1F9MA

Crystal structure of thioredoxin f from spinach chloroplast (short form)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
112
structure length
112
Chain Sequence
MEAIVGKVTEVNKDTFWPIVKAAGDKPVVLDMFTQWCGPCKAMAPKYEKLAEEYLDVIFLKLDCNQENKTLAKELGIRVVPTFKILKENSVVGEVTGAKYDKLLEAIQAARS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN F
publication title Crystal structures of two functionally different thioredoxins in spinach chloroplasts.
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Electron transport
total genus 30
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1f9mA00
3NIVA 2P0GA 2R2JA 3LEFA 1XPVA 4PUAA 3KGKA 4TVEA 1YKCA 2J9HA 4TR1B 4I2TA 2QGVA 1KEBA 3MAKA 5CRGA 2WS2A 1TK8B 1YQ1A 1G6WA 2LSTA 3GNJA 5DAKA 4YH2A 3KMNA 2H30A 2B6MA 3GX8A 4XIHA 1GULA 4JBBA 2FD3A 4MPFA 5ECQB 1M0UA 2H73A 1PSQA 1R4WA 5F05A 3PINA 3I43A 1VF4A 4K2DA 4OD7A 1GNWA 2MMZA 2B1KA 3LWAA 3VI5A 4POKA 2AAWA 4ACSA 4FH8A 4JEDA 1R26A 2TRXA 1DE1A 1ZGNA 3FW2A 4Q5QA 1ACVA 4ZL7A 1XWCA 4OO4A 6GSTA 1FHEA 3CYNA 6GSVA 2OBKA 1UA5A 3CBUA 2WFCA 5J3RA 2DJJA 4NV2A 4K6XA 4MJBA 2G2QA 1MD3A 2H0GA 4ECBA 3EINA 5HR3A 2B5XA 4GSTA 3D0ZA 1PD21 1DUGA 1T1VA 1FOVA 3BD2A 4WXTA 3TKSE 1JZDA 1FB6A 5AN1A 2CQ9A 2REMA 1IYHA 1WIKA 2AJQB 2V32A 3C71A 3L9SA 1SENA 4MLYA 4MF7A 5AISA 2V1MA 4G10A 3GH6A 5IMAA 3HD5A 3J7Yk 3VFIA 4ZBAA 2IFQB 2N5AA 1TI3A 2C0GA 3HJPA 2HNLA 5AIVA 3TJBA 4ZB9A 4NV5A 5DALA 4L5LA 5G5FA 2K9FA 1AC1A 1V57A 5HQPA 2L57A 3KXOA 4KSMA 1XWAA 5A4WA 3PGTA 3TDGA 3GA4A 4MK3A 4DSSB 1EOHA 1GUKA 3GL5A 2GLRA 4PNGA 2PU9C 11GSA 4IJ3A 3HYPA 3Q19A 4YQMA 2OA7A 3MSZA 4JZQA 1G7EA 3US3A 2L4QA 5CAXA 1FVJA 1Z7PA 3TKQA 5E4WA 5JCGA 5JCWA 3GSSA 4V1Ap 1J08A 1XVWA 2XBIA 2IMIA 2OACA 4L8EA 3ERFA 2JU5A 1BJXA 3FKFA 5ECPB 3F6FA 5IQYA 4N11A 5DCGA 3M8NA 5IIZA 5FT3A 2K8VA 5D9XA 3ZREA 2VL3A 1E2YA 3APSA 5EY6A 3D21A 1PKZA 4WF4A 3TCOA 5B8BA 4QL7A 2YN1A 2PERA 5DJMA 4EC0A 1X5CA 4IBPA 5KN1A 2WULA 5LNKe 1YF1A 3IV4A 3O76A 1EV4A 2FNOA 4IVFA 1WOUA 3DYRA 6GSYA 2O89A 3IAS2 1U3IA 4G19A 2YJHA 3H79A 2NVLA 1ZYQB 4DSRA 5IMFA 2C3TA 2MYGA 3O3TA 2WB9A 2M80A 2VLUA 3I9V2 2P31A 2H6YA 2EIQA 1O6JA 2HI7A 4DEJA 2PWJA 3QOUA 2DJ3A 3C1RA 4EXJA 3GX0A 2X8HA 5ENUA 3RHCA 4PXOA 2FA4A 2HXKA 4JR6A 5IOWA 2HZEB 5H5RA 1BEDA 2H1BA 1S3AA 3N5OA 5A4VA 1SL2B 2KHPA 5G1KA 3KTBA 2JZTA 1EV9A 1AIUA 3A2VA 1FB0A 2GDRA 1TTZA 3TKPA 3W8SA 3G7JA 5DDLA 1YJ6A 3IHQA 2RM5A 2DJ2A 4GRFA 1SJZA 3ZL5A 1EP7A 4YQUA 5ECNB 4FO5A 2H1DA 2ALBA 4X0XA 2A2RA 4KE3A 3CRTA 2B7JA 5ELAA 3SBCA 2C0FA 1A8LA 4PUFC 1O7UA 4GWRA 5JCUA 1J0FA 1SYRA 2DSAA 6GSWA 2DMLA 3DWVA 5ECMB 2H8LA 4YQVA 2F8AA 2DC5A 4LLRA 5ECRB 3WT2A 3IK9A 2GQMA 3DMLA 3UARA 1EGOA 4I2UA 2J23A 2L6DA 4MPGA 4ML1A 1G7OA 2JADA 5GAPD 1ST9A 2CAIA 3ZZXA 3P7XA 4TR1A 4TXOB 2PGTA 3J7Yb 2FLSA 3FR9A 5ELGA 2ZNMA 2GSTA 1Q98A 2JZSA 1QUWA 2BTOT 4PQ1A 1GWCA 2IMEA 3D4MA 3LG6A 2X8CA 4IP6A 2MBSA 2LQOA 3F4SA 1JZWA 4XHMA 2YWOA 3P2AA 3QFAC 4X43A 3WGDA 5IO2A 2GQLA 4JRRA 2CVBA 1VF3A 4N10A 2IWTA 3BCIA 4E8EA 5CP1A 3L0HA 5HFKA 3GL3A 3EVIA 3UVHA 2A2SA 3KD0A 1GSSA 3IBHA 2VCTA 4PURA 1O85A 3DD3A 1DBYA 2H0IA 3DEXA 4PQIA 3KTLA 2C3NA 4BL7A 3WYWA 1JZRA 2XHFA 5GZZB 1SU9A 5LD0A 4F0BA 4HQZA 1FO5A 3KMOA 1TXXA 2LEGA 2QC7A 1XWGA 4ISDA 4NHWA 2O8VB 3TJKA 4NHZA 3HVVA 1YY7A 3W8JA 4O32A 3LSZA 2HFDA 4HI7A 5IMZA 2HT9A 2KOKA 2QKEA 4JU5A 4OCEA 1THXA 5D96A 4HJ2A 2CVDA 2IFQA 4K1FA 2R4VA 4MDCA 1PKWA 1M7TA 3HHVA 1PX7A 2DIYA 2GQKA 2FY6A 2HRFA 1OE7A 3I6AA 1U3AA 2GZPA 4O7HA 3RPPA 1SK0A 3ZVJD 3LGCA 1SKSB 2YCDA 4OWYA 1EZKA 4KB3A 5ID2B 4DSSA 1F37A 1S3CA 3FEUA 1NHOA 3ZLPA 1V58A 5CREA 5EL8A 1EWXA 1GSFA 1N8JA 4IQAA 2PVOC 4EF0A 3GRXA 3FZAA 1GSEA 4J2FA 5DCHA 2LJRA 3UEMA 3WD6A 4POBA 7GSSA 3UAPA 3TRPA 1VGLA 1K0OA 1OKDA 1TK5B 4MH2A 3F3RA 1R7HA 1O73A 5EVOA 2DJKA 2VLVA 2HYXA 1TK0B 5DQSA 3MNGA 4F82A 1THOA 4TN8A 4HU7A 2E7PA 2A4VA 3ZMKA 5CRWA 4GTUA 1M99A 1WWJA 4J57E 4IW9A 1SD8A 1PRXA 3KIJA 2VIMA 12GSA 5IPGA 4MA9A 1PQNA 2VCZA 4I5QA 3F8UA 4F0CA 3RPNA 4KUNA 4JR4A 3TKRA 3EYTA 2H66A 2H6ZA 2B5EA 5G5EA 3M9JA 3HVSA 4EVMA 2JSZA 2R6KA 1R5PA 3FZ9A 5G2ZA 2VL9A 1IYIA 2WJUA 1TOFA 4V2LA 1T00A 1JLWA 4TW5A 2N5BA 2FCHA 5J9CA 2LV3A 3FR6A 4XS1A 1AXDA 3EU3A 3A2WA 1WRYA 3GSTA 4MZWA 4GQFA 1K0AA 1O8XA 2DIZA 3G7IA 5KN2A 4MJCA 3ZRDA 5IOXA 2KUCA 5DVBA 2HZEA 4WKWA 4IN0A 3TKSC 4NPBA 4F9ZA 3CXGA 1G0TA 2ZCTA 5HR0A 3ZITA 4CHSA 3L9UA 2R37A 1Z6NA 5KEJA 2GT5A 2YP6A 4KSOA 3KCMA 2B7KA 1XVQA 4K7NA 4ZXGA 4D73B 1X0RA 3F4RA 3JCML 1PX6A 4MF5A 3QD9A 2K18A 5CYYA 2KLXA 3TJFA 4HUAA 4OO5A 1F3BA 5CRDA 4BWQA 2RLIA 4KCEA 13GSA 2IJYA 4HOJA 2P5QA 4ZBDA 1SKRB 3IK7A 4KX4A 3F6DA 3CSJA 1BX9A 3TUEA 3FY7A 1UN2A 4NXIA 2VOCA 1Z5YE 1T4ZA 2VCWA 2XPDA 2Z9SA 1TKDB 5F06A 5HR2A 3QAGA 4G2EA 3U6VA 1SJ6A 2L6CA 5A4UA 2I1UA 1YZXA 1EP8A 3FR3A 1Z7RA 2NTOA 5LCZA 4XRAA 1V2AA 1JLVA 5G31A 1XZOA 4KNDA 2WCIA 3G7YA 4TXOA 1OC9A 4YAVA 3UBKA 2O85A 3QDNA 4K7OA 1R5AA 3HDCA 2CT6A 3DRNA 3KJYA 2GSSA 1FG4A 1TI1A 2L59A 1M2BA 1K3OA 4K9ZA 3F63A 3GKXA 1JFUA 1KNGA 1A0FA 2OE0A 1XOAA 4BWSA 1GUMA 3UIWA 2IMFA 1JHBA 4ZB8A 3F3QA 4ULXA 3D5JA 1LU4A 4I97A 2F3MA 1HQOA 1FVKA 3D6IA 1ABAA 3P8WA 17GSA 1GTUA 2DBCA 3EURA 1AW9A 3GIXA 5HFIA 5AIXA 4V2MA 4EUYA 2VM2A 1WMJA 4JE1A 3TJJA 2VCQA 4HJMA 1UVZA 2X8GA 1A8YA 3F4TA 4AGSA 4LMVA 1AQXA 4IGJA 2FWGA 5IMCA 1GRXA 4POLA 5INYA 1JZOA 1XBSA 2GZZA 2IIYA 2M72A 1KTEA 4L0UA 3PR8A 3N9JA 2VCVA 4QL9A 2B3SA 4MABA 4K8MA 3KP8A 2R5GA 4Q5NA 1XW9A 4KGIA 1T7PB 1TRSA 1TDIA 3QR6A 2LTKA 2HE3A 3ISOA 3LXZA 3HJOA 2YWMA 2GGTA 4TR0A 4V1Ag 2RUFA 3EC3A 2YANA 4HZ4A 4HS1A 3VWUA 1OKTA 3ED3A 4MF6A 3IXRA 2JL4A 3WGXA 1UC7A 4XTSA 3SWLA 4AF2A 5C04A 4RQXA 2CX4A 1GLPA 5D93A 2C4JA 2VD0A 1TU8A 2YJ7A 4IS0A 4ECJA 5ID2A 3M3MA 5G30A 1VF2A 2V41A 4MMMA 4IP1A 3C1SA 3F9UA 3ZYWA 4O5RA 4AJ8A 4MH3A 2VM1A 1BQ7A 2YNXA 4PX1A 5COHA 1ZCPA 2V2GA 5DQYA 2C80A 2ZUPA 1XWKA 4XS4B 2B5YA 3C7MA 5HR1A 4FYCA 6GSXA 4V2NA 5F0GA 3GTUB 4GSNA 3VURA 1MDIA 2OBIA 1BAYA 1B4PA 5A5KA 2B1LA 10GSA 1A2LA 3GH9A 3EMPA 1B9XC 3DKSA 5FWGA 1URMA 2FWFA 4OFNA 1MD4A 5D8IA 5F07A 1F6MC 19GSA 2O7KA 4IELA 1XW5A 3IPZA 1N2AA 2H1GA 3FYGA 3QAVA 2YZUA 3FK8A 2VUPA 2X99A 2H72A 1MDKA 2I81A 5GSSA 2H76A 4ZIJA 4ID0A 1GL8A 1USBA 4X1UA 2AHEA 4Q5RA 3E9JB 2VD1A 4OCFA 2V6OA 3R2QA 3VLNA 2PPTA 3Q74A 2M46A 3FRCA 1K0MA 4ILFA 5G1LA 3ZFBA 3BBYA 3H4KA 4LMWA 3TB2A 1GP1A 1ILOA 2ON7A 3W6GA 2GT6A 4Z7XA 2OJLA 2HRNA 16GSA 1AQVA 1T4YA 3H93A 1QMVA 2GZYA 1K0BA 4P3YB 5IMDA 1TRUA 5DBQA 2FUG2 1SKWB 4GXZA 3ZVJA 1M2AA 2X64A 5D9WA 1HD2A 3C73A 4PQHA 5F8BA 3HZ4A 2GSQA 1H4OA 4MP4A 4HZ2A 1HNAA 1W4VA 1X9SB 2LJAA 1J9BA 2GS3A 3G9BA 3DGQA 2LKUA 3BCKA 4D73A 4K0NA 3GHAA 3M1GA 5D73A 3HY2A 2H6XA 4RUVA 1A23A 3F0IA 1ZL9A 2BJXA 5JWRB 1HNBA 1X9WB 5GSTA 2WGRA 2E0QA 4TRXA 1C72A 2ES7A 3KH9A 3UBLA 5IPHA 5CRHA 1Q4JA 3RAZA 1T3BA 2QSIA 4WEYA 3BJ5A 3S9FA 1QXHA 1GTIA 2FWEA 4LA1A 2C3QA 3E0UA 1OE8A 2I4AA 2NPBA 3A5WA 3LQ7A 1DE2A 2CAQA 2C0DA 3K8NA 2LRNA 3O6TA 1YDKA 3DIEA 4IQ1A 4KW6A 4BPYA 1V98A 2F9SA 2F51A 4TKYA 1F2EA 3PH9A 4MZCA 5CO3A 4ZL8A 4XRDA 4IHUA 4OFTA 1MDJA 4TR4A 5ABRA 4N0VA 4KA0A 3IDVA 2LRTA 2EIRA 1PL1A 2H1AA 1K0CA 1NM3A 3HZ8A 4MJEA 4F2IA 5KN3A 1B9YC 2H70A 4HQSA 5IMVA 3KH7A 2IL3A 5B7CA 2GTUA 3NOFA 2G0FA 2CV4A 5J5NA 1WP0A 4AJ6A 5AGYA 4ZB6A 2P5RA 2RUEA 3EU4A 1XCCA 1S3DA 3GKNA 4FIWA 1M9BA 3UVTA 3V1WA 2AYTA 1F9MA 4BVXA 5EPFA 1MEKA 2VLTA 2K8SA 2HSHA 1Z3EA 1AAZA 1WE0A 2H19A 2HLSA 5B6NA 5B8AA 1WPIA 1NSWA 3QAWA 4O92A 2WZ9A 3VWVA 1SL0B 3CRUA 1ERWA 1G6YA 5ECHB 2PVQA 1QFNA 5L71A 3UJ1A 3L9VA 3CSIA 4I6XA 2IPAA 3VWXA 5D9VA 3E3EA 2XBQA 5ECLB 1O8WA 3Q6OA 3DVXA 5D9TA 2XC2A 3ERWA 3TGZA 1RK4A 4EDYA 2HZFA 3H1NA 1GTAA 1RQMA 5KN0A 2LRCA 3WT1A 3WGEA 4K7IA 1OC8A 1O81A 1XW6A 5J4UA 1PN9A 1YEPA 1U87A 2H0HA 1GH2A 1EGRA 3L4NA 1VF1A 2L5LA 4FYBA 2IN3A 2RM6A 3UMAA 3OR5A 1FW1A 3TRQA 1SD9A 3IOSA 3TOUA 1OYJA 4ML6A 1ML6A 5J41A 2YOIA 3MWHA 3GUSA 3VPQA 2D2ZA 3ME8A 4BA7A 1SK1A 2AUVA 2DJ1A 9GSSA 1B4QA 4EO3A 5CNWA 1GUHA 4KH7A 3IR4A 1YEXA 3KEBA 4XS4A 1CQGA 2CX3A 4EKZA 2E2GA 2L4CA 2TIRA 3GTUA 1ZYEA 4H86A 1BYEA 3ZTLA 4PNFA 4BVYA 4L0WA 4ZL9A 1TJDA 3QPMA 3LJRA 1GTBA 2BMXA 1LJRA 2LNTA 2EC4A 4KDYA 4LL4B 3NZNA 4GCIA 2FHEA 2NBSA 1A2MA 1GSQA 4NAXA 2MMAA 2VCXA 3IAM2 1MTCA 4ECIA 3BOAA 3KP9A 4WBRD 3ZFLA 1F3AA 3GFKA 1XOBA 2MBTA 4RI6A 1PL2A 1XXUA 4IKHA 2DMMA 4K0GA 3TKSA 5DAKB 3LXTA 1W89A 3ME7A 5B6MA 3A2XA 2GVPA 3DXBA 4WBJA 1X5DA 1XFLA 1A2JA 1CQHA 3I69A 4TOPA 2H71A 2H74A 3IRAA 1M9AA 4ZBBA 3AY8A 2VAFA 1GNEA 3LFLA 1GLQA 2DLXA 3ERGA 4AJ7A 1B48A 1OAZA 3UOMA 2JZRA 2JACA 1T8EB 2C8UA 4J56E 1A0RP 2FWHA 4MZBA 1SK2A 1I5GA 4N30A 3EE2A 1HYUA 2PUKC 4LL1B 2K6VA 1PGTA 4HDEA 4EE0A 1Y25A 4KDXA 4WR4A 4GF0A 1AUCA 1A24A 2O87A 3L78A 4N0ZA 1KBNA 2I9HA 3GKMA 1ERVA 3QCPA 1I9DA 3GN3A 3UL3A 5JWOB 3ZMLA 4OMVA 4EDZA 5ECKB 2YPMA 1AQWA 1K3YA 2PBJA 3FZ4A 1NW2A 1NHYA 1E6BA 2VO4A 1SL1B 3RDWA 3CTGA 1ZMAA 4MCUA 3C8EA 1Y6EA 2NDOA 1YF0A 2E2MA 5DALB 4CW9A 1U6TA 5ECIB 1YKAA 2GSRA 1QGVA 2I3YA 3HA9A 1GSYA 20GSA 1Z6MA 1K0NA 3EWLA 3GMFA 2H75A 8GSSA 2OE1A 3RHBA 1V9WA 4QQ7A 1WJKA 3LYPA 1M2DA 2CVKA 4CDOA 2R3XA 3RBTA 4GQCA 1Z9HA 1LBKA 4RI7A 5IO0A 1OVNA 2IMDA 1TU7A 2YWIA 4YAPA 4PGTA 1QK8A 4XS6A 3D4TA 5ECOB 1X9MB 6GSUA 2FGXA 2MZCA 3DVWA 4WF5A 3IA1A 4TR3A 2CZ2A 1EEJA 4GSSA 1OC9B 1QQ2A 4ZILA 3VK9A 2HSYA 6GSSA 2WDUA 3KZQA 4GLTA 2C1YA 3HKRA 2YV9A 1EOGA 1U88A 4L5OA 3A3TA 3CSHA 2CA8A 2AB6A 2AV4A 4XCSA 3TOTA 3KM6A 2CZ3A 4NMUA 3GKKA 3IC4A 3GV1A 2F8FA 1ERTA 1TRVA 2VL2C 1VRSD 1BG5A 3FHKA 4KCAA 5C00A 5E59A 4DSQA 18GSA 2DJ0A 1PMTA 5JWQB 2JSYA 5H5SA 1RW1A 4EL1A 4OFMA 2MMOA 1ZOFA 4POMA 2C0EA 4ECCA 3FZ5A 4F03A 1FAAA 2OE3A 1HNCA 2FA8A 2XPEA 5DJLA 2WRTA 5ECSA 3D22A 1EEMA 14GSA 1OC3A 4IJIA 4HEA2 3MDKA 4DVCA 3LORA 4KAEA 2EIOA 2YV7A 2LQQA 3VPTA 2KP1A 1TP9A 5H5QA 3ZIJA 3HXSA 1DSBA 2KP2A 5GAND 3GYKA 1GSDA 4E8HA 1TW9A 4TXVA 1GSUA 3M0FA 2LNSA 1SJIA 3M9KA 2YZHA 2LUSA 1SYXA 1H75A 1ON4A 2V6KA 2N5FA 5J9BA 3EMXA 4G9HA 4WETA 1K3LA 3U5RE 2OADA 3APQA 4MJAA 4NWYA 1TRWA 2TRCP 3GURA 4WR5A 4RQRA 4Q5FA 22GSA 2PN8A 2LS5A 1V40A 1XWBA 2H01A 1PA3A 2IMKA 3IE3A 3ZIVA 2PMTA 3VI7A 1ERUA 2RIIA 4FYUA 2OKAA 1ZZYA 4HU9A 3QFBC 3QMXA 3Q18A 2MMNA 3HVXA 3TRXA 2ON5A 3LYKA 1X5EA 2YWNA 3HCZA 3TJGA 3P90A 2VL2A 3CTFA 5IM9A 2L5OA 3H8QA 5HFGA 3CMIA 4KDUA 5FHIA 3VWWA 1XIYA 1B8XA 3APOA 3HJMA 4I8BA 1K0DA 2LJKA
