY2A 3I9V2 3Q19A 3C73A 1FOVA 1T1VA 4V1Ag 3KGKA 5B6MA 4HI7A 1QXHA 4HSCX 4ZB9A 1LBKA 1O7UA 1Z6NA 1G6YA 5LNKe 3HVSA 1T7PB 3MSZA 3LSZA 3GH6A 1EP8A 3A3TA 3TDGA 1EGRA 2VL2A 2LJKA 4PTSA 5J9CA 3WT1A 3VLNA 3DMLA 2PN8A 4IN0A 2HE3A 2A2SA 4ZB6A 2HNLA 5ENUA 2R6KA 4JE1A 3I6AA 2HYXA 3D4TA 4EC0A 2IMIA 3P7XA 4N0VA 1GSYA 1XFLA 5D9TA 2VO4A 2CX4A 2K18A 2WGRA 1T00A 3IV4A 4NV2A 4BWQA 3GUSA 3LFLA 2DJ2A 2P5RA 1B9YC 1EEMA 4KCAA 1Z9HA 2ON5A 3BCKA 3K8NA 1JZWA 2JL4A 5J3RA 2H30A 1ZYPA 2VD1A 5ABRA 3DD3A 4F03A 3UVTA 1A23A 2FNOA 1FW1A 2GS3A 2YWNA 1NM3A 5J41A 1YEXA 4WR4A 5LCZA 4X4JA 5IO2A 5IMCA 3RAZA 2O8VB 1URMA 3H4KA 4CY6A 1YKCA 1M3JA 4HJ2A 3CRTA 3L9SA 2HRNA 1XZOA 2QC7A 3GYKA 1KBNA 4TOPA 5J9BA 2RUFA 3GRXA 4HQSA 4GCIA 2N5AA 1S3RA 2CAQA 1ZGNA 12GSA 1XWBA 4BVYA 2CX3A 1GSDA 3M8NA 2AV4A 4ID0A 2ZCTA 4LMWA 4XHMA 3EVIA 2R4VA 2X8GA 1U87A 3GFKA 6GSXA 1ZCPA 2L4QA 3V1WA 1RK4A 2B7JA 2C0FA 3M9JA 4ICYA 2IMFA 4I8BA 1K3LA 5IMFA 3C1RA 6GSWA 2GZPA 1SKRB 2GLRA 5DAKB 3GNJA 1GSQA 2JZSA 2L4CA 1XWCA 1YZXA 3WD6A 2PPTA 1O6JA 2V2GA 1EV9A 3KD0A 3G9BA 4ZL9A 4YAPA 5EL8A 4K2DA 3DGQA 19GSA 4ZL8A 4DSRA 2PVQA 4XS4A 1PL1A 3VWUA 1M99A 5HFIA 4IW9A 1QQ2A 4EUYA 3HJOA 4BWSA 3FZ4A 3TOTA 4WKWA 4MF7A 3HDCA 13GSA 2ALBA 2DSAA 2FWFA 1X5CA 3TKSE 2WS2A 4KB3A 4OCFA 1OC9B 1B9XC 5A4VA 4I6XA 4GWRA 1Z7RA 3F6DA 3NZNA 3UIWA 2O7KA 4XTSA 4EXJA 1XVWA 3IXRA 4XCSA 3HYPA 2VD0A 4HDEA 1GLQA 4KDYA 4JBBA 4EDZA 5IM9A 4IJ3A 4F0CA 1XWAA 5JWOB 2IL3A 3CQFA 3RBTA 1U3AA 2BMXA 2MMAA 1S3CA 4Z2RA 3APSA 4LLRA 4MLYA 2C0GA 3DWVA 1YF0A 18GSA 4E8HA 1G7EA 1H75A 1WOUA 3UBLA 4TRXA 5B7CA 1QFNA 4NHZA 1DBYA 4JR4A 3IHGA 1PSQA 2LS5A 5B8AA 1K0BA 2GSQA 4MCUA 4GXZA 4KAEA 6GSTA 1GSFA 4EE0A 4HZ2A 3MAKA 2VL2C 1C72A 1G0TA 3EURA 3GHAA 4ZILA 2M46A 1GNEA 5HR3A 2E7PA 4ECJA 2FD3A 6GSVA 3FR6A 4HOJA 2M80A 4GTUA 4NPBA 3ZTLA 1ZMAA 1J9BA 4PUFC 1XOAA 3IPZA 4POKA 3LEFA 5IMDA 3BJ5A 4WXTA 1THXA 2MYGA 3GTUA 1NSWA 2TRXA 4DEJA 3I43A 2P5QA 3HVVA 1AQWA 4XS1A 4OD7A 1HD2A 2OE0A 4Q5FA 2C3TA 1GTUA 1TU7A 4I97A 5KEJA 4I2TA 2KOKA 5DCGA 3GURA 4IHUA 3PPUA 2JSYA 3SWLA 2YP6A 4JEDA 4WF5A 3EU4A 3HHVA 2CQ9A 2OJLA 3LJRA 1EZKA 1EP7A 5B8BA 1A8YA 3A2XA 2OBIA 2DJ1A 5ECMB 4WBJA 4IELA 5H5SA 2XBQA 4D73B 3HD5A 2P31A 3FHKA 1FB6A 3W6GA 4G0KA 4OMVA 4Z2UA 1MDKA 4IP1A 2NBSA 1SKSB 2PUKC 2OE3A 2HZEB 2VOCA 4G10A 4LMVA 4ULXA 3LG6A 5HFKA 3E0UA 3LXTA 2R0GA 4TXOB 5G1KA 4K5RA 3TKSA 1IYHA 3IRAA 2CZ3A 4K9ZA 1GSEA 1W89A 3CSJA 1XW5A 1M7TA 5ECOB 3QOUA 1PX7A 1ABAA 2RM6A 4JU5A 2C3NA 3CTFA 2C0DA 1YQ1A 1T3BA 3FY7A 3LXZA 2A2PA 4EVMA 1OE8A 3EINA 2EIOA 1OE7A 2LJRA 5E59A 1GTIA 4MZBA 1SYRA 1H4OA 1A2JA 1J08A 1M2DA 2H75A 3HJPA 4HUAA 11GSA 2LQQA 4GLTA 3C7MA 1PFOA 4BIKA 3KMNA 4OO4A 3DEXA
chains in the Genus database with same CATH topology
1FOHA 3FK8A 3HZ8A 2JACA 3QPMA 1A0RP 5D8IA 3KP9A 1J0FA 3VPQA 3EC3A 1WE0A 5COHA 3A5IA 4WF4A 4HEA2 5F0GA 1EV4A 5F05A 2QA1A 1AQXA 3CSHA 4F9ZA 4V1Ap 1K0AA 4O5UA 3D4MA 3Q18A 4EKZA 4O5QA 5DQSA 5EY6A 5HFGA 1ERVA 3IC8A 4FIWA 4JRRA 1SU9A 4ECBA 2YV9A 1YKAA 3HJMA 3EWLA 1FO5A 2LRNA 4F2IA 2H1DA 2I3YA 2OBKA 3O3TA 2ZUPA 1DUGA 3F4SA 3WYWA 1O8XA 4IQ1A 4GSTA 4WBRD 2YV7A 1A2LA 1SL2B 4O7HA 1V58A 3TJFA 1ERWA 1FVKA 2LEGA 2VL9A 2H71A 3ZIJA 1X5DA 2GTUA 2XC2A 4K2XA 2WFCA 2TIRA 2EC4A 1HNBA 2DJJA 1KTEA 1ST9A 2AJQB 1Z5YE 1KNGA 5HR2A 2O85A 5CAXA 1SJ6A 3DXBA 3G7IA 5G2ZA 1Y6EA 3QD9A 2WRTA 2YCDA 2IPAA 4NHWA 4OFMA 3LYKA 4ZBAA 2IFQB 1X9WB 2MMNA 7GSSA 4IBPA 2NVLA 4MJCA 3F4TA 1SYXA 2GVPA 4HS1A 3CXGA 5AISA 1TK5B 4JR6A 1B4PA 4K7NA 3QAGA 4FYCA 3CTGA 1Z7PA 1U3IA 2MZCA 3KJYA 3ZFLA 5GSTA 3FMWA 4A5PA 5IPHA 3Q6OA 2NDOA 2P0GA 2C80A 3UEMA 4TVEA 1R4WA 1MD3A 5FT3A 2V6KA 1WP0A 4BVXA 5D9WA 1M0UA 3RDWA 2YN1A 5JCGA 5DALA 3L9UA 4PNGA 2CA8A 4WR5A 5JWQB 4N30A 2AHEA 4CHSA 1WRYA 4MZCA 2WDUA 2L59A 1CQHA 3GKMA 4LA1A 2H66A 5KN3A 3KP8A 3D6IA 4XS4B 1VGLA 1AUCA 2H6ZA 1A0FA 2JADA 4Z7XA 4PX1A 1QK8A 1VRSD 3IE3A 1X9SB 5G31A 4HJMA 8GSSA 3ZLPA 1OVNA 1JLWA 4IJIA 1UC7A 1XWGA 1NHYA 2AB6A 3TOUA 3FKFA 4TXVA 3ISOA 2VLUA 1A2MA 4HU7A 2GT5A 2X49A 2H6YA 2GQKA 4ILFA 2MMZA 2K8VA 1MEKA 3UJ1A 5IPGA 2LUSA 3TKSC 3MNGA 3J7Yk 2GQMA 5GSSA 4MZWA 2NPBA 1VF1A 1PX6A 16GSA 1GTBA 2PWJA 3M1GA 2H8LA 1X5EA 3VURA 2PGTA 1GRXA 2H76A 3IAM2 4KSMA 4XRAA 2CV4A 3ZZXA 4ML1A 2IIYA 3RHCA 5IIZA 1F2EA 4NAXA 5F8BA 3DVXA 3KCMA 3VFIA 1I5GA 3HKRA 3UARA 2K6VA 2X8HA 3QDNA 1YEPA 5KOWA 4KA0A 1TDIA 2H1AA 1M9BA 1TOFA 3UMAA 1ERTA 1MDJA 2PVOC 3GV1A 6GSSA 1AXDA 5IQYA 4K5SA 14GSA 4FQUA 5G5FA 2BTOT 4CDOA 1PN9A 4PNFA 5HQPA 3IK9A 3ME8A 1SD9A 3ZREA 1TW9A 4IP6A 1UN2A 4BL7B 1XBSA 5H5QA 4MH2A 4PGTA 1TRWA 2MBTA 4L5OA 3VI5A 3GL3A 4BPYA 1A24A 1TI1A 2F8FA 2LTKA 3CBUA 3GIXA 3TUEA 3DIEA 2OA7A 2J9HA 3C1SA 2F51A 1PKWA 4MJEA 4EL1A 1GUHA 4MK3A 4N0ZA 1VF4A 4G2EA 2DIYA 1O81A 3BOAA 4DSSA 1GNWA 1Z3EA 1DE2A 3CYNA 1GULA 2H6XA 3LWAA 3IR4A 4TR0A 2MBSA 3MYDA 3EMPA 4QL7A 2LQOA 3TB2A 1B48A 3KEBA 4K7OA 3G7YA 2OE1A 5CNWA 1V98A 1TKDB 1G7OA 1F9MA 4J2FA 5DAKA 3KZQA 1XCCA 5D9XA 1V2AA 1R26A 5IOXA 4J57E 2FLSA 4NXIA 20GSA 1K0NA 4X43A 4RI7A 1SK0A 4G19A 1OC8A 3ZRDA 2IWTA 4YQUA 3F3QA 3KH7A 2E0QA 3F3RA 5D93A 2A4VA 2ON7A 2GT6A 3VWVA 2ZNMA 2IMDA 3KIJA 2IN3A 1BYEA 3QFAC 1TI3A 3HXSA 3F9UA 3EPTA 2B5XA 4GSNA 1PL2A 5GAND 4HQZA 4WETA 2GDRA 3F6FA 4MA9A 2KHPA 2F8AA 5ECSA 2UZ8A 1OC9A 1M2AA 2XHFA 2G2QA 2IMKA 2YJ7A 3DRNA 3LGCA 2GGTA 2YWOA 1ZL9A 1GUMA 4MMMA 5J4UA 3N5OA 2B6MA 1JHBA 9GSSA 5G30A 1PKZA 2H0GA 2QKEA 3TKPA 4POLA 4L5LA 5CRDA 5ID2B 4OO5A 1EOHA 4ZL7A 5A5KA 3O6TA 1HNAA 3ME7A 3VK9A 4O5RA 1T4YA 3LQ7A 1DSBA 2GZZA 5ECHB 17GSA 2HLSA 1XW9A 1WIKA 5CRWA 2R0CA 4OFTA 3FR9A 1E2YA 4USSA 1O8WA 3F0IA 5G5EA 2C3QA 2QGVA 1W4VA 3PGTA 3ZIVA 2V41A 3TRXA 1AAZA 1ML6A 3IC4A 3TJJA 4IS0A 1UVZA 1PGTA 2B7KA 1XOBA 2VUPA 1K3YA 3L78A 1V40A 1M2BA 2L6CA 5DDLA 4KCEA 3I69A 4YQVA 5AGYA 2H19A 4K0GA 3A5WA 5DCHA 1SL0B 2DBCA 2VLTA 4TR1A 5DVBA 4MJBA 5CP1A 2PBJA 1MTCA 3E9JB 4ISDA 1ZYEA 4EDYA 3ZL5A 4IGJA 5ECQB 4ZB8A 4DSQA 4OWYA 2NTOA 5IMZA 3HA9A 1ZOFA 2H0HA 4AJ6A 3APOA 3VPTA 3ERFA 3LORA 1SD8A 4MF6A 3MIXA 2CZ2A 2LJAA 2H73A 3H93A 3L0HA 3CRUA 1TTZA 4MH3A 1HNCA 4F0BA 2QA2A 4KSOA 2GSRA 4HU9A 2VM2A 1PMTA 2N5FA 1MD4A 5C04A 4RQRA 1DE1A 4GQFA 1HQOA 4KW6A 3APQA 4G0IA 2YJHA 3ZMKA 2X64A 2VCWA 5JWRB 5E4WA 2C8UA 2CT6A 2LSTA 5INYA 1SK1A 2C1YA 2V32A 2DJKA 4DVCA 2HSHA 3KTLA 3BD2A 2LRCA 1SENA 5EPFA 3NIVA 3FW2A 1GUKA 3TJBA 2HSYA 1S3DA 3IDVA 1YY7A 5L71A 2I9HA 2M72A 2KLXA 1YF1A 4Q5RA 1AQVA 3R3EA 3FZ5A 4P3YB 3VWXA 5ECIB 3UL3A 1BX9A 5DALB 1Q98A 3KH9A 2GSTA 2HZFA 2RLIA 2XBIA 2HT9A 3E3EA 2REMA 1SJIA 5BMUA 3M9KA 2VL3A 4KDXA 4MJAA 1F3AA 3FR3A 2VCVA 2X99A 1GTAA 2B5EA 2I4AA 4PUAA 3A2WA 3U5RE 2E2MA 2JZRA 1XWKA 3GMFA 1Q4JA 4GQCA 4YKGA 2I1UA 4PQHA 3GSSA 4I5QA 4JZQA 2YWMA 5CRGA 2LNSA 5G1LA 2C4JA 4ZXGA 3J7Yb 5IMVA 4V2NA 3F4RA 1AC1A 2J23A 3ZYWA 4CY8A 2XPDA 3O76A 3KTBA 4BVYB 3UOMA 3GA4A 3ED3A 1K0OA 5DQYA 4TR4A 1OKTA 5CREA 5KOXA 3FRCA 2H1BA 2WJUA 2KP1A 3P8WA 4LL1B 2R3XA 2H0IA 1XVQA 4AJ7A 2PU9C 4K6XA 3GL5A 4POMA 1WPIA 2RIIA 4HZ4A 1NW2A 2IMEA 4OCEA 1KEBA 4MABA 1OC3A 4O92A 4ZBBA 4F82A 1RW1A 4ACSA 3IHQA 5D73A 1VF3A 1TP9A 1V57A 3ERWA 1T4ZA 1GLPA 2DMMA 2FWHA 4EIPA 3UVHA 2FUG2 2VCZA 1PD21 4MF5A 1QMVA 2AAWA 2B5YA 4MDCA 4EO3A 1TU8A 1EWXA 3IAS2 3Q74A 4KUNA 