2B3SA

Structure of the dsba mutant (p31g-c33a)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
187
structure length
187
Chain Sequence
QYEDGKQYTTLEKPVAGAPQVLEFFSFFCGHAYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thiol:disulfide interchange protein dsbA
publication title Structure of the DSBA mutant (P31G-C33A)
rcsb
source organism Escherichia coli
total genus 61
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2b3sA00
2YZHA 3KEBA 3QFBC 4I97A 1G7EA 4QQ7A 1O8XA 3TB2A 4DSSA 2C0EA 5IMDA 2FD3A 1J9BA 3H79A 5H5SA 2O85A 3FRCA 1MDJA 3US3A 4GCIA 3ZMLA 1A2JA 4TR1B 5KN2A 4IS0A 4POMA 3RPNA 5D93A 1PN9A 4JR4A 4IJIA 2GSTA 2IMFA 3VI5A 2H75A 5ID2B 2H74A 1CQHA 1GTUA 5L71A 2YJHA 1EP8A 2YZUA 6GSYA 6GSWA 1SL1B 1HD2A 3KCMA 4J2FA 4HZ2A 1Z5YE 2DMLA 4ZBAA 5CRDA 2YWMA 3NIVA 2JZRA 2B5EA 4KH7A 5DVBA 3HZ4A 3GFKA 1T4ZA 2LRTA 2VL2C 4N30A 4HJ2A 4BWQA 3LYPA 2H1AA 1FW1A 4BVXA 4TXOB 3GSTA 3A3TA 1WE0A 5F0GA 4RI7A 1FG4A 4E8EA 3BBYA 3D5JA 1W89A 1TTZA 4XS6A 2DC5A 3BJ5A 2CAIA 1QMVA 4NV5A 1GSSA 1GTAA 3ZLPA 2AHEA 1PSQA 3P2AA 5A5KA 5G1LA 5CYYA 3MNGA 1Z7PA 1LJRA 4PQIA 3G7IA 4MLYA 12GSA 1FVKA 2YP6A 3OR5A 1K0CA 1OC8A 5AIVA 4PNFA 5J5NA 1X9WB 2VLVA 1WJKA 3TCOA 1O6JA 4F0CA 1OAZA 1WMJA 3GX0A 3H1NA 3IDVA 1X5CA 5LCZA 2YV9A 3GTUB 1TU8A 2VM2A 4KUNA 1TK5B 2JU5A 1QXHA 1JHBA 3EC3A 4ECBA 3VPQA 2VLUA 2GQMA 2RUFA 4L0WA 3TKRA 1EV4A 3GKKA 3LSZA 1XOBA 1EV9A 4K7OA 4G10A 3D6IA 2AB6A 3V1WA 1GWCA 1TDIA 2H66A 4OD7A 1SK2A 3GKMA 4IELA 1XFLA 1A0FA 2YJ7A 2GGTA 4HI7A 2J9HA 5H5RA 4NHZA 4MA9A 3K8NA 4HOJA 3FR9A 1XWGA 1X9MB 3CTFA 1B4QA 2L4CA 3E0UA 3APOA 3UVTA 2H70A 4Q5QA 3MWHA 1O8WA 2GT5A 1X0RA 2LTKA 2FA8A 1ZL9A 3IV4A 2KP2A 3A2XA 4XS4B 1VGLA 5E59A 1OKDA 4BL7A 1THOA 3ZIJA 5DAKB 2AYTA 5KEJA 2X8GA 4GXZA 1AQXA 2F8AA 1XOAA 3GA4A 1K0OA 1NHYA 2I81A 3TDGA 3TGZA 1QK8A 3FZ9A 1ABAA 5ECRB 4KX4A 2DJKA 2LKUA 5B6MA 3UJ1A 1GLQA 3O76A 5KN3A 1OE8A 3TJFA 5ECIB 3GNJA 5IQYA 1H4OA 19GSA 1GRXA 2E7PA 3IK7A 2R4VA 4WBRD 3C71A 3F4RA 3FZ4A 3GN3A 1V58A 1ZCPA 5A4VA 1DUGA 1KTEA 2IJYA 4F2IA 1YF1A 4K1FA 4MMMA 2HRNA 2OJLA 4GSTA 4PUAA 2Z9SA 4L0UA 2L57A 3UL3A 2MYGA 1PKWA 2OBIA 4XIHA 1SYXA 5D8IA 3CRTA 5D9VA 2LSTA 1VF2A 5D73A 3LXZA 2YOIA 1ILOA 1SKRB 2FUG2 2NPBA 1A2MA 2IMEA 4JE1A 2AAWA 3TJBA 1F3BA 3N5OA 3KTBA 1VRSD 4E8HA 1TOFA 1GSUA 1SYRA 1KEBA 5F06A 1QFNA 4HU9A 2H6XA 2AUVA 2EIRA 2L5LA 1WP0A 3GHAA 3QCPA 4X1UA 4ZL8A 3VK9A 1J0FA 2XPEA 2H8LA 2OKAA 2C4JA 1H75A 1PD21 4X43A 4KW6A 11GSA 2C0DA 4LA1A 5ECNB 3E3EA 4GLTA 2B5YA 3EWLA 4KNDA 3LWAA 1M0UA 4I8BA 3TRPA 3NOFA 4MP4A 5HFGA 2I3YA 3TKSA 3WT2A 1Y6EA 2JZSA 2RUEA 2DJ0A 2FY6A 9GSSA 4Z7XA 3EVIA 2LS5A 5LD0A 3DVWA 3UVHA 2DLXA 1QGVA 1JZRA 2E2MA 1ZMAA 3I9V2 1G6YA 5G5FA 1GUKA 3ERGA 4TN8A 2MMZA 2KOKA 3LJRA 5HR3A 6GSXA 3J7Yk 4JRRA 4HS1A 14GSA 2ZCTA 3R2QA 1T3BA 3L9UA 1T1VA 2HSYA 3EU4A 3HYPA 3M0FA 4K7IA 4PX1A 2I4AA 2IIYA 4LMWA 3H4KA 1ZZYA 3AY8A 1GULA 5GAPD 1RQMA 3DRNA 3QAWA 1GSDA 1Z9HA 4MK3A 5J41A 2E2GA 2M46A 5GAND 2L4QA 4NAXA 3ZITA 1GUHA 2O87A 4IJ3A 1BQ7A 5JWRB 3DIEA 2VIMA 4MPGA 1TP9A 3PGTA 4YQMA 5GSTA 2LEGA 4ZXGA 3C1SA 2ZNMA 1R4WA 2WGRA 5DQYA 2G0FA 3IPZA 3GYKA 4KAEA 2QGVA 1UN2A 4XHMA 1S3AA 2FWGA 4XCSA 2LQQA 5ECPB 2EIOA 1V40A 2VCZA 5ECMB 1U88A 2DJ3A 3GRXA 2FCHA 3UBKA 3GH6A 2C0FA 1GTBA 3BD2A 2DMMA 2IL3A 5FT3A 1BYEA 1M2BA 2K9FA 2H76A 2LV3A 3F63A 1MEKA 2LJAA 1K0AA 4TRXA 1URMA 4GSNA 3TOUA 2PERA 4HUAA 2H19A 1A2LA 3UMAA 1FOVA 1YKCA 2H1DA 3GKXA 3ZYWA 4EDYA 3TRXA 5G31A 1DSBA 13GSA 5ECQB 2HLSA 2O8VB 2X99A 5IMZA 3ED3A 4O5RA 4N11A 1F3AA 4EUYA 4EL1A 3CRUA 2BJXA 1FB0A 2YWNA 3W8SA 3CMIA 3F3QA 3DMLA 3WYWA 2C8UA 3FR6A 1GSFA 3CXGA 2YN1A 3GUSA 2VD1A 5ELGA 4XTSA 1DBYA 3CYNA 2LRCA 3VI7A 1OC9A 1PX6A 2MMNA 4RUVA 4YQVA 4K0GA 1TRSA 4HDEA 1BJXA 2QC7A 2H1BA 3TOTA 1EP7A 2VO4A 1Z7RA 4H86A 3I6AA 22GSA 2VCQA 1T4YA 4K0NA 1YQ1A 5AISA 5H5QA 1HNBA 4IVFA 1PGTA 1O85A 2VM1A 1EGRA 2PU9C 1FO5A 2IWTA 2B7JA 1SU9A 8GSSA 3BCKA 3MDKA 4ECCA 2H0GA 1XBSA 5JCWA 5G5EA 1TJDA 1ZYEA 1TKDB 2WULA 3ZMKA 1SENA 3VWUA 4Q5FA 5HFIA 4IW9A 3LQ7A 5D9XA 1LU4A 2IFQB 1SK1A 2JSYA 3CBUA 5CRGA 4AGSA 1PQNA 2B3SA 1GSYA 3PR8A 1T8EB 2C3QA 1NSWA 2OE1A 4F9ZA 4FO5A 4K7NA 1ST9A 4POBA 2C3NA 3W6GA 3L78A 3LG6A 3KP9A 3QD9A 2HNLA 3UEMA 1K0MA 3IAS2 3PH9A 5JWOB 4ECIA 4MZCA 2M80A 4F0BA 1MD3A 3W8JA 3VWXA 3DD3A 2CVKA 1XW5A 3ZFBA 2L59A 1M2AA 2WS2A 2V2GA 4KDXA 4V2MA 3C8EA 5IMAA 2TRCP 1HQOA 5JWQB 1YF0A 5KN0A 3FR3A 4RQRA 2A2SA 5DJMA 1Z3EA 2GSRA 2CVBA 1WPIA 2L5OA 4EVMA 2AV4A 2C1YA 5D9WA 2VL3A 2YV7A 1GLPA 3QR6A 4KA0A 2GQLA 5DCHA 2OE0A 2LJKA 3ME7A 1G0TA 4D73B 4N0VA 4ISDA 2PVQA 3ZFLA 3SWLA 4AJ7A 5HR1A 3TRQA 6GSVA 2VCTA 2RLIA 3KMNA 3ERFA 2FLSA 3O6TA 1YJ6A 1M2DA 4PUFC 4V1Ap 4DSSB 2VCXA 4OCEA 1TU7A 5B8BA 3WD6A 1VF1A 4TW5A 5DQSA 4EC0A 2L6CA 2TRXA 1XWKA 1T7PB 1XCCA 3G9BA 3IA1A 1AQWA 4O7HA 3HDCA 5CO3A 3QAVA 2RM5A 1YEPA 2ON7A 2YWIA 3TKSC 4QL7A 4WEYA 3SBCA 3TJJA 20GSA 2GZYA 2A4VA 2NVLA 2N5AA 1ACVA 3PINA 1Z6MA 4LL1B 3FKFA 3TJKA 4POLA 2AJQB 1K0DA 1MDIA 1V2AA 1SD9A 2XBQA 4MABA 5JCGA 5A4UA 4OO5A 2FWHA 1QQ2A 1XWBA 1VF3A 3H93A 2H72A 2P0GA 3LEFA 3U6VA 1FVJA 2IMKA 3Q74A 4YAPA 3ZVJA 2GLRA 4ML1A 1BAYA 3LYKA 3F3RA 4ZL9A 3WT1A 4NV2A 3P7XA 4WF5A 3U5RE 3L4NA 2CT6A 1KBNA 3VWWA 3E9JB 1A8YA 1V57A 2WCIA 4WR4A 2PWJA 3KTLA 4YQUA 4MPFA 2IN3A 1B9YC 3IC4A 5J9BA 5C04A 1FB6A 4Q5RA 2MBSA 2FA4A 2C0GA 4WETA 5J9CA 4IN0A 2HYXA 4TXVA 2HZEA 3LFLA 2JADA 4HQSA 4MH2A 1TRWA 4LMVA 4PURA 3FHKA 1U3AA 5IMFA 1IYHA 1O73A 4PGTA 3LXTA 5COHA 4TOPA 2P5QA 5IPHA 17GSA 2IMIA 4MF5A 1XWCA 4XRAA 3F6DA 2V32A 1GNWA 2GVPA 1YY7A 3QPMA 4DVCA 3EMPA 1FHEA 3FYGA 2GSQA 5IPGA 2ON5A 3FW2A 5ECHB 5EVOA 16GSA 4ACSA 1AC1A 4BA7A 4I2TA 1XXUA 3HKRA 2EIQA 3S9FA 2VUPA 3M3MA 5F8BA 1B48A 1X5EA 2YNXA 4WR5A 3IE3A 1U3IA 3LORA 2HRFA 5IMCA 1XZOA 3D4TA 2DSAA 1EWXA 3G7YA 4N10A 3QFAC 1UC7A 1A23A 2R3XA 5LNKe 4AF2A 1PKZA 1SJ6A 2XBIA 2DIZA 4G2EA 1FAAA 4TVEA 3F6FA 3APQA 3GMFA 5AN1A 2QSIA 2X8CA 5IM9A 2NBSA 1AXDA 3L9SA 1DE2A 2CV4A 5F05A 4BVYA 1THXA 4FYCA 4YH2A 5CAXA 2FGXA 4FH8A 2ES7A 4GWRA 4FYBA 1PX7A 2YWOA 1TXXA 2CAQA 1WWJA 4FIWA 4O92A 2M72A 2XC2A 1E6BA 4HJMA 1HNCA 5DALA 3FZ5A 2F3MA 2DJ1A 5DDLA 2WB9A 1UVZA 1TK8B 4PXOA 1EZKA 3IXRA 4CW9A 2R37A 1BEDA 4CDOA 4AJ8A 2RM6A 4OFMA 4L5LA 4I2UA 2LRNA 3WGDA 3WGEA 1PRXA 3F4SA 3IBHA 3EYTA 4TR1A 2OA7A 5E4WA 5B6NA 1IYIA 1EOGA 5JCUA 1XWAA 2V6KA 2WDUA 5ID2A 3J7Yb 3HJPA 1OVNA 3CSIA 1C72A 5FWGA 4MCUA 3C1RA 3HXSA 3L0HA 1T00A 2DJ2A 3F8UA 3HD5A 2CX4A 3ERWA 2L6DA 2B1LA 2LNSA 1RW1A 4AJ6A 5CRWA 4KSMA 3L9VA 1ERUA 4ZILA 2IMDA 1K0NA 2H6YA 2VD0A 2BTOT 4KE3A 1R26A 4ULXA 3HY2A 1G6WA 1M7TA 3VLNA 4BWSA 1XW6A 2O7KA 1O81A 4ZB6A 3VPTA 3F9UA 2N5FA 4NPBA 4ML6A 1A24A 3DXBA 2FWEA 2K8SA 1XVWA 4LLRA 4YAVA 2LQOA 3HJMA 2VOCA 3P90A 1F6MC 1E2YA 3RDWA 3APSA 1AAZA 1GP1A 3Q6OA 3TKSE 3ME8A 4ZB9A 1AW9A 3KD0A 3GKNA 4TR0A 1PMTA 3GL3A 1JFUA 2CZ2A 3GSSA 4EXJA 1MDKA 3GIXA 5IO0A 4G9HA 4PQ1A 1YKAA 2V6OA 1S3DA 3IK9A 1R5PA 2MMAA 2V1MA 3GTUA 1SKSB 3GH9A 4IHUA 4F03A 1PA3A 4QL9A 5D9TA 2MBTA 4DSQA 2C3TA 3EE2A 2WFCA 1GNEA 2VCVA 1TK0B 2B7KA 1NW2A 4HQZA 3KIJA 2OE3A 3KH7A 4GF0A 1SD8A 2ZUPA 4WBJA 4DEJA 1OC3A 2N5BA 3HVVA 2B5XA 4I5QA 1KNGA 1ON4A 1GSEA 1TRVA 4OWYA 3RBTA 2JACA 3O3TA 3UBLA 3EU3A 2H30A 4MJEA 5CNWA 2BMXA 1SL2B 4ECJA 1R7HA 3RPPA 3FZAA 1MD4A 2HE3A 2LJRA 3RHBA 2JSZA 2GS3A 18GSA 4L5OA 1JLVA 1K0BA 2LNTA 3KJYA 3EINA 4XS4A 1Q4JA 4V2NA 1SL0B 4OMVA 5B7CA 1PL2A 3N9JA 2GQKA 5DAKA 1ERTA 3D0ZA 3I69A 2NTOA 3BCIA 5CREA 4OFTA 4CHSA 5IOWA 3ZVJD 2F51A 1VF4A 3HHVA 4WKWA 5INYA 3UARA 2KP1A 3FY7A 4GTUA 3FK8A 4WF4A 3M1GA 1K3OA 4ILFA 3GL5A 3UOMA 2PGTA 1G7OA 1BX9A 4MH3A 2OADA 2HZFA 3HZ8A 4RQXA 3KXOA 2O89A 1V9WA 4I6XA 2R2JA 2IPAA 1QUWA 1WOUA 3EURA 2PN8A 1SJIA 2PUKC 4G19A 3ZREA 3TKQA 2P5RA 1OC9B 5GSSA 3HJOA 1GUMA 5EL8A 4K9ZA 1M9AA 2H0HA 2CQ9A 5DBQA 4MDCA 3CSHA 2K8VA 1OYJA 3GURA 1J08A 2VLTA 3CTGA 1HYUA 4ZBBA 3G7JA 2CVDA 3GV1A 1V98A 5G30A 4ZBDA 3P8WA 3VURA 1X9SB 5ECOB 2E0QA 3LGCA 2KUCA 4JU5A 3JCML 3A2WA 1F9MA 2FWFA 2H6ZA 1OE7A 2WRTA 5J3RA 4MJCA 3C73A 1TW9A 5ENUA 2CZ3A 4ID0A 4IBPA 4EF0A 2ALBA 3RAZA 2HSHA 1YDKA 1DE1A 4KB3A 1B9XC 1JZDA 3IR4A 4NXIA 1W4VA 2VCWA 5GZZB 4IKHA 1M9BA 4EO3A 5IOXA 4MZBA 3QAGA 2GT6A 2YPMA 2B1KA 1ERVA 2CX3A 2LUSA 2PBJA 1CQGA 4NMUA 3MAKA 3EMXA 4ZB8A 2R5GA 2VL2A 1Y25A 3ZTLA 5G2ZA 4KCAA 4Q5NA 3M9JA 3KP8A 1U87A 2RIIA 3ISOA 4ZL7A 1F37A 3HA9A 3ZRDA 2F8FA 6GSTA 3BOAA 6GSUA 4POKA 4JR6A 5EY6A 4PQHA 2YANA 2JZTA 2VL9A 4MJAA 5ECLB 3ZL5A 4K6XA 2P31A 2J23A 5B8AA 1SJZA 3D21A 3GX8A 3WGXA 1XPVA 2VAFA 2HXKA 5DCGA 1JZWA 1PL1A 2KHPA 1TI1A 1HNAA 3HCZA 3MSZA 1MTCA 1B8XA 4JEDA 1I9DA 5IMVA 3KM6A 4KSOA 1BG5A 3KZQA 4MF7A 3TUEA 3D22A 4J56E 4WXTA 4HU7A 2K18A 4LL4B 2K6VA 2KLXA 4ZIJA 2H0IA 4MZWA 2GTUA 5KN1A 2XPDA 3IRAA 4RI6A 1R5AA 7GSSA 5AGYA 4NHWA 1K3LA 3A5WA 5ECSA 1ML6A 4N0ZA 4GQFA 2REMA 2HT9A 1JLWA 2OBKA 3DKSA 4EE0A 5FHIA 3VFIA 2MZCA 4NWYA 5ELAA 1ERWA 4OFNA 5EPFA 10GSA 3ZZXA 6GSSA 4FYUA 2NDOA 2CA8A 5G1KA 3F4TA 2PVOC 1B4PA 1NM3A 5DJLA 4IP1A 4HZ4A 4GSSA 1WRYA 4GRFA 1O7UA 1K3YA 1EOHA 2GZPA 4IGJA 1SKWB 4K8MA 5ABRA 1TRUA 5CP1A 2HFDA 2YCDA 3HVXA 4L8EA 2H01A 3TJGA 1UA5A 1YEXA 1RK4A 3HVSA 1AIUA 4OCFA 3M8NA 3ZIVA 4MF6A 3TKPA 2QKEA 1XW9A 2FNOA 2R6KA 1ZGNA 1NHOA 3C7MA 1Q98A 3I43A 3UIWA 1WIKA 1EEJA 2DIYA 2X8HA 1USBA 3KMOA 1OKTA 3DEXA 1XIYA 3NZNA 4F82A 4GQCA 4XS1A 2I1UA 5AIXA 1EEMA 3D4MA 5F07A 2H71A 2GZZA 5ECKB 3QOUA 4XRDA 3QDNA 1Z6NA 4HEA2 4TKYA 2H73A 5D96A 2C80A 1I5GA 2HZEB 2DBCA 4IQAA 3CSJA 5IIZA 4PNGA 3IHQA 2XHFA 4TR4A 2GDRA 4DSRA 2WJUA 2F9SA 2A2RA 2JL4A 1ZYQB 1F2EA 2H1GA 4OO4A 5J4UA 4X0XA 2X64A 1JZOA 3VWVA 1EGOA 3M9KA 4JBBA 3DVXA 5C00A 4KDUA 4IP6A 3DYRA 1LBKA 2IFQA 1N2AA 3Q19A 1S3CA 4TXOA 1ZOFA 3KH9A 2WZ9A 1N8JA 2TIRA 1A8LA 5HFKA 1TI3A 2G2QA 3Q18A 4MJBA 4EDZA 5IO2A 3RHCA 3F0IA 3DGQA 1GTIA 3QMXA 4BPYA 2FHEA 2D2ZA 1U6TA 4IQ1A 2HI7A 2B6MA 1AQVA 1XVQA 4EKZA 3DWVA 4KDYA 1GSQA 2EC4A 2I9HA 2V41A 3H8QA 4V1Ag 5HR0A 1GH2A 1YZXA 3UAPA 2GSSA 4KCEA 5CRHA 5HQPA 4V2LA 4K2DA 3A2VA 2OACA 1AUCA 2DJJA 1X5DA 2MMOA 1SK0A 3FEUA 3IAM2 4J57E 5HR2A 1GL8A 2PPTA 4TR3A 3KGKA 1M99A 5DALB 1A0RP 4P3YB 4KGIA 3IOSA 4D73A 5A4WA 2PMTA 4JZQA 4O32A