chains in the Genus database with same CATH superfamily
3NIVA 2P0GA 2R2JA 3LEFA 1XPVA 4PUAA 3KGKA 4TVEA 1YKCA 2J9HA 4TR1B 4I2TA 2QGVA 1KEBA 3MAKA 5CRGA 2WS2A 1TK8B 1YQ1A 1G6WA 2LSTA 3GNJA 5DAKA 4YH2A 3KMNA 2H30A 2B6MA 3GX8A 4XIHA 1GULA 4JBBA 2FD3A 4MPFA 5ECQB 1M0UA 2H73A 1PSQA 1R4WA 5F05A 3PINA 3I43A 1VF4A 4K2DA 4OD7A 1GNWA 2MMZA 2B1KA 3LWAA 3VI5A 4POKA 2AAWA 4ACSA 4FH8A 4JEDA 1R26A 2TRXA 1DE1A 1ZGNA 3FW2A 4Q5QA 1ACVA 4ZL7A 4BL7B 1XG8A 1XWCA 4OO4A 6GSTA 1FHEA 3CYNA 6GSVA 2OBKA 1UA5A 3CBUA 2WFCA 5J3RA 2DJJA 4NV2A 4K6XA 4MJBA 2G2QA 1MD3A 2H0GA 4ECBA 3EINA 5HR3A 2B5XA 4GSTA 3D0ZA 1PD21 1DUGA 1T1VA 1FOVA 3BD2A 4WXTA 3TKSE 1JZDA 1FB6A 5AN1A 2CQ9A 2REMA 1IYHA 1WIKA 2AJQB 2V32A 3C71A 3L9SA 1SENA 4MLYA 4MF7A 5AISA 2V1MA 4G10A 3GH6A 4EIPA 5IMAA 3HD5A 3J7Yk 3VFIA 4ZBAA 2IFQB 2N5AA 1TI3A 2C0GA 5BMUA 3HJPA 2HNLA 5AIVA 3TJBA 4ZB9A 4NV5A 5DALA 4L5LA 5G5FA 2K9FA 1AC1A 1V57A 5HQPA 2L57A 3KXOA 4KSMA 1XWAA 5A4WA 3PGTA 2QA1A 3TDGA 3GA4A 4MK3A 4DSSB 1EOHA 1GUKA 3GL5A 2GLRA 4PNGA 2PU9C 11GSA 4IJ3A 3HYPA 3Q19A 4YQMA 2OA7A 3MSZA 4JZQA 1G7EA 3US3A 2L4QA 5CAXA 1FVJA 1Z7PA 3TKQA 1M3JA 5E4WA 5JCGA 5JCWA 3GSSA 4V1Ap 1J08A 1XVWA 2XBIA 2IMIA 2OACA 4L8EA 3ERFA 2JU5A 1BJXA 3FKFA 5ECPB 3F6FA 5IQYA 4N11A 5DCGA 3M8NA 5IIZA 3MYDA 5FT3A 2K8VA 5D9XA 3ZREA 3R3EA 2VL3A 1E2YA 3APSA 5EY6A 3D21A 1PKZA 4WF4A 3TCOA 5B8BA 4QL7A 2YN1A 2PERA 5DJMA 4EC0A 1X5CA 4IBPA 5KN1A 2WULA 5LNKe 1YF1A 3IV4A 3O76A 1EV4A 2FNOA 4IVFA 1WOUA 3DYRA 6GSYA 2O89A 2DKHA 3IAS2 1U3IA 4G19A 2YJHA 3H79A 2NVLA 1ZYQB 4DSRA 5IMFA 2C3TA 3IHGA 1S3RA 2MYGA 3O3TA 2WB9A 2M80A 2VLUA 3EPTA 3I9V2 2P31A 2H6YA 2EIQA 1O6JA 2HI7A 4DEJA 2PWJA 4CY6A 3QOUA 2DJ3A 3C1RA 4EXJA 3GX0A 2X8HA 5ENUA 3RHCA 4PXOA 2FA4A 2HXKA 4JR6A 5IOWA 2HZEB 5H5RA 1BEDA 2H1BA 1S3AA 3N5OA 4ICYA 5A4VA 1SL2B 4K2XA 2KHPA 5G1KA 3PPUA 3KTBA 2JZTA 1EV9A 3HVNA 1AIUA 3A2VA 1FB0A 2GDRA 1TTZA 3TKPA 3W8SA 3G7JA 5DDLA 1YJ6A 3IHQA 2RM5A 2DJ2A 4GRFA 1SJZA 3ZL5A 1EP7A 4YQUA 5ECNB 4FO5A 2H1DA 2ALBA 4X0XA 2QA2A 2A2RA 4KE3A 3CRTA 2B7JA 5ELAA 3SBCA 2C0FA 1A8LA 4PUFC 1O7UA 4GWRA 5JCUA 1J0FA 1SYRA 2DSAA 6GSWA 2R0CA 5KOWA 2DMLA 3DWVA 5ECMB 2H8LA 4YQVA 2F8AA 2DC5A 4LLRA 5ECRB 3WT2A 3IK9A 2GQMA 3DMLA 3UARA 1EGOA 4I2UA 2J23A 2L6DA 3MIXA 4MPGA 4ML1A 1G7OA 2JADA 5GAPD 1ST9A 2CAIA 3ZZXA 3P7XA 4TR1A 4TXOB 2PGTA 3J7Yb 2FLSA 3FR9A 5ELGA 2ZNMA 2GSTA 1Q98A 2JZSA 1QUWA 2BTOT 4PQ1A 1GWCA 4HSCX 2IMEA 3D4MA 3LG6A 2X8CA 4IP6A 2MBSA 2LQOA 3F4SA 1JZWA 4XHMA 2YWOA 3P2AA 3QFAC 4X43A 3WGDA 5IO2A 2GQLA 4JRRA 2CVBA 1VF3A 4N10A 2IWTA 3BCIA 4E8EA 5CP1A 1PN0A 3L0HA 5HFKA 3GL3A 1PFOA 3EVIA 3UVHA 2A2SA 3KD0A 1GSSA 3IBHA 2VCTA 4PURA 1O85A 3DD3A 1DBYA 2H0IA 3DEXA 4PQIA 3KTLA 2C3NA 4BL7A 2HRAA 3WYWA 1JZRA 2XHFA 5GZZB 1SU9A 5LD0A 4F0BA 4HQZA 1FO5A 3KMOA 1TXXA 2LEGA 2QC7A 1XWGA 4ISDA 4NHWA 2O8VB 3TJKA 4NHZA 3HVVA 1YY7A 3A5IA 3W8JA 4O32A 3LSZA 2HFDA 4HI7A 5IMZA 2HT9A 2KOKA 2QKEA 4JU5A 4OCEA 1THXA 5D96A 4HJ2A 2CVDA 2IFQA 4K1FA 2R4VA 4MDCA 1PKWA 1M7TA 3HHVA 1PX7A 2DIYA 2GQKA 2FY6A 2HRFA 1OE7A 3I6AA 1U3AA 2GZPA 4O7HA 3RPPA 1SK0A 3ZVJD 3LGCA 1SKSB 2HSMA 2YCDA 4OWYA 1EZKA 4KB3A 5ID2B 4DSSA 1F37A 1S3CA 3FEUA 1NHOA 3ZLPA 1V58A 5CREA 5EL8A 1EWXA 1GSFA 1N8JA 4IQAA 2PVOC 4EF0A 3GRXA 3FZAA 1GSEA 4J2FA 5DCHA 2LJRA 3UEMA 3WD6A 4POBA 7GSSA 3UAPA 4Z2TA 5KOXA 3TRPA 1VGLA 1K0OA 1OKDA 1TK5B 4MH2A 3F3RA 1R7HA 1O73A 5EVOA 2DJKA 2VLVA 2HYXA 1TK0B 5DQSA 3MNGA 4F82A 1THOA 4TN8A 4HU7A 2E7PA 2A4VA 3ZMKA 5CRWA 4GTUA 1M99A 1WWJA 4J57E 4IW9A 1SD8A 5BRTA 1PRXA 3KIJA 2VIMA 12GSA 5IPGA 4MA9A 1PQNA 2VCZA 4I5QA 3F8UA 4F0CA 3RPNA 4KF9A 4KUNA 4JR4A 3TKRA 3EYTA 2H66A 2H6ZA 2B5EA 5G5EA 3M9JA 3HVSA 4EVMA 2JSZA 2R6KA 4CY8A 3LW9A 1R5PA 3FZ9A 5G2ZA 2VL9A 1IYIA 2WJUA 1TOFA 4V2LA 1T00A 1JLWA 4TW5A 2N5BA 2FCHA 5J9CA 2LV3A 3FR6A 4XS1A 1AXDA 3EU3A 3A2WA 4K5SA 1WRYA 3GSTA 4MZWA 4GQFA 1K0AA 1O8XA 2DIZA 3G7IA 5KN2A 4MJCA 3ZRDA 5IOXA 2KUCA 5DVBA 2HZEA 4WKWA 1ZYNA 4IN0A 3TKSC 4NPBA 4F9ZA 3CXGA 1G0TA 2ZCTA 5HR0A 3ZITA 4CHSA 3L9UA 2R37A 1Z6NA 5KEJA 2GT5A 2YP6A 4KSOA 3KCMA 2B7KA 1XVQA 4K7NA 4ZXGA 4D73B 1X0RA 3F4RA 3JCML 1PX6A 4MF5A 1FOHA 3QD9A 2K18A 5CYYA 2KLXA 3TJFA 4HUAA 4OO5A 1F3BA 5CRDA 4BWQA 2RLIA 4KCEA 13GSA 2IJYA 4HOJA 2P5QA 4ZBDA 1SKRB 3IK7A 4KX4A 3F6DA 3CSJA 1BX9A 3TUEA 3FY7A 4O5UA 1UN2A 4NXIA 2VOCA 1Z5YE 1T4ZA 2VCWA 2XPDA 2Z9SA 1TKDB 5F06A 5HR2A 3QAGA 4G2EA 3U6VA 1SJ6A 2L6CA 5A4UA 2I1UA 1YZXA 1EP8A 3FR3A 1Z7RA 4BIKA 2NTOA 5LCZA 4XRAA 1V2AA 1JLVA 5G31A 1XZOA 4KNDA 2WCIA 3G7YA 4TXOA 1OC9A 2A4HA 4YAVA 3UBKA 2O85A 4G0KA 3QDNA 4K7OA 1R5AA 3HDCA 2CT6A 3DRNA 3KJYA 2GSSA 1FG4A 1TI1A 2L59A 1M2BA 1K3OA 4K9ZA 3F63A 3GKXA 1JFUA 1KNGA 1A0FA 2OE0A 1XOAA 4BWSA 1GUMA 3UIWA 2IMFA 1JHBA 4ZB8A 3F3QA 4ULXA 3D5JA 1LU4A 4I97A 2F3MA 1HQOA 1FVKA 3D6IA 1ABAA 3P8WA 17GSA 1GTUA 4BVXB 2DBCA 3EURA 1AW9A 3GIXA 5HFIA 5AIXA 4V2MA 4EUYA 2VM2A 1WMJA 4JE1A 3TJJA 2VCQA 4HJMA 1UVZA 2X8GA 1A8YA 3F4TA 4AGSA 4LMVA 1AQXA 4IGJA 2FWGA 5IMCA 1GRXA 4POLA 5INYA 1JZOA 1XBSA 2GZZA 2IIYA 2M72A 1KTEA 4L0UA 3PR8A 3N9JA 2VCVA 4QL9A 2B3SA 4MABA 4K8MA 3KP8A 2R5GA 4Q5NA 1XW9A 4KGIA 1T7PB 1TRSA 1TDIA 3QR6A 2LTKA 2HE3A 3ISOA 3LXZA 3HJOA 2YWMA 2GGTA 4TR0A 4V1Ag 2RUFA 3EC3A 2YANA 4HZ4A 4HS1A 3VWUA 1OKTA 3ED3A 4MF6A 3IXRA 2JL4A 3WGXA 1UC7A 4XTSA 3SWLA 4AF2A 5C04A 4RQXA 2CX4A 1GLPA 5D93A 2C4JA 2VD0A 1TU8A 2YJ7A 4IS0A 4ECJA 5ID2A 3M3MA 5G30A 1VF2A 2V41A 4MMMA 4IP1A 3C1SA 3F9UA 3ZYWA 4O5RA 4AJ8A 4MH3A 2VM1A 1BQ7A 2YNXA 4PX1A 5COHA 1ZCPA 2V2GA 5DQYA 2C80A 2ZUPA 1XWKA 4XS4B 2B5YA 3C7MA 5HR1A 4FYCA 6GSXA 4V2NA 5F0GA 3GTUB 4GSNA 2X4AA 3VURA 1MDIA 2OBIA 1BAYA 4BVYB 1B4PA 1ZYPA 5A5KA 2B1LA 10GSA 1A2LA 3GH9A 3EMPA 1B9XC 3IC8A 4X4JA 3DKSA 5FWGA 1URMA 2FWFA 4OFNA 1MD4A 5D8IA 5F07A 1F6MC 19GSA 2O7KA 4IELA 1XW5A 3IPZA 1N2AA 2H1GA 3FYGA 3QAVA 2YZUA 3FK8A 2VUPA 2X99A 2H72A 1MDKA 2I81A 5GSSA 1M3IA 2H76A 4ZIJA 4ID0A 1GL8A 1USBA 4X1UA 2AHEA 4Q5RA 3E9JB 2VD1A 4OCFA 2V6OA 3R2QA 3VLNA 2PPTA 3Q74A 2M46A 3FRCA 1K0MA 4FQUA 4ILFA 5G1LA 3ZFBA 3BBYA 3H4KA 4LMWA 3TB2A 1GP1A 1ILOA 2ON7A 3W6GA 2GT6A 4Z7XA 2OJLA 2HRNA 16GSA 1AQVA 1T4YA 3H93A 1QMVA 2GZYA 1K0BA 4P3YB 5IMDA 1TRUA 5DBQA 2FUG2 1SKWB 4GXZA 3ZVJA 1M2AA 2X64A 5D9WA 1HD2A 3C73A 4PQHA 4YKGA 5F8BA 3HZ4A 2GSQA 1H4OA 4MP4A 4HZ2A 1HNAA 1W4VA 1X9SB 2LJAA 1J9BA 2GS3A 3G9BA 3DGQA 2LKUA 3BCKA 4D73A 4K0NA 3GHAA 3M1GA 5D73A 3HY2A 2H6XA 4RUVA 1A23A 3F0IA 1ZL9A 2BJXA 5JWRB 1HNBA 1X9WB 5GSTA 2WGRA 2E0QA 4TRXA 1C72A 2ES7A 3KH9A 3UBLA 5IPHA 5CRHA 1Q4JA 3RAZA 1T3BA 2QSIA 4WEYA 3BJ5A 3S9FA 1QXHA 1GTIA 2FWEA 4LA1A 2C3QA 3E0UA 1OE8A 2I4AA 2NPBA 3A5WA 3LQ7A 1DE2A 2CAQA 2C0DA 3K8NA 2LRNA 3O6TA 1YDKA 3DIEA 4IQ1A 4KW6A 4BPYA 1V98A 2F9SA 2F51A 4TKYA 1F2EA 3PH9A 4MZCA 5CO3A 4ZL8A 4XRDA 4IHUA 4O5QA 4OFTA 1MDJA 4TR4A 3FMWA 5ABRA 4N0VA 4KA0A 3IDVA 2LRTA 2EIRA 1PL1A 2H1AA 1K0CA 1NM3A 3HZ8A 4MJEA 4F2IA 5KN3A 1B9YC 2H70A 4HQSA 5IMVA 3KH7A 2IL3A 5B7CA 2GTUA 3NOFA 2G0FA 2CV4A 5J5NA 1WP0A 4AJ6A 5AGYA 4ZB6A 2P5RA 2RUEA 3EU4A 1XCCA 1S3DA 3GKNA 4FIWA 1M9BA 3UVTA 3V1WA 2AYTA 1F9MA 4BVXA 5EPFA 1MEKA 2UZ8A 2VLTA 2K8SA 2DKIA 2HSHA 1Z3EA 1AAZA 1WE0A 2H19A 2HLSA 5B6NA 5B8AA 1WPIA 1NSWA 3QAWA 4O92A 2WZ9A 2HRKA 3VWVA 1SL0B 3CRUA 1ERWA 1G6YA 5ECHB 3CQFA 2PVQA 1QFNA 5L71A 3UJ1A 3L9VA 3CSIA 4I6XA 2IPAA 3VWXA 5D9VA 3E3EA 2XBQA 5ECLB 1O8WA 3Q6OA 3DVXA 5D9TA 2XC2A 2R0GA 3ERWA 3TGZA 1RK4A 4G0IA 4EDYA 2HZFA 3H1NA 1GTAA 1RQMA 5KN0A 2LRCA 3WT1A 3WGEA 4K7IA 1OC8A 1O81A 1XW6A 5J4UA 1PN9A 1YEPA 1U87A 2H0HA 2A2PA 1GH2A 1EGRA 3L4NA 1VF1A 2L5LA 4FYBA 2IN3A 2RM6A 3UMAA 3OR5A 1FW1A 3TRQA 1SD9A 3IOSA 4USSA 3TOUA 1OYJA 4ML6A 1ML6A 4Z2UA 5J41A 2YOIA 3MWHA 3GUSA 3VPQA 2D2ZA 3ME8A 4BA7A 1SK1A 2AUVA 2DJ1A 9GSSA 2R0PA 1B4QA 4EO3A 5CNWA 1GUHA 4KH7A 3IR4A 1YEXA 3KEBA 4XS4A 1CQGA 2CX3A 4EKZA 2E2GA 2L4CA 2TIRA 3GTUA 1ZYEA 4H86A 1BYEA 3ZTLA 4PNFA 4BVYA 4L0WA 4ZL9A 1TJDA 3QPMA 3LJRA 1GTBA 2BMXA 1LJRA 2LNTA 2EC4A 4KDYA 4LL4B 3NZNA 4GCIA 2FHEA 2NBSA 1A2MA 1GSQA 4NAXA 2MMAA 2VCXA 3IAM2 1MTCA 4ECIA 3BOAA 3KP9A 4WBRD 3ZFLA 1F3AA 3GFKA 1XOBA 2MBTA 4RI6A 1PL2A 1XXUA 4IKHA 2DMMA 4K0GA 3TKSA 5DAKB 3LXTA 1W89A 3ME7A 5B6MA 3A2XA 2GVPA 3DXBA 4WBJA 1X5DA 1XFLA 1A2JA 1CQHA 3I69A 4TOPA 2H71A 2H74A 3IRAA 4MNNA 1M9AA 4ZBBA 3AY8A 2VAFA 1GNEA 3LFLA 1GLQA 2DLXA 3ERGA 4Z2RA 4AJ7A 1B48A 1OAZA 3UOMA 2JZRA 2JACA 1T8EB 2C8UA 4J56E 1A0RP 4K5RA 2FWHA 4MZBA 1SK2A 1I5GA 4N30A 3EE2A 1HYUA 2PUKC 4LL1B 2K6VA 1PGTA 4HDEA 4PTSA 4EE0A 1Y25A 4KDXA 4WR4A 4GF0A 1AUCA 1A24A 2O87A 3L78A 4N0ZA 1KBNA 2I9HA 3GKMA 1ERVA 3QCPA 1I9DA 3GN3A 3UL3A 5JWOB 3ZMLA 