1E6BA 4XIHA 5EVOA 4V2LA 3D21A 5A4UA 2ES7A 1I9DA 3M3MA 1HYUA 2CVKA 5DBQA 2H01A 1EGOA 4YH2A 3D22A 3ZITA 1TK0B 5IOWA 2VCQA 1AIUA 1V9WA 3NOFA 4PURA 4RUVA 3MWHA 1OKDA 2AUVA 3GH9A 2YNXA 2K9FA 1PN0A 2IFQA 1SL1B 2D2ZA 5AIXA 3DKSA 1U88A 1NHOA 2VLVA 2R5GA 5DJLA 3TJKA 2CAIA 2GSSA 3L9VA 1ERUA 2FWGA 1JLVA 3SBCA 3KMOA 4FO5A 4DSSB 2HRFA 22GSA 1OYJA 4G0LA 2F9SA 1SKWB 2O89A 3GN3A 6GSYA 4ML6A 3WGEA 4FH8A 1M9AA 2LNTA 1A8LA 1CQGA 2HFDA 3P2AA 4ECIA 4GSSA 2HXKA 4RI6A 1R5AA 4V2MA 5HR1A 3BCIA 4QQ7A 2BJXA 3CSIA 1JZRA 1FG4A 1U6TA 3QAWA 3GKXA 2WZ9A 1YJ6A 2H74A 3DVWA 3TCOA 2JZTA 4K7IA 3U6VA 1QGVA 2VIMA 3TKRA 5ECNB 2VCTA 4G9HA 2K8SA 2B1KA 1JZOA 1F37A 5LD0A 5IMAA 2H70A 2X8CA 4X0XA 2AYTA 2EIQA 1WMJA 1K3OA 1FAAA 1TRVA 2GZYA 4QL9A 1GH2A 3FEUA 3F63A 1F3BA 2VM1A 1K0CA 3GTUB 3IOSA 3WT2A 4RQXA 1N2AA 2IJYA 1B8XA 4O32A 5AN1A 2I81A 2KUCA 4L0UA 2A2RA 2C0EA 4BA7A 3IBHA 1TRUA 5AIVA 2HI7A 1GP1A 2VAFA 5JCUA 1JFUA 4Q5NA 1WWJA 3G7JA 3DYRA 1FHEA 2WULA 3WGDA 3VI7A 5IO0A 2RM5A 3HVXA 1ZYQB 2QSIA 3RPPA 2WCIA 2DJ3A 4TW5A 5F06A 2YWIA 2L5OA 4GRFA 3R2QA 3QR6A 5D9VA 3L4NA 4OFNA 4EIQA 5FWGA 4Z2TA 3W8JA 3LYPA 3US3A 2G0FA 2MMOA 2L6DA 5GZZB 1TK8B 2H1GA 2JSZA 2RUEA 2DKHA 4MPFA 4PQIA 1BJXA 3CMIA 3ZFBA 3ZVJD 4ECCA 4J56E 1GL8A 4TKYA 3RPNA 3TRPA 2TRCP 3H79A 2LRTA 4LL4B 3TRQA 1TRSA 2VCXA 4YQMA 2GQLA 1BQ7A 3H1NA 2DMLA 1X0RA 3A2VA 4BL7A 1EEJA 2OKAA 4N10A 1FB0A 3QMXA 2PERA 1PQNA 2FWEA 2OACA 3W8SA 3IA1A 1Z6MA 1YDKA 4NV5A 1O85A 4TR1B 5ECPB 1ILOA 4L0WA 4L8EA 4CW9A 2YOIA 2LV3A 4XRDA 1SJZA 3GX0A 4E8EA 3D5JA 2YANA 2O87A 2B1LA 5H5RA 1X9MB 5ELAA 5KN2A 3EU3A 4KF9A 1ACVA 2R0PA 5CRHA 3QFBC 6GSUA 3GKNA 1K0MA 5CYYA 3MDKA 2FY6A 1BG5A 4IVFA 1GSSA 3HCZA 2FHEA 3S9FA 4AGSA 2KP2A 3M0FA 4GF0A 4KGIA 3TKQA 3N9JA 4KE3A 3PH9A 3OR5A 2V1MA 1BEDA 1QUWA 1GSUA 2DJ0A 3FZ9A 1R7HA 2R2JA 4FYBA 2DKIA 2FA8A 5ECRB 3PR8A 1VF2A 2R37A 2N5BA 1SK2A 1BAYA 1Y25A 4NWYA 1TJDA 2A4HA 3TGZA 3P90A 1PRXA 5D96A 3JCML 1EOGA 4K1FA 1N8JA 5B6NA 4KDUA 4IQAA 4WEYA 4IKHA 4EF0A 4POBA 3BBYA 4PQ1A 1XW6A 1RQMA 4MP4A 2DC5A 4XS6A 5HR0A 4KH7A 1ZZYA 4KX4A 3EE2A 3QCPA 4TN8A 2FA4A 4YKFA 1LJRA 2L57A 1R5PA 2WB9A 2XPEA 3ZMLA 3KXOA 1ZYNA 5GAPD 3PINA 1OAZA 1TXXA 2HSMA 4YAVA 2YPMA 1ON4A 2L5LA 3UAPA 5ECLB 1XPVA 4K8MA 10GSA 5ID2A 2FCHA 3H8QA 1O73A 2OADA 4N11A 5CO3A 2YZHA 2V6OA 1THOA 2Z9SA 3HZ4A 1IYIA 5J5NA 2YZUA 4I2UA 2F3MA 4AF2A 2CVDA 5BRTA 1B4QA 1XIYA 2FGXA 3LW9A 3FZAA 1S3AA 5ECKB 1G6WA 3KM6A 3GKKA 4K0NA 2JU5A 1XXUA 2DIZA 2DLXA 4X1UA 1USBA 3D0ZA 1F6MC 4D73A 5C00A 4TR3A 4H86A 1K0DA 3GX8A 5KN0A 3AY8A 3FYGA 3C71A 1T8EB 3QAVA 5KN1A 2HZEA 3ZVJA 4BVXB 4NMUA 2LKUA 3F8UA 5FHIA 4AJ8A 4ZBDA 5JCWA 3GSTA 5F07A 1AW9A 4TXOA 2PMTA 3EMXA 4ZIJA 4PXOA 3TJGA 4MNNA 3RHBA 2HRKA 2EIRA 2E2GA 1UA5A 2B3SA 1LU4A 3C8EA 4FYUA 3EYTA 1GWCA 2H72A 5ELGA 3UBKA 1WJKA 5DJMA 3WGXA 4KNDA 1FVJA 1PA3A 2X4AA 2HRAA 3VWWA 1JZDA 3ERGA 4Q5QA 4MPGA 2CVBA 3IK7A 1MDIA 5A4WA 3HY2A 3I9V2 3Q19A 3C73A 1FOVA 1T1VA 4V1Ag 3KGKA 5B6MA 4HI7A 1QXHA 4ZB9A 1LBKA 1O7UA 1Z6NA 1G6YA 5LNKe 3HVSA 1T7PB 3MSZA 3LSZA 3GH6A 1EP8A 3A3TA 3TDGA 1EGRA 2VL2A 2LJKA 4PTSA 5J9CA 3WT1A 3VLNA 3DMLA 2PN8A 4IN0A 2HE3A 2A2SA 4ZB6A 2HNLA 5ENUA 2R6KA 4JE1A 3I6AA 2HYXA 3D4TA 4EC0A 2IMIA 3P7XA 4N0VA 1GSYA 1XFLA 5D9TA 2VO4A 2CX4A 2K18A 2WGRA 1T00A 3IV4A 4NV2A 4BWQA 3GUSA 3LFLA 2DJ2A 2P5RA 1B9YC 1EEMA 4KCAA 1Z9HA 2ON5A 3BCKA 3K8NA 1JZWA 2JL4A 5J3RA 2H30A 1ZYPA 2VD1A 5ABRA 3DD3A 4F03A 3UVTA 1A23A 2FNOA 1FW1A 2GS3A 2YWNA 1NM3A 5J41A 1YEXA 4WR4A 5LCZA 4X4JA 5IO2A 5IMCA 3RAZA 2O8VB 1URMA 3H4KA 4CY6A 1YKCA 4HJ2A 3CRTA 3L9SA 2HRNA 1XZOA 2QC7A 3GYKA 1KBNA 4TOPA 5J9BA 2RUFA 3GRXA 4HQSA 4GCIA 2N5AA 2CAQA 1ZGNA 12GSA 1XWBA 4BVYA 2CX3A 1GSDA 3M8NA 2AV4A 4ID0A 2ZCTA 4LMWA 4XHMA 3EVIA 2R4VA 2X8GA 1U87A 3GFKA 6GSXA 1ZCPA 2L4QA 3V1WA 1RK4A 2B7JA 2C0FA 3M9JA 4ICYA 2IMFA 4I8BA 1K3LA 5IMFA 3C1RA 6GSWA 2GZPA 1SKRB 2GLRA 5DAKB 3GNJA 1GSQA 2JZSA 2L4CA 1XWCA 1YZXA 3WD6A 2PPTA 1O6JA 2V2GA 1EV9A 3KD0A 3G9BA 4ZL9A 4YAPA 5EL8A 4K2DA 3DGQA 19GSA 4ZL8A 4DSRA 2PVQA 4XS4A 1PL1A 3VWUA 1M99A 5HFIA 4IW9A 1QQ2A 4EUYA 3HJOA 4BWSA 3FZ4A 3TOTA 4WKWA 4MF7A 3HDCA 13GSA 2ALBA 2DSAA 2FWFA 1X5CA 3TKSE 2WS2A 4KB3A 4OCFA 1OC9B 1B9XC 5A4VA 4I6XA 4GWRA 1Z7RA 3F6DA 3NZNA 3UIWA 2O7KA 4XTSA 4EXJA 1XVWA 3IXRA 4XCSA 3HYPA 2VD0A 4HDEA 1GLQA 4KDYA 4JBBA 4EDZA 5IM9A 4IJ3A 4F0CA 1XWAA 5JWOB 2IL3A 3RBTA 1U3AA 2BMXA 2MMAA 1S3CA 4Z2RA 3APSA 4LLRA 4MLYA 2C0GA 3DWVA 1YF0A 18GSA 4E8HA 1G7EA 1H75A 1WOUA 3UBLA 4TRXA 5B7CA 1QFNA 4NHZA 1DBYA 4JR4A 3IHGA 1PSQA 2LS5A 5B8AA 1K0BA 2GSQA 4MCUA 4GXZA 4KAEA 6GSTA 1GSFA 4EE0A 4HZ2A 3MAKA 2VL2C 1C72A 1G0TA 3EURA 3GHAA 4ZILA 2M46A 1GNEA 5HR3A 2E7PA 4ECJA 2FD3A 6GSVA 3FR6A 4HOJA 2M80A 4GTUA 4NPBA 3ZTLA 1ZMAA 1J9BA 4PUFC 1XOAA 3IPZA 4POKA 3LEFA 5IMDA 3BJ5A 4WXTA 1THXA 2MYGA 3GTUA 1NSWA 2TRXA 4DEJA 3I43A 2P5QA 3HVVA 1AQWA 4XS1A 4OD7A 1HD2A 2OE0A 4Q5FA 2C3TA 1GTUA 1TU7A 4I97A 5KEJA 4I2TA 2KOKA 5DCGA 3GURA 4IHUA 3PPUA 2JSYA 3SWLA 2YP6A 4JEDA 4WF5A 3EU4A 3HHVA 2CQ9A 2OJLA 3LJRA 1EZKA 1EP7A 5B8BA 1A8YA 3A2XA 2OBIA 2DJ1A 5ECMB 4WBJA 4IELA 5H5SA 2XBQA 4D73B 3HD5A 2P31A 3FHKA 1FB6A 3W6GA 4G0KA 4OMVA 4Z2UA 1MDKA 4IP1A 2NBSA 1SKSB 2PUKC 2OE3A 2HZEB 2VOCA 4G10A 4LMVA 4ULXA 3LG6A 5HFKA 3E0UA 3LXTA 2R0GA 4TXOB 5G1KA 4K5RA 3TKSA 1IYHA 3IRAA 2CZ3A 4K9ZA 1GSEA 1W89A 3CSJA 1XW5A 1M7TA 5ECOB 3QOUA 1PX7A 1ABAA 2RM6A 4JU5A 2C3NA 3CTFA 2C0DA 1YQ1A 1T3BA 3FY7A 3LXZA 2A2PA 4EVMA 1OE8A 3EINA 2EIOA 1OE7A 2LJRA 5E59A 1GTIA 4MZBA 1SYRA 1H4OA 1A2JA 1J08A 1M2DA 2H75A 3HJPA 4HUAA 11GSA 2LQQA 4GLTA 3C7MA 3KMNA 4OO4A 3DEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FK8 A;  3HZ8 A;  2JAC A;  3QPM A;  1A0R P;  5D8I A;  3KP9 A;  1J0F A;  3VPQ A;  3EC3 A;  1WE0 A;  5COH A;  4WF4 A;  4HEA 2;  5F0G A;  1EV4 A;  5F05 A;  1AQX A;  3CSH A;  4F9Z A;  4V1A p;  1K0A A;  3D4M A;  3Q18 A;  4EKZ A;  5DQS A;  5EY6 A;  5HFG A;  1ERV A;  4JRR A;  4FIW A;  1SU9 A;  4ECB A;  2YV9 A;  1YKA A;  3HJM A;  3EWL A;  1FO5 A;  2LRN A;  4F2I A;  2H1D A;  2I3Y A;  2OBK A;  3O3T A;  2ZUP A;  1DUG A;  3F4S A;  3WYW A;  1O8X A;  4IQ1 A;  4GST A;  4WBR D;  2YV7 A;  1A2L A;  1SL2 B;  4O7H A;  1V58 A;  3TJF A;  1ERW A;  1FVK A;  2LEG A;  2VL9 A;  2H71 A;  3ZIJ A;  1X5D A;  2GTU A;  2XC2 A;  2WFC A;  2TIR A;  2EC4 A;  1HNB A;  2DJJ A;  1KTE A;  1ST9 A;  2AJQ B;  1Z5Y E;  1KNG A;  5HR2 A;  2O85 A;  5CAX A;  1SJ6 A;  3DXB A;  3G7I A;  5G2Z A;  1Y6E A;  3QD9 A;  2WRT A;  2YCD A;  2IPA A;  4NHW A;  4OFM A;  3LYK A;  4ZBA A;  2IFQ B;  1X9W B;  2MMN A;  7GSS A;  4IBP A;  2NVL A;  4MJC A;  3F4T A;  1SYX A;  2GVP A;  4HS1 A;  3CXG A;  5AIS A;  1TK5 B;  4JR6 A;  1B4P A;  4K7N A;  3QAG A;  4FYC A;  3CTG A;  1Z7P A;  1U3I A;  2MZC A;  3KJY A;  3ZFL A;  5GST A;  5IPH A;  3Q6O A;  2NDO A;  2P0G A;  2C80 A;  3UEM A;  4TVE A;  1R4W A;  1MD3 A;  5FT3 A;  2V6K A;  1WP0 A;  4BVX A;  5D9W A;  1M0U A;  3RDW A;  2YN1 A;  5JCG A;  5DAL A;  3L9U A;  4PNG A;  2CA8 A;  4WR5 A;  5JWQ B;  4N30 A;  2AHE A;  4CHS A;  1WRY A;  4MZC A;  2WDU A;  2L59 A;  1CQH A;  3GKM A;  4LA1 A;  2H66 A;  5KN3 A;  3KP8 A;  3D6I A;  4XS4 B;  1VGL A;  1AUC A;  2H6Z A;  1A0F A;  2JAD A;  4Z7X A;  