chains in the Genus database with same CATH superfamily
2YZHA 3KEBA 3QFBC 4I97A 1G7EA 4QQ7A 1O8XA 3TB2A 4DSSA 2C0EA 5IMDA 2FD3A 1J9BA 3H79A 5H5SA 2O85A 3FRCA 1MDJA 3US3A 4GCIA 3ZMLA 1A2JA 4TR1B 5KN2A 4IS0A 4POMA 3RPNA 5D93A 1PN9A 4JR4A 4IJIA 2GSTA 2IMFA 3VI5A 2H75A 5ID2B 2H74A 1CQHA 1GTUA 5L71A 2YJHA 1EP8A 2YZUA 3A5IA 6GSYA 6GSWA 1SL1B 1HD2A 3KCMA 4J2FA 4HZ2A 1Z5YE 2DMLA 4ZBAA 5CRDA 2HRAA 2YWMA 3NIVA 2JZRA 2B5EA 4KH7A 5DVBA 3HZ4A 3GFKA 1T4ZA 2LRTA 2VL2C 4N30A 4HJ2A 4BWQA 3LYPA 2H1AA 1FW1A 4BVXA 4TXOB 3GSTA 3A3TA 1WE0A 5F0GA 4RI7A 1FG4A 4E8EA 3BBYA 3D5JA 1W89A 1TTZA 4XS6A 2DC5A 3BJ5A 2CAIA 1QMVA 4NV5A 1GSSA 1GTAA 3ZLPA 2AHEA 1PSQA 3P2AA 5A5KA 5G1LA 5CYYA 3MNGA 1Z7PA 1LJRA 4PQIA 3G7IA 4MLYA 12GSA 1FVKA 2YP6A 3OR5A 4O5QA 1K0CA 1OC8A 5AIVA 4PNFA 5J5NA 1X9WB 2VLVA 1WJKA 3TCOA 1O6JA 4F0CA 1OAZA 1WMJA 3GX0A 3H1NA 3IDVA 1X5CA 5LCZA 2YV9A 3GTUB 1TU8A 2VM2A 4KUNA 1ZYPA 1TK5B 2JU5A 1QXHA 1JHBA 3EC3A 4ECBA 3VPQA 2VLUA 2GQMA 2RUFA 4L0WA 3TKRA 4FQUA 1EV4A 3GKKA 3LSZA 1XOBA 1EV9A 4A5PA 4K7OA 4G10A 3D6IA 2AB6A 3V1WA 1GWCA 1TDIA 2H66A 4OD7A 1SK2A 3GKMA 4IELA 1XFLA 1A0FA 2YJ7A 2GGTA 4HI7A 2J9HA 5H5RA 4NHZA 4MA9A 3K8NA 4HOJA 3FR9A 1XWGA 1X9MB 3CTFA 1B4QA 2L4CA 3E0UA 3APOA 3UVTA 2H70A 4Q5QA 3MWHA 1O8WA 2GT5A 1X0RA 4CY8A 2LTKA 2FA8A 1ZL9A 3IV4A 2KP2A 3A2XA 1XG8A 4XS4B 1VGLA 5E59A 1OKDA 4BL7A 1THOA 3ZIJA 5DAKB 2AYTA 5KEJA 2X8GA 4GXZA 1AQXA 2F8AA 1XOAA 3GA4A 1K0OA 1NHYA 2I81A 3TDGA 3TGZA 1QK8A 3FZ9A 1ABAA 5ECRB 4KX4A 2DJKA 2LKUA 5B6MA 3UJ1A 1GLQA 3O76A 5KN3A 1OE8A 3TJFA 5ECIB 3GNJA 5IQYA 1H4OA 19GSA 1GRXA 2E7PA 3IK7A 2R4VA 4WBRD 3C71A 3F4RA 3FZ4A 3GN3A 1V58A 1ZCPA 2HRKA 5A4VA 1DUGA 1KTEA 2IJYA 4F2IA 1YF1A 4K1FA 4MMMA 2DKIA 2HRNA 2OJLA 4GSTA 4PUAA 2Z9SA 4L0UA 2L57A 3UL3A 2MYGA 1PKWA 2OBIA 4XIHA 1SYXA 5D8IA 3CRTA 5D9VA 2LSTA 1VF2A 5D73A 3LXZA 2YOIA 1ILOA 1SKRB 2FUG2 2NPBA 1A2MA 2IMEA 4JE1A 2AAWA 3TJBA 1F3BA 3N5OA 3KTBA 1VRSD 4E8HA 1TOFA 1GSUA 1SYRA 1KEBA 5F06A 1QFNA 3IC8A 4ICYA 4HU9A 2H6XA 2AUVA 2EIRA 2L5LA 1WP0A 3GHAA 3QCPA 4X1UA 4ZL8A 3VK9A 1J0FA 2XPEA 2H8LA 2OKAA 2C4JA 1H75A 1PD21 4X43A 4KW6A 11GSA 2C0DA 4LA1A 5ECNB 3E3EA 4GLTA 2B5YA 3EWLA 4KNDA 3LWAA 1M0UA 4I8BA 3TRPA 3NOFA 4MP4A 5HFGA 2I3YA 3TKSA 3WT2A 1Y6EA 2JZSA 2RUEA 2DJ0A 2FY6A 9GSSA 4Z7XA 3EVIA 2LS5A 5LD0A 3DVWA 3UVHA 2DLXA 1QGVA 1JZRA 2E2MA 4KF9A 1ZMAA 3I9V2 1G6YA 5G5FA 1GUKA 3ERGA 4TN8A 2MMZA 2KOKA 3LJRA 5HR3A 6GSXA 3J7Yk 4JRRA 4HS1A 3PPUA 14GSA 2ZCTA 3R2QA 1T3BA 3L9UA 1T1VA 2HSYA 4Z2UA 3EU4A 3HYPA 3M0FA 4K7IA 4PX1A 2I4AA 2IIYA 4LMWA 3H4KA 1ZZYA 3AY8A 1GULA 5GAPD 1RQMA 1S3RA 3DRNA 3QAWA 1GSDA 1Z9HA 4MK3A 5J41A 2E2GA 2M46A 5GAND 2L4QA 4NAXA 5KOWA 3ZITA 1GUHA 2O87A 4IJ3A 1BQ7A 5JWRB 3DIEA 2VIMA 4MPGA 1TP9A 3PGTA 4YQMA 5GSTA 2LEGA 4ZXGA 3C1SA 2ZNMA 1R4WA 2WGRA 5DQYA 2G0FA 4G0IA 3IPZA 3GYKA 4KAEA 2QGVA 1UN2A 4XHMA 1S3AA 2FWGA 4XCSA 2LQQA 5ECPB 2EIOA 1V40A 2VCZA 5ECMB 1U88A 2DJ3A 3GRXA 2FCHA 3UBKA 3GH6A 2C0FA 1GTBA 3BD2A 2DMMA 2IL3A 5FT3A 1BYEA 1M2BA 2K9FA 2H76A 2HSMA 2LV3A 3F63A 1MEKA 2LJAA 1K0AA 4K5SA 4TRXA 1URMA 4GSNA 3TOUA 2PERA 4HUAA 2H19A 1A2LA 3UMAA 1FOVA 1YKCA 2H1DA 3GKXA 3ZYWA 4EDYA 3TRXA 5G31A 1DSBA 13GSA 5ECQB 2HLSA 2O8VB 2X99A 5IMZA 3ED3A 4O5RA 4N11A 1F3AA 4EUYA 4EL1A 3CRUA 2BJXA 1FB0A 2YWNA 3W8SA 3CMIA 3F3QA 3DMLA 3WYWA 2C8UA 3FR6A 1GSFA 3CXGA 2X49A 2YN1A 3GUSA 2VD1A 5ELGA 4XTSA 1DBYA 3CYNA 2LRCA 3VI7A 1OC9A 1PX6A 5BRTA 2MMNA 4RUVA 4YQVA 4K0GA 1TRSA 4HDEA 1BJXA 2QC7A 2H1BA 3TOTA 1EP7A 2VO4A 1Z7RA 4H86A 3I6AA 22GSA 2VCQA 1T4YA 4K0NA 1YQ1A 5AISA 5H5QA 1HNBA 4IVFA 1PGTA 5BMUA 1O85A 2VM1A 1EGRA 2PU9C 1FO5A 2IWTA 2B7JA 1SU9A 8GSSA 1PFOA 3BCKA 3MDKA 4ECCA 2H0GA 1XBSA 5JCWA 5G5EA 1TJDA 1ZYEA 1TKDB 2WULA 3ZMKA 1SENA 3VWUA 4Q5FA 5HFIA 4IW9A 3LQ7A 5D9XA 4K2XA 4G0LA 1LU4A 2IFQB 1SK1A 2JSYA 3CBUA 5CRGA 4AGSA 1PQNA 2B3SA 1GSYA 3PR8A 1T8EB 2C3QA 1NSWA 2OE1A 4F9ZA 4FO5A 4K7NA 1ST9A 4POBA 2C3NA 3W6GA 3L78A 4Z2RA 3LG6A 3KP9A 3QD9A 2HNLA 3UEMA 1K0MA 3IAS2 3PH9A 5JWOB 4ECIA 4MZCA 2M80A 4F0BA 1MD3A 3W8JA 3VWXA 3DD3A 2CVKA 1XW5A 3ZFBA 2L59A 3LW9A 1M2AA 2WS2A 2V2GA 4KDXA 4V2MA 3C8EA 5IMAA 2TRCP 1HQOA 5JWQB 1YF0A 5KN0A 3FR3A 4RQRA 2A2SA 5DJMA 1Z3EA 2GSRA 2CVBA 1WPIA 2L5OA 4EVMA 2AV4A 2C1YA 5D9WA 2VL3A 2YV7A 1GLPA 3QR6A 4KA0A 2GQLA 5DCHA 2OE0A 2LJKA 3ME7A 1G0TA 4D73B 4N0VA 4ISDA 2PVQA 3ZFLA 3SWLA 4AJ7A 5HR1A 3TRQA 6GSVA 2VCTA 2RLIA 3KMNA 3ERFA 2FLSA 3O6TA 1YJ6A 1M2DA 4PUFC 4V1Ap 4DSSB 2VCXA 4OCEA 1TU7A 5B8BA 3WD6A 1VF1A 4TW5A 5DQSA 4EC0A 2L6CA 2TRXA 1XWKA 3CQFA 1T7PB 1XCCA 3G9BA 3IA1A 1AQWA 4O7HA 3HDCA 5CO3A 3QAVA 2RM5A 1YEPA 2ON7A 2YWIA 3TKSC 4QL7A 4WEYA 3SBCA 3TJJA 20GSA 2GZYA 2A4VA 2NVLA 2N5AA 1ACVA 3PINA 1Z6MA 4LL1B 3FKFA 2R0GA 3TJKA 4POLA 2AJQB 1K0DA 1MDIA 1V2AA 1SD9A 2XBQA 4MABA 5JCGA 5A4UA 4OO5A 2FWHA 1QQ2A 1XWBA 1VF3A 3H93A 1M3JA 2H72A 2P0GA 3LEFA 3U6VA 1FVJA 2IMKA 3Q74A 4YAPA 3ZVJA 2GLRA 4BVXB 4ML1A 1BAYA 3LYKA 3F3RA 4ZL9A 3WT1A 4NV2A 3P7XA 4WF5A 3U5RE 3L4NA 2CT6A 1KBNA 3VWWA 3E9JB 1A8YA 1V57A 2WCIA 4WR4A 2PWJA 3KTLA 4YQUA 4MPFA 2IN3A 1B9YC 3IC4A 5J9BA 5C04A 1FB6A 4Q5RA 2MBSA 2FA4A 2C0GA 4WETA 5J9CA 4IN0A 2HYXA 4TXVA 2HZEA 3LFLA 2JADA 4HQSA 4MH2A 1TRWA 4LMVA 4PURA 3FHKA 1U3AA 5IMFA 1IYHA 1O73A 4PGTA 3LXTA 5COHA 4TOPA 3R3EA 2P5QA 5IPHA 17GSA 2IMIA 4MF5A 4EIQA 1XWCA 4XRAA 3F6DA 2V32A 1GNWA 2GVPA 1YY7A 3QPMA 4DVCA 3EMPA 1FHEA 2QA2A 3FYGA 2GSQA 3EPTA 5IPGA 2ON5A 3FW2A 5ECHB 5EVOA 16GSA 4ACSA 1AC1A 4BA7A 4I2TA 1XXUA 3HKRA 2EIQA 3S9FA 2VUPA 3M3MA 5F8BA 1B48A 1X5EA 2YNXA 4WR5A 3IE3A 1U3IA 3LORA 2HRFA 5IMCA 1XZOA 3D4TA 2DSAA 1EWXA 3G7YA 4N10A 3QFAC 1UC7A 1A23A 2R3XA 5LNKe 4AF2A 1PKZA 1SJ6A 2XBIA 2DIZA 4G2EA 1FAAA 4TVEA 3F6FA 3APQA 3GMFA 5AN1A 2QSIA 2X8CA 5IM9A 2NBSA 1AXDA 3L9SA 1DE2A 2CV4A 5F05A 4BVYA 1THXA 4FYCA 4YH2A 5CAXA 2FGXA 4BL7B 4FH8A 2ES7A 4GWRA 4FYBA 1PX7A 2YWOA 1TXXA 2CAQA 1WWJA 4FIWA 4O92A 2M72A 2XC2A 1E6BA 4HJMA 1HNCA 5DALA 3FZ5A 2F3MA 2DJ1A 5DDLA 2WB9A 1UVZA 1TK8B 4PXOA 1EZKA 3IXRA 4CW9A 2R37A 1BEDA 4CDOA 4AJ8A 2RM6A 4OFMA 4L5LA 4I2UA 2LRNA 3WGDA 3WGEA 1PRXA 4USSA 3F4SA 3IBHA 3EYTA 4TR1A 2OA7A 5E4WA 2R0CA 5B6NA 1IYIA 1EOGA 5JCUA 1XWAA 2V6KA 2WDUA 5ID2A 3J7Yb 3HJPA 1OVNA 3CSIA 1C72A 5FWGA 4MCUA 3C1RA 3HXSA 3L0HA 1T00A 2DJ2A 3F8UA 3HD5A 2CX4A 3ERWA 2L6DA 2B1LA 2LNSA 1RW1A 4AJ6A 5CRWA 4KSMA 3L9VA 1ERUA 4ZILA 2IMDA 1K0NA 1M3IA 2H6YA 2VD0A 2BTOT 4KE3A 1R26A 4ULXA 3HY2A 1G6WA 1M7TA 3VLNA 4BWSA 1XW6A 2O7KA 1O81A 4ZB6A 3VPTA 3F9UA 2N5FA 4NPBA 4ML6A 1A24A 3DXBA 2FWEA 2K8SA 1XVWA 4LLRA 4YAVA 2LQOA 3HJMA 2VOCA 3P90A 1F6MC 1E2YA 3RDWA 3APSA 1AAZA 1GP1A 3Q6OA 3TKSE 3ME8A 4ZB9A 1AW9A 3KD0A 3GKNA 4TR0A 1PMTA 3MYDA 3GL3A 1JFUA 2CZ2A 3GSSA 4EXJA 1MDKA 3GIXA 5IO0A 4G9HA 4PQ1A 1YKAA 2V6OA 1S3DA 3IK9A 1R5PA 2MMAA 2V1MA 3MIXA 3GTUA 1SKSB 3GH9A 4IHUA 4F03A 1PA3A 1PN0A 4QL9A 5D9TA 2MBTA 4DSQA 2C3TA 3EE2A 2WFCA 1GNEA 2VCVA 4CY6A 1TK0B 2B7KA 1NW2A 4HQZA 3KIJA 2OE3A 3KH7A 4GF0A 1SD8A 2ZUPA 4WBJA 4DEJA 4BIKA 1OC3A 2N5BA 3HVVA 2B5XA 4I5QA 1KNGA 1ON4A 1GSEA 1TRVA 4OWYA 3RBTA 2JACA 3O3TA 3UBLA 3EU3A 2H30A 4MJEA 5CNWA 2BMXA 4O5UA 1SL2B 4ECJA 1R7HA 4EIPA 3RPPA 3FZAA 1MD4A 2HE3A 2LJRA 3RHBA 2JSZA 2GS3A 18GSA 4L5OA 1JLVA 1K0BA 2LNTA 3KJYA 3EINA 4XS4A 1Q4JA 4V2NA 1SL0B 4OMVA 5B7CA 1PL2A 3N9JA 2GQKA 5DAKA 1ERTA 3D0ZA 3I69A 2NTOA 3BCIA 5CREA 4OFTA 4CHSA 5IOWA 3ZVJD 2F51A 1VF4A 3HHVA 4WKWA 5INYA 3UARA 2KP1A 3FY7A 4GTUA 3FK8A 4WF4A 3M1GA 1K3OA 4ILFA 3GL5A 3UOMA 2PGTA 3HVNA 1G7OA 1BX9A 4MH3A 2OADA 2HZFA 3HZ8A 4RQXA 3KXOA 2O89A 1V9WA 4I6XA 2R2JA 2IPAA 1QUWA 1WOUA 3EURA 2PN8A 1SJIA 2PUKC 4G19A 3ZREA 3TKQA 2P5RA 1OC9B 5GSSA 3HJOA 1GUMA 5EL8A 2A2PA 4K9ZA 1M9AA 2H0HA 2CQ9A 5DBQA 4MDCA 3CSHA 2K8VA 5KOXA 1OYJA 3GURA 1J08A 2VLTA 3CTGA 1HYUA 4ZBBA 3G7JA 4YKGA 2CVDA 3GV1A 1V98A 5G30A 4ZBDA 3P8WA 3VURA 1X9SB 5ECOB 2E0QA 3LGCA 2KUCA 4JU5A 3JCML 3A2WA 1F9MA 2FWFA 2H6ZA 1OE7A 2WRTA 5J3RA 4MJCA 3C73A 1TW9A 5ENUA 2CZ3A 4ID0A 4IBPA 4EF0A 2ALBA 3RAZA 2HSHA 1YDKA 1DE1A 4KB3A 1B9XC 1JZDA 3IR4A 4NXIA 1W4VA 2VCWA 5GZZB 4Z2TA 4IKHA 1M9BA 4EO3A 5IOXA 4MZBA 3QAGA 2GT6A 2UZ8A 2YPMA 2B1KA 1ERVA 2CX3A 2LUSA 2PBJA 1CQGA 4NMUA 4MNNA 3MAKA 3EMXA 4ZB8A 2R5GA 2VL2A 1Y25A 2X4AA 3ZTLA 5G2ZA 4KCAA 4Q5NA 3M9JA 3KP8A 1U87A 2RIIA 3ISOA 4ZL7A 1F37A 3HA9A 3ZRDA 2F8FA 6GSTA 3BOAA 6GSUA 4POKA 4JR6A 5EY6A 4PQHA 2YANA 2JZTA 2VL9A 4MJAA 2QA1A 5ECLB 3ZL5A 4K6XA 2P31A 4HSCX 2J23A 5B8AA 1SJZA 3D21A 3GX8A 3WGXA 1XPVA 2VAFA 2HXKA 5DCGA 1JZWA 1PL1A 2KHPA 1TI1A 1HNAA 3HCZA 3MSZA 4YKFA 1MTCA 1B8XA 4JEDA 1I9DA 5IMVA 3KM6A 4KSOA 1BG5A 3KZQA 4MF7A 4X4JA 3TUEA 3D22A 4J56E 4WXTA 4HU7A 2K18A 4LL4B 2K6VA 2KLXA 4ZIJA 2H0IA 4MZWA 2GTUA 5KN1A 2XPDA 3IRAA 4RI6A 1R5AA 