4OMVA 4EDZA 5ECKB 4G0LA 2YPMA 1AQWA 1K3YA 2PBJA 3FZ4A 1NW2A 1NHYA 1E6BA 2VO4A 1SL1B 3RDWA 3CTGA 1ZMAA 4MCUA 3C8EA 1Y6EA 2NDOA 1YF0A 2E2MA 5DALB 4CW9A 1U6TA 5ECIB 1YKAA 2GSRA 1QGVA 2I3YA 3HA9A 1GSYA 20GSA 4A5PA 1Z6MA 1K0NA 3EWLA 3GMFA 2H75A 8GSSA 2OE1A 3RHBA 1V9WA 4QQ7A 4EIQA 1WJKA 3LYPA 1M2DA 2CVKA 4CDOA 2R3XA 3RBTA 4GQCA 2X49A 1Z9HA 1LBKA 4RI7A 5IO0A 1OVNA 2IMDA 1TU7A 2YWIA 4YAPA 4PGTA 1QK8A 4XS6A 3D4TA 5ECOB 1X9MB 6GSUA 2FGXA 2MZCA 3DVWA 4WF5A 3IA1A 4TR3A 4YKFA 2CZ2A 1EEJA 4GSSA 1OC9B 1QQ2A 4ZILA 3VK9A 2HSYA 6GSSA 2WDUA 3KZQA 4GLTA 2C1YA 3HKRA 2YV9A 1EOGA 1U88A 4L5OA 3A3TA 3CSHA 2CA8A 2AB6A 2AV4A 4XCSA 3TOTA 3KM6A 2CZ3A 4NMUA 3GKKA 3IC4A 3GV1A 2F8FA 1ERTA 1TRVA 2VL2C 1VRSD 1BG5A 3FHKA 4KCAA 5C00A 5E59A 4DSQA 18GSA 2DJ0A 1PMTA 5JWQB 2JSYA 5H5SA 1RW1A 4EL1A 4OFMA 2MMOA 1ZOFA 4POMA 2C0EA 4ECCA 3FZ5A 4F03A 1FAAA 2OE3A 1HNCA 2FA8A 2XPEA 5DJLA 2WRTA 5ECSA 3D22A 1EEMA 14GSA 1OC3A 4IJIA 4HEA2 3MDKA 4DVCA 3LORA 4KAEA 2EIOA 2YV7A 2LQQA 3VPTA 2KP1A 1TP9A 5H5QA 3ZIJA 3HXSA 1DSBA 2KP2A 5GAND 3GYKA 1GSDA 4E8HA 1TW9A 4TXVA 1GSUA 3M0FA 2LNSA 1SJIA 3M9KA 2YZHA 2LUSA 1SYXA 1H75A 1ON4A 2V6KA 2N5FA 5J9BA 3EMXA 4G9HA 4WETA 1K3LA 3U5RE 2OADA 3APQA 4MJAA 4NWYA 1TRWA 2TRCP 3GURA 4WR5A 4RQRA 4Q5FA 22GSA 2PN8A 2LS5A 1V40A 1XWBA 2H01A 1PA3A 2IMKA 3IE3A 3ZIVA 2PMTA 3VI7A 1ERUA 2RIIA 4FYUA 2OKAA 1ZZYA 4HU9A 3QFBC 3QMXA 3Q18A 2MMNA 3HVXA 3TRXA 2ON5A 3LYKA 1X5EA 2YWNA 3HCZA 3TJGA 3P90A 2VL2A 3CTFA 5IM9A 2L5OA 3H8QA 5HFGA 3CMIA 4KDUA 5FHIA 3VWWA 1XIYA 1B8XA 3APOA 3HJMA 4I8BA 1K0DA 2LJKA
chains in the Genus database with same CATH topology
3NIVA 2P0GA 2R2JA 3LEFA 1XPVA 4PUAA 3KGKA 4TVEA 1YKCA 2J9HA 4TR1B 4I2TA 2QGVA 1KEBA 3MAKA 5CRGA 2WS2A 1TK8B 1YQ1A 1G6WA 2LSTA 3GNJA 5DAKA 4YH2A 3KMNA 2H30A 2B6MA 3GX8A 4XIHA 1GULA 4JBBA 2FD3A 4MPFA 5ECQB 1M0UA 2H73A 1PSQA 1R4WA 5F05A 3PINA 3I43A 1VF4A 4K2DA 4OD7A 1GNWA 2MMZA 2B1KA 3LWAA 3VI5A 4POKA 2AAWA 4ACSA 4FH8A 4JEDA 1R26A 2TRXA 1DE1A 1ZGNA 3FW2A 4Q5QA 1ACVA 4ZL7A 4BL7B 1XWCA 4OO4A 6GSTA 1FHEA 3CYNA 6GSVA 2OBKA 1UA5A 3CBUA 2WFCA 5J3RA 2DJJA 4NV2A 4K6XA 4MJBA 2G2QA 1MD3A 2H0GA 4ECBA 3EINA 5HR3A 2B5XA 4GSTA 3D0ZA 1PD21 1DUGA 1T1VA 1FOVA 3BD2A 4WXTA 3TKSE 1JZDA 1FB6A 5AN1A 2CQ9A 2REMA 1IYHA 1WIKA 2AJQB 2V32A 3C71A 3L9SA 1SENA 4MLYA 4MF7A 5AISA 2V1MA 4G10A 3GH6A 4EIPA 5IMAA 3HD5A 3J7Yk 3VFIA 4ZBAA 2IFQB 2N5AA 1TI3A 2C0GA 5BMUA 3HJPA 2HNLA 5AIVA 3TJBA 4ZB9A 4NV5A 5DALA 4L5LA 5G5FA 2K9FA 1AC1A 1V57A 5HQPA 2L57A 3KXOA 4KSMA 1XWAA 5A4WA 3PGTA 2QA1A 3TDGA 3GA4A 4MK3A 4DSSB 1EOHA 1GUKA 3GL5A 2GLRA 4PNGA 2PU9C 11GSA 4IJ3A 3HYPA 3Q19A 4YQMA 2OA7A 3MSZA 4JZQA 1G7EA 3US3A 2L4QA 5CAXA 1FVJA 1Z7PA 3TKQA 5E4WA 5JCGA 5JCWA 3GSSA 4V1Ap 1J08A 1XVWA 2XBIA 2IMIA 2OACA 4L8EA 3ERFA 2JU5A 1BJXA 3FKFA 5ECPB 3F6FA 5IQYA 4N11A 5DCGA 3M8NA 5IIZA 3MYDA 5FT3A 2K8VA 5D9XA 3ZREA 3R3EA 2VL3A 1E2YA 3APSA 5EY6A 3D21A 1PKZA 4WF4A 3TCOA 5B8BA 4QL7A 2YN1A 2PERA 5DJMA 4EC0A 1X5CA 4IBPA 5KN1A 2WULA 5LNKe 1YF1A 3IV4A 3O76A 1EV4A 2FNOA 4IVFA 1WOUA 3DYRA 6GSYA 2O89A 2DKHA 3IAS2 1U3IA 4G19A 2YJHA 3H79A 2NVLA 1ZYQB 4DSRA 5IMFA 2C3TA 3IHGA 2MYGA 3O3TA 2WB9A 2M80A 2VLUA 3EPTA 3I9V2 2P31A 2H6YA 2EIQA 1O6JA 2HI7A 4DEJA 2PWJA 4CY6A 3QOUA 2DJ3A 3C1RA 4EXJA 3GX0A 2X8HA 5ENUA 3RHCA 4PXOA 2FA4A 2HXKA 4JR6A 5IOWA 2HZEB 5H5RA 1BEDA 2H1BA 1S3AA 3N5OA 4ICYA 5A4VA 1SL2B 4K2XA 2KHPA 5G1KA 3PPUA 3KTBA 2JZTA 1EV9A 1AIUA 3A2VA 1FB0A 2GDRA 1TTZA 3TKPA 3W8SA 3G7JA 5DDLA 1YJ6A 3IHQA 2RM5A 2DJ2A 4GRFA 1SJZA 3ZL5A 1EP7A 4YQUA 5ECNB 4FO5A 2H1DA 2ALBA 4X0XA 2QA2A 2A2RA 4KE3A 3CRTA 2B7JA 5ELAA 3SBCA 2C0FA 1A8LA 4PUFC 1O7UA 4GWRA 5JCUA 1J0FA 1SYRA 2DSAA 6GSWA 2R0CA 5KOWA 2DMLA 3DWVA 5ECMB 2H8LA 4YQVA 2F8AA 2DC5A 4LLRA 5ECRB 3WT2A 3IK9A 2GQMA 3DMLA 3UARA 1EGOA 4I2UA 2J23A 2L6DA 3MIXA 4MPGA 4ML1A 1G7OA 2JADA 5GAPD 1ST9A 2CAIA 3ZZXA 3P7XA 4TR1A 4TXOB 2PGTA 3J7Yb 2FLSA 3FR9A 5ELGA 2ZNMA 2GSTA 1Q98A 2JZSA 1QUWA 2BTOT 4PQ1A 1GWCA 2IMEA 3D4MA 3LG6A 2X8CA 4IP6A 2MBSA 2LQOA 3F4SA 1JZWA 4XHMA 2YWOA 3P2AA 3QFAC 4X43A 3WGDA 5IO2A 2GQLA 4JRRA 2CVBA 1VF3A 4N10A 2IWTA 3BCIA 4E8EA 5CP1A 1PN0A 3L0HA 5HFKA 3GL3A 3EVIA 3UVHA 2A2SA 3KD0A 1GSSA 3IBHA 2VCTA 4PURA 1O85A 3DD3A 1DBYA 2H0IA 3DEXA 4PQIA 3KTLA 2C3NA 4BL7A 2HRAA 3WYWA 1JZRA 2XHFA 5GZZB 1SU9A 5LD0A 4F0BA 4HQZA 1FO5A 3KMOA 1TXXA 2LEGA 2QC7A 1XWGA 4ISDA 4NHWA 2O8VB 3TJKA 4NHZA 3HVVA 1YY7A 3A5IA 3W8JA 4O32A 3LSZA 2HFDA 4HI7A 5IMZA 2HT9A 2KOKA 2QKEA 4JU5A 4OCEA 1THXA 5D96A 4HJ2A 2CVDA 2IFQA 4K1FA 2R4VA 4MDCA 1PKWA 1M7TA 3HHVA 1PX7A 2DIYA 2GQKA 2FY6A 2HRFA 1OE7A 3I6AA 1U3AA 2GZPA 4O7HA 3RPPA 1SK0A 3ZVJD 3LGCA 1SKSB 2HSMA 2YCDA 4OWYA 1EZKA 4KB3A 5ID2B 4DSSA 1F37A 1S3CA 3FEUA 1NHOA 3ZLPA 1V58A 5CREA 5EL8A 1EWXA 1GSFA 1N8JA 4IQAA 2PVOC 4EF0A 3GRXA 3FZAA 1GSEA 4J2FA 5DCHA 2LJRA 3UEMA 3WD6A 4POBA 7GSSA 3UAPA 4Z2TA 5KOXA 3TRPA 1VGLA 1K0OA 1OKDA 1TK5B 4MH2A 3F3RA 1R7HA 1O73A 5EVOA 2DJKA 2VLVA 2HYXA 1TK0B 5DQSA 3MNGA 4F82A 1THOA 4TN8A 4HU7A 2E7PA 2A4VA 3ZMKA 5CRWA 4GTUA 1M99A 1WWJA 4J57E 4IW9A 1SD8A 5BRTA 1PRXA 3KIJA 2VIMA 12GSA 5IPGA 4MA9A 1PQNA 2VCZA 4I5QA 3F8UA 4F0CA 3RPNA 4KF9A 4KUNA 4JR4A 3TKRA 3EYTA 2H66A 2H6ZA 2B5EA 5G5EA 3M9JA 3HVSA 4EVMA 2JSZA 2R6KA 4CY8A 3LW9A 1R5PA 3FZ9A 5G2ZA 2VL9A 1IYIA 2WJUA 1TOFA 4V2LA 1T00A 1JLWA 4TW5A 2N5BA 2FCHA 5J9CA 2LV3A 3FR6A 4XS1A 1AXDA 3EU3A 3A2WA 4K5SA 1WRYA 3GSTA 4MZWA 4GQFA 1K0AA 1O8XA 2DIZA 3G7IA 5KN2A 4MJCA 3ZRDA 5IOXA 2KUCA 5DVBA 2HZEA 4WKWA 1ZYNA 4IN0A 3TKSC 4NPBA 4F9ZA 3CXGA 1G0TA 2ZCTA 5HR0A 3ZITA 4CHSA 3L9UA 2R37A 1Z6NA 5KEJA 2GT5A 2YP6A 4KSOA 3KCMA 2B7KA 1XVQA 4K7NA 4ZXGA 4D73B 1X0RA 3F4RA 3JCML 1PX6A 4MF5A 1FOHA 3QD9A 2K18A 5CYYA 2KLXA 3TJFA 4HUAA 4OO5A 1F3BA 5CRDA 4BWQA 2RLIA 4KCEA 13GSA 2IJYA 4HOJA 2P5QA 4ZBDA 1SKRB 3IK7A 4KX4A 3F6DA 3CSJA 1BX9A 3TUEA 3FY7A 4O5UA 1UN2A 4NXIA 2VOCA 1Z5YE 1T4ZA 2VCWA 2XPDA 2Z9SA 1TKDB 5F06A 5HR2A 3QAGA 4G2EA 3U6VA 1SJ6A 2L6CA 5A4UA 2I1UA 1YZXA 1EP8A 3FR3A 1Z7RA 2NTOA 5LCZA 4XRAA 1V2AA 1JLVA 5G31A 1XZOA 4KNDA 2WCIA 3G7YA 4TXOA 1OC9A 2A4HA 4YAVA 3UBKA 2O85A 4G0KA 3QDNA 4K7OA 1R5AA 3HDCA 2CT6A 3DRNA 3KJYA 2GSSA 1FG4A 1TI1A 2L59A 1M2BA 1K3OA 4K9ZA 3F63A 3GKXA 1JFUA 1KNGA 1A0FA 2OE0A 1XOAA 4BWSA 1GUMA 3UIWA 2IMFA 1JHBA 4ZB8A 3F3QA 4ULXA 3D5JA 1LU4A 4I97A 2F3MA 1HQOA 1FVKA 3D6IA 1ABAA 3P8WA 17GSA 1GTUA 4BVXB 2DBCA 3EURA 1AW9A 3GIXA 5HFIA 5AIXA 4V2MA 4EUYA 2VM2A 1WMJA 4JE1A 3TJJA 2VCQA 4HJMA 1UVZA 2X8GA 1A8YA 3F4TA 4AGSA 4LMVA 1AQXA 4IGJA 2FWGA 5IMCA 1GRXA 4POLA 5INYA 1JZOA 1XBSA 2GZZA 2IIYA 2M72A 1KTEA 4L0UA 3PR8A 3N9JA 2VCVA 4QL9A 2B3SA 4MABA 4K8MA 3KP8A 2R5GA 4Q5NA 1XW9A 4KGIA 1T7PB 1TRSA 1TDIA 3QR6A 2LTKA 2HE3A 3ISOA 3LXZA 3HJOA 2YWMA 2GGTA 4TR0A 4V1Ag 2RUFA 3EC3A 2YANA 4HZ4A 4HS1A 3VWUA 1OKTA 3ED3A 4MF6A 3IXRA 2JL4A 3WGXA 1UC7A 4XTSA 3SWLA 4AF2A 5C04A 4RQXA 2CX4A 1GLPA 5D93A 2C4JA 2VD0A 1TU8A 2YJ7A 4IS0A 4ECJA 5ID2A 3M3MA 5G30A 1VF2A 2V41A 4MMMA 4IP1A 3C1SA 3F9UA 3ZYWA 4O5RA 4AJ8A 4MH3A 2VM1A 1BQ7A 2YNXA 4PX1A 5COHA 1ZCPA 2V2GA 5DQYA 2C80A 2ZUPA 1XWKA 4XS4B 2B5YA 3C7MA 5HR1A 4FYCA 6GSXA 4V2NA 5F0GA 3GTUB 4GSNA 2X4AA 3VURA 1MDIA 2OBIA 1BAYA 4BVYB 1B4PA 1ZYPA 5A5KA 2B1LA 10GSA 1A2LA 3GH9A 3EMPA 1B9XC 3IC8A 4X4JA 3DKSA 5FWGA 1URMA 2FWFA 4OFNA 1MD4A 5D8IA 5F07A 1F6MC 19GSA 2O7KA 4IELA 1XW5A 3IPZA 1N2AA 2H1GA 3FYGA 3QAVA 2YZUA 3FK8A 2VUPA 2X99A 2H72A 1MDKA 2I81A 5GSSA 2H76A 4ZIJA 4ID0A 1GL8A 1USBA 4X1UA 2AHEA 4Q5RA 3E9JB 2VD1A 4OCFA 2V6OA 3R2QA 3VLNA 2PPTA 3Q74A 2M46A 3FRCA 1K0MA 4FQUA 4ILFA 5G1LA 3ZFBA 3BBYA 3H4KA 4LMWA 3TB2A 1GP1A 1ILOA 2ON7A 3W6GA 2GT6A 4Z7XA 2OJLA 2HRNA 16GSA 1AQVA 1T4YA 3H93A 1QMVA 2GZYA 1K0BA 4P3YB 5IMDA 1TRUA 5DBQA 2FUG2 1SKWB 4GXZA 3ZVJA 1M2AA 2X64A 5D9WA 1HD2A 3C73A 4PQHA 4YKGA 5F8BA 3HZ4A 2GSQA 1H4OA 4MP4A 4HZ2A 1HNAA 1W4VA 1X9SB 2LJAA 1J9BA 2GS3A 3G9BA 3DGQA 2LKUA 3BCKA 4D73A 4K0NA 3GHAA 3M1GA 5D73A 3HY2A 2H6XA 4RUVA 1A23A 3F0IA 1ZL9A 2BJXA 5JWRB 1HNBA 1X9WB 5GSTA 2WGRA 2E0QA 4TRXA 1C72A 2ES7A 3KH9A 3UBLA 5IPHA 5CRHA 1Q4JA 3RAZA 1T3BA 2QSIA 4WEYA 3BJ5A 3S9FA 1QXHA 1GTIA 2FWEA 4LA1A 2C3QA 3E0UA 1OE8A 2I4AA 2NPBA 3A5WA 3LQ7A 1DE2A 2CAQA 2C0DA 3K8NA 2LRNA 3O6TA 1YDKA 3DIEA 4IQ1A 4KW6A 4BPYA 1V98A 2F9SA 2F51A 4TKYA 1F2EA 3PH9A 4MZCA 5CO3A 4ZL8A 4XRDA 4IHUA 4O5QA 4OFTA 1MDJA 4TR4A 3FMWA 5ABRA 4N0VA 4KA0A 3IDVA 2LRTA 2EIRA 1PL1A 2H1AA 1K0CA 1NM3A 3HZ8A 4MJEA 4F2IA 5KN3A 1B9YC 2H70A 4HQSA 5IMVA 3KH7A 2IL3A 5B7CA 2GTUA 3NOFA 2G0FA 2CV4A 5J5NA 1WP0A 4AJ6A 5AGYA 4ZB6A 2P5RA 2RUEA 3EU4A 1XCCA 1S3DA 3GKNA 4FIWA 1M9BA 3UVTA 3V1WA 2AYTA 1F9MA 4BVXA 5EPFA 1MEKA 2UZ8A 2VLTA 2K8SA 2DKIA 2HSHA 1Z3EA 1AAZA 1WE0A 2H19A 2HLSA 5B6NA 5B8AA 1WPIA 1NSWA 3QAWA 4O92A 2WZ9A 2HRKA 3VWVA 1SL0B 3CRUA 1ERWA 1G6YA 5ECHB 2PVQA 1QFNA 5L71A 3UJ1A 3L9VA 3CSIA 4I6XA 2IPAA 3VWXA 5D9VA 3E3EA 2XBQA 5ECLB 1O8WA 3Q6OA 3DVXA 5D9TA 2XC2A 2R0GA 3ERWA 3TGZA 1RK4A 4G0IA 4EDYA 2HZFA 3H1NA 1GTAA 1RQMA 5KN0A 2LRCA 3WT1A 3WGEA 4K7IA 1OC8A 1O81A 1XW6A 5J4UA 1PN9A 1YEPA 1U87A 2H0HA 2A2PA 1GH2A 1EGRA 3L4NA 1VF1A 2L5LA 4FYBA 2IN3A 2RM6A 3UMAA 3OR5A 1FW1A 3TRQA 1SD9A 3IOSA 4USSA 3TOUA 1OYJA 4ML6A 1ML6A 4Z2UA 5J41A 2YOIA 3MWHA 3GUSA 3VPQA 2D2ZA 3ME8A 4BA7A 1SK1A 2AUVA 2DJ1A 9GSSA 2R0PA 1B4QA 4EO3A 5CNWA 1GUHA 4KH7A 3IR4A 1YEXA 3KEBA 4XS4A 1CQGA 2CX3A 4EKZA 2E2GA 2L4CA 2TIRA 3GTUA 1ZYEA 4H86A 1BYEA 3ZTLA 4PNFA 4BVYA 4L0WA 4ZL9A 1TJDA 3QPMA 3LJRA 1GTBA 2BMXA 1LJRA 