2B3SA

Structure of the dsba mutant (p31g-c33a)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
187
structure length
187
Chain Sequence
QYEDGKQYTTLEKPVAGAPQVLEFFSFFCGHAYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein dsbA
publication title Structure of the DSBA mutant (P31G-C33A)
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 61
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2b3sA00
5IM9A 1OAZA 2JZTA 1RW1A 2HT9A 3P8WA 1EGRA 3IHQA 5DQYA 1O8WA 5ECKB 3SWLA 2H1AA 5HFGA 5INYA 2CZ3A 4D73A 4XIHA 1TOFA 3HVSA 1PQNA 4XHMA 1CQGA 4YH2A 4TR4A 2CVBA 4Q5RA 1SL1B 3UL3A 1X9MB 3F6DA 4AJ8A 5GZZB 3KJYA 1GSQA 5JCGA 3DD3A 4V2LA 2E2MA 4OO4A 2V1MA 2LTKA 5DCHA 4O5RA 3L9VA 4BA7A 2R5GA 4J2FA 2B5EA 1EP8A 2CA8A 4MZBA 3GKMA 3IXRA 3RHCA 1FVJA 4BWSA 2H6YA 3VWUA 2QGVA 2FY6A 1YJ6A 4MH3A 4ZB6A 4F0CA 2P5RA 1XWBA 6GSYA 5LCZA 1X5CA 4OMVA 3TKQA 2R6KA 2JU5A 4LMWA 2QC7A 4RI7A 1SD8A 2I3YA 2NBSA 5E59A 3P2AA 2H01A 4F9ZA 2KP2A 1V57A 3KM6A 1YF0A 2YJ7A 4XCSA 1XOAA 2YWOA 3M9KA 1XOBA 3MDKA 2L5LA 4K0GA 2B6MA 3HJPA 4X43A 1FHEA 3MNGA 4XS6A 3A2XA 1AXDA 5ID2B 1G0TA 4XTSA 5HR1A 4H86A 2E2GA 5C00A 4HI7A 1N2AA 4NMUA 3NZNA 3GX8A 1TI1A 5EL8A 1PKWA 2YV9A 5D9TA 1OVNA 3GX0A 2BTOT 5B8BA 5H5QA 2AUVA 4MF6A 1SJIA 3DMLA 1RK4A 2GSTA 3U6VA 3A2WA 3VK9A 2H30A 5ENUA 3TRXA 3TJKA 4LL1B 1G6WA 1TI3A 5ECSA 8GSSA 1EZKA 3EVIA 3E9JB 1XW5A 5HQPA 1TRUA 3TKSC 5IMFA 1USBA 1TK5B 1S3AA 1BAYA 2VL3A 1ERUA 1GLQA 1THXA 2PVQA 5IOXA 2DBCA 2RUEA 2LRNA 3GRXA 1ZGNA 1A0FA 3DXBA 2LUSA 3CTGA 6GSSA 1ZMAA 5ABRA 5B8AA 3HHVA 1E2YA 5D93A 2B7JA 1ZCPA 4PUFC 3H1NA 2DJKA 2F51A 3TJBA 4TR1A 3E0UA 1JZOA 1AW9A 4ECIA 2K6VA 1U88A 1GH2A 5FWGA 3QPMA 1M9BA 3FRCA 4XRAA 5GSTA 4EE0A 1UA5A 3UVHA 1QFNA 1ON4A 2I9HA 5B6MA 3GFKA 4K6XA 4NHWA 4ML6A 1JLVA 2DMLA 2F3MA 2IIYA 2MBSA 4NV2A 1W89A 2CX3A 1XFLA 1G7OA 4JU5A 2VCZA 3G9BA 1GSUA 5IPGA 5KN1A 3S9FA 3GKXA 1YDKA 2IWTA 3M1GA 5KN0A 3QFAC 1F3BA 4MZWA 4OFNA 4IS0A 2YJHA 3C1RA 2VM1A 1GSYA 1J0FA 4L5LA 3PINA 7GSSA 1JFUA 3N5OA 2R2JA 2B5XA 5HR2A 4MCUA 4JZQA 3A3TA 3IDVA 4WF5A 3ERGA 5D9VA 2CX4A 2KOKA 4ILFA 5D73A 3PR8A 1K0BA 2DSAA 3L0HA 2H75A 3KMOA 2YCDA 3ED3A 4OD7A 2J23A 3IE3A 3ISOA 4O32A 1PL1A 1C72A 5CRHA 3F4SA 4ECBA 3I9V2 2H76A 2JSZA 1TK0B 2PERA 2MBTA 1Z6NA 3HKRA 5DDLA 2HXKA 1ACVA 2FCHA 4WEYA 1ERTA 3TB2A 1M2AA 1AUCA 5L71A 2VCVA 1I9DA 4N11A 2O89A 1XWAA 1K3YA 1EWXA 2H0HA 1RQMA 3RDWA 2OE0A 4KE3A 2D2ZA 3FYGA 4KCAA 3EE2A 2GZZA 3DKSA 4IVFA 2EIOA 3HJOA 2IJYA 4HQSA 1YF1A 3LWAA 2YP6A 4YQUA 2A2RA 2PBJA 5J3RA 4MMMA 3IK7A 4WBJA 5DVBA 3EMPA 4FIWA 2YNXA 1O73A 4I8BA 2L5OA 1B4PA 2ON7A 1YEXA 1V2AA 1EOGA 2VD0A 1F9MA 3KXOA 5DAKB 5J9CA 4LL4B 2GGTA 1HNBA 2VL9A 3QD9A 2H0GA 2C3TA 2OADA 4KDYA 1T1VA 4I5QA 3C1SA 3FR9A 1SYXA 3C7MA 1PA3A 3M9JA 2M80A 2I4AA 1UVZA 1ZZYA 2IFQB 3F3RA 3GSSA 5H5SA 4K7OA 2C1YA 2HNLA 3IC4A 3GURA 2B5YA 4V2MA 4KGIA 2H6ZA 4I6XA 3ZL5A 4EDYA 4Q5FA 3RPNA 5LD0A 5G1KA 3VFIA 3LQ7A 1SK2A 3ZMLA 2GLRA 5DCGA 3RPPA 1J9BA 5AIVA 3DWVA 2YOIA 1MEKA 3HZ8A 3GN3A 1SENA 1T7PB 5ECIB 1DE2A 2HYXA 4KX4A 1YKAA 2VAFA 5JCUA 3CXGA 3KP9A 2O87A 1OKTA 2FHEA 1GTBA 4IKHA 2IMKA 4HZ2A 4HS1A 4KAEA 4POKA 4IP6A 3CMIA 2WFCA 3MSZA 1WP0A 5KEJA 4WKWA 5IMDA 3BJ5A 3F4RA 2X8CA 3Q6OA 1TRWA 5GSSA 3KH9A 1JLWA 4FYBA 1GL8A 2L4QA 3F8UA 2LQOA 4MA9A 4OFMA 19GSA 1GSFA 3CRUA 1ILOA 3AY8A 3CRTA 3SBCA 3D21A 1ERVA 1R26A 2FD3A 4DSSB 2QSIA 5ECLB 1VGLA 1NM3A 2YZUA 3TUEA 2HZEB 3WT1A 4KH7A 2VLVA 3VLNA 6GSXA 2N5BA 3OR5A 2K8VA 1B4QA 2IMFA 4F2IA 3UOMA 2HRFA 4X0XA 4KNDA 1EEJA 3I6AA 3M3MA 2IMIA 4MJAA 3O3TA 2P31A 1AAZA 1ZYEA 2GSSA 2FGXA 4PX1A 2GQLA 2LV3A 4PQ1A 4TXVA 5IOWA 4ECCA 1FG4A 2M72A 2WRTA 3PH9A 5ECOB 2PGTA 4L0UA 2FWEA 3P7XA 2PU9C 4GRFA 4PNFA 3IAM2 1B8XA 4MK3A 2FLSA 4JEDA 1SU9A 2A2SA 4ZL9A 4KA0A 5HR0A 2CAIA 1K3LA 6GSUA 3TKPA 5COHA 4PUAA 5DALB 1XIYA 1FB0A 4GXZA 5CNWA 3FKFA 2OACA 3TKRA 1SL2B 3LYPA 4HQZA 1H4OA 3DEXA 4MDCA 1KTEA 3VWXA 2GZPA 3P90A 4BPYA 3Q18A 4YAVA 2GZYA 3DIEA 4CW9A 4JBBA 1HNAA 1TTZA 1U3AA 4IBPA 1ZL9A 1TXXA 4ZBBA 1A2LA 2OBKA 3GYKA 2I81A 1CQHA 5J9BA 2WCIA 2X8GA 2X8HA 5J41A 1MD3A 4ML1A 2DJ2A 2IMEA 2MMAA 2VD1A 3IOSA 3ZLPA 4PXOA 1XWCA 3EYTA 1TP9A 1GULA 4EKZA 2HI7A 3TOUA 4ULXA 1N8JA 3LFLA 4EUYA 2F8AA 1W4VA 4DSRA 2AJQB 5C04A 1BQ7A 2HRNA 3KCMA 5F05A 1SKRB 3LGCA 5HR3A 1K3OA 2DJ0A 5JWRB 3TKSE 4ECJA 4EXJA 1QK8A 1SKWB 1B48A 1THOA 4KSOA 2K9FA 5EVOA 1GSDA 1XCCA 3ZVJD 1XPVA 5B7CA 1XBSA 4TR1B 1B9YC 2VCTA 4TXOA 2NVLA 1YY7A 1FW1A 5D96A 2VL2C 2YWIA 2FNOA 5F07A 4N30A 2JZRA 1BX9A 3C8EA 2LRCA 4ZB8A 3TRQA 3IV4A 1B9XC 4F82A 1DUGA 3FK8A 2H8LA 3KH7A 3PGTA 3LSZA 2XBIA 3ME7A 3KTBA 2CVKA 2MYGA 1R4WA 1T4YA 2V41A 4PQHA 3FZ5A 2IN3A 3W8SA 2LS5A 2DLXA 4OO5A 3H79A 2WB9A 3UVTA 3IRAA 4QL9A 3GNJA 4K2DA 3WGXA 1TJDA 3J7Yb 1EV4A 4JR4A 4J57E 5ELGA 1NHOA 1WJKA 3FZ4A 12GSA 1TRVA 4MPGA 2JL4A 4KB3A 3VURA 1IYHA 4HUAA 4ZB9A 1UC7A 3IBHA 3HY2A 3ERWA 3L78A 1GWCA 4E8HA 5IO0A 5DJMA 4OWYA 2VOCA 1O8XA 20GSA 2C8UA 4RUVA 2ALBA 1EOHA 1XW9A 1SJZA 4PGTA 4GF0A 2HE3A 1M7TA 5FHIA 3E3EA 1U3IA 2ZNMA 1X5EA 2DJ1A 3GSTA 2JSYA 4V1Ap 2IMDA 2GT5A 3V1WA 2X99A 2GQMA 4ZBDA 5J4UA 1A23A 5ELAA 2L59A 4E8EA 2L57A 4YAPA 2LNTA 1NHYA 3ZZXA 3BCIA 3TKSA 5AIXA 1YEPA 5CRDA 2F9SA 5A4UA 4POLA 4JRRA 4XS1A 1AQXA 1EV9A 3TJJA 2KHPA 4GSNA 2IPAA 4HU9A 5CO3A 5EY6A 4F0BA 4O92A 2YANA 3UIWA 4AGSA 3TGZA 5FT3A 1AQWA 1YZXA 3L9SA 2C3QA 3TJGA 4L0WA 4P3YB 1OYJA 2Z9SA 3LJRA 1PGTA 2LNSA 1M2DA 1A8LA 1IYIA 5A4VA 1F6MC 3APQA 3U5RE 1R5PA 1OE7A 1VRSD 2HZFA 1GSEA 5D8IA 2V6KA 4TKYA 1O7UA 2C0EA 4JR6A 2LQQA 1K0DA 4WBRD 3RHBA 2MMNA 3G7IA 2R37A 3IK9A 2H72A 2JZSA 1MDJA 3GH6A 2ON5A 1JHBA 2H6XA 3F6FA 4TOPA 3GUSA 2L6DA 2VLUA 4KDXA 3NIVA 3ZTLA 3DYRA 3FR3A 3QCPA 11GSA 1ERWA 2DJJA 4AF2A 1PX6A 1PD21 5IIZA 2H1DA 10GSA 4FH8A 2C80A 4V2NA 5G30A 4KUNA 1Y25A 3UMAA 3WT2A 1XVQA 4TVEA 2O85A 4NHZA 1A8YA 1X5DA 3GL5A 2R3XA 1G6YA 2YWNA 4XS4A 4GQFA 2REMA 4GCIA 3HA9A 1EP7A 2AV4A 3HYPA 1HYUA 1MD4A 3ZFBA 1URMA 2KUCA 3APOA 1K0AA 2H71A 1BJXA 1EEMA 4HU7A 1SD9A 1Q98A 4IJ3A 1ML6A 3LXTA 3FR6A 4X1UA 6GSVA 5H5RA 1MTCA 3US3A 5JWQB 3UBKA 1GLPA 1A2JA 3JCML 17GSA 3K8NA 4WETA 1SKSB 3IR4A 2QKEA 2BJXA 2CAQA 3G7YA 1E6BA 9GSSA 1SK1A 4MF5A 3GIXA 2N5FA 1T4ZA 4JE1A 2XC2A 3HD5A 2LJRA 1TU7A 3GTUB 1OC9B 4ZIJA 1AIUA 3QAVA 2XPDA 3BOAA 5AN1A 3APSA 4EO3A 1TRSA 4AJ7A 3L4NA 2CV4A 2K8SA 5DAKA 2YPMA 1PSQA 4LA1A 1LJRA 4IELA 4EC0A 3HCZA 3MAKA 4TR0A 1GTAA 3M0FA 1XW6A 2EC4A 2EIQA 1R5AA 3VWWA 3LG6A 4I97A 13GSA 3LXZA 5G2ZA 5CRGA 3KTLA 3F3QA 2G0FA 1FVKA 2IFQA 3DGQA 2GS3A 4N0ZA 1AC1A 5GAPD 1DSBA 3QMXA 4D73B 1WMJA 3CSIA 3UARA 2LRTA 3EURA 4EDZA 1JZRA 4WF4A 3L9UA 2H66A 4DSQA 4ZBAA 2RM5A 5AISA 1FO5A 1QXHA 2XBQA 3ZITA 1XWGA 3GA4A 1VF4A 2OKAA 5JCWA 2DIYA 3WGEA 4GTUA 3WYWA 2YWMA 5G5FA 1YQ1A 2DMMA 2H73A 4YQMA 1LBKA 3VPTA 1EGOA 3QAGA 4IHUA 2AB6A 4HZ4A 3GHAA 5G1LA 3D0ZA 1U87A 1WRYA 5A5KA 1OE8A 2H1GA 2FA4A 5CREA 5IO2A 4Q5NA 1PN9A 3CTFA 6GSWA 4K7IA 5KN3A 1BEDA 1GSSA 1HQOA 2C4JA 2BMXA 5GAND 2VLTA 4V1Ag 3GKNA 1SL0B 5KN2A 3KIJA 1T8EB 2GSQA 1WPIA 3HXSA 3I43A 4OCFA 4QQ7A 2CZ2A 2B3SA 3CSHA 2CQ9A 1OC3A 4ZILA 1M0UA 4DSSA 2K18A 4G10A 5CYYA 3EINA 2HZEA 1V98A 3GV1A 2ZCTA 4TXOB 4GLTA 1M99A 4FYCA 2LKUA 2FUG2 1SK0A 2VM2A 2FWGA 3VI7A 1HNCA 2AAWA 3UBLA 2P0GA 3O76A 3W6GA 4HOJA 5AGYA 5CAXA 2V2GA 2KLXA 1QGVA 1XWKA 4MJCA 4ISDA 2WJUA 4YQVA 3D4TA 4OFTA 1AQVA 2ES7A 2GVPA 2PN8A 4HJ2A 2HFDA 3KEBA 3HDCA 4FYUA 2RIIA 4AJ6A 1K0OA 1QQ2A 4DVCA 4L8EA 5ECPB 2VO4A 2PVOC 2A4VA 4FO5A 2E0QA 3EU3A 4K8MA 3DVXA 1VF3A 3MWHA 1S3DA 2XHFA 2NDOA 3KGKA 4HDEA 1FB6A 5DALA 4WR4A 4MJBA 3ZMKA 1OC8A 5ECQB 2TRXA 2VIMA 5ECRB 1KBNA 4ZL7A 2FWHA 3BBYA 3IAS2 2JACA 3KD0A 4L5OA 1PKZA 4BL7A 2LJAA 1PRXA 3CSJA 3QOUA 1Z9HA 2OJLA 1XVWA 4I2UA 1A0RP 3HVVA 4NAXA 2L6CA 4Q5QA 3Q74A 3GH9A 3FY7A 2B1KA 3TDGA 4LLRA 2P5QA 4O7HA 3W8JA 4N10A 1A24A 3H93A 2PUKC 4IN0A 4IW9A 4K9ZA 1GUKA 5B6NA 1DBYA 4EL1A 1ZYQB 3A2VA 2C0DA 4EF0A 1G7EA 4J56E 1MDIA 5JWOB 3WD6A 3FZ9A 2OA7A 1GUMA 3VPQA 14GSA 1K0NA 18GSA 2C0FA 5F0GA 1VF2A 5ID2A 4IP1A 3ZIVA 3LORA 1S3CA 2DJ3A 3RAZA 3C73A 1PX7A 1ZOFA 1NW2A 4HJMA 1WE0A 2GDRA 3ZREA 4KCEA 3ZVJA 1Q4JA 2YZHA 4MF7A 2F8FA 2DC5A 2J9HA 1A2MA 2HSHA 1PL2A 5IQYA 3QFBC 3A5WA 2VCXA 4F03A 4NPBA 2RLIA 5LNKe 2VL2A 2GSRA 1JZWA 3G7JA 2AHEA 1TK8B 5HFIA 1XZOA 4ACSA 3FEUA 3BD2A 1O81A 3LEFA 5F06A 1X9SB 1GNEA 4TN8A 2O7KA 2HSYA 5D9WA 3VI5A 4MH2A 4GWRA 4PQIA 1JZDA 1K0CA 3LYKA 1X0RA 2B1LA 4GSSA 1M2BA 1DE1A 2V32A 3FHKA 4BVYA 1BYEA 5J5NA 2CT6A 2PWJA 3QAWA 2C3NA 5DQSA 3C71A 4ZL8A 3ZRDA 2E7PA 5D9XA 2N5AA 5CP1A 2OBIA 2NTOA 4KDUA 2FA8A 2JADA 3D6IA 3N9JA 2CVDA 4BVXA 1GTIA 3F4TA 2RM6A 1V40A 1F3AA 3HJMA 4XS4B 2GT6A 1GUHA 3D5JA 1XXUA 5F8BA 4HEA2 1V9WA 4POBA 2GQKA 1R7HA 1VF1A 2MMOA 3Q19A 3KZQA 2C0GA 4TRXA 1NSWA 3GL3A 1M9AA 5IMVA 5A4WA 4CHSA 1GP1A 5ECHB 4PNGA 2WS2A 4EVMA 3I69A 4N0VA 4MJEA 2PMTA 2WULA 1KEBA 3ME8A 4G19A 4WR5A 4GSTA 1V58A 1WIKA 4RI6A 4ZXGA 3KMNA 1GNWA 1OKDA 2G2QA 2YV7A 2XPEA 2MZCA 4IQ1A 1SJ6A 5HFKA 3WGDA 1QUWA 3TJFA 3BCKA 4MPFA 3IPZA 5IMAA 3HVXA 1KNGA 2KP1A 3D22A 2X64A 3R2QA 4IQAA 4XRDA 2B7KA 1T00A 2WGRA 4PURA 3ZYWA 3EC3A 3RBTA 3EMXA 4K1FA 22GSA 1QMVA 1YKCA 1Z5YE 3TOTA 4DEJA 2I1UA 4BWQA 1J08A 2EIRA 1K0MA 4NV5A 2AYTA 2PPTA 1PMTA 1U6TA 2VCQA 2GTUA 5CRWA 3D4MA 3TCOA 2OE1A 4I2TA 4G2EA 1Y6EA 4K7NA 2ZUPA 4WXTA 4NWYA 1HD2A 1Z7PA 4QL7A 2H19A 3UEMA 4NXIA 2H70A 2RUFA 1T3BA 16GSA 2LSTA 3UAPA 4KW6A 2V6OA 2LJKA 3J7Yk 2H0IA 3GKKA 3EU4A 1ST9A 2M46A 4LMVA 5E4WA 1WOUA 2H1BA 1TW9A 4MP4A 1X9WB 4CDOA 2TIRA 1Z3EA 4TW5A 5ECNB 4IJIA 5DJLA 5IMCA 4K0NA 1GRXA 4TR3A 4Z7XA 3NOFA 1O6JA 5EPFA 1GTUA 2TRCP 3H8QA 2OE3A 3HZ4A 1F2EA 2O8VB 6GSTA 1F37A 3QDNA 2VCWA 3ERFA 3F63A 2NPBA 2H74A 4POMA 3M8NA 4ID0A 4GQCA 2MMZA 1FAAA 1O85A 1Z7RA 4G9HA 3IA1A 4IGJA 3TRPA 4OCEA 2DIZA 2YN1A 1Z6MA 4RQXA 5IMZA 5G5EA 2FWFA 3VWVA 4MLYA 5DBQA 1TKDB 3CYNA 3ZFLA 2HLSA 3QR6A 1FOVA 1TU8A 3F0IA 3DRNA 3KP8A 3H4KA 2IL3A 4KSMA 3FZAA 5IPHA 3DVWA 1H75A 3GTUA 1OC9A 2WDUA 1LU4A 4RQRA 2WZ9A 3ZIJA 3EWLA 1BG5A 1UN2A 1MDKA 2L4CA 2LEGA 1SYRA 2R4VA 3CBUA 1I5GA 3O6TA 3FW2A 5G31A 5ECMB 2VUPA 3GMFA 3UJ1A 4MZCA 3F9UA 1TDIA 4MABA 1ABAA 1WWJA