7GSSA 5AGYA 4NHWA 1K3LA 3A5WA 5ECSA 1ML6A 4N0ZA 4GQFA 2REMA 2HT9A 1JLWA 2OBKA 3DKSA 4EE0A 5FHIA 3VFIA 2MZCA 4NWYA 5ELAA 1ERWA 4OFNA 5EPFA 10GSA 3ZZXA 6GSSA 4FYUA 2NDOA 2CA8A 5G1KA 3F4TA 2PVOC 1B4PA 1NM3A 5DJLA 4IP1A 2DKHA 4HZ4A 4GSSA 1WRYA 4GRFA 1O7UA 1K3YA 1EOHA 2GZPA 4IGJA 4G0KA 4K8MA 1SKWB 5ABRA 1TRUA 5CP1A 2HFDA 2YCDA 4K5RA 3HVXA 4L8EA 2H01A 3TJGA 1UA5A 1YEXA 1RK4A 3HVSA 1AIUA 4OCFA 3M8NA 3ZIVA 4MF6A 3TKPA 2QKEA 1XW9A 2FNOA 2R6KA 1ZGNA 1NHOA 3C7MA 1Q98A 3I43A 3UIWA 1WIKA 1EEJA 2DIYA 2X8HA 1USBA 3KMOA 1OKTA 3DEXA 1XIYA 3NZNA 4F82A 4GQCA 4XS1A 2I1UA 5AIXA 1EEMA 3D4MA 5F07A 2H71A 2GZZA 5ECKB 3QOUA 4PTSA 4XRDA 3QDNA 1Z6NA 4HEA2 4TKYA 2H73A 1FOHA 5D96A 3FMWA 2C80A 1I5GA 2HZEB 2DBCA 4IQAA 3CSJA 5IIZA 4PNGA 3IHQA 2XHFA 4TR4A 2GDRA 4DSRA 2WJUA 2F9SA 2A2RA 2JL4A 1ZYQB 1F2EA 2H1GA 4OO4A 2A4HA 5J4UA 4X0XA 2X64A 1JZOA 3VWVA 1EGOA 3M9KA 4JBBA 3DVXA 5C00A 4KDUA 4IP6A 3DYRA 1LBKA 2IFQA 1N2AA 3Q19A 1S3CA 4TXOA 1ZOFA 3KH9A 2WZ9A 1N8JA 2TIRA 1A8LA 5HFKA 1TI3A 2G2QA 3Q18A 4MJBA 4EDZA 5IO2A 3RHCA 3F0IA 3DGQA 1GTIA 3QMXA 4BPYA 2FHEA 2D2ZA 1U6TA 4IQ1A 2HI7A 2B6MA 1AQVA 1XVQA 4EKZA 3DWVA 4KDYA 1GSQA 2EC4A 2R0PA 3IHGA 2I9HA 2V41A 3H8QA 4V1Ag 5HR0A 1GH2A 1YZXA 3UAPA 2GSSA 4KCEA 1ZYNA 5CRHA 5HQPA 4V2LA 4K2DA 3A2VA 2OACA 4BVYB 1AUCA 2DJJA 1X5DA 2MMOA 1SK0A 3FEUA 3IAM2 4J57E 5HR2A 1GL8A 2PPTA 4TR3A 3KGKA 1M99A 5DALB 1A0RP 4P3YB 4KGIA 3IOSA 4D73A 5A4WA 2PMTA 4JZQA 4O32A
chains in the Genus database with same CATH topology
2YZHA 3KEBA 3QFBC 4I97A 1G7EA 4QQ7A 1O8XA 3TB2A 4DSSA 2C0EA 5IMDA 2FD3A 1J9BA 3H79A 5H5SA 2O85A 3FRCA 1MDJA 3US3A 4GCIA 3ZMLA 1A2JA 4TR1B 5KN2A 4IS0A 4POMA 3RPNA 5D93A 1PN9A 4JR4A 4IJIA 2GSTA 2IMFA 3VI5A 2H75A 5ID2B 2H74A 1CQHA 1GTUA 5L71A 2YJHA 1EP8A 2YZUA 3A5IA 6GSYA 6GSWA 1SL1B 1HD2A 3KCMA 4J2FA 4HZ2A 1Z5YE 2DMLA 4ZBAA 5CRDA 2HRAA 2YWMA 3NIVA 2JZRA 2B5EA 4KH7A 5DVBA 3HZ4A 3GFKA 1T4ZA 2LRTA 2VL2C 4N30A 4HJ2A 4BWQA 3LYPA 2H1AA 1FW1A 4BVXA 4TXOB 3GSTA 3A3TA 1WE0A 5F0GA 4RI7A 1FG4A 4E8EA 3BBYA 3D5JA 1W89A 1TTZA 4XS6A 2DC5A 3BJ5A 2CAIA 1QMVA 4NV5A 1GSSA 1GTAA 3ZLPA 2AHEA 1PSQA 3P2AA 5A5KA 5G1LA 5CYYA 3MNGA 1Z7PA 1LJRA 4PQIA 3G7IA 4MLYA 12GSA 1FVKA 2YP6A 3OR5A 4O5QA 1K0CA 1OC8A 5AIVA 4PNFA 5J5NA 1X9WB 2VLVA 1WJKA 3TCOA 1O6JA 4F0CA 1OAZA 1WMJA 3GX0A 3H1NA 3IDVA 1X5CA 5LCZA 2YV9A 3GTUB 1TU8A 2VM2A 4KUNA 1ZYPA 1TK5B 2JU5A 1QXHA 1JHBA 3EC3A 4ECBA 3VPQA 2VLUA 2GQMA 2RUFA 4L0WA 3TKRA 4FQUA 1EV4A 3GKKA 3LSZA 1XOBA 1EV9A 4A5PA 4K7OA 4G10A 3D6IA 2AB6A 3V1WA 1GWCA 1TDIA 2H66A 4OD7A 1SK2A 3GKMA 4IELA 1XFLA 1A0FA 2YJ7A 2GGTA 4HI7A 2J9HA 5H5RA 4NHZA 4MA9A 3K8NA 4HOJA 3FR9A 1XWGA 1X9MB 3CTFA 1B4QA 2L4CA 3E0UA 3APOA 3UVTA 2H70A 4Q5QA 3MWHA 1O8WA 2GT5A 1X0RA 4CY8A 2LTKA 2FA8A 1ZL9A 3IV4A 2KP2A 3A2XA 4XS4B 1VGLA 5E59A 1OKDA 4BL7A 1THOA 3ZIJA 5DAKB 2AYTA 5KEJA 2X8GA 4GXZA 1AQXA 2F8AA 1XOAA 3GA4A 1K0OA 1NHYA 2I81A 3TDGA 3TGZA 1QK8A 3FZ9A 1ABAA 5ECRB 4KX4A 2DJKA 2LKUA 5B6MA 3UJ1A 1GLQA 3O76A 5KN3A 1OE8A 3TJFA 5ECIB 3GNJA 5IQYA 1H4OA 19GSA 1GRXA 2E7PA 3IK7A 2R4VA 4WBRD 3C71A 3F4RA 3FZ4A 3GN3A 1V58A 1ZCPA 2HRKA 5A4VA 1DUGA 1KTEA 2IJYA 4F2IA 1YF1A 4K1FA 4MMMA 2DKIA 2HRNA 2OJLA 4GSTA 4PUAA 2Z9SA 4L0UA 2L57A 3UL3A 2MYGA 1PKWA 2OBIA 4XIHA 1SYXA 5D8IA 3CRTA 5D9VA 2LSTA 1VF2A 5D73A 3LXZA 2YOIA 1ILOA 1SKRB 2FUG2 2NPBA 1A2MA 2IMEA 4JE1A 2AAWA 3TJBA 1F3BA 3N5OA 3KTBA 1VRSD 4E8HA 1TOFA 1GSUA 1SYRA 1KEBA 5F06A 1QFNA 3IC8A 4ICYA 4HU9A 2H6XA 2AUVA 2EIRA 2L5LA 1WP0A 3GHAA 3QCPA 4X1UA 4ZL8A 3VK9A 1J0FA 2XPEA 2H8LA 2OKAA 2C4JA 1H75A 1PD21 4X43A 4KW6A 11GSA 2C0DA 4LA1A 5ECNB 3E3EA 4GLTA 2B5YA 3EWLA 4KNDA 3LWAA 1M0UA 4I8BA 3TRPA 3NOFA 4MP4A 5HFGA 2I3YA 3TKSA 3WT2A 1Y6EA 2JZSA 2RUEA 2DJ0A 2FY6A 9GSSA 4Z7XA 3EVIA 2LS5A 5LD0A 3DVWA 3UVHA 2DLXA 1QGVA 1JZRA 2E2MA 4KF9A 1ZMAA 3I9V2 1G6YA 5G5FA 1GUKA 3ERGA 4TN8A 2MMZA 2KOKA 3LJRA 5HR3A 6GSXA 3J7Yk 4JRRA 4HS1A 3PPUA 14GSA 2ZCTA 3R2QA 1T3BA 3L9UA 1T1VA 2HSYA 4Z2UA 3EU4A 3HYPA 3M0FA 4K7IA 4PX1A 2I4AA 2IIYA 4LMWA 3H4KA 1ZZYA 3AY8A 1GULA 5GAPD 1RQMA 3DRNA 3QAWA 1GSDA 1Z9HA 4MK3A 5J41A 2E2GA 2M46A 5GAND 2L4QA 4NAXA 5KOWA 3ZITA 1GUHA 2O87A 4IJ3A 1BQ7A 5JWRB 3DIEA 2VIMA 4MPGA 1TP9A 3PGTA 4YQMA 5GSTA 2LEGA 4ZXGA 3C1SA 2ZNMA 1R4WA 2WGRA 5DQYA 2G0FA 4G0IA 3IPZA 3GYKA 4KAEA 2QGVA 1UN2A 4XHMA 1S3AA 2FWGA 4XCSA 2LQQA 5ECPB 2EIOA 1V40A 2VCZA 5ECMB 1U88A 2DJ3A 3GRXA 2FCHA 3UBKA 3GH6A 2C0FA 1GTBA 3BD2A 2DMMA 2IL3A 5FT3A 1BYEA 1M2BA 2K9FA 2H76A 2HSMA 2LV3A 3F63A 1MEKA 2LJAA 1K0AA 4K5SA 4TRXA 1URMA 4GSNA 3TOUA 2PERA 4HUAA 2H19A 1A2LA 3UMAA 1FOVA 1YKCA 2H1DA 3GKXA 3ZYWA 4EDYA 3TRXA 5G31A 1DSBA 13GSA 5ECQB 2HLSA 2O8VB 2X99A 5IMZA 3ED3A 4O5RA 4N11A 1F3AA 4EUYA 4EL1A 3CRUA 2BJXA 1FB0A 2YWNA 3W8SA 3CMIA 3F3QA 3DMLA 3WYWA 2C8UA 3FR6A 1GSFA 3CXGA 2X49A 2YN1A 3GUSA 2VD1A 5ELGA 4XTSA 1DBYA 3CYNA 2LRCA 3VI7A 1OC9A 1PX6A 5BRTA 2MMNA 4RUVA 4YQVA 4K0GA 1TRSA 4HDEA 1BJXA 2QC7A 2H1BA 3TOTA 1EP7A 2VO4A 1Z7RA 4H86A 3I6AA 22GSA 2VCQA 1T4YA 4K0NA 1YQ1A 5AISA 5H5QA 1HNBA 4IVFA 1PGTA 5BMUA 1O85A 2VM1A 1EGRA 2PU9C 1FO5A 2IWTA 2B7JA 1SU9A 8GSSA 3BCKA 3MDKA 4ECCA 2H0GA 1XBSA 5JCWA 5G5EA 1TJDA 1ZYEA 1TKDB 2WULA 3ZMKA 1SENA 3VWUA 4Q5FA 5HFIA 4IW9A 3LQ7A 5D9XA 4K2XA 4G0LA 1LU4A 2IFQB 1SK1A 2JSYA 3CBUA 5CRGA 4AGSA 1PQNA 2B3SA 1GSYA 3PR8A 1T8EB 2C3QA 1NSWA 2OE1A 4F9ZA 4FO5A 4K7NA 1ST9A 4POBA 2C3NA 3W6GA 3L78A 4Z2RA 3LG6A 3KP9A 3QD9A 2HNLA 3UEMA 1K0MA 3IAS2 3PH9A 5JWOB 4ECIA 4MZCA 2M80A 4F0BA 1MD3A 3W8JA 3VWXA 3DD3A 2CVKA 1XW5A 3ZFBA 2L59A 3LW9A 1M2AA 2WS2A 2V2GA 4KDXA 4V2MA 3C8EA 5IMAA 2TRCP 1HQOA 5JWQB 1YF0A 5KN0A 3FR3A 4RQRA 2A2SA 5DJMA 1Z3EA 2GSRA 2CVBA 1WPIA 2L5OA 4EVMA 2AV4A 2C1YA 5D9WA 2VL3A 2YV7A 1GLPA 3QR6A 4KA0A 2GQLA 5DCHA 2OE0A 2LJKA 3ME7A 1G0TA 4D73B 4N0VA 4ISDA 2PVQA 3ZFLA 3SWLA 4AJ7A 5HR1A 3TRQA 6GSVA 2VCTA 2RLIA 3KMNA 3ERFA 2FLSA 3O6TA 1YJ6A 1M2DA 4PUFC 4V1Ap 4DSSB 2VCXA 4OCEA 1TU7A 5B8BA 3WD6A 1VF1A 4TW5A 5DQSA 4EC0A 2L6CA 2TRXA 1XWKA 1T7PB 1XCCA 3G9BA 3IA1A 1AQWA 4O7HA 3HDCA 5CO3A 3QAVA 2RM5A 1YEPA 2ON7A 2YWIA 3TKSC 4QL7A 4WEYA 3SBCA 3TJJA 20GSA 2GZYA 2A4VA 2NVLA 2N5AA 1ACVA 3PINA 1Z6MA 4LL1B 3FKFA 2R0GA 3TJKA 4POLA 2AJQB 1K0DA 1MDIA 1V2AA 1SD9A 2XBQA 4MABA 5JCGA 5A4UA 4OO5A 2FWHA 1QQ2A 1XWBA 1VF3A 3H93A 2H72A 2P0GA 3LEFA 3U6VA 1FVJA 2IMKA 3Q74A 4YAPA 3ZVJA 2GLRA 4BVXB 4ML1A 1BAYA 3LYKA 3F3RA 4ZL9A 3WT1A 4NV2A 3P7XA 4WF5A 3U5RE 3L4NA 2CT6A 1KBNA 3VWWA 3E9JB 1A8YA 1V57A 2WCIA 4WR4A 2PWJA 3KTLA 4YQUA 4MPFA 2IN3A 1B9YC 3IC4A 5J9BA 5C04A 1FB6A 4Q5RA 2MBSA 2FA4A 2C0GA 4WETA 5J9CA 4IN0A 2HYXA 4TXVA 2HZEA 3LFLA 2JADA 4HQSA 4MH2A 1TRWA 4LMVA 4PURA 3FHKA 1U3AA 5IMFA 1IYHA 1O73A 4PGTA 3LXTA 5COHA 4TOPA 3R3EA 2P5QA 5IPHA 17GSA 2IMIA 4MF5A 4EIQA 1XWCA 4XRAA 3F6DA 2V32A 1GNWA 2GVPA 1YY7A 3QPMA 4DVCA 3EMPA 1FHEA 2QA2A 3FYGA 2GSQA 3EPTA 5IPGA 2ON5A 3FW2A 5ECHB 5EVOA 16GSA 4ACSA 1AC1A 4BA7A 4I2TA 1XXUA 3HKRA 2EIQA 3S9FA 2VUPA 3M3MA 5F8BA 1B48A 1X5EA 2YNXA 4WR5A 3IE3A 1U3IA 3LORA 2HRFA 5IMCA 1XZOA 3D4TA 2DSAA 1EWXA 3G7YA 4N10A 3QFAC 1UC7A 1A23A 2R3XA 5LNKe 4AF2A 1PKZA 1SJ6A 2XBIA 2DIZA 4G2EA 1FAAA 4TVEA 3F6FA 3APQA 3GMFA 5AN1A 2QSIA 2X8CA 5IM9A 2NBSA 1AXDA 3L9SA 1DE2A 2CV4A 5F05A 4BVYA 1THXA 4FYCA 4YH2A 5CAXA 2FGXA 4BL7B 4FH8A 2ES7A 4GWRA 4FYBA 1PX7A 2YWOA 1TXXA 2CAQA 1WWJA 4FIWA 4O92A 2M72A 2XC2A 1E6BA 4HJMA 1HNCA 5DALA 3FZ5A 2F3MA 2DJ1A 5DDLA 2WB9A 1UVZA 1TK8B 4PXOA 1EZKA 3IXRA 4CW9A 2R37A 1BEDA 4CDOA 4AJ8A 2RM6A 4OFMA 4L5LA 4I2UA 2LRNA 3WGDA 3WGEA 1PRXA 4USSA 3F4SA 3IBHA 3EYTA 4TR1A 2OA7A 5E4WA 2R0CA 5B6NA 1IYIA 1EOGA 5JCUA 1XWAA 2V6KA 2WDUA 5ID2A 3J7Yb 3HJPA 1OVNA 3CSIA 1C72A 5FWGA 4MCUA 3C1RA 3HXSA 3L0HA 1T00A 2DJ2A 3F8UA 3HD5A 2CX4A 3ERWA 2L6DA 2B1LA 2LNSA 1RW1A 4AJ6A 5CRWA 4KSMA 3L9VA 1ERUA 4ZILA 2IMDA 1K0NA 2H6YA 2VD0A 2BTOT 4KE3A 1R26A 4ULXA 3HY2A 1G6WA 1M7TA 3VLNA 4BWSA 1XW6A 2O7KA 1O81A 4ZB6A 3VPTA 3F9UA 2N5FA 4NPBA 4ML6A 1A24A 3DXBA 2FWEA 2K8SA 1XVWA 4LLRA 4YAVA 2LQOA 3HJMA 2VOCA 3P90A 1F6MC 1E2YA 3RDWA 3APSA 1AAZA 1GP1A 3Q6OA 3TKSE 3ME8A 4ZB9A 1AW9A 3KD0A 3GKNA 4TR0A 1PMTA 3MYDA 3GL3A 1JFUA 2CZ2A 3GSSA 4EXJA 1MDKA 3GIXA 5IO0A 4G9HA 4PQ1A 1YKAA 2V6OA 1S3DA 3IK9A 1R5PA 2MMAA 2V1MA 3MIXA 3GTUA 1SKSB 3GH9A 4IHUA 4F03A 1PA3A 1PN0A 4QL9A 5D9TA 2MBTA 4DSQA 2C3TA 3EE2A 2WFCA 1GNEA 2VCVA 4CY6A 1TK0B 2B7KA 1NW2A 4HQZA 3KIJA 2OE3A 3KH7A 4GF0A 1SD8A 2ZUPA 4WBJA 4DEJA 1OC3A 2N5BA 3HVVA 2B5XA 4I5QA 1KNGA 1ON4A 1GSEA 1TRVA 4OWYA 3RBTA 2JACA 3O3TA 3UBLA 3EU3A 2H30A 4MJEA 5CNWA 2BMXA 4O5UA 1SL2B 4ECJA 1R7HA 4EIPA 3RPPA 3FZAA 1MD4A 2HE3A 2LJRA 3RHBA 2JSZA 2GS3A 18GSA 4L5OA 1JLVA 1K0BA 2LNTA 3KJYA 3EINA 4XS4A 1Q4JA 4V2NA 1SL0B 4OMVA 5B7CA 1PL2A 3N9JA 2GQKA 5DAKA 1ERTA 3D0ZA 3I69A 2NTOA 3BCIA 5CREA 4OFTA 4CHSA 5IOWA 3ZVJD 2F51A 1VF4A 3HHVA 4WKWA 5INYA 3UARA 2KP1A 3FY7A 4GTUA 3FK8A 4WF4A 3M1GA 1K3OA 4ILFA 3GL5A 3UOMA 2PGTA 1G7OA 1BX9A 4MH3A 2OADA 2HZFA 3HZ8A 4RQXA 3KXOA 2O89A 1V9WA 4I6XA 2R2JA 2IPAA 1QUWA 1WOUA 3EURA 2PN8A 1SJIA 2PUKC 4G19A 3ZREA 3TKQA 2P5RA 1OC9B 5GSSA 3HJOA 1GUMA 5EL8A 2A2PA 4K9ZA 1M9AA 2H0HA 2CQ9A 5DBQA 4MDCA 3CSHA 2K8VA 5KOXA 1OYJA 3GURA 1J08A 2VLTA 3CTGA 1HYUA 4ZBBA 3G7JA 4YKGA 2CVDA 3GV1A 1V98A 5G30A 4ZBDA 3P8WA 3VURA 1X9SB 5ECOB 2E0QA 3LGCA 2KUCA 4JU5A 3JCML 3A2WA 1F9MA 2FWFA 2H6ZA 1OE7A 2WRTA 5J3RA 4MJCA 3C73A 1TW9A 5ENUA 2CZ3A 4ID0A 4IBPA 4EF0A 2ALBA 3RAZA 2HSHA 1YDKA 1DE1A 4KB3A 1B9XC 1JZDA 