2LNTA 2EC4A 4KDYA 4LL4B 3NZNA 4GCIA 2FHEA 2NBSA 1A2MA 1GSQA 4NAXA 2MMAA 2VCXA 3IAM2 1MTCA 4ECIA 3BOAA 3KP9A 4WBRD 3ZFLA 1F3AA 3GFKA 1XOBA 2MBTA 4RI6A 1PL2A 1XXUA 4IKHA 2DMMA 4K0GA 3TKSA 5DAKB 3LXTA 1W89A 3ME7A 5B6MA 3A2XA 2GVPA 3DXBA 4WBJA 1X5DA 1XFLA 1A2JA 1CQHA 3I69A 4TOPA 2H71A 2H74A 3IRAA 4MNNA 1M9AA 4ZBBA 3AY8A 2VAFA 1GNEA 3LFLA 1GLQA 2DLXA 3ERGA 4Z2RA 4AJ7A 1B48A 1OAZA 3UOMA 2JZRA 2JACA 1T8EB 2C8UA 4J56E 1A0RP 4K5RA 2FWHA 4MZBA 1SK2A 1I5GA 4N30A 3EE2A 1HYUA 2PUKC 4LL1B 2K6VA 1PGTA 4HDEA 4PTSA 4EE0A 1Y25A 4KDXA 4WR4A 4GF0A 1AUCA 1A24A 2O87A 3L78A 4N0ZA 1KBNA 2I9HA 3GKMA 1ERVA 3QCPA 1I9DA 3GN3A 3UL3A 5JWOB 3ZMLA 4OMVA 4EDZA 5ECKB 4G0LA 2YPMA 1AQWA 1K3YA 2PBJA 3FZ4A 1NW2A 1NHYA 1E6BA 2VO4A 1SL1B 3RDWA 3CTGA 1ZMAA 4MCUA 3C8EA 1Y6EA 2NDOA 1YF0A 2E2MA 5DALB 4CW9A 1U6TA 5ECIB 1YKAA 2GSRA 1QGVA 2I3YA 3HA9A 1GSYA 20GSA 4A5PA 1Z6MA 1K0NA 3EWLA 3GMFA 2H75A 8GSSA 2OE1A 3RHBA 1V9WA 4QQ7A 4EIQA 1WJKA 3LYPA 1M2DA 2CVKA 4CDOA 2R3XA 3RBTA 4GQCA 2X49A 1Z9HA 1LBKA 4RI7A 5IO0A 1OVNA 2IMDA 1TU7A 2YWIA 4YAPA 4PGTA 1QK8A 4XS6A 3D4TA 5ECOB 1X9MB 6GSUA 2FGXA 2MZCA 3DVWA 4WF5A 3IA1A 4TR3A 4YKFA 2CZ2A 1EEJA 4GSSA 1OC9B 1QQ2A 4ZILA 3VK9A 2HSYA 6GSSA 2WDUA 3KZQA 4GLTA 2C1YA 3HKRA 2YV9A 1EOGA 1U88A 4L5OA 3A3TA 3CSHA 2CA8A 2AB6A 2AV4A 4XCSA 3TOTA 3KM6A 2CZ3A 4NMUA 3GKKA 3IC4A 3GV1A 2F8FA 1ERTA 1TRVA 2VL2C 1VRSD 1BG5A 3FHKA 4KCAA 5C00A 5E59A 4DSQA 18GSA 2DJ0A 1PMTA 5JWQB 2JSYA 5H5SA 1RW1A 4EL1A 4OFMA 2MMOA 1ZOFA 4POMA 2C0EA 4ECCA 3FZ5A 4F03A 1FAAA 2OE3A 1HNCA 2FA8A 2XPEA 5DJLA 2WRTA 5ECSA 3D22A 1EEMA 14GSA 1OC3A 4IJIA 4HEA2 3MDKA 4DVCA 3LORA 4KAEA 2EIOA 2YV7A 2LQQA 3VPTA 2KP1A 1TP9A 5H5QA 3ZIJA 3HXSA 1DSBA 2KP2A 5GAND 3GYKA 1GSDA 4E8HA 1TW9A 4TXVA 1GSUA 3M0FA 2LNSA 1SJIA 3M9KA 2YZHA 2LUSA 1SYXA 1H75A 1ON4A 2V6KA 2N5FA 5J9BA 3EMXA 4G9HA 4WETA 1K3LA 3U5RE 2OADA 3APQA 4MJAA 4NWYA 1TRWA 2TRCP 3GURA 4WR5A 4RQRA 4Q5FA 22GSA 2PN8A 2LS5A 1V40A 1XWBA 2H01A 1PA3A 2IMKA 3IE3A 3ZIVA 2PMTA 3VI7A 1ERUA 2RIIA 4FYUA 2OKAA 1ZZYA 4HU9A 3QFBC 3QMXA 3Q18A 2MMNA 3HVXA 3TRXA 2ON5A 3LYKA 1X5EA 2YWNA 3HCZA 3TJGA 3P90A 2VL2A 3CTFA 5IM9A 2L5OA 3H8QA 5HFGA 3CMIA 4KDUA 5FHIA 3VWWA 1XIYA 1B8XA 3APOA 3HJMA 4I8BA 1K0DA 2LJKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NIV A;  2P0G A;  2R2J A;  3LEF A;  1XPV A;  4PUA A;  3KGK A;  4TVE A;  1YKC A;  2J9H A;  4TR1 B;  4I2T A;  2QGV A;  1KEB A;  3MAK A;  5CRG A;  2WS2 A;  1TK8 B;  1YQ1 A;  1G6W A;  2LST A;  3GNJ A;  5DAK A;  4YH2 A;  3KMN A;  2H30 A;  2B6M A;  3GX8 A;  4XIH A;  1GUL A;  4JBB A;  2FD3 A;  4MPF A;  5ECQ B;  1M0U A;  2H73 A;  1PSQ A;  1R4W A;  5F05 A;  3PIN A;  3I43 A;  1VF4 A;  4K2D A;  4OD7 A;  1GNW A;  2MMZ A;  2B1K A;  3LWA A;  3VI5 A;  4POK A;  2AAW A;  4ACS A;  4FH8 A;  4JED A;  1R26 A;  2TRX A;  1DE1 A;  1ZGN A;  3FW2 A;  4Q5Q A;  1ACV A;  4ZL7 A;  1XWC A;  4OO4 A;  6GST A;  1FHE A;  3CYN A;  6GSV A;  2OBK A;  1UA5 A;  3CBU A;  2WFC A;  5J3R A;  2DJJ A;  4NV2 A;  4K6X A;  4MJB A;  2G2Q A;  1MD3 A;  2H0G A;  4ECB A;  3EIN A;  5HR3 A;  2B5X A;  4GST A;  3D0Z A;  1PD2 1;  1DUG A;  1T1V A;  1FOV A;  3BD2 A;  4WXT A;  3TKS E;  1JZD A;  1FB6 A;  5AN1 A;  2CQ9 A;  2REM A;  1IYH A;  1WIK A;  2AJQ B;  2V32 A;  3C71 A;  3L9S A;  1SEN A;  4MLY A;  4MF7 A;  5AIS A;  2V1M A;  4G10 A;  3GH6 A;  5IMA A;  3HD5 A;  3J7Y k;  3VFI A;  4ZBA A;  2IFQ B;  2N5A A;  1TI3 A;  2C0G A;  3HJP A;  2HNL A;  5AIV A;  3TJB A;  4ZB9 A;  4NV5 A;  5DAL A;  4L5L A;  5G5F A;  2K9F A;  1AC1 A;  1V57 A;  5HQP A;  2L57 A;  3KXO A;  4KSM A;  1XWA A;  5A4W A;  3PGT A;  3TDG A;  3GA4 A;  4MK3 A;  4DSS B;  1EOH A;  1GUK A;  3GL5 A;  2GLR A;  4PNG A;  2PU9 C;  11GS A;  4IJ3 A;  3HYP A;  3Q19 A;  4YQM A;  2OA7 A;  3MSZ A;  4JZQ A;  1G7E A;  3US3 A;  2L4Q A;  5CAX A;  1FVJ A;  1Z7P A;  3TKQ A;  5E4W A;  5JCG A;  5JCW A;  3GSS A;  4V1A p;  1J08 A;  1XVW A;  2XBI A;  2IMI A;  2OAC A;  4L8E A;  3ERF A;  2JU5 A;  1BJX A;  3FKF A;  5ECP B;  3F6F A;  5IQY A;  4N11 A;  5DCG A;  3M8N A;  5IIZ A;  5FT3 A;  2K8V A;  5D9X A;  3ZRE A;  2VL3 A;  1E2Y A;  3APS A;  5EY6 A;  3D21 A;  1PKZ A;  4WF4 A;  3TCO A;  5B8B A;  4QL7 A;  2YN1 A;  2PER A;  5DJM A;  4EC0 A;  1X5C A;  4IBP A;  5KN1 A;  2WUL A;  5LNK e;  1YF1 A;  3IV4 A;  3O76 A;  1EV4 A;  2FNO A;  4IVF A;  1WOU A;  3DYR A;  6GSY A;  2O89 A;  3IAS 2;  1U3I A;  4G19 A;  2YJH A;  3H79 A;  2NVL A;  1ZYQ B;  4DSR A;  5IMF A;  2C3T A;  2MYG A;  3O3T A;  2WB9 A;  2M80 A;  2VLU A;  3I9V 2;  2P31 A;  2H6Y A;  2EIQ A;  1O6J A;  2HI7 A;  4DEJ A;  2PWJ A;  3QOU A;  2DJ3 A;  3C1R A;  4EXJ A;  3GX0 A;  2X8H A;  5ENU A;  3RHC A;  4PXO A;  2FA4 A;  2HXK A;  4JR6 A;  5IOW A;  2HZE B;  5H5R A;  1BED A;  2H1B A;  1S3A A;  3N5O A;  5A4V A;  1SL2 B;  2KHP A;  5G1K A;  3KTB A;  2JZT A;  1EV9 A;  1AIU A;  3A2V A;  1FB0 A;  2GDR A;  1TTZ A;  3TKP A;  3W8S A;  3G7J A;  5DDL A;  1YJ6 A;  3IHQ A;  2RM5 A;  2DJ2 A;  4GRF A;  1SJZ A;  3ZL5 A;  1EP7 A;  4YQU A;  5ECN B;  4FO5 A;  2H1D A;  2ALB A;  4X0X A;  2A2R A;  4KE3 A;  3CRT A;  2B7J A;  5ELA A;  3SBC A;  2C0F A;  1A8L A;  4PUF C;  1O7U A;  4GWR A;  5JCU A;  1J0F A;  1SYR A;  2DSA A;  6GSW A;  2DML A;  3DWV A;  5ECM B;  2H8L A;  4YQV A;  2F8A A;  2DC5 A;  4LLR A;  5ECR B;  3WT2 A;  3IK9 A;  2GQM A;  3DML A;  3UAR A;  1EGO A;  4I2U A;  2J23 A;  2L6D A;  4MPG A;  4ML1 A;  1G7O A;  2JAD A;  5GAP D;  1ST9 A;  2CAI A;  3ZZX A;  3P7X A;  4TR1 A;  4TXO B;  2PGT A;  3J7Y b;  2FLS A;  3FR9 A;  5ELG A;  2ZNM A;  2GST A;  1Q98 A;  2JZS A;  1QUW A;  2BTO T;  4PQ1 A;  1GWC A;  2IME A;  3D4M A;  3LG6 A;  2X8C A;  4IP6 A;  2MBS A;  2LQO A;  3F4S A;  1JZW A;  4XHM A;  2YWO A;  3P2A A;  3QFA C;  4X43 A;  3WGD A;  5IO2 A;  2GQL A;  4JRR A;  2CVB A;  1VF3 A;  4N10 A;  2IWT A;  3BCI A;  4E8E A;  5CP1 A;  3L0H A;  5HFK A;  3GL3 A;  3EVI A;  3UVH A;  2A2S A;  3KD0 A;  1GSS A;  3IBH A;  2VCT A;  4PUR A;  1O85 A;  3DD3 A;  1DBY A;  2H0I A;  3DEX A;  4PQI A;  3KTL A;  2C3N A;  4BL7 A;  3WYW A;  1JZR A;  2XHF A;  5GZZ B;  1SU9 A;  5LD0 A;  4F0B A;  4HQZ A;  1FO5 A;  3KMO A;  1TXX A;  2LEG A;  2QC7 A;  1XWG A;  4ISD A;  4NHW A;  2O8V B;  3TJK A;  4NHZ A;  3HVV A;  1YY7 A;  3W8J A;  4O32 A;  3LSZ A;  2HFD A;  4HI7 A;  5IMZ A;  2HT9 A;  2KOK A;  2QKE A;  4JU5 A;  4OCE A;  1THX A;  5D96 A;  4HJ2 A;  2CVD A;  2IFQ A;  4K1F A;  2R4V A;  4MDC A;  1PKW A;  1M7T A;  3HHV A;  1PX7 A;  2DIY A;  2GQK A;  2FY6 A;  2HRF A;  1OE7 A;  3I6A A;  1U3A A;  2GZP A;  4O7H A;  3RPP A;  1SK0 A;  3ZVJ D;  3LGC A;  1SKS B;  2YCD A;  4OWY A;  1EZK A;  4KB3 A;  5ID2 B;  4DSS A;  1F37 A;  1S3C A;  3FEU A;  1NHO A;  3ZLP A;  1V58 A;  5CRE A;  5EL8 A;  1EWX A;  1GSF A;  1N8J A;  4IQA A;  2PVO C;  4EF0 A;  3GRX A;  3FZA A;  1GSE A;  4J2F A;  5DCH A;  2LJR A;  3UEM A;  3WD6 A;  4POB A;  7GSS A;  3UAP A;  3TRP A;  1VGL A;  1K0O A;  1OKD A;  1TK5 B;  4MH2 A;  3F3R A;  1R7H A;  1O73 A;  5EVO A;  2DJK A;  2VLV A;  2HYX A;  1TK0 B;  5DQS A;  3MNG A;  4F82 A;  1THO A;  4TN8 A;  4HU7 A;  2E7P A;  2A4V A;  3ZMK A;  5CRW A;  4GTU A;  1M99 A;  1WWJ A;  4J57 E;  4IW9 A;  1SD8 A;  1PRX A;  3KIJ A;  2VIM A;  12GS A;  5IPG A;  4MA9 A;  1PQN A;  2VCZ A;  4I5Q A;  3F8U A;  4F0C A;  3RPN A;  4KUN A;  4JR4 A;  3TKR A;  3EYT A;  2H66 A;  2H6Z A;  2B5E A;  5G5E A;  3M9J A;  3HVS A;  4EVM A;  2JSZ A;  2R6K A;  1R5P A;  3FZ9 A;  5G2Z A;  2VL9 A;  1IYI A;  2WJU A;  1TOF A;  4V2L A;  1T00 A;  1JLW A;  4TW5 A;  2N5B A;  2FCH A;  5J9C A;  2LV3 A;  3FR6 A;  4XS1 A;  1AXD A;  3EU3 A;  3A2W A;  1WRY A;  3GST A;  4MZW A;  4GQF A;  1K0A A;  1O8X A;  2DIZ A;  3G7I A;  5KN2 A;  4MJC A;  3ZRD A;  5IOX A;  2KUC A;  5DVB A;  2HZE A;  4WKW A;  4IN0 A;  3TKS C;  4NPB A;  4F9Z A;  3CXG A;  1G0T A;  2ZCT A;  5HR0 A;  3ZIT A;  4CHS A;  3L9U A;  2R37 A;  1Z6N A;  5KEJ A;  2GT5 A;  2YP6 A;  4KSO A;  3KCM A;  2B7K A;  1XVQ A;  4K7N A;  4ZXG A;  4D73 B;  1X0R A;  3F4R A;  3JCM L;  1PX6 A;  4MF5 A;  3QD9 A;  2K18 A;  5CYY A;  2KLX A;  3TJF A;  4HUA A;  4OO5 A;  1F3B A;  5CRD A;  4BWQ A;  2RLI A;  4KCE A;  13GS A;  2IJY A;  4HOJ A;  2P5Q A;  4ZBD A;  1SKR B;  3IK7 A;  4KX4 A;  3F6D A;  3CSJ A;  1BX9 A;  3TUE A;  3FY7 A;  1UN2 A;  4NXI A;  2VOC A;  1Z5Y E;  1T4Z A;  2VCW A;  2XPD A;  2Z9S A;  1TKD B;  5F06 A;  5HR2 A;  3QAG A;  4G2E A;  3U6V A;  1SJ6 A;  2L6C A;  5A4U A;  2I1U A;  1YZX A;  1EP8 A;  3FR3 A;  1Z7R A;  2NTO A;  5LCZ A;  4XRA A;  1V2A A;  1JLV A;  5G31 A;  1XZO A;  4KND A;  2WCI A;  3G7Y A;  4TXO A;  1OC9 A;  4YAV A;  3UBK A;  2O85 A;  3QDN A;  4K7O A;  1R5A A;  3HDC A;  2CT6 A;  3DRN A;  3KJY A;  2GSS A;  1FG4 A;  1TI1 A;  2L59 A;  1M2B A;  1K3O A;  4K9Z A;  3F63 A;  3GKX A;  1JFU A;  1KNG A;  1A0F A;  2OE0 A;  1XOA A;  4BWS A;  1GUM A;  3UIW A;  2IMF A;  1JHB A;  4ZB8 A;  3F3Q A;  4ULX A;  3D5J A;  1LU4 A;  4I97 A;  2F3M A;  1HQO A;  1FVK A;  3D6I A;  1ABA A;  3P8W A;  17GS A;  1GTU A;  2DBC A;  3EUR A;  1AW9 A;  3GIX A;  5HFI A;  5AIX A;  4V2M A;  4EUY A;  2VM2 A;  1WMJ A;  4JE1 A;  3TJJ A;  2VCQ A;  4HJM A;  1UVZ A;  2X8G A;  1A8Y A;  3F4T A;  4AGS A;  4LMV A;  1AQX A;  4IGJ A;  2FWG A;  5IMC A;  1GRX A;  4POL A;  5INY A;  1JZO A;  1XBS A;  2GZZ A;  2IIY A;  2M72 A;  1KTE A;  4L0U A;  3PR8 A;  3N9J A;  2VCV A;  4QL9 A;  2B3S A;  