4PX1 A;  1QK8 A;  1VRS D;  3IE3 A;  1X9S B;  5G31 A;  4HJM A;  8GSS A;  3ZLP A;  1OVN A;  1JLW A;  4IJI A;  1UC7 A;  1XWG A;  1NHY A;  2AB6 A;  3TOU A;  3FKF A;  4TXV A;  3ISO A;  2VLU A;  1A2M A;  4HU7 A;  2GT5 A;  2H6Y A;  2GQK A;  4ILF A;  2MMZ A;  2K8V A;  1MEK A;  3UJ1 A;  5IPG A;  2LUS A;  3TKS C;  3MNG A;  3J7Y k;  2GQM A;  5GSS A;  4MZW A;  2NPB A;  1VF1 A;  1PX6 A;  16GS A;  1GTB A;  2PWJ A;  3M1G A;  2H8L A;  1X5E A;  3VUR A;  2PGT A;  1GRX A;  2H76 A;  3IAM 2;  4KSM A;  4XRA A;  2CV4 A;  3ZZX A;  4ML1 A;  2IIY A;  3RHC A;  5IIZ A;  1F2E A;  4NAX A;  5F8B A;  3DVX A;  3KCM A;  3VFI A;  1I5G A;  3HKR A;  3UAR A;  2K6V A;  2X8H A;  3QDN A;  1YEP A;  4KA0 A;  1TDI A;  2H1A A;  1M9B A;  1TOF A;  3UMA A;  1ERT A;  1MDJ A;  2PVO C;  3GV1 A;  6GSS A;  1AXD A;  5IQY A;  14GS A;  5G5F A;  2BTO T;  4CDO A;  1PN9 A;  4PNF A;  5HQP A;  3IK9 A;  3ME8 A;  1SD9 A;  3ZRE A;  1TW9 A;  4IP6 A;  1UN2 A;  1XBS A;  5H5Q A;  4MH2 A;  4PGT A;  1TRW A;  2MBT A;  4L5O A;  3VI5 A;  3GL3 A;  4BPY A;  1A24 A;  1TI1 A;  2F8F A;  2LTK A;  3CBU A;  3GIX A;  3TUE A;  3DIE A;  2OA7 A;  2J9H A;  3C1S A;  2F51 A;  1PKW A;  4MJE A;  4EL1 A;  1GUH A;  4MK3 A;  4N0Z A;  1VF4 A;  4G2E A;  2DIY A;  1O81 A;  3BOA A;  4DSS A;  1GNW A;  1Z3E A;  1DE2 A;  3CYN A;  1GUL A;  2H6X A;  3LWA A;  3IR4 A;  4TR0 A;  2MBS A;  3EMP A;  4QL7 A;  2LQO A;  3TB2 A;  1B48 A;  3KEB A;  4K7O A;  3G7Y A;  2OE1 A;  5CNW A;  1V98 A;  1TKD B;  1G7O A;  1F9M A;  5DAK A;  4J2F A;  3KZQ A;  1XCC A;  5D9X A;  1V2A A;  1R26 A;  5IOX A;  4J57 E;  2FLS A;  4NXI A;  20GS A;  1K0N A;  4X43 A;  4RI7 A;  1SK0 A;  4G19 A;  1OC8 A;  3ZRD A;  2IWT A;  4YQU A;  3F3Q A;  3KH7 A;  2E0Q A;  3F3R A;  5D93 A;  2A4V A;  2ON7 A;  2GT6 A;  3VWV A;  2ZNM A;  2IMD A;  3KIJ A;  2IN3 A;  1BYE A;  3QFA C;  1TI3 A;  3HXS A;  3F9U A;  2B5X A;  4GSN A;  1PL2 A;  5GAN D;  4HQZ A;  4WET A;  2GDR A;  3F6F A;  4MA9 A;  2KHP A;  2F8A A;  5ECS A;  1OC9 A;  1M2A A;  2XHF A;  2G2Q A;  2IMK A;  2YJ7 A;  3DRN A;  3LGC A;  2GGT A;  2YWO A;  1ZL9 A;  1GUM A;  4MMM A;  5J4U A;  3N5O A;  2B6M A;  1JHB A;  9GSS A;  5G30 A;  1PKZ A;  2H0G A;  2QKE A;  3TKP A;  4POL A;  4L5L A;  5CRD A;  5ID2 B;  4OO5 A;  1EOH A;  4ZL7 A;  5A5K A;  3O6T A;  1HNA A;  3ME7 A;  3VK9 A;  4O5R A;  1T4Y A;  3LQ7 A;  1DSB A;  2GZZ A;  5ECH B;  17GS A;  2HLS A;  1XW9 A;  1WIK A;  5CRW A;  4OFT A;  3FR9 A;  1E2Y A;  1O8W A;  3F0I A;  5G5E A;  2C3Q A;  2QGV A;  1W4V A;  3PGT A;  3ZIV A;  2V41 A;  3TRX A;  1AAZ A;  1ML6 A;  3IC4 A;  3TJJ A;  4IS0 A;  1UVZ A;  1PGT A;  2B7K A;  1XOB A;  2VUP A;  1K3Y A;  3L78 A;  1V40 A;  1M2B A;  2L6C A;  5DDL A;  4KCE A;  3I69 A;  4YQV A;  5AGY A;  2H19 A;  4K0G A;  3A5W A;  5DCH A;  1SL0 B;  2DBC A;  2VLT A;  4TR1 A;  5DVB A;  4MJB A;  5CP1 A;  2PBJ A;  1MTC A;  3E9J B;  4ISD A;  1ZYE A;  4EDY A;  3ZL5 A;  4IGJ A;  5ECQ B;  4ZB8 A;  4DSQ A;  4OWY A;  2NTO A;  5IMZ A;  3HA9 A;  1ZOF A;  2H0H A;  4AJ6 A;  3APO A;  3VPT A;  3ERF A;  3LOR A;  1SD8 A;  4MF6 A;  2CZ2 A;  2LJA A;  2H73 A;  3H93 A;  3L0H A;  3CRU A;  1TTZ A;  4MH3 A;  1HNC A;  4F0B A;  4KSO A;  2GSR A;  4HU9 A;  2VM2 A;  1PMT A;  2N5F A;  1MD4 A;  5C04 A;  4RQR A;  1DE1 A;  4GQF A;  1HQO A;  4KW6 A;  3APQ A;  2YJH A;  3ZMK A;  2X64 A;  2VCW A;  5JWR B;  5E4W A;  2C8U A;  2CT6 A;  2LST A;  5INY A;  1SK1 A;  2C1Y A;  2V32 A;  2DJK A;  4DVC A;  2HSH A;  3KTL A;  3BD2 A;  2LRC A;  1SEN A;  5EPF A;  3NIV A;  3FW2 A;  1GUK A;  3TJB A;  2HSY A;  1S3D A;  3IDV A;  1YY7 A;  5L71 A;  2I9H A;  2M72 A;  2KLX A;  1YF1 A;  4Q5R A;  1AQV A;  3FZ5 A;  4P3Y B;  3VWX A;  5ECI B;  3UL3 A;  1BX9 A;  5DAL B;  1Q98 A;  3KH9 A;  2GST A;  2HZF A;  2RLI A;  2XBI A;  2HT9 A;  3E3E A;  2REM A;  1SJI A;  3M9K A;  2VL3 A;  4KDX A;  4MJA A;  1F3A A;  3FR3 A;  2VCV A;  2X99 A;  1GTA A;  2B5E A;  2I4A A;  4PUA A;  3A2W A;  3U5R E;  2E2M A;  2JZR A;  1XWK A;  3GMF A;  1Q4J A;  4GQC A;  2I1U A;  4PQH A;  3GSS A;  4I5Q A;  4JZQ A;  2YWM A;  5CRG A;  2LNS A;  5G1L A;  2C4J A;  4ZXG A;  3J7Y b;  5IMV A;  4V2N A;  3F4R A;  1AC1 A;  2J23 A;  3ZYW A;  2XPD A;  3O76 A;  3KTB A;  3UOM A;  3GA4 A;  3ED3 A;  1K0O A;  5DQY A;  4TR4 A;  1OKT A;  5CRE A;  3FRC A;  2H1B A;  2WJU A;  2KP1 A;  3P8W A;  4LL1 B;  2R3X A;  2H0I A;  1XVQ A;  4AJ7 A;  2PU9 C;  4K6X A;  3GL5 A;  4POM A;  1WPI A;  2RII A;  4HZ4 A;  1NW2 A;  2IME A;  4OCE A;  1KEB A;  4MAB A;  1OC3 A;  4O92 A;  4ZBB A;  4F82 A;  1RW1 A;  4ACS A;  3IHQ A;  5D73 A;  1VF3 A;  1TP9 A;  1V57 A;  3ERW A;  1T4Z A;  1GLP A;  2DMM A;  2FWH A;  3UVH A;  2FUG 2;  2VCZ A;  1PD2 1;  4MF5 A;  1QMV A;  2AAW A;  2B5Y A;  4MDC A;  4EO3 A;  1TU8 A;  1EWX A;  3IAS 2;  3Q74 A;  4KUN A;  1E6B A;  4XIH A;  5EVO A;  4V2L A;  3D21 A;  5A4U A;  2ES7 A;  1I9D A;  3M3M A;  1HYU A;  2CVK A;  5DBQ A;  2H01 A;  1EGO A;  4YH2 A;  3D22 A;  3ZIT A;  1TK0 B;  5IOW A;  2VCQ A;  1AIU A;  1V9W A;  3NOF A;  4PUR A;  4RUV A;  3MWH A;  1OKD A;  2AUV A;  3GH9 A;  2YNX A;  2K9F A;  2IFQ A;  1SL1 B;  2D2Z A;  5AIX A;  3DKS A;  1U88 A;  1NHO A;  2VLV A;  2R5G A;  5DJL A;  3TJK A;  2CAI A;  2GSS A;  3L9V A;  1ERU A;  2FWG A;  1JLV A;  3SBC A;  3KMO A;  4FO5 A;  4DSS B;  2HRF A;  22GS A;  1OYJ A;  2F9S A;  1SKW B;  2O89 A;  3GN3 A;  6GSY A;  4ML6 A;  3WGE A;  4FH8 A;  1M9A A;  2LNT A;  1A8L A;  1CQG A;  2HFD A;  3P2A A;  4ECI A;  4GSS A;  2HXK A;  4RI6 A;  1R5A A;  4V2M A;  5HR1 A;  3BCI A;  4QQ7 A;  2BJX A;  3CSI A;  1JZR A;  1FG4 A;  1U6T A;  3QAW A;  3GKX A;  2WZ9 A;  1YJ6 A;  2H74 A;  3DVW A;  3TCO A;  2JZT A;  4K7I A;  3U6V A;  1QGV A;  2VIM A;  3TKR A;  5ECN B;  2VCT A;  4G9H A;  2K8S A;  2B1K A;  1JZO A;  1F37 A;  5LD0 A;  5IMA A;  2H70 A;  2X8C A;  4X0X A;  2AYT A;  2EIQ A;  1WMJ A;  1K3O A;  1FAA A;  1TRV A;  2GZY A;  4QL9 A;  1GH2 A;  3FEU A;  3F63 A;  1F3B A;  2VM1 A;  1K0C A;  3GTU B;  3IOS A;  3WT2 A;  4RQX A;  1N2A A;  2IJY A;  1B8X A;  4O32 A;  5AN1 A;  2I81 A;  2KUC A;  4L0U A;  2A2R A;  2C0E A;  4BA7 A;  3IBH A;  1TRU A;  5AIV A;  2HI7 A;  1GP1 A;  2VAF A;  5JCU A;  1JFU A;  4Q5N A;  1WWJ A;  3G7J A;  3DYR A;  1FHE A;  2WUL A;  3WGD A;  3VI7 A;  5IO0 A;  2RM5 A;  3HVX A;  1ZYQ B;  2QSI A;  3RPP A;  2WCI A;  2DJ3 A;  4TW5 A;  5F06 A;  2YWI A;  2L5O A;  4GRF A;  3R2Q A;  3QR6 A;  5D9V A;  3L4N A;  4OFN A;  5FWG A;  3W8J A;  3LYP A;  3US3 A;  2G0F A;  2MMO A;  2L6D A;  5GZZ B;  1TK8 B;  2H1G A;  2JSZ A;  2RUE A;  4PQI A;  4MPF A;  1BJX A;  3CMI A;  3ZFB A;  3ZVJ D;  4ECC A;  4J56 E;  1GL8 A;  4TKY A;  3RPN A;  3TRP A;  2TRC P;  3H79 A;  2LRT A;  4LL4 B;  3TRQ A;  1TRS A;  2VCX A;  4YQM A;  2GQL A;  1BQ7 A;  3H1N A;  2DML A;  1X0R A;  3A2V A;  4BL7 A;  1EEJ A;  2OKA A;  4N10 A;  1FB0 A;  3QMX A;  2PER A;  1PQN A;  2FWE A;  2OAC A;  3W8S A;  3IA1 A;  1Z6M A;  1YDK A;  4NV5 A;  1O85 A;  4TR1 B;  5ECP B;  1ILO A;  4L0W A;  4L8E A;  4CW9 A;  2YOI A;  2LV3 A;  4XRD A;  1SJZ A;  3GX0 A;  4E8E A;  3D5J A;  2YAN A;  2O87 A;  2B1L A;  5H5R A;  1X9M B;  5ELA A;  5KN2 A;  3EU3 A;  1ACV A;  5CRH A;  3QFB