1F9MA

Crystal structure of thioredoxin f from spinach chloroplast (short form)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
112
structure length
112
Chain Sequence
MEAIVGKVTEVNKDTFWPIVKAAGDKPVVLDMFTQWCGPCKAMAPKYEKLAEEYLDVIFLKLDCNQENKTLAKELGIRVVPTFKILKENSVVGEVTGAKYDKLLEAIQAARS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords THIOREDOXIN F
publication title Crystal structures of two functionally different thioredoxins in spinach chloroplasts.
pubmed doi rcsb
source organism Spinacia oleracea
total genus 30
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1f9mA00
2VCVA 2RM6A 4ZB6A 1UC7A 3ME8A 1UVZA 1B4PA 3GX0A 4K2DA 2DJJA 2KHPA 5B8AA 2VAFA 12GSA 1K3LA 4BA7A 1XW5A 2LTKA 1TRVA 1SYXA 1EGRA 1QK8A 4WR5A 4EDYA 1URMA 3UIWA 2LQOA 1VGLA 3HKRA 2OA7A 2EIRA 2L4QA 4YH2A 2C0EA 5COHA 3TJGA 4NXIA 5IOWA 2L57A 1XIYA 3QPMA 2P5RA 2DMMA 3S9FA 1AC1A 1EOGA 1ERUA 5A5KA 1PMTA 2L59A 3F3RA 3CXGA 1XOAA 1GSUA 3ZL5A 3A2VA 4MCUA 3F4TA 2AB6A 4MJCA 1AIUA 1G0TA 1RK4A 2B7KA 2WRTA 4MJBA 4J2FA 2XPEA 4OFNA 1TTZA 6GSUA 5EY6A 4TR1B 4KDYA 3IPZA 2GQLA 2F51A 2RUFA 5DCGA 1A2MA 3BBYA 2BJXA 5HR2A 3G9BA 1WPIA 2IL3A 1U3IA 8GSSA 1J08A 1G7OA 1AQXA 1UN2A 4PX1A 4J57E 2YANA 2H76A 4KCAA 2A2RA 4K7NA 4XRDA 5GSSA 1T7PB 2I3YA 1Z7RA 4JR6A 1ZYEA 2VLUA 3TJBA 4TXVA 2LSTA 1GTAA 1GLQA 1TI3A 1GUHA 3GSSA 2YZHA 2EC4A 1WP0A 1VRSD 1F37A 4ZL7A 3BD2A 1B9XC 1NHYA 4HQZA 2HSHA 1BAYA 1CQHA 4YQUA 3DWVA 2J9HA 4N0VA 1EEMA 2O89A 3VWWA 3I69A 4J56E 2FA4A 1KTEA 4I5QA 4D73B 1S3DA 1OE8A 4TN8A 3ME7A 2DSAA 4G2EA 2YWNA 1QXHA 2XC2A 3M9JA 1M7TA 5FWGA 2VD1A 2HRNA 2M46A 1F6MC 1WOUA 5CNWA 3D4MA 1CQGA 3C73A 3CRUA 1E6BA 4DSSA 1TOFA 5AGYA 3FZ9A 3LYKA 3KH9A 4GRFA 1U6TA 5IMZA 3LSZA 2JZSA 1GSEA 4RI6A 5LCZA 3F6FA 4MMMA 1MD4A 2OBKA 3LFLA 2FCHA 2C3NA 3SWLA 4O7HA 2VUPA 3A2XA 4KX4A 4KSMA 1HQOA 3TGZA 3VK9A 1KEBA 4MZWA 3O6TA 2B6MA 2XBQA 1SJ6A 3DKSA 2MBSA 4BPYA 3TKSE 3EURA 1O8WA 6GSXA 2VD0A 2LJRA 3KEBA 2OKAA 4BVYA 4HU9A 1IYHA 2E0QA 2YOIA 1DE2A 1VF3A 2FWHA 1T00A 1T1VA 3VURA 2NPBA 4BL7A 4TW5A 3TB2A 3VI5A 2A2SA 4LMWA 1XOBA 2IWTA 2K8VA 4LL1B 2N5BA 1B4QA 4MDCA 1VF1A 1QUWA 1ILOA 1EV4A 2DIYA 3FW2A 1X5EA 1I9DA 4I2UA 5ABRA 1LJRA 2GT6A 2YV7A 5HR0A 1GNEA 1SK1A 1TK5B 5ECMB 3F3QA 4IN0A 2VCTA 2A4VA 2YPMA 5DDLA 18GSA 2NVLA 2GZZA 1PD21 4IP6A 5KN1A 1GSFA 1V9WA 4HEA2 2L6DA 2O7KA 3GKMA 3KTLA 4MPGA 4TR0A 5ECIB 3WYWA 6GSSA 3VI7A 3ED3A 3F63A 9GSSA 3FHKA 1F3BA 1WMJA 2JADA 5A4WA 1GSYA 1EV9A 4AJ8A 1A0RP 4KB3A 2TIRA 1VF2A 4TRXA 5IMAA 4CDOA 4DSQA 3KH7A 3BOAA 2G2QA 2JZTA 3F8UA 4HU7A 2HSYA 1MEKA 3HJPA 2OJLA 2IMEA 2ZCTA 1YZXA 4YAVA 3HY2A 3HVSA 3FR6A 2H75A 5ELGA 3C7MA 5IPGA 4E8EA 4KE3A 2GDRA 3G7YA 4KAEA 2H30A 2X99A 1C72A 2C0DA 5J9BA 1SKWB 4TR1A 4OFTA 5ENUA 2DJ3A 5DQSA 2VCZA 3LEFA 3APSA 3VFIA 1GH2A 1U87A 5DALB 5DAKB 2YWMA 4OO4A 3MDKA 3QAVA 3A2WA 5H5RA 3TKSA 4WBJA 1H75A 2NBSA 1O85A 4XRAA 3FR3A 3TJFA 3LORA 1DSBA 2VCWA 2CVBA 1YDKA 3KMOA 5J41A 2B7JA 4ECCA 1M0UA 2GVPA 4DEJA 1HYUA 3DVWA 1EZKA 2I81A 7GSSA 4HOJA 3ZLPA 5J9CA 1YEPA 4OWYA 1GNWA 5HFIA 2HZEB 4IJ3A 3IR4A 1FB0A 2L5OA 1E2YA 3F9UA 2X64A 2VOCA 2LRNA 2H01A 2ES7A 2GSQA 3ZFLA 2H71A 3MAKA 3E9JB 5H5SA 4QL7A 3VWVA 5CP1A 3O3TA 2YJ7A 4TKYA 1SKSB 3DIEA 1W89A 1TK8B 1ABAA 4JZQA 4K0GA 4D73A 2Z9SA 1GTBA 4NV2A 1PL1A 2NDOA 1OAZA 5DCHA 1QQ2A 2IJYA 4X43A 1AQWA 3P2AA 3WT2A 4ZILA 3HCZA 1F9MA 4PGTA 2MMOA 2I4AA 1I5GA 5DQYA 5D9WA 3ISOA 5CO3A 3U5RE 3H1NA 3J7Yk 1O73A 1PX7A 1DUGA 3G7IA 1FW1A 5DVBA 4PURA 2LUSA 1YKCA 4NWYA 2GT5A 3FEUA 2RM5A 2V41A 4MH3A 3GRXA 4EDZA 1ZMAA 3KM6A 3ZMKA 2PWJA 4I97A 4V1Ap 3DGQA 2F3MA 3FZ4A 1YF0A 3RAZA 3BJ5A 5FT3A 3GN3A 4I8BA 2AUVA 2WJUA 2FD3A 1TDIA 2DC5A 20GSA 3NOFA 3Q74A 4O32A 1K0BA 2RLIA 3RBTA 3TDGA 5HQPA 3EE2A 2H1GA 4LLRA 2XPDA 2FLSA 3WT1A 2H73A 2YNXA 5IOXA 4TXOB 1USBA 5C00A 5IIZA 4MK3A 3E0UA 1ERVA 4DSRA 3CSIA 3MNGA 4GSTA 5EL8A 2JSYA 5AN1A 1V57A 2PU9C 1X9SB 1GSQA 4HJ2A 1TU7A 1MD3A 2KOKA 3EU4A 1KBNA 4YQMA 3PR8A 4EF0A 1TW9A 3IK7A 1EWXA 2GS3A 1PX6A 4KUNA 17GSA 4Q5QA 2MZCA 2IMFA 2QC7A 1M2AA 3F4RA 3J7Yb 1PA3A 3LXTA 2H1AA 3TKQA 4L0WA 4EC0A 4MF7A 2C3QA 