4MAB A;  4K8M A;  3KP8 A;  2R5G A;  4Q5N A;  1XW9 A;  4KGI A;  1T7P B;  1TRS A;  1TDI A;  3QR6 A;  2LTK A;  2HE3 A;  3ISO A;  3LXZ A;  3HJO A;  2YWM A;  2GGT A;  4TR0 A;  4V1A g;  2RUF A;  3EC3 A;  2YAN A;  4HZ4 A;  4HS1 A;  3VWU A;  1OKT A;  3ED3 A;  4MF6 A;  3IXR A;  2JL4 A;  3WGX A;  1UC7 A;  4XTS A;  3SWL A;  4AF2 A;  5C04 A;  4RQX A;  2CX4 A;  1GLP A;  5D93 A;  2C4J A;  2VD0 A;  1TU8 A;  2YJ7 A;  4IS0 A;  4ECJ A;  5ID2 A;  3M3M A;  5G30 A;  1VF2 A;  2V41 A;  4MMM A;  4IP1 A;  3C1S A;  3F9U A;  3ZYW A;  4O5R A;  4AJ8 A;  4MH3 A;  2VM1 A;  1BQ7 A;  2YNX A;  4PX1 A;  5COH A;  1ZCP A;  2V2G A;  5DQY A;  2C80 A;  2ZUP A;  1XWK A;  4XS4 B;  2B5Y A;  3C7M A;  5HR1 A;  4FYC A;  6GSX A;  4V2N A;  5F0G A;  3GTU B;  4GSN A;  3VUR A;  1MDI A;  2OBI A;  1BAY A;  1B4P A;  5A5K A;  2B1L A;  10GS A;  1A2L A;  3GH9 A;  3EMP A;  1B9X C;  3DKS A;  5FWG A;  1URM A;  2FWF A;  4OFN A;  1MD4 A;  5D8I A;  5F07 A;  1F6M C;  19GS A;  2O7K A;  4IEL A;  1XW5 A;  3IPZ A;  1N2A A;  2H1G A;  3FYG A;  3QAV A;  2YZU A;  3FK8 A;  2VUP A;  2X99 A;  2H72 A;  1MDK A;  2I81 A;  5GSS A;  2H76 A;  4ZIJ A;  4ID0 A;  1GL8 A;  1USB A;  4X1U A;  2AHE A;  4Q5R A;  3E9J B;  2VD1 A;  4OCF A;  2V6O A;  3R2Q A;  3VLN A;  2PPT A;  3Q74 A;  2M46 A;  3FRC A;  1K0M A;  4ILF A;  5G1L A;  3ZFB A;  3BBY A;  3H4K A;  4LMW A;  3TB2 A;  1GP1 A;  1ILO A;  2ON7 A;  3W6G A;  2GT6 A;  4Z7X A;  2OJL A;  2HRN A;  16GS A;  1AQV A;  1T4Y A;  3H93 A;  1QMV A;  2GZY A;  1K0B A;  4P3Y B;  5IMD A;  1TRU A;  5DBQ A;  2FUG 2;  1SKW B;  4GXZ A;  3ZVJ A;  1M2A A;  2X64 A;  5D9W A;  1HD2 A;  3C73 A;  4PQH A;  5F8B A;  3HZ4 A;  2GSQ A;  1H4O A;  4MP4 A;  4HZ2 A;  1HNA A;  1W4V A;  1X9S B;  2LJA A;  1J9B A;  2GS3 A;  3G9B A;  3DGQ A;  2LKU A;  3BCK A;  4D73 A;  4K0N A;  3GHA A;  3M1G A;  5D73 A;  3HY2 A;  2H6X A;  4RUV A;  1A23 A;  3F0I A;  1ZL9 A;  2BJX A;  5JWR B;  1HNB A;  1X9W B;  5GST A;  2WGR A;  2E0Q A;  4TRX A;  1C72 A;  2ES7 A;  3KH9 A;  3UBL A;  5IPH A;  5CRH A;  1Q4J A;  3RAZ A;  1T3B A;  2QSI A;  4WEY A;  3BJ5 A;  3S9F A;  1QXH A;  1GTI A;  2FWE A;  4LA1 A;  2C3Q A;  3E0U A;  1OE8 A;  2I4A A;  2NPB A;  3A5W A;  3LQ7 A;  1DE2 A;  2CAQ A;  2C0D A;  3K8N A;  2LRN A;  3O6T A;  1YDK A;  3DIE A;  4IQ1 A;  4KW6 A;  4BPY A;  1V98 A;  2F9S A;  2F51 A;  4TKY A;  1F2E A;  3PH9 A;  4MZC A;  5CO3 A;  4ZL8 A;  4XRD A;  4IHU A;  4OFT A;  1MDJ A;  4TR4 A;  5ABR A;  4N0V A;  4KA0 A;  3IDV A;  2LRT A;  2EIR A;  1PL1 A;  2H1A A;  1K0C A;  1NM3 A;  3HZ8 A;  4MJE A;  4F2I A;  5KN3 A;  1B9Y C;  2H70 A;  4HQS A;  5IMV A;  3KH7 A;  2IL3 A;  5B7C A;  2GTU A;  3NOF A;  2G0F A;  2CV4 A;  5J5N A;  1WP0 A;  4AJ6 A;  5AGY A;  4ZB6 A;  2P5R A;  2RUE A;  3EU4 A;  1XCC A;  1S3D A;  3GKN A;  4FIW A;  1M9B A;  3UVT A;  3V1W A;  2AYT A;  1F9M A;  4BVX A;  5EPF A;  1MEK A;  2VLT A;  2K8S A;  2HSH A;  1Z3E A;  1AAZ A;  1WE0 A;  2H19 A;  2HLS A;  5B6N A;  5B8A A;  1WPI A;  1NSW A;  3QAW A;  4O92 A;  2WZ9 A;  3VWV A;  1SL0 B;  3CRU A;  1ERW A;  1G6Y A;  5ECH B;  2PVQ A;  1QFN A;  5L71 A;  3UJ1 A;  3L9V A;  3CSI A;  4I6X A;  2IPA A;  3VWX A;  5D9V A;  3E3E A;  2XBQ A;  5ECL B;  1O8W A;  3Q6O A;  3DVX A;  5D9T A;  2XC2 A;  3ERW A;  3TGZ A;  1RK4 A;  4EDY A;  2HZF A;  3H1N A;  1GTA A;  1RQM A;  5KN0 A;  2LRC A;  3WT1 A;  3WGE A;  4K7I A;  1OC8 A;  1O81 A;  1XW6 A;  5J4U A;  1PN9 A;  1YEP A;  1U87 A;  2H0H A;  1GH2 A;  1EGR A;  3L4N A;  1VF1 A;  2L5L A;  4FYB A;  2IN3 A;  2RM6 A;  3UMA A;  3OR5 A;  1FW1 A;  3TRQ A;  1SD9 A;  3IOS A;  3TOU A;  1OYJ A;  4ML6 A;  1ML6 A;  5J41 A;  2YOI A;  3MWH A;  3GUS A;  3VPQ A;  2D2Z A;  3ME8 A;  4BA7 A;  1SK1 A;  2AUV A;  2DJ1 A;  9GSS A;  1B4Q A;  4EO3 A;  5CNW A;  1GUH A;  4KH7 A;  3IR4 A;  1YEX A;  3KEB A;  4XS4 A;  1CQG A;  2CX3 A;  4EKZ A;  2E2G A;  2L4C A;  2TIR A;  3GTU A;  1ZYE A;  4H86 A;  1BYE A;  3ZTL A;  4PNF A;  4BVY A;  4L0W A;  4ZL9 A;  1TJD A;  3QPM A;  3LJR A;  1GTB A;  2BMX A;  1LJR A;  2LNT A;  2EC4 A;  4KDY A;  4LL4 B;  3NZN A;  4GCI A;  2FHE A;  2NBS A;  1A2M A;  1GSQ A;  4NAX A;  2MMA A;  2VCX A;  3IAM 2;  1MTC A;  4ECI A;  3BOA A;  3KP9 A;  4WBR D;  3ZFL A;  1F3A A;  3GFK A;  1XOB A;  2MBT A;  4RI6 A;  1PL2 A;  1XXU A;  4IKH A;  2DMM A;  4K0G A;  3TKS A;  5DAK B;  3LXT A;  1W89 A;  3ME7 A;  5B6M A;  3A2X A;  2GVP A;  3DXB A;  4WBJ A;  1X5D A;  1XFL A;  1A2J A;  1CQH A;  3I69 A;  4TOP A;  2H71 A;  2H74 A;  3IRA A;  1M9A A;  4ZBB A;  3AY8 A;  2VAF A;  1GNE A;  3LFL A;  1GLQ A;  2DLX A;  3ERG A;  4AJ7 A;  1B48 A;  1OAZ A;  3UOM A;  2JZR A;  2JAC A;  1T8E B;  2C8U A;  4J56 E;  1A0R P;  2FWH A;  4MZB A;  1SK2 A;  1I5G A;  4N30 A;  3EE2 A;  1HYU A;  2PUK C;  4LL1 B;  2K6V A;  1PGT A;  4HDE A;  4EE0 A;  1Y25 A;  4KDX A;  4WR4 A;  4GF0 A;  1AUC A;  1A24 A;  2O87 A;  3L78 A;  4N0Z A;  1KBN A;  2I9H A;  3GKM A;  1ERV A;  3QCP A;  1I9D A;  3GN3 A;  3UL3 A;  5JWO B;  3ZML A;  4OMV A;  4EDZ A;  5ECK B;  2YPM A;  1AQW A;  1K3Y A;  2PBJ A;  3FZ4 A;  1NW2 A;  1NHY A;  1E6B A;  2VO4 A;  1SL1 B;  3RDW A;  3CTG A;  1ZMA A;  4MCU A;  3C8E A;  1Y6E A;  2NDO A;  1YF0 A;  2E2M A;  5DAL B;  4CW9 A;  1U6T A;  5ECI B;  1YKA A;  2GSR A;  1QGV A;  2I3Y A;  3HA9 A;  1GSY A;  20GS A;  1Z6M A;  1K0N A;  3EWL A;  3GMF A;  2H75 A;  8GSS A;  2OE1 A;  3RHB A;  1V9W A;  4QQ7 A;  1WJK A;  3LYP A;  1M2D A;  2CVK A;  4CDO A;  2R3X A;  3RBT A;  4GQC A;  1Z9H A;  1LBK A;  4RI7 A;  5IO0 A;  1OVN A;  2IMD A;  1TU7 A;  2YWI A;  4YAP A;  4PGT A;  1QK8 A;  4XS6 A;  3D4T A;  5ECO B;  1X9M B;  6GSU A;  2FGX A;  2MZC A;  3DVW A;  4WF5 A;  3IA1 A;  4TR3 A;  2CZ2 A;  1EEJ A;  4GSS A;  1OC9 B;  1QQ2 A;  4ZIL A;  3VK9 A;  2HSY A;  6GSS A;  2WDU A;  3KZQ A;  4GLT A;  2C1Y A;  3HKR A;  2YV9 A;  1EOG A;  1U88 A;  4L5O A;  3A3T A;  3CSH A;  2CA8 A;  2AB6 A;  2AV4 A;  4XCS A;  3TOT A;  3KM6 A;  2CZ3 A;  4NMU A;  3GKK A;  3IC4 A;  3GV1 A;  2F8F A;  1ERT A;  1TRV A;  2VL2 C;  1VRS D;  1BG5 A;  3FHK A;  4KCA A;  5C00 A;  5E59 A;  4DSQ A;  18GS A;  2DJ0 A;  1PMT A;  5JWQ B;  2JSY A;  5H5S A;  1RW1 A;  4EL1 A;  4OFM A;  2MMO A;  1ZOF A;  4POM A;  2C0E A;  4ECC A;  3FZ5 A;  4F03 A;  1FAA A;  2OE3 A;  1HNC A;  2FA8 A;  2XPE A;  5DJL A;  2WRT A;  5ECS A;  3D22 A;  1EEM A;  14GS A;  1OC3 A;  4IJI A;  4HEA 2;  3MDK A;  4DVC A;  3LOR A;  4KAE A;  2EIO A;  2YV7 A;  2LQQ A;  3VPT A;  2KP1 A;  1TP9 A;  5H5Q A;  3ZIJ A;  3HXS A;  1DSB A;  2KP2 A;  5GAN D;  3GYK A;  1GSD A;  4E8H A;  1TW9 A;  4TXV A;  1GSU A;  3M0F A;  2LNS A;  1SJI A;  3M9K A;  2YZH A;  2LUS A;  1SYX A;  1H75 A;  1ON4 A;  2V6K A;  2N5F A;  5J9B A;  3EMX A;  4G9H A;  4WET A;  1K3L A;  3U5R E;  2OAD A;  3APQ A;  4MJA A;  4NWY A;  1TRW A;  2TRC P;  3GUR A;  4WR5 A;  4RQR A;  4Q5F A;  22GS A;  2PN8 A;  2LS5 A;  1V40 A;  1XWB A;  2H01 A;  1PA3 A;  2IMK A;  3IE3 A;  3ZIV A;  2PMT A;  3VI7 A;  1ERU A;  2RII A;  4FYU A;  2OKA A;  1ZZY A;  4HU9 A;  3QFB C;  3QMX A;  3Q18 A;  2MMN A;  3HVX A;  3TRX A;  2ON5 A;  3LYK A;  1X5E A;  2YWN A;  3HCZ A;  3TJG A;  3P90 A;  2VL2 A;  3CTF A;  5IM9 A;  2L5O A;  3H8Q A;  5HFG A;  3CMI A;  4KDU A;  5FHI A;  3VWW A;  1XIY A;  1B8X A;  3APO A;  3HJM A;  4I8B A;  1K0D A;  2LJK A; 
#chains in the Genus database with same CATH topology
 3NIV A;  2P0G A;  2R2J A;  3LEF A;  1XPV A;  4PUA A;  3KGK A;  4TVE A;  1YKC A;  2J9H A;  4TR1 B;  4I2T A;  2QGV A;  1KEB A;  3MAK A;  5CRG A;  2WS2 A;  1TK8 B;  1YQ1 A;  1G6W A;  2LST A;  3GNJ A;  5DAK A;  4YH2 A;  3KMN A;  2H30 A;  2B6M A;  3GX8 A;  4XIH A;  1GUL A;  4JBB A;  2FD3 A;  4MPF A;  5ECQ B;  1M0U A;  2H73 A;  1PSQ A;  1R4W A;  5F05 A;  3PIN A;  3I43 A;  1VF4 A;  4K2D A;  4OD7 A;  1GNW A;  2MMZ A;  2B1K A;  3LWA A;  3VI5 A;  4POK A;  2AAW A;  4ACS A;  4FH8 A;  4JED A;  1R26 A;  2TRX A;  1DE1 A;  1ZGN A;  3FW2 A;  4Q5Q A;  1ACV A;  4ZL7 A;  4BL7 B;  1XG8 A;  1XWC A;  4OO4 A;  6GST A;  1FHE A;  3CYN A;  6GSV A;  2OBK A;  1UA5 A;  3CBU A;  2WFC A;  5J3R A;  2DJJ A;  4NV2 A;  4K6X A;  4MJB A;  2G2Q A;  1MD3 A;  2H0G A;  4ECB A;  3EIN A;  5HR3 A;  2B5X A;  4GST A;  3D0Z A;  1PD2 1;  1DUG A;  1T1V A;  1FOV A;  3BD2 A;  4WXT A;  3TKS E;  1JZD A;  1FB6 A;  5AN1 A;  2CQ9 A;  2REM A;  1IYH A;  1WIK A;  2AJQ B;  2V32 A;  3C71 A;  3L9S A;  1SEN A;  4MLY A;  4MF7 A;  5AIS A;  2V1M A;  4G10 A;  3GH6 A;  4EIP A;  5IMA A;  3HD5 A;  3J7Y k;  3VFI A;  4ZBA A;  2IFQ B;  2N5A A;  1TI3 A;  2C0G A;  5BMU A;  3HJP A;  2HNL A;  5AIV A;  3TJB A;  4ZB9 A;  4NV5 A;  5DAL A;  4L5L A;  5G5F A;  2K9F A;  1AC1 A;  1V57 A;  5HQP A;  2L57 A;  3KXO A;  4KSM A;  1XWA A;  5A4W A;  3PGT A;  2QA1 A;  3TDG A;  3GA4 A;  4MK3 A;  4DSS B;  1EOH A;  1GUK A;  3GL5 A;  2GLR A;  4PNG A;  2PU9 C;  11GS A;  4IJ3 A;  3HYP A;  3Q19 A;  4YQM A;  2OA7 A;  3MSZ A;  4JZQ A;  1G7E A;  3US3 A;  2L4Q A;  5CAX A;  1FVJ A;  1Z7P A;  3TKQ A;  1M3J A;  5E4W A;  5JCG A;  5JCW A;  3GSS A;  4V1A p;  1J08 A;  1XVW A;  2XBI A;  2IMI A;  2OAC A;  4L8E A;  3ERF A;  2JU5 A;  1BJX A;  3FKF A;  5ECP B;  3F6F A;  5IQY A;  4N11 A;  5DCG A;  3M8N A;  5IIZ A;  3MYD A;  5FT3 A;  2K8V A;  5D9X A;  3ZRE A;  3R3E A;  2VL3 A;  1E2Y A;  3APS A;  5EY6 A;  3D21 A;  1PKZ A;  4WF4 A;  3TCO A;  5B8B A;  4QL7 A;  2YN1 A;  2PER A;  5DJM A;  