C;  6GSU A;  3GKN A;  1K0M A;  5CYY A;  3MDK A;  2FY6 A;  1BG5 A;  4IVF A;  1GSS A;  3HCZ A;  2FHE A;  3S9F A;  4AGS A;  2KP2 A;  3M0F A;  4GF0 A;  4KGI A;  3TKQ A;  3N9J A;  4KE3 A;  3PH9 A;  3OR5 A;  2V1M A;  1BED A;  1QUW A;  1GSU A;  2DJ0 A;  3FZ9 A;  1R7H A;  2R2J A;  4FYB A;  2FA8 A;  5ECR B;  3PR8 A;  1VF2 A;  2R37 A;  2N5B A;  1SK2 A;  1BAY A;  1Y25 A;  4NWY A;  1TJD A;  3TGZ A;  3P90 A;  1PRX A;  5D96 A;  3JCM L;  1EOG A;  4K1F A;  1N8J A;  5B6N A;  4KDU A;  4IQA A;  4WEY A;  4IKH A;  4EF0 A;  4POB A;  3BBY A;  4PQ1 A;  1XW6 A;  1RQM A;  4MP4 A;  2DC5 A;  4XS6 A;  5HR0 A;  4KH7 A;  1ZZY A;  4KX4 A;  3EE2 A;  3QCP A;  4TN8 A;  2FA4 A;  1LJR A;  2L57 A;  1R5P A;  2WB9 A;  2XPE A;  3ZML A;  3KXO A;  5GAP D;  3PIN A;  1OAZ A;  1TXX A;  4YAV A;  2YPM A;  1ON4 A;  2L5L A;  3UAP A;  5ECL B;  1XPV A;  4K8M A;  10GS A;  5ID2 A;  2FCH A;  3H8Q A;  1O73 A;  2OAD A;  4N11 A;  5CO3 A;  2YZH A;  2V6O A;  1THO A;  2Z9S A;  3HZ4 A;  1IYI A;  5J5N A;  2YZU A;  4I2U A;  2F3M A;  4AF2 A;  2CVD A;  1B4Q A;  1XIY A;  2FGX A;  3FZA A;  1S3A A;  5ECK B;  1G6W A;  3KM6 A;  3GKK A;  4K0N A;  2JU5 A;  1XXU A;  2DIZ A;  2DLX A;  4X1U A;  1USB A;  3D0Z A;  1F6M C;  4D73 A;  5C00 A;  4TR3 A;  4H86 A;  1K0D A;  3GX8 A;  5KN0 A;  3AY8 A;  3FYG A;  3C71 A;  1T8E B;  3QAV A;  5KN1 A;  2HZE A;  3ZVJ A;  4NMU A;  2LKU A;  3F8U A;  5FHI A;  4AJ8 A;  4ZBD A;  5JCW A;  3GST A;  5F07 A;  1AW9 A;  4TXO A;  2PMT A;  3EMX A;  4ZIJ A;  4PXO A;  3TJG A;  3RHB A;  2EIR A;  2E2G A;  1UA5 A;  2B3S A;  1LU4 A;  3C8E A;  4FYU A;  3EYT A;  1GWC A;  2H72 A;  5ELG A;  3UBK A;  1WJK A;  5DJM A;  3WGX A;  4KND A;  1FVJ A;  1PA3 A;  3VWW A;  1JZD A;  3ERG A;  4Q5Q A;  4MPG A;  2CVB A;  3IK7 A;  1MDI A;  5A4W A;  3HY2 A;  3I9V 2;  3Q19 A;  3C73 A;  1FOV A;  1T1V A;  4V1A g;  3KGK A;  5B6M A;  4HI7 A;  1QXH A;  4ZB9 A;  1LBK A;  1O7U A;  1Z6N A;  1G6Y A;  5LNK e;  3HVS A;  1T7P B;  3MSZ A;  3LSZ A;  3GH6 A;  1EP8 A;  3A3T A;  3TDG A;  1EGR A;  2VL2 A;  2LJK A;  5J9C A;  3WT1 A;  3VLN A;  3DML A;  2PN8 A;  4IN0 A;  2HE3 A;  2A2S A;  4ZB6 A;  2HNL A;  5ENU A;  2R6K A;  4JE1 A;  3I6A A;  2HYX A;  3D4T A;  4EC0 A;  2IMI A;  3P7X A;  4N0V A;  1GSY A;  1XFL A;  5D9T A;  2VO4 A;  2CX4 A;  2K18 A;  2WGR A;  1T00 A;  3IV4 A;  4NV2 A;  4BWQ A;  3GUS A;  3LFL A;  2DJ2 A;  2P5R A;  1B9Y C;  1EEM A;  4KCA A;  1Z9H A;  2ON5 A;  3BCK A;  3K8N A;  1JZW A;  2JL4 A;  5J3R A;  2H30 A;  2VD1 A;  5ABR A;  3DD3 A;  4F03 A;  3UVT A;  1A23 A;  2FNO A;  1FW1 A;  2GS3 A;  2YWN A;  1NM3 A;  5J41 A;  1YEX A;  4WR4 A;  5LCZ A;  5IO2 A;  5IMC A;  3RAZ A;  2O8V B;  1URM A;  3H4K A;  1YKC A;  4HJ2 A;  3CRT A;  3L9S A;  2HRN A;  1XZO A;  2QC7 A;  3GYK A;  1KBN A;  4TOP A;  5J9B A;  2RUF A;  3GRX A;  4HQS A;  4GCI A;  2N5A A;  2CAQ A;  1ZGN A;  12GS A;  1XWB A;  4BVY A;  2CX3 A;  1GSD A;  3M8N A;  2AV4 A;  4ID0 A;  2ZCT A;  4LMW A;  4XHM A;  3EVI A;  2R4V A;  2X8G A;  1U87 A;  3GFK A;  6GSX A;  1ZCP A;  2L4Q A;  3V1W A;  1RK4 A;  2B7J A;  2C0F A;  3M9J A;  2IMF A;  4I8B A;  1K3L A;  5IMF A;  3C1R A;  6GSW A;  2GZP A;  1SKR B;  2GLR A;  5DAK B;  3GNJ A;  1GSQ A;  2JZS A;  2L4C A;  1XWC A;  1YZX A;  3WD6 A;  2PPT A;  1O6J A;  2V2G A;  1EV9 A;  3KD0 A;  3G9B A;  4ZL9 A;  4YAP A;  5EL8 A;  4K2D A;  3DGQ A;  19GS A;  4ZL8 A;  4DSR A;  2PVQ A;  4XS4 A;  1PL1 A;  3VWU A;  1M99 A;  5HFI A;  4IW9 A;  1QQ2 A;  4EUY A;  3HJO A;  4BWS A;  3FZ4 A;  3TOT A;  4WKW A;  4MF7 A;  3HDC A;  13GS A;  2ALB A;  2DSA A;  2FWF A;  1X5C A;  3TKS E;  2WS2 A;  4KB3 A;  4OCF A;  1OC9 B;  1B9X C;  5A4V A;  4I6X A;  4GWR A;  1Z7R A;  3F6D A;  3NZN A;  3UIW A;  2O7K A;  4XTS A;  4EXJ A;  1XVW A;  3IXR A;  4XCS A;  3HYP A;  2VD0 A;  4HDE A;  1GLQ A;  4KDY A;  4JBB A;  4EDZ A;  5IM9 A;  4IJ3 A;  4F0C A;  1XWA A;  5JWO B;  2IL3 A;  3RBT A;  1U3A A;  2BMX A;  2MMA A;  1S3C A;  3APS A;  4LLR A;  4MLY A;  2C0G A;  3DWV A;  1YF0 A;  18GS A;  4E8H A;  1G7E A;  1H75 A;  1WOU A;  3UBL A;  4TRX A;  5B7C A;  1QFN A;  4NHZ A;  1DBY A;  4JR4 A;  1PSQ A;  2LS5 A;  5B8A A;  1K0B A;  2GSQ A;  4MCU A;  4GXZ A;  4KAE A;  6GST A;  1GSF A;  4EE0 A;  4HZ2 A;  3MAK A;  2VL2 C;  1C72 A;  1G0T A;  3EUR A;  3GHA A;  4ZIL A;  2M46 A;  1GNE A;  5HR3 A;  2E7P A;  4ECJ A;  2FD3 A;  6GSV A;  3FR6 A;  4HOJ A;  2M80 A;  4GTU A;  4NPB A;  3ZTL A;  1ZMA A;  1J9B A;  4PUF C;  1XOA A;  3IPZ A;  4POK A;  3LEF A;  5IMD A;  3BJ5 A;  4WXT A;  1THX A;  2MYG A;  3GTU A;  1NSW A;  2TRX A;  4DEJ A;  3I43 A;  2P5Q A;  3HVV A;  1AQW A;  4XS1 A;  4OD7 A;  1HD2 A;  2OE0 A;  4Q5F A;  2C3T A;  1GTU A;  1TU7 A;  4I97 A;  5KEJ A;  4I2T A;  2KOK A;  5DCG A;  3GUR A;  4IHU A;  2JSY A;  3SWL A;  2YP6 A;  4JED A;  4WF5 A;  3EU4 A;  3HHV A;  2CQ9 A;  2OJL A;  3LJR A;  1EZK A;  1EP7 A;  5B8B A;  1A8Y A;  3A2X A;  2OBI A;  2DJ1 A;  5ECM B;  4WBJ A;  4IEL A;  5H5S A;  2XBQ A;  4D73 B;  3HD5 A;  2P31 A;  3FHK A;  1FB6 A;  3W6G A;  4OMV A;  1MDK A;  4IP1 A;  2NBS A;  1SKS B;  2PUK C;  2OE3 A;  2HZE B;  2VOC A;  4G10 A;  4LMV A;  4ULX A;  3LG6 A;  5HFK A;  3E0U A;  3LXT A;  4TXO B;  5G1K A;  3TKS A;  1IYH A;  3IRA A;  2CZ3 A;  4K9Z A;  1GSE A;  1W89 A;  3CSJ A;  1XW5 A;  1M7T A;  5ECO B;  3QOU A;  1PX7 A;  1ABA A;  2RM6 A;  4JU5 A;  2C3N A;  3CTF A;  2C0D A;  1YQ1 A;  1T3B A;  3FY7 A;  3LXZ A;  4EVM A;  1OE8 A;  3EIN A;  2EIO A;  1OE7 A;  2LJR A;  5E59 A;  1GTI A;  4MZB A;  1SYR A;  1H4O A;  1A2J A;  1J08 A;  1M2D A;  2H75 A;  3HJP A;  4HUA A;  11GS A;  2LQQ A;  4GLT A;  3C7M A;  3KMN A;  4OO4 A;  3DEX A; 
#chains in the Genus database with same CATH topology
 1FOH A;  3FK8 A;  3HZ8 A;  2JAC A;  3QPM A;  1A0R P;  5D8I A;  3KP9 A;  1J0F A;  3VPQ A;  3EC3 A;  1WE0 A;  5COH A;  3A5I A;  4WF4 A;  4HEA 2;  5F0G A;  1EV4 A;  5F05 A;  2QA1 A;  1AQX A;  3CSH A;  4F9Z A;  4V1A p;  1XG8 A;  1K0A A;  4O5U A;  3D4M A;  3Q18 A;  4EKZ A;  4O5Q A;  5DQS A;  5EY6 A;  5HFG A;  1ERV A;  3IC8 A;  4FIW A;  4JRR A;  1SU9 A;  4ECB A;  2YV9 A;  1YKA A;  3HJM A;  3EWL A;  1FO5 A;  2LRN A;  4F2I A;  2H1D A;  2I3Y A;  2OBK A;  3O3T A;  2ZUP A;  1DUG A;  3F4S A;  3WYW A;  1O8X A;  4IQ1 A;  4GST A;  4WBR D;  2YV7 A;  1A2L A;  1SL2 B;  4O7H A;  1V58 A;  3TJF A;  1ERW A;  1FVK A;  2LEG A;  2VL9 A;  2H71 A;  3ZIJ A;  1X5D A;  2GTU A;  2XC2 A;  4K2X A;  2WFC A;  2TIR A;  2EC4 A;  1HNB A;  2DJJ A;  1KTE A;  1ST9 A;  2AJQ B;  1Z5Y E;  1KNG A;  5HR2 A;  2O85 A;  5CAX A;  1SJ6 A;  3DXB A;  3G7I A;  5G2Z A;  1Y6E A;  3QD9 A;  2WRT A;  2YCD A;  2IPA A;  4NHW A;  4OFM A;  3LYK A;  4ZBA A;  2IFQ B;  1X9W B;  2MMN A;  7GSS A;  4IBP A;  2NVL A;  4MJC A;  3F4T A;  1SYX A;  2GVP A;  4HS1 A;  3CXG A;  5AIS A;  1TK5 B;  4JR6 A;  1B4P A;  4K7N A;  3QAG A;  4FYC A;  3CTG A;  1Z7P A;  1U3I A;  2MZC A;  3KJY A;  3ZFL A;  5GST A;  3FMW A;  4A5P A;  5IPH A;  3Q6O A;  2NDO A;  2P0G A;  2C80 A;  3UEM A;  4TVE A;  1R4W A;  1MD3 A;  5FT3 A;  2V6K A;  1WP0 A;  4BVX A;  5D9W A;  1M0U A;  3RDW A;  2YN1 A;  5JCG A;  5DAL A;  3L9U A;  4PNG A;  2CA8 A;  4WR5 A;  5JWQ B;  4N30 A;  2AHE A;  4CHS A;  1WRY A;  4MZC A;  2WDU A;  2L59 A;  1CQH A;  3GKM A;  4LA1 A;  2H66 A;  5KN3 A;  3KP8 A;  3D6I A;  4XS4 B;  1VGL A;  1AUC A;  2H6Z A;  1A0F A;  2JAD A;  4Z7X A;  4PX1 A;  1QK8 A;  1VRS D;  3IE3 A;  1X9S B;  5G31 A;  4HJM A;  8GSS A;  3ZLP A;  1OVN A;  1JLW A;  4IJI A;  1UC7 A;  1XWG A;  1NHY A;  2AB6 A;  3TOU A;  3FKF A;  4TXV A;  3ISO A;  2VLU A;  1A2M A;  4HU7 A;  2GT5 A;  2X49 A;  2H6Y A;  2GQK A;  4ILF A;  2MMZ A;  2K8V A;  1MEK A;  3UJ1 A;  5IPG A;  2LUS A;  3TKS C;  3MNG A;  3J7Y k;  2GQM A;  5GSS A;  4MZW A;  2NPB A;  1VF1 A;  1PX6 A;  16GS A;  1GTB A;  2PWJ A;  3M1G A;  2H8L A;  1X5E A;  3VUR A;  2PGT A;  1GRX A;  2H76 A;  3IAM 2;  4KSM A;  4XRA A;  2CV4 A;  3ZZX A;  4ML1 A;  2IIY A;  3RHC A;  5IIZ A;  1F2E A;  4NAX A;  5F8B A;  3DVX A;  3KCM A;  3VFI A;  1I5G A;  3HKR A;  3UAR A;  2K6V A;  2X8H A;  3QDN A;  1YEP A;  5KOW A;  4KA0 A;  1TDI A;  2H1A A;  1M9B A;  1TOF A;  3UMA A;  1ERT A;  1MDJ A;  2PVO C;  3GV1 A;  6GSS A;  1AXD A;  5IQY A;  4K5S A;  14GS A;  4FQU A;  5G5F A;  2BTO T;  4CDO A;  1PN9 A;  4PNF A;  5HQP A;  3IK9 A;  3ME8 A;  1SD9 A;  3ZRE A;  1TW9 A;  4IP6 A;  1UN2 A;  4BL7 B;  1XBS A;  5H5Q A;  4MH2 A;  4PGT A;  1TRW A;  2MBT A;  4L5O A;  3VI5 A;  3GL3 A;  4BPY A;  1A24 A;  1TI1 A;  2F8F A;  1M3I A;  2LTK A;  3CBU A;  3GIX A;  3TUE A;  3DIE A;  2OA7 A;  2J9H A;  3C1S A;  2F51 A;  1PKW A;  4MJE A;  4EL1 A;  1GUH A;  4MK3 A;  4N0Z A;  1VF4 A;  4G2E A;  2DIY A;  1O81 A;  3BOA A;  4DSS A;  1GNW A;  1Z3E A;  1DE2 A;  3CYN A;  1GUL A;  2H6X A;  3LWA A;  3IR4 A;  4TR0 A;  2MBS A;  3MYD A;  3EMP A;  4QL7 A;  2LQO A;  3TB2 A;  1B48 A;  3KEB A;  4K7O A;  3G7Y A;  2OE1 A;  5CNW A;  1V98 A;  1TKD B;  1G7O A;  1F9M A;  4J2F A;  5DAK A;  3KZQ A;  1XCC A;  5D9X A;  1V2A A;  1R26 A;  5IOX A;  4J57 E;  2FLS A;  4NXI A;  20GS A;  1K0N A;  4X43 A;  4RI7 A;  1SK0 A;  4G19 A;  1OC8 A;  3ZRD A;  2IWT A;  4YQU A;  3F3Q A;  3KH7 A;  2E0Q A;  3F3R A;  5D93 A;  2A4V A;  2ON7 A;  2GT6 A;  3VWV A;  2ZNM A;  2IMD A;  3KIJ A;  2IN3 A;  1BYE A;  3QFA C;  1TI3 A;  3HXS A;  3F9U A;  3EPT A;  2B5X A;  4GSN A;  1PL2 A;  5GAN D;  4HQZ A;  4WET A;  2GDR A;  3F6F A;  4MA9 A;  2KHP A;  2F8A A;  5ECS A;  2UZ8 A;  1OC9 A;  1M2A A;  2XHF A;  2G2Q A;  2IMK A;  2YJ7 A;  3DRN A;  3LGC A;  2GGT A;  2YWO A;  1ZL9 A;  1GUM A;  4MMM A;  5J4U A;  3N5O A;  2B6M A;  1JHB A;  9GSS A;  5G30 A;  1PKZ A;  2H0G A;  2QKE A;  3TKP A;  4POL A;  4L5L A;  5CRD A;  5ID2 B;  4OO5 A;  1EOH A;  4ZL7 A;  5A5K A;  3O6T A;  1HNA A;  3ME7 A;  3VK9 A;  4O5R A;  1T4Y A;  3LQ7 A;  1DSB A;  2GZZ A;  5ECH B;  17GS A;  2HLS A;  1XW9 A;  1WIK A;  5CRW A;  2R0C A;  4OFT A;  3FR9 A;  1E2Y A;  4USS A;  1O8W A;  3F0I A;  5G5E A;  2C3Q A;  2QGV A;  1W4V A;  3PGT A;  3ZIV A;  2V41 A;  3TRX A;  1AAZ A;  1ML6 A;  3IC4 A;  3TJJ A;  4IS0 A;  1UVZ A;  1PGT A;  2B7K A;  1XOB A;  2VUP A;  1K3Y A;  3L78 A;  1V40 A;  1M2B A;  2L6C A;  5DDL A;  4KCE A;  3I69 A;  4YQV A;  5AGY A;  2H19 A;  4K0G A;  3A5W A;  5DCH A;  1SL0 B;  2DBC A;  2VLT A;  4TR1 A;  5DVB A;  4MJB A;  5CP1 A;  2PBJ A;  1MTC A;  3E9J B;  4ISD A;  1ZYE A;  4EDY A;  3ZL5 A;  4IGJ A;  5ECQ B;  4ZB8 A;  4DSQ A;  4OWY A;  2NTO A;  5IMZ A;  3HA9 A;  1ZOF A;  2H0H A;  4AJ6 A;  3APO A;  3VPT A;  3ERF A;  3LOR A;  1SD8 A;  4MF6 A;  3MIX A;  2CZ2 A;  2LJA A;  2H73 A;  3H93 A;  3L0H A;  3CRU A;  1TTZ A;  4MH3 A;  1HNC A;  4F0B A;  2QA2 A;  4KSO A;  2GSR A;  4HU9 A;  2VM2 A;  1PMT A;  2N5F A;  1MD4 A;  5C04 A;  4RQR A;  1DE1 A;  4GQF A;  1HQO A;  4KW6 A;  3APQ A;  4G0I A;  2YJH A;  3ZMK A;  2X64 A;  2VCW A;  5JWR B;  5E4W A;  2C8U A;  2CT6 A;  2LST A;  5INY A;  1SK1 A;  2C1Y A;  2V32 A;  2DJK A;  4DVC A;  2HSH A;  3KTL A;  3BD2 A;  2LRC A;  1SEN A;  5EPF A;  3NIV A;  3FW2 A;  1GUK A;  3TJB A;  2HSY A;  1S3D A;  3IDV A;  1YY7 A;  5L71 A;  2I9H A;  2M72 A;  2KLX A;  1YF1 A;  4Q5R A;  1AQV A;  3R3E A;  3FZ5 A;  4P3Y B;  3VWX A;  5ECI B;  3UL3 A;  1BX9 A;  5DAL B;  1Q98 A;  3KH9 A;  2GST A;  2HZF A;  2RLI A;  2XBI A;  2HT9 A;  3E3E A;  2REM A;  1SJI A;  5BMU A;  3M9K A;  2VL3 A;  4KDX A;  4MJA A;  1F3A A;  3FR3 A;  2VCV A;  2X99 A;  1GTA A;  2B5E A;  2I4A A;  4PUA A;  3A2W A;  3U5R E;  2E2M A;  2JZR A;  1XWK A;  3GMF A;  1Q4J A;  4GQC A;  4YKG A;  2I1U A;  4PQH A;  3GSS A;  4I5Q A;  4JZQ A;  2YWM A;  5CRG A;  2LNS A;  5G1L A;  2C4J A;  4ZXG A;  3J7Y b;  5IMV A;  4V2N A;  3F4R A;  1AC1 A;  2J23 A;  3ZYW A;  4CY8 A;  2XPD A;  3O76 A;  3KTB A;  4BVY B;  3UOM A;  3GA4 A;  3ED3 A;  1K0O A;  5DQY A;  4TR4 A;  1OKT A;  5CRE A;  5KOX A;  3FRC A;  2H1B A;  2WJU A;  2KP1 A;  3P8W A;  4LL1 B;  2R3X A;  2H0I A;  1XVQ A;  4AJ7 A;  2PU9 C;  4K6X A;  3GL5 A;  4POM A;  1WPI A;  2RII A;  4HZ4 A;  1NW2 A;  2IME A;  4OCE A;  1KEB A;  4MAB A;  1OC3 A;  4O92 A;  4ZBB A;  4F82 A;  1RW1 A;  4ACS A;  3IHQ A;  5D73 A;  1VF3 A;  1TP9 A;  1V57 A;  3ERW A;  1T4Z A;  1GLP A;  2DMM A;  2FWH A;  4EIP A;  3UVH A;  2FUG 2;  2VCZ A;  1PD2 1;  4MF5 A;  1QMV A;  2AAW A;  2B5Y A;  4MDC A;  4EO3 A;  1TU8 A;  1EWX A;  3IAS 2;  3Q74 A;  4KUN A;  1E6B A;  4XIH A;  5EVO A;  4V2L A;  3D21 A;  5A4U A;  2ES7 A;  1I9D A;  3M3M A;  1HYU A;  2CVK A;  5DBQ A;  2H01 A;  1EGO A;  4YH2 A;  3D22 A;  3ZIT A;  1TK0 B;  5IOW A;  2VCQ A;  1AIU A;  1V9W A;  3NOF A;  4PUR A;  4RUV A;  3MWH A;  1OKD A;  2AUV A;  3GH9 A;  2YNX A;  2K9F A;  1PN0 A;  2IFQ A;  1SL1 B;  2D2Z A;  5AIX A;  3DKS A;  1U88 A;  1NHO A;  2VLV A;  2R5G A;  5DJL A;  3TJK A;  2CAI A;  2GSS A;  3L9V A;  1ERU A;  2FWG A;  1JLV A;  3SBC A;  3KMO A;  4FO5 A;  4DSS B;  2HRF A;  22GS A;  1OYJ A;  4G0L A;  2F9S A;  1SKW B;  2O89 A;  3GN3 A;  6GSY A;  4ML6 A;  3WGE A;  4FH8 A;  1M9A A;  2LNT A;  1A8L A;  1CQG A;  2HFD A;  3P2A A;  4ECI A;  4GSS A;  2HXK A;  4RI6 A;  1R5A A;  4V2M A;  5HR1 A;  3BCI A;  3HVN A;  4QQ7 A;  2BJX A;  3CSI A;  1JZR A;  1FG4 A;  1U6T A;  3QAW A;  3GKX A;  2WZ9 A;  1YJ6 A;  2H74 A;  3DVW A;  3TCO A;  2JZT A;  4K7I A;  3U6V A;  1QGV A;  2VIM A;  3TKR A;  5ECN B;  2VCT A;  4G9H A;  2K8S A;  2B1K A;  1JZO A;  1F37 A;  5LD0 A;  5IMA A;  2H70 A;  2X8C A;  4X0X A;  2AYT A;  2EIQ A;  1WMJ A;  1K3O A;  1FAA A;  1TRV A;  2GZY A;  4QL9 A;  1GH2 A;  3FEU A;  3F63 A;  1F3B A;  2VM1 A;  1K0C A;  3GTU B;  3IOS A;  3WT2 A;  4RQX A;  1N2A A;  2IJY A;  1B8X A;  4O32 A;  5AN1 A;  2I81 A;  2KUC A;  4L0U A;  2A2R A;  2C0E A;  4BA7 A;  3IBH A;  1TRU A;  5AIV A;  2HI7 A;  1GP1 A;  2VAF A;  5JCU A;  1JFU A;  4Q5N A;  1WWJ A;  3G7J A;  3DYR A;  1FHE A;  2WUL A;  3WGD A;  3VI7 A;  5IO0 A;  2RM5 A;  3HVX A;  1ZYQ B;  2QSI A;  3RPP A;  2WCI A;  2DJ3 A;  4TW5 A;  5F06 A;  2YWI A;  2L5O A;  4GRF A;  3R2Q A;  3QR6 A;  5D9V A;  3L4N A;  4OFN A;  4EIQ A;  5FWG A;  4Z2T A;  3W8J A;  3LYP A;  3US3 A;  2G0F A;  2MMO A;  2L6D A;  5GZZ B;  1TK8 B;  2H1G A;  2JSZ A;  2RUE A;  2DKH A;  4MPF A;  4PQI A;  1BJX A;  3CMI A;  3ZFB A;  3ZVJ D;  4ECC A;  4J56 E;  1GL8 A;  4TKY A;  3RPN A;  3TRP A;  2TRC P;  3H79 A;  2LRT A;  4LL4 B;  3TRQ A;  