3IR4A 4NXIA 1W4VA 2VCWA 5GZZB 4Z2TA 4IKHA 1M9BA 4EO3A 5IOXA 4MZBA 3QAGA 2GT6A 2UZ8A 2YPMA 2B1KA 1ERVA 2CX3A 2LUSA 2PBJA 1CQGA 4NMUA 4MNNA 3MAKA 3EMXA 4ZB8A 2R5GA 2VL2A 1Y25A 2X4AA 3ZTLA 5G2ZA 4KCAA 4Q5NA 3M9JA 3KP8A 1U87A 2RIIA 3ISOA 4ZL7A 1F37A 3HA9A 3ZRDA 2F8FA 6GSTA 3BOAA 6GSUA 4POKA 4JR6A 5EY6A 4PQHA 2YANA 2JZTA 2VL9A 4MJAA 2QA1A 5ECLB 3ZL5A 4K6XA 2P31A 2J23A 5B8AA 1SJZA 3D21A 3GX8A 3WGXA 1XPVA 2VAFA 2HXKA 5DCGA 1JZWA 1PL1A 2KHPA 1TI1A 1HNAA 3HCZA 3MSZA 4YKFA 1MTCA 1B8XA 4JEDA 1I9DA 5IMVA 3KM6A 4KSOA 1BG5A 3KZQA 4MF7A 4X4JA 3TUEA 3D22A 4J56E 4WXTA 4HU7A 2K18A 4LL4B 2K6VA 2KLXA 4ZIJA 2H0IA 4MZWA 2GTUA 5KN1A 2XPDA 3IRAA 4RI6A 1R5AA 7GSSA 5AGYA 4NHWA 1K3LA 3A5WA 5ECSA 1ML6A 4N0ZA 4GQFA 2REMA 2HT9A 1JLWA 2OBKA 3DKSA 4EE0A 5FHIA 3VFIA 2MZCA 4NWYA 5ELAA 1ERWA 4OFNA 5EPFA 10GSA 3ZZXA 6GSSA 4FYUA 2NDOA 2CA8A 5G1KA 3F4TA 2PVOC 1B4PA 1NM3A 5DJLA 4IP1A 2DKHA 4HZ4A 4GSSA 1WRYA 4GRFA 1O7UA 1K3YA 1EOHA 2GZPA 4IGJA 4G0KA 4K8MA 1SKWB 5ABRA 1TRUA 5CP1A 2HFDA 2YCDA 4K5RA 3HVXA 4L8EA 2H01A 3TJGA 1UA5A 1YEXA 1RK4A 3HVSA 1AIUA 4OCFA 3M8NA 3ZIVA 4MF6A 3TKPA 2QKEA 1XW9A 2FNOA 2R6KA 1ZGNA 1NHOA 3C7MA 1Q98A 3I43A 3UIWA 1WIKA 1EEJA 2DIYA 2X8HA 1USBA 3KMOA 1OKTA 3DEXA 1XIYA 3NZNA 4F82A 4GQCA 4XS1A 2I1UA 5AIXA 1EEMA 3D4MA 5F07A 2H71A 2GZZA 5ECKB 3QOUA 4PTSA 4XRDA 3QDNA 1Z6NA 4HEA2 4TKYA 2H73A 1FOHA 5D96A 3FMWA 2C80A 1I5GA 2HZEB 2DBCA 4IQAA 3CSJA 5IIZA 4PNGA 3IHQA 2XHFA 4TR4A 2GDRA 4DSRA 2WJUA 2F9SA 2A2RA 2JL4A 1ZYQB 1F2EA 2H1GA 4OO4A 2A4HA 5J4UA 4X0XA 2X64A 1JZOA 3VWVA 1EGOA 3M9KA 4JBBA 3DVXA 5C00A 4KDUA 4IP6A 3DYRA 1LBKA 2IFQA 1N2AA 3Q19A 1S3CA 4TXOA 1ZOFA 3KH9A 2WZ9A 1N8JA 2TIRA 1A8LA 5HFKA 1TI3A 2G2QA 3Q18A 4MJBA 4EDZA 5IO2A 3RHCA 3F0IA 3DGQA 1GTIA 3QMXA 4BPYA 2FHEA 2D2ZA 1U6TA 4IQ1A 2HI7A 2B6MA 1AQVA 1XVQA 4EKZA 3DWVA 4KDYA 1GSQA 2EC4A 2R0PA 3IHGA 2I9HA 2V41A 3H8QA 4V1Ag 5HR0A 1GH2A 1YZXA 3UAPA 2GSSA 4KCEA 1ZYNA 5CRHA 5HQPA 4V2LA 4K2DA 3A2VA 2OACA 4BVYB 1AUCA 2DJJA 1X5DA 2MMOA 1SK0A 3FEUA 3IAM2 4J57E 5HR2A 1GL8A 2PPTA 4TR3A 3KGKA 1M99A 5DALB 1A0RP 4P3YB 4KGIA 3IOSA 4D73A 5A4WA 2PMTA 4JZQA 4O32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YZH A;  3KEB A;  3QFB C;  4I97 A;  1G7E A;  4QQ7 A;  1O8X A;  3TB2 A;  4DSS A;  2C0E A;  5IMD A;  2FD3 A;  1J9B A;  3H79 A;  5H5S A;  2O85 A;  3FRC A;  1MDJ A;  3US3 A;  4GCI A;  3ZML A;  1A2J A;  4TR1 B;  5KN2 A;  4IS0 A;  4POM A;  3RPN A;  5D93 A;  1PN9 A;  4JR4 A;  4IJI A;  2GST A;  2IMF A;  3VI5 A;  2H75 A;  5ID2 B;  2H74 A;  1CQH A;  1GTU A;  5L71 A;  2YJH A;  1EP8 A;  2YZU A;  6GSY A;  6GSW A;  1SL1 B;  1HD2 A;  3KCM A;  4J2F A;  4HZ2 A;  1Z5Y E;  2DML A;  4ZBA A;  5CRD A;  2YWM A;  3NIV A;  2JZR A;  2B5E A;  4KH7 A;  5DVB A;  3HZ4 A;  3GFK A;  1T4Z A;  2LRT A;  2VL2 C;  4N30 A;  4HJ2 A;  4BWQ A;  3LYP A;  2H1A A;  1FW1 A;  4BVX A;  4TXO B;  3GST A;  3A3T A;  1WE0 A;  5F0G A;  4RI7 A;  1FG4 A;  4E8E A;  3BBY A;  3D5J A;  1W89 A;  1TTZ A;  4XS6 A;  2DC5 A;  3BJ5 A;  2CAI A;  1QMV A;  4NV5 A;  1GSS A;  1GTA A;  3ZLP A;  2AHE A;  1PSQ A;  3P2A A;  5A5K A;  5G1L A;  5CYY A;  3MNG A;  1Z7P A;  1LJR A;  4PQI A;  3G7I A;  4MLY A;  12GS A;  1FVK A;  2YP6 A;  3OR5 A;  1K0C A;  1OC8 A;  5AIV A;  4PNF A;  5J5N A;  1X9W B;  2VLV A;  1WJK A;  3TCO A;  1O6J A;  4F0C A;  1OAZ A;  1WMJ A;  3GX0 A;  3H1N A;  3IDV A;  1X5C A;  5LCZ A;  2YV9 A;  3GTU B;  1TU8 A;  2VM2 A;  4KUN A;  1TK5 B;  2JU5 A;  1QXH A;  1JHB A;  3EC3 A;  4ECB A;  3VPQ A;  2VLU A;  2GQM A;  2RUF A;  4L0W A;  3TKR A;  1EV4 A;  3GKK A;  3LSZ A;  1XOB A;  1EV9 A;  4K7O A;  4G10 A;  3D6I A;  2AB6 A;  3V1W A;  1GWC A;  1TDI A;  2H66 A;  4OD7 A;  1SK2 A;  3GKM A;  4IEL A;  1XFL A;  1A0F A;  2YJ7 A;  2GGT A;  4HI7 A;  2J9H A;  5H5R A;  4NHZ A;  4MA9 A;  3K8N A;  4HOJ A;  3FR9 A;  1XWG A;  1X9M B;  3CTF A;  1B4Q A;  2L4C A;  3E0U A;  3APO A;  3UVT A;  2H70 A;  4Q5Q A;  3MWH A;  1O8W A;  2GT5 A;  1X0R A;  2LTK A;  2FA8 A;  1ZL9 A;  3IV4 A;  2KP2 A;  3A2X A;  4XS4 B;  1VGL A;  5E59 A;  1OKD A;  4BL7 A;  1THO A;  3ZIJ A;  5DAK B;  2AYT A;  5KEJ A;  2X8G A;  4GXZ A;  1AQX A;  2F8A A;  1XOA A;  3GA4 A;  1K0O A;  1NHY A;  2I81 A;  3TDG A;  3TGZ A;  1QK8 A;  3FZ9 A;  1ABA A;  5ECR B;  4KX4 A;  2DJK A;  2LKU A;  5B6M A;  3UJ1 A;  1GLQ A;  3O76 A;  5KN3 A;  1OE8 A;  3TJF A;  5ECI B;  3GNJ A;  5IQY A;  1H4O A;  19GS A;  1GRX A;  2E7P A;  3IK7 A;  2R4V A;  4WBR D;  3C71 A;  3F4R A;  3FZ4 A;  3GN3 A;  1V58 A;  1ZCP A;  5A4V A;  1DUG A;  1KTE A;  2IJY A;  4F2I A;  1YF1 A;  4K1F A;  4MMM A;  2HRN A;  2OJL A;  4GST A;  4PUA A;  2Z9S A;  4L0U A;  2L57 A;  3UL3 A;  2MYG A;  1PKW A;  2OBI A;  4XIH A;  1SYX A;  5D8I A;  3CRT A;  5D9V A;  2LST A;  1VF2 A;  5D73 A;  3LXZ A;  2YOI A;  1ILO A;  1SKR B;  2FUG 2;  2NPB A;  1A2M A;  2IME A;  4JE1 A;  2AAW A;  3TJB A;  1F3B A;  3N5O A;  3KTB A;  1VRS D;  4E8H A;  1TOF A;  1GSU A;  1SYR A;  1KEB A;  5F06 A;  1QFN A;  4HU9 A;  2H6X A;  2AUV A;  2EIR A;  2L5L A;  1WP0 A;  3GHA A;  3QCP A;  4X1U A;  4ZL8 A;  3VK9 A;  1J0F A;  2XPE A;  2H8L A;  2OKA A;  2C4J A;  1H75 A;  1PD2 1;  4X43 A;  4KW6 A;  11GS A;  2C0D A;  4LA1 A;  5ECN B;  3E3E A;  4GLT A;  2B5Y A;  3EWL A;  4KND A;  3LWA A;  1M0U A;  4I8B A;  3TRP A;  3NOF A;  4MP4 A;  5HFG A;  2I3Y A;  3TKS A;  3WT2 A;  1Y6E A;  2JZS A;  2RUE A;  2DJ0 A;  2FY6 A;  9GSS A;  4Z7X A;  3EVI A;  2LS5 A;  5LD0 A;  3DVW A;  3UVH A;  2DLX A;  1QGV A;  1JZR A;  2E2M A;  1ZMA A;  3I9V 2;  1G6Y A;  5G5F A;  1GUK A;  3ERG A;  4TN8 A;  2MMZ A;  2KOK A;  3LJR A;  5HR3 A;  6GSX A;  3J7Y k;  4JRR A;  4HS1 A;  14GS A;  2ZCT A;  3R2Q A;  1T3B A;  3L9U A;  1T1V A;  2HSY A;  3EU4 A;  3HYP A;  3M0F A;  4K7I A;  4PX1 A;  2I4A A;  2IIY A;  4LMW A;  3H4K A;  1ZZY A;  3AY8 A;  1GUL A;  5GAP D;  1RQM A;  3DRN A;  3QAW A;  1GSD A;  1Z9H A;  4MK3 A;  5J41 A;  2E2G A;  2M46 A;  5GAN D;  2L4Q A;  4NAX A;  3ZIT A;  1GUH A;  2O87 A;  4IJ3 A;  1BQ7 A;  5JWR B;  3DIE A;  2VIM A;  4MPG A;  1TP9 A;  3PGT A;  4YQM A;  5GST A;  2LEG A;  4ZXG A;  3C1S A;  2ZNM A;  1R4W A;  2WGR A;  5DQY A;  2G0F A;  3IPZ A;  3GYK A;  4KAE A;  2QGV A;  1UN2 A;  4XHM A;  1S3A A;  2FWG A;  4XCS A;  2LQQ A;  5ECP B;  2EIO A;  1V40 A;  2VCZ A;  5ECM B;  1U88 A;  2DJ3 A;  3GRX A;  2FCH A;  3UBK A;  3GH6 A;  2C0F A;  1GTB A;  3BD2 A;  2DMM A;  2IL3 A;  5FT3 A;  1BYE A;  1M2B A;  2K9F A;  2H76 A;  2LV3 A;  3F63 A;  1MEK A;  2LJA A;  1K0A A;  4TRX A;  1URM A;  4GSN A;  3TOU A;  2PER A;  4HUA A;  2H19 A;  1A2L A;  3UMA A;  1FOV A;  1YKC A;  2H1D A;  3GKX A;  3ZYW A;  4EDY A;  3TRX A;  5G31 A;  1DSB A;  13GS A;  5ECQ B;  2HLS A;  2O8V B;  2X99 A;  5IMZ A;  3ED3 A;  4O5R A;  4N11 A;  1F3A A;  4EUY A;  4EL1 A;  3CRU A;  2BJX A;  1FB0 A;  2YWN A;  3W8S A;  3CMI A;  3F3Q A;  3DML A;  3WYW A;  2C8U A;  3FR6 A;  1GSF A;  3CXG A;  2YN1 A;  3GUS A;  2VD1 A;  5ELG A;  4XTS A;  1DBY A;  3CYN A;  2LRC A;  3VI7 A;  1OC9 A;  1PX6 A;  2MMN A;  4RUV A;  4YQV A;  4K0G A;  1TRS A;  4HDE A;  1BJX A;  2QC7 A;  2H1B A;  3TOT A;  1EP7 A;  2VO4 A;  1Z7R A;  4H86 A;  3I6A A;  22GS A;  2VCQ A;  1T4Y A;  4K0N A;  1YQ1 A;  5AIS A;  5H5Q A;  1HNB A;  4IVF A;  1PGT A;  1O85 A;  2VM1 A;  1EGR A;  2PU9 C;  1FO5 A;  2IWT A;  2B7J A;  1SU9 A;  8GSS A;  3BCK A;  3MDK A;  4ECC A;  2H0G A;  1XBS A;  5JCW A;  5G5E A;  1TJD A;  1ZYE A;  1TKD B;  2WUL A;  3ZMK A;  1SEN A;  3VWU A;  4Q5F A;  5HFI A;  4IW9 A;  3LQ7 A;  5D9X A;  1LU4 A;  2IFQ B;  1SK1 A;  2JSY A;  3CBU A;  5CRG A;  4AGS A;  1PQN A;  2B3S A;  1GSY A;  3PR8 A;  1T8E B;  2C3Q A;  1NSW A;  2OE1 A;  4F9Z A;  4FO5 A;  4K7N A;  1ST9 A;  4POB A;  2C3N A;  3W6G A;  3L78 A;  3LG6 A;  3KP9 A;  3QD9 A;  2HNL A;  3UEM A;  1K0M A;  3IAS 2;  3PH9 A;  5JWO B;  4ECI A;  4MZC A;  2M80 A;  4F0B A;  1MD3 A;  3W8J A;  3VWX A;  3DD3 A;  2CVK A;  1XW5 A;  3ZFB A;  2L59 A;  1M2A A;  2WS2 A;  2V2G A;  4KDX A;  4V2M A;  3C8E A;  5IMA A;  2TRC P;  1HQO A;  5JWQ B;  1YF0 A;  5KN0 A;  3FR3 A;  4RQR A;  2A2S A;  5DJM A;  1Z3E A;  2GSR A;  2CVB A;  1WPI A;  2L5O A;  4EVM A;  2AV4 A;  2C1Y A;  5D9W A;  2VL3 A;  2YV7 A;  1GLP A;  3QR6 A;  4KA0 A;  2GQL A;  5DCH A;  2OE0 A;  2LJK A;  3ME7 A;  1G0T A;  4D73 B;  4N0V A;  4ISD A;  2PVQ A;  3ZFL A;  3SWL A;  4AJ7 A;  5HR1 A;  3TRQ A;  6GSV A;  2VCT A;  2RLI A;  3KMN A;  3ERF A;  2FLS A;  3O6T A;  1YJ6 A;  1M2D A;  4PUF C;  4V1A p;  4DSS B;  2VCX A;  4OCE A;  1TU7 A;  5B8B A;  3WD6 A;  1VF1 A;  4TW5 A;  5DQS A;  4EC0 A;  2L6C A;  2TRX A;  1XWK A;  1T7P B;  1XCC A;  3G9B A;  3IA1 A;  1AQW A;  4O7H A;  3HDC A;  5CO3 A;  3QAV A;  2RM5 A;  1YEP A;  2ON7 A;  2YWI A;  3TKS C;  4QL7 A;  4WEY A;  3SBC A;  3TJJ A;  20GS A;  2GZY A;  2A4V A;  2NVL A;  2N5A A;  1ACV A;  3PIN A;  1Z6M A;  4LL1 B;  3FKF A;  3TJK A;  4POL A;  2AJQ B;  1K0D A;  1MDI A;  1V2A A;  1SD9 A;  2XBQ A;  4MAB A;  5JCG A;  5A4U A;  4OO5 A;  2FWH A;  1QQ2 A;  1XWB A;  1VF3 A;  3H93 A;  2H72 A;  2P0G A;  3LEF A;  3U6V A;  1FVJ A;  2IMK A;  3Q74 A;  4YAP A;  3ZVJ A;  2GLR A;  4ML1 A;  1BAY A;  3LYK A;  3F3R A;  4ZL9 A;  3WT1 A;  4NV2 A;  3P7X A;  4WF5 A;  3U5R E;  3L4N A;  2CT6 A;  1KBN A;  3VWW A;  3E9J B;  1A8Y A;  1V57 A;  2WCI A;  4WR4 A;  2PWJ A;  3KTL A;  4YQU A;  4MPF A;  2IN3 A;  1B9Y