1EEJA 2O87A 2GSRA 2O8VB 3HYPA 1TI1A 1R5PA 5D9TA 1GSDA 3QAGA 2AV4A 3C8EA 2GLRA 1Y6EA 3H93A 2DJKA 3A3TA 1SENA 2VCXA 1W4VA 4EE0A 5DJMA 2IMIA 5IMCA 5JCUA 5LD0A 1JZRA 1EP8A 2K6VA 3VWXA 4RQRA 4IW9A 4EUYA 1Z6MA 6GSYA 2PBJA 1TU8A 3GSTA 5DALA 5DAKA 5D8IA 2EIOA 3VPTA 4MJAA 3GHAA 1BYEA 4HQSA 2PVQA 4WF5A 5B6NA 5H5QA 3WGDA 4ML6A 2CAQA 1ERTA 3HD5A 4Q5FA 4O92A 1NHOA 1XWAA 3ZREA 3APOA 1NSWA 2WZ9A 2HZEA 3KXOA 2WFCA 4GQFA 3P90A 1T8EB 4K9ZA 5CYYA 3PGTA 4MP4A 2LNSA 2X8CA 4OFMA 4PNFA 5L71A 4K7IA 3QCPA 3HJOA 4ZIJA 1EGOA 5B7CA 5G1KA 3FKFA 1R7HA 1XFLA 4KW6A 3C1RA 1ZYQB 2R4VA 5ELAA 1JFUA 4L0UA 4MJEA 2L5LA 1YQ1A 3LXZA 4DVCA 1SD9A 2H74A 4IKHA 2KUCA 1K0MA 1YJ6A 5F8BA 2YCDA 2CZ2A 2VL3A 4V2LA 3FY7A 3HHVA 2LV3A 4POLA 3FYGA 1F3AA 5KN3A 4GSNA 1GSSA 3EWLA 4ZL9A 2MMAA 4IGJA 2GTUA 2DJ0A 4N0ZA 1TRWA 2FUG2 1TXXA 2F8FA 4OMVA 2K9FA 4LMVA 2C0FA 3HZ4A 1TJDA 2H0GA 2IFQB 2L4CA 3KD0A 4ILFA 5CRGA 1PN9A 1RW1A 5ECQB 3GKKA 4FYCA 1HNBA 1ZCPA 2C0GA 5G30A 3NIVA 3QMXA 1S3AA 1B48A 5D73A 1GP1A 3EMXA 3K8NA 4KA0A 4PUAA 1QGVA 1X9WB 3VPQA 5E4WA 3GL3A 1V40A 3C71A 3GV1A 3F6DA 3P7XA 1OE7A 2VO4A 3L0HA 1Z7PA 3WGEA 3RPNA 3CMIA 1AUCA 4TXOA 1XXUA 6GSVA 4XS1A 4EKZA 1XWGA 1ST9A 2XBIA 5CREA 2H6ZA 1JZDA 1O6JA 4IP1A 3UL3A 2OADA 2P5QA 3TKSC 3FK8A 1SD8A 1XVWA 2YJHA 1SK2A 3W8SA 1PL2A 1G6YA 5IMFA 1SL1B 2K8SA 4JE1A 2E2GA 3GTUB 4EXJA 3D22A 2V2GA 1A23A 2DJ1A 4V2MA 2HFDA 4KNDA 1AXDA 3LYPA 1G6WA 5ECKB 4BVXA 2EIQA 1N8JA 5ECLB 1MDIA 10GSA 1Z3EA 3D0ZA 1R5AA 1ZGNA 4POKA 4ZL8A 2J23A 2CAIA 2TRXA 1M99A 2PUKC 1GLPA 5C04A 3GKXA 3JCML 2ON7A 3GYKA 4X1UA 2I1UA 2I9HA 1WE0A 3EC3A 3UBKA 2LJAA 1S3CA 2MMNA 4KDXA 4GWRA 2ZUPA 2OE3A 4NV5A 5F07A 2H8LA 2VL2A 3EYTA 1PGTA 4JU5A 3I6AA 2F8AA 2VIMA 6GSTA 1R26A 5E59A 3IRAA 5EPFA 2OBIA 2AAWA 1X5DA 1G7EA 1THOA 2DJ2A 3AY8A 1OYJA 2HZFA 2FA8A 5GAND 2GSSA 1XW6A 4OCFA 3KIJA 4F82A 4LL4B 5D9XA 4EL1A 4FH8A 4NHWA 2LKUA 1YF1A 11GSA 2GGTA 2MMZA 5B6MA 4XS4B 2VLVA 3ZVJD 5ECHB 2KP1A 3TKRA 1X5CA 3H79A 3KJYA 1V58A 3D5JA 2QSIA 1NM3A 1B9YC 1YY7A 3UMAA 2H6XA 3W6GA 3KMNA 2C8UA 2RUEA 6GSWA 2CQ9A 2HT9A 4ZBDA 2JSZA 4BWSA 3HJMA 3IAS2 3U6VA 1XVQA 4MABA 4KCEA 3CSHA 2CT6A 3IXRA 3UOMA 4KGIA 1MTCA 2AYTA 1QMVA 3L9VA 1FVKA 2H1DA 1TP9A 2PGTA 22GSA 3D6IA 4Q5RA 1OC3A 3TRXA 3LJRA 2V32A 1XWBA 1A24A 5KN2A 3TRQA 5ID2B 3GX8A 2L6CA 4WKWA 2CVDA 5IQYA 4PNGA 1PKWA 1OC9B 3ZVJA 2B5YA 3GURA 3Q19A 1XWCA 5IO2A 3CTGA 1SJZA 2LEGA 3GIXA 3FZAA 4POBA 4NHZA 1FO5A 4GLTA 3QFAC 1SKRB 2KLXA 4MH2A 3TJKA 4PUFC 1OC8A 4MLYA 5D96A 3NZNA 3G7JA 2RIIA 1YEXA 2HI7A 2DMLA 2IFQA 1O7UA 5DBQA 2JL4A 4IHUA 1FG4A 1PRXA 5A4VA 2HXKA 3LQ7A 1N2AA 2CX4A 2MYGA 2E7PA 1T3BA 3HVXA 1PKZA 2AJQB 4XCSA 3F0IA 3HDCA 2ON5A 2QKEA 2P0GA 2HRFA 2XHFA 3F4SA 5F06A 3CRTA 4N10A 1XBSA 4NPBA 4N11A 2CVKA 3M1GA 1A8LA 3GKNA 3UVHA 4AJ6A 5J5NA 3DXBA 2FWEA 4IELA 4V1Ag 1NW2A 5HFGA 1J0FA 2VCQA 3EMPA 1H4OA 3UBLA 4LA1A 2O85A 4OO5A 2GZYA 5D9VA 4KSOA 4Q5NA 4ML1A 3GTUA 2PN8A 1HNCA 5GAPD 1TK0B 4F9ZA 1AAZA 1BX9A 1ZL9A 4EVMA 3QFBC 1ON4A 4AJ7A 5AIVA 3N9JA 4G9HA 3ZYWA 1QFNA 4I6XA 1GULA 3A5WA 3LGCA 3TRPA 1WRYA 5JWQB 2WGRA 4TVEA 4WEYA 1T4ZA 1OVNA 2FNOA 4HJMA 2PPTA 2CZ3A 1ZOFA 1WWJA 4MA9A 1SL2B 5INYA 2CX3A 4P3YB 5CRWA 4ZBBA 4RUVA 14GSA 2WB9A 3TOTA 1Q4JA 4FO5A 4G19A 3TKPA 3GA4A 3GNJA 3CBUA 2GSTA 5KEJA 2N5AA 3ZMLA 1IYIA 1GUKA 1X9MB 4ID0A 3V1WA 3PH9A 3ZIJA 2MBTA 2VLTA 4FYUA 3L78A 2V1MA 5ECRB 1BJXA 3KGKA 3DD3A 1Y25A 3CYNA 5FHIA 3IK9A 4JRRA 3GL5A 4XS4A 2QGVA 5AISA 2M80A 3KTBA 5JWOB 1GTUA 3APQA 2M72A 4RQXA 5IMVA 5HR3A 4MPFA 5ECNB 3H4KA 4ZB8A 3TJJA 5IPHA 3EU3A 4FYBA 1XZOA 2H6YA 2OACA 2LRCA 2WCIA 2C4JA 4AGSA 5G5FA 3QOUA 2B1LA 4TOPA 1HNAA 4XTSA 1XCCA 5ECOB 1ZZYA 3I9V2 2HNLA 2VL9A 5EVOA 1LU4A 2H1BA 3GH6A 5HR1A 4IBPA 2YZUA 2FGXA 3E3EA 3SBCA 4H86A 1RQMA 3MWHA 4ECIA 4HS1A 4XIHA 5ID2A 3GMFA 2DIZA 2PERA 2FY6A 2YV9A 1EP7A 3ZTLA 1OC9A 3DEXA 2YP6A 1LBKA 4ECJA 4XS6A 4YQVA 2CA8A 3IC4A 5F0GA 3GFKA 4G10A 2LS5A 1FOVA 4HUAA 2R3XA 4PQHA 1SK0A 3Q6OA 1DE1A 3DVXA 2OE0A 2PVOC 2NTOA 3KZQA 1K0NA 1K3OA 2V6OA 4YAPA 5ECPB 5G1LA 4PQIA 1FB6A 3KP9A 2LQQA 5CRDA 1PQNA 3M9KA 1XW9A 1AW9A 13GSA 3KP8A 