chains in the Genus database with same CATH superfamily
5IM9A 1OAZA 2JZTA 1RW1A 2HT9A 3P8WA 1EGRA 3IHQA 5DQYA 1O8WA 5ECKB 3SWLA 2H1AA 5HFGA 5INYA 2CZ3A 4D73A 4XIHA 1TOFA 3HVSA 1PQNA 4XHMA 1CQGA 4YH2A 4TR4A 2CVBA 4Q5RA 1SL1B 3UL3A 1X9MB 3F6DA 4AJ8A 5GZZB 3KJYA 1GSQA 5JCGA 3DD3A 4V2LA 2E2MA 4OO4A 2V1MA 2LTKA 2QA1A 5DCHA 4O5RA 3L9VA 4BA7A 2R5GA 4J2FA 2B5EA 1EP8A 2CA8A 4MZBA 3GKMA 3IXRA 3RHCA 1FVJA 4BWSA 2H6YA 3VWUA 2QGVA 2FY6A 1YJ6A 4MH3A 4ZB6A 4F0CA 2P5RA 1XWBA 6GSYA 5LCZA 1X5CA 4OMVA 3TKQA 2R6KA 2JU5A 4LMWA 2QC7A 4RI7A 1SD8A 2I3YA 2NBSA 5E59A 3P2AA 2H01A 4F9ZA 2KP2A 1V57A 3KM6A 5KOXA 1YF0A 2YJ7A 4XCSA 1XOAA 3EPTA 2YWOA 3M9KA 4G0KA 1XOBA 3MDKA 2L5LA 4K0GA 2B6MA 3HJPA 4X43A 1FHEA 3MNGA 4XS6A 3A2XA 1AXDA 5ID2B 1G0TA 4XTSA 5HR1A 4H86A 2E2GA 5C00A 4HI7A 1N2AA 4NMUA 3NZNA 3GX8A 1TI1A 5EL8A 1PKWA 4K2XA 2YV9A 5D9TA 4Z2TA 1OVNA 3GX0A 2BTOT 5B8BA 5H5QA 2AUVA 4MF6A 1SJIA 1PN0A 3DMLA 1RK4A 2GSTA 3U6VA 3A2WA 3VK9A 2H30A 5ENUA 3TRXA 3TJKA 4LL1B 1G6WA 1TI3A 5ECSA 8GSSA 4ICYA 1EZKA 3EVIA 3E9JB 1XW5A 5HQPA 1TRUA 3TKSC 5IMFA 1USBA 1TK5B 1S3AA 1BAYA 2VL3A 1ERUA 1GLQA 1THXA 2PVQA 5IOXA 2DBCA 2RUEA 2LRNA 3GRXA 1ZGNA 1A0FA 3DXBA 2LUSA 3CTGA 6GSSA 1ZMAA 5ABRA 5B8AA 3HHVA 1E2YA 5D93A 2B7JA 4K5RA 1ZCPA 4PUFC 3H1NA 2DJKA 2F51A 3TJBA 4TR1A 3E0UA 1JZOA 1AW9A 4PTSA 4ECIA 2K6VA 1U88A 1GH2A 5FWGA 3QPMA 1M9BA 3FRCA 4XRAA 5GSTA 4EE0A 4BVXB 1UA5A 3UVHA 1QFNA 1ON4A 2I9HA 5B6MA 3GFKA 4K6XA 4NHWA 4ML6A 1JLVA 2DMLA 2F3MA 2IIYA 2MBSA 4NV2A 1W89A 2CX3A 1XFLA 1G7OA 4JU5A 2VCZA 3G9BA 1GSUA 5IPGA 5KN1A 3S9FA 3GKXA 1YDKA 1ZYNA 2IWTA 3M1GA 5KN0A 3QFAC 1F3BA 4MZWA 4OFNA 4IS0A 2YJHA 3C1RA 2VM1A 1GSYA 2X49A 1J0FA 4L5LA 3PINA 7GSSA 1JFUA 3N5OA 2R2JA 2B5XA 5HR2A 4MCUA 4JZQA 3A3TA 3IDVA 4WF5A 3ERGA 5D9VA 4Z2RA 2CX4A 2KOKA 4ILFA 5D73A 3PR8A 1K0BA 2DSAA 3L0HA 2H75A 3KMOA 2YCDA 3ED3A 4OD7A 2J23A 3IE3A 3ISOA 4O32A 1PL1A 1C72A 5CRHA 3F4SA 4ECBA 3I9V2 2H76A 2JSZA 1TK0B 2PERA 2MBTA 1Z6NA 3HKRA 5DDLA 2HXKA 1ACVA 2FCHA 4WEYA 1ERTA 3TB2A 1M2AA 1AUCA 5L71A 4USSA 2VCVA 1I9DA 4N11A 2O89A 1XWAA 1K3YA 1EWXA 2H0HA 1RQMA 3RDWA 2OE0A 4KE3A 2D2ZA 3FYGA 4KCAA 3EE2A 4G0LA 2GZZA 3DKSA 4IVFA 4O5QA 2EIOA 3HJOA 2IJYA 4HQSA 1YF1A 3LWAA 2YP6A 4YQUA 2A2RA 2PBJA 5J3RA 4MMMA 3IK7A 4WBJA 5DVBA 3EMPA 4FIWA 2YNXA 1O73A 4I8BA 4EIPA 2L5OA 1B4PA 2ON7A 1YEXA 1V2AA 1EOGA 2VD0A 1F9MA 3KXOA 5DAKB 5J9CA 4LL4B 2GGTA 1HNBA 2VL9A 3QD9A 2H0GA 2C3TA 2OADA 4KDYA 1T1VA 4I5QA 3C1SA 3FR9A 1SYXA 2A4HA 3C7MA 1PA3A 3M9JA 2M80A 2I4AA 1UVZA 1ZZYA 2IFQB 3F3RA 3GSSA 5H5SA 4K7OA 1PFOA 2C1YA 2HNLA 3IC4A 3GURA 2B5YA 4V2MA 4KGIA 2H6ZA 4I6XA 3ZL5A 4EDYA 4Q5FA 3RPNA 5LD0A 5G1KA 3VFIA 3LQ7A 1SK2A 3ZMLA 2GLRA 5DCGA 4YKGA 3RPPA 1J9BA 5AIVA 3DWVA 2YOIA 1MEKA 3HZ8A 3GN3A 1SENA 1T7PB 5ECIB 1DE2A 2HYXA 4KX4A 1YKAA 2VAFA 5JCUA 3CXGA 3KP9A 2O87A 1OKTA 2FHEA 1GTBA 2HRAA 4IKHA 2IMKA 4HZ2A 4HS1A 4X4JA 4KAEA 4POKA 4IP6A 3CMIA 2WFCA 3MSZA 1WP0A 5KEJA 4WKWA 5IMDA 3BJ5A 3F4RA 2X8CA 3Q6OA 1TRWA 5GSSA 3KH9A 1JLWA 4FYBA 1GL8A 2L4QA 3F8UA 2LQOA 4MA9A 4OFMA 19GSA 1GSFA 3CRUA 1ILOA 3AY8A 3CRTA 3SBCA 3D21A 1ERVA 1R26A 2FD3A 1XG8A 4DSSB 2QSIA 5ECLB 1VGLA 1NM3A 2YZUA 3TUEA 2HZEB 3WT1A 4KH7A 2VLVA 3VLNA 6GSXA 2N5BA 3OR5A 2K8VA 1B4QA 2IMFA 4F2IA 3UOMA 2HRFA 4X0XA 4KNDA 1EEJA 3I6AA 3M3MA 2IMIA 4MJAA 3O3TA 2P31A 1AAZA 1ZYEA 2GSSA 2FGXA 4PX1A 2GQLA 2LV3A 4BIKA 4PQ1A 4TXVA 5IOWA 4ECCA 1FG4A 2M72A 2WRTA 3PH9A 5ECOB 2PGTA 4L0UA 2FWEA 3P7XA 4Z2UA 2PU9C 4GRFA 4PNFA 3IAM2 1B8XA 4MK3A 2FLSA 4JEDA 1SU9A 2A2SA 4ZL9A 4KA0A 5HR0A 2CAIA 1K3LA 6GSUA 3TKPA 5COHA 4PUAA 5DALB 1XIYA 4CY6A 1FB0A 4GXZA 5CNWA 3FKFA 2OACA 3TKRA 1SL2B 3LYPA 4HQZA 3HVNA 1H4OA 3DEXA 4MDCA 1KTEA 3VWXA 2GZPA 3P90A 4BPYA 3Q18A 4BL7B 4YAVA 2GZYA 3DIEA 4CW9A 4JBBA 1HNAA 5BMUA 1TTZA 1U3AA 4IBPA 1ZL9A 1TXXA 4ZBBA 1A2LA 2OBKA 3GYKA 2I81A 1CQHA 5J9BA 2WCIA 2X8GA 2X8HA 5J41A 1MD3A 4ML1A 2DJ2A 2IMEA 2MMAA 2VD1A 3IOSA 3ZLPA 4O5UA 4PXOA 1XWCA 3EYTA 1TP9A 1GULA 4EKZA 2HI7A 4G0IA 3TOUA 4ULXA 1N8JA 3LFLA 2A2PA 4EUYA 2F8AA 1W4VA 4DSRA 2AJQB 5C04A 1BQ7A 2HRNA 3KCMA 3MIXA 5F05A 1SKRB 3LGCA 5HR3A 1K3OA 2DJ0A 5JWRB 3TKSE 4ECJA 4EXJA 2DKIA 1QK8A 1SKWB 1B48A 1THOA 4KSOA 2K9FA 5EVOA 1GSDA 1XCCA 3ZVJD 1XPVA 5B7CA 1XBSA 4TR1B 1B9YC 2VCTA 4TXOA 2NVLA 1YY7A 1FW1A 5D96A 2VL2C 2YWIA 2FNOA 5F07A 4N30A 2JZRA 1BX9A 3C8EA 2LRCA 4ZB8A 3TRQA 3IV4A 1B9XC 4F82A 1DUGA 3FK8A 2H8LA 3KH7A 3PGTA 3LSZA 2XBIA 3ME7A 3KTBA 2CVKA 2MYGA 1R4WA 1T4YA 2V41A 4PQHA 1M3JA 3FZ5A 2IN3A 3W8SA 2LS5A 2DLXA 4OO5A 3H79A 2WB9A 3UVTA 3IRAA 4BVYB 4QL9A 3GNJA 4K2DA 3WGXA 1TJDA 3J7Yb 1EV4A 4JR4A 4J57E 1NHOA 3FZ4A 1WJKA 5ELGA 5KOWA 12GSA 1TRVA 4MPGA 2JL4A 4KB3A 3VURA 1IYHA 3R3EA 4HUAA 4ZB9A 1UC7A 3IBHA 3HY2A 3ERWA 3L78A 1GWCA 4E8HA 5IO0A 5DJMA 4OWYA 2VOCA 1O8XA 20GSA 2C8UA 4MNNA 4RUVA 2ALBA 1EOHA 1XW9A 1SJZA 4PGTA 4GF0A 2HE3A 1M7TA 3CQFA 5FHIA 3E3EA 1U3IA 2ZNMA 1X5EA 2DJ1A 3GSTA 2QA2A 2JSYA 4V1Ap 2IMDA 2GT5A 3V1WA 2X99A 2GQMA 4ZBDA 5J4UA 1A23A 5ELAA 2L59A 4E8EA 2L57A 4YAPA 2LNTA 1NHYA 3ZZXA 3BCIA 3TKSA 5AIXA 1YEPA 5CRDA 2F9SA 1M3IA 5A4UA 4POLA 4JRRA 4XS1A 1AQXA 1EV9A 3TJJA 2KHPA 4GSNA 2IPAA 4HU9A 5CO3A 5EY6A 4F0BA 4O92A 2YANA 3UIWA 4AGSA 3TGZA 5FT3A 1AQWA 1YZXA 3L9SA 2C3QA 3TJGA 4L0WA 4P3YB 1OYJA 2Z9SA 3LJRA 1PGTA 2LNSA 1M2DA 1A8LA 1IYIA 5A4VA 1F6MC 3APQA 3U5RE 1R5PA 1OE7A 1VRSD 2HZFA 1GSEA 5D8IA 2V6KA 4TKYA 1O7UA 2C0EA 4JR6A 2LQQA 1K0DA 4WBRD 3RHBA 2MMNA 3G7IA 2R37A 3IK9A 2H72A 2JZSA 1MDJA 3GH6A 2ON5A 1JHBA 2H6XA 3F6FA 4TOPA 3GUSA 2L6DA 2VLUA 4KDXA 3NIVA 3ZTLA 3DYRA 3FR3A 3QCPA 11GSA 1ERWA 2DJJA 4AF2A 1PX6A 1PD21 5IIZA 2H1DA 10GSA 4FH8A 2C80A 4V2NA 5G30A 4KUNA 1Y25A 3UMAA 3WT2A 1XVQA 4TVEA 2O85A 4NHZA 1A8YA 1X5DA 3GL5A 2R3XA 1G6YA 2YWNA 4XS4A 4GQFA 2REMA 4GCIA 3HA9A 1EP7A 2AV4A 3HYPA 1HYUA 1MD4A 3ZFBA 1URMA 2KUCA 3APOA 1K0AA 2H71A 1BJXA 1EEMA 4HU7A 1SD9A 1Q98A 4IJ3A 1ML6A 3LXTA 3FR6A 4X1UA 6GSVA 5H5RA 1MTCA 3US3A 5JWQB 3UBKA 1GLPA 4K5SA 1A2JA 3JCML 17GSA 3K8NA 4WETA 1SKSB 3IR4A 2QKEA 2BJXA 2CAQA 3G7YA 1E6BA 9GSSA 1SK1A 4MF5A 3GIXA 2N5FA 1T4ZA 4JE1A 2XC2A 3HD5A 2LJRA 1TU7A 3GTUB 1OC9B 4ZIJA 1AIUA 3QAVA 3FMWA 2XPDA 3BOAA 5AN1A 3APSA 4EO3A 1TRSA 4AJ7A 3L4NA 2CV4A 2K8SA 5DAKA 2YPMA 1PSQA 4LA1A 1LJRA 4IELA 4EC0A 3HCZA 2R0CA 3MAKA 4TR0A 1GTAA 3M0FA 1XW6A 2EC4A 2EIQA 1R5AA 3PPUA 3VWWA 3LG6A 4I97A 13GSA 3LXZA 5G2ZA 2R0GA 5CRGA 3KTLA 3F3QA 2G0FA 1FVKA 2IFQA 3DGQA 2GS3A 4N0ZA 1AC1A 5GAPD 1DSBA 3QMXA 4D73B 1WMJA 3CSIA 3UARA 2LRTA 3EURA 4EDZA 1JZRA 4WF4A 3L9UA 2H66A 4DSQA 4ZBAA 2RM5A 5AISA 1FO5A 1QXHA 2XBQA 3ZITA 1XWGA 3GA4A 1VF4A 2OKAA 5JCWA 2DIYA 3WGEA 4GTUA 3WYWA 2YWMA 5G5FA 1YQ1A 2DMMA 2H73A 4YQMA 1LBKA 3VPTA 1EGOA 3QAGA 4IHUA 2AB6A 4HZ4A 3GHAA 5G1LA 3D0ZA 1U87A 1WRYA 5A5KA 1OE8A 2H1GA 2FA4A 5CREA 5IO2A 4Q5NA 1PN9A 2X4AA 3CTFA 6GSWA 4K7IA 5KN3A 1BEDA 1GSSA 1HQOA 2C4JA 3IHGA 2BMXA 5GAND 2VLTA 4V1Ag 3GKNA 1SL0B 5KN2A 3KIJA 1T8EB 2GSQA 1WPIA 3HXSA 3I43A 4OCFA 4QQ7A 2CZ2A 2B3SA 3CSHA 2CQ9A 1OC3A 4ZILA 1M0UA 4DSSA 2K18A 4G10A 5CYYA 3EINA 2HZEA 1V98A 3GV1A 2ZCTA 4TXOB 4GLTA 1M99A 4FYCA 2LKUA 2FUG2 1SK0A 2VM2A 2FWGA 3VI7A 1HNCA 2AAWA 3UBLA 2P0GA 3O76A 3W6GA 4HOJA 5AGYA 5CAXA 2V2GA 2KLXA 1QGVA 1XWKA 4MJCA 4ISDA 2WJUA 4YQVA 3D4TA 4OFTA 3LW9A 1AQVA 2ES7A 2GVPA 2PN8A 4HJ2A 2HFDA 3KEBA 3HDCA 4FYUA 2RIIA 4AJ6A 1K0OA 1QQ2A 4DVCA 4L8EA 2VO4A 5ECPB 2PVOC 2A4VA 4FO5A 2E0QA 3EU3A 4K8MA 3DVXA 1VF3A 3MWHA 1S3DA 2XHFA 2NDOA 3KGKA 4HDEA 1FB6A 5DALA 4WR4A 4MJBA 3ZMKA 1OC8A 5ECQB 2TRXA 2VIMA 5ECRB 1KBNA 4ZL7A 2FWHA 3BBYA 3IAS2 2JACA 3KD0A 4L5OA 1PKZA 4BL7A 2LJAA 1PRXA 3CSJA 3QOUA 1Z9HA 2OJLA 1XVWA 4I2UA 1A0RP 3HVVA 4NAXA 2L6CA 4Q5QA 3A5IA 3Q74A 3GH9A 3FY7A 2B1KA 3TDGA 4LLRA 2P5QA 4O7HA 3W8JA 4FQUA 4N10A 1A24A 3H93A 2PUKC 4IN0A 4IW9A 4K9ZA 1GUKA 5B6NA 1DBYA 4EL1A 1ZYQB 3A2VA 2C0DA 4EF0A 1G7EA 4J56E 1MDIA 5JWOB 3WD6A 3FZ9A 2OA7A 1GUMA 3VPQA 14GSA 1K0NA 18GSA 2C0FA 5F0GA 1VF2A 3MYDA 5ID2A 4IP1A 3ZIVA 3LORA 1S3CA 2DJ3A 3RAZA 3C73A 1S3RA 1PX7A 1ZOFA 4KF9A 1NW2A 4HJMA 1WE0A 2GDRA 3ZREA 4KCEA 3ZVJA 1Q4JA 2YZHA 3IC8A 4MF7A 2F8FA 2DC5A 2J9HA 1A2MA 2HSHA 1PL2A 5IQYA 3QFBC 3A5WA 2VCXA 4F03A 4NPBA 2RLIA 5LNKe 2VL2A 2GSRA 1JZWA 3G7JA 2AHEA 1TK8B 5HFIA 1XZOA 2DKHA 4ACSA 3FEUA 3BD2A 1O81A 3LEFA 5F06A 1X9SB 1GNEA 4TN8A 2O7KA 2UZ8A 2HSYA 5D9WA 3VI5A 4MH2A 4GWRA 4PQIA 1JZDA 1K0CA 1ZYPA 3LYKA 1X0RA 2B1LA 4GSSA 1M2BA 1DE1A 2V32A 3FHKA 4BVYA 1BYEA 5J5NA 2CT6A 2PWJA 3QAWA 2C3NA 5DQSA 3C71A 4ZL8A 3ZRDA 2E7PA 5D9XA 2HSMA 2N5AA 5CP1A 2OBIA 2NTOA 4KDUA 2FA8A 2JADA 3D6IA 3N9JA 2CVDA 4BVXA 1GTIA 3F4TA 2RM6A 1V40A 1F3AA 3HJMA 4XS4B 2GT6A 1GUHA 3D5JA 1XXUA 5F8BA 4HEA2 1V9WA 4POBA 2GQKA 1R7HA 1VF1A 2MMOA 2R0PA 3Q19A 3KZQA 2C0GA 4TRXA 