C;  3IC4 A;  5J9B A;  5C04 A;  1FB6 A;  4Q5R A;  2MBS A;  2FA4 A;  2C0G A;  4WET A;  5J9C A;  4IN0 A;  2HYX A;  4TXV A;  2HZE A;  3LFL A;  2JAD A;  4HQS A;  4MH2 A;  1TRW A;  4LMV A;  4PUR A;  3FHK A;  1U3A A;  5IMF A;  1IYH A;  1O73 A;  4PGT A;  3LXT A;  5COH A;  4TOP A;  2P5Q A;  5IPH A;  17GS A;  2IMI A;  4MF5 A;  1XWC A;  4XRA A;  3F6D A;  2V32 A;  1GNW A;  2GVP A;  1YY7 A;  3QPM A;  4DVC A;  3EMP A;  1FHE A;  3FYG A;  2GSQ A;  5IPG A;  2ON5 A;  3FW2 A;  5ECH B;  5EVO A;  16GS A;  4ACS A;  1AC1 A;  4BA7 A;  4I2T A;  1XXU A;  3HKR A;  2EIQ A;  3S9F A;  2VUP A;  3M3M A;  5F8B A;  1B48 A;  1X5E A;  2YNX A;  4WR5 A;  3IE3 A;  1U3I A;  3LOR A;  2HRF A;  5IMC A;  1XZO A;  3D4T A;  2DSA A;  1EWX A;  3G7Y A;  4N10 A;  3QFA C;  1UC7 A;  1A23 A;  2R3X A;  5LNK e;  4AF2 A;  1PKZ A;  1SJ6 A;  2XBI A;  2DIZ A;  4G2E A;  1FAA A;  4TVE A;  3F6F A;  3APQ A;  3GMF A;  5AN1 A;  2QSI A;  2X8C A;  5IM9 A;  2NBS A;  1AXD A;  3L9S A;  1DE2 A;  2CV4 A;  5F05 A;  4BVY A;  1THX A;  4FYC A;  4YH2 A;  5CAX A;  2FGX A;  4FH8 A;  2ES7 A;  4GWR A;  4FYB A;  1PX7 A;  2YWO A;  1TXX A;  2CAQ A;  1WWJ A;  4FIW A;  4O92 A;  2M72 A;  2XC2 A;  1E6B A;  4HJM A;  1HNC A;  5DAL A;  3FZ5 A;  2F3M A;  2DJ1 A;  5DDL A;  2WB9 A;  1UVZ A;  1TK8 B;  4PXO A;  1EZK A;  3IXR A;  4CW9 A;  2R37 A;  1BED A;  4CDO A;  4AJ8 A;  2RM6 A;  4OFM A;  4L5L A;  4I2U A;  2LRN A;  3WGD A;  3WGE A;  1PRX A;  3F4S A;  3IBH A;  3EYT A;  4TR1 A;  2OA7 A;  5E4W A;  5B6N A;  1IYI A;  1EOG A;  5JCU A;  1XWA A;  2V6K A;  2WDU A;  5ID2 A;  3J7Y b;  3HJP A;  1OVN A;  3CSI A;  1C72 A;  5FWG A;  4MCU A;  3C1R A;  3HXS A;  3L0H A;  1T00 A;  2DJ2 A;  3F8U A;  3HD5 A;  2CX4 A;  3ERW A;  2L6D A;  2B1L A;  2LNS A;  1RW1 A;  4AJ6 A;  5CRW A;  4KSM A;  3L9V A;  1ERU A;  4ZIL A;  2IMD A;  1K0N A;  2H6Y A;  2VD0 A;  2BTO T;  4KE3 A;  1R26 A;  4ULX A;  3HY2 A;  1G6W A;  1M7T A;  3VLN A;  4BWS A;  1XW6 A;  2O7K A;  1O81 A;  4ZB6 A;  3VPT A;  3F9U A;  2N5F A;  4NPB A;  4ML6 A;  1A24 A;  3DXB A;  2FWE A;  2K8S A;  1XVW A;  4LLR A;  4YAV A;  2LQO A;  3HJM A;  2VOC A;  3P90 A;  1F6M C;  1E2Y A;  3RDW A;  3APS A;  1AAZ A;  1GP1 A;  3Q6O A;  3TKS E;  3ME8 A;  4ZB9 A;  1AW9 A;  3KD0 A;  3GKN A;  4TR0 A;  1PMT A;  3GL3 A;  1JFU A;  2CZ2 A;  3GSS A;  4EXJ A;  1MDK A;  3GIX A;  5IO0 A;  4G9H A;  4PQ1 A;  1YKA A;  2V6O A;  1S3D A;  3IK9 A;  1R5P A;  2MMA A;  2V1M A;  3GTU A;  1SKS B;  3GH9 A;  4IHU A;  4F03 A;  1PA3 A;  4QL9 A;  5D9T A;  2MBT A;  4DSQ A;  2C3T A;  3EE2 A;  2WFC A;  1GNE A;  2VCV A;  1TK0 B;  2B7K A;  1NW2 A;  4HQZ A;  3KIJ A;  2OE3 A;  3KH7 A;  4GF0 A;  1SD8 A;  2ZUP A;  4WBJ A;  4DEJ A;  1OC3 A;  2N5B A;  3HVV A;  2B5X A;  4I5Q A;  1KNG A;  1ON4 A;  1GSE A;  1TRV A;  4OWY A;  3RBT A;  2JAC A;  3O3T A;  3UBL A;  3EU3 A;  2H30 A;  4MJE A;  5CNW A;  2BMX A;  1SL2 B;  4ECJ A;  1R7H A;  3RPP A;  3FZA A;  1MD4 A;  2HE3 A;  2LJR A;  3RHB A;  2JSZ A;  2GS3 A;  18GS A;  4L5O A;  1JLV A;  1K0B A;  2LNT A;  3KJY A;  3EIN A;  4XS4 A;  1Q4J A;  4V2N A;  1SL0 B;  4OMV A;  5B7C A;  1PL2 A;  3N9J A;  2GQK A;  5DAK A;  1ERT A;  3D0Z A;  3I69 A;  2NTO A;  3BCI A;  5CRE A;  4OFT A;  4CHS A;  5IOW A;  3ZVJ D;  2F51 A;  1VF4 A;  3HHV A;  4WKW A;  5INY A;  3UAR A;  2KP1 A;  3FY7 A;  4GTU A;  3FK8 A;  4WF4 A;  3M1G A;  1K3O A;  4ILF A;  3GL5 A;  3UOM A;  2PGT A;  1G7O A;  1BX9 A;  4MH3 A;  2OAD A;  2HZF A;  3HZ8 A;  4RQX A;  3KXO A;  2O89 A;  1V9W A;  4I6X A;  2R2J A;  2IPA A;  1QUW A;  1WOU A;  3EUR A;  2PN8 A;  1SJI A;  2PUK C;  4G19 A;  3ZRE A;  3TKQ A;  2P5R A;  1OC9 B;  5GSS A;  3HJO A;  1GUM A;  5EL8 A;  4K9Z A;  1M9A A;  2H0H A;  2CQ9 A;  5DBQ A;  4MDC A;  3CSH A;  2K8V A;  1OYJ A;  3GUR A;  1J08 A;  2VLT A;  3CTG A;  1HYU A;  4ZBB A;  3G7J A;  2CVD A;  3GV1 A;  1V98 A;  5G30 A;  4ZBD A;  3P8W A;  3VUR A;  1X9S B;  5ECO B;  2E0Q A;  3LGC A;  2KUC A;  4JU5 A;  3JCM L;  3A2W A;  1F9M A;  2FWF A;  2H6Z A;  1OE7 A;  2WRT A;  5J3R A;  4MJC A;  3C73 A;  1TW9 A;  5ENU A;  2CZ3 A;  4ID0 A;  4IBP A;  4EF0 A;  2ALB A;  3RAZ A;  2HSH A;  1YDK A;  1DE1 A;  4KB3 A;  1B9X C;  1JZD A;  3IR4 A;  4NXI A;  1W4V A;  2VCW A;  5GZZ B;  4IKH A;  1M9B A;  4EO3 A;  5IOX A;  4MZB A;  3QAG A;  2GT6 A;  2YPM A;  2B1K A;  1ERV A;  2CX3 A;  2LUS A;  2PBJ A;  1CQG A;  4NMU A;  3MAK A;  3EMX A;  4ZB8 A;  2R5G A;  2VL2 A;  1Y25 A;  3ZTL A;  5G2Z A;  4KCA A;  4Q5N A;  3M9J A;  3KP8 A;  1U87 A;  2RII A;  3ISO A;  4ZL7 A;  1F37 A;  3HA9 A;  3ZRD A;  2F8F A;  6GST A;  3BOA A;  6GSU A;  4POK A;  4JR6 A;  5EY6 A;  4PQH A;  2YAN A;  2JZT A;  2VL9 A;  4MJA A;  5ECL B;  3ZL5 A;  4K6X A;  2P31 A;  2J23 A;  5B8A A;  1SJZ A;  3D21 A;  3GX8 A;  3WGX A;  1XPV A;  2VAF A;  2HXK A;  5DCG A;  1JZW A;  1PL1 A;  2KHP A;  1TI1 A;  1HNA A;  3HCZ A;  3MSZ A;  1MTC A;  1B8X A;  4JED A;  1I9D A;  5IMV A;  3KM6 A;  4KSO A;  1BG5 A;  3KZQ A;  4MF7 A;  3TUE A;  3D22 A;  4J56 E;  4WXT A;  4HU7 A;  2K18 A;  4LL4 B;  2K6V A;  2KLX A;  4ZIJ A;  2H0I A;  4MZW A;  2GTU A;  5KN1 A;  2XPD A;  3IRA A;  4RI6 A;  1R5A A;  7GSS A;  5AGY A;  4NHW A;  1K3L A;  3A5W A;  5ECS A;  1ML6 A;  4N0Z A;  4GQF A;  2REM A;  2HT9 A;  1JLW A;  2OBK A;  3DKS A;  4EE0 A;  5FHI A;  3VFI A;  2MZC A;  4NWY A;  5ELA A;  1ERW A;  4OFN A;  5EPF A;  10GS A;  3ZZX A;  6GSS A;  4FYU A;  2NDO A;  2CA8 A;  5G1K A;  3F4T A;  2PVO C;  1B4P A;  1NM3 A;  5DJL A;  4IP1 A;  4HZ4 A;  4GSS A;  1WRY A;  4GRF A;  1O7U A;  1K3Y A;  1EOH A;  2GZP A;  4IGJ A;  1SKW B;  4K8M A;  5ABR A;  1TRU A;  5CP1 A;  2HFD A;  2YCD A;  3HVX A;  4L8E A;  2H01 A;  3TJG A;  1UA5 A;  1YEX A;  1RK4 A;  3HVS A;  1AIU A;  4OCF A;  3M8N A;  3ZIV A;  4MF6 A;  3TKP A;  2QKE A;  1XW9 A;  2FNO A;  2R6K A;  1ZGN A;  1NHO A;  3C7M A;  1Q98 A;  3I43 A;  3UIW A;  1WIK A;  1EEJ A;  2DIY A;  2X8H A;  1USB A;  3KMO A;  1OKT A;  3DEX A;  1XIY A;  3NZN A;  4F82 A;  4GQC A;  4XS1 A;  2I1U A;  5AIX A;  1EEM A;  3D4M A;  5F07 A;  2H71 A;  2GZZ A;  5ECK B;  3QOU A;  4XRD A;  3QDN A;  1Z6N A;  4HEA 2;  4TKY A;  2H73 A;  5D96 A;  2C80 A;  1I5G A;  2HZE B;  2DBC A;  4IQA A;  3CSJ A;  5IIZ A;  4PNG A;  3IHQ A;  2XHF A;  4TR4 A;  2GDR A;  4DSR A;  2WJU A;  2F9S A;  2A2R A;  2JL4 A;  1ZYQ B;  1F2E A;  2H1G A;  4OO4 A;  5J4U A;  4X0X A;  2X64 A;  1JZO A;  3VWV A;  1EGO A;  3M9K A;  4JBB A;  3DVX A;  5C00 A;  4KDU A;  4IP6 A;  3DYR A;  1LBK A;  2IFQ A;  1N2A A;  3Q19 A;  1S3C A;  4TXO A;  1ZOF A;  3KH9 A;  2WZ9 A;  1N8J A;  2TIR A;  1A8L A;  5HFK A;  1TI3 A;  2G2Q A;  3Q18 A;  4MJB A;  4EDZ A;  5IO2 A;  3RHC A;  3F0I A;  3DGQ A;  1GTI A;  3QMX A;  4BPY A;  2FHE A;  2D2Z A;  1U6T A;  4IQ1 A;  2HI7 A;  2B6M A;  1AQV A;  1XVQ A;  4EKZ A;  3DWV A;  4KDY A;  1GSQ A;  2EC4 A;  2I9H A;  2V41 A;  3H8Q A;  4V1A g;  5HR0 A;  1GH2 A;  1YZX A;  3UAP A;  2GSS A;  4KCE A;  5CRH A;  5HQP A;  4V2L A;  4K2D A;  3A2V A;  2OAC A;  1AUC A;  2DJJ A;  1X5D A;  2MMO A;  1SK0 A;  3FEU A;  3IAM 2;  4J57 E;  5HR2 A;  1GL8 A;  2PPT A;  4TR3 A;  3KGK A;  1M99 A;  5DAL B;  1A0R P;  4P3Y B;  4KGI A;  3IOS A;  4D73 A;  5A4W A;  2PMT A;  4JZQ A;  4O32 A; 
#chains in the Genus database with same CATH topology
 2YZH A;  3KEB A;  3QFB C;  4I97 A;  1G7E A;  4QQ7 A;  1O8X A;  3TB2 A;  4DSS A;  2C0E A;  5IMD A;  2FD3 A;  1J9B A;  3H79 A;  5H5S A;  2O85 A;  3FRC A;  1MDJ A;  3US3 A;  4GCI A;  3ZML A;  1A2J A;  4TR1 B;  5KN2 A;  4IS0 A;  4POM A;  3RPN A;  5D93 A;  1PN9 A;  4JR4 A;  4IJI A;  2GST A;  2IMF A;  3VI5 A;  2H75 A;  5ID2 B;  2H74 A;  1CQH A;  1GTU A;  5L71 A;  2YJH A;  1EP8 A;  2YZU A;  3A5I A;  6GSY A;  6GSW A;  1SL1 B;  1HD2 A;  3KCM A;  4J2F A;  4HZ2 A;  1Z5Y E;  2DML A;  4ZBA A;  5CRD A;  2HRA A;  2YWM A;  3NIV A;  2JZR A;  2B5E A;  4KH7 A;  5DVB A;  3HZ4 A;  3GFK A;  1T4Z A;  2LRT A;  2VL2 C;  4N30 A;  4HJ2 A;  4BWQ A;  3LYP A;  2H1A A;  1FW1 A;  4BVX A;  4TXO B;  3GST A;  3A3T A;  1WE0 A;  5F0G A;  4RI7 A;  1FG4 A;  4E8E A;  3BBY A;  3D5J A;  1W89 A;  1TTZ A;  4XS6 A;  2DC5 A;  3BJ5 A;  2CAI A;  1QMV A;  4NV5 A;  1GSS A;  1GTA A;  3ZLP A;  2AHE A;  1PSQ A;  3P2A A;  5A5K A;  5G1L A;  5CYY A;  3MNG A;  1Z7P A;  1LJR A;  4PQI A;  3G7I A;  4MLY A;  12GS A;  1FVK A;  2YP6 A;  3OR5 A;  4O5Q A;  1K0C A;  1OC8 A;  5AIV A;  4PNF A;  5J5N A;  1X9W B;  2VLV A;  1WJK A;  3TCO A;  1O6J A;  4F0C A;  1OAZ A;  1WMJ A;  3GX0 A;  3H1N A;  3IDV A;  1X5C A;  5LCZ A;  2YV9 A;  3GTU B;  1TU8 A;  2VM2 A;  4KUN A;  1ZYP A;  1TK5 B;  2JU5 A;  1QXH A;  1JHB A;  3EC3 A;  4ECB A;  3VPQ A;  2VLU A;  2GQM A;  2RUF A;  4L0W A;  3TKR A;  4FQU A;  1EV4 A;  3GKK A;  3LSZ A;  1XOB A;  1EV9 A;  4A5P A;  4K7O A;  4G10 A;  3D6I A;  2AB6 A;  3V1W A;  1GWC A;  1TDI A;  2H66 A;  4OD7 A;  1SK2 A;  3GKM A;  4IEL A;  1XFL A;  1A0F A;  2YJ7 A;  2GGT A;  4HI7 A;  2J9H A;  5H5R A;  4NHZ A;  4MA9 A;  3K8N A;  4HOJ A;  3FR9 A;  1XWG A;  1X9M B;  3CTF A;  1B4Q A;  2L4C A;  3E0U A;  3APO A;  3UVT A;  2H70 A;  4Q5Q A;  3MWH A;  1O8W A;  2GT5 A;  1X0R A;  4CY8 A;  2LTK A;  2FA8 A;  1ZL9 A;  3IV4 A;  2KP2 A;  3A2X A;  1XG8 A;  4XS4 B;  1VGL A;  5E59 A;  1OKD A;  4BL7 A;  1THO A;  3ZIJ A;  5DAK B;  2AYT A;  5KEJ A;  2X8G A;  4GXZ A;  1AQX A;  2F8A A;  1XOA A;  3GA4 A;  1K0O