3KCMA 2LNTA 4HI7A 2B5XA 3FRCA 3BCIA 1FAAA 1JLVA 3QD9A 3UVTA 1TKDB 1MDJA 2VL2C 2IMKA 1J9BA 5IM9A 4ACSA 2B3SA 5J4UA 5G5EA 1KNGA 4CHSA 4BWQA 4F03A 4IQAA 1OKTA 3TCOA 3D4TA 3IDVA 1BG5A 2H19A 4X0XA 4ZBAA 4IJIA 1Z5YE 5CRHA 3HZ8A 4K8MA 4WXTA 3ZFBA 4FIWA 4EO3A 2WULA 4PQ1A 1BQ7A 2YN1A 1SL0B 1XPVA 1PSQA 3IAM2 1GUMA 1K0DA 4OD7A 5HFKA 4K1FA 2IIYA 3EVIA 3QAWA 2JU5A 4GQCA 3M3MA 1M9AA 1Q98A 1WJKA 4ULXA 2IPAA 3L4NA 3IBHA 3IV4A 4JBBA 3CTFA 5D93A 3GH9A 1U3AA 1Z6NA 1YKAA 2REMA 1K0AA 2LRTA 2K18A 2OE1A 3ZITA 4IVFA 4QQ7A 3LG6A 4POMA 1OKDA 2JACA 1GWCA 3P8WA 3ZIVA 16GSA 1ERWA 4WETA 1JLWA 3MSZA 1ACVA 3TUEA 3UAPA 2CV4A 2R37A 3RPPA 4MF6A 1TRUA 1WIKA 4F0BA 1GRXA 2D2ZA 2F9SA 5G2ZA 5GSTA 3DRNA 2R6KA 4KDUA 2VM1A 2IN3A 4L5LA 4E8HA 1A2LA 3CSJA 3IA1A 1JZWA 3ZZXA 5F05A 2HYXA 3C1SA 2BTOT 4L5OA 3L9UA 4Z7XA 3IE3A 1M2DA 1T4YA 3QDNA 1THXA 4NAXA 4WBRD 3IHQA 3US3A 1JHBA 3DMLA 5KN0A 4MF5A 3VWUA 1MDKA 2FHEA 4MZBA 4K7OA 2H66A 4RI7A 1R4WA 3I43A 4F0CA 4O5RA 4CW9A 4MZCA 3UEMA 2BMXA 4HZ4A 3EINA 2LJKA 3WD6A 5CAXA 4ZXGA 4QL9A 1DBYA 2IMDA 5J3RA 1SYRA 2ZNMA 1GL8A 5B8BA 2VM2A 2HE3A 3M8NA 2FWGA 4JEDA 4JR4A 3IOSA 4ZB9A 4K6XA 5A4UA 5DJLA 2ALBA 2HLSA 2R2JA 2YWIA 2WS2A 4WR4A 1A0FA 3O76A 1A8YA 1JZOA 2C1YA 3ERWA 1EOHA 4I2TA 2P31A 4HDEA 5AIXA 4IS0A 2H70A 4HZ2A 3TOUA 3OR5A 5JCWA 4WF4A 1X0RA 1O8XA 3RHCA 4OCEA 2GQMA 3R2QA 1VF4A 4PXOA 1SJIA 1K0OA 1A2JA 1O81A 2JZRA 1FVJA 1XWKA 3FR9A 2X8GA 4ECBA 4NMUA 3RHBA 2C80A 3UJ1A 1M9BA 5G31A 2AHEA 2G0FA 3W8JA 3UARA 3QR6A 4TR4A 4IQ1A 2B1KA 4XHMA 3VLNA 1B8XA 1UA5A 3N5OA 4L8EA 4DSSB 1U88A 1V98A 4GXZA 4N30A 3HXSA 1Z9HA 3Q18A 1FHEA 1K3YA 1BEDA 2FWFA 2YWOA 4KH7A 3ZRDA 3D21A 2N5FA 3ERGA 19GSA 3H8QA 1F2EA 3HVVA 3BCKA 5ECSA 2PMTA 4TR3A 2GQKA 1HD2A 2R5GA 1ML6A 5IMDA 1AQVA 1GTIA 2H72A 5JWRB 4V2NA 3L9SA 2KP2A 4AF2A 3PINA 5IO0A 2H0HA 4GTUA 3LWAA 4GF0A 3DYRA 2DLXA 2DBCA 5LNKe 2GZPA 4F2IA 1K0CA 3M0FA 2B5EA 4K0NA 4ISDA 2WDUA 4GSSA 2TRCP 4GCIA 2V6KA 2X8HA 2E2MA 3ERFA 1V2AA 1SU9A 5JCGA 3RDWA 3FZ5A 3WGXA 2C3TA 3GUSA 2H0IA 5GZZB 1TRSA 1M2BA 3HA9A
chains in the Genus database with same CATH superfamily
2VCVA 2RM6A 4ZB6A 1UC7A 3ME8A 4FQUA 1UVZA 1B4PA 3GX0A 4K2DA 2DJJA 2KHPA 2HRKA 5B8AA 2VAFA 12GSA 4A5PA 1K3LA 4BA7A 1XW5A 2LTKA 1TRVA 1SYXA 1EGRA 1QK8A 4WR5A 4EDYA 1URMA 3UIWA 2LQOA 1VGLA 3HKRA 2OA7A 2EIRA 2L4QA 4YH2A 2C0EA 5COHA 3TJGA 4NXIA 5IOWA 2L57A 1XIYA 3QPMA 2P5RA 2DMMA 3S9FA 1AC1A 1EOGA 1ERUA 5A5KA 1PMTA 2L59A 3F3RA 3CXGA 1XOAA 1GSUA 3ZL5A 3A2VA 4MCUA 3F4TA 2AB6A 4MJCA 1AIUA 1G0TA 1RK4A 2B7KA 2WRTA 4MJBA 4J2FA 2XPEA 4OFNA 1TTZA 6GSUA 5EY6A 4TR1B 4KDYA 3IPZA 2GQLA 2F51A 2RUFA 5DCGA 1PFOA 1A2MA 3BBYA 2BJXA 4ICYA 5HR2A 3G9BA 1WPIA 2IL3A 1U3IA 8GSSA 1J08A 1G7OA 1AQXA 1UN2A 4PX1A 4J57E 2YANA 2H76A 4KCAA 2A2RA 4K7NA 4XRDA 5GSSA 1T7PB 2I3YA 1Z7RA 4JR6A 1ZYEA 2VLUA 3TJBA 4TXVA 2LSTA 1GTAA 1GLQA 1TI3A 1GUHA 3GSSA 2YZHA 2EC4A 1WP0A 1VRSD 1F37A 4ZL7A 3BD2A 1B9XC 1NHYA 4HQZA 2HSHA 1BAYA 1CQHA 4YQUA 3DWVA 2J9HA 4N0VA 1EEMA 2O89A 3VWWA 3I69A 4J56E 2FA4A 1KTEA 4I5QA 4D73B 1S3DA 1OE8A 4TN8A 3ME7A 2DSAA 4G2EA 2YWNA 1QXHA 2XC2A 3M9JA 1M7TA 5FWGA 2VD1A 2HRNA 2M46A 1F6MC 1WOUA 5CNWA 3D4MA 1CQGA 3C73A 3CRUA 1E6BA 4DSSA 1TOFA 5AGYA 3FZ9A 3LYKA 3KH9A 4GRFA 1U6TA 5IMZA 3LSZA 2JZSA 1GSEA 4RI6A 5LCZA 3F6FA 4MMMA 1MD4A 2OBKA 3LFLA 2FCHA 2C3NA 3SWLA 4O7HA 1S3RA 2VUPA 3A2XA 4KX4A 4KSMA 1HQOA 3TGZA 3VK9A 1KEBA 4MZWA 3O6TA 2B6MA 2XBQA 1SJ6A 3DKSA 2MBSA 4BPYA 3TKSE 3EURA 1O8WA 6GSXA 2VD0A 2LJRA 3KEBA 2OKAA 4BVYA 4HU9A 1IYHA 2E0QA 2YOIA 1DE2A 1VF3A 2FWHA 1T00A 1T1VA 3VURA 2NPBA 4BL7A 4TW5A 3TB2A 3VI5A 2A2SA 4LMWA 1XOBA 2IWTA 2K8VA 4LL1B 2N5BA 1B4QA 4MDCA 1VF1A 1QUWA 1ILOA 1EV4A 2DIYA 3FW2A 3MYDA 1X5EA 1I9DA 4I2UA 5ABRA 1LJRA 2GT6A 2YV7A 5HR0A 1GNEA 1SK1A 1TK5B 5ECMB 3F3QA 4IN0A 2VCTA 2A4VA 2YPMA 5DDLA 18GSA 2NVLA 2GZZA 1PD21 4IP6A 5KN1A 1GSFA 1V9WA 4HEA2 2L6DA 2O7KA 3GKMA 3KTLA 2DKIA 2R0GA 4MPGA 4TR0A 5ECIB 3WYWA 6GSSA 3VI7A 3ED3A 3F63A 9GSSA 3FHKA 1F3BA 1WMJA 2JADA 5A4WA 1GSYA 1EV9A 4Z2UA 4AJ8A 1A0RP 4KB3A 2TIRA 1VF2A 4TRXA 5IMAA 4CDOA 4DSQA 3KH7A 3BOAA 