1NSWA 3GL3A 1M9AA 5IMVA 5A4WA 4CHSA 1GP1A 5ECHB 4PNGA 2WS2A 4EVMA 3I69A 4N0VA 4MJEA 2PMTA 2WULA 1KEBA 3ME8A 4G19A 4WR5A 4GSTA 1V58A 1WIKA 4RI6A 4ZXGA 3KMNA 1GNWA 1OKDA 2G2QA 2YV7A 2XPEA 2MZCA 4IQ1A 1SJ6A 5HFKA 3WGDA 1QUWA 3TJFA 3BCKA 4EIQA 4MPFA 3IPZA 2HRKA 5IMAA 3HVXA 1KNGA 2KP1A 3D22A 2X64A 3R2QA 4IQAA 4XRDA 2B7KA 1T00A 2WGRA 4PURA 3ZYWA 3EC3A 3RBTA 3EMXA 4K1FA 22GSA 1QMVA 1YKCA 1Z5YE 3TOTA 4DEJA 2I1UA 4BWQA 1J08A 2EIRA 1K0MA 4NV5A 2AYTA 2PPTA 1PMTA 1U6TA 2VCQA 2GTUA 5CRWA 3D4MA 3TCOA 2OE1A 4I2TA 4G2EA 1Y6EA 4K7NA 2ZUPA 4WXTA 4NWYA 1HD2A 1FOHA 1Z7PA 4QL7A 2H19A 3UEMA 4NXIA 2H70A 2RUFA 1T3BA 16GSA 2LSTA 3UAPA 4KW6A 2V6OA 2LJKA 3J7Yk 2H0IA 3GKKA 3EU4A 1ST9A 2M46A 4LMVA 5E4WA 1WOUA 2H1BA 1TW9A 4MP4A 1X9WB 4CDOA 2TIRA 1Z3EA 4TW5A 5ECNB 4IJIA 5DJLA 5IMCA 5BRTA 4K0NA 1GRXA 4TR3A 4Z7XA 3NOFA 1O6JA 5EPFA 1GTUA 2TRCP 3H8QA 2OE3A 3HZ4A 1F2EA 2O8VB 6GSTA 1F37A 3QDNA 2VCWA 3ERFA 3F63A 2NPBA 2H74A 4POMA 3M8NA 4ID0A 4GQCA 2MMZA 1FAAA 1O85A 1Z7RA 4G9HA 3IA1A 4IGJA 3TRPA 4OCEA 2DIZA 2YN1A 1Z6MA 4A5PA 4RQXA 5IMZA 5G5EA 2FWFA 3VWVA 4MLYA 5DBQA 1TKDB 3CYNA 4YKFA 3ZFLA 2HLSA 3QR6A 1FOVA 1TU8A 3F0IA 3DRNA 3KP8A 3H4KA 2IL3A 4KSMA 3FZAA 5IPHA 3DVWA 4CY8A 1H75A 3GTUA 1OC9A 2WDUA 1LU4A 4RQRA 2WZ9A 3ZIJA 3EWLA 1BG5A 1UN2A 1MDKA 2L4CA 2LEGA 1SYRA 2R4VA 3CBUA 1I5GA 3O6TA 3FW2A 5G31A 5ECMB 2VUPA 3GMFA 3UJ1A 4HSCX 4MZCA 3F9UA 1TDIA 4MABA 1ABAA 1WWJA
chains in the Genus database with same CATH topology
5IM9A 1OAZA 2JZTA 1RW1A 2HT9A 3P8WA 1EGRA 3IHQA 5DQYA 1O8WA 5ECKB 3SWLA 2H1AA 5HFGA 5INYA 2CZ3A 4D73A 4XIHA 1TOFA 3HVSA 1PQNA 4XHMA 1CQGA 4YH2A 4TR4A 2CVBA 4Q5RA 1SL1B 3UL3A 1X9MB 3F6DA 4AJ8A 5GZZB 3KJYA 1GSQA 5JCGA 3DD3A 4V2LA 2E2MA 4OO4A 2V1MA 2LTKA 2QA1A 5DCHA 4O5RA 3L9VA 4BA7A 2R5GA 4J2FA 2B5EA 1EP8A 2CA8A 4MZBA 3GKMA 3IXRA 3RHCA 1FVJA 4BWSA 2H6YA 3VWUA 2QGVA 2FY6A 1YJ6A 4MH3A 4ZB6A 4F0CA 2P5RA 1XWBA 6GSYA 5LCZA 1X5CA 4OMVA 3TKQA 2R6KA 2JU5A 4LMWA 2QC7A 4RI7A 1SD8A 2I3YA 2NBSA 5E59A 3P2AA 2H01A 4F9ZA 2KP2A 1V57A 3KM6A 5KOXA 1YF0A 2YJ7A 4XCSA 1XOAA 3EPTA 2YWOA 3M9KA 4G0KA 1XOBA 3MDKA 2L5LA 4K0GA 2B6MA 3HJPA 4X43A 1FHEA 3MNGA 4XS6A 3A2XA 1AXDA 5ID2B 1G0TA 4XTSA 5HR1A 4H86A 2E2GA 5C00A 4HI7A 1N2AA 4NMUA 3NZNA 3GX8A 1TI1A 5EL8A 1PKWA 4K2XA 2YV9A 5D9TA 4Z2TA 1OVNA 3GX0A 2BTOT 5B8BA 5H5QA 2AUVA 4MF6A 1SJIA 1PN0A 3DMLA 1RK4A 2GSTA 3U6VA 3A2WA 3VK9A 2H30A 5ENUA 3TRXA 3TJKA 4LL1B 1G6WA 1TI3A 5ECSA 8GSSA 4ICYA 1EZKA 3EVIA 3E9JB 1XW5A 5HQPA 1TRUA 3TKSC 5IMFA 1USBA 1TK5B 1S3AA 1BAYA 2VL3A 1ERUA 1GLQA 1THXA 2PVQA 5IOXA 2DBCA 2RUEA 2LRNA 3GRXA 1ZGNA 1A0FA 3DXBA 2LUSA 3CTGA 6GSSA 1ZMAA 5ABRA 5B8AA 3HHVA 1E2YA 5D93A 2B7JA 4K5RA 1ZCPA 4PUFC 3H1NA 2DJKA 2F51A 3TJBA 4TR1A 3E0UA 1JZOA 1AW9A 4PTSA 4ECIA 2K6VA 1U88A 1GH2A 5FWGA 3QPMA 1M9BA 3FRCA 4XRAA 5GSTA 4EE0A 4BVXB 1UA5A 3UVHA 1QFNA 1ON4A 2I9HA 5B6MA 3GFKA 4K6XA 4NHWA 4ML6A 1JLVA 2DMLA 2F3MA 2IIYA 2MBSA 4NV2A 1W89A 2CX3A 1XFLA 1G7OA 4JU5A 2VCZA 3G9BA 1GSUA 5IPGA 5KN1A 3S9FA 3GKXA 1YDKA 1ZYNA 2IWTA 3M1GA 5KN0A 3QFAC 1F3BA 4MZWA 4OFNA 4IS0A 2YJHA 3C1RA 2VM1A 1GSYA 2X49A 1J0FA 4L5LA 3PINA 7GSSA 1JFUA 3N5OA 2R2JA 2B5XA 5HR2A 4MCUA 4JZQA 3A3TA 3IDVA 4WF5A 3ERGA 5D9VA 4Z2RA 2CX4A 2KOKA 4ILFA 5D73A 3PR8A 1K0BA 2DSAA 3L0HA 2H75A 3KMOA 2YCDA 3ED3A 4OD7A 2J23A 3IE3A 3ISOA 4O32A 1PL1A 1C72A 5CRHA 3F4SA 4ECBA 3I9V2 2H76A 2JSZA 1TK0B 2PERA 2MBTA 1Z6NA 3HKRA 5DDLA 2HXKA 1ACVA 2FCHA 4WEYA 1ERTA 3TB2A 1M2AA 1AUCA 5L71A 4USSA 2VCVA 1I9DA 4N11A 2O89A 1XWAA 1K3YA 1EWXA 2H0HA 1RQMA 3RDWA 2OE0A 4KE3A 2D2ZA 3FYGA 4KCAA 3EE2A 4G0LA 2GZZA 3DKSA 4IVFA 4O5QA 2EIOA 3HJOA 2IJYA 4HQSA 1YF1A 3LWAA 2YP6A 4YQUA 2A2RA 2PBJA 5J3RA 4MMMA 3IK7A 4WBJA 5DVBA 3EMPA 4FIWA 2YNXA 1O73A 4I8BA 4EIPA 2L5OA 1B4PA 2ON7A 1YEXA 1V2AA 1EOGA 2VD0A 1F9MA 3KXOA 5DAKB 5J9CA 4LL4B 2GGTA 1HNBA 2VL9A 3QD9A 2H0GA 2C3TA 2OADA 4KDYA 1T1VA 4I5QA 3C1SA 3FR9A 1SYXA 2A4HA 3C7MA 1PA3A 3M9JA 2M80A 2I4AA 1UVZA 1ZZYA 2IFQB 3F3RA 3GSSA 5H5SA 4K7OA 2C1YA 2HNLA 3IC4A 3GURA 2B5YA 4V2MA 4KGIA 2H6ZA 4I6XA 3ZL5A 4EDYA 4Q5FA 3RPNA 5LD0A 5G1KA 3VFIA 3LQ7A 1SK2A 3ZMLA 2GLRA 5DCGA 4YKGA 3RPPA 1J9BA 5AIVA 3DWVA 2YOIA 1MEKA 3HZ8A 3GN3A 1SENA 1T7PB 5ECIB 1DE2A 2HYXA 4KX4A 1YKAA 2VAFA 5JCUA 3CXGA 3KP9A 2O87A 1OKTA 2FHEA 1GTBA 2HRAA 4IKHA 2IMKA 4HZ2A 4HS1A 4X4JA 4KAEA 4POKA 4IP6A 3CMIA 2WFCA 3MSZA 1WP0A 5KEJA 4WKWA 5IMDA 3BJ5A 3F4RA 2X8CA 3Q6OA 1TRWA 5GSSA 3KH9A 1JLWA 4FYBA 1GL8A 2L4QA 3F8UA 2LQOA 4MA9A 4OFMA 19GSA 1GSFA 3CRUA 1ILOA 3AY8A 3CRTA 3SBCA 3D21A 1ERVA 1R26A 2FD3A 4DSSB 2QSIA 5ECLB 1VGLA 1NM3A 2YZUA 3TUEA 2HZEB 3WT1A 4KH7A 2VLVA 3VLNA 6GSXA 2N5BA 3OR5A 2K8VA 1B4QA 2IMFA 4F2IA 3UOMA 2HRFA 4X0XA 4KNDA 1EEJA 3I6AA 3M3MA 2IMIA 4MJAA 3O3TA 2P31A 1AAZA 1ZYEA 2GSSA 2FGXA 4PX1A 2GQLA 2LV3A 4PQ1A 4TXVA 5IOWA 4ECCA 1FG4A 2M72A 2WRTA 3PH9A 5ECOB 2PGTA 4L0UA 2FWEA 3P7XA 4Z2UA 2PU9C 4GRFA 4PNFA 3IAM2 1B8XA 4MK3A 2FLSA 4JEDA 1SU9A 2A2SA 4ZL9A 4KA0A 5HR0A 2CAIA 1K3LA 6GSUA 3TKPA 5COHA 4PUAA 5DALB 1XIYA 4CY6A 1FB0A 4GXZA 5CNWA 3FKFA 2OACA 3TKRA 1SL2B 3LYPA 4HQZA 1H4OA 3DEXA 4MDCA 1KTEA 3VWXA 2GZPA 3P90A 4BPYA 3Q18A 4BL7B 4YAVA 2GZYA 3DIEA 4CW9A 4JBBA 1HNAA 5BMUA 1TTZA 1U3AA 4IBPA 1ZL9A 1TXXA 4ZBBA 1A2LA 2OBKA 3GYKA 2I81A 1CQHA 5J9BA 2WCIA 2X8GA 2X8HA 5J41A 1MD3A 4ML1A 2DJ2A 2IMEA 2MMAA 2VD1A 3IOSA 3ZLPA 4O5UA 4PXOA 1XWCA 3EYTA 1TP9A 1GULA 4EKZA 2HI7A 4G0IA 3TOUA 4ULXA 1N8JA 3LFLA 2A2PA 4EUYA 2F8AA 1W4VA 4DSRA 2AJQB 5C04A 1BQ7A 2HRNA 3KCMA 3MIXA 5F05A 1SKRB 3LGCA 5HR3A 1K3OA 2DJ0A 5JWRB 3TKSE 4ECJA 4EXJA 2DKIA 1QK8A 1SKWB 1B48A 1THOA 4KSOA 2K9FA 5EVOA 1GSDA 1XCCA 3ZVJD 1XPVA 5B7CA 1XBSA 4TR1B 1B9YC 2VCTA 4TXOA 2NVLA 1YY7A 1FW1A 5D96A 2VL2C 2YWIA 2FNOA 5F07A 4N30A 2JZRA 1BX9A 3C8EA 2LRCA 4ZB8A 3TRQA 3IV4A 1B9XC 4F82A 1DUGA 3FK8A 2H8LA 3KH7A 3PGTA 3LSZA 2XBIA 3ME7A 3KTBA 2CVKA 2MYGA 1R4WA 1T4YA 2V41A 4PQHA 3FZ5A 2IN3A 3W8SA 2LS5A 2DLXA 4OO5A 3H79A 2WB9A 3UVTA 3IRAA 4BVYB 4QL9A 3GNJA 4K2DA 3WGXA 1TJDA 3J7Yb 1EV4A 4JR4A 4J57E 1NHOA 3FZ4A 1WJKA 5ELGA 5KOWA 12GSA 1TRVA 4MPGA 2JL4A 4KB3A 3VURA 1IYHA 3R3EA 4HUAA 4ZB9A 1UC7A 3IBHA 3HY2A 3ERWA 3L78A 1GWCA 4E8HA 5IO0A 5DJMA 4OWYA 2VOCA 1O8XA 20GSA 2C8UA 4MNNA 4RUVA 2ALBA 1EOHA 1XW9A 1SJZA 4PGTA 4GF0A 2HE3A 1M7TA 5FHIA 3E3EA 1U3IA 2ZNMA 1X5EA 2DJ1A 3GSTA 2QA2A 2JSYA 4V1Ap 2IMDA 2GT5A 3V1WA 2X99A 2GQMA 4ZBDA 5J4UA 1A23A 5ELAA 2L59A 4E8EA 2L57A 4YAPA 2LNTA 1NHYA 3ZZXA 3BCIA 3TKSA 5AIXA 1YEPA 5CRDA 2F9SA 5A4UA 4POLA 4JRRA 4XS1A 1AQXA 1EV9A 3TJJA 2KHPA 4GSNA 2IPAA 4HU9A 5CO3A 5EY6A 4F0BA 4O92A 2YANA 3UIWA 4AGSA 3TGZA 5FT3A 1AQWA 1YZXA 3L9SA 2C3QA 3TJGA 4L0WA 4P3YB 1OYJA 2Z9SA 3LJRA 1PGTA 2LNSA 1M2DA 1A8LA 1IYIA 5A4VA 1F6MC 3APQA 3U5RE 1R5PA 1OE7A 1VRSD 2HZFA 1GSEA 5D8IA 2V6KA 4TKYA 1O7UA 2C0EA 4JR6A 2LQQA 1K0DA 4WBRD 3RHBA 2MMNA 3G7IA 2R37A 3IK9A 2H72A 2JZSA 1MDJA 3GH6A 2ON5A 1JHBA 2H6XA 3F6FA 4TOPA 3GUSA 2L6DA 2VLUA 4KDXA 3NIVA 3ZTLA 3DYRA 3FR3A 3QCPA 11GSA 1ERWA 2DJJA 4AF2A 1PX6A 1PD21 5IIZA 2H1DA 10GSA 4FH8A 2C80A 4V2NA 5G30A 4KUNA 1Y25A 3UMAA 3WT2A 1XVQA 4TVEA 2O85A 4NHZA 1A8YA 1X5DA 3GL5A 2R3XA 1G6YA 2YWNA 4XS4A 4GQFA 2REMA 4GCIA 3HA9A 1EP7A 2AV4A 3HYPA 1HYUA 1MD4A 3ZFBA 1URMA 2KUCA 3APOA 1K0AA 2H71A 1BJXA 1EEMA 4HU7A 1SD9A 1Q98A 4IJ3A 1ML6A 3LXTA 3FR6A 4X1UA 6GSVA 5H5RA 1MTCA 3US3A 5JWQB 3UBKA 1GLPA 4K5SA 1A2JA 3JCML 17GSA 3K8NA 4WETA 1SKSB 3IR4A 2QKEA 2BJXA 2CAQA 3G7YA 1E6BA 9GSSA 1SK1A 4MF5A 3GIXA 2N5FA 1T4ZA 4JE1A 2XC2A 3HD5A 2LJRA 1TU7A 3GTUB 1OC9B 4ZIJA 1AIUA 3QAVA 3FMWA 2XPDA 3BOAA 5AN1A 3APSA 4EO3A 1TRSA 4AJ7A 3L4NA 2CV4A 2K8SA 5DAKA 2YPMA 1PSQA 4LA1A 1LJRA 4IELA 4EC0A 3HCZA 2R0CA 3MAKA 4TR0A 1GTAA 3M0FA 1XW6A 2EC4A 2EIQA 1R5AA 3PPUA 3VWWA 3LG6A 4I97A 13GSA 3LXZA 5G2ZA 2R0GA 5CRGA 3KTLA 3F3QA 2G0FA 1FVKA 2IFQA 3DGQA 2GS3A 4N0ZA 1AC1A 5GAPD 1DSBA 3QMXA 4D73B 1WMJA 3CSIA 3UARA 2LRTA 3EURA 4EDZA 1JZRA 4WF4A 3L9UA 2H66A 4DSQA 4ZBAA 2RM5A 5AISA 1FO5A 1QXHA 2XBQA 3ZITA 1XWGA 3GA4A 1VF4A 2OKAA 5JCWA 2DIYA 3WGEA 4GTUA 3WYWA 2YWMA 5G5FA 1YQ1A 2DMMA 2H73A 4YQMA 1LBKA 3VPTA 1EGOA 3QAGA 4IHUA 2AB6A 4HZ4A 3GHAA 5G1LA 3D0ZA 1U87A 1WRYA 5A5KA 1OE8A 2H1GA 2FA4A 5CREA 5IO2A 4Q5NA 1PN9A 2X4AA 3CTFA 6GSWA 4K7IA 5KN3A 1BEDA 1GSSA 1HQOA 2C4JA 3IHGA 2BMXA 5GAND 2VLTA 4V1Ag 3GKNA 1SL0B 5KN2A 3KIJA 1T8EB 2GSQA 1WPIA 3HXSA 3I43A 4OCFA 4QQ7A 2CZ2A 2B3SA 3CSHA 2CQ9A 1OC3A 4ZILA 1M0UA 4DSSA 2K18A 4G10A 5CYYA 3EINA 2HZEA 1V98A 3GV1A 2ZCTA 4TXOB 4GLTA 1M99A 4FYCA 2LKUA 2FUG2 1SK0A 2VM2A 2FWGA 3VI7A 1HNCA 2AAWA 3UBLA 2P0GA 3O76A 3W6GA 4HOJA 5AGYA 5CAXA 2V2GA 2KLXA 1QGVA 1XWKA 4MJCA 4ISDA 2WJUA 4YQVA 3D4TA 4OFTA 3LW9A 1AQVA 2ES7A 2GVPA 2PN8A 4HJ2A 2HFDA 3KEBA 3HDCA 4FYUA 2RIIA 4AJ6A 1K0OA 1QQ2A 4DVCA 4L8EA 2VO4A 5ECPB 2PVOC 2A4VA 4FO5A 2E0QA 3EU3A 4K8MA 3DVXA 1VF3A 3MWHA 1S3DA 2XHFA 2NDOA 3KGKA 4HDEA 1FB6A 5DALA 4WR4A 4MJBA 3ZMKA 1OC8A 5ECQB 2TRXA 2VIMA 5ECRB 1KBNA 4ZL7A 2FWHA 3BBYA 3IAS2 2JACA 3KD0A 4L5OA 1PKZA 4BL7A 2LJAA 1PRXA 3CSJA 3QOUA 1Z9HA 2OJLA 1XVWA 4I2UA 1A0RP 3HVVA 4NAXA 2L6CA 4Q5QA 3A5IA 3Q74A 3GH9A 3FY7A 2B1KA 3TDGA 4LLRA 2P5QA 4O7HA 3W8JA 4FQUA 4N10A 1A24A 3H93A 2PUKC 4IN0A 4IW9A 4K9ZA 1GUKA 5B6NA 1DBYA 4EL1A 1ZYQB 3A2VA 2C0DA 4EF0A 1G7EA 4J56E 1MDIA 5JWOB 3WD6A 3FZ9A 2OA7A 1GUMA 3VPQA 14GSA 1K0NA 18GSA 2C0FA 5F0GA 1VF2A 3MYDA 5ID2A 4IP1A 3ZIVA 3LORA 1S3CA 2DJ3A 3RAZA 3C73A 1PX7A 1ZOFA 4KF9A 1NW2A 4HJMA 