A;  1NHY A;  2I81 A;  3TDG A;  3TGZ A;  1QK8 A;  3FZ9 A;  1ABA A;  5ECR B;  4KX4 A;  2DJK A;  2LKU A;  5B6M A;  3UJ1 A;  1GLQ A;  3O76 A;  5KN3 A;  1OE8 A;  3TJF A;  5ECI B;  3GNJ A;  5IQY A;  1H4O A;  19GS A;  1GRX A;  2E7P A;  3IK7 A;  2R4V A;  4WBR D;  3C71 A;  3F4R A;  3FZ4 A;  3GN3 A;  1V58 A;  1ZCP A;  2HRK A;  5A4V A;  1DUG A;  1KTE A;  2IJY A;  4F2I A;  1YF1 A;  4K1F A;  4MMM A;  2DKI A;  2HRN A;  2OJL A;  4GST A;  4PUA A;  2Z9S A;  4L0U A;  2L57 A;  3UL3 A;  2MYG A;  1PKW A;  2OBI A;  4XIH A;  1SYX A;  5D8I A;  3CRT A;  5D9V A;  2LST A;  1VF2 A;  5D73 A;  3LXZ A;  2YOI A;  1ILO A;  1SKR B;  2FUG 2;  2NPB A;  1A2M A;  2IME A;  4JE1 A;  2AAW A;  3TJB A;  1F3B A;  3N5O A;  3KTB A;  1VRS D;  4E8H A;  1TOF A;  1GSU A;  1SYR A;  1KEB A;  5F06 A;  1QFN A;  3IC8 A;  4ICY A;  4HU9 A;  2H6X A;  2AUV A;  2EIR A;  2L5L A;  1WP0 A;  3GHA A;  3QCP A;  4X1U A;  4ZL8 A;  3VK9 A;  1J0F A;  2XPE A;  2H8L A;  2OKA A;  2C4J A;  1H75 A;  1PD2 1;  4X43 A;  4KW6 A;  11GS A;  2C0D A;  4LA1 A;  5ECN B;  3E3E A;  4GLT A;  2B5Y A;  3EWL A;  4KND A;  3LWA A;  1M0U A;  4I8B A;  3TRP A;  3NOF A;  4MP4 A;  5HFG A;  2I3Y A;  3TKS A;  3WT2 A;  1Y6E A;  2JZS A;  2RUE A;  2DJ0 A;  2FY6 A;  9GSS A;  4Z7X A;  3EVI A;  2LS5 A;  5LD0 A;  3DVW A;  3UVH A;  2DLX A;  1QGV A;  1JZR A;  2E2M A;  4KF9 A;  1ZMA A;  3I9V 2;  1G6Y A;  5G5F A;  1GUK A;  3ERG A;  4TN8 A;  2MMZ A;  2KOK A;  3LJR A;  5HR3 A;  6GSX A;  3J7Y k;  4JRR A;  4HS1 A;  3PPU A;  14GS A;  2ZCT A;  3R2Q A;  1T3B A;  3L9U A;  1T1V A;  2HSY A;  4Z2U A;  3EU4 A;  3HYP A;  3M0F A;  4K7I A;  4PX1 A;  2I4A A;  2IIY A;  4LMW A;  3H4K A;  1ZZY A;  3AY8 A;  1GUL A;  5GAP D;  1RQM A;  1S3R A;  3DRN A;  3QAW A;  1GSD A;  1Z9H A;  4MK3 A;  5J41 A;  2E2G A;  2M46 A;  5GAN D;  2L4Q A;  4NAX A;  5KOW A;  3ZIT A;  1GUH A;  2O87 A;  4IJ3 A;  1BQ7 A;  5JWR B;  3DIE A;  2VIM A;  4MPG A;  1TP9 A;  3PGT A;  4YQM A;  5GST A;  2LEG A;  4ZXG A;  3C1S A;  2ZNM A;  1R4W A;  2WGR A;  5DQY A;  2G0F A;  4G0I A;  3IPZ A;  3GYK A;  4KAE A;  2QGV A;  1UN2 A;  4XHM A;  1S3A A;  2FWG A;  4XCS A;  2LQQ A;  5ECP B;  2EIO A;  1V40 A;  2VCZ A;  5ECM B;  1U88 A;  2DJ3 A;  3GRX A;  2FCH A;  3UBK A;  3GH6 A;  2C0F A;  1GTB A;  3BD2 A;  2DMM A;  2IL3 A;  5FT3 A;  1BYE A;  1M2B A;  2K9F A;  2H76 A;  2HSM A;  2LV3 A;  3F63 A;  1MEK A;  2LJA A;  1K0A A;  4K5S A;  4TRX A;  1URM A;  4GSN A;  3TOU A;  2PER A;  4HUA A;  2H19 A;  1A2L A;  3UMA A;  1FOV A;  1YKC A;  2H1D A;  3GKX A;  3ZYW A;  4EDY A;  3TRX A;  5G31 A;  1DSB A;  13GS A;  5ECQ B;  2HLS A;  2O8V B;  2X99 A;  5IMZ A;  3ED3 A;  4O5R A;  4N11 A;  1F3A A;  4EUY A;  4EL1 A;  3CRU A;  2BJX A;  1FB0 A;  2YWN A;  3W8S A;  3CMI A;  3F3Q A;  3DML A;  3WYW A;  2C8U A;  3FR6 A;  1GSF A;  3CXG A;  2X49 A;  2YN1 A;  3GUS A;  2VD1 A;  5ELG A;  4XTS A;  1DBY A;  3CYN A;  2LRC A;  3VI7 A;  1OC9 A;  1PX6 A;  5BRT A;  2MMN A;  4RUV A;  4YQV A;  4K0G A;  1TRS A;  4HDE A;  1BJX A;  2QC7 A;  2H1B A;  3TOT A;  1EP7 A;  2VO4 A;  1Z7R A;  4H86 A;  3I6A A;  22GS A;  2VCQ A;  1T4Y A;  4K0N A;  1YQ1 A;  5AIS A;  5H5Q A;  1HNB A;  4IVF A;  1PGT A;  5BMU A;  1O85 A;  2VM1 A;  1EGR A;  2PU9 C;  1FO5 A;  2IWT A;  2B7J A;  1SU9 A;  8GSS A;  1PFO A;  3BCK A;  3MDK A;  4ECC A;  2H0G A;  1XBS A;  5JCW A;  5G5E A;  1TJD A;  1ZYE A;  1TKD B;  2WUL A;  3ZMK A;  1SEN A;  3VWU A;  4Q5F A;  5HFI A;  4IW9 A;  3LQ7 A;  5D9X A;  4K2X A;  4G0L A;  1LU4 A;  2IFQ B;  1SK1 A;  2JSY A;  3CBU A;  5CRG A;  4AGS A;  1PQN A;  2B3S A;  1GSY A;  3PR8 A;  1T8E B;  2C3Q A;  1NSW A;  2OE1 A;  4F9Z A;  4FO5 A;  4K7N A;  1ST9 A;  4POB A;  2C3N A;  3W6G A;  3L78 A;  4Z2R A;  3LG6 A;  3KP9 A;  3QD9 A;  2HNL A;  3UEM A;  1K0M A;  3IAS 2;  3PH9 A;  5JWO B;  4ECI A;  4MZC A;  2M80 A;  4F0B A;  1MD3 A;  3W8J A;  3VWX A;  3DD3 A;  2CVK A;  1XW5 A;  3ZFB A;  2L59 A;  3LW9 A;  1M2A A;  2WS2 A;  2V2G A;  4KDX A;  4V2M A;  3C8E A;  5IMA A;  2TRC P;  1HQO A;  5JWQ B;  1YF0 A;  5KN0 A;  3FR3 A;  4RQR A;  2A2S A;  5DJM A;  1Z3E A;  2GSR A;  2CVB A;  1WPI A;  2L5O A;  4EVM A;  2AV4 A;  2C1Y A;  5D9W A;  2VL3 A;  2YV7 A;  1GLP A;  3QR6 A;  4KA0 A;  2GQL A;  5DCH A;  2OE0 A;  2LJK A;  3ME7 A;  1G0T A;  4D73 B;  4N0V A;  4ISD A;  2PVQ A;  3ZFL A;  3SWL A;  4AJ7 A;  5HR1 A;  3TRQ A;  6GSV A;  2VCT A;  2RLI A;  3KMN A;  3ERF A;  2FLS A;  3O6T A;  1YJ6 A;  1M2D A;  4PUF C;  4V1A p;  4DSS B;  2VCX A;  4OCE A;  1TU7 A;  5B8B A;  3WD6 A;  1VF1 A;  4TW5 A;  5DQS A;  4EC0 A;  2L6C A;  2TRX A;  1XWK A;  3CQF A;  1T7P B;  1XCC A;  3G9B A;  3IA1 A;  1AQW A;  4O7H A;  3HDC A;  5CO3 A;  3QAV A;  2RM5 A;  1YEP A;  2ON7 A;  2YWI A;  3TKS C;  4QL7 A;  4WEY A;  3SBC A;  3TJJ A;  20GS A;  2GZY A;  2A4V A;  2NVL A;  2N5A A;  1ACV A;  3PIN A;  1Z6M A;  4LL1 B;  3FKF A;  2R0G A;  3TJK A;  4POL A;  2AJQ B;  1K0D A;  1MDI A;  1V2A A;  1SD9 A;  2XBQ A;  4MAB A;  5JCG A;  5A4U A;  4OO5 A;  2FWH A;  1QQ2 A;  1XWB A;  1VF3 A;  3H93 A;  1M3J A;  2H72 A;  2P0G A;  3LEF A;  3U6V A;  1FVJ A;  2IMK A;  3Q74 A;  4YAP A;  3ZVJ A;  2GLR A;  4BVX B;  4ML1 A;  1BAY A;  3LYK A;  3F3R A;  4ZL9 A;  3WT1 A;  4NV2 A;  3P7X A;  4WF5 A;  3U5R E;  3L4N A;  2CT6 A;  1KBN A;  3VWW A;  3E9J B;  1A8Y A;  1V57 A;  2WCI A;  4WR4 A;  2PWJ A;  3KTL A;  4YQU A;  4MPF A;  2IN3 A;  1B9Y C;  3IC4 A;  5J9B A;  5C04 A;  1FB6 A;  4Q5R A;  2MBS A;  2FA4 A;  2C0G A;  4WET A;  5J9C A;  4IN0 A;  2HYX A;  4TXV A;  2HZE A;  3LFL A;  2JAD A;  4HQS A;  4MH2 A;  1TRW A;  4LMV A;  4PUR A;  3FHK A;  1U3A A;  5IMF A;  1IYH A;  1O73 A;  4PGT A;  3LXT A;  5COH A;  4TOP A;  3R3E A;  2P5Q A;  5IPH A;  17GS A;  2IMI A;  4MF5 A;  4EIQ A;  1XWC A;  4XRA A;  3F6D A;  2V32 A;  1GNW A;  2GVP A;  1YY7 A;  3QPM A;  4DVC A;  3EMP A;  1FHE A;  2QA2 A;  3FYG A;  2GSQ A;  3EPT A;  5IPG A;  2ON5 A;  3FW2 A;  5ECH B;  5EVO A;  16GS A;  4ACS A;  1AC1 A;  4BA7 A;  4I2T A;  1XXU A;  3HKR A;  2EIQ A;  3S9F A;  2VUP A;  3M3M A;  5F8B A;  1B48 A;  1X5E A;  2YNX A;  4WR5 A;  3IE3 A;  1U3I A;  3LOR A;  2HRF A;  5IMC A;  1XZO A;  3D4T A;  2DSA A;  1EWX A;  3G7Y A;  4N10 A;  3QFA C;  1UC7 A;  1A23 A;  2R3X A;  5LNK e;  4AF2 A;  1PKZ A;  1SJ6 A;  2XBI A;  2DIZ A;  4G2E A;  1FAA A;  4TVE A;  3F6F A;  3APQ A;  3GMF A;  5AN1 A;  2QSI A;  2X8C A;  5IM9 A;  2NBS A;  1AXD A;  3L9S A;  1DE2 A;  2CV4 A;  5F05 A;  4BVY A;  1THX A;  4FYC A;  4YH2 A;  5CAX A;  2FGX A;  4BL7 B;  4FH8 A;  2ES7 A;  4GWR A;  4FYB A;  1PX7 A;  2YWO A;  1TXX A;  2CAQ A;  1WWJ A;  4FIW A;  4O92 A;  2M72 A;  2XC2 A;  1E6B A;  4HJM A;  1HNC A;  5DAL A;  3FZ5 A;  2F3M A;  2DJ1 A;  5DDL A;  2WB9 A;  1UVZ A;  1TK8 B;  4PXO A;  1EZK A;  3IXR A;  4CW9 A;  2R37 A;  1BED A;  4CDO A;  4AJ8 A;  2RM6 A;  4OFM A;  4L5L A;  4I2U A;  2LRN A;  3WGD A;  3WGE A;  1PRX A;  4USS A;  3F4S A;  3IBH A;  3EYT A;  4TR1 A;  2OA7 A;  5E4W A;  2R0C A;  5B6N A;  1IYI A;  1EOG A;  5JCU A;  1XWA A;  2V6K A;  2WDU A;  5ID2 A;  3J7Y b;  3HJP A;  1OVN A;  3CSI A;  1C72 A;  5FWG A;  4MCU A;  3C1R A;  3HXS A;  3L0H A;  1T00 A;  2DJ2 A;  3F8U A;  3HD5 A;  2CX4 A;  3ERW A;  2L6D A;  2B1L A;  2LNS A;  1RW1 A;  4AJ6 A;  5CRW A;  4KSM A;  3L9V A;  1ERU A;  4ZIL A;  2IMD A;  1K0N A;  1M3I A;  2H6Y A;  2VD0 A;  2BTO T;  4KE3 A;  1R26 A;  4ULX A;  3HY2 A;  1G6W A;  1M7T A;  3VLN A;  4BWS A;  1XW6 A;  2O7K A;  1O81 A;  4ZB6 A;  3VPT A;  3F9U A;  2N5F A;  4NPB A;  4ML6 A;  1A24 A;  3DXB A;  2FWE A;  2K8S A;  1XVW A;  4LLR A;  4YAV A;  2LQO A;  3HJM A;  2VOC A;  3P90 A;  1F6M C;  1E2Y A;  3RDW A;  3APS A;  1AAZ A;  1GP1 A;  3Q6O A;  3TKS E;  3ME8 A;  4ZB9 A;  1AW9 A;  3KD0 A;  3GKN A;  4TR0 A;  1PMT A;  3MYD A;  3GL3 A;  1JFU A;  2CZ2 A;  3GSS A;  4EXJ A;  1MDK A;  3GIX A;  5IO0 A;  4G9H A;  4PQ1 A;  1YKA A;  2V6O A;  1S3D A;  3IK9 A;  1R5P A;  2MMA A;  2V1M A;  3MIX A;  3GTU A;  1SKS B;  3GH9 A;  4IHU A;  4F03 A;  1PA3 A;  1PN0 A;  4QL9 A;  5D9T A;  2MBT A;  4DSQ A;  2C3T A;  3EE2 A;  2WFC A;  1GNE A;  2VCV A;  4CY6 A;  1TK0 B;  2B7K A;  1NW2 A;  4HQZ A;  3KIJ A;  2OE3 A;  3KH7 A;  4GF0 A;  1SD8 A;  2ZUP A;  4WBJ A;  4DEJ A;  4BIK A;  1OC3 A;  2N5B A;  3HVV A;  2B5X A;  4I5Q A;  1KNG A;  1ON4 A;  1GSE A;  1TRV A;  4OWY A;  3RBT A;  2JAC A;  3O3T A;  3UBL A;  3EU3 A;  2H30 A;  4MJE A;  5CNW A;  2BMX A;  4O5U A;  1SL2 B;  4ECJ A;  1R7H A;  4EIP A;  3RPP A;  3FZA A;  1MD4 A;  2HE3 A;  2LJR A;  3RHB A;  2JSZ A;  2GS3 A;  18GS A;  4L5O A;  1JLV A;  1K0B A;  2LNT A;  3KJY A;  3EIN A;  4XS4 A;  1Q4J A;  4V2N A;  1SL0 B;  4OMV A;  5B7C A;  1PL2 A;  3N9J A;  2GQK A;  5DAK A;  1ERT A;  3D0Z A;  3I69 A;  2NTO A;  3BCI A;  5CRE A;  4OFT A;  4CHS A;  5IOW A;  3ZVJ D;  2F51 A;  1VF4 A;  3HHV A;  4WKW A;  5INY A;  3UAR A;  2KP1 A;  3FY7 A;  4GTU A;  3FK8 A;  4WF4 A;  3M1G A;  1K3O A;  4ILF A;  3GL5 A;  3UOM A;  2PGT A;  3HVN A;  1G7O A;  1BX9 A;  4MH3 A;  2OAD A;  2HZF A;  3HZ8 A;  4RQX A;  3KXO A;  2O89 A;  1V9W A;  4I6X A;  2R2J A;  2IPA A;  1QUW A;  1WOU A;  3EUR A;  2PN8 A;  1SJI A;  2PUK C;  4G19 A;  3ZRE A;  3TKQ A;  2P5R A;  1OC9 B;  5GSS A;  3HJO A;  1GUM A;  5EL8 A;  2A2P A;  4K9Z A;  1M9A A;  2H0H A;  2CQ9 A;  5DBQ A;  4MDC A;  3CSH A;  2K8V A;  5KOX A;  1OYJ A;  3GUR A;  