1TRS A;  2VCX A;  4YQM A;  2GQL A;  1BQ7 A;  3H1N A;  2DML A;  1X0R A;  3A2V A;  4BL7 A;  1EEJ A;  2OKA A;  4N10 A;  1FB0 A;  3QMX A;  2PER A;  1PQN A;  2FWE A;  2OAC A;  3W8S A;  3IA1 A;  1Z6M A;  1YDK A;  4NV5 A;  1O85 A;  4TR1 B;  5ECP B;  1ILO A;  4L0W A;  4L8E A;  4CW9 A;  2YOI A;  2LV3 A;  4XRD A;  1SJZ A;  3GX0 A;  4E8E A;  3D5J A;  2YAN A;  2O87 A;  2B1L A;  5H5R A;  1X9M B;  5ELA A;  5KN2 A;  3EU3 A;  4KF9 A;  1ACV A;  2R0P A;  5CRH A;  3QFB C;  6GSU A;  3GKN A;  1K0M A;  5CYY A;  3MDK A;  2FY6 A;  1BG5 A;  4IVF A;  1GSS A;  3HCZ A;  2FHE A;  3S9F A;  4AGS A;  2KP2 A;  3M0F A;  4GF0 A;  4KGI A;  3TKQ A;  3N9J A;  4KE3 A;  3PH9 A;  3OR5 A;  2V1M A;  1BED A;  1QUW A;  1GSU A;  2DJ0 A;  3FZ9 A;  1R7H A;  2R2J A;  4FYB A;  2DKI A;  2FA8 A;  5ECR B;  3PR8 A;  1VF2 A;  2R37 A;  2N5B A;  1SK2 A;  1BAY A;  1Y25 A;  4NWY A;  1TJD A;  2A4H A;  3TGZ A;  3P90 A;  1PRX A;  5D96 A;  3JCM L;  1EOG A;  4K1F A;  1N8J A;  5B6N A;  4KDU A;  4IQA A;  4WEY A;  4IKH A;  4EF0 A;  4POB A;  3BBY A;  4PQ1 A;  1XW6 A;  1RQM A;  4MP4 A;  2DC5 A;  4XS6 A;  5HR0 A;  4KH7 A;  1ZZY A;  4KX4 A;  3EE2 A;  3QCP A;  4TN8 A;  2FA4 A;  4YKF A;  1LJR A;  2L57 A;  1R5P A;  2WB9 A;  2XPE A;  3ZML A;  3KXO A;  1ZYN A;  5GAP D;  3PIN A;  1OAZ A;  1TXX A;  2HSM A;  4YAV A;  2YPM A;  1ON4 A;  2L5L A;  3UAP A;  5ECL B;  1XPV A;  4K8M A;  10GS A;  5ID2 A;  2FCH A;  3H8Q A;  1O73 A;  2OAD A;  4N11 A;  5CO3 A;  2YZH A;  2V6O A;  1THO A;  2Z9S A;  3HZ4 A;  1IYI A;  5J5N A;  2YZU A;  4I2U A;  2F3M A;  4AF2 A;  2CVD A;  5BRT A;  1B4Q A;  1XIY A;  2FGX A;  3LW9 A;  3FZA A;  1S3A A;  5ECK B;  1G6W A;  3KM6 A;  3GKK A;  4K0N A;  2JU5 A;  1XXU A;  2DIZ A;  2DLX A;  4X1U A;  1USB A;  3D0Z A;  1F6M C;  4D73 A;  5C00 A;  4TR3 A;  4H86 A;  1K0D A;  3GX8 A;  5KN0 A;  3AY8 A;  3FYG A;  3C71 A;  1T8E B;  3QAV A;  5KN1 A;  2HZE A;  3ZVJ A;  4BVX B;  4NMU A;  2LKU A;  3F8U A;  5FHI A;  4AJ8 A;  4ZBD A;  5JCW A;  3GST A;  5F07 A;  1AW9 A;  4TXO A;  2PMT A;  3EMX A;  4ZIJ A;  4PXO A;  3TJG A;  4MNN A;  3RHB A;  2HRK A;  2EIR A;  2E2G A;  1UA5 A;  2B3S A;  1LU4 A;  3C8E A;  4FYU A;  3EYT A;  1GWC A;  2H72 A;  5ELG A;  3UBK A;  1WJK A;  5DJM A;  3WGX A;  4KND A;  1FVJ A;  1PA3 A;  2X4A A;  2HRA A;  3VWW A;  1JZD A;  3ERG A;  4Q5Q A;  4MPG A;  2CVB A;  3IK7 A;  1MDI A;  5A4W A;  3HY2 A;  3I9V 2;  3Q19 A;  3C73 A;  1FOV A;  1T1V A;  4V1A g;  3KGK A;  5B6M A;  4HI7 A;  1QXH A;  4HSC X;  4ZB9 A;  1LBK A;  1O7U A;  1Z6N A;  1G6Y A;  5LNK e;  3HVS A;  1T7P B;  3MSZ A;  3LSZ A;  3GH6 A;  1EP8 A;  3A3T A;  3TDG A;  1EGR A;  2VL2 A;  2LJK A;  4PTS A;  5J9C A;  3WT1 A;  3VLN A;  3DML A;  2PN8 A;  4IN0 A;  2HE3 A;  2A2S A;  4ZB6 A;  2HNL A;  5ENU A;  2R6K A;  4JE1 A;  3I6A A;  2HYX A;  3D4T A;  4EC0 A;  2IMI A;  3P7X A;  4N0V A;  1GSY A;  1XFL A;  5D9T A;  2VO4 A;  2CX4 A;  2K18 A;  2WGR A;  1T00 A;  3IV4 A;  4NV2 A;  4BWQ A;  3GUS A;  3LFL A;  2DJ2 A;  2P5R A;  1B9Y C;  1EEM A;  4KCA A;  1Z9H A;  2ON5 A;  3BCK A;  3K8N A;  1JZW A;  2JL4 A;  5J3R A;  2H30 A;  1ZYP A;  2VD1 A;  5ABR A;  3DD3 A;  4F03 A;  3UVT A;  1A23 A;  2FNO A;  1FW1 A;  2GS3 A;  2YWN A;  1NM3 A;  5J41 A;  1YEX A;  4WR4 A;  5LCZ A;  4X4J A;  5IO2 A;  5IMC A;  3RAZ A;  2O8V B;  1URM A;  3H4K A;  4CY6 A;  1YKC A;  1M3J A;  4HJ2 A;  3CRT A;  3L9S A;  2HRN A;  1XZO A;  2QC7 A;  3GYK A;  1KBN A;  4TOP A;  5J9B A;  2RUF A;  3GRX A;  4HQS A;  4GCI A;  2N5A A;  1S3R A;  2CAQ A;  1ZGN A;  12GS A;  1XWB A;  4BVY A;  2CX3 A;  1GSD A;  3M8N A;  2AV4 A;  4ID0 A;  2ZCT A;  4LMW A;  4XHM A;  3EVI A;  2R4V A;  2X8G A;  1U87 A;  3GFK A;  6GSX A;  1ZCP A;  2L4Q A;  3V1W A;  1RK4 A;  2B7J A;  2C0F A;  3M9J A;  4ICY A;  2IMF A;  4I8B A;  1K3L A;  5IMF A;  3C1R A;  6GSW A;  2GZP A;  1SKR B;  2GLR A;  5DAK B;  3GNJ A;  1GSQ A;  2JZS A;  2L4C A;  1XWC A;  1YZX A;  3WD6 A;  2PPT A;  1O6J A;  2V2G A;  1EV9 A;  3KD0 A;  3G9B A;  4ZL9 A;  4YAP A;  5EL8 A;  4K2D A;  3DGQ A;  19GS A;  4ZL8 A;  4DSR A;  2PVQ A;  4XS4 A;  1PL1 A;  3VWU A;  1M99 A;  5HFI A;  4IW9 A;  1QQ2 A;  4EUY A;  3HJO A;  4BWS A;  3FZ4 A;  3TOT A;  4WKW A;  4MF7 A;  3HDC A;  13GS A;  2ALB A;  2DSA A;  2FWF A;  1X5C A;  3TKS E;  2WS2 A;  4KB3 A;  4OCF A;  1OC9 B;  1B9X C;  5A4V A;  4I6X A;  4GWR A;  1Z7R A;  3F6D A;  3NZN A;  3UIW A;  2O7K A;  4XTS A;  4EXJ A;  1XVW A;  3IXR A;  4XCS A;  3HYP A;  2VD0 A;  4HDE A;  1GLQ A;  4KDY A;  4JBB A;  4EDZ A;  5IM9 A;  4IJ3 A;  4F0C A;  1XWA A;  5JWO B;  2IL3 A;  3CQF A;  3RBT A;  1U3A A;  2BMX A;  2MMA A;  1S3C A;  4Z2R A;  3APS A;  4LLR A;  4MLY A;  2C0G A;  3DWV A;  1YF0 A;  18GS A;  4E8H A;  1G7E A;  1H75 A;  1WOU A;  3UBL A;  4TRX A;  5B7C A;  1QFN A;  4NHZ A;  1DBY A;  4JR4 A;  3IHG A;  1PSQ A;  2LS5 A;  5B8A A;  1K0B A;  2GSQ A;  4MCU A;  4GXZ A;  4KAE A;  6GST A;  1GSF A;  4EE0 A;  4HZ2 A;  3MAK A;  2VL2 C;  1C72 A;  1G0T A;  3EUR A;  3GHA A;  4ZIL A;  2M46 A;  1GNE A;  5HR3 A;  2E7P A;  4ECJ A;  2FD3 A;  6GSV A;  3FR6 A;  4HOJ A;  2M80 A;  4GTU A;  4NPB A;  3ZTL A;  1ZMA A;  1J9B A;  4PUF C;  1XOA A;  3IPZ A;  4POK A;  3LEF A;  5IMD A;  3BJ5 A;  4WXT A;  1THX A;  2MYG A;  3GTU A;  1NSW A;  2TRX A;  4DEJ A;  3I43 A;  2P5Q A;  3HVV A;  1AQW A;  4XS1 A;  4OD7 A;  1HD2 A;  2OE0 A;  4Q5F A;  2C3T A;  1GTU A;  1TU7 A;  4I97 A;  5KEJ A;  4I2T A;  2KOK A;  5DCG A;  3GUR A;  4IHU A;  3PPU A;  2JSY A;  3SWL A;  2YP6 A;  4JED A;  4WF5 A;  3EU4 A;  3HHV A;  2CQ9 A;  2OJL A;  3LJR A;  1EZK A;  1EP7 A;  5B8B A;  1A8Y A;  3A2X A;  2OBI A;  2DJ1 A;  5ECM B;  4WBJ A;  4IEL A;  5H5S A;  2XBQ A;  4D73 B;  3HD5 A;  2P31 A;  3FHK A;  1FB6 A;  3W6G A;  4G0K A;  4OMV A;  4Z2U A;  1MDK A;  4IP1 A;  2NBS A;  1SKS B;  2PUK C;  2OE3 A;  2HZE B;  2VOC A;  4G10 A;  4LMV A;  4ULX A;  3LG6 A;  5HFK A;  3E0U A;  3LXT A;  2R0G A;  4TXO B;  5G1K A;  4K5R A;  3TKS A;  1IYH A;  3IRA A;  2CZ3 A;  4K9Z A;  1GSE A;  1W89 A;  3CSJ A;  1XW5 A;  1M7T A;  5ECO B;  3QOU A;  1PX7 A;  1ABA A;  2RM6 A;  4JU5 A;  2C3N A;  3CTF A;  2C0D A;  1YQ1 A;  1T3B A;  3FY7 A;  3LXZ A;  2A2P A;  4EVM A;  1OE8 A;  3EIN A;  2EIO A;  1OE7 A;  2LJR A;  5E59 A;  1GTI A;  4MZB A;  1SYR A;  1H4O A;  1A2J A;  1J08 A;  1M2D A;  2H75 A;  3HJP A;  4HUA A;  11GS A;  2LQQ A;  4GLT A;  3C7M A;  1PFO A;  4BIK A;  3KMN A;  4OO4 A;  3DEX A; 
#chains in the Genus database with same CATH homology