2G2QA 2JZTA 3F8UA 4HU7A 2HSYA 1MEKA 3HJPA 2OJLA 2IMEA 2ZCTA 1YZXA 3HVSA 3HY2A 4YAVA 3FR6A 2H75A 5ELGA 3C7MA 5IPGA 4E8EA 4KE3A 2GDRA 3G7YA 4KAEA 2H30A 3LW9A 2X99A 1C72A 4Z2TA 2C0DA 5J9BA 1SKWB 4TR1A 4OFTA 5ENUA 2DJ3A 5DQSA 2VCZA 3LEFA 3APSA 3VFIA 1GH2A 1U87A 5DALB 5DAKB 2YWMA 4OO4A 3MDKA 3QAVA 3A2WA 5H5RA 3TKSA 4WBJA 1H75A 2NBSA 1O85A 4XRAA 3FR3A 3TJFA 3LORA 1DSBA 2VCWA 2CVBA 1YDKA 3KMOA 5J41A 2B7JA 4ECCA 1M0UA 2GVPA 4DEJA 1HYUA 3DVWA 1EZKA 2I81A 7GSSA 4HOJA 3ZLPA 5J9CA 1YEPA 4OWYA 1GNWA 5HFIA 2HZEB 4IJ3A 3IR4A 1FB0A 2L5OA 1E2YA 3F9UA 2X64A 2VOCA 2LRNA 2H01A 4PTSA 2ES7A 2GSQA 3ZFLA 2H71A 3MAKA 3E9JB 4KF9A 5H5SA 4QL7A 3VWVA 5CP1A 3O3TA 2YJ7A 4TKYA 1SKSB 2QA2A 2HSMA 3DIEA 3FMWA 1W89A 1TK8B 1ABAA 2R0PA 4JZQA 4K0GA 4D73A 2Z9SA 1GTBA 4NV2A 1PL1A 2NDOA 1OAZA 5DCHA 1QQ2A 2IJYA 4X43A 1AQWA 3P2AA 3WT2A 4ZILA 3HCZA 1F9MA 4PGTA 2MMOA 2I4AA 1I5GA 5DQYA 5D9WA 3ISOA 5CO3A 3U5RE 3H1NA 3J7Yk 1O73A 1PX7A 1DUGA 3G7IA 1FW1A 5DVBA 4PURA 2LUSA 1YKCA 4NWYA 2GT5A 3FEUA 2RM5A 2V41A 4MH3A 3GRXA 4EDZA 1ZMAA 3KM6A 3ZMKA 2PWJA 4I97A 4V1Ap 3DGQA 2F3MA 3FZ4A 1YF0A 3RAZA 3BJ5A 5FT3A 3GN3A 4I8BA 2AUVA 3PPUA 2WJUA 2FD3A 1TDIA 2DC5A 20GSA 3NOFA 3Q74A 4O32A 1K0BA 2RLIA 1M3JA 3RBTA 3TDGA 5HQPA 3EE2A 2H1GA 4LLRA 2XPDA 2FLSA 3WT1A 2H73A 2YNXA 5IOXA 4TXOB 1USBA 5C00A 5IIZA 4MK3A 3E0UA 1ERVA 4DSRA 3CSIA 3MNGA 4GSTA 5EL8A 2JSYA 5AN1A 1V57A 2PU9C 1X9SB 1GSQA 4HJ2A 1TU7A 1MD3A 2KOKA 3EU4A 1KBNA 4YQMA 3PR8A 4EF0A 1TW9A 3IK7A 1EWXA 2GS3A 1PX6A 4KUNA 17GSA 4Q5QA 2MZCA 2IMFA 1ZYPA 2QC7A 1M2AA 3F4RA 3J7Yb 1PA3A 4BVXB 3LXTA 2H1AA 3TKQA 4L0WA 4EC0A 4MF7A 2C3QA 1EEJA 2O87A 3IC8A 2GSRA 2O8VB 3HYPA 1TI1A 1R5PA 5D9TA 1GSDA 3QAGA 2AV4A 3C8EA 2GLRA 1Y6EA 3H93A 2DJKA 3A3TA 1SENA 2VCXA 1W4VA 4EE0A 5DJMA 2IMIA 4O5QA 5IMCA 5JCUA 5LD0A 1JZRA 1EP8A 2K6VA 3VWXA 4RQRA 4IW9A 4EUYA 1Z6MA 6GSYA 2PBJA 1TU8A 3GSTA 5DALA 5DAKA 5D8IA 2EIOA 3VPTA 4MJAA 3GHAA 1BYEA 4HQSA 2PVQA 4WF5A 5B6NA 5H5QA 3WGDA 4ML6A 2CAQA 1ERTA 3HD5A 4Q5FA 4O92A 1NHOA 1XWAA 3ZREA 3APOA 1NSWA 2WZ9A 2HZEA 3KXOA 2WFCA 4GQFA 3P90A 1T8EB 4K9ZA 5CYYA 3PGTA 4MP4A 2LNSA 2X8CA 4OFMA 4PNFA 5L71A 4K7IA 2X49A 3QCPA 3HJOA 4ZIJA 1EGOA 5B7CA 3IHGA 5G1KA 3FKFA 1R7HA 1XFLA 4KW6A 3C1RA 1ZYQB 2R4VA 5ELAA 1JFUA 4L0UA 4MJEA 2L5LA 1YQ1A 3LXZA 4DVCA 1SD9A 5BRTA 2H74A 4IKHA 2KUCA 1K0MA 1YJ6A 5F8BA 2YCDA 2CZ2A 2VL3A 4V2LA 3FY7A 3HHVA 2LV3A 4POLA 3FYGA 1F3AA 5KN3A 4GSNA 4BIKA 1GSSA 3EWLA 4ZL9A 2MMAA 4IGJA 2GTUA 2DJ0A 4N0ZA 1TRWA 2FUG2 1TXXA 2F8FA 4OMVA 2K9FA 4LMVA 2C0FA 3HZ4A 4YKFA 1TJDA 2H0GA 2IFQB 2L4CA 3KD0A 4ILFA 5CRGA 1PN9A 1RW1A 5ECQB 3GKKA 4FYCA 1HNBA 1ZCPA 2C0GA 5G30A 3NIVA 3QMXA 1S3AA 1B48A 5D73A 1GP1A 3EMXA 4PUAA 3K8NA 4KA0A 1QGVA 1X9WB 3VPQA 5E4WA 3GL3A 1V40A 3C71A 3GV1A 3F6DA 3P7XA 1OE7A 2VO4A 3L0HA 1Z7PA 3WGEA 4EIQA 3RPNA 3CMIA 1AUCA 4TXOA 1XXUA 6GSVA 4XS1A 4EKZA 1XWGA 1ST9A 2XBIA 5CREA 2H6ZA 1JZDA 1O6JA 4IP1A 3UL3A 2OADA 2P5QA 3TKSC 3FK8A 1SD8A 1XVWA 2YJHA 1SK2A 3W8SA 1PL2A 1G6YA 5IMFA 3CQFA 1SL1B 2K8SA 4JE1A 2E2GA 3GTUB 4EXJA 3D22A 2V2GA 1A23A 2DJ1A 4V2MA 2A2PA 2HFDA 4KNDA 1AXDA 3LYPA 1G6WA 5ECKB 4BVXA 2EIQA 1N8JA 5ECLB 4EIPA 1MDIA 10GSA 1Z3EA 3D0ZA 1R5AA 1ZGNA 4POKA 4ZL8A 2J23A 2CAIA 2TRXA 1M99A 2PUKC 1GLPA 5C04A 3GKXA 3JCML 2ON7A 3GYKA 4X1UA 2I1UA 2I9HA 1WE0A 3EC3A 3UBKA 2LJAA 1S3CA 2MMNA 4KDXA 4GWRA 2ZUPA 2OE3A 4NV5A 5F07A 2H8LA 2VL2A 3EYTA 1PGTA 4JU5A 3I6AA 2F8AA 2VIMA 6GSTA 1R26A 5E59A 3IRAA 5EPFA 2OBIA 2AAWA 1X5DA 1G7EA 1THOA 2DJ2A 3AY8A 1OYJA 2HZFA 2FA8A 5GAND 2GSSA 1XW6A 4OCFA 2A4HA 3KIJA 4F82A 4LL4B 5D9XA 4EL1A 4FH8A 4NHWA 2LKUA 1YF1A 11GSA 2GGTA 2MMZA 5B6MA 4XS4B 2VLVA 3ZVJD 5ECHB 2KP1A 3TKRA 1X5CA 4K5RA 3H79A 3KJYA 1V58A 3D5JA 2QSIA 1NM3A 1B9YC 1YY7A 3UMAA 2H6XA 3W6GA 3KMNA 2C8UA 2RUEA 6GSWA 2CQ9A 2HT9A 4ZBDA 2JSZA 4BWSA 3HJMA 3IAS2 3U6VA 1XVQA 4MABA 4KCEA 3CSHA 2CT6A 3IXRA 3UOMA 4KGIA 1MTCA 2AYTA 1QMVA 3L9VA 1FVKA 2H1DA 1TP9A 2PGTA 22GSA 3D6IA 4Q5RA 1OC3A 3TRXA 3LJRA 4Z2RA 2V32A 1XWBA 1A24A 5KN2A 3TRQA 5ID2B 3GX8A 2L6CA 4WKWA 2CVDA 4YKGA 5IQYA 4PNGA 1PKWA 1OC9B 3ZVJA 2B5YA 3GURA 