1J08 A;  2VLT A;  3CTG A;  1HYU A;  4ZBB A;  3G7J A;  4YKG A;  2CVD A;  3GV1 A;  1V98 A;  5G30 A;  4ZBD A;  3P8W A;  3VUR A;  1X9S B;  5ECO B;  2E0Q A;  3LGC A;  2KUC A;  4JU5 A;  3JCM L;  3A2W A;  1F9M A;  2FWF A;  2H6Z A;  1OE7 A;  2WRT A;  5J3R A;  4MJC A;  3C73 A;  1TW9 A;  5ENU A;  2CZ3 A;  4ID0 A;  4IBP A;  4EF0 A;  2ALB A;  3RAZ A;  2HSH A;  1YDK A;  1DE1 A;  4KB3 A;  1B9X C;  1JZD A;  3IR4 A;  4NXI A;  1W4V A;  2VCW A;  5GZZ B;  4Z2T A;  4IKH A;  1M9B A;  4EO3 A;  5IOX A;  4MZB A;  3QAG A;  2GT6 A;  2UZ8 A;  2YPM A;  2B1K A;  1ERV A;  2CX3 A;  2LUS A;  2PBJ A;  1CQG A;  4NMU A;  4MNN A;  3MAK A;  3EMX A;  4ZB8 A;  2R5G A;  2VL2 A;  1Y25 A;  2X4A A;  3ZTL A;  5G2Z A;  4KCA A;  4Q5N A;  3M9J A;  3KP8 A;  1U87 A;  2RII A;  3ISO A;  4ZL7 A;  1F37 A;  3HA9 A;  3ZRD A;  2F8F A;  6GST A;  3BOA A;  6GSU A;  4POK A;  4JR6 A;  5EY6 A;  4PQH A;  2YAN A;  2JZT A;  2VL9 A;  4MJA A;  2QA1 A;  5ECL B;  3ZL5 A;  4K6X A;  2P31 A;  4HSC X;  2J23 A;  5B8A A;  1SJZ A;  3D21 A;  3GX8 A;  3WGX A;  1XPV A;  2VAF A;  2HXK A;  5DCG A;  1JZW A;  1PL1 A;  2KHP A;  1TI1 A;  1HNA A;  3HCZ A;  3MSZ A;  4YKF A;  1MTC A;  1B8X A;  4JED A;  1I9D A;  5IMV A;  3KM6 A;  4KSO A;  1BG5 A;  3KZQ A;  4MF7 A;  4X4J A;  3TUE A;  3D22 A;  4J56 E;  4WXT A;  4HU7 A;  2K18 A;  4LL4 B;  2K6V A;  2KLX A;  4ZIJ A;  2H0I A;  4MZW A;  2GTU A;  5KN1 A;  2XPD A;  3IRA A;  4RI6 A;  1R5A A;  7GSS A;  5AGY A;  4NHW A;  1K3L A;  3A5W A;  5ECS A;  1ML6 A;  4N0Z A;  4GQF A;  2REM A;  2HT9 A;  1JLW A;  2OBK A;  3DKS A;  4EE0 A;  5FHI A;  3VFI A;  2MZC A;  4NWY A;  5ELA A;  1ERW A;  4OFN A;  5EPF A;  10GS A;  3ZZX A;  6GSS A;  4FYU A;  2NDO A;  2CA8 A;  5G1K A;  3F4T A;  2PVO C;  1B4P A;  1NM3 A;  5DJL A;  4IP1 A;  2DKH A;  4HZ4 A;  4GSS A;  1WRY A;  4GRF A;  1O7U A;  1K3Y A;  1EOH A;  2GZP A;  4IGJ A;  4G0K A;  4K8M A;  1SKW B;  5ABR A;  1TRU A;  5CP1 A;  2HFD A;  2YCD A;  4K5R A;  3HVX A;  4L8E A;  2H01 A;  3TJG A;  1UA5 A;  1YEX A;  1RK4 A;  3HVS A;  1AIU A;  4OCF A;  3M8N A;  3ZIV A;  4MF6 A;  3TKP A;  2QKE A;  1XW9 A;  2FNO A;  2R6K A;  1ZGN A;  1NHO A;  3C7M A;  1Q98 A;  3I43 A;  3UIW A;  1WIK A;  1EEJ A;  2DIY A;  2X8H A;  1USB A;  3KMO A;  1OKT A;  3DEX A;  1XIY A;  3NZN A;  4F82 A;  4GQC A;  4XS1 A;  2I1U A;  5AIX A;  1EEM A;  3D4M A;  5F07 A;  2H71 A;  2GZZ A;  5ECK B;  3QOU A;  4PTS A;  4XRD A;  3QDN A;  1Z6N A;  4HEA 2;  4TKY A;  2H73 A;  1FOH A;  5D96 A;  3FMW A;  2C80 A;  1I5G A;  2HZE B;  2DBC A;  4IQA A;  3CSJ A;  5IIZ A;  4PNG A;  3IHQ A;  2XHF A;  4TR4 A;  2GDR A;  4DSR A;  2WJU A;  2F9S A;  2A2R A;  2JL4 A;  1ZYQ B;  1F2E A;  2H1G A;  4OO4 A;  2A4H A;  5J4U A;  4X0X A;  2X64 A;  1JZO A;  3VWV A;  1EGO A;  3M9K A;  4JBB A;  3DVX A;  5C00 A;  4KDU A;  4IP6 A;  3DYR A;  1LBK A;  2IFQ A;  1N2A A;  3Q19 A;  1S3C A;  4TXO A;  1ZOF A;  3KH9 A;  2WZ9 A;  1N8J A;  2TIR A;  1A8L A;  5HFK A;  1TI3 A;  2G2Q A;  3Q18 A;  4MJB A;  4EDZ A;  5IO2 A;  3RHC A;  3F0I A;  3DGQ A;  1GTI A;  3QMX A;  4BPY A;  2FHE A;  2D2Z A;  1U6T A;  4IQ1 A;  2HI7 A;  2B6M A;  1AQV A;  1XVQ A;  4EKZ A;  3DWV A;  4KDY A;  1GSQ A;  2EC4 A;  2R0P A;  3IHG A;  2I9H A;  2V41 A;  3H8Q A;  4V1A g;  5HR0 A;  1GH2 A;  1YZX A;  3UAP A;  2GSS A;  4KCE A;  1ZYN A;  5CRH A;  5HQP A;  4V2L A;  4K2D A;  3A2V A;  2OAC A;  4BVY B;  1AUC A;  2DJJ A;  1X5D A;  2MMO A;  1SK0 A;  3FEU A;  3IAM 2;  4J57 E;  5HR2 A;  1GL8 A;  2PPT A;  4TR3 A;  3KGK A;  1M99 A;  5DAL B;  1A0R P;  4P3Y B;  4KGI A;  3IOS A;  4D73 A;  5A4W A;  2PMT A;  4JZQ A;  4O32 A; 
#chains in the Genus database with same CATH homology
 2YZH A;  3KEB A;  3QFB C;  4I97 A;  1G7E A;  4QQ7 A;  1O8X A;  3TB2 A;  4DSS A;  2C0E A;  5IMD A;  2FD3 A;  1J9B A;  3H79 A;  5H5S A;  2O85 A;  3FRC A;  1MDJ A;  3US3 A;  4GCI A;  3ZML A;  1A2J A;  4TR1 B;  5KN2 A;  4IS0 A;  4POM A;  3RPN A;  5D93 A;  1PN9 A;  4JR4 A;  4IJI A;  2GST A;  2IMF A;  3VI5 A;  2H75 A;  5ID2 B;  2H74 A;  1CQH A;  1GTU A;  5L71 A;  2YJH A;  1EP8 A;  2YZU A;  3A5I A;  6GSY A;  6GSW A;  1SL1 B;  1HD2 A;  3KCM A;  4J2F A;  4HZ2 A;  1Z5Y E;  2DML A;  4ZBA A;  5CRD A;  2HRA A;  2YWM A;  3NIV A;  2JZR A;  2B5E A;  4KH7 A;  5DVB A;  3HZ4 A;  3GFK A;  1T4Z A;  2LRT A;  2VL2 C;  4N30 A;  4HJ2 A;  4BWQ A;  3LYP A;  2H1A A;  1FW1 A;  4BVX A;  4TXO B;  3GST A;  3A3T A;  1WE0 A;  5F0G A;  4RI7 A;  1FG4 A;  4E8E A;  3BBY A;  3D5J A;  1W89 A;  1TTZ A;  4XS6 A;  2DC5 A;  3BJ5 A;  2CAI A;  1QMV A;  4NV5 A;  1GSS A;  1GTA A;  3ZLP A;  2AHE A;  1PSQ A;  3P2A A;  5A5K A;  5G1L A;  5CYY A;  3MNG A;  1Z7P A;  1LJR A;  4PQI A;  3G7I A;  4MLY A;  12GS A;  1FVK A;  2YP6 A;  3OR5 A;  4O5Q A;  1K0C A;  1OC8 A;  5AIV A;  4PNF A;  5J5N A;  1X9W B;  2VLV A;  1WJK A;  3TCO A;  1O6J A;  4F0C A;  1OAZ A;  1WMJ A;  3GX0 A;  3H1N A;  3IDV A;  1X5C A;  5LCZ A;  2YV9 A;  3GTU B;  1TU8 A;  2VM2 A;  4KUN A;  1ZYP A;  1TK5 B;  2JU5 A;  1QXH A;  1JHB A;  3EC3 A;  4ECB A;  3VPQ A;  2VLU A;  2GQM A;  2RUF A;  4L0W A;  3TKR A;  4FQU A;  1EV4 A;  3GKK A;  3LSZ A;  1XOB A;  1EV9 A;  4A5P A;  4K7O A;  4G10 A;  3D6I A;  2AB6 A;  3V1W A;  1GWC A;  1TDI A;  2H66 A;  4OD7 A;  1SK2 A;  3GKM A;  4IEL A;  1XFL A;  1A0F A;  2YJ7 A;  2GGT A;  4HI7 A;  2J9H A;  5H5R A;  4NHZ A;  4MA9 A;  3K8N A;  4HOJ A;  3FR9 A;  1XWG A;  1X9M B;  3CTF A;  1B4Q A;  2L4C A;  3E0U A;  3APO A;  3UVT A;  2H70 A;  4Q5Q A;  3MWH A;  1O8W A;  2GT5 A;  1X0R A;  4CY8 A;  2LTK A;  2FA8 A;  1ZL9 A;  3IV4 A;  2KP2 A;  3A2X A;  4XS4 B;  1VGL A;  5E59 A;  1OKD A;  4BL7 A;  1THO A;  3ZIJ A;  5DAK B;  2AYT A;  5KEJ A;  2X8G A;  4GXZ A;  1AQX A;  2F8A A;  1XOA A;  3GA4 A;  1K0O A;  1NHY A;  2I81 A;  3TDG A;  3TGZ A;  1QK8 A;  3FZ9 A;  1ABA A;  5ECR B;  4KX4 A;  2DJK A;  2LKU A;  5B6M A;  3UJ1 A;  1GLQ A;  3O76 A;  5KN3 A;  1OE8 A;  3TJF A;  5ECI B;  3GNJ A;  5IQY A;  1H4O A;  19GS A;  1GRX A;  2E7P A;  3IK7 A;  2R4V A;  4WBR D;  3C71 A;  3F4R A;  3FZ4 A;  3GN3 A;  1V58 A;  1ZCP A;  2HRK A;  5A4V A;  1DUG A;  1KTE A;  2IJY A;  4F2I A;  1YF1 A;  4K1F A;  4MMM A;  2DKI A;  2HRN A;  2OJL A;  4GST A;  4PUA A;  2Z9S A;  4L0U A;  2L57 A;  3UL3 A;  2MYG A;  1PKW A;  2OBI A;  4XIH A;  1SYX A;  5D8I A;  3CRT A;  5D9V A;  2LST A;  1VF2 A;  5D73 A;  3LXZ A;  2YOI A;  1ILO A;  1SKR B;  2FUG 2;  2NPB A;  1A2M A;  2IME A;  4JE1 A;  2AAW A;  3TJB A;  1F3B A;  3N5O A;  3KTB A;  1VRS D;  4E8H A;  1TOF A;  1GSU A;  1SYR A;  1KEB A;  5F06 A;  1QFN A;  3IC8 A;  4ICY A;  4HU9 A;  2H6X A;  2AUV A;  2EIR A;  2L5L A;  1WP0 A;  3GHA A;  3QCP A;  4X1U A;  4ZL8 A;  3VK9 A;  1J0F A;  2XPE A;  2H8L A;  2OKA A;  2C4J A;  1H75 A;  1PD2 1;  4X43 A;  4KW6 A;  11GS A;  2C0D A;  4LA1 A;  5ECN B;  3E3E A;  4GLT A;  2B5Y A;  3EWL A;  4KND A;  3LWA A;  1M0U A;  4I8B A;  3TRP A;  3NOF A;  4MP4 A;  5HFG A;  2I3Y A;  3TKS A;  3WT2 A;  1Y6E A;  2JZS A;  2RUE A;  2DJ0 A;  2FY6 A;  9GSS A;  4Z7X A;  3EVI A;  2LS5 A;  5LD0 A;  3DVW A;  3UVH A;  2DLX A;  1QGV A;  1JZR A;  2E2M A;  4KF9 A;  1ZMA A;  3I9V 2;  1G6Y A;  5G5F A;  1GUK A;  3ERG A;  4TN8 A;  2MMZ A;  2KOK A;  3LJR A;  5HR3 A;  6GSX A;  3J7Y k;  4JRR A;  4HS1 A;  3PPU A;  14GS A;  2ZCT A;  3R2Q A;  1T3B A;  3L9U A;  1T1V A;  2HSY A;  4Z2U A;  3EU4 A;  3HYP A;  3M0F A;  4K7I A;  4PX1 A;  2I4A A;  2IIY A;  4LMW A;  3H4K A;  1ZZY A;  3AY8 A;  1GUL A;  5GAP D;  1RQM A;  3DRN A;  3QAW A;  1GSD A;  1Z9H A;  4MK3 A;  5J41 A;  2E2G A;  2M46 A;  5GAN D;  2L4Q A;  4NAX A;  5KOW A;  3ZIT A;  1GUH A;  2O87 A;  4IJ3 A;  1BQ7 A;  5JWR B;  3DIE A;  2VIM A;  4MPG A;  1TP9 A;  3PGT A;  4YQM A;  5GST A;  2LEG A;  4ZXG A;  3C1S A;  2ZNM A;  1R4W A;  2WGR A;  5DQY A;  2G0F A;  4G0I A;  3IPZ A;  3GYK A;  4KAE A;  2QGV A;  1UN2 A;  4XHM A;  1S3A A;  2FWG A;  4XCS A;  2LQQ A;  5ECP B;  2EIO A;  1V40 A;  2VCZ A;  5ECM B;  1U88 A;  2DJ3 A;  3GRX A;  2FCH A;  3UBK A;  3GH6 A;  2C0F A;  1GTB A;  3BD2 A;  2DMM A;  2IL3 A;  5FT3 A;  1BYE A;  1M2B A;  2K9F A;  2H76 A;  2HSM A;  2LV3 A;  3F63 A;  1MEK A;  2LJA A;  1K0A A;  4K5S A;  4TRX A;  1URM A;  4GSN A;  3TOU A;  2PER A;  4HUA A;  2H19 A;  1A2L A;  3UMA A;  1FOV A;  1YKC A;  2H1D A;  3GKX A;  3ZYW A;  4EDY A;  3TRX A;  5G31 A;  1DSB A;  13GS A;  5ECQ B;  2HLS A;  2O8V B;  2X99 A;  5IMZ A;  3ED3 A;  4O5R A;  4N11 A;  1F3A A;  4EUY A;  4EL1 A;  3CRU A;  2BJX A;  1FB0 A;  2YWN A;  3W8S A;  3CMI A;  3F3Q A;  3DML A;  3WYW A;  2C8U A;  3FR6 A;  1GSF A;  3CXG A;  2X49 A;  2YN1 A;  3GUS A;  2VD1 A;  5ELG A;  4XTS A;  1DBY A;  3CYN A;  2LRC A;  3VI7 A;  1OC9 A;  1PX6 A;  5BRT A;  2MMN A;  4RUV A;  4YQV A;  4K0G A;  1TRS A;  4HDE A;  1BJX A;  2QC7 A;  2H1B A;  3TOT A;  1EP7 A;  2VO4 A;  1Z7R A;  4H86 A;  3I6A A;  22GS A;  2VCQ A;  1T4Y A;  4K0N A;  1YQ1 A;  5AIS A;  5H5Q A;  1HNB A;  4IVF A;  1PGT A;  5BMU A;  1O85 A;  2VM1 A;  1EGR A;  2PU9 C;  1FO5 A;  2IWT A;  2B7J A;  1SU9 A;  8GSS A;  3BCK A;  3MDK A;  4ECC A;  2H0G A;  1XBS A;  5JCW A;  5G5E A;  1TJD A;  1ZYE A;  1TKD B;  2WUL A;  3ZMK A;  1SEN A;  3VWU A;  4Q5F A;  5HFI A;  4IW9 A;  3LQ7 A;  5D9X A;  4K2X A;  4G0L A;  1LU4 A;  2IFQ B;  1SK1 A;  2JSY A;  3CBU A;  5CRG A;  4AGS A;  1PQN A;  2B3S A;  1GSY A;  3PR8 A;  1T8E B;  2C3Q