1WE0A 2GDRA 3ZREA 4KCEA 3ZVJA 1Q4JA 2YZHA 3IC8A 4MF7A 2F8FA 2DC5A 2J9HA 1A2MA 2HSHA 1PL2A 5IQYA 3QFBC 3A5WA 2VCXA 4F03A 4NPBA 2RLIA 5LNKe 2VL2A 2GSRA 1JZWA 3G7JA 2AHEA 1TK8B 5HFIA 1XZOA 2DKHA 4ACSA 3FEUA 3BD2A 1O81A 3LEFA 5F06A 1X9SB 1GNEA 4TN8A 2O7KA 2UZ8A 2HSYA 5D9WA 3VI5A 4MH2A 4GWRA 4PQIA 1JZDA 1K0CA 1ZYPA 3LYKA 1X0RA 2B1LA 4GSSA 1M2BA 1DE1A 2V32A 3FHKA 4BVYA 1BYEA 5J5NA 2CT6A 2PWJA 3QAWA 2C3NA 5DQSA 3C71A 4ZL8A 3ZRDA 2E7PA 5D9XA 2HSMA 2N5AA 5CP1A 2OBIA 2NTOA 4KDUA 2FA8A 2JADA 3D6IA 3N9JA 2CVDA 4BVXA 1GTIA 3F4TA 2RM6A 1V40A 1F3AA 3HJMA 4XS4B 2GT6A 1GUHA 3D5JA 1XXUA 5F8BA 4HEA2 1V9WA 4POBA 2GQKA 1R7HA 1VF1A 2MMOA 2R0PA 3Q19A 3KZQA 2C0GA 4TRXA 1NSWA 3GL3A 1M9AA 5IMVA 5A4WA 4CHSA 1GP1A 5ECHB 4PNGA 2WS2A 4EVMA 3I69A 4N0VA 4MJEA 2PMTA 2WULA 1KEBA 3ME8A 4G19A 4WR5A 4GSTA 1V58A 1WIKA 4RI6A 4ZXGA 3KMNA 1GNWA 1OKDA 2G2QA 2YV7A 2XPEA 2MZCA 4IQ1A 1SJ6A 5HFKA 3WGDA 1QUWA 3TJFA 3BCKA 4EIQA 4MPFA 3IPZA 2HRKA 5IMAA 3HVXA 1KNGA 2KP1A 3D22A 2X64A 3R2QA 4IQAA 4XRDA 2B7KA 1T00A 2WGRA 4PURA 3ZYWA 3EC3A 3RBTA 3EMXA 4K1FA 22GSA 1QMVA 1YKCA 1Z5YE 3TOTA 4DEJA 2I1UA 4BWQA 1J08A 2EIRA 1K0MA 4NV5A 2AYTA 2PPTA 1PMTA 1U6TA 2VCQA 2GTUA 5CRWA 3D4MA 3TCOA 2OE1A 4I2TA 4G2EA 1Y6EA 4K7NA 2ZUPA 4WXTA 4NWYA 1HD2A 1FOHA 1Z7PA 4QL7A 2H19A 3UEMA 4NXIA 2H70A 2RUFA 1T3BA 16GSA 2LSTA 3UAPA 4KW6A 2V6OA 2LJKA 3J7Yk 2H0IA 3GKKA 3EU4A 1ST9A 2M46A 4LMVA 5E4WA 1WOUA 2H1BA 1TW9A 4MP4A 1X9WB 4CDOA 2TIRA 1Z3EA 4TW5A 5ECNB 4IJIA 5DJLA 5IMCA 5BRTA 4K0NA 1GRXA 4TR3A 4Z7XA 3NOFA 1O6JA 5EPFA 1GTUA 2TRCP 3H8QA 2OE3A 3HZ4A 1F2EA 2O8VB 6GSTA 1F37A 3QDNA 2VCWA 3ERFA 3F63A 2NPBA 2H74A 4POMA 3M8NA 4ID0A 4GQCA 2MMZA 1FAAA 1O85A 1Z7RA 4G9HA 3IA1A 4IGJA 3TRPA 4OCEA 2DIZA 2YN1A 1Z6MA 4A5PA 4RQXA 5IMZA 5G5EA 2FWFA 3VWVA 4MLYA 5DBQA 1TKDB 3CYNA 4YKFA 3ZFLA 2HLSA 3QR6A 1FOVA 1TU8A 3F0IA 3DRNA 3KP8A 3H4KA 2IL3A 4KSMA 3FZAA 5IPHA 3DVWA 4CY8A 1H75A 3GTUA 1OC9A 2WDUA 1LU4A 4RQRA 2WZ9A 3ZIJA 3EWLA 1BG5A 1UN2A 1MDKA 2L4CA 2LEGA 1SYRA 2R4VA 3CBUA 1I5GA 3O6TA 3FW2A 5G31A 5ECMB 2VUPA 3GMFA 3UJ1A 4MZCA 3F9UA 1TDIA 4MABA 1ABAA 1WWJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IM9 A;  1OAZ A;  2JZT A;  1RW1 A;  2HT9 A;  3P8W A;  1EGR A;  3IHQ A;  5DQY A;  1O8W A;  5ECK B;  3SWL A;  2H1A A;  5HFG A;  5INY A;  2CZ3 A;  4D73 A;  4XIH A;  1TOF A;  3HVS A;  1PQN A;  4XHM A;  1CQG A;  4YH2 A;  4TR4 A;  2CVB A;  4Q5R A;  1SL1 B;  3UL3 A;  1X9M B;  3F6D A;  4AJ8 A;  5GZZ B;  3KJY A;  1GSQ A;  5JCG A;  3DD3 A;  4V2L A;  2E2M A;  4OO4 A;  2V1M A;  2LTK A;  5DCH A;  4O5R A;  3L9V A;  4BA7 A;  2R5G A;  4J2F A;  2B5E A;  1EP8 A;  2CA8 A;  4MZB A;  3GKM A;  3IXR A;  3RHC A;  1FVJ A;  4BWS A;  2H6Y A;  3VWU A;  2QGV A;  2FY6 A;  1YJ6 A;  4MH3 A;  4ZB6 A;  4F0C A;  2P5R A;  1XWB A;  6GSY A;  5LCZ A;  1X5C A;  4OMV A;  3TKQ A;  2R6K A;  2JU5 A;  4LMW A;  2QC7 A;  4RI7 A;  1SD8 A;  2I3Y A;  2NBS A;  5E59 A;  3P2A A;  2H01 A;  4F9Z A;  2KP2 A;  1V57 A;  3KM6 A;  1YF0 A;  2YJ7 A;  4XCS A;  1XOA A;  2YWO A;  3M9K A;  1XOB A;  3MDK A;  2L5L A;  4K0G A;  2B6M A;  3HJP A;  4X43 A;  1FHE A;  3MNG A;  4XS6 A;  3A2X A;  1AXD A;  5ID2 B;  1G0T A;  4XTS A;  5HR1 A;  4H86 A;  2E2G A;  5C00 A;  4HI7 A;  1N2A A;  4NMU A;  3NZN A;  3GX8 A;  1TI1 A;  5EL8 A;  1PKW A;  2YV9 A;  5D9T A;  1OVN A;  3GX0 A;  2BTO T;  5B8B A;  5H5Q A;  2AUV A;  4MF6 A;  1SJI A;  3DML A;  1RK4 A;  2GST A;  3U6V A;  3A2W A;  3VK9 A;  2H30 A;  5ENU A;  3TRX A;  3TJK A;  4LL1 B;  1G6W A;  1TI3 A;  5ECS A;  8GSS A;  1EZK A;  3EVI A;  3E9J B;  1XW5 A;  5HQP A;  1TRU A;  3TKS C;  5IMF A;  1USB A;  1TK5 B;  1S3A A;  1BAY A;  2VL3 A;  1ERU A;  1GLQ A;  1THX A;  2PVQ A;  5IOX A;  2DBC A;  2RUE A;  2LRN A;  3GRX A;  1ZGN A;  1A0F A;  3DXB A;  2LUS A;  3CTG A;  6GSS A;  1ZMA A;  5ABR A;  5B8A A;  3HHV A;  1E2Y A;  5D93 A;  2B7J A;  1ZCP A;  4PUF C;  3H1N A;  2DJK A;  2F51 A;  3TJB A;  4TR1 A;  3E0U A;  1JZO A;  1AW9 A;  4ECI A;  2K6V A;  1U88 A;  1GH2 A;  5FWG A;  3QPM A;  1M9B A;  3FRC A;  4XRA A;  5GST A;  4EE0 A;  1UA5 A;  3UVH A;  1QFN A;  1ON4 A;  2I9H A;  5B6M A;  3GFK A;  4K6X A;  4NHW A;  4ML6 A;  1JLV A;  2DML A;  2F3M A;  2IIY A;  2MBS A;  4NV2 A;  1W89 A;  2CX3 A;  1XFL A;  1G7O A;  4JU5 A;  2VCZ A;  3G9B A;  1GSU A;  5IPG A;  5KN1 A;  3S9F A;  3GKX A;  1YDK A;  2IWT A;  3M1G A;  5KN0 A;  3QFA C;  1F3B A;  4MZW A;  4OFN A;  4IS0 A;  2YJH A;  3C1R A;  2VM1 A;  1GSY A;  1J0F A;  4L5L A;  3PIN A;  7GSS A;  1JFU A;  3N5O A;  2R2J A;  2B5X A;  5HR2 A;  4MCU A;  4JZQ A;  3A3T A;  3IDV A;  4WF5 A;  3ERG A;  5D9V A;  2CX4 A;  2KOK A;  4ILF A;  5D73 A;  3PR8 A;  1K0B A;  2DSA A;  3L0H A;  2H75 A;  3KMO A;  2YCD A;  3ED3 A;  4OD7 A;  2J23 A;  3IE3 A;  3ISO A;  4O32 A;  1PL1 A;  1C72 A;  5CRH A;  3F4S A;  4ECB A;  3I9V 2;  2H76 A;  2JSZ A;  1TK0 B;  2PER A;  2MBT A;  1Z6N A;  3HKR A;  5DDL A;  2HXK A;  1ACV A;  2FCH A;  4WEY A;  1ERT A;  3TB2 A;  1M2A A;  1AUC A;  5L71 A;  2VCV A;  1I9D A;  4N11 A;  2O89 A;  1XWA A;  1K3Y A;  1EWX A;  2H0H A;  1RQM A;  3RDW A;  2OE0 A;  4KE3 A;  2D2Z A;  3FYG A;  4KCA A;  3EE2 A;  2GZZ A;  3DKS A;  4IVF A;  2EIO A;  3HJO A;  2IJY A;  4HQS A;  1YF1 A;  3LWA A;  2YP6 A;  4YQU A;  2A2R A;  2PBJ A;  5J3R A;  4MMM A;  3IK7 A;  4WBJ A;  5DVB A;  3EMP A;  4FIW A;  2YNX A;  1O73 A;  4I8B A;  2L5O A;  1B4P A;  2ON7 A;  1YEX A;  1V2A A;  1EOG A;  2VD0 A;  1F9M A;  3KXO A;  5DAK B;  5J9C A;  4LL4 B;  2GGT A;  1HNB A;  2VL9 A;  3QD9 A;  2H0G A;  2C3T A;  2OAD A;  4KDY A;  1T1V A;  4I5Q A;  3C1S A;  3FR9 A;  1SYX A;  3C7M A;  1PA3 A;  3M9J A;  2M80 A;  2I4A A;  1UVZ A;  1ZZY A;  2IFQ B;  3F3R A;  3GSS A;  5H5S A;  4K7O A;  2C1Y A;  2HNL A;  3IC4 A;  3GUR A;  2B5Y A;  4V2M A;  4KGI A;  2H6Z A;  4I6X A;  3ZL5 A;  4EDY A;  4Q5F A;  3RPN A;  5LD0 A;  5G1K A;  3VFI A;  3LQ7 A;  1SK2 A;  3ZML A;  2GLR A;  5DCG A;  3RPP A;  1J9B A;  5AIV A;  3DWV A;  2YOI A;  1MEK A;  3HZ8 A;  3GN3 A;  1SEN A;  1T7P B;  5ECI B;  1DE2 A;  2HYX A;  4KX4 A;  1YKA A;  2VAF A;  5JCU A;  3CXG A;  3KP9 A;  2O87 A;  1OKT A;  2FHE A;  1GTB A;  4IKH A;  2IMK A;  4HZ2 A;  4HS1 A;  4KAE A;  4POK A;  4IP6 A;  3CMI A;  2WFC A;  3MSZ A;  1WP0 A;  5KEJ A;  4WKW A;  5IMD A;  3BJ5 A;  3F4R A;  2X8C A;  3Q6O A;  1TRW A;  5GSS A;  3KH9 A;  1JLW A;  4FYB A;  1GL8 A;  2L4Q A;  3F8U A;  2LQO A;  4MA9 A;  4OFM A;  19GS A;  1GSF A;  3CRU A;  1ILO A;  3AY8 A;  3CRT A;  3SBC A;  3D21 A;  1ERV A;  1R26 A;  2FD3 A;  4DSS B;  2QSI A;  5ECL B;  1VGL A;  1NM3 A;  2YZU A;  3TUE A;  2HZE B;  3WT1 A;  4KH7 A;  2VLV A;  3VLN A;  6GSX A;  2N5B A;  3OR5 A;  2K8V A;  1B4Q A;  2IMF A;  4F2I A;  3UOM A;  2HRF A;  4X0X A;  4KND A;  1EEJ A;  3I6A A;  3M3M A;  2IMI A;  4MJA A;  3O3T A;  2P31 A;  1AAZ A;  1ZYE A;  2GSS A;  2FGX A;  4PX1 A;  2GQL A;  2LV3 A;  4PQ1 A;  4TXV A;  5IOW A;  4ECC A;  1FG4 A;  2M72 A;  2WRT A;  3PH9 A;  5ECO B;  2PGT A;  4L0U A;  2FWE A;  3P7X A;  2PU9 C;  4GRF A;  4PNF A;  3IAM 2;  1B8X A;  4MK3 A;  2FLS A;  4JED A;  1SU9 A;  2A2S A;  4ZL9 A;  4KA0 A;  5HR0 A;  2CAI A;  1K3L A;  6GSU A;  3TKP A;  5COH A;  4PUA A;  5DAL B;  1XIY A;  1FB0 A;  4GXZ A;  5CNW A;  3FKF A;  2OAC A;  3TKR A;  1SL2 B;  3LYP A;  4HQZ A;  1H4O A;  3DEX A;  4MDC A;  1KTE A;  3VWX A;  2GZP A;  3P90 A;  4BPY A;  3Q18 A;  4YAV A;  2GZY A;  3DIE A;  4CW9 A;  4JBB A;  1HNA A;  1TTZ A;  1U3A A;  4IBP A;  1ZL9 A;  1TXX A;  4ZBB A;  1A2L A;  2OBK A;  3GYK A;  2I81 A;  1CQH A;  5J9B A;  2WCI A;  2X8G A;  2X8H A;  5J41 A;  1MD3 A;  4ML1 A;  2DJ2 A;  2IME A;  2MMA A;  2VD1 A;  3IOS A;  3ZLP A;  4PXO A;  1XWC A;  3EYT A;  1TP9 A;  1GUL A;  4EKZ A;  2HI7 A;  3TOU A;  4ULX A;  1N8J A;  3LFL A;  4EUY A;  2F8A A;  1W4V A;  4DSR A;  2AJQ B;  5C04 A;  1BQ7 A;  2HRN A;  3KCM A;  5F05 A;  1SKR B;  3LGC A;  5HR3 A;  1K3O A;  2DJ0 A;  5JWR B;  3TKS E;  4ECJ A;  4EXJ A;  1QK8 A;  1SKW B;  1B48 A;  1THO A;  4KSO A;  2K9F A;  5EVO A;  1GSD A;  1XCC A;  3ZVJ D;  1XPV A;  5B7C A;  1XBS A;  4TR1 B;  1B9Y C;  2VCT A;  4TXO A;  2NVL A;  1YY7 A;  1FW1 A;  5D96 A;  2VL2 C;  2YWI A;  2FNO A;  5F07 A;  4N30 A;  2JZR A;  1BX9 A;  3C8E A;  2LRC A;  4ZB8 A;  3TRQ A;  3IV4 A;  1B9X C;  4F82 A;  1DUG A;  3FK8 A;  2H8L A;  3KH7 A;  3PGT A;  3LSZ A;  2XBI A;  3ME7 A;  3KTB A;  2CVK A;  2MYG A;  1R4W A;  1T4Y A;  2V41 A;  4PQH A;  3FZ5 A;  2IN3 A;  3W8S A;  2LS5 A;  2DLX A;  4OO5 A;  3H79 A;  2WB9 A;  3UVT A;  3IRA A;  4QL9 A;  3GNJ A;  4K2D A;  3WGX A;  1TJD A;  3J7Y b;  1EV4 A;  4JR4 A;  4J57 E;  5ELG A;  1NHO A;  1WJK A;  3FZ4 A;  12GS A;  1TRV A;  4MPG A;  2JL4 A;  4KB3 A;  3VUR A;  1IYH A;  4HUA A;  4ZB9 A;  1UC7 A;  3IBH A;  3HY2 A;  3ERW A;  3L78 A;  1GWC A;  4E8H A;  5IO0 A;  5DJM A;  4OWY A;  2VOC A;  1O8X A;  20GS A;  2C8U A;  4RUV A;  2ALB A;  1EOH A;  1XW9 A;  1SJZ A;  4PGT A;  4GF0 A;  2HE3 A;  1M7T A;  5FHI A;  3E3E A;  1U3I A;  2ZNM A;  1X5E A;  2DJ1 A;  3GST A;  2JSY A;  4V1A p;  2IMD A;  2GT5 A;  3V1W A;  2X99 A;  2GQM A;  4ZBD A;  5J4U A;  1A23 A;  5ELA A;  2L59 A;  4E8E A;  2L57 A;  4YAP A;  2LNT A;  1NHY A;  3ZZX A;  3BCI A;  3TKS A;  5AIX A;  1YEP A;  5CRD A;  2F9S A;  5A4U A;  4POL A;  4JRR A;  4XS1 A;  1AQX A;  1EV9 A;  3TJJ A;  2KHP A;  4GSN A;  2IPA A;  