 1FOH A;  3FK8 A;  3HZ8 A;  2JAC A;  3QPM A;  1A0R P;  5D8I A;  3KP9 A;  1J0F A;  3VPQ A;  3EC3 A;  1WE0 A;  5COH A;  3A5I A;  4WF4 A;  4HEA 2;  5F0G A;  1EV4 A;  5F05 A;  2QA1 A;  1AQX A;  3CSH A;  4F9Z A;  4V1A p;  1K0A A;  4O5U A;  3D4M A;  3Q18 A;  4EKZ A;  4O5Q A;  5DQS A;  5EY6 A;  5HFG A;  1ERV A;  3IC8 A;  4FIW A;  4JRR A;  1SU9 A;  4ECB A;  2YV9 A;  1YKA A;  3HJM A;  3EWL A;  1FO5 A;  2LRN A;  4F2I A;  2H1D A;  2I3Y A;  2OBK A;  3O3T A;  2ZUP A;  1DUG A;  3F4S A;  3WYW A;  1O8X A;  4IQ1 A;  4GST A;  4WBR D;  2YV7 A;  1A2L A;  1SL2 B;  4O7H A;  1V58 A;  3TJF A;  1ERW A;  1FVK A;  2LEG A;  2VL9 A;  2H71 A;  3ZIJ A;  1X5D A;  2GTU A;  2XC2 A;  4K2X A;  2WFC A;  2TIR A;  2EC4 A;  1HNB A;  2DJJ A;  1KTE A;  1ST9 A;  2AJQ B;  1Z5Y E;  1KNG A;  5HR2 A;  2O85 A;  5CAX A;  1SJ6 A;  3DXB A;  3G7I A;  5G2Z A;  1Y6E A;  3QD9 A;  2WRT A;  2YCD A;  2IPA A;  4NHW A;  4OFM A;  3LYK A;  4ZBA A;  2IFQ B;  1X9W B;  2MMN A;  7GSS A;  4IBP A;  2NVL A;  4MJC A;  3F4T A;  1SYX A;  2GVP A;  4HS1 A;  3CXG A;  5AIS A;  1TK5 B;  4JR6 A;  1B4P A;  4K7N A;  3QAG A;  4FYC A;  3CTG A;  1Z7P A;  1U3I A;  2MZC A;  3KJY A;  3ZFL A;  5GST A;  3FMW A;  4A5P A;  5IPH A;  3Q6O A;  2NDO A;  2P0G A;  2C80 A;  3UEM A;  4TVE A;  1R4W A;  1MD3 A;  5FT3 A;  2V6K A;  1WP0 A;  4BVX A;  5D9W A;  1M0U A;  3RDW A;  2YN1 A;  5JCG A;  5DAL A;  3L9U A;  4PNG A;  2CA8 A;  4WR5 A;  5JWQ B;  4N30 A;  2AHE A;  4CHS A;  1WRY A;  4MZC A;  2WDU A;  2L59 A;  1CQH A;  3GKM A;  4LA1 A;  2H66 A;  5KN3 A;  3KP8 A;  3D6I A;  4XS4 B;  1VGL A;  1AUC A;  2H6Z A;  1A0F A;  2JAD A;  4Z7X A;  4PX1 A;  1QK8 A;  1VRS D;  3IE3 A;  1X9S B;  5G31 A;  4HJM A;  8GSS A;  3ZLP A;  1OVN A;  1JLW A;  4IJI A;  1UC7 A;  1XWG A;  1NHY A;  2AB6 A;  3TOU A;  3FKF A;  4TXV A;  3ISO A;  2VLU A;  1A2M A;  4HU7 A;  2GT5 A;  2X49 A;  2H6Y A;  2GQK A;  4ILF A;  2MMZ A;  2K8V A;  1MEK A;  3UJ1 A;  5IPG A;  2LUS A;  3TKS C;  3MNG A;  3J7Y k;  2GQM A;  5GSS A;  4MZW A;  2NPB A;  1VF1 A;  1PX6 A;  16GS A;  1GTB A;  2PWJ A;  3M1G A;  2H8L A;  1X5E A;  3VUR A;  2PGT A;  1GRX A;  2H76 A;  3IAM 2;  4KSM A;  4XRA A;  2CV4 A;  3ZZX A;  4ML1 A;  2IIY A;  3RHC A;  5IIZ A;  1F2E A;  4NAX A;  5F8B A;  3DVX A;  3KCM A;  3VFI A;  1I5G A;  3HKR A;  3UAR A;  2K6V A;  2X8H A;  3QDN A;  1YEP A;  5KOW A;  4KA0 A;  1TDI A;  2H1A A;  1M9B A;  1TOF A;  3UMA A;  1ERT A;  1MDJ A;  2PVO C;  3GV1 A;  6GSS A;  1AXD A;  5IQY A;  4K5S A;  14GS A;  4FQU A;  5G5F A;  2BTO T;  4CDO A;  1PN9 A;  4PNF A;  5HQP A;  3IK9 A;  3ME8 A;  1SD9 A;  3ZRE A;  1TW9 A;  4IP6 A;  1UN2 A;  4BL7 B;  1XBS A;  5H5Q A;  4MH2 A;  4PGT A;  1TRW A;  2MBT A;  4L5O A;  3VI5 A;  3GL3 A;  4BPY A;  1A24 A;  1TI1 A;  2F8F A;  2LTK A;  3CBU A;  3GIX A;  3TUE A;  3DIE A;  2OA7 A;  2J9H A;  3C1S A;  2F51 A;  1PKW A;  4MJE A;  4EL1 A;  1GUH A;  4MK3 A;  4N0Z A;  1VF4 A;  4G2E A;  2DIY A;  1O81 A;  3BOA A;  4DSS A;  1GNW A;  1Z3E A;  1DE2 A;  3CYN A;  1GUL A;  2H6X A;  3LWA A;  3IR4 A;  4TR0 A;  2MBS A;  3MYD A;  3EMP A;  4QL7 A;  2LQO A;  3TB2 A;  1B48 A;  3KEB A;  4K7O A;  3G7Y A;  2OE1 A;  5CNW A;  1V98 A;  1TKD B;  1G7O A;  1F9M A;  4J2F A;  5DAK A;  3KZQ A;  1XCC A;  5D9X A;  1V2A A;  1R26 A;  5IOX A;  4J57 E;  2FLS A;  4NXI A;  20GS A;  1K0N A;  4X43 A;  4RI7 A;  1SK0 A;  4G19 A;  1OC8 A;  3ZRD A;  2IWT A;  4YQU A;  3F3Q A;  3KH7 A;  2E0Q A;  3F3R A;  5D93 A;  2A4V A;  2ON7 A;  2GT6 A;  3VWV A;  2ZNM A;  2IMD A;  3KIJ A;  2IN3 A;  1BYE A;  3QFA C;  1TI3 A;  3HXS A;  3F9U A;  3EPT A;  2B5X A;  4GSN A;  1PL2 A;  5GAN D;  4HQZ A;  4WET A;  2GDR A;  3F6F A;  4MA9 A;  2KHP A;  2F8A A;  5ECS A;  2UZ8 A;  1OC9 A;  1M2A A;  2XHF A;  2G2Q A;  2IMK A;  2YJ7 A;  3DRN A;  3LGC A;  2GGT A;  2YWO A;  1ZL9 A;  1GUM A;  4MMM A;  5J4U A;  3N5O A;  2B6M A;  1JHB A;  9GSS A;  5G30 A;  1PKZ A;  2H0G A;  2QKE A;  3TKP A;  4POL A;  4L5L A;  5CRD A;  5ID2 B;  4OO5 A;  1EOH A;  4ZL7 A;  5A5K A;  3O6T A;  1HNA A;  3ME7 A;  3VK9 A;  4O5R A;  1T4Y A;  3LQ7 A;  1DSB A;  2GZZ A;  5ECH B;  17GS A;  2HLS A;  1XW9 A;  1WIK A;  5CRW A;  2R0C A;  4OFT A;  3FR9 A;  1E2Y A;  4USS A;  1O8W A;  3F0I A;  5G5E A;  2C3Q A;  2QGV A;  1W4V A;  3PGT A;  3ZIV A;  2V41 A;  3TRX A;  1AAZ A;  1ML6 A;  3IC4 A;  3TJJ A;  4IS0 A;  1UVZ A;  1PGT A;  2B7K A;  1XOB A;  2VUP A;  1K3Y A;  3L78 A;  1V40 A;  1M2B A;  2L6C A;  5DDL A;  4KCE A;  3I69 A;  4YQV A;  5AGY A;  2H19 A;  4K0G A;  3A5W A;  5DCH A;  1SL0 B;  2DBC A;  2VLT A;  4TR1 A;  5DVB A;  4MJB A;  5CP1 A;  2PBJ A;  1MTC A;  3E9J B;  4ISD A;  1ZYE A;  4EDY A;  3ZL5 A;  4IGJ A;  5ECQ B;  4ZB8 A;  4DSQ A;  4OWY A;  2NTO A;  5IMZ A;  3HA9 A;  1ZOF A;  2H0H A;  4AJ6 A;  3APO A;  3VPT A;  3ERF A;  3LOR A;  1SD8 A;  4MF6 A;  3MIX A;  2CZ2 A;  2LJA A;  2H73 A;  3H93 A;  3L0H A;  3CRU A;  1TTZ A;  4MH3 A;  1HNC A;  4F0B A;  2QA2 A;  4KSO A;  2GSR A;  4HU9 A;  2VM2 A;  1PMT A;  2N5F A;  1MD4 A;  5C04 A;  4RQR A;  1DE1 A;  4GQF A;  1HQO A;  4KW6 A;  3APQ A;  4G0I A;  2YJH A;  3ZMK A;  2X64 A;  2VCW A;  5JWR B;  5E4W A;  2C8U A;  2CT6 A;  2LST A;  5INY A;  1SK1 A;  2C1Y A;  2V32 A;  2DJK A;  4DVC A;  2HSH A;  3KTL A;  3BD2 A;  2LRC A;  1SEN A;  5EPF A;  3NIV A;  3FW2 A;  1GUK A;  3TJB A;  2HSY A;  1S3D A;  3IDV A;  1YY7 A;  5L71 A;  2I9H A;  2M72 A;  2KLX A;  1YF1 A;  4Q5R A;  1AQV A;  3R3E A;  3FZ5 A;  4P3Y B;  3VWX A;  5ECI B;  3UL3 A;  1BX9 A;  5DAL B;  1Q98 A;  3KH9 A;  2GST A;  2HZF A;  2RLI A;  2XBI A;  2HT9 A;  3E3E A;  2REM A;  1SJI A;  5BMU A;  3M9K A;  2VL3 A;  4KDX A;  4MJA A;  1F3A A;  3FR3 A;  2VCV A;  2X99 A;  1GTA A;  2B5E A;  2I4A A;  4PUA A;  3A2W A;  3U5R E;  2E2M A;  2JZR A;  1XWK A;  3GMF A;  1Q4J A;  4GQC A;  4YKG A;  2I1U A;  4PQH A;  3GSS A;  4I5Q A;  4JZQ A;  2YWM A;  5CRG A;  2LNS A;  5G1L A;  2C4J A;  4ZXG A;  3J7Y b;  5IMV A;  4V2N A;  3F4R A;  1AC1 A;  2J23 A;  3ZYW A;  4CY8 A;  2XPD A;  3O76 A;  3KTB A;  4BVY B;  3UOM A;  3GA4 A;  3ED3 A;  1K0O A;  5DQY A;  4TR4 A;  1OKT A;  5CRE A;  5KOX A;  3FRC A;  2H1B A;  2WJU A;  2KP1 A;  3P8W A;  4LL1 B;  2R3X A;  2H0I A;  1XVQ A;  4AJ7 A;  2PU9 C;  4K6X A;  3GL5 A;  4POM A;  1WPI A;  2RII A;  4HZ4 A;  1NW2 A;  2IME A;  4OCE A;  1KEB A;  4MAB A;  1OC3 A;  4O92 A;  4ZBB A;  4F82 A;  1RW1 A;  4ACS A;  3IHQ A;  5D73 A;  1VF3 A;  1TP9 A;  1V57 A;  3ERW A;  1T4Z A;  1GLP A;  2DMM A;  2FWH A;  4EIP A;  3UVH A;  2FUG 2;  2VCZ A;  1PD2 1;  4MF5 A;  1QMV A;  2AAW A;  2B5Y A;  4MDC A;  4EO3 A;  1TU8 A;  1EWX A;  3IAS 2;  3Q74 A;  4KUN A;  1E6B A;  4XIH A;  5EVO A;  4V2L A;  3D21 A;  5A4U A;  2ES7 A;  1I9D A;  3M3M A;  1HYU A;  2CVK A;  5DBQ A;  2H01 A;  1EGO A;  4YH2 A;  3D22 A;  3ZIT A;  1TK0 B;  5IOW A;  2VCQ A;  1AIU A;  1V9W A;  3NOF A;  4PUR A;  4RUV A;  3MWH A;  1OKD A;  2AUV A;  3GH9 A;  2YNX A;  2K9F A;  1PN0 A;  2IFQ A;  1SL1 B;  2D2Z A;  5AIX A;  3DKS A;  1U88 A;  1NHO A;  2VLV A;  2R5G A;  5DJL A;  3TJK A;  2CAI A;  2GSS A;  3L9V A;  1ERU A;  2FWG A;  1JLV A;  3SBC A;  3KMO A;  4FO5 A;  4DSS B;  2HRF A;  22GS A;  1OYJ A;  4G0L A;  2F9S A;  1SKW B;  2O89 A;  3GN3 A;  6GSY A;  4ML6 A;  3WGE A;  4FH8 A;  1M9A A;  2LNT A;  1A8L A;  1CQG A;  2HFD A;  3P2A A;  4ECI A;  4GSS A;  2HXK A;  4RI6 A;  1R5A A;  4V2M A;  5HR1 A;  3BCI A;  4QQ7 A;  2BJX A;  3CSI A;  1JZR A;  1FG4 A;  1U6T A;  3QAW A;  3GKX A;  2WZ9 A;  1YJ6 A;  2H74 A;  3DVW A;  3TCO A;  2JZT A;  4K7I A;  3U6V A;  1QGV A;  2VIM A;  3TKR A;  5ECN B;  2VCT A;  4G9H A;  2K8S A;  2B1K A;  1JZO A;  1F37 A;  5LD0 A;  5IMA A;  2H70 A;  2X8C A;  4X0X A;  2AYT A;  2EIQ A;  1WMJ A;  1K3O A;  1FAA A;  1TRV A;  2GZY A;  4QL9 A;  1GH2 A;  3FEU A;  3F63 A;  1F3B A;  2VM1 A;  1K0C A;  3GTU B;  3IOS A;  3WT2 A;  