3Q19A 1XWCA 5IO2A 3CTGA 1SJZA 2LEGA 3GIXA 3FZAA 4POBA 4NHZA 1FO5A 4MNNA 4GLTA 3QFAC 1SKRB 2KLXA 2X4AA 4MH2A 3TJKA 4PUFC 1OC8A 4MLYA 5D96A 3NZNA 3G7JA 2RIIA 1YEXA 2HI7A 2DMLA 2IFQA 1O7UA 5DBQA 2JL4A 4X4JA 4IHUA 1FG4A 1PRXA 5A4VA 2HXKA 3LQ7A 1N2AA 2CX4A 2MYGA 2E7PA 1T3BA 3HVXA 1PKZA 2AJQB 4XCSA 3F0IA 3HDCA 2ON5A 2QKEA 2P0GA 2HRFA 2XHFA 3F4SA 5F06A 3CRTA 4N10A 1XBSA 4NPBA 4N11A 2CVKA 3M1GA 1A8LA 3GKNA 3UVHA 4AJ6A 5J5NA 3DXBA 2FWEA 4IELA 4V1Ag 1NW2A 5HFGA 1J0FA 2VCQA 3EMPA 1H4OA 3UBLA 4LA1A 2O85A 4OO5A 2GZYA 5D9VA 4KSOA 4Q5NA 4ML1A 3GTUA 2PN8A 1HNCA 5GAPD 1TK0B 4F9ZA 1AAZA 1BX9A 4CY6A 1ZL9A 4EVMA 3QFBC 1ON4A 4AJ7A 5AIVA 3N9JA 4G9HA 3ZYWA 1QFNA 4I6XA 1GULA 3A5WA 3LGCA 3TRPA 1WRYA 5JWQB 2WGRA 4TVEA 4WEYA 1T4ZA 1OVNA 2FNOA 4HJMA 2PPTA 2CZ3A 1ZOFA 4HSCX 1WWJA 4MA9A 1SL2B 5INYA 2CX3A 4P3YB 5CRWA 4ZBBA 4RUVA 14GSA 2WB9A 3TOTA 1Q4JA 4FO5A 4G19A 3TKPA 3GA4A 3GNJA 3CBUA 2GSTA 5KEJA 2N5AA 3ZMLA 1IYIA 1GUKA 1X9MB 4ID0A 3V1WA 3PH9A 3ZIJA 2MBTA 2VLTA 4FYUA 3L78A 2V1MA 5ECRB 1BJXA 3KGKA 3DD3A 1Y25A 3CYNA 5FHIA 3IK9A 4JRRA 3GL5A 4XS4A 2QGVA 4G0KA 5AISA 2M80A 3KTBA 5JWOB 1GTUA 3APQA 2M72A 4RQXA 5IMVA 5HR3A 4MPFA 5ECNB 3H4KA 4ZB8A 3TJJA 5IPHA 3EU3A 4FYBA 1XZOA 2H6YA 2OACA 2LRCA 2WCIA 2C4JA 4AGSA 5G5FA 3QOUA 2B1LA 4TOPA 1HNAA 4XTSA 1XCCA 5ECOB 1ZZYA 3I9V2 2HNLA 2VL9A 5EVOA 1LU4A 2H1BA 3GH6A 5HR1A 4IBPA 2YZUA 2FGXA 3E3EA 3SBCA 4H86A 1RQMA 3MWHA 4ECIA 4HS1A 4XIHA 5ID2A 3GMFA 2DIZA 2PERA 2FY6A 2YV9A 1EP7A 3ZTLA 1OC9A 3DEXA 2YP6A 1LBKA 4ECJA 4XS6A 4YQVA 2CA8A 3IC4A 5F0GA 3GFKA 4G10A 2LS5A 1FOVA 4HUAA 4G0LA 2R3XA 4PQHA 1SK0A 3Q6OA 1DE1A 3DVXA 2OE0A 2PVOC 2NTOA 3KZQA 1K0NA 1K3OA 2V6OA 4YAPA 5ECPB 5G1LA 4PQIA 1FB6A 3KP9A 2LQQA 5CRDA 1PQNA 3M9KA 1XW9A 1AW9A 13GSA 3KP8A 3KCMA 2LNTA 4HI7A 2B5XA 3FRCA 3BCIA 1FAAA 1JLVA 3QD9A 3UVTA 1TKDB 1MDJA 2VL2C 2IMKA 1J9BA 5IM9A 4G0IA 4ACSA 2B3SA 5J4UA 5G5EA 1KNGA 4CHSA 4O5UA 4BWQA 4F03A 4IQAA 1OKTA 3TCOA 3D4TA 1M3IA 1BG5A 3IDVA 2H19A 4X0XA 4ZBAA 4IJIA 1Z5YE 5CRHA 3HZ8A 4K8MA 4WXTA 3ZFBA 4FIWA 4EO3A 2WULA 4PQ1A 1BQ7A 2YN1A 1SL0B 1XPVA 1PSQA 3IAM2 1GUMA 1K0DA 3EPTA 4OD7A 5HFKA 4K1FA 3A5IA 2IIYA 3EVIA 3QAWA 2JU5A 4GQCA 3M3MA 1M9AA 5BMUA 1Q98A 1WJKA 4ULXA 2IPAA 3L4NA 3IBHA 3IV4A 4USSA 4JBBA 3CTFA 5D93A 3GH9A 1U3AA 1Z6NA 1YKAA 2REMA 1K0AA 2LRTA 2K18A 2QA1A 2OE1A 3ZITA 4IVFA 4QQ7A 3LG6A 4POMA 1OKDA 2JACA 1GWCA 3P8WA 3ZIVA 16GSA 1ERWA 4WETA 1JLWA 3MSZA 1ACVA 3TUEA 3UAPA 2CV4A 2R37A 3RPPA 4MF6A 1TRUA 1WIKA 4F0BA 1GRXA 2D2ZA 1XG8A 2F9SA 5G2ZA 5GSTA 3DRNA 2R6KA 4KDUA 2VM1A 2IN3A 4L5LA 4E8HA 1A2LA 3CSJA 3IA1A 1JZWA 3ZZXA 5F05A 2HYXA 3C1SA 2BTOT 4L5OA 3L9UA 5KOWA 4Z7XA 3IE3A 1M2DA 4CY8A 1T4YA 3QDNA 1THXA 4NAXA 4WBRD 3IHQA 3US3A 1JHBA 3DMLA 5KN0A 4MF5A 3VWUA 1MDKA 2FHEA 4MZBA 4K7OA 2H66A 4RI7A 1R4WA 3I43A 4F0CA 4O5RA 4CW9A 4MZCA 3UEMA 2BMXA 4HZ4A 1FOHA 3EINA 2LJKA 3WD6A 5CAXA 4ZXGA 4K5SA 4QL9A 1DBYA 2IMDA 5J3RA 1SYRA 2ZNMA 1GL8A 5B8BA 2VM2A 2HE3A 4K2XA 3M8NA 2FWGA 4JEDA 4JR4A 3IOSA 4ZB9A 4K6XA 2HRAA 1ZYNA 5A4UA 5DJLA 2ALBA 2HLSA 2R2JA 2YWIA 2WS2A 4WR4A 1A0FA 3O76A 1A8YA 1JZOA 2C1YA 3ERWA 1EOHA 4I2TA 2P31A 4HDEA 5AIXA 4IS0A 2H70A 4HZ2A 3TOUA 3OR5A 5JCWA 4WF4A 1X0RA 1O8XA 3RHCA 4OCEA 2GQMA 3R2QA 1VF4A 3MIXA 4PXOA 1SJIA 1K0OA 1A2JA 1O81A 2JZRA 1FVJA 1XWKA 1PN0A 3FR9A 2X8GA 4ECBA 4NMUA 3RHBA 2C80A 3UJ1A 1M9BA 5G31A 2AHEA 2G0FA 3R3EA 3W8JA 3UARA 3QR6A 4TR4A 4IQ1A 2B1KA 3HVNA 4XHMA 3VLNA 1B8XA 1UA5A 3N5OA 2UZ8A 4L8EA 4DSSB 1U88A 1V98A 4GXZA 4N30A 3HXSA 1Z9HA 3Q18A 1FHEA 5KOXA 1K3YA 1BEDA 2FWFA 2YWOA 4KH7A 3ZRDA 3D21A 2N5FA 3ERGA 19GSA 3H8QA 1F2EA 3HVVA 2R0CA 3BCKA 5ECSA 2PMTA 4TR3A 2GQKA 1HD2A 2R5GA 1ML6A 5IMDA 1AQVA 1GTIA 2H72A 5JWRB 4V2NA 3L9SA 2KP2A 4AF2A 3PINA 5IO0A 2H0HA 4GTUA 3LWAA 4GF0A 3DYRA 2DLXA 2DBCA 5LNKe 2GZPA 4F2IA 1K0CA 4BVYB 3M0FA 2B5EA 4K0NA 4ISDA 2WDUA 4BL7B 4GSSA 2TRCP 4GCIA 2V6KA 2DKHA 2X8HA 2E2MA 3ERFA 1V2AA 1SU9A 5JCGA 3RDWA 3FZ5A 3WGXA 2C3TA 3GUSA 2H0IA 5GZZB 1TRSA 1M2BA 3HA9A
chains in the Genus database with same CATH topology