4HU9 A;  5CO3 A;  5EY6 A;  4F0B A;  4O92 A;  2YAN A;  3UIW A;  4AGS A;  3TGZ A;  5FT3 A;  1AQW A;  1YZX A;  3L9S A;  2C3Q A;  3TJG A;  4L0W A;  4P3Y B;  1OYJ A;  2Z9S A;  3LJR A;  1PGT A;  2LNS A;  1M2D A;  1A8L A;  1IYI A;  5A4V A;  1F6M C;  3APQ A;  3U5R E;  1R5P A;  1OE7 A;  1VRS D;  2HZF A;  1GSE A;  5D8I A;  2V6K A;  4TKY A;  1O7U A;  2C0E A;  4JR6 A;  2LQQ A;  1K0D A;  4WBR D;  3RHB A;  2MMN A;  3G7I A;  2R37 A;  3IK9 A;  2H72 A;  2JZS A;  1MDJ A;  3GH6 A;  2ON5 A;  1JHB A;  2H6X A;  3F6F A;  4TOP A;  3GUS A;  2L6D A;  2VLU A;  4KDX A;  3NIV A;  3ZTL A;  3DYR A;  3FR3 A;  3QCP A;  11GS A;  1ERW A;  2DJJ A;  4AF2 A;  1PX6 A;  1PD2 1;  5IIZ A;  2H1D A;  10GS A;  4FH8 A;  2C80 A;  4V2N A;  5G30 A;  4KUN A;  1Y25 A;  3UMA A;  3WT2 A;  1XVQ A;  4TVE A;  2O85 A;  4NHZ A;  1A8Y A;  1X5D A;  3GL5 A;  2R3X A;  1G6Y A;  2YWN A;  4XS4 A;  4GQF A;  2REM A;  4GCI A;  3HA9 A;  1EP7 A;  2AV4 A;  3HYP A;  1HYU A;  1MD4 A;  3ZFB A;  1URM A;  2KUC A;  3APO A;  1K0A A;  2H71 A;  1BJX A;  1EEM A;  4HU7 A;  1SD9 A;  1Q98 A;  4IJ3 A;  1ML6 A;  3LXT A;  3FR6 A;  4X1U A;  6GSV A;  5H5R A;  1MTC A;  3US3 A;  5JWQ B;  3UBK A;  1GLP A;  1A2J A;  3JCM L;  17GS A;  3K8N A;  4WET A;  1SKS B;  3IR4 A;  2QKE A;  2BJX A;  2CAQ A;  3G7Y A;  1E6B A;  9GSS A;  1SK1 A;  4MF5 A;  3GIX A;  2N5F A;  1T4Z A;  4JE1 A;  2XC2 A;  3HD5 A;  2LJR A;  1TU7 A;  3GTU B;  1OC9 B;  4ZIJ A;  1AIU A;  3QAV A;  2XPD A;  3BOA A;  5AN1 A;  3APS A;  4EO3 A;  1TRS A;  4AJ7 A;  3L4N A;  2CV4 A;  2K8S A;  5DAK A;  2YPM A;  1PSQ A;  4LA1 A;  1LJR A;  4IEL A;  4EC0 A;  3HCZ A;  3MAK A;  4TR0 A;  1GTA A;  3M0F A;  1XW6 A;  2EC4 A;  2EIQ A;  1R5A A;  3VWW A;  3LG6 A;  4I97 A;  13GS A;  3LXZ A;  5G2Z A;  5CRG A;  3KTL A;  3F3Q A;  2G0F A;  1FVK A;  2IFQ A;  3DGQ A;  2GS3 A;  4N0Z A;  1AC1 A;  5GAP D;  1DSB A;  3QMX A;  4D73 B;  1WMJ A;  3CSI A;  3UAR A;  2LRT A;  3EUR A;  4EDZ A;  1JZR A;  4WF4 A;  3L9U A;  2H66 A;  4DSQ A;  4ZBA A;  2RM5 A;  5AIS A;  1FO5 A;  1QXH A;  2XBQ A;  3ZIT A;  1XWG A;  3GA4 A;  1VF4 A;  2OKA A;  5JCW A;  2DIY A;  3WGE A;  4GTU A;  3WYW A;  2YWM A;  5G5F A;  1YQ1 A;  2DMM A;  2H73 A;  4YQM A;  1LBK A;  3VPT A;  1EGO A;  3QAG A;  4IHU A;  2AB6 A;  4HZ4 A;  3GHA A;  5G1L A;  3D0Z A;  1U87 A;  1WRY A;  5A5K A;  1OE8 A;  2H1G A;  2FA4 A;  5CRE A;  5IO2 A;  4Q5N A;  1PN9 A;  3CTF A;  6GSW A;  4K7I A;  5KN3 A;  1BED A;  1GSS A;  1HQO A;  2C4J A;  2BMX A;  5GAN D;  2VLT A;  4V1A g;  3GKN A;  1SL0 B;  5KN2 A;  3KIJ A;  1T8E B;  2GSQ A;  1WPI A;  3HXS A;  3I43 A;  4OCF A;  4QQ7 A;  2CZ2 A;  2B3S A;  3CSH A;  2CQ9 A;  1OC3 A;  4ZIL A;  1M0U A;  4DSS A;  2K18 A;  4G10 A;  5CYY A;  3EIN A;  2HZE A;  1V98 A;  3GV1 A;  2ZCT A;  4TXO B;  4GLT A;  1M99 A;  4FYC A;  2LKU A;  2FUG 2;  1SK0 A;  2VM2 A;  2FWG A;  3VI7 A;  1HNC A;  2AAW A;  3UBL A;  2P0G A;  3O76 A;  3W6G A;  4HOJ A;  5AGY A;  5CAX A;  2V2G A;  2KLX A;  1QGV A;  1XWK A;  4MJC A;  4ISD A;  2WJU A;  4YQV A;  3D4T A;  4OFT A;  1AQV A;  2ES7 A;  2GVP A;  2PN8 A;  4HJ2 A;  2HFD A;  3KEB A;  3HDC A;  4FYU A;  2RII A;  4AJ6 A;  1K0O A;  1QQ2 A;  4DVC A;  4L8E A;  5ECP B;  2VO4 A;  2PVO C;  2A4V A;  4FO5 A;  2E0Q A;  3EU3 A;  4K8M A;  3DVX A;  1VF3 A;  3MWH A;  1S3D A;  2XHF A;  2NDO A;  3KGK A;  4HDE A;  1FB6 A;  5DAL A;  4WR4 A;  4MJB A;  3ZMK A;  1OC8 A;  5ECQ B;  2TRX A;  2VIM A;  5ECR B;  1KBN A;  4ZL7 A;  2FWH A;  3BBY A;  3IAS 2;  2JAC A;  3KD0 A;  4L5O A;  1PKZ A;  4BL7 A;  2LJA A;  1PRX A;  3CSJ A;  3QOU A;  1Z9H A;  2OJL A;  1XVW A;  4I2U A;  1A0R P;  3HVV A;  4NAX A;  2L6C A;  4Q5Q A;  3Q74 A;  3GH9 A;  3FY7 A;  2B1K A;  3TDG A;  4LLR A;  2P5Q A;  4O7H A;  3W8J A;  4N10 A;  1A24 A;  3H93 A;  2PUK C;  4IN0 A;  4IW9 A;  4K9Z A;  1GUK A;  5B6N A;  1DBY A;  4EL1 A;  1ZYQ B;  3A2V A;  2C0D A;  4EF0 A;  1G7E A;  4J56 E;  1MDI A;  5JWO B;  3WD6 A;  3FZ9 A;  2OA7 A;  1GUM A;  3VPQ A;  14GS A;  1K0N A;  18GS A;  2C0F A;  5F0G A;  1VF2 A;  5ID2 A;  4IP1 A;  3ZIV A;  3LOR A;  1S3C A;  2DJ3 A;  3RAZ A;  3C73 A;  1PX7 A;  1ZOF A;  1NW2 A;  4HJM A;  1WE0 A;  2GDR A;  3ZRE A;  4KCE A;  3ZVJ A;  1Q4J A;  2YZH A;  4MF7 A;  2F8F A;  2DC5 A;  2J9H A;  1A2M A;  2HSH A;  1PL2 A;  5IQY A;  3QFB C;  3A5W A;  2VCX A;  4F03 A;  4NPB A;  2RLI A;  5LNK e;  2VL2 A;  2GSR A;  1JZW A;  3G7J A;  2AHE A;  1TK8 B;  5HFI A;  1XZO A;  4ACS A;  3FEU A;  3BD2 A;  1O81 A;  3LEF A;  5F06 A;  1X9S B;  1GNE A;  4TN8 A;  2O7K A;  2HSY A;  5D9W A;  3VI5 A;  4MH2 A;  4GWR A;  4PQI A;  1JZD A;  1K0C A;  3LYK A;  1X0R A;  2B1L A;  4GSS A;  1M2B A;  1DE1 A;  2V32 A;  3FHK A;  4BVY A;  1BYE A;  5J5N A;  2CT6 A;  2PWJ A;  3QAW A;  2C3N A;  5DQS A;  3C71 A;  4ZL8 A;  3ZRD A;  2E7P A;  5D9X A;  2N5A A;  5CP1 A;  2OBI A;  2NTO A;  4KDU A;  2FA8 A;  2JAD A;  3D6I A;  3N9J A;  2CVD A;  4BVX A;  1GTI A;  3F4T A;  2RM6 A;  1V40 A;  1F3A A;  3HJM A;  4XS4 B;  2GT6 A;  1GUH A;  3D5J A;  1XXU A;  5F8B A;  4HEA 2;  1V9W A;  4POB A;  2GQK A;  1R7H A;  1VF1 A;  2MMO A;  3Q19 A;  3KZQ A;  2C0G A;  4TRX A;  1NSW A;  3GL3 A;  1M9A A;  5IMV A;  5A4W A;  4CHS A;  1GP1 A;  5ECH B;  4PNG A;  2WS2 A;  4EVM A;  3I69 A;  4N0V A;  4MJE A;  2PMT A;  2WUL A;  1KEB A;  3ME8 A;  4G19 A;  4WR5 A;  4GST A;  1V58 A;  1WIK A;  4RI6 A;  4ZXG A;  3KMN A;  1GNW A;  1OKD A;  2G2Q A;  2YV7 A;  2XPE A;  2MZC A;  4IQ1 A;  1SJ6 A;  5HFK A;  3WGD A;  1QUW A;  3TJF A;  3BCK A;  4MPF A;  3IPZ A;  5IMA A;  3HVX A;  1KNG A;  2KP1 A;  3D22 A;  2X64 A;  3R2Q A;  4IQA A;  4XRD A;  2B7K A;  1T00 A;  2WGR A;  4PUR A;  3ZYW A;  3EC3 A;  3RBT A;  3EMX A;  4K1F A;  22GS A;  1QMV A;  1YKC A;  1Z5Y E;  3TOT A;  4DEJ A;  2I1U A;  4BWQ A;  1J08 A;  2EIR A;  1K0M A;  4NV5 A;  2AYT A;  2PPT A;  1PMT A;  1U6T A;  2VCQ A;  2GTU A;  5CRW A;  3D4M A;  3TCO A;  2OE1 A;  4I2T A;  4G2E A;  1Y6E A;  4K7N A;  2ZUP A;  4WXT A;  4NWY A;  1HD2 A;  1Z7P A;  4QL7 A;  2H19 A;  3UEM A;  4NXI A;  2H70 A;  2RUF A;  1T3B A;  16GS A;  2LST A;  3UAP A;  4KW6 A;  2V6O A;  2LJK A;  3J7Y k;  2H0I A;  3GKK A;  3EU4 A;  1ST9 A;  2M46 A;  4LMV A;  5E4W A;  1WOU A;  2H1B A;  1TW9 A;  4MP4 A;  1X9W B;  4CDO A;  2TIR A;  1Z3E A;  4TW5 A;  5ECN B;  4IJI A;  5DJL A;  5IMC A;  4K0N A;  1GRX A;  4TR3 A;  4Z7X A;  3NOF A;  1O6J A;  5EPF A;  1GTU A;  2TRC P;  3H8Q A;  2OE3 A;  3HZ4 A;  1F2E A;  2O8V B;  6GST A;  1F37 A;  3QDN A;  2VCW A;  3ERF A;  3F63 A;  2NPB A;  2H74 A;  4POM A;  3M8N A;  4ID0 A;  4GQC A;  2MMZ A;  1FAA A;  1O85 A;  1Z7R A;  4G9H A;  3IA1 A;  4IGJ A;  3TRP A;  4OCE A;  2DIZ A;  2YN1 A;  1Z6M A;  4RQX A;  5IMZ A;  5G5E A;  2FWF A;  3VWV A;  4MLY A;  5DBQ A;  1TKD B;  3CYN A;  3ZFL A;  2HLS A;  3QR6 A;  1FOV A;  1TU8 A;  3F0I A;  3DRN A;  3KP8 A;  3H4K A;  2IL3 A;  4KSM A;  3FZA A;  5IPH A;  3DVW A;  1H75 A;  3GTU A;  1OC9 A;  2WDU A;  1LU4 A;  4RQR A;  2WZ9 A;  3ZIJ A;  3EWL A;  1BG5 A;  1UN2 A;  1MDK A;  2L4C A;  2LEG A;  1SYR A;  2R4V A;  3CBU A;  1I5G A;  3O6T A;  3FW2 A;  5G31 A;  5ECM B;  2VUP A;  3GMF A;  3UJ1 A;  4MZC A;  3F9U A;  1TDI A;  4MAB A;  1ABA A;  1WWJ A; 
#chains in the Genus database with same CATH topology
 5IM9 A;  1OAZ A;  2JZT A;  1RW1 A;  2HT9 A;  3P8W A;  1EGR A;  3IHQ A;  5DQY A;  1O8W A;  5ECK B;  3SWL A;  2H1A A;  5HFG A;  5INY A;  2CZ3 A;  4D73 A;  4XIH A;  1TOF A;  3HVS A;  1PQN A;  4XHM A;  1CQG A;  4YH2 A;  4TR4 A;  2CVB A;  4Q5R A;  1SL1 B;  3UL3 A;  1X9M B;  3F6D A;  4AJ8 A;  5GZZ B;  3KJY A;  1GSQ A;  5JCG A;  3DD3 A;  4V2L A;  2E2M A;  4OO4 A;  2V1M A;  2LTK A;  2QA1 A;  5DCH A;  4O5R A;  3L9V A;  4BA7 A;  2R5G A;  4J2F A;  2B5E A;  1EP8 A;  2CA8 A;  4MZB A;  3GKM A;  3IXR A;  3RHC A;  1FVJ A;  4BWS A;  2H6Y A;  3VWU A;  2QGV A;  2FY6 A;  1YJ6 A;  4MH3 A;  4ZB6 A;  4F0C A;  2P5R A;  1XWB A;  6GSY A;  5LCZ A;  1X5C A;  4OMV A;  3TKQ A;  2R6K A;  2JU5 A;  4LMW A;  2QC7 A;  4RI7 A;  1SD8 A;  2I3Y A;  2NBS A;  5E59 A;  3P2A A;  2H01 A;  4F9Z A;  2KP2 A;  1V57 A;  3KM6 A;  5KOX A;  1YF0 A;  2YJ7 A;  4XCS A;  1XOA A;  3EPT A;  2YWO A;  3M9K A;  4G0K A;  1XOB A;  3MDK A;  2L5L A;  4K0G A;  2B6M A;  3HJP A;  4X43 A;  1FHE A;  3MNG A;  4XS6 A;  3A2X A;  1AXD A;  5ID2 B;  1G0T A;  4XTS A;  5HR1 A;  4H86 A;  2E2G A;  5C00 A;  4HI7 A;  1N2A A;  4NMU A;  3NZN A;  3GX8 A;  1TI1 A;  5EL8 A;  1PKW A;  4K2X A;  2YV9 A;  5D9T A;  4Z2T A;  1OVN A;  3GX0 A;  2BTO T;  5B8B A;  5H5Q A;  2AUV A;  4MF6 A;  1SJI A;  1PN0 A;  3DML A;  1RK4 A;  2GST A;  3U6V A;  3A2W A;  3VK9 A;  2H30 A;  5ENU A;  3TRX A;  3TJK A;  4LL1 B;  1G6W A;  1TI3 A;  5ECS A;  8GSS A;  4ICY A;  1EZK A;  3EVI A;  3E9J B;  1XW5 A;  5HQP A;  1TRU A;  3TKS C;  5IMF A;  1USB A;  1TK5 B;  1S3A A;  1BAY A;  2VL3 A;  1ERU A;  1GLQ A;  1THX A;  2PVQ A;  5IOX A;  2DBC A;  2RUE A;  2LRN A;  3GRX A;  1ZGN A;  1A0F A;  3DXB A;  2LUS A;  3CTG A;  6GSS A;  1ZMA A;  5ABR A;  5B8A A;  3HHV A;  1E2Y A;  5D93 A;  2B7J A;  4K5R A;  1ZCP A;  4PUF C;  3H1N A;  2DJK A;  2F51 A;  3TJB A;  4TR1 A;  3E0U A;  1JZO A;  1AW9 A;  4PTS A;  4ECI A;  2K6V A;  1U88 A;  1GH2 A;  5FWG A;  3QPM A;  1M9B A;  3FRC A;  4XRA A;  5GST A;  4EE0 A;  4BVX B;  1UA5 A;  3UVH A;  1QFN A;  1ON4 A;  2I9H A;  5B6M A;  3GFK A;  