4EC0 A;  1X5C A;  4IBP A;  5KN1 A;  2WUL A;  5LNK e;  1YF1 A;  3IV4 A;  3O76 A;  1EV4 A;  2FNO A;  4IVF A;  1WOU A;  3DYR A;  6GSY A;  2O89 A;  2DKH A;  3IAS 2;  1U3I A;  4G19 A;  2YJH A;  3H79 A;  2NVL A;  1ZYQ B;  4DSR A;  5IMF A;  2C3T A;  3IHG A;  1S3R A;  2MYG A;  3O3T A;  2WB9 A;  2M80 A;  2VLU A;  3EPT A;  3I9V 2;  2P31 A;  2H6Y A;  2EIQ A;  1O6J A;  2HI7 A;  4DEJ A;  2PWJ A;  4CY6 A;  3QOU A;  2DJ3 A;  3C1R A;  4EXJ A;  3GX0 A;  2X8H A;  5ENU A;  3RHC A;  4PXO A;  2FA4 A;  2HXK A;  4JR6 A;  5IOW A;  2HZE B;  5H5R A;  1BED A;  2H1B A;  1S3A A;  3N5O A;  4ICY A;  5A4V A;  1SL2 B;  4K2X A;  2KHP A;  5G1K A;  3PPU A;  3KTB A;  2JZT A;  1EV9 A;  3HVN A;  1AIU A;  3A2V A;  1FB0 A;  2GDR A;  1TTZ A;  3TKP A;  3W8S A;  3G7J A;  5DDL A;  1YJ6 A;  3IHQ A;  2RM5 A;  2DJ2 A;  4GRF A;  1SJZ A;  3ZL5 A;  1EP7 A;  4YQU A;  5ECN B;  4FO5 A;  2H1D A;  2ALB A;  4X0X A;  2QA2 A;  2A2R A;  4KE3 A;  3CRT A;  2B7J A;  5ELA A;  3SBC A;  2C0F A;  1A8L A;  4PUF C;  1O7U A;  4GWR A;  5JCU A;  1J0F A;  1SYR A;  2DSA A;  6GSW A;  2R0C A;  5KOW A;  2DML A;  3DWV A;  5ECM B;  2H8L A;  4YQV A;  2F8A A;  2DC5 A;  4LLR A;  5ECR B;  3WT2 A;  3IK9 A;  2GQM A;  3DML A;  3UAR A;  1EGO A;  4I2U A;  2J23 A;  2L6D A;  3MIX A;  4MPG A;  4ML1 A;  1G7O A;  2JAD A;  5GAP D;  1ST9 A;  2CAI A;  3ZZX A;  3P7X A;  4TR1 A;  4TXO B;  2PGT A;  3J7Y b;  2FLS A;  3FR9 A;  5ELG A;  2ZNM A;  2GST A;  1Q98 A;  2JZS A;  1QUW A;  2BTO T;  4PQ1 A;  1GWC A;  4HSC X;  2IME A;  3D4M A;  3LG6 A;  2X8C A;  4IP6 A;  2MBS A;  2LQO A;  3F4S A;  1JZW A;  4XHM A;  2YWO A;  3P2A A;  3QFA C;  4X43 A;  3WGD A;  5IO2 A;  2GQL A;  4JRR A;  2CVB A;  1VF3 A;  4N10 A;  2IWT A;  3BCI A;  4E8E A;  5CP1 A;  1PN0 A;  3L0H A;  5HFK A;  3GL3 A;  1PFO A;  3EVI A;  3UVH A;  2A2S A;  3KD0 A;  1GSS A;  3IBH A;  2VCT A;  4PUR A;  1O85 A;  3DD3 A;  1DBY A;  2H0I A;  3DEX A;  4PQI A;  3KTL A;  2C3N A;  4BL7 A;  2HRA A;  3WYW A;  1JZR A;  2XHF A;  5GZZ B;  1SU9 A;  5LD0 A;  4F0B A;  4HQZ A;  1FO5 A;  3KMO A;  1TXX A;  2LEG A;  2QC7 A;  1XWG A;  4ISD A;  4NHW A;  2O8V B;  3TJK A;  4NHZ A;  3HVV A;  1YY7 A;  3A5I A;  3W8J A;  4O32 A;  3LSZ A;  2HFD A;  4HI7 A;  5IMZ A;  2HT9 A;  2KOK A;  2QKE A;  4JU5 A;  4OCE A;  1THX A;  5D96 A;  4HJ2 A;  2CVD A;  2IFQ A;  4K1F A;  2R4V A;  4MDC A;  1PKW A;  1M7T A;  3HHV A;  1PX7 A;  2DIY A;  2GQK A;  2FY6 A;  2HRF A;  1OE7 A;  3I6A A;  1U3A A;  2GZP A;  4O7H A;  3RPP A;  1SK0 A;  3ZVJ D;  3LGC A;  1SKS B;  2HSM A;  2YCD A;  4OWY A;  1EZK A;  4KB3 A;  5ID2 B;  4DSS A;  1F37 A;  1S3C A;  3FEU A;  1NHO A;  3ZLP A;  1V58 A;  5CRE A;  5EL8 A;  1EWX A;  1GSF A;  1N8J A;  4IQA A;  2PVO C;  4EF0 A;  3GRX A;  3FZA A;  1GSE A;  4J2F A;  5DCH A;  2LJR A;  3UEM A;  3WD6 A;  4POB A;  7GSS A;  3UAP A;  4Z2T A;  5KOX A;  3TRP A;  1VGL A;  1K0O A;  1OKD A;  1TK5 B;  4MH2 A;  3F3R A;  1R7H A;  1O73 A;  5EVO A;  2DJK A;  2VLV A;  2HYX A;  1TK0 B;  5DQS A;  3MNG A;  4F82 A;  1THO A;  4TN8 A;  4HU7 A;  2E7P A;  2A4V A;  3ZMK A;  5CRW A;  4GTU A;  1M99 A;  1WWJ A;  4J57 E;  4IW9 A;  1SD8 A;  5BRT A;  1PRX A;  3KIJ A;  2VIM A;  12GS A;  5IPG A;  4MA9 A;  1PQN A;  2VCZ A;  4I5Q A;  3F8U A;  4F0C A;  3RPN A;  4KF9 A;  4KUN A;  4JR4 A;  3TKR A;  3EYT A;  2H66 A;  2H6Z A;  2B5E A;  5G5E A;  3M9J A;  3HVS A;  4EVM A;  2JSZ A;  2R6K A;  4CY8 A;  3LW9 A;  1R5P A;  3FZ9 A;  5G2Z A;  2VL9 A;  1IYI A;  2WJU A;  1TOF A;  4V2L A;  1T00 A;  1JLW A;  4TW5 A;  2N5B A;  2FCH A;  5J9C A;  2LV3 A;  3FR6 A;  4XS1 A;  1AXD A;  3EU3 A;  3A2W A;  4K5S A;  1WRY A;  3GST A;  4MZW A;  4GQF A;  1K0A A;  1O8X A;  2DIZ A;  3G7I A;  5KN2 A;  4MJC A;  3ZRD A;  5IOX A;  2KUC A;  5DVB A;  2HZE A;  4WKW A;  1ZYN A;  4IN0 A;  3TKS C;  4NPB A;  4F9Z A;  3CXG A;  1G0T A;  2ZCT A;  5HR0 A;  3ZIT A;  4CHS A;  3L9U A;  2R37 A;  1Z6N A;  5KEJ A;  2GT5 A;  2YP6 A;  4KSO A;  3KCM A;  2B7K A;  1XVQ A;  4K7N A;  4ZXG A;  4D73 B;  1X0R A;  3F4R A;  3JCM L;  1PX6 A;  4MF5 A;  1FOH A;  3QD9 A;  2K18 A;  5CYY A;  2KLX A;  3TJF A;  4HUA A;  4OO5 A;  1F3B A;  5CRD A;  4BWQ A;  2RLI A;  4KCE A;  13GS A;  2IJY A;  4HOJ A;  2P5Q A;  4ZBD A;  1SKR B;  3IK7 A;  4KX4 A;  3F6D A;  3CSJ A;  1BX9 A;  3TUE A;  3FY7 A;  4O5U A;  1UN2 A;  4NXI A;  2VOC A;  1Z5Y E;  1T4Z A;  2VCW A;  2XPD A;  2Z9S A;  1TKD B;  5F06 A;  5HR2 A;  3QAG A;  4G2E A;  3U6V A;  1SJ6 A;  2L6C A;  5A4U A;  2I1U A;  1YZX A;  1EP8 A;  3FR3 A;  1Z7R A;  4BIK A;  2NTO A;  5LCZ A;  4XRA A;  1V2A A;  1JLV A;  5G31 A;  1XZO A;  4KND A;  2WCI A;  3G7Y A;  4TXO A;  1OC9 A;  2A4H A;  4YAV A;  3UBK A;  2O85 A;  4G0K A;  3QDN A;  4K7O A;  1R5A A;  3HDC A;  2CT6 A;  3DRN A;  3KJY A;  2GSS A;  1FG4 A;  1TI1 A;  2L59 A;  1M2B A;  1K3O A;  4K9Z A;  3F63 A;  3GKX A;  1JFU A;  1KNG A;  1A0F A;  2OE0 A;  1XOA A;  4BWS A;  1GUM A;  3UIW A;  2IMF A;  1JHB A;  4ZB8 A;  3F3Q A;  4ULX A;  3D5J A;  1LU4 A;  4I97 A;  2F3M A;  1HQO A;  1FVK A;  3D6I A;  1ABA A;  3P8W A;  17GS A;  1GTU A;  4BVX B;  2DBC A;  3EUR A;  1AW9 A;  3GIX A;  5HFI A;  5AIX A;  4V2M A;  4EUY A;  2VM2 A;  1WMJ A;  4JE1 A;  3TJJ A;  2VCQ A;  4HJM A;  1UVZ A;  2X8G A;  1A8Y A;  3F4T A;  4AGS A;  4LMV A;  1AQX A;  4IGJ A;  2FWG A;  5IMC A;  1GRX A;  4POL A;  5INY A;  1JZO A;  1XBS A;  2GZZ A;  2IIY A;  2M72 A;  1KTE A;  4L0U A;  3PR8 A;  3N9J A;  2VCV A;  4QL9 A;  2B3S A;  4MAB A;  4K8M A;  3KP8 A;  2R5G A;  4Q5N A;  1XW9 A;  4KGI A;  1T7P B;  1TRS A;  1TDI A;  3QR6 A;  2LTK A;  2HE3 A;  3ISO A;  3LXZ A;  3HJO A;  2YWM A;  2GGT A;  4TR0 A;  4V1A g;  2RUF A;  3EC3 A;  2YAN A;  4HZ4 A;  4HS1 A;  3VWU A;  1OKT A;  3ED3 A;  4MF6 A;  3IXR A;  2JL4 A;  3WGX A;  1UC7 A;  4XTS A;  3SWL A;  4AF2 A;  5C04 A;  4RQX A;  2CX4 A;  1GLP A;  5D93 A;  2C4J A;  2VD0 A;  1TU8 A;  2YJ7 A;  4IS0 A;  4ECJ A;  5ID2 A;  3M3M A;  5G30 A;  1VF2 A;  2V41 A;  4MMM A;  4IP1 A;  3C1S A;  3F9U A;  3ZYW A;  4O5R A;  4AJ8 A;  4MH3 A;  2VM1 A;  1BQ7 A;  2YNX A;  4PX1 A;  5COH A;  1ZCP A;  2V2G A;  5DQY A;  2C80 A;  2ZUP A;  1XWK A;  4XS4 B;  2B5Y A;  3C7M A;  5HR1 A;  4FYC A;  6GSX A;  4V2N A;  5F0G A;  3GTU B;  4GSN A;  2X4A A;  3VUR A;  1MDI A;  2OBI A;  1BAY A;  4BVY B;  1B4P A;  1ZYP A;  5A5K A;  2B1L A;  10GS A;  1A2L A;  3GH9 A;  3EMP A;  1B9X C;  3IC8 A;  4X4J A;  3DKS A;  5FWG A;  1URM A;  2FWF A;  4OFN A;  1MD4 A;  5D8I A;  5F07 A;  1F6M C;  19GS A;  2O7K A;  4IEL A;  1XW5 A;  3IPZ A;  1N2A A;  2H1G A;  3FYG A;  3QAV A;  2YZU A;  3FK8 A;  2VUP A;  2X99 A;  2H72 A;  1MDK A;  2I81 A;  5GSS A;  1M3I A;  2H76 A;  4ZIJ A;  4ID0 A;  1GL8 A;  1USB A;  4X1U A;  2AHE A;  4Q5R A;  3E9J B;  2VD1 A;  4OCF A;  2V6O A;  3R2Q A;  3VLN A;  2PPT A;  3Q74 A;  2M46 A;  3FRC A;  1K0M A;  4FQU A;  4ILF A;  5G1L A;  3ZFB A;  3BBY A;  3H4K A;  4LMW A;  3TB2 A;  1GP1 A;  1ILO A;  2ON7 A;  3W6G A;  2GT6 A;  4Z7X A;  2OJL A;  2HRN A;  16GS A;  1AQV A;  1T4Y A;  3H93 A;  1QMV A;  2GZY A;  1K0B A;  4P3Y B;  5IMD A;  1TRU A;  5DBQ A;  2FUG 2;  1SKW B;  4GXZ A;  3ZVJ A;  1M2A A;  2X64 A;  5D9W A;  1HD2 A;  3C73 A;  4PQH A;  4YKG A;  5F8B A;  3HZ4 A;  2GSQ A;  1H4O A;  4MP4 A;  4HZ2 A;  1HNA A;  1W4V A;  1X9S B;  2LJA A;  1J9B A;  2GS3 A;  3G9B A;  3DGQ A;  2LKU A;  3BCK A;  4D73 A;  4K0N A;  3GHA A;  3M1G A;  5D73 A;  3HY2 A;  2H6X A;  4RUV A;  1A23 A;  3F0I A;  1ZL9 A;  2BJX A;  5JWR B;  1HNB A;  1X9W B;  5GST A;  2WGR A;  2E0Q A;  4TRX A;  1C72 A;  2ES7 A;  3KH9 A;  3UBL A;  5IPH A;  5CRH A;  1Q4J A;  3RAZ A;  1T3B A;  2QSI A;  4WEY A;  3BJ5 A;  3S9F A;  1QXH A;  1GTI A;  2FWE A;  4LA1 A;  2C3Q A;  3E0U A;  1OE8 A;  2I4A A;  2NPB A;  3A5W A;  3LQ7 A;  1DE2 A;  2CAQ A;  2C0D A;  3K8N A;  2LRN A;  3O6T A;  1YDK A;  3DIE A;  4IQ1 A;  4KW6 A;  4BPY A;  1V98 A;  2F9S A;  2F51 A;  4TKY A;  1F2E A;  3PH9 A;  4MZC A;  5CO3 A;  4ZL8 A;  4XRD A;  4IHU A;  4O5Q A;  4OFT A;  1MDJ A;  4TR4 A;  3FMW A;  5ABR A;  4N0V A;  4KA0 A;  3IDV A;  2LRT A;  2EIR A;  1PL1 A;  2H1A A;  1K0C A;  1NM3 A;  3HZ8 A;  4MJE A;  4F2I A;  5KN3 A;  1B9Y C;  2H70 A;  4HQS A;  5IMV A;  3KH7 A;  2IL3 A;  5B7C A;  2GTU A;  3NOF A;  2G0F A;  2CV4 A;  5J5N A;  1WP0 A;  4AJ6 A;  5AGY A;  4ZB6 A;  2P5R A;  2RUE A;  3EU4 A;  1XCC A;  1S3D A;  3GKN A;  4FIW A;  1M9B A;  3UVT A;  3V1W A;  2AYT A;  1F9M A;  4BVX A;  5EPF A;  1MEK A;  2UZ8 A;  2VLT A;  2K8S A;  2DKI A;  2HSH A;  1Z3E A;  1AAZ A;  1WE0 A;  2H19 A;  2HLS A;  5B6N A;  5B8A A;  1WPI A;  1NSW A;  3QAW A;  4O92 A;  2WZ9 A;  2HRK A;  3VWV A;  1SL0 B;  3CRU A;  1ERW A;  1G6Y A;  5ECH B;  3CQF A;  2PVQ A;  1QFN A;  5L71 A;  3UJ1 A;  3L9V A;  3CSI A;  4I6X A;  2IPA A;  3VWX A;  5D9V A;  3E3E A;  2XBQ A;  5ECL B;  1O8W A;  3Q6O A;  3DVX A;  5D9T A;  2XC2 A;  2R0G A;  3ERW A;  3TGZ A;  1RK4 A;  4G0I A;  4EDY A;  2HZF A;  3H1N A;  1GTA A;  1RQM A;  5KN0 A;  2LRC A;  3WT1 A;  3WGE A;  4K7I A;  1OC8 A;  1O81 A;  1XW6 A;  5J4U A;  1PN9 A;  1YEP A;  1U87 A;  2H0H A;  2A2P A;  1GH2 A;  1EGR A;  3L4N A;  1VF1 A;  2L5L A;  4FYB A;  2IN3 A;  2RM6 A;  3UMA A;  3OR5 A;  1FW1 A;  3TRQ A;  1SD9 A;  3IOS A;  4USS A;  3TOU A;  1OYJ A;  4ML6 A;  1ML6 A;  4Z2U A;  5J41 A;  2YOI A;  3MWH A;  3GUS A;  3VPQ A;  2D2Z A;  3ME8 A;  4BA7 A;  1SK1 A;  2AUV