2VCVA 2RM6A 4ZB6A 1UC7A 3ME8A 4FQUA 1UVZA 1B4PA 3GX0A 4K2DA 2DJJA 2KHPA 2HRKA 5B8AA 2VAFA 12GSA 4A5PA 1K3LA 4BA7A 1XW5A 2LTKA 1TRVA 1SYXA 1EGRA 1QK8A 4WR5A 4EDYA 1URMA 3UIWA 2LQOA 1VGLA 3HKRA 2OA7A 2EIRA 2L4QA 4YH2A 2C0EA 5COHA 3TJGA 4NXIA 5IOWA 2L57A 1XIYA 3QPMA 2P5RA 2DMMA 3S9FA 1AC1A 1EOGA 1ERUA 5A5KA 1PMTA 2L59A 3F3RA 3CXGA 1XOAA 1GSUA 3ZL5A 3A2VA 4MCUA 3F4TA 2AB6A 4MJCA 1AIUA 1G0TA 1RK4A 2B7KA 2WRTA 4MJBA 4J2FA 2XPEA 4OFNA 1TTZA 6GSUA 5EY6A 4TR1B 4KDYA 3IPZA 2GQLA 2F51A 2RUFA 5DCGA 1A2MA 3BBYA 2BJXA 4ICYA 5HR2A 3G9BA 1WPIA 2IL3A 1U3IA 8GSSA 1J08A 1G7OA 1AQXA 1UN2A 4PX1A 4J57E 2YANA 2H76A 4KCAA 2A2RA 4K7NA 4XRDA 5GSSA 1T7PB 2I3YA 1Z7RA 4JR6A 1ZYEA 2VLUA 3TJBA 4TXVA 2LSTA 1GTAA 1GLQA 1TI3A 1GUHA 3GSSA 2YZHA 2EC4A 1WP0A 1VRSD 1F37A 4ZL7A 3BD2A 1B9XC 1NHYA 4HQZA 2HSHA 1BAYA 1CQHA 4YQUA 3DWVA 2J9HA 4N0VA 1EEMA 2O89A 3VWWA 3I69A 4J56E 2FA4A 1KTEA 4I5QA 4D73B 1S3DA 1OE8A 4TN8A 3ME7A 2DSAA 4G2EA 2YWNA 1QXHA 2XC2A 3M9JA 1M7TA 5FWGA 2VD1A 2HRNA 2M46A 1F6MC 1WOUA 5CNWA 3D4MA 1CQGA 3C73A 3CRUA 1E6BA 4DSSA 1TOFA 5AGYA 3FZ9A 3LYKA 3KH9A 4GRFA 1U6TA 5IMZA 3LSZA 2JZSA 1GSEA 4RI6A 5LCZA 3F6FA 4MMMA 1MD4A 2OBKA 3LFLA 2FCHA 2C3NA 3SWLA 4O7HA 2VUPA 3A2XA 4KX4A 4KSMA 1HQOA 3TGZA 3VK9A 1KEBA 4MZWA 3O6TA 2B6MA 2XBQA 1SJ6A 3DKSA 2MBSA 4BPYA 3TKSE 3EURA 1O8WA 6GSXA 2VD0A 2LJRA 3KEBA 2OKAA 4BVYA 4HU9A 1IYHA 2E0QA 2YOIA 1DE2A 1VF3A 2FWHA 1T00A 1T1VA 3VURA 2NPBA 4BL7A 4TW5A 3TB2A 3VI5A 2A2SA 4LMWA 1XOBA 2IWTA 2K8VA 4LL1B 2N5BA 1B4QA 4MDCA 1VF1A 1QUWA 1ILOA 1EV4A 2DIYA 3FW2A 3MYDA 1X5EA 1I9DA 4I2UA 5ABRA 1LJRA 2GT6A 2YV7A 5HR0A 1GNEA 1SK1A 1TK5B 5ECMB 3F3QA 4IN0A 2VCTA 2A4VA 2YPMA 5DDLA 18GSA 2NVLA 2GZZA 1PD21 4IP6A 5KN1A 1GSFA 1V9WA 4HEA2 2L6DA 2O7KA 3GKMA 3KTLA 2DKIA 2R0GA 4MPGA 4TR0A 5ECIB 3WYWA 6GSSA 3VI7A 3ED3A 3F63A 9GSSA 3FHKA 1F3BA 1WMJA 2JADA 5A4WA 1GSYA 1EV9A 4Z2UA 4AJ8A 1A0RP 4KB3A 2TIRA 1VF2A 4TRXA 5IMAA 4CDOA 4DSQA 3KH7A 3BOAA 2G2QA 2JZTA 3F8UA 4HU7A 2HSYA 1MEKA 3HJPA 2OJLA 2IMEA 2ZCTA 1YZXA 4YAVA 3HY2A 3HVSA 3FR6A 2H75A 5ELGA 3C7MA 5IPGA 4E8EA 4KE3A 2GDRA 3G7YA 4KAEA 2H30A 3LW9A 2X99A 1C72A 4Z2TA 2C0DA 5J9BA 1SKWB 4TR1A 4OFTA 5ENUA 2DJ3A 5DQSA 2VCZA 3LEFA 3APSA 3VFIA 1GH2A 1U87A 5DALB 5DAKB 2YWMA 4OO4A 3MDKA 3QAVA 3A2WA 5H5RA 3TKSA 4WBJA 1H75A 2NBSA 1O85A 4XRAA 3FR3A 3TJFA 3LORA 1DSBA 2VCWA 2CVBA 1YDKA 3KMOA 5J41A 2B7JA 4ECCA 1M0UA 2GVPA 4DEJA 1HYUA 3DVWA 1EZKA 2I81A 7GSSA 4HOJA 3ZLPA 5J9CA 1YEPA 4OWYA 1GNWA 5HFIA 2HZEB 4IJ3A 3IR4A 1FB0A 2L5OA 1E2YA 3F9UA 2X64A 2VOCA 2LRNA 2H01A 4PTSA 2ES7A 2GSQA 3ZFLA 2H71A 3MAKA 3E9JB 4KF9A 5H5SA 4QL7A 3VWVA 5CP1A 3O3TA 2YJ7A 4TKYA 1SKSB 2QA2A 2HSMA 3DIEA 3FMWA 1W89A 1TK8B 1ABAA 2R0PA 4JZQA 4K0GA 4D73A 2Z9SA 1GTBA 4NV2A 1PL1A 2NDOA 1OAZA 5DCHA 1QQ2A 2IJYA 4X43A 1AQWA 3P2AA 3WT2A 4ZILA 3HCZA 1F9MA 4PGTA 2MMOA 2I4AA 1I5GA 5DQYA 5D9WA 3ISOA 5CO3A 3U5RE 3H1NA 3J7Yk 1O73A 1PX7A 1DUGA 3G7IA 1FW1A 5DVBA 4PURA 2LUSA 1YKCA 4NWYA 2GT5A 3FEUA 2RM5A 2V41A 4MH3A 3GRXA 4EDZA 1ZMAA 3KM6A 3ZMKA 2PWJA 4I97A 4V1Ap 3DGQA 2F3MA 3FZ4A 1YF0A 3RAZA 3BJ5A 5FT3A 3GN3A 4I8BA 2AUVA 3PPUA 2WJUA 2FD3A 1TDIA 2DC5A 20GSA 3NOFA 3Q74A 4O32A 1K0BA 2RLIA 3RBTA 3TDGA 5HQPA 3EE2A 2H1GA 4LLRA 2XPDA 2FLSA 3WT1A 2H73A 2YNXA 5IOXA 4TXOB 1USBA 5C00A 5IIZA 4MK3A 3E0UA 1ERVA 4DSRA 3CSIA 3MNGA 4GSTA 5EL8A 2JSYA 5AN1A 1V57A 2PU9C 1X9SB 1GSQA 4HJ2A 1TU7A 1MD3A 2KOKA 3EU4A 1KBNA 4YQMA 3PR8A 4EF0A 1TW9A 3IK7A 1EWXA 2GS3A 1PX6A 4KUNA 17GSA 4Q5QA 2MZCA 2IMFA 1ZYPA 2QC7A 1M2AA 3F4RA 3J7Yb 1PA3A 4BVXB 3LXTA 2H1AA 3TKQA 4L0WA 4EC0A 4MF7A 2C3QA 1EEJA 2O87A 3IC8A 2GSRA 2O8VB 3HYPA 1TI1A 1R5PA 5D9TA 1GSDA 3QAGA 2AV4A 3C8EA 2GLRA 1Y6EA 3H93A 2DJKA 3A3TA 1SENA 2VCXA 1W4VA 4EE0A 5DJMA 2IMIA 4O5QA 5IMCA 5JCUA 5LD0A 1JZRA 1EP8A 2K6VA 3VWXA 4RQRA 4IW9A 4EUYA 1Z6MA 6GSYA 2PBJA 1TU8A 3GSTA 5DALA 5DAKA 5D8IA 2EIOA 3VPTA 4MJAA 3GHAA 1BYEA 4HQSA 2PVQA 4WF5A 5B6NA 5H5QA 3WGDA 4ML6A 2CAQA 1ERTA 3HD5A 4Q5FA 4O92A 1NHOA 1XWAA 3ZREA 3APOA 1NSWA 2WZ9A 2HZEA 3KXOA 2WFCA 4GQFA 3P90A 1T8EB 4K9ZA 5CYYA 3PGTA 4MP4A 2LNSA 2X8CA 4OFMA 4PNFA 5L71A 4K7IA 2X49A 3QCPA 3HJOA 