4K6X A;  4NHW A;  4ML6 A;  1JLV A;  2DML A;  2F3M A;  2IIY A;  2MBS A;  4NV2 A;  1W89 A;  2CX3 A;  1XFL A;  1G7O A;  4JU5 A;  2VCZ A;  3G9B A;  1GSU A;  5IPG A;  5KN1 A;  3S9F A;  3GKX A;  1YDK A;  1ZYN A;  2IWT A;  3M1G A;  5KN0 A;  3QFA C;  1F3B A;  4MZW A;  4OFN A;  4IS0 A;  2YJH A;  3C1R A;  2VM1 A;  1GSY A;  2X49 A;  1J0F A;  4L5L A;  3PIN A;  7GSS A;  1JFU A;  3N5O A;  2R2J A;  2B5X A;  5HR2 A;  4MCU A;  4JZQ A;  3A3T A;  3IDV A;  4WF5 A;  3ERG A;  5D9V A;  4Z2R A;  2CX4 A;  2KOK A;  4ILF A;  5D73 A;  3PR8 A;  1K0B A;  2DSA A;  3L0H A;  2H75 A;  3KMO A;  2YCD A;  3ED3 A;  4OD7 A;  2J23 A;  3IE3 A;  3ISO A;  4O32 A;  1PL1 A;  1C72 A;  5CRH A;  3F4S A;  4ECB A;  3I9V 2;  2H76 A;  2JSZ A;  1TK0 B;  2PER A;  2MBT A;  1Z6N A;  3HKR A;  5DDL A;  2HXK A;  1ACV A;  2FCH A;  4WEY A;  1ERT A;  3TB2 A;  1M2A A;  1AUC A;  5L71 A;  4USS A;  2VCV A;  1I9D A;  4N11 A;  2O89 A;  1XWA A;  1K3Y A;  1EWX A;  2H0H A;  1RQM A;  3RDW A;  2OE0 A;  4KE3 A;  2D2Z A;  3FYG A;  4KCA A;  3EE2 A;  4G0L A;  2GZZ A;  3DKS A;  4IVF A;  4O5Q A;  2EIO A;  3HJO A;  2IJY A;  4HQS A;  1YF1 A;  3LWA A;  2YP6 A;  4YQU A;  2A2R A;  2PBJ A;  5J3R A;  4MMM A;  3IK7 A;  4WBJ A;  5DVB A;  3EMP A;  4FIW A;  2YNX A;  1O73 A;  4I8B A;  4EIP A;  2L5O A;  1B4P A;  2ON7 A;  1YEX A;  1V2A A;  1EOG A;  2VD0 A;  1F9M A;  3KXO A;  5DAK B;  5J9C A;  4LL4 B;  2GGT A;  1HNB A;  2VL9 A;  3QD9 A;  2H0G A;  2C3T A;  2OAD A;  4KDY A;  1T1V A;  4I5Q A;  3C1S A;  3FR9 A;  1SYX A;  2A4H A;  3C7M A;  1PA3 A;  3M9J A;  2M80 A;  2I4A A;  1UVZ A;  1ZZY A;  2IFQ B;  3F3R A;  3GSS A;  5H5S A;  4K7O A;  1PFO A;  2C1Y A;  2HNL A;  3IC4 A;  3GUR A;  2B5Y A;  4V2M A;  4KGI A;  2H6Z A;  4I6X A;  3ZL5 A;  4EDY A;  4Q5F A;  3RPN A;  5LD0 A;  5G1K A;  3VFI A;  3LQ7 A;  1SK2 A;  3ZML A;  2GLR A;  5DCG A;  4YKG A;  3RPP A;  1J9B A;  5AIV A;  3DWV A;  2YOI A;  1MEK A;  3HZ8 A;  3GN3 A;  1SEN A;  1T7P B;  5ECI B;  1DE2 A;  2HYX A;  4KX4 A;  1YKA A;  2VAF A;  5JCU A;  3CXG A;  3KP9 A;  2O87 A;  1OKT A;  2FHE A;  1GTB A;  2HRA A;  4IKH A;  2IMK A;  4HZ2 A;  4HS1 A;  4X4J A;  4KAE A;  4POK A;  4IP6 A;  3CMI A;  2WFC A;  3MSZ A;  1WP0 A;  5KEJ A;  4WKW A;  5IMD A;  3BJ5 A;  3F4R A;  2X8C A;  3Q6O A;  1TRW A;  5GSS A;  3KH9 A;  1JLW A;  4FYB A;  1GL8 A;  2L4Q A;  3F8U A;  2LQO A;  4MA9 A;  4OFM A;  19GS A;  1GSF A;  3CRU A;  1ILO A;  3AY8 A;  3CRT A;  3SBC A;  3D21 A;  1ERV A;  1R26 A;  2FD3 A;  1XG8 A;  4DSS B;  2QSI A;  5ECL B;  1VGL A;  1NM3 A;  2YZU A;  3TUE A;  2HZE B;  3WT1 A;  4KH7 A;  2VLV A;  3VLN A;  6GSX A;  2N5B A;  3OR5 A;  2K8V A;  1B4Q A;  2IMF A;  4F2I A;  3UOM A;  2HRF A;  4X0X A;  4KND A;  1EEJ A;  3I6A A;  3M3M A;  2IMI A;  4MJA A;  3O3T A;  2P31 A;  1AAZ A;  1ZYE A;  2GSS A;  2FGX A;  4PX1 A;  2GQL A;  2LV3 A;  4BIK A;  4PQ1 A;  4TXV A;  5IOW A;  4ECC A;  1FG4 A;  2M72 A;  2WRT A;  3PH9 A;  5ECO B;  2PGT A;  4L0U A;  2FWE A;  3P7X A;  4Z2U A;  2PU9 C;  4GRF A;  4PNF A;  3IAM 2;  1B8X A;  4MK3 A;  2FLS A;  4JED A;  1SU9 A;  2A2S A;  4ZL9 A;  4KA0 A;  5HR0 A;  2CAI A;  1K3L A;  6GSU A;  3TKP A;  5COH A;  4PUA A;  5DAL B;  1XIY A;  4CY6 A;  1FB0 A;  4GXZ A;  5CNW A;  3FKF A;  2OAC A;  3TKR A;  1SL2 B;  3LYP A;  4HQZ A;  3HVN A;  1H4O A;  3DEX A;  4MDC A;  1KTE A;  3VWX A;  2GZP A;  3P90 A;  4BPY A;  3Q18 A;  4BL7 B;  4YAV A;  2GZY A;  3DIE A;  4CW9 A;  4JBB A;  1HNA A;  5BMU A;  1TTZ A;  1U3A A;  4IBP A;  1ZL9 A;  1TXX A;  4ZBB A;  1A2L A;  2OBK A;  3GYK A;  2I81 A;  1CQH A;  5J9B A;  2WCI A;  2X8G A;  2X8H A;  5J41 A;  1MD3 A;  4ML1 A;  2DJ2 A;  2IME A;  2MMA A;  2VD1 A;  3IOS A;  3ZLP A;  4O5U A;  4PXO A;  1XWC A;  3EYT A;  1TP9 A;  1GUL A;  4EKZ A;  2HI7 A;  4G0I A;  3TOU A;  4ULX A;  1N8J A;  3LFL A;  2A2P A;  4EUY A;  2F8A A;  1W4V A;  4DSR A;  2AJQ B;  5C04 A;  1BQ7 A;  2HRN A;  3KCM A;  3MIX A;  5F05 A;  1SKR B;  3LGC A;  5HR3 A;  1K3O A;  2DJ0 A;  5JWR B;  3TKS E;  4ECJ A;  4EXJ A;  2DKI A;  1QK8 A;  1SKW B;  1B48 A;  1THO A;  4KSO A;  2K9F A;  5EVO A;  1GSD A;  1XCC A;  3ZVJ D;  1XPV A;  5B7C A;  1XBS A;  4TR1 B;  1B9Y C;  2VCT A;  4TXO A;  2NVL A;  1YY7 A;  1FW1 A;  5D96 A;  2VL2 C;  2YWI A;  2FNO A;  5F07 A;  4N30 A;  2JZR A;  1BX9 A;  3C8E A;  2LRC A;  4ZB8 A;  3TRQ A;  3IV4 A;  1B9X C;  4F82 A;  1DUG A;  3FK8 A;  2H8L A;  3KH7 A;  3PGT A;  3LSZ A;  2XBI A;  3ME7 A;  3KTB A;  2CVK A;  2MYG A;  1R4W A;  1T4Y A;  2V41 A;  4PQH A;  1M3J A;  3FZ5 A;  2IN3 A;  3W8S A;  2LS5 A;  2DLX A;  4OO5 A;  3H79 A;  2WB9 A;  3UVT A;  3IRA A;  4BVY B;  4QL9 A;  3GNJ A;  4K2D A;  3WGX A;  1TJD A;  3J7Y b;  1EV4 A;  4JR4 A;  4J57 E;  1NHO A;  3FZ4 A;  1WJK A;  5ELG A;  5KOW A;  12GS A;  1TRV A;  4MPG A;  2JL4 A;  4KB3 A;  3VUR A;  1IYH A;  3R3E A;  4HUA A;  4ZB9 A;  1UC7 A;  3IBH A;  3HY2 A;  3ERW A;  3L78 A;  1GWC A;  4E8H A;  5IO0 A;  5DJM A;  4OWY A;  2VOC A;  1O8X A;  20GS A;  2C8U A;  4MNN A;  4RUV A;  2ALB A;  1EOH A;  1XW9 A;  1SJZ A;  4PGT A;  4GF0 A;  2HE3 A;  1M7T A;  3CQF A;  5FHI A;  3E3E A;  1U3I A;  2ZNM A;  1X5E A;  2DJ1 A;  3GST A;  2QA2 A;  2JSY A;  4V1A p;  2IMD A;  2GT5 A;  3V1W A;  2X99 A;  2GQM A;  4ZBD A;  5J4U A;  1A23 A;  5ELA A;  2L59 A;  4E8E A;  2L57 A;  4YAP A;  2LNT A;  1NHY A;  3ZZX A;  3BCI A;  3TKS A;  5AIX A;  1YEP A;  5CRD A;  2F9S A;  1M3I A;  5A4U A;  4POL A;  4JRR A;  4XS1 A;  1AQX A;  1EV9 A;  3TJJ A;  2KHP A;  4GSN A;  2IPA A;  4HU9 A;  5CO3 A;  5EY6 A;  4F0B A;  4O92 A;  2YAN A;  3UIW A;  4AGS A;  3TGZ A;  5FT3 A;  1AQW A;  1YZX A;  3L9S A;  2C3Q A;  3TJG A;  4L0W A;  4P3Y B;  1OYJ A;  2Z9S A;  3LJR A;  1PGT A;  2LNS A;  1M2D A;  1A8L A;  1IYI A;  5A4V A;  1F6M C;  3APQ A;  3U5R E;  1R5P A;  1OE7 A;  1VRS D;  2HZF A;  1GSE A;  5D8I A;  2V6K A;  4TKY A;  1O7U A;  2C0E A;  4JR6 A;  2LQQ A;  1K0D A;  4WBR D;  3RHB A;  2MMN A;  3G7I A;  2R37 A;  3IK9 A;  2H72 A;  2JZS A;  1MDJ A;  3GH6 A;  2ON5 A;  1JHB A;  2H6X A;  3F6F A;  4TOP A;  3GUS A;  2L6D A;  2VLU A;  4KDX A;  3NIV A;  3ZTL A;  3DYR A;  3FR3 A;  3QCP A;  11GS A;  1ERW A;  2DJJ A;  4AF2 A;  1PX6 A;  1PD2 1;  5IIZ A;  2H1D A;  10GS A;  4FH8 A;  2C80 A;  4V2N A;  5G30 A;  4KUN A;  1Y25 A;  3UMA A;  3WT2 A;  1XVQ A;  4TVE A;  2O85 A;  4NHZ A;  1A8Y A;  1X5D A;  3GL5 A;  2R3X A;  1G6Y A;  2YWN A;  4XS4 A;  4GQF A;  2REM A;  4GCI A;  3HA9 A;  1EP7 A;  2AV4 A;  3HYP A;  1HYU A;  1MD4 A;  3ZFB A;  1URM A;  2KUC A;  3APO A;  1K0A A;  2H71 A;  1BJX A;  1EEM A;  4HU7 A;  1SD9 A;  1Q98 A;  4IJ3 A;  1ML6 A;  3LXT A;  3FR6 A;  4X1U A;  6GSV A;  5H5R A;  1MTC A;  3US3 A;  5JWQ B;  3UBK A;  1GLP A;  4K5S A;  1A2J A;  3JCM L;  17GS A;  3K8N A;  4WET A;  1SKS B;  3IR4 A;  2QKE A;  2BJX A;  2CAQ A;  3G7Y A;  1E6B A;  9GSS A;  1SK1 A;  4MF5 A;  3GIX A;  2N5F A;  1T4Z A;  4JE1 A;  2XC2 A;  3HD5 A;  2LJR A;  1TU7 A;  3GTU B;  1OC9 B;  4ZIJ A;  1AIU A;  3QAV A;  3FMW A;  2XPD A;  3BOA A;  5AN1 A;  3APS A;  4EO3 A;  1TRS A;  4AJ7 A;  3L4N A;  2CV4 A;  2K8S A;  5DAK A;  2YPM A;  1PSQ A;  4LA1 A;  1LJR A;  4IEL A;  4EC0 A;  3HCZ A;  2R0C A;  3MAK A;  4TR0 A;  1GTA A;  3M0F A;  1XW6 A;  2EC4 A;  2EIQ A;  1R5A A;  3PPU A;  3VWW A;  3LG6 A;  4I97 A;  13GS A;  3LXZ A;  5G2Z A;  2R0G A;  5CRG A;  3KTL A;  3F3Q A;  2G0F A;  1FVK A;  2IFQ A;  3DGQ A;  2GS3 A;  4N0Z A;  1AC1 A;  5GAP D;  1DSB A;  3QMX A;  4D73 B;  1WMJ A;  3CSI A;  3UAR A;  2LRT A;  3EUR A;  4EDZ A;  1JZR A;  4WF4 A;  3L9U A;  2H66 A;  4DSQ A;  4ZBA A;  2RM5 A;  5AIS A;  1FO5 A;  1QXH A;  2XBQ A;  3ZIT A;  1XWG A;  3GA4 A;  1VF4 A;  2OKA A;  5JCW A;  2DIY A;  3WGE A;  4GTU A;  3WYW A;  2YWM A;  5G5F A;  1YQ1 A;  2DMM A;  2H73 A;  4YQM A;  1LBK A;  3VPT A;  1EGO A;  3QAG A;  4IHU A;  2AB6 A;  4HZ4 A;  3GHA A;  5G1L A;  3D0Z A;  1U87 A;  1WRY A;  5A5K A;  1OE8 A;  2H1G A;  2FA4 A;  5CRE A;  5IO2 A;  4Q5N A;  1PN9 A;  2X4A A;  3CTF A;  6GSW A;  4K7I A;  5KN3 A;  1BED A;  1GSS A;  1HQO A;  2C4J A;  3IHG A;  2BMX A;  5GAN D;  2VLT A;  4V1A g;  3GKN A;  1SL0 B;  5KN2 A;  3KIJ A;  1T8E B;  2GSQ A;  1WPI A;  3HXS A;  3I43 A;  4OCF A;  4QQ7 A;  2CZ2 A;  2B3S A;  3CSH A;  2CQ9 A;  1OC3 A;  4ZIL A;  1M0U A;  4DSS A;  2K18 A;  4G10 A;  5CYY A;  3EIN A;  2HZE A;  1V98 A;  3GV1 A;  2ZCT A;  4TXO B;  4GLT A;  1M99 A;  4FYC A;  2LKU A;  2FUG 2;  1SK0 A;  2VM2 A;  2FWG A;  3VI7 A;  1HNC A;  2AAW A;  3UBL A;  2P0G A;  3O76 A;  3W6G A;  4HOJ A;  5AGY A;  5CAX A;  2V2G A;  2KLX A;  1QGV A;  1XWK A;  4MJC A;  4ISD A;  2WJU A;  4YQV A;  3D4T A;  4OFT A;  3LW9 A;  1AQV A;  2ES7 A;  2GVP A;  2PN8 A;  4HJ2 A;  2HFD A;  3KEB A;  3HDC A;  4FYU A;  2RII A;  4AJ6 A;  1K0O A;  1QQ2 A;  4DVC A;  4L8E A;  2VO4 A;  5ECP B;  2PVO C;  2A4V A;  4FO5 A;  2E0Q A;  3EU3 A;  4K8M A;  3DVX A;  1VF3 A;  3MWH A;  1S3D A;  2XHF A;  2NDO A;  3KGK A;  4HDE A;  1FB6 A;  5DAL A;  4WR4 A;  4MJB A;  3ZMK A;  1OC8 A;  5ECQ B;  2TRX A;  2VIM A;  5ECR B;  1KBN A;  4ZL7 A;  2FWH A;  3BBY A;  3IAS 2;  2JAC A;  3KD0 A;  4L5O A;  1PKZ A;  4BL7 A;  2LJA A;  1PRX A;  3CSJ A;  3QOU A;  1Z9H A;  2OJL A;  1XVW A;  4I2U A;  1A0R P;  3HVV A;  4NAX A;  2L6C A;  4Q5Q A;  3A5I A;  3Q74 A;  3GH9 A;  3FY7 A;  2B1K A;  3TDG A;  4LLR A;  2P5Q A;  4O7H A;  3W8J A;  