A;  2DJ1 A;  9GSS A;  2R0P A;  1B4Q A;  4EO3 A;  5CNW A;  1GUH A;  4KH7 A;  3IR4 A;  1YEX A;  3KEB A;  4XS4 A;  1CQG A;  2CX3 A;  4EKZ A;  2E2G A;  2L4C A;  2TIR A;  3GTU A;  1ZYE A;  4H86 A;  1BYE A;  3ZTL A;  4PNF A;  4BVY A;  4L0W A;  4ZL9 A;  1TJD A;  3QPM A;  3LJR A;  1GTB A;  2BMX A;  1LJR A;  2LNT A;  2EC4 A;  4KDY A;  4LL4 B;  3NZN A;  4GCI A;  2FHE A;  2NBS A;  1A2M A;  1GSQ A;  4NAX A;  2MMA A;  2VCX A;  3IAM 2;  1MTC A;  4ECI A;  3BOA A;  3KP9 A;  4WBR D;  3ZFL A;  1F3A A;  3GFK A;  1XOB A;  2MBT A;  4RI6 A;  1PL2 A;  1XXU A;  4IKH A;  2DMM A;  4K0G A;  3TKS A;  5DAK B;  3LXT A;  1W89 A;  3ME7 A;  5B6M A;  3A2X A;  2GVP A;  3DXB A;  4WBJ A;  1X5D A;  1XFL A;  1A2J A;  1CQH A;  3I69 A;  4TOP A;  2H71 A;  2H74 A;  3IRA A;  4MNN A;  1M9A A;  4ZBB A;  3AY8 A;  2VAF A;  1GNE A;  3LFL A;  1GLQ A;  2DLX A;  3ERG A;  4Z2R A;  4AJ7 A;  1B48 A;  1OAZ A;  3UOM A;  2JZR A;  2JAC A;  1T8E B;  2C8U A;  4J56 E;  1A0R P;  4K5R A;  2FWH A;  4MZB A;  1SK2 A;  1I5G A;  4N30 A;  3EE2 A;  1HYU A;  2PUK C;  4LL1 B;  2K6V A;  1PGT A;  4HDE A;  4PTS A;  4EE0 A;  1Y25 A;  4KDX A;  4WR4 A;  4GF0 A;  1AUC A;  1A24 A;  2O87 A;  3L78 A;  4N0Z A;  1KBN A;  2I9H A;  3GKM A;  1ERV A;  3QCP A;  1I9D A;  3GN3 A;  3UL3 A;  5JWO B;  3ZML A;  4OMV A;  4EDZ A;  5ECK B;  4G0L A;  2YPM A;  1AQW A;  1K3Y A;  2PBJ A;  3FZ4 A;  1NW2 A;  1NHY A;  1E6B A;  2VO4 A;  1SL1 B;  3RDW A;  3CTG A;  1ZMA A;  4MCU A;  3C8E A;  1Y6E A;  2NDO A;  1YF0 A;  2E2M A;  5DAL B;  4CW9 A;  1U6T A;  5ECI B;  1YKA A;  2GSR A;  1QGV A;  2I3Y A;  3HA9 A;  1GSY A;  20GS A;  4A5P A;  1Z6M A;  1K0N A;  3EWL A;  3GMF A;  2H75 A;  8GSS A;  2OE1 A;  3RHB A;  1V9W A;  4QQ7 A;  4EIQ A;  1WJK A;  3LYP A;  1M2D A;  2CVK A;  4CDO A;  2R3X A;  3RBT A;  4GQC A;  2X49 A;  1Z9H A;  1LBK A;  4RI7 A;  5IO0 A;  1OVN A;  2IMD A;  1TU7 A;  2YWI A;  4YAP A;  4PGT A;  1QK8 A;  4XS6 A;  3D4T A;  5ECO B;  1X9M B;  6GSU A;  2FGX A;  2MZC A;  3DVW A;  4WF5 A;  3IA1 A;  4TR3 A;  4YKF A;  2CZ2 A;  1EEJ A;  4GSS A;  1OC9 B;  1QQ2 A;  4ZIL A;  3VK9 A;  2HSY A;  6GSS A;  2WDU A;  3KZQ A;  4GLT A;  2C1Y A;  3HKR A;  2YV9 A;  1EOG A;  1U88 A;  4L5O A;  3A3T A;  3CSH A;  2CA8 A;  2AB6 A;  2AV4 A;  4XCS A;  3TOT A;  3KM6 A;  2CZ3 A;  4NMU A;  3GKK A;  3IC4 A;  3GV1 A;  2F8F A;  1ERT A;  1TRV A;  2VL2 C;  1VRS D;  1BG5 A;  3FHK A;  4KCA A;  5C00 A;  5E59 A;  4DSQ A;  18GS A;  2DJ0 A;  1PMT A;  5JWQ B;  2JSY A;  5H5S A;  1RW1 A;  4EL1 A;  4OFM A;  2MMO A;  1ZOF A;  4POM A;  2C0E A;  4ECC A;  3FZ5 A;  4F03 A;  1FAA A;  2OE3 A;  1HNC A;  2FA8 A;  2XPE A;  5DJL A;  2WRT A;  5ECS A;  3D22 A;  1EEM A;  14GS A;  1OC3 A;  4IJI A;  4HEA 2;  3MDK A;  4DVC A;  3LOR A;  4KAE A;  2EIO A;  2YV7 A;  2LQQ A;  3VPT A;  2KP1 A;  1TP9 A;  5H5Q A;  3ZIJ A;  3HXS A;  1DSB A;  2KP2 A;  5GAN D;  3GYK A;  1GSD A;  4E8H A;  1TW9 A;  4TXV A;  1GSU A;  3M0F A;  2LNS A;  1SJI A;  3M9K A;  2YZH A;  2LUS A;  1SYX A;  1H75 A;  1ON4 A;  2V6K A;  2N5F A;  5J9B A;  3EMX A;  4G9H A;  4WET A;  1K3L A;  3U5R E;  2OAD A;  3APQ A;  4MJA A;  4NWY A;  1TRW A;  2TRC P;  3GUR A;  4WR5 A;  4RQR A;  4Q5F A;  22GS A;  2PN8 A;  2LS5 A;  1V40 A;  1XWB A;  2H01 A;  1PA3 A;  2IMK A;  3IE3 A;  3ZIV A;  2PMT A;  3VI7 A;  1ERU A;  2RII A;  4FYU A;  2OKA A;  1ZZY A;  4HU9 A;  3QFB C;  3QMX A;  3Q18 A;  2MMN A;  3HVX A;  3TRX A;  2ON5 A;  3LYK A;  1X5E A;  2YWN A;  3HCZ A;  3TJG A;  3P90 A;  2VL2 A;  3CTF A;  5IM9 A;  2L5O A;  3H8Q A;  5HFG A;  3CMI A;  4KDU A;  5FHI A;  3VWW A;  1XIY A;  1B8X A;  3APO A;  3HJM A;  4I8B A;  1K0D A;  2LJK A; 
#chains in the Genus database with same CATH homology
 3NIV A;  2P0G A;  2R2J A;  3LEF A;  1XPV A;  4PUA A;  3KGK A;  4TVE A;  1YKC A;  2J9H A;  4TR1 B;  4I2T A;  2QGV A;  1KEB A;  3MAK A;  5CRG A;  2WS2 A;  1TK8 B;  1YQ1 A;  1G6W A;  2LST A;  3GNJ A;  5DAK A;  4YH2 A;  3KMN A;  2H30 A;  2B6M A;  3GX8 A;  4XIH A;  1GUL A;  4JBB A;  2FD3 A;  4MPF A;  5ECQ B;  1M0U A;  2H73 A;  1PSQ A;  1R4W A;  5F05 A;  3PIN A;  3I43 A;  1VF4 A;  4K2D A;  4OD7 A;  1GNW A;  2MMZ A;  2B1K A;  3LWA A;  3VI5 A;  4POK A;  2AAW A;  4ACS A;  4FH8 A;  4JED A;  1R26 A;  2TRX A;  1DE1 A;  1ZGN A;  3FW2 A;  4Q5Q A;  1ACV A;  4ZL7 A;  4BL7 B;  1XWC A;  4OO4 A;  6GST A;  1FHE A;  3CYN A;  6GSV A;  2OBK A;  1UA5 A;  3CBU A;  2WFC A;  5J3R A;  2DJJ A;  4NV2 A;  4K6X A;  4MJB A;  2G2Q A;  1MD3 A;  2H0G A;  4ECB A;  3EIN A;  5HR3 A;  2B5X A;  4GST A;  3D0Z A;  1PD2 1;  1DUG A;  1T1V A;  1FOV A;  3BD2 A;  4WXT A;  3TKS E;  1JZD A;  1FB6 A;  5AN1 A;  2CQ9 A;  2REM A;  1IYH A;  1WIK A;  2AJQ B;  2V32 A;  3C71 A;  3L9S A;  1SEN A;  4MLY A;  4MF7 A;  5AIS A;  2V1M A;  4G10 A;  3GH6 A;  4EIP A;  5IMA A;  3HD5 A;  3J7Y k;  3VFI A;  4ZBA A;  2IFQ B;  2N5A A;  1TI3 A;  2C0G A;  5BMU A;  3HJP A;  2HNL A;  5AIV A;  3TJB A;  4ZB9 A;  4NV5 A;  5DAL A;  4L5L A;  5G5F A;  2K9F A;  1AC1 A;  1V57 A;  5HQP A;  2L57 A;  3KXO A;  4KSM A;  1XWA A;  5A4W A;  3PGT A;  2QA1 A;  3TDG A;  3GA4 A;  4MK3 A;  4DSS B;  1EOH A;  1GUK A;  3GL5 A;  2GLR A;  4PNG A;  2PU9 C;  11GS A;  4IJ3 A;  3HYP A;  3Q19 A;  4YQM A;  2OA7 A;  3MSZ A;  4JZQ A;  1G7E A;  3US3 A;  2L4Q A;  5CAX A;  1FVJ A;  1Z7P A;  3TKQ A;  5E4W A;  5JCG A;  5JCW A;  3GSS A;  4V1A p;  1J08 A;  1XVW A;  2XBI A;  2IMI A;  2OAC A;  4L8E A;  3ERF A;  2JU5 A;  1BJX A;  3FKF A;  5ECP B;  3F6F A;  5IQY A;  4N11 A;  5DCG A;  3M8N A;  5IIZ A;  3MYD A;  5FT3 A;  2K8V A;  5D9X A;  3ZRE A;  3R3E A;  2VL3 A;  1E2Y A;  3APS A;  5EY6 A;  3D21 A;  1PKZ A;  4WF4 A;  3TCO A;  5B8B A;  4QL7 A;  2YN1 A;  2PER A;  5DJM A;  4EC0 A;  1X5C A;  4IBP A;  5KN1 A;  2WUL A;  5LNK e;  1YF1 A;  3IV4 A;  3O76 A;  1EV4 A;  2FNO A;  4IVF A;  1WOU A;  3DYR A;  6GSY A;  2O89 A;  2DKH A;  3IAS 2;  1U3I A;  4G19 A;  2YJH A;  3H79 A;  2NVL A;  1ZYQ B;  4DSR A;  5IMF A;  2C3T A;  3IHG A;  2MYG A;  3O3T A;  2WB9 A;  2M80 A;  2VLU A;  3EPT A;  3I9V 2;  2P31 A;  2H6Y A;  2EIQ A;  1O6J A;  2HI7 A;  4DEJ A;  2PWJ A;  4CY6 A;  3QOU A;  2DJ3 A;  3C1R A;  4EXJ A;  3GX0 A;  2X8H A;  5ENU A;  3RHC A;  4PXO A;  2FA4 A;  2HXK A;  4JR6 A;  5IOW A;  2HZE B;  5H5R A;  1BED A;  2H1B A;  1S3A A;  3N5O A;  4ICY A;  5A4V A;  1SL2 B;  4K2X A;  2KHP A;  5G1K A;  3PPU A;  3KTB A;  2JZT A;  1EV9 A;  1AIU A;  3A2V A;  1FB0 A;  2GDR A;  1TTZ A;  3TKP A;  3W8S A;  3G7J A;  5DDL A;  1YJ6 A;  3IHQ A;  2RM5 A;  2DJ2 A;  4GRF A;  1SJZ A;  3ZL5 A;  1EP7 A;  4YQU A;  5ECN B;  4FO5 A;  2H1D A;  2ALB A;  4X0X A;  2QA2 A;  2A2R A;  4KE3 A;  3CRT A;  2B7J A;  5ELA A;  3SBC A;  2C0F A;  1A8L A;  4PUF C;  1O7U A;  4GWR A;  5JCU A;  1J0F A;  1SYR A;  2DSA A;  6GSW A;  2R0C A;  5KOW A;  2DML A;  3DWV A;  5ECM B;  2H8L A;  4YQV A;  2F8A A;  2DC5 A;  4LLR A;  5ECR B;  3WT2 A;  3IK9 A;  2GQM A;  3DML A;  3UAR A;  1EGO A;  4I2U A;  2J23 A;  2L6D A;  3MIX A;  4MPG A;  4ML1 A;  1G7O A;  2JAD A;  5GAP D;  1ST9 A;  2CAI A;  3ZZX A;  3P7X A;  4TR1 A;  4TXO B;  2PGT A;  3J7Y b;  2FLS A;  3FR9 A;  5ELG A;  2ZNM A;  2GST A;  1Q98 A;  2JZS A;  1QUW A;  2BTO T;  4PQ1 A;  1GWC A;  2IME A;  3D4M A;  3LG6 A;  2X8C A;  4IP6 A;  2MBS A;  2LQO A;  3F4S A;  1JZW A;  4XHM A;  2YWO A;  3P2A A;  3QFA C;  4X43 A;  3WGD A;  5IO2 A;  2GQL A;  4JRR A;  2CVB A;  1VF3 A;  4N10 A;  2IWT A;  3BCI A;  4E8E A;  5CP1 A;  1PN0 A;  3L0H A;  5HFK A;  3GL3 A;  3EVI A;  3UVH A;  2A2S A;  3KD0 A;  1GSS A;  3IBH A;  2VCT A;  4PUR A;  1O85 A;  3DD3 A;  1DBY A;  2H0I A;  3DEX A;  4PQI A;  3KTL A;  2C3N A;  4BL7 A;  2HRA A;  3WYW A;  1JZR A;  2XHF A;  5GZZ B;  1SU9 A;  5LD0 A;  4F0B A;  4HQZ A;  1FO5 A;  3KMO A;  1TXX A;  2LEG A;  2QC7 A;  1XWG A;  4ISD A;  4NHW A;  2O8V B;  3TJK A;  4NHZ A;  3HVV A;  1YY7 A;  3A5I A;  3W8J A;  4O32 A;  3LSZ A;  2HFD A;  4HI7 A;  5IMZ A;  2HT9 A;  2KOK A;  2QKE A;  4JU5 A;  4OCE A;  1THX A;  5D96 A;  4HJ2 A;  2CVD A;  2IFQ A;  4K1F A;  2R4V A;  4MDC A;  1PKW A;  1M7T A;  3HHV A;  1PX7 A;  2DIY A;  2GQK A;  2FY6 A;  2HRF A;  1OE7 A;  3I6A A;  1U3A A;  2GZP A;  4O7H A;  3RPP A;  1SK0 A;  3ZVJ D;  3LGC A;  1SKS B;  2HSM A;  2YCD A;  4OWY A;  1EZK A;  4KB3 A;  5ID2 B;  4DSS A;  1F37 A;  1S3C A;  3FEU A;  1NHO A;  3ZLP A;  1V58 A;  5CRE A;  5EL8 A;  1EWX A;  1GSF A;  1N8J A;  4IQA A;  2PVO C;  4EF0 A;  3GRX A;  3FZA A;  1GSE A;  4J2F A;  5DCH A;  2LJR A;  3UEM A;  3WD6 A;  4POB A;  7GSS A;  3UAP A;  4Z2T A;  5KOX A;  3TRP A;  1VGL A;  1K0O A;  1OKD A;  1TK5 B;  4MH2 A;  3F3R A;  1R7H A;  1O73 A;  5EVO A;  2DJK A;  2VLV A;  2HYX A;  1TK0 B;  5DQS A;  3MNG A;  4F82 A;  1THO A;  4TN8 A;  4HU7 A;  2E7P A;  2A4V A;  3ZMK A;  5CRW A;  4GTU A;  1M99 A;  1WWJ A;  4J57 E;  4IW9 A;  1SD8 A;  5BRT A;  1PRX A;  3KIJ A;  2VIM A;  12GS A;  5IPG A;  4MA9 A;  1PQN A;  2VCZ A;  4I5Q A;  3F8U A;  4F0C A;  3RPN A;  4KF9 A;  4KUN A;  4JR4 A;  3TKR A;  3EYT A;  2H66 A;  2H6Z A;  2B5E A;  5G5E A;  3M9J A;  3HVS A;  4EVM A;  2JSZ A;  2R6K A;  4CY8 A;  3LW9 A;  1R5P A;  3FZ9 A;  5G2Z A;  2VL9 A;  1IYI A;  2WJU A;  1TOF A;  4V2L A;  1T00 A;  1JLW A;  4TW5 A;  2N5B A;  2FCH A;  5J9C A;  2LV3 A;  3FR6 A;  4XS1 A;  1AXD A;  3EU3 A;  3A2W A;  4K5S A;  1WRY A;  3GST A;  4MZW A;  4GQF A;  1K0A A;  1O8X A;  