4RQX A;  1N2A A;  2IJY A;  1B8X A;  4O32 A;  5AN1 A;  2I81 A;  2KUC A;  4L0U A;  2A2R A;  2C0E A;  4BA7 A;  3IBH A;  1TRU A;  5AIV A;  2HI7 A;  1GP1 A;  2VAF A;  5JCU A;  1JFU A;  4Q5N A;  1WWJ A;  3G7J A;  3DYR A;  1FHE A;  2WUL A;  3WGD A;  3VI7 A;  5IO0 A;  2RM5 A;  3HVX A;  1ZYQ B;  2QSI A;  3RPP A;  2WCI A;  2DJ3 A;  4TW5 A;  5F06 A;  2YWI A;  2L5O A;  4GRF A;  3R2Q A;  3QR6 A;  5D9V A;  3L4N A;  4OFN A;  4EIQ A;  5FWG A;  4Z2T A;  3W8J A;  3LYP A;  3US3 A;  2G0F A;  2MMO A;  2L6D A;  5GZZ B;  1TK8 B;  2H1G A;  2JSZ A;  2RUE A;  2DKH A;  4MPF A;  4PQI A;  1BJX A;  3CMI A;  3ZFB A;  3ZVJ D;  4ECC A;  4J56 E;  1GL8 A;  4TKY A;  3RPN A;  3TRP A;  2TRC P;  3H79 A;  2LRT A;  4LL4 B;  3TRQ A;  1TRS A;  2VCX A;  4YQM A;  2GQL A;  1BQ7 A;  3H1N A;  2DML A;  1X0R A;  3A2V A;  4BL7 A;  1EEJ A;  2OKA A;  4N10 A;  1FB0 A;  3QMX A;  2PER A;  1PQN A;  2FWE A;  2OAC A;  3W8S A;  3IA1 A;  1Z6M A;  1YDK A;  4NV5 A;  1O85 A;  4TR1 B;  5ECP B;  1ILO A;  4L0W A;  4L8E A;  4CW9 A;  2YOI A;  2LV3 A;  4XRD A;  1SJZ A;  3GX0 A;  4E8E A;  3D5J A;  2YAN A;  2O87 A;  2B1L A;  5H5R A;  1X9M B;  5ELA A;  5KN2 A;  3EU3 A;  4KF9 A;  1ACV A;  2R0P A;  5CRH A;  3QFB C;  6GSU A;  3GKN A;  1K0M A;  5CYY A;  3MDK A;  2FY6 A;  1BG5 A;  4IVF A;  1GSS A;  3HCZ A;  2FHE A;  3S9F A;  4AGS A;  2KP2 A;  3M0F A;  4GF0 A;  4KGI A;  3TKQ A;  3N9J A;  4KE3 A;  3PH9 A;  3OR5 A;  2V1M A;  1BED A;  1QUW A;  1GSU A;  2DJ0 A;  3FZ9 A;  1R7H A;  2R2J A;  4FYB A;  2DKI A;  2FA8 A;  5ECR B;  3PR8 A;  1VF2 A;  2R37 A;  2N5B A;  1SK2 A;  1BAY A;  1Y25 A;  4NWY A;  1TJD A;  2A4H A;  3TGZ A;  3P90 A;  1PRX A;  5D96 A;  3JCM L;  1EOG A;  4K1F A;  1N8J A;  5B6N A;  4KDU A;  4IQA A;  4WEY A;  4IKH A;  4EF0 A;  4POB A;  3BBY A;  4PQ1 A;  1XW6 A;  1RQM A;  4MP4 A;  2DC5 A;  4XS6 A;  5HR0 A;  4KH7 A;  1ZZY A;  4KX4 A;  3EE2 A;  3QCP A;  4TN8 A;  2FA4 A;  4YKF A;  1LJR A;  2L57 A;  1R5P A;  2WB9 A;  2XPE A;  3ZML A;  3KXO A;  1ZYN A;  5GAP D;  3PIN A;  1OAZ A;  1TXX A;  2HSM A;  4YAV A;  2YPM A;  1ON4 A;  2L5L A;  3UAP A;  5ECL B;  1XPV A;  4K8M A;  10GS A;  5ID2 A;  2FCH A;  3H8Q A;  1O73 A;  2OAD A;  4N11 A;  5CO3 A;  2YZH A;  2V6O A;  1THO A;  2Z9S A;  3HZ4 A;  1IYI A;  5J5N A;  2YZU A;  4I2U A;  2F3M A;  4AF2 A;  2CVD A;  5BRT A;  1B4Q A;  1XIY A;  2FGX A;  3LW9 A;  3FZA A;  1S3A A;  5ECK B;  1G6W A;  3KM6 A;  3GKK A;  4K0N A;  2JU5 A;  1XXU A;  2DIZ A;  2DLX A;  4X1U A;  1USB A;  3D0Z A;  1F6M C;  4D73 A;  5C00 A;  4TR3 A;  4H86 A;  1K0D A;  3GX8 A;  5KN0 A;  3AY8 A;  3FYG A;  3C71 A;  1T8E B;  3QAV A;  5KN1 A;  2HZE A;  3ZVJ A;  4BVX B;  4NMU A;  2LKU A;  3F8U A;  5FHI A;  4AJ8 A;  4ZBD A;  5JCW A;  3GST A;  5F07 A;  1AW9 A;  4TXO A;  2PMT A;  3EMX A;  4ZIJ A;  4PXO A;  3TJG A;  4MNN A;  3RHB A;  2HRK A;  2EIR A;  2E2G A;  1UA5 A;  2B3S A;  1LU4 A;  3C8E A;  4FYU A;  3EYT A;  1GWC A;  2H72 A;  5ELG A;  3UBK A;  1WJK A;  5DJM A;  3WGX A;  4KND A;  1FVJ A;  1PA3 A;  2X4A A;  2HRA A;  3VWW A;  1JZD A;  3ERG A;  4Q5Q A;  4MPG A;  2CVB A;  3IK7 A;  1MDI A;  5A4W A;  3HY2 A;  3I9V 2;  3Q19 A;  3C73 A;  1FOV A;  1T1V A;  4V1A g;  3KGK A;  5B6M A;  4HI7 A;  1QXH A;  4ZB9 A;  1LBK A;  1O7U A;  1Z6N A;  1G6Y A;  5LNK e;  3HVS A;  1T7P B;  3MSZ A;  3LSZ A;  3GH6 A;  1EP8 A;  3A3T A;  3TDG A;  1EGR A;  2VL2 A;  2LJK A;  4PTS A;  5J9C A;  3WT1 A;  3VLN A;  3DML A;  2PN8 A;  4IN0 A;  2HE3 A;  2A2S A;  4ZB6 A;  2HNL A;  5ENU A;  2R6K A;  4JE1 A;  3I6A A;  2HYX A;  3D4T A;  4EC0 A;  2IMI A;  3P7X A;  4N0V A;  1GSY A;  1XFL A;  5D9T A;  2VO4 A;  2CX4 A;  2K18 A;  2WGR A;  1T00 A;  3IV4 A;  4NV2 A;  4BWQ A;  3GUS A;  3LFL A;  2DJ2 A;  2P5R A;  1B9Y C;  1EEM A;  4KCA A;  1Z9H A;  2ON5 A;  3BCK A;  3K8N A;  1JZW A;  2JL4 A;  5J3R A;  2H30 A;  1ZYP A;  2VD1 A;  5ABR A;  3DD3 A;  4F03 A;  3UVT A;  1A23 A;  2FNO A;  1FW1 A;  2GS3 A;  2YWN A;  1NM3 A;  5J41 A;  1YEX A;  4WR4 A;  5LCZ A;  4X4J A;  5IO2 A;  5IMC A;  3RAZ A;  2O8V B;  1URM A;  3H4K A;  4CY6 A;  1YKC A;  4HJ2 A;  3CRT A;  3L9S A;  2HRN A;  1XZO A;  2QC7 A;  3GYK A;  1KBN A;  4TOP A;  5J9B A;  2RUF A;  3GRX A;  4HQS A;  4GCI A;  2N5A A;  2CAQ A;  1ZGN A;  12GS A;  1XWB A;  4BVY A;  2CX3 A;  1GSD A;  3M8N A;  2AV4 A;  4ID0 A;  2ZCT A;  4LMW A;  4XHM A;  3EVI A;  2R4V A;  2X8G A;  1U87 A;  3GFK A;  6GSX A;  1ZCP A;  2L4Q A;  3V1W A;  1RK4 A;  2B7J A;  2C0F A;  3M9J A;  4ICY A;  2IMF A;  4I8B A;  1K3L A;  5IMF A;  3C1R A;  6GSW A;  2GZP A;  1SKR B;  2GLR A;  5DAK B;  3GNJ A;  1GSQ A;  2JZS A;  2L4C A;  1XWC A;  1YZX A;  3WD6 A;  2PPT A;  1O6J A;  2V2G A;  1EV9 A;  3KD0 A;  3G9B A;  4ZL9 A;  4YAP A;  5EL8 A;  4K2D A;  3DGQ A;  19GS A;  4ZL8 A;  4DSR A;  2PVQ A;  4XS4 A;  1PL1 A;  3VWU A;  1M99 A;  5HFI A;  4IW9 A;  1QQ2 A;  4EUY A;  3HJO A;  4BWS A;  3FZ4 A;  3TOT A;  4WKW A;  4MF7 A;  3HDC A;  13GS A;  2ALB A;  2DSA A;  2FWF A;  1X5C A;  3TKS E;  2WS2 A;  4KB3 A;  4OCF A;  1OC9 B;  1B9X C;  5A4V A;  4I6X A;  4GWR A;  1Z7R A;  3F6D A;  3NZN A;  3UIW A;  2O7K A;  4XTS A;  4EXJ A;  1XVW A;  3IXR A;  4XCS A;  3HYP A;  2VD0 A;  4HDE A;  1GLQ A;  4KDY A;  4JBB A;  4EDZ A;  5IM9 A;  4IJ3 A;  4F0C A;  1XWA A;  5JWO B;  2IL3 A;  3RBT A;  1U3A A;  2BMX A;  2MMA A;  1S3C A;  4Z2R A;  3APS A;  4LLR A;  4MLY A;  2C0G A;  3DWV A;  1YF0 A;  18GS A;  4E8H A;  1G7E A;  1H75 A;  1WOU A;  3UBL A;  4TRX A;  5B7C A;  1QFN A;  4NHZ A;  1DBY A;  4JR4 A;  3IHG A;  1PSQ A;  2LS5 A;  5B8A A;  1K0B A;  2GSQ A;  4MCU A;  4GXZ A;  4KAE A;  6GST A;  1GSF A;  4EE0 A;  4HZ2 A;  3MAK A;  2VL2 C;  1C72 A;  1G0T A;  3EUR A;  3GHA A;  4ZIL A;  2M46 A;  1GNE A;  5HR3 A;  2E7P A;  4ECJ A;  2FD3 A;  6GSV A;  3FR6 A;  4HOJ A;  2M80 A;  4GTU A;  4NPB A;  3ZTL A;  1ZMA A;  1J9B A;  4PUF C;  1XOA A;  3IPZ A;  4POK A;  3LEF A;  5IMD A;  3BJ5 A;  4WXT A;  1THX A;  2MYG A;  3GTU A;  1NSW A;  2TRX A;  4DEJ A;  3I43 A;  2P5Q A;  3HVV A;  1AQW A;  4XS1 A;  4OD7 A;  1HD2 A;  2OE0 A;  4Q5F A;  2C3T A;  1GTU A;  1TU7 A;  4I97 A;  5KEJ A;  4I2T A;  2KOK A;  5DCG A;  3GUR A;  4IHU A;  3PPU A;  2JSY A;  3SWL A;  2YP6 A;  4JED A;  4WF5 A;  3EU4 A;  3HHV A;  2CQ9 A;  2OJL A;  3LJR A;  1EZK A;  1EP7 A;  5B8B A;  1A8Y A;  3A2X A;  2OBI A;  2DJ1 A;  5ECM B;  4WBJ A;  4IEL A;  5H5S A;  2XBQ A;  4D73 B;  3HD5 A;  2P31 A;  3FHK A;  1FB6 A;  3W6G A;  4G0K A;  4OMV A;  4Z2U A;  1MDK A;  4IP1 A;  2NBS A;  1SKS B;  2PUK C;  2OE3 A;  2HZE B;  2VOC A;  4G10 A;  4LMV A;  4ULX A;  3LG6 A;  5HFK A;  3E0U A;  3LXT A;  2R0G A;  4TXO B;  5G1K A;  4K5R A;  3TKS A;  1IYH A;  3IRA A;  2CZ3 A;  4K9Z A;  1GSE A;  1W89 A;  3CSJ A;  1XW5 A;  1M7T A;  5ECO B;  3QOU A;  1PX7 A;  1ABA A;  2RM6 A;  4JU5 A;  2C3N A;  3CTF A;  2C0D A;  1YQ1 A;  1T3B A;  3FY7 A;  3LXZ A;  2A2P A;  4EVM A;  1OE8 A;  3EIN A;  2EIO A;  1OE7 A;  2LJR A;  5E59 A;  1GTI A;  4MZB A;  1SYR A;  1H4O A;  1A2J A;  1J08 A;  1M2D A;  2H75 A;  3HJP A;  4HUA A;  11GS A;  2LQQ A;  4GLT A;  3C7M A;  3KMN A;  4OO4 A;  3DEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...