4ZIJA 1EGOA 5B7CA 3IHGA 5G1KA 3FKFA 1R7HA 1XFLA 4KW6A 3C1RA 1ZYQB 2R4VA 5ELAA 1JFUA 4L0UA 4MJEA 2L5LA 1YQ1A 3LXZA 4DVCA 1SD9A 5BRTA 2H74A 4IKHA 2KUCA 1K0MA 1YJ6A 5F8BA 2YCDA 2CZ2A 2VL3A 4V2LA 3FY7A 3HHVA 2LV3A 4POLA 3FYGA 1F3AA 5KN3A 4GSNA 1GSSA 3EWLA 4ZL9A 2MMAA 4IGJA 2GTUA 2DJ0A 4N0ZA 1TRWA 2FUG2 1TXXA 2F8FA 4OMVA 2K9FA 4LMVA 2C0FA 3HZ4A 4YKFA 1TJDA 2H0GA 2IFQB 2L4CA 3KD0A 4ILFA 5CRGA 1PN9A 1RW1A 5ECQB 3GKKA 4FYCA 1HNBA 1ZCPA 2C0GA 5G30A 3NIVA 3QMXA 1S3AA 1B48A 5D73A 1GP1A 3EMXA 4PUAA 3K8NA 4KA0A 1QGVA 1X9WB 3VPQA 5E4WA 3GL3A 1V40A 3C71A 3GV1A 3F6DA 3P7XA 1OE7A 2VO4A 3L0HA 1Z7PA 3WGEA 4EIQA 3RPNA 3CMIA 1AUCA 4TXOA 1XXUA 6GSVA 4XS1A 4EKZA 1XWGA 1ST9A 2XBIA 5CREA 2H6ZA 1JZDA 1O6JA 4IP1A 3UL3A 2OADA 2P5QA 3TKSC 3FK8A 1SD8A 1XVWA 2YJHA 1SK2A 3W8SA 1PL2A 1G6YA 5IMFA 1SL1B 2K8SA 4JE1A 2E2GA 3GTUB 4EXJA 3D22A 2V2GA 1A23A 2DJ1A 4V2MA 2A2PA 2HFDA 4KNDA 1AXDA 3LYPA 1G6WA 5ECKB 4BVXA 2EIQA 1N8JA 5ECLB 4EIPA 1MDIA 10GSA 1Z3EA 3D0ZA 1R5AA 1ZGNA 4POKA 4ZL8A 2J23A 2CAIA 2TRXA 1M99A 2PUKC 1GLPA 5C04A 3GKXA 3JCML 2ON7A 3GYKA 4X1UA 2I1UA 2I9HA 1WE0A 3EC3A 3UBKA 2LJAA 1S3CA 2MMNA 4KDXA 4GWRA 2ZUPA 2OE3A 4NV5A 5F07A 2H8LA 2VL2A 3EYTA 1PGTA 4JU5A 3I6AA 2F8AA 2VIMA 6GSTA 1R26A 5E59A 3IRAA 5EPFA 2OBIA 2AAWA 1X5DA 1G7EA 1THOA 2DJ2A 3AY8A 1OYJA 2HZFA 2FA8A 5GAND 2GSSA 1XW6A 4OCFA 2A4HA 3KIJA 4F82A 4LL4B 5D9XA 4EL1A 4FH8A 4NHWA 2LKUA 1YF1A 11GSA 2GGTA 2MMZA 5B6MA 4XS4B 2VLVA 3ZVJD 5ECHB 2KP1A 3TKRA 1X5CA 4K5RA 3H79A 3KJYA 1V58A 3D5JA 2QSIA 1NM3A 1B9YC 1YY7A 3UMAA 2H6XA 3W6GA 3KMNA 2C8UA 2RUEA 6GSWA 2CQ9A 2HT9A 4ZBDA 2JSZA 4BWSA 3HJMA 3IAS2 3U6VA 1XVQA 4MABA 4KCEA 3CSHA 2CT6A 3IXRA 3UOMA 4KGIA 1MTCA 2AYTA 1QMVA 3L9VA 1FVKA 2H1DA 1TP9A 2PGTA 22GSA 3D6IA 4Q5RA 1OC3A 3TRXA 3LJRA 4Z2RA 2V32A 1XWBA 1A24A 5KN2A 3TRQA 5ID2B 3GX8A 2L6CA 4WKWA 2CVDA 4YKGA 5IQYA 4PNGA 1PKWA 1OC9B 3ZVJA 2B5YA 3GURA 3Q19A 1XWCA 5IO2A 3CTGA 1SJZA 2LEGA 3GIXA 3FZAA 4POBA 4NHZA 1FO5A 4MNNA 4GLTA 3QFAC 1SKRB 2KLXA 2X4AA 4MH2A 3TJKA 4PUFC 1OC8A 4MLYA 5D96A 3NZNA 3G7JA 2RIIA 1YEXA 2HI7A 2DMLA 2IFQA 1O7UA 5DBQA 2JL4A 4X4JA 4IHUA 1FG4A 1PRXA 5A4VA 2HXKA 3LQ7A 1N2AA 2CX4A 2MYGA 2E7PA 1T3BA 3HVXA 1PKZA 2AJQB 4XCSA 3F0IA 3HDCA 2ON5A 2QKEA 2P0GA 2HRFA 2XHFA 3F4SA 5F06A 3CRTA 4N10A 1XBSA 4NPBA 4N11A 2CVKA 3M1GA 1A8LA 3GKNA 3UVHA 4AJ6A 5J5NA 3DXBA 2FWEA 4IELA 4V1Ag 1NW2A 5HFGA 1J0FA 2VCQA 3EMPA 1H4OA 3UBLA 4LA1A 2O85A 4OO5A 2GZYA 5D9VA 4KSOA 4Q5NA 4ML1A 3GTUA 2PN8A 1HNCA 5GAPD 1TK0B 4F9ZA 1AAZA 1BX9A 4CY6A 1ZL9A 4EVMA 3QFBC 1ON4A 4AJ7A 5AIVA 3N9JA 4G9HA 3ZYWA 1QFNA 4I6XA 1GULA 3A5WA 3LGCA 3TRPA 1WRYA 5JWQB 2WGRA 4TVEA 4WEYA 1T4ZA 1OVNA 2FNOA 4HJMA 2PPTA 2CZ3A 1ZOFA 1WWJA 4MA9A 1SL2B 5INYA 2CX3A 4P3YB 5CRWA 4ZBBA 4RUVA 14GSA 2WB9A 3TOTA 1Q4JA 4FO5A 4G19A 3TKPA 3GA4A 3GNJA 3CBUA 2GSTA 5KEJA 2N5AA 3ZMLA 1IYIA 1GUKA 1X9MB 4ID0A 3V1WA 3PH9A 3ZIJA 2MBTA 2VLTA 4FYUA 3L78A 2V1MA 5ECRB 1BJXA 3KGKA 3DD3A 1Y25A 3CYNA 5FHIA 3IK9A 4JRRA 3GL5A 4XS4A 2QGVA 4G0KA 5AISA 2M80A 3KTBA 5JWOB 1GTUA 3APQA 2M72A 4RQXA 5IMVA 5HR3A 4MPFA 5ECNB 3H4KA 4ZB8A 3TJJA 5IPHA 3EU3A 4FYBA 1XZOA 2H6YA 2OACA 2LRCA 2WCIA 2C4JA 4AGSA 5G5FA 3QOUA 2B1LA 4TOPA 1HNAA 4XTSA 1XCCA 5ECOB 1ZZYA 3I9V2 2HNLA 2VL9A 5EVOA 1LU4A 2H1BA 3GH6A 5HR1A 4IBPA 2YZUA 2FGXA 3E3EA 3SBCA 4H86A 1RQMA 3MWHA 4ECIA 4HS1A 4XIHA 5ID2A 3GMFA 2DIZA 2PERA 2FY6A 2YV9A 1EP7A 3ZTLA 1OC9A 3DEXA 2YP6A 1LBKA 4ECJA 4XS6A 4YQVA 2CA8A 3IC4A 5F0GA 3GFKA 4G10A 2LS5A 1FOVA 4HUAA 4G0LA 2R3XA 4PQHA 1SK0A 3Q6OA 1DE1A 3DVXA 2OE0A 2PVOC 2NTOA 3KZQA 1K0NA 1K3OA 2V6OA 4YAPA 5ECPB 5G1LA 4PQIA 1FB6A 3KP9A 2LQQA 5CRDA 1PQNA 3M9KA 1XW9A 1AW9A 13GSA 3KP8A 3KCMA 2LNTA 4HI7A 2B5XA 3FRCA 3BCIA 1FAAA 1JLVA 3QD9A 3UVTA 1TKDB 1MDJA 2VL2C 2IMKA 1J9BA 5IM9A 4G0IA 4ACSA 2B3SA 5J4UA 5G5EA 1KNGA 4CHSA 4O5UA 4BWQA 4F03A 4IQAA 1OKTA 3TCOA 3D4TA 3IDVA 1BG5A 2H19A 4X0XA 4ZBAA 4IJIA 1Z5YE 5CRHA 3HZ8A 4K8MA 4WXTA 3ZFBA 4FIWA 4EO3A 2WULA 4PQ1A 1BQ7A 2YN1A 1SL0B 1XPVA 1PSQA 3IAM2 1GUMA 1K0DA 3EPTA 4OD7A 5HFKA 4K1FA 3A5IA 2IIYA 3EVIA 3QAWA 2JU5A 4GQCA 3M3MA 1M9AA 