4FQU A;  4N10 A;  1A24 A;  3H93 A;  2PUK C;  4IN0 A;  4IW9 A;  4K9Z A;  1GUK A;  5B6N A;  1DBY A;  4EL1 A;  1ZYQ B;  3A2V A;  2C0D A;  4EF0 A;  1G7E A;  4J56 E;  1MDI A;  5JWO B;  3WD6 A;  3FZ9 A;  2OA7 A;  1GUM A;  3VPQ A;  14GS A;  1K0N A;  18GS A;  2C0F A;  5F0G A;  1VF2 A;  3MYD A;  5ID2 A;  4IP1 A;  3ZIV A;  3LOR A;  1S3C A;  2DJ3 A;  3RAZ A;  3C73 A;  1S3R A;  1PX7 A;  1ZOF A;  4KF9 A;  1NW2 A;  4HJM A;  1WE0 A;  2GDR A;  3ZRE A;  4KCE A;  3ZVJ A;  1Q4J A;  2YZH A;  3IC8 A;  4MF7 A;  2F8F A;  2DC5 A;  2J9H A;  1A2M A;  2HSH A;  1PL2 A;  5IQY A;  3QFB C;  3A5W A;  2VCX A;  4F03 A;  4NPB A;  2RLI A;  5LNK e;  2VL2 A;  2GSR A;  1JZW A;  3G7J A;  2AHE A;  1TK8 B;  5HFI A;  1XZO A;  2DKH A;  4ACS A;  3FEU A;  3BD2 A;  1O81 A;  3LEF A;  5F06 A;  1X9S B;  1GNE A;  4TN8 A;  2O7K A;  2UZ8 A;  2HSY A;  5D9W A;  3VI5 A;  4MH2 A;  4GWR A;  4PQI A;  1JZD A;  1K0C A;  1ZYP A;  3LYK A;  1X0R A;  2B1L A;  4GSS A;  1M2B A;  1DE1 A;  2V32 A;  3FHK A;  4BVY A;  1BYE A;  5J5N A;  2CT6 A;  2PWJ A;  3QAW A;  2C3N A;  5DQS A;  3C71 A;  4ZL8 A;  3ZRD A;  2E7P A;  5D9X A;  2HSM A;  2N5A A;  5CP1 A;  2OBI A;  2NTO A;  4KDU A;  2FA8 A;  2JAD A;  3D6I A;  3N9J A;  2CVD A;  4BVX A;  1GTI A;  3F4T A;  2RM6 A;  1V40 A;  1F3A A;  3HJM A;  4XS4 B;  2GT6 A;  1GUH A;  3D5J A;  1XXU A;  5F8B A;  4HEA 2;  1V9W A;  4POB A;  2GQK A;  1R7H A;  1VF1 A;  2MMO A;  2R0P A;  3Q19 A;  3KZQ A;  2C0G A;  4TRX A;  1NSW A;  3GL3 A;  1M9A A;  5IMV A;  5A4W A;  4CHS A;  1GP1 A;  5ECH B;  4PNG A;  2WS2 A;  4EVM A;  3I69 A;  4N0V A;  4MJE A;  2PMT A;  2WUL A;  1KEB A;  3ME8 A;  4G19 A;  4WR5 A;  4GST A;  1V58 A;  1WIK A;  4RI6 A;  4ZXG A;  3KMN A;  1GNW A;  1OKD A;  2G2Q A;  2YV7 A;  2XPE A;  2MZC A;  4IQ1 A;  1SJ6 A;  5HFK A;  3WGD A;  1QUW A;  3TJF A;  3BCK A;  4EIQ A;  4MPF A;  3IPZ A;  2HRK A;  5IMA A;  3HVX A;  1KNG A;  2KP1 A;  3D22 A;  2X64 A;  3R2Q A;  4IQA A;  4XRD A;  2B7K A;  1T00 A;  2WGR A;  4PUR A;  3ZYW A;  3EC3 A;  3RBT A;  3EMX A;  4K1F A;  22GS A;  1QMV A;  1YKC A;  1Z5Y E;  3TOT A;  4DEJ A;  2I1U A;  4BWQ A;  1J08 A;  2EIR A;  1K0M A;  4NV5 A;  2AYT A;  2PPT A;  1PMT A;  1U6T A;  2VCQ A;  2GTU A;  5CRW A;  3D4M A;  3TCO A;  2OE1 A;  4I2T A;  4G2E A;  1Y6E A;  4K7N A;  2ZUP A;  4WXT A;  4NWY A;  1HD2 A;  1FOH A;  1Z7P A;  4QL7 A;  2H19 A;  3UEM A;  4NXI A;  2H70 A;  2RUF A;  1T3B A;  16GS A;  2LST A;  3UAP A;  4KW6 A;  2V6O A;  2LJK A;  3J7Y k;  2H0I A;  3GKK A;  3EU4 A;  1ST9 A;  2M46 A;  4LMV A;  5E4W A;  1WOU A;  2H1B A;  1TW9 A;  4MP4 A;  1X9W B;  4CDO A;  2TIR A;  1Z3E A;  4TW5 A;  5ECN B;  4IJI A;  5DJL A;  5IMC A;  5BRT A;  4K0N A;  1GRX A;  4TR3 A;  4Z7X A;  3NOF A;  1O6J A;  5EPF A;  1GTU A;  2TRC P;  3H8Q A;  2OE3 A;  3HZ4 A;  1F2E A;  2O8V B;  6GST A;  1F37 A;  3QDN A;  2VCW A;  3ERF A;  3F63 A;  2NPB A;  2H74 A;  4POM A;  3M8N A;  4ID0 A;  4GQC A;  2MMZ A;  1FAA A;  1O85 A;  1Z7R A;  4G9H A;  3IA1 A;  4IGJ A;  3TRP A;  4OCE A;  2DIZ A;  2YN1 A;  1Z6M A;  4A5P A;  4RQX A;  5IMZ A;  5G5E A;  2FWF A;  3VWV A;  4MLY A;  5DBQ A;  1TKD B;  3CYN A;  4YKF A;  3ZFL A;  2HLS A;  3QR6 A;  1FOV A;  1TU8 A;  3F0I A;  3DRN A;  3KP8 A;  3H4K A;  2IL3 A;  4KSM A;  3FZA A;  5IPH A;  3DVW A;  4CY8 A;  1H75 A;  3GTU A;  1OC9 A;  2WDU A;  1LU4 A;  4RQR A;  2WZ9 A;  3ZIJ A;  3EWL A;  1BG5 A;  1UN2 A;  1MDK A;  2L4C A;  2LEG A;  1SYR A;  2R4V A;  3CBU A;  1I5G A;  3O6T A;  3FW2 A;  5G31 A;  5ECM B;  2VUP A;  3GMF A;  3UJ1 A;  4HSC X;  4MZC A;  3F9U A;  1TDI A;  4MAB A;  1ABA A;  1WWJ A; 
#chains in the Genus database with same CATH homology
 5IM9 A;  1OAZ A;  2JZT A;  1RW1 A;  2HT9 A;  3P8W A;  1EGR A;  3IHQ A;  5DQY A;  1O8W A;  5ECK B;  3SWL A;  2H1A A;  5HFG A;  5INY A;  2CZ3 A;  4D73 A;  4XIH A;  1TOF A;  3HVS A;  1PQN A;  4XHM A;  1CQG A;  4YH2 A;  4TR4 A;  2CVB A;  4Q5R A;  1SL1 B;  3UL3 A;  1X9M B;  3F6D A;  4AJ8 A;  5GZZ B;  3KJY A;  1GSQ A;  5JCG A;  3DD3 A;  4V2L A;  2E2M A;  4OO4 A;  2V1M A;  2LTK A;  2QA1 A;  5DCH A;  4O5R A;  3L9V A;  4BA7 A;  2R5G A;  4J2F A;  2B5E A;  1EP8 A;  2CA8 A;  4MZB A;  3GKM A;  3IXR A;  3RHC A;  1FVJ A;  4BWS A;  2H6Y A;  3VWU A;  2QGV A;  2FY6 A;  1YJ6 A;  4MH3 A;  4ZB6 A;  4F0C A;  2P5R A;  1XWB A;  6GSY A;  5LCZ A;  1X5C A;  4OMV A;  3TKQ A;  2R6K A;  2JU5 A;  4LMW A;  2QC7 A;  4RI7 A;  1SD8 A;  2I3Y A;  2NBS A;  5E59 A;  3P2A A;  2H01 A;  4F9Z A;  2KP2 A;  1V57 A;  3KM6 A;  5KOX A;  1YF0 A;  2YJ7 A;  4XCS A;  1XOA A;  3EPT A;  2YWO A;  3M9K A;  4G0K A;  1XOB A;  3MDK A;  2L5L A;  4K0G A;  2B6M A;  3HJP A;  4X43 A;  1FHE A;  3MNG A;  4XS6 A;  3A2X A;  1AXD A;  5ID2 B;  1G0T A;  4XTS A;  5HR1 A;  4H86 A;  2E2G A;  5C00 A;  4HI7 A;  1N2A A;  4NMU A;  3NZN A;  3GX8 A;  1TI1 A;  5EL8 A;  1PKW A;  4K2X A;  2YV9 A;  5D9T A;  4Z2T A;  1OVN A;  3GX0 A;  2BTO T;  5B8B A;  5H5Q A;  2AUV A;  4MF6 A;  1SJI A;  1PN0 A;  3DML A;  1RK4 A;  2GST A;  3U6V A;  3A2W A;  3VK9 A;  2H30 A;  5ENU A;  3TRX A;  3TJK A;  4LL1 B;  1G6W A;  1TI3 A;  5ECS A;  8GSS A;  4ICY A;  1EZK A;  3EVI A;  3E9J B;  1XW5 A;  5HQP A;  1TRU A;  3TKS C;  5IMF A;  1USB A;  1TK5 B;  1S3A A;  1BAY A;  2VL3 A;  1ERU A;  1GLQ A;  1THX A;  2PVQ A;  5IOX A;  2DBC A;  2RUE A;  2LRN A;  3GRX A;  1ZGN A;  1A0F A;  3DXB A;  2LUS A;  3CTG A;  6GSS A;  1ZMA A;  5ABR A;  5B8A A;  3HHV A;  1E2Y A;  5D93 A;  2B7J A;  4K5R A;  1ZCP A;  4PUF C;  3H1N A;  2DJK A;  2F51 A;  3TJB A;  4TR1 A;  3E0U A;  1JZO A;  1AW9 A;  4PTS A;  4ECI A;  2K6V A;  1U88 A;  1GH2 A;  5FWG A;  3QPM A;  1M9B A;  3FRC A;  4XRA A;  5GST A;  4EE0 A;  4BVX B;  1UA5 A;  3UVH A;  1QFN A;  1ON4 A;  2I9H A;  5B6M A;  3GFK A;  4K6X A;  4NHW A;  4ML6 A;  1JLV A;  2DML A;  2F3M A;  2IIY A;  2MBS A;  4NV2 A;  1W89 A;  2CX3 A;  1XFL A;  1G7O A;  4JU5 A;  2VCZ A;  3G9B A;  1GSU A;  5IPG A;  5KN1 A;  3S9F A;  3GKX A;  1YDK A;  1ZYN A;  2IWT A;  3M1G A;  5KN0 A;  3QFA C;  1F3B A;  4MZW A;  4OFN A;  4IS0 A;  2YJH A;  3C1R A;  2VM1 A;  1GSY A;  2X49 A;  1J0F A;  4L5L A;  3PIN A;  7GSS A;  1JFU A;  3N5O A;  2R2J A;  2B5X A;  5HR2 A;  4MCU A;  4JZQ A;  3A3T A;  3IDV A;  4WF5 A;  3ERG A;  5D9V A;  4Z2R A;  2CX4 A;  2KOK A;  4ILF A;  5D73 A;  3PR8 A;  1K0B A;  2DSA A;  3L0H A;  2H75 A;  3KMO A;  2YCD A;  3ED3 A;  4OD7 A;  2J23 A;  3IE3 A;  3ISO A;  4O32 A;  1PL1 A;  1C72 A;  5CRH A;  3F4S A;  4ECB A;  3I9V 2;  2H76 A;  2JSZ A;  1TK0 B;  2PER A;  2MBT A;  1Z6N A;  3HKR A;  5DDL A;  2HXK A;  1ACV A;  2FCH A;  4WEY A;  1ERT A;  3TB2 A;  1M2A A;  1AUC A;  5L71 A;  4USS A;  2VCV A;  1I9D A;  4N11 A;  2O89 A;  1XWA A;  1K3Y A;  1EWX A;  2H0H A;  1RQM A;  3RDW A;  2OE0 A;  4KE3 A;  2D2Z A;  3FYG A;  4KCA A;  3EE2 A;  4G0L A;  2GZZ A;  3DKS A;  4IVF A;  4O5Q A;  2EIO A;  3HJO A;  2IJY A;  4HQS A;  1YF1 A;  3LWA A;  2YP6 A;  4YQU A;  2A2R A;  2PBJ A;  5J3R A;  4MMM A;  3IK7 A;  4WBJ A;  5DVB A;  3EMP A;  4FIW A;  2YNX A;  1O73 A;  4I8B A;  4EIP A;  2L5O A;  1B4P A;  2ON7 A;  1YEX A;  1V2A A;  1EOG A;  2VD0 A;  1F9M A;  3KXO A;  5DAK B;  5J9C A;  4LL4 B;  2GGT A;  1HNB A;  2VL9 A;  3QD9 A;  2H0G A;  2C3T A;  2OAD A;  4KDY A;  1T1V A;  4I5Q A;  3C1S A;  3FR9 A;  1SYX A;  2A4H A;  3C7M A;  1PA3 A;  3M9J A;  2M80 A;  2I4A A;  1UVZ A;  1ZZY A;  2IFQ B;  3F3R A;  3GSS A;  5H5S A;  4K7O A;  2C1Y A;  2HNL A;  3IC4 A;  3GUR A;  2B5Y A;  4V2M A;  4KGI A;  2H6Z A;  4I6X A;  3ZL5 A;  4EDY A;  4Q5F A;  3RPN A;  5LD0 A;  5G1K A;  3VFI A;  3LQ7 A;  1SK2 A;  3ZML A;  2GLR A;  5DCG A;  4YKG A;  3RPP A;  1J9B A;  5AIV A;  3DWV A;  2YOI A;  1MEK A;  3HZ8 A;  3GN3 A;  1SEN A;  1T7P B;  5ECI B;  1DE2 A;  2HYX A;  4KX4 A;  1YKA A;  2VAF A;  5JCU A;  3CXG A;  3KP9 A;  2O87 A;  1OKT A;  2FHE A;  1GTB A;  2HRA A;  4IKH A;  2IMK A;  4HZ2 A;  4HS1 A;  4X4J A;  4KAE A;  4POK A;  4IP6 A;  3CMI A;  2WFC A;  3MSZ A;  1WP0 A;  5KEJ A;  4WKW A;  5IMD A;  3BJ5 A;  3F4R A;  2X8C A;  3Q6O A;  1TRW A;  5GSS A;  3KH9 A;  1JLW A;  4FYB A;  1GL8 A;  2L4Q A;  3F8U A;  2LQO A;  4MA9 A;  4OFM A;  19GS A;  1GSF A;  3CRU A;  1ILO A;  3AY8 A;  3CRT A;  3SBC A;  3D21 A;  1ERV A;  1R26 A;  2FD3 A;  4DSS B;  2QSI A;  5ECL B;  1VGL A;  1NM3 A;  2YZU A;  3TUE A;  2HZE B;  3WT1 A;  4KH7 A;  2VLV A;  3VLN A;  6GSX A;  2N5B A;  3OR5 A;  2K8V A;  1B4Q A;  2IMF A;  4F2I A;  3UOM A;  2HRF A;  4X0X A;  4KND A;  1EEJ A;  3I6A A;  3M3M A;  2IMI A;  4MJA A;  3O3T A;  2P31 A;  1AAZ A;  1ZYE A;  2GSS A;  2FGX A;  4PX1 A;  2GQL A;  2LV3 A;  4PQ1 A;  4TXV A;  5IOW A;  4ECC A;  1FG4 A;  2M72 A;  2WRT A;  3PH9 A;  5ECO B;  2PGT A;  4L0U A;  2FWE A;  3P7X A;  4Z2U A;  2PU9 C;  4GRF A;  4PNF A;  3IAM 2;  1B8X A;  4MK3 A;  2FLS A;  4JED A;  1SU9 A;  2A2S A;  4ZL9 A;  4KA0 A;  5HR0 A;  2CAI A;  1K3L A;  6GSU A;  3TKP A;  5COH A;  4PUA A;  5DAL B;  1XIY A;  4CY6 A;  1FB0 A;  4GXZ A;  5CNW A;  3FKF A;  2OAC A;  3TKR A;  1SL2 B;  3LYP A;  4HQZ A;  1H4O A;  3DEX A;  4MDC A;  1KTE A;  3VWX A;  2GZP A;  3P90 A;  4BPY A;  3Q18 A;  4BL7 B;  4YAV A;  2GZY A;  3DIE A;  4CW9 A;  4JBB A;  1HNA A;  5BMU A;  1TTZ A;  1U3A A;  4IBP A;  1ZL9 A;  1TXX A;  4ZBB A;  1A2L A;  2OBK A;  3GYK A;  2I81 A;  1CQH A;  5J9B A;  2WCI A;  2X8G A;  2X8H A;  5J41 