A;  1NSW A;  2OE1 A;  4F9Z A;  4FO5 A;  4K7N A;  1ST9 A;  4POB A;  2C3N A;  3W6G A;  3L78 A;  4Z2R A;  3LG6 A;  3KP9 A;  3QD9 A;  2HNL A;  3UEM A;  1K0M A;  3IAS 2;  3PH9 A;  5JWO B;  4ECI A;  4MZC A;  2M80 A;  4F0B A;  1MD3 A;  3W8J A;  3VWX A;  3DD3 A;  2CVK A;  1XW5 A;  3ZFB A;  2L59 A;  3LW9 A;  1M2A A;  2WS2 A;  2V2G A;  4KDX A;  4V2M A;  3C8E A;  5IMA A;  2TRC P;  1HQO A;  5JWQ B;  1YF0 A;  5KN0 A;  3FR3 A;  4RQR A;  2A2S A;  5DJM A;  1Z3E A;  2GSR A;  2CVB A;  1WPI A;  2L5O A;  4EVM A;  2AV4 A;  2C1Y A;  5D9W A;  2VL3 A;  2YV7 A;  1GLP A;  3QR6 A;  4KA0 A;  2GQL A;  5DCH A;  2OE0 A;  2LJK A;  3ME7 A;  1G0T A;  4D73 B;  4N0V A;  4ISD A;  2PVQ A;  3ZFL A;  3SWL A;  4AJ7 A;  5HR1 A;  3TRQ A;  6GSV A;  2VCT A;  2RLI A;  3KMN A;  3ERF A;  2FLS A;  3O6T A;  1YJ6 A;  1M2D A;  4PUF C;  4V1A p;  4DSS B;  2VCX A;  4OCE A;  1TU7 A;  5B8B A;  3WD6 A;  1VF1 A;  4TW5 A;  5DQS A;  4EC0 A;  2L6C A;  2TRX A;  1XWK A;  1T7P B;  1XCC A;  3G9B A;  3IA1 A;  1AQW A;  4O7H A;  3HDC A;  5CO3 A;  3QAV A;  2RM5 A;  1YEP A;  2ON7 A;  2YWI A;  3TKS C;  4QL7 A;  4WEY A;  3SBC A;  3TJJ A;  20GS A;  2GZY A;  2A4V A;  2NVL A;  2N5A A;  1ACV A;  3PIN A;  1Z6M A;  4LL1 B;  3FKF A;  2R0G A;  3TJK A;  4POL A;  2AJQ B;  1K0D A;  1MDI A;  1V2A A;  1SD9 A;  2XBQ A;  4MAB A;  5JCG A;  5A4U A;  4OO5 A;  2FWH A;  1QQ2 A;  1XWB A;  1VF3 A;  3H93 A;  2H72 A;  2P0G A;  3LEF A;  3U6V A;  1FVJ A;  2IMK A;  3Q74 A;  4YAP A;  3ZVJ A;  2GLR A;  4BVX B;  4ML1 A;  1BAY A;  3LYK A;  3F3R A;  4ZL9 A;  3WT1 A;  4NV2 A;  3P7X A;  4WF5 A;  3U5R E;  3L4N A;  2CT6 A;  1KBN A;  3VWW A;  3E9J B;  1A8Y A;  1V57 A;  2WCI A;  4WR4 A;  2PWJ A;  3KTL A;  4YQU A;  4MPF A;  2IN3 A;  1B9Y C;  3IC4 A;  5J9B A;  5C04 A;  1FB6 A;  4Q5R A;  2MBS A;  2FA4 A;  2C0G A;  4WET A;  5J9C A;  4IN0 A;  2HYX A;  4TXV A;  2HZE A;  3LFL A;  2JAD A;  4HQS A;  4MH2 A;  1TRW A;  4LMV A;  4PUR A;  3FHK A;  1U3A A;  5IMF A;  1IYH A;  1O73 A;  4PGT A;  3LXT A;  5COH A;  4TOP A;  3R3E A;  2P5Q A;  5IPH A;  17GS A;  2IMI A;  4MF5 A;  4EIQ A;  1XWC A;  4XRA A;  3F6D A;  2V32 A;  1GNW A;  2GVP A;  1YY7 A;  3QPM A;  4DVC A;  3EMP A;  1FHE A;  2QA2 A;  3FYG A;  2GSQ A;  3EPT A;  5IPG A;  2ON5 A;  3FW2 A;  5ECH B;  5EVO A;  16GS A;  4ACS A;  1AC1 A;  4BA7 A;  4I2T A;  1XXU A;  3HKR A;  2EIQ A;  3S9F A;  2VUP A;  3M3M A;  5F8B A;  1B48 A;  1X5E A;  2YNX A;  4WR5 A;  3IE3 A;  1U3I A;  3LOR A;  2HRF A;  5IMC A;  1XZO A;  3D4T A;  2DSA A;  1EWX A;  3G7Y A;  4N10 A;  3QFA C;  1UC7 A;  1A23 A;  2R3X A;  5LNK e;  4AF2 A;  1PKZ A;  1SJ6 A;  2XBI A;  2DIZ A;  4G2E A;  1FAA A;  4TVE A;  3F6F A;  3APQ A;  3GMF A;  5AN1 A;  2QSI A;  2X8C A;  5IM9 A;  2NBS A;  1AXD A;  3L9S A;  1DE2 A;  2CV4 A;  5F05 A;  4BVY A;  1THX A;  4FYC A;  4YH2 A;  5CAX A;  2FGX A;  4BL7 B;  4FH8 A;  2ES7 A;  4GWR A;  4FYB A;  1PX7 A;  2YWO A;  1TXX A;  2CAQ A;  1WWJ A;  4FIW A;  4O92 A;  2M72 A;  2XC2 A;  1E6B A;  4HJM A;  1HNC A;  5DAL A;  3FZ5 A;  2F3M A;  2DJ1 A;  5DDL A;  2WB9 A;  1UVZ A;  1TK8 B;  4PXO A;  1EZK A;  3IXR A;  4CW9 A;  2R37 A;  1BED A;  4CDO A;  4AJ8 A;  2RM6 A;  4OFM A;  4L5L A;  4I2U A;  2LRN A;  3WGD A;  3WGE A;  1PRX A;  4USS A;  3F4S A;  3IBH A;  3EYT A;  4TR1 A;  2OA7 A;  5E4W A;  2R0C A;  5B6N A;  1IYI A;  1EOG A;  5JCU A;  1XWA A;  2V6K A;  2WDU A;  5ID2 A;  3J7Y b;  3HJP A;  1OVN A;  3CSI A;  1C72 A;  5FWG A;  4MCU A;  3C1R A;  3HXS A;  3L0H A;  1T00 A;  2DJ2 A;  3F8U A;  3HD5 A;  2CX4 A;  3ERW A;  2L6D A;  2B1L A;  2LNS A;  1RW1 A;  4AJ6 A;  5CRW A;  4KSM A;  3L9V A;  1ERU A;  4ZIL A;  2IMD A;  1K0N A;  2H6Y A;  2VD0 A;  2BTO T;  4KE3 A;  1R26 A;  4ULX A;  3HY2 A;  1G6W A;  1M7T A;  3VLN A;  4BWS A;  1XW6 A;  2O7K A;  1O81 A;  4ZB6 A;  3VPT A;  3F9U A;  2N5F A;  4NPB A;  4ML6 A;  1A24 A;  3DXB A;  2FWE A;  2K8S A;  1XVW A;  4LLR A;  4YAV A;  2LQO A;  3HJM A;  2VOC A;  3P90 A;  1F6M C;  1E2Y A;  3RDW A;  3APS A;  1AAZ A;  1GP1 A;  3Q6O A;  3TKS E;  3ME8 A;  4ZB9 A;  1AW9 A;  3KD0 A;  3GKN A;  4TR0 A;  1PMT A;  3MYD A;  3GL3 A;  1JFU A;  2CZ2 A;  3GSS A;  4EXJ A;  1MDK A;  3GIX A;  5IO0 A;  4G9H A;  4PQ1 A;  1YKA A;  2V6O A;  1S3D A;  3IK9 A;  1R5P A;  2MMA A;  2V1M A;  3MIX A;  3GTU A;  1SKS B;  3GH9 A;  4IHU A;  4F03 A;  1PA3 A;  1PN0 A;  4QL9 A;  5D9T A;  2MBT A;  4DSQ A;  2C3T A;  3EE2 A;  2WFC A;  1GNE A;  2VCV A;  4CY6 A;  1TK0 B;  2B7K A;  1NW2 A;  4HQZ A;  3KIJ A;  2OE3 A;  3KH7 A;  4GF0 A;  1SD8 A;  2ZUP A;  4WBJ A;  4DEJ A;  1OC3 A;  2N5B A;  3HVV A;  2B5X A;  4I5Q A;  1KNG A;  1ON4 A;  1GSE A;  1TRV A;  4OWY A;  3RBT A;  2JAC A;  3O3T A;  3UBL A;  3EU3 A;  2H30 A;  4MJE A;  5CNW A;  2BMX A;  4O5U A;  1SL2 B;  4ECJ A;  1R7H A;  4EIP A;  3RPP A;  3FZA A;  1MD4 A;  2HE3 A;  2LJR A;  3RHB A;  2JSZ A;  2GS3 A;  18GS A;  4L5O A;  1JLV A;  1K0B A;  2LNT A;  3KJY A;  3EIN A;  4XS4 A;  1Q4J A;  4V2N A;  1SL0 B;  4OMV A;  5B7C A;  1PL2 A;  3N9J A;  2GQK A;  5DAK A;  1ERT A;  3D0Z A;  3I69 A;  2NTO A;  3BCI A;  5CRE A;  4OFT A;  4CHS A;  5IOW A;  3ZVJ D;  2F51 A;  1VF4 A;  3HHV A;  4WKW A;  5INY A;  3UAR A;  2KP1 A;  3FY7 A;  4GTU A;  3FK8 A;  4WF4 A;  3M1G A;  1K3O A;  4ILF A;  3GL5 A;  3UOM A;  2PGT A;  1G7O A;  1BX9 A;  4MH3 A;  2OAD A;  2HZF A;  3HZ8 A;  4RQX A;  3KXO A;  2O89 A;  1V9W A;  4I6X A;  2R2J A;  2IPA A;  1QUW A;  1WOU A;  3EUR A;  2PN8 A;  1SJI A;  2PUK C;  4G19 A;  3ZRE A;  3TKQ A;  2P5R A;  1OC9 B;  5GSS A;  3HJO A;  1GUM A;  5EL8 A;  2A2P A;  4K9Z A;  1M9A A;  2H0H A;  2CQ9 A;  5DBQ A;  4MDC A;  3CSH A;  2K8V A;  5KOX A;  1OYJ A;  3GUR A;  1J08 A;  2VLT A;  3CTG A;  1HYU A;  4ZBB A;  3G7J A;  4YKG A;  2CVD A;  3GV1 A;  1V98 A;  5G30 A;  4ZBD A;  3P8W A;  3VUR A;  1X9S B;  5ECO B;  2E0Q A;  3LGC A;  2KUC A;  4JU5 A;  3JCM L;  3A2W A;  1F9M A;  2FWF A;  2H6Z A;  1OE7 A;  2WRT A;  5J3R A;  4MJC A;  3C73 A;  1TW9 A;  5ENU A;  2CZ3 A;  4ID0 A;  4IBP A;  4EF0 A;  2ALB A;  3RAZ A;  2HSH A;  1YDK A;  1DE1 A;  4KB3 A;  1B9X C;  1JZD A;  3IR4 A;  4NXI A;  1W4V A;  2VCW A;  5GZZ B;  4Z2T A;  4IKH A;  1M9B A;  4EO3 A;  5IOX A;  4MZB A;  3QAG A;  2GT6 A;  2UZ8 A;  2YPM A;  2B1K A;  1ERV A;  2CX3 A;  2LUS A;  2PBJ A;  1CQG A;  4NMU A;  4MNN A;  3MAK A;  3EMX A;  4ZB8 A;  2R5G A;  2VL2 A;  1Y25 A;  2X4A A;  3ZTL A;  5G2Z A;  4KCA A;  4Q5N A;  3M9J A;  3KP8 A;  1U87 A;  2RII A;  3ISO A;  4ZL7 A;  1F37 A;  3HA9 A;  3ZRD A;  2F8F A;  6GST A;  3BOA A;  6GSU A;  4POK A;  4JR6 A;  5EY6 A;  4PQH A;  2YAN A;  2JZT A;  2VL9 A;  4MJA A;  2QA1 A;  5ECL B;  3ZL5 A;  4K6X A;  2P31 A;  2J23 A;  5B8A A;  1SJZ A;  3D21 A;  3GX8 A;  3WGX A;  1XPV A;  2VAF A;  2HXK A;  5DCG A;  1JZW A;  1PL1 A;  2KHP A;  1TI1 A;  1HNA A;  3HCZ A;  3MSZ A;  4YKF A;  1MTC A;  1B8X A;  4JED A;  1I9D A;  5IMV A;  3KM6 A;  4KSO A;  1BG5 A;  3KZQ A;  4MF7 A;  4X4J A;  3TUE A;  3D22 A;  4J56 E;  4WXT A;  4HU7 A;  2K18 A;  4LL4 B;  2K6V A;  2KLX A;  4ZIJ A;  2H0I A;  4MZW A;  2GTU A;  5KN1 A;  2XPD A;  3IRA A;  4RI6 A;  1R5A A;  7GSS A;  5AGY A;  4NHW A;  1K3L A;  3A5W A;  5ECS A;  1ML6 A;  4N0Z A;  4GQF A;  2REM A;  2HT9 A;  1JLW A;  2OBK A;  3DKS A;  4EE0 A;  5FHI A;  3VFI A;  2MZC A;  4NWY A;  5ELA A;  1ERW A;  4OFN A;  5EPF A;  10GS A;  3ZZX A;  6GSS A;  4FYU A;  2NDO A;  2CA8 A;  5G1K A;  3F4T A;  2PVO C;  1B4P A;  1NM3 A;  5DJL A;  4IP1 A;  2DKH A;  4HZ4 A;  4GSS A;  1WRY A;  4GRF A;  1O7U A;  1K3Y A;  1EOH A;  2GZP A;  4IGJ A;  4G0K A;  4K8M A;  1SKW B;  5ABR A;  1TRU A;  5CP1 A;  2HFD A;  2YCD A;  4K5R A;  3HVX A;  4L8E A;  2H01 A;  3TJG A;  1UA5 A;  1YEX A;  1RK4 A;  3HVS A;  1AIU A;  4OCF A;  3M8N A;  3ZIV A;  4MF6 A;  3TKP A;  2QKE A;  1XW9 A;  2FNO A;  2R6K A;  1ZGN A;  1NHO A;  3C7M A;  1Q98 A;  3I43 A;  3UIW A;  1WIK A;  1EEJ A;  2DIY A;  2X8H A;  1USB A;  3KMO A;  1OKT A;  3DEX A;  1XIY A;  3NZN A;  4F82 A;  4GQC A;  4XS1 A;  2I1U A;  5AIX A;  1EEM A;  3D4M A;  5F07 A;  2H71 A;  2GZZ A;  5ECK B;  3QOU A;  4PTS A;  4XRD A;  3QDN A;  1Z6N A;  4HEA 2;  4TKY A;  2H73 A;  1FOH A;  5D96 A;  3FMW A;  2C80 A;  1I5G A;  2HZE B;  2DBC A;  4IQA A;  3CSJ A;  5IIZ A;  4PNG A;  3IHQ A;  2XHF A;  4TR4 A;  2GDR A;  4DSR A;  2WJU A;  2F9S A;  2A2R A;  2JL4 A;  1ZYQ B;  1F2E A;  2H1G A;  4OO4 A;  2A4H A;  5J4U A;  4X0X A;  2X64 A;  1JZO A;  3VWV A;  1EGO A;  3M9K A;  4JBB A;  3DVX A;  5C00 A;  4KDU A;  4IP6 A;  3DYR A;  1LBK A;  2IFQ A;  1N2A A;  3Q19 A;  1S3C A;  4TXO A;  1ZOF A;  3KH9 A;  2WZ9 A;  1N8J A;  2TIR A;  1A8L A;  5HFK A;  1TI3 A;  2G2Q A;  3Q18 A;  4MJB A;  4EDZ A;  5IO2 A;  3RHC A;  3F0I A;  3DGQ A;  1GTI A;  3QMX A;  4BPY A;  2FHE A;  2D2Z A;  1U6T A;  4IQ1 A;  2HI7 A;  2B6M A;  1AQV A;  1XVQ A;  4EKZ A;  3DWV A;  4KDY A;  1GSQ A;  2EC4 A;  2R0P A;  3IHG A;  2I9H A;  2V41 A;  3H8Q A;  4V1A g;  5HR0 A;  1GH2 A;  1YZX A;  3UAP A;  2GSS A;  4KCE A;  1ZYN A;  5CRH A;  5HQP A;  4V2L A;  4K2D A;  3A2V A;  2OAC A;  4BVY B;  1AUC A;  2DJJ A;  1X5D A;  2MMO A;  1SK0 A;  3FEU A;  3IAM 2;  4J57 E;  5HR2 A;  1GL8 A;  2PPT A;  4TR3 A;  3KGK A;  1M99 A;  5DAL B;  1A0R P;  4P3Y B;  4KGI A;  3IOS A;  4D73 A;  5A4W A;  2PMT A;  4JZQ A;  4O32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...