2DIZ A;  3G7I A;  5KN2 A;  4MJC A;  3ZRD A;  5IOX A;  2KUC A;  5DVB A;  2HZE A;  4WKW A;  1ZYN A;  4IN0 A;  3TKS C;  4NPB A;  4F9Z A;  3CXG A;  1G0T A;  2ZCT A;  5HR0 A;  3ZIT A;  4CHS A;  3L9U A;  2R37 A;  1Z6N A;  5KEJ A;  2GT5 A;  2YP6 A;  4KSO A;  3KCM A;  2B7K A;  1XVQ A;  4K7N A;  4ZXG A;  4D73 B;  1X0R A;  3F4R A;  3JCM L;  1PX6 A;  4MF5 A;  1FOH A;  3QD9 A;  2K18 A;  5CYY A;  2KLX A;  3TJF A;  4HUA A;  4OO5 A;  1F3B A;  5CRD A;  4BWQ A;  2RLI A;  4KCE A;  13GS A;  2IJY A;  4HOJ A;  2P5Q A;  4ZBD A;  1SKR B;  3IK7 A;  4KX4 A;  3F6D A;  3CSJ A;  1BX9 A;  3TUE A;  3FY7 A;  4O5U A;  1UN2 A;  4NXI A;  2VOC A;  1Z5Y E;  1T4Z A;  2VCW A;  2XPD A;  2Z9S A;  1TKD B;  5F06 A;  5HR2 A;  3QAG A;  4G2E A;  3U6V A;  1SJ6 A;  2L6C A;  5A4U A;  2I1U A;  1YZX A;  1EP8 A;  3FR3 A;  1Z7R A;  2NTO A;  5LCZ A;  4XRA A;  1V2A A;  1JLV A;  5G31 A;  1XZO A;  4KND A;  2WCI A;  3G7Y A;  4TXO A;  1OC9 A;  2A4H A;  4YAV A;  3UBK A;  2O85 A;  4G0K A;  3QDN A;  4K7O A;  1R5A A;  3HDC A;  2CT6 A;  3DRN A;  3KJY A;  2GSS A;  1FG4 A;  1TI1 A;  2L59 A;  1M2B A;  1K3O A;  4K9Z A;  3F63 A;  3GKX A;  1JFU A;  1KNG A;  1A0F A;  2OE0 A;  1XOA A;  4BWS A;  1GUM A;  3UIW A;  2IMF A;  1JHB A;  4ZB8 A;  3F3Q A;  4ULX A;  3D5J A;  1LU4 A;  4I97 A;  2F3M A;  1HQO A;  1FVK A;  3D6I A;  1ABA A;  3P8W A;  17GS A;  1GTU A;  4BVX B;  2DBC A;  3EUR A;  1AW9 A;  3GIX A;  5HFI A;  5AIX A;  4V2M A;  4EUY A;  2VM2 A;  1WMJ A;  4JE1 A;  3TJJ A;  2VCQ A;  4HJM A;  1UVZ A;  2X8G A;  1A8Y A;  3F4T A;  4AGS A;  4LMV A;  1AQX A;  4IGJ A;  2FWG A;  5IMC A;  1GRX A;  4POL A;  5INY A;  1JZO A;  1XBS A;  2GZZ A;  2IIY A;  2M72 A;  1KTE A;  4L0U A;  3PR8 A;  3N9J A;  2VCV A;  4QL9 A;  2B3S A;  4MAB A;  4K8M A;  3KP8 A;  2R5G A;  4Q5N A;  1XW9 A;  4KGI A;  1T7P B;  1TRS A;  1TDI A;  3QR6 A;  2LTK A;  2HE3 A;  3ISO A;  3LXZ A;  3HJO A;  2YWM A;  2GGT A;  4TR0 A;  4V1A g;  2RUF A;  3EC3 A;  2YAN A;  4HZ4 A;  4HS1 A;  3VWU A;  1OKT A;  3ED3 A;  4MF6 A;  3IXR A;  2JL4 A;  3WGX A;  1UC7 A;  4XTS A;  3SWL A;  4AF2 A;  5C04 A;  4RQX A;  2CX4 A;  1GLP A;  5D93 A;  2C4J A;  2VD0 A;  1TU8 A;  2YJ7 A;  4IS0 A;  4ECJ A;  5ID2 A;  3M3M A;  5G30 A;  1VF2 A;  2V41 A;  4MMM A;  4IP1 A;  3C1S A;  3F9U A;  3ZYW A;  4O5R A;  4AJ8 A;  4MH3 A;  2VM1 A;  1BQ7 A;  2YNX A;  4PX1 A;  5COH A;  1ZCP A;  2V2G A;  5DQY A;  2C80 A;  2ZUP A;  1XWK A;  4XS4 B;  2B5Y A;  3C7M A;  5HR1 A;  4FYC A;  6GSX A;  4V2N A;  5F0G A;  3GTU B;  4GSN A;  2X4A A;  3VUR A;  1MDI A;  2OBI A;  1BAY A;  4BVY B;  1B4P A;  1ZYP A;  5A5K A;  2B1L A;  10GS A;  1A2L A;  3GH9 A;  3EMP A;  1B9X C;  3IC8 A;  4X4J A;  3DKS A;  5FWG A;  1URM A;  2FWF A;  4OFN A;  1MD4 A;  5D8I A;  5F07 A;  1F6M C;  19GS A;  2O7K A;  4IEL A;  1XW5 A;  3IPZ A;  1N2A A;  2H1G A;  3FYG A;  3QAV A;  2YZU A;  3FK8 A;  2VUP A;  2X99 A;  2H72 A;  1MDK A;  2I81 A;  5GSS A;  2H76 A;  4ZIJ A;  4ID0 A;  1GL8 A;  1USB A;  4X1U A;  2AHE A;  4Q5R A;  3E9J B;  2VD1 A;  4OCF A;  2V6O A;  3R2Q A;  3VLN A;  2PPT A;  3Q74 A;  2M46 A;  3FRC A;  1K0M A;  4FQU A;  4ILF A;  5G1L A;  3ZFB A;  3BBY A;  3H4K A;  4LMW A;  3TB2 A;  1GP1 A;  1ILO A;  2ON7 A;  3W6G A;  2GT6 A;  4Z7X A;  2OJL A;  2HRN A;  16GS A;  1AQV A;  1T4Y A;  3H93 A;  1QMV A;  2GZY A;  1K0B A;  4P3Y B;  5IMD A;  1TRU A;  5DBQ A;  2FUG 2;  1SKW B;  4GXZ A;  3ZVJ A;  1M2A A;  2X64 A;  5D9W A;  1HD2 A;  3C73 A;  4PQH A;  4YKG A;  5F8B A;  3HZ4 A;  2GSQ A;  1H4O A;  4MP4 A;  4HZ2 A;  1HNA A;  1W4V A;  1X9S B;  2LJA A;  1J9B A;  2GS3 A;  3G9B A;  3DGQ A;  2LKU A;  3BCK A;  4D73 A;  4K0N A;  3GHA A;  3M1G A;  5D73 A;  3HY2 A;  2H6X A;  4RUV A;  1A23 A;  3F0I A;  1ZL9 A;  2BJX A;  5JWR B;  1HNB A;  1X9W B;  5GST A;  2WGR A;  2E0Q A;  4TRX A;  1C72 A;  2ES7 A;  3KH9 A;  3UBL A;  5IPH A;  5CRH A;  1Q4J A;  3RAZ A;  1T3B A;  2QSI A;  4WEY A;  3BJ5 A;  3S9F A;  1QXH A;  1GTI A;  2FWE A;  4LA1 A;  2C3Q A;  3E0U A;  1OE8 A;  2I4A A;  2NPB A;  3A5W A;  3LQ7 A;  1DE2 A;  2CAQ A;  2C0D A;  3K8N A;  2LRN A;  3O6T A;  1YDK A;  3DIE A;  4IQ1 A;  4KW6 A;  4BPY A;  1V98 A;  2F9S A;  2F51 A;  4TKY A;  1F2E A;  3PH9 A;  4MZC A;  5CO3 A;  4ZL8 A;  4XRD A;  4IHU A;  4O5Q A;  4OFT A;  1MDJ A;  4TR4 A;  3FMW A;  5ABR A;  4N0V A;  4KA0 A;  3IDV A;  2LRT A;  2EIR A;  1PL1 A;  2H1A A;  1K0C A;  1NM3 A;  3HZ8 A;  4MJE A;  4F2I A;  5KN3 A;  1B9Y C;  2H70 A;  4HQS A;  5IMV A;  3KH7 A;  2IL3 A;  5B7C A;  2GTU A;  3NOF A;  2G0F A;  2CV4 A;  5J5N A;  1WP0 A;  4AJ6 A;  5AGY A;  4ZB6 A;  2P5R A;  2RUE A;  3EU4 A;  1XCC A;  1S3D A;  3GKN A;  4FIW A;  1M9B A;  3UVT A;  3V1W A;  2AYT A;  1F9M A;  4BVX A;  5EPF A;  1MEK A;  2UZ8 A;  2VLT A;  2K8S A;  2DKI A;  2HSH A;  1Z3E A;  1AAZ A;  1WE0 A;  2H19 A;  2HLS A;  5B6N A;  5B8A A;  1WPI A;  1NSW A;  3QAW A;  4O92 A;  2WZ9 A;  2HRK A;  3VWV A;  1SL0 B;  3CRU A;  1ERW A;  1G6Y A;  5ECH B;  2PVQ A;  1QFN A;  5L71 A;  3UJ1 A;  3L9V A;  3CSI A;  4I6X A;  2IPA A;  3VWX A;  5D9V A;  3E3E A;  2XBQ A;  5ECL B;  1O8W A;  3Q6O A;  3DVX A;  5D9T A;  2XC2 A;  2R0G A;  3ERW A;  3TGZ A;  1RK4 A;  4G0I A;  4EDY A;  2HZF A;  3H1N A;  1GTA A;  1RQM A;  5KN0 A;  2LRC A;  3WT1 A;  3WGE A;  4K7I A;  1OC8 A;  1O81 A;  1XW6 A;  5J4U A;  1PN9 A;  1YEP A;  1U87 A;  2H0H A;  2A2P A;  1GH2 A;  1EGR A;  3L4N A;  1VF1 A;  2L5L A;  4FYB A;  2IN3 A;  2RM6 A;  3UMA A;  3OR5 A;  1FW1 A;  3TRQ A;  1SD9 A;  3IOS A;  4USS A;  3TOU A;  1OYJ A;  4ML6 A;  1ML6 A;  4Z2U A;  5J41 A;  2YOI A;  3MWH A;  3GUS A;  3VPQ A;  2D2Z A;  3ME8 A;  4BA7 A;  1SK1 A;  2AUV A;  2DJ1 A;  9GSS A;  2R0P A;  1B4Q A;  4EO3 A;  5CNW A;  1GUH A;  4KH7 A;  3IR4 A;  1YEX A;  3KEB A;  4XS4 A;  1CQG A;  2CX3 A;  4EKZ A;  2E2G A;  2L4C A;  2TIR A;  3GTU A;  1ZYE A;  4H86 A;  1BYE A;  3ZTL A;  4PNF A;  4BVY A;  4L0W A;  4ZL9 A;  1TJD A;  3QPM A;  3LJR A;  1GTB A;  2BMX A;  1LJR A;  2LNT A;  2EC4 A;  4KDY A;  4LL4 B;  3NZN A;  4GCI A;  2FHE A;  2NBS A;  1A2M A;  1GSQ A;  4NAX A;  2MMA A;  2VCX A;  3IAM 2;  1MTC A;  4ECI A;  3BOA A;  3KP9 A;  4WBR D;  3ZFL A;  1F3A A;  3GFK A;  1XOB A;  2MBT A;  4RI6 A;  1PL2 A;  1XXU A;  4IKH A;  2DMM A;  4K0G A;  3TKS A;  5DAK B;  3LXT A;  1W89 A;  3ME7 A;  5B6M A;  3A2X A;  2GVP A;  3DXB A;  4WBJ A;  1X5D A;  1XFL A;  1A2J A;  1CQH A;  3I69 A;  4TOP A;  2H71 A;  2H74 A;  3IRA A;  4MNN A;  1M9A A;  4ZBB A;  3AY8 A;  2VAF A;  1GNE A;  3LFL A;  1GLQ A;  2DLX A;  3ERG A;  4Z2R A;  4AJ7 A;  1B48 A;  1OAZ A;  3UOM A;  2JZR A;  2JAC A;  1T8E B;  2C8U A;  4J56 E;  1A0R P;  4K5R A;  2FWH A;  4MZB A;  1SK2 A;  1I5G A;  4N30 A;  3EE2 A;  1HYU A;  2PUK C;  4LL1 B;  2K6V A;  1PGT A;  4HDE A;  4PTS A;  4EE0 A;  1Y25 A;  4KDX A;  4WR4 A;  4GF0 A;  1AUC A;  1A24 A;  2O87 A;  3L78 A;  4N0Z A;  1KBN A;  2I9H A;  3GKM A;  1ERV A;  3QCP A;  1I9D A;  3GN3 A;  3UL3 A;  5JWO B;  3ZML A;  4OMV A;  4EDZ A;  5ECK B;  4G0L A;  2YPM A;  1AQW A;  1K3Y A;  2PBJ A;  3FZ4 A;  1NW2 A;  1NHY A;  1E6B A;  2VO4 A;  1SL1 B;  3RDW A;  3CTG A;  1ZMA A;  4MCU A;  3C8E A;  1Y6E A;  2NDO A;  1YF0 A;  2E2M A;  5DAL B;  4CW9 A;  1U6T A;  5ECI B;  1YKA A;  2GSR A;  1QGV A;  2I3Y A;  3HA9 A;  1GSY A;  20GS A;  4A5P A;  1Z6M A;  1K0N A;  3EWL A;  3GMF A;  2H75 A;  8GSS A;  2OE1 A;  3RHB A;  1V9W A;  4QQ7 A;  4EIQ A;  1WJK A;  3LYP A;  1M2D A;  2CVK A;  4CDO A;  2R3X A;  3RBT A;  4GQC A;  2X49 A;  1Z9H A;  1LBK A;  4RI7 A;  5IO0 A;  1OVN A;  2IMD A;  1TU7 A;  2YWI A;  4YAP A;  4PGT A;  1QK8 A;  4XS6 A;  3D4T A;  5ECO B;  1X9M B;  6GSU A;  2FGX A;  2MZC A;  3DVW A;  4WF5 A;  3IA1 A;  4TR3 A;  4YKF A;  2CZ2 A;  1EEJ A;  4GSS A;  1OC9 B;  1QQ2 A;  4ZIL A;  3VK9 A;  2HSY A;  6GSS A;  2WDU A;  3KZQ A;  4GLT A;  2C1Y A;  3HKR A;  2YV9 A;  1EOG A;  1U88 A;  4L5O A;  3A3T A;  3CSH A;  2CA8 A;  2AB6 A;  2AV4 A;  4XCS A;  3TOT A;  3KM6 A;  2CZ3 A;  4NMU A;  3GKK A;  3IC4 A;  3GV1 A;  2F8F A;  1ERT A;  1TRV A;  2VL2 C;  1VRS D;  1BG5 A;  3FHK A;  4KCA A;  5C00 A;  5E59 A;  4DSQ A;  18GS A;  2DJ0 A;  1PMT A;  5JWQ B;  2JSY A;  5H5S A;  1RW1 A;  4EL1 A;  4OFM A;  2MMO A;  1ZOF A;  4POM A;  2C0E A;  4ECC A;  3FZ5 A;  4F03 A;  1FAA A;  2OE3 A;  1HNC A;  2FA8 A;  2XPE A;  5DJL A;  2WRT A;  5ECS A;  3D22 A;  1EEM A;  14GS A;  1OC3 A;  4IJI A;  4HEA 2;  3MDK A;  4DVC A;  3LOR A;  4KAE A;  2EIO A;  2YV7 A;  2LQQ A;  3VPT A;  2KP1 A;  1TP9 A;  5H5Q A;  3ZIJ A;  3HXS A;  1DSB A;  2KP2 A;  5GAN D;  3GYK A;  1GSD A;  4E8H A;  1TW9 A;  4TXV A;  1GSU A;  3M0F A;  2LNS A;  1SJI A;  3M9K A;  2YZH A;  2LUS A;  1SYX A;  1H75 A;  1ON4 A;  2V6K A;  2N5F A;  5J9B A;  3EMX A;  4G9H A;  4WET A;  1K3L A;  3U5R E;  2OAD A;  3APQ A;  4MJA A;  4NWY A;  1TRW A;  2TRC P;  3GUR A;  4WR5 A;  4RQR A;  4Q5F A;  22GS A;  2PN8 A;  2LS5 A;  1V40 A;  1XWB A;  2H01 A;  1PA3 A;  2IMK A;  3IE3 A;  3ZIV A;  2PMT A;  3VI7 A;  1ERU A;  2RII A;  4FYU A;  2OKA A;  1ZZY A;  4HU9 A;  3QFB C;  3QMX A;  3Q18 A;  2MMN A;  3HVX A;  3TRX A;  2ON5 A;  3LYK A;  1X5E A;  2YWN A;  3HCZ A;  3TJG A;  3P90 A;  2VL2 A;  3CTF A;  5IM9 A;  2L5O A;  3H8Q A;  5HFG A;  3CMI A;  4KDU A;  5FHI A;  3VWW A;  1XIY A;  1B8X A;  3APO A;  3HJM A;  4I8B A;  1K0D A;  2LJK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...