A;  1MD3 A;  4ML1 A;  2DJ2 A;  2IME A;  2MMA A;  2VD1 A;  3IOS A;  3ZLP A;  4O5U A;  4PXO A;  1XWC A;  3EYT A;  1TP9 A;  1GUL A;  4EKZ A;  2HI7 A;  4G0I A;  3TOU A;  4ULX A;  1N8J A;  3LFL A;  2A2P A;  4EUY A;  2F8A A;  1W4V A;  4DSR A;  2AJQ B;  5C04 A;  1BQ7 A;  2HRN A;  3KCM A;  3MIX A;  5F05 A;  1SKR B;  3LGC A;  5HR3 A;  1K3O A;  2DJ0 A;  5JWR B;  3TKS E;  4ECJ A;  4EXJ A;  2DKI A;  1QK8 A;  1SKW B;  1B48 A;  1THO A;  4KSO A;  2K9F A;  5EVO A;  1GSD A;  1XCC A;  3ZVJ D;  1XPV A;  5B7C A;  1XBS A;  4TR1 B;  1B9Y C;  2VCT A;  4TXO A;  2NVL A;  1YY7 A;  1FW1 A;  5D96 A;  2VL2 C;  2YWI A;  2FNO A;  5F07 A;  4N30 A;  2JZR A;  1BX9 A;  3C8E A;  2LRC A;  4ZB8 A;  3TRQ A;  3IV4 A;  1B9X C;  4F82 A;  1DUG A;  3FK8 A;  2H8L A;  3KH7 A;  3PGT A;  3LSZ A;  2XBI A;  3ME7 A;  3KTB A;  2CVK A;  2MYG A;  1R4W A;  1T4Y A;  2V41 A;  4PQH A;  3FZ5 A;  2IN3 A;  3W8S A;  2LS5 A;  2DLX A;  4OO5 A;  3H79 A;  2WB9 A;  3UVT A;  3IRA A;  4BVY B;  4QL9 A;  3GNJ A;  4K2D A;  3WGX A;  1TJD A;  3J7Y b;  1EV4 A;  4JR4 A;  4J57 E;  1NHO A;  3FZ4 A;  1WJK A;  5ELG A;  5KOW A;  12GS A;  1TRV A;  4MPG A;  2JL4 A;  4KB3 A;  3VUR A;  1IYH A;  3R3E A;  4HUA A;  4ZB9 A;  1UC7 A;  3IBH A;  3HY2 A;  3ERW A;  3L78 A;  1GWC A;  4E8H A;  5IO0 A;  5DJM A;  4OWY A;  2VOC A;  1O8X A;  20GS A;  2C8U A;  4MNN A;  4RUV A;  2ALB A;  1EOH A;  1XW9 A;  1SJZ A;  4PGT A;  4GF0 A;  2HE3 A;  1M7T A;  5FHI A;  3E3E A;  1U3I A;  2ZNM A;  1X5E A;  2DJ1 A;  3GST A;  2QA2 A;  2JSY A;  4V1A p;  2IMD A;  2GT5 A;  3V1W A;  2X99 A;  2GQM A;  4ZBD A;  5J4U A;  1A23 A;  5ELA A;  2L59 A;  4E8E A;  2L57 A;  4YAP A;  2LNT A;  1NHY A;  3ZZX A;  3BCI A;  3TKS A;  5AIX A;  1YEP A;  5CRD A;  2F9S A;  5A4U A;  4POL A;  4JRR A;  4XS1 A;  1AQX A;  1EV9 A;  3TJJ A;  2KHP A;  4GSN A;  2IPA A;  4HU9 A;  5CO3 A;  5EY6 A;  4F0B A;  4O92 A;  2YAN A;  3UIW A;  4AGS A;  3TGZ A;  5FT3 A;  1AQW A;  1YZX A;  3L9S A;  2C3Q A;  3TJG A;  4L0W A;  4P3Y B;  1OYJ A;  2Z9S A;  3LJR A;  1PGT A;  2LNS A;  1M2D A;  1A8L A;  1IYI A;  5A4V A;  1F6M C;  3APQ A;  3U5R E;  1R5P A;  1OE7 A;  1VRS D;  2HZF A;  1GSE A;  5D8I A;  2V6K A;  4TKY A;  1O7U A;  2C0E A;  4JR6 A;  2LQQ A;  1K0D A;  4WBR D;  3RHB A;  2MMN A;  3G7I A;  2R37 A;  3IK9 A;  2H72 A;  2JZS A;  1MDJ A;  3GH6 A;  2ON5 A;  1JHB A;  2H6X A;  3F6F A;  4TOP A;  3GUS A;  2L6D A;  2VLU A;  4KDX A;  3NIV A;  3ZTL A;  3DYR A;  3FR3 A;  3QCP A;  11GS A;  1ERW A;  2DJJ A;  4AF2 A;  1PX6 A;  1PD2 1;  5IIZ A;  2H1D A;  10GS A;  4FH8 A;  2C80 A;  4V2N A;  5G30 A;  4KUN A;  1Y25 A;  3UMA A;  3WT2 A;  1XVQ A;  4TVE A;  2O85 A;  4NHZ A;  1A8Y A;  1X5D A;  3GL5 A;  2R3X A;  1G6Y A;  2YWN A;  4XS4 A;  4GQF A;  2REM A;  4GCI A;  3HA9 A;  1EP7 A;  2AV4 A;  3HYP A;  1HYU A;  1MD4 A;  3ZFB A;  1URM A;  2KUC A;  3APO A;  1K0A A;  2H71 A;  1BJX A;  1EEM A;  4HU7 A;  1SD9 A;  1Q98 A;  4IJ3 A;  1ML6 A;  3LXT A;  3FR6 A;  4X1U A;  6GSV A;  5H5R A;  1MTC A;  3US3 A;  5JWQ B;  3UBK A;  1GLP A;  4K5S A;  1A2J A;  3JCM L;  17GS A;  3K8N A;  4WET A;  1SKS B;  3IR4 A;  2QKE A;  2BJX A;  2CAQ A;  3G7Y A;  1E6B A;  9GSS A;  1SK1 A;  4MF5 A;  3GIX A;  2N5F A;  1T4Z A;  4JE1 A;  2XC2 A;  3HD5 A;  2LJR A;  1TU7 A;  3GTU B;  1OC9 B;  4ZIJ A;  1AIU A;  3QAV A;  3FMW A;  2XPD A;  3BOA A;  5AN1 A;  3APS A;  4EO3 A;  1TRS A;  4AJ7 A;  3L4N A;  2CV4 A;  2K8S A;  5DAK A;  2YPM A;  1PSQ A;  4LA1 A;  1LJR A;  4IEL A;  4EC0 A;  3HCZ A;  2R0C A;  3MAK A;  4TR0 A;  1GTA A;  3M0F A;  1XW6 A;  2EC4 A;  2EIQ A;  1R5A A;  3PPU A;  3VWW A;  3LG6 A;  4I97 A;  13GS A;  3LXZ A;  5G2Z A;  2R0G A;  5CRG A;  3KTL A;  3F3Q A;  2G0F A;  1FVK A;  2IFQ A;  3DGQ A;  2GS3 A;  4N0Z A;  1AC1 A;  5GAP D;  1DSB A;  3QMX A;  4D73 B;  1WMJ A;  3CSI A;  3UAR A;  2LRT A;  3EUR A;  4EDZ A;  1JZR A;  4WF4 A;  3L9U A;  2H66 A;  4DSQ A;  4ZBA A;  2RM5 A;  5AIS A;  1FO5 A;  1QXH A;  2XBQ A;  3ZIT A;  1XWG A;  3GA4 A;  1VF4 A;  2OKA A;  5JCW A;  2DIY A;  3WGE A;  4GTU A;  3WYW A;  2YWM A;  5G5F A;  1YQ1 A;  2DMM A;  2H73 A;  4YQM A;  1LBK A;  3VPT A;  1EGO A;  3QAG A;  4IHU A;  2AB6 A;  4HZ4 A;  3GHA A;  5G1L A;  3D0Z A;  1U87 A;  1WRY A;  5A5K A;  1OE8 A;  2H1G A;  2FA4 A;  5CRE A;  5IO2 A;  4Q5N A;  1PN9 A;  2X4A A;  3CTF A;  6GSW A;  4K7I A;  5KN3 A;  1BED A;  1GSS A;  1HQO A;  2C4J A;  3IHG A;  2BMX A;  5GAN D;  2VLT A;  4V1A g;  3GKN A;  1SL0 B;  5KN2 A;  3KIJ A;  1T8E B;  2GSQ A;  1WPI A;  3HXS A;  3I43 A;  4OCF A;  4QQ7 A;  2CZ2 A;  2B3S A;  3CSH A;  2CQ9 A;  1OC3 A;  4ZIL A;  1M0U A;  4DSS A;  2K18 A;  4G10 A;  5CYY A;  3EIN A;  2HZE A;  1V98 A;  3GV1 A;  2ZCT A;  4TXO B;  4GLT A;  1M99 A;  4FYC A;  2LKU A;  2FUG 2;  1SK0 A;  2VM2 A;  2FWG A;  3VI7 A;  1HNC A;  2AAW A;  3UBL A;  2P0G A;  3O76 A;  3W6G A;  4HOJ A;  5AGY A;  5CAX A;  2V2G A;  2KLX A;  1QGV A;  1XWK A;  4MJC A;  4ISD A;  2WJU A;  4YQV A;  3D4T A;  4OFT A;  3LW9 A;  1AQV A;  2ES7 A;  2GVP A;  2PN8 A;  4HJ2 A;  2HFD A;  3KEB A;  3HDC A;  4FYU A;  2RII A;  4AJ6 A;  1K0O A;  1QQ2 A;  4DVC A;  4L8E A;  2VO4 A;  5ECP B;  2PVO C;  2A4V A;  4FO5 A;  2E0Q A;  3EU3 A;  4K8M A;  3DVX A;  1VF3 A;  3MWH A;  1S3D A;  2XHF A;  2NDO A;  3KGK A;  4HDE A;  1FB6 A;  5DAL A;  4WR4 A;  4MJB A;  3ZMK A;  1OC8 A;  5ECQ B;  2TRX A;  2VIM A;  5ECR B;  1KBN A;  4ZL7 A;  2FWH A;  3BBY A;  3IAS 2;  2JAC A;  3KD0 A;  4L5O A;  1PKZ A;  4BL7 A;  2LJA A;  1PRX A;  3CSJ A;  3QOU A;  1Z9H A;  2OJL A;  1XVW A;  4I2U A;  1A0R P;  3HVV A;  4NAX A;  2L6C A;  4Q5Q A;  3A5I A;  3Q74 A;  3GH9 A;  3FY7 A;  2B1K A;  3TDG A;  4LLR A;  2P5Q A;  4O7H A;  3W8J A;  4FQU A;  4N10 A;  1A24 A;  3H93 A;  2PUK C;  4IN0 A;  4IW9 A;  4K9Z A;  1GUK A;  5B6N A;  1DBY A;  4EL1 A;  1ZYQ B;  3A2V A;  2C0D A;  4EF0 A;  1G7E A;  4J56 E;  1MDI A;  5JWO B;  3WD6 A;  3FZ9 A;  2OA7 A;  1GUM A;  3VPQ A;  14GS A;  1K0N A;  18GS A;  2C0F A;  5F0G A;  1VF2 A;  3MYD A;  5ID2 A;  4IP1 A;  3ZIV A;  3LOR A;  1S3C A;  2DJ3 A;  3RAZ A;  3C73 A;  1PX7 A;  1ZOF A;  4KF9 A;  1NW2 A;  4HJM A;  1WE0 A;  2GDR A;  3ZRE A;  4KCE A;  3ZVJ A;  1Q4J A;  2YZH A;  3IC8 A;  4MF7 A;  2F8F A;  2DC5 A;  2J9H A;  1A2M A;  2HSH A;  1PL2 A;  5IQY A;  3QFB C;  3A5W A;  2VCX A;  4F03 A;  4NPB A;  2RLI A;  5LNK e;  2VL2 A;  2GSR A;  1JZW A;  3G7J A;  2AHE A;  1TK8 B;  5HFI A;  1XZO A;  2DKH A;  4ACS A;  3FEU A;  3BD2 A;  1O81 A;  3LEF A;  5F06 A;  1X9S B;  1GNE A;  4TN8 A;  2O7K A;  2UZ8 A;  2HSY A;  5D9W A;  3VI5 A;  4MH2 A;  4GWR A;  4PQI A;  1JZD A;  1K0C A;  1ZYP A;  3LYK A;  1X0R A;  2B1L A;  4GSS A;  1M2B A;  1DE1 A;  2V32 A;  3FHK A;  4BVY A;  1BYE A;  5J5N A;  2CT6 A;  2PWJ A;  3QAW A;  2C3N A;  5DQS A;  3C71 A;  4ZL8 A;  3ZRD A;  2E7P A;  5D9X A;  2HSM A;  2N5A A;  5CP1 A;  2OBI A;  2NTO A;  4KDU A;  2FA8 A;  2JAD A;  3D6I A;  3N9J A;  2CVD A;  4BVX A;  1GTI A;  3F4T A;  2RM6 A;  1V40 A;  1F3A A;  3HJM A;  4XS4 B;  2GT6 A;  1GUH A;  3D5J A;  1XXU A;  5F8B A;  4HEA 2;  1V9W A;  4POB A;  2GQK A;  1R7H A;  1VF1 A;  2MMO A;  2R0P A;  3Q19 A;  3KZQ A;  2C0G A;  4TRX A;  1NSW A;  3GL3 A;  1M9A A;  5IMV A;  5A4W A;  4CHS A;  1GP1 A;  5ECH B;  4PNG A;  2WS2 A;  4EVM A;  3I69 A;  4N0V A;  4MJE A;  2PMT A;  2WUL A;  1KEB A;  3ME8 A;  4G19 A;  4WR5 A;  4GST A;  1V58 A;  1WIK A;  4RI6 A;  4ZXG A;  3KMN A;  1GNW A;  1OKD A;  2G2Q A;  2YV7 A;  2XPE A;  2MZC A;  4IQ1 A;  1SJ6 A;  5HFK A;  3WGD A;  1QUW A;  3TJF A;  3BCK A;  4EIQ A;  4MPF A;  3IPZ A;  2HRK A;  5IMA A;  3HVX A;  1KNG A;  2KP1 A;  3D22 A;  2X64 A;  3R2Q A;  4IQA A;  4XRD A;  2B7K A;  1T00 A;  2WGR A;  4PUR A;  3ZYW A;  3EC3 A;  3RBT A;  3EMX A;  4K1F A;  22GS A;  1QMV A;  1YKC A;  1Z5Y E;  3TOT A;  4DEJ A;  2I1U A;  4BWQ A;  1J08 A;  2EIR A;  1K0M A;  4NV5 A;  2AYT A;  2PPT A;  1PMT A;  1U6T A;  2VCQ A;  2GTU A;  5CRW A;  3D4M A;  3TCO A;  2OE1 A;  4I2T A;  4G2E A;  1Y6E A;  4K7N A;  2ZUP A;  4WXT A;  4NWY A;  1HD2 A;  1FOH A;  1Z7P A;  4QL7 A;  2H19 A;  3UEM A;  4NXI A;  2H70 A;  2RUF A;  1T3B A;  16GS A;  2LST A;  3UAP A;  4KW6 A;  2V6O A;  2LJK A;  3J7Y k;  2H0I A;  3GKK A;  3EU4 A;  1ST9 A;  2M46 A;  4LMV A;  5E4W A;  1WOU A;  2H1B A;  1TW9 A;  4MP4 A;  1X9W B;  4CDO A;  2TIR A;  1Z3E A;  4TW5 A;  5ECN B;  4IJI A;  5DJL A;  5IMC A;  5BRT A;  4K0N A;  1GRX A;  4TR3 A;  4Z7X A;  3NOF A;  1O6J A;  5EPF A;  1GTU A;  2TRC P;  3H8Q A;  2OE3 A;  3HZ4 A;  1F2E A;  2O8V B;  6GST A;  1F37 A;  3QDN A;  2VCW A;  3ERF A;  3F63 A;  2NPB A;  2H74 A;  4POM A;  3M8N A;  4ID0 A;  4GQC A;  2MMZ A;  1FAA A;  1O85 A;  1Z7R A;  4G9H A;  3IA1 A;  4IGJ A;  3TRP A;  4OCE A;  2DIZ A;  2YN1 A;  1Z6M A;  4A5P A;  4RQX A;  5IMZ A;  5G5E A;  2FWF A;  3VWV A;  4MLY A;  5DBQ A;  1TKD B;  3CYN A;  4YKF A;  3ZFL A;  2HLS A;  3QR6 A;  1FOV A;  1TU8 A;  3F0I A;  3DRN A;  3KP8 A;  3H4K A;  2IL3 A;  4KSM A;  3FZA A;  5IPH A;  3DVW A;  4CY8 A;  1H75 A;  3GTU A;  1OC9 A;  2WDU A;  1LU4 A;  4RQR A;  2WZ9 A;  3ZIJ A;  3EWL A;  1BG5 A;  1UN2 A;  1MDK A;  2L4C A;  2LEG A;  1SYR A;  2R4V A;  3CBU A;  1I5G A;  3O6T A;  3FW2 A;  5G31 A;  5ECM B;  2VUP A;  3GMF A;  3UJ1 A;  4MZC A;  3F9U A;  1TDI A;  4MAB A;  1ABA A;  1WWJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...