5BMUA 1Q98A 1WJKA 4ULXA 2IPAA 3L4NA 3IBHA 3IV4A 4USSA 4JBBA 3CTFA 5D93A 3GH9A 1U3AA 1Z6NA 1YKAA 2REMA 1K0AA 2LRTA 2K18A 2QA1A 2OE1A 3ZITA 4IVFA 4QQ7A 3LG6A 4POMA 1OKDA 2JACA 1GWCA 3P8WA 3ZIVA 16GSA 1ERWA 4WETA 1JLWA 3MSZA 1ACVA 3TUEA 3UAPA 2CV4A 2R37A 3RPPA 4MF6A 1TRUA 1WIKA 4F0BA 1GRXA 2D2ZA 2F9SA 5G2ZA 5GSTA 3DRNA 2R6KA 4KDUA 2VM1A 2IN3A 4L5LA 4E8HA 1A2LA 3CSJA 3IA1A 1JZWA 3ZZXA 5F05A 2HYXA 3C1SA 2BTOT 4L5OA 3L9UA 5KOWA 4Z7XA 3IE3A 1M2DA 4CY8A 1T4YA 3QDNA 1THXA 4NAXA 4WBRD 3IHQA 3US3A 1JHBA 3DMLA 5KN0A 4MF5A 3VWUA 1MDKA 2FHEA 4MZBA 4K7OA 2H66A 4RI7A 1R4WA 3I43A 4F0CA 4O5RA 4CW9A 4MZCA 3UEMA 2BMXA 4HZ4A 1FOHA 3EINA 2LJKA 3WD6A 5CAXA 4ZXGA 4K5SA 4QL9A 1DBYA 2IMDA 5J3RA 1SYRA 2ZNMA 1GL8A 5B8BA 2VM2A 2HE3A 4K2XA 3M8NA 2FWGA 4JEDA 4JR4A 3IOSA 4ZB9A 4K6XA 2HRAA 1ZYNA 5A4UA 5DJLA 2ALBA 2HLSA 2R2JA 2YWIA 2WS2A 4WR4A 1A0FA 3O76A 1A8YA 1JZOA 2C1YA 3ERWA 1EOHA 4I2TA 2P31A 4HDEA 5AIXA 4IS0A 2H70A 4HZ2A 3TOUA 3OR5A 5JCWA 4WF4A 1X0RA 1O8XA 3RHCA 4OCEA 2GQMA 3R2QA 1VF4A 3MIXA 4PXOA 1SJIA 1K0OA 1A2JA 1O81A 2JZRA 1FVJA 1XWKA 1PN0A 3FR9A 2X8GA 4ECBA 4NMUA 3RHBA 2C80A 3UJ1A 1M9BA 5G31A 2AHEA 2G0FA 3R3EA 3W8JA 3UARA 3QR6A 4TR4A 4IQ1A 2B1KA 4XHMA 3VLNA 1B8XA 1UA5A 3N5OA 2UZ8A 4L8EA 4DSSB 1U88A 1V98A 4GXZA 4N30A 3HXSA 1Z9HA 3Q18A 1FHEA 5KOXA 1K3YA 1BEDA 2FWFA 2YWOA 4KH7A 3ZRDA 3D21A 2N5FA 3ERGA 19GSA 3H8QA 1F2EA 3HVVA 2R0CA 3BCKA 5ECSA 2PMTA 4TR3A 2GQKA 1HD2A 2R5GA 1ML6A 5IMDA 1AQVA 1GTIA 2H72A 5JWRB 4V2NA 3L9SA 2KP2A 4AF2A 3PINA 5IO0A 2H0HA 4GTUA 3LWAA 4GF0A 3DYRA 2DLXA 2DBCA 5LNKe 2GZPA 4F2IA 1K0CA 4BVYB 3M0FA 2B5EA 4K0NA 4ISDA 2WDUA 4BL7B 4GSSA 2TRCP 4GCIA 2V6KA 2DKHA 2X8HA 2E2MA 3ERFA 1V2AA 1SU9A 5JCGA 3RDWA 3FZ5A 3WGXA 2C3TA 3GUSA 2H0IA 5GZZB 1TRSA 1M2BA 3HA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VCV A;  2RM6 A;  4ZB6 A;  1UC7 A;  3ME8 A;  1UVZ A;  1B4P A;  3GX0 A;  4K2D A;  2DJJ A;  2KHP A;  5B8A A;  2VAF A;  12GS A;  1K3L A;  4BA7 A;  1XW5 A;  2LTK A;  1TRV A;  1SYX A;  1EGR A;  1QK8 A;  4WR5 A;  4EDY A;  1URM A;  3UIW A;  2LQO A;  1VGL A;  3HKR A;  2OA7 A;  2EIR A;  2L4Q A;  4YH2 A;  2C0E A;  5COH A;  3TJG A;  4NXI A;  5IOW A;  2L57 A;  1XIY A;  3QPM A;  2P5R A;  2DMM A;  3S9F A;  1AC1 A;  1EOG A;  1ERU A;  5A5K A;  1PMT A;  2L59 A;  3F3R A;  3CXG A;  1XOA A;  1GSU A;  3ZL5 A;  3A2V A;  4MCU A;  3F4T A;  2AB6 A;  4MJC A;  1AIU A;  1G0T A;  1RK4 A;  2B7K A;  2WRT A;  4MJB A;  4J2F A;  2XPE A;  4OFN A;  1TTZ A;  6GSU A;  5EY6 A;  4TR1 B;  4KDY A;  3IPZ A;  2GQL A;  2F51 A;  2RUF A;  5DCG A;  1A2M A;  3BBY A;  2BJX A;  5HR2 A;  3G9B A;  1WPI A;  2IL3 A;  1U3I A;  8GSS A;  1J08 A;  1G7O A;  1AQX A;  1UN2 A;  4PX1 A;  4J57 E;  2YAN A;  2H76 A;  4KCA A;  2A2R A;  4K7N A;  4XRD A;  5GSS A;  1T7P B;  2I3Y A;  1Z7R A;  4JR6 A;  1ZYE A;  2VLU A;  3TJB A;  4TXV A;  2LST A;  1GTA A;  1GLQ A;  1TI3 A;  1GUH A;  3GSS A;  2YZH A;  2EC4 A;  1WP0 A;  1VRS D;  1F37 A;  4ZL7 A;  3BD2 A;  1B9X C;  1NHY A;  4HQZ A;  2HSH A;  1BAY A;  1CQH A;  4YQU A;  3DWV A;  2J9H A;  4N0V A;  1EEM A;  2O89 A;  3VWW A;  3I69 A;  4J56 E;  2FA4 A;  1KTE A;  4I5Q A;  4D73 B;  1S3D A;  1OE8 A;  4TN8 A;  3ME7 A;  2DSA A;  4G2E A;  2YWN A;  1QXH A;  2XC2 A;  3M9J A;  1M7T A;  5FWG A;  2VD1 A;  2HRN A;  2M46 A;  1F6M C;  1WOU A;  5CNW A;  3D4M A;  1CQG A;  3C73 A;  3CRU A;  1E6B A;  4DSS A;  1TOF A;  5AGY A;  3FZ9 A;  3LYK A;  3KH9 A;  4GRF A;  1U6T A;  5IMZ A;  3LSZ A;  2JZS A;  1GSE A;  4RI6 A;  5LCZ A;  3F6F A;  4MMM A;  1MD4 A;  2OBK A;  3LFL A;  2FCH A;  2C3N A;  3SWL A;  4O7H A;  2VUP A;  3A2X A;  4KX4 A;  4KSM A;  1HQO A;  3TGZ A;  3VK9 A;  1KEB A;  4MZW A;  3O6T A;  2B6M A;  2XBQ A;  1SJ6 A;  3DKS A;  2MBS A;  4BPY A;  3TKS E;  3EUR A;  1O8W A;  6GSX A;  2VD0 A;  2LJR A;  3KEB A;  2OKA A;  4BVY A;  4HU9 A;  1IYH A;  2E0Q A;  2YOI A;  1DE2 A;  1VF3 A;  2FWH A;  1T00 A;  1T1V A;  3VUR A;  2NPB A;  4BL7 A;  4TW5 A;  3TB2 A;  3VI5 A;  2A2S A;  4LMW A;  1XOB A;  2IWT A;  2K8V A;  4LL1 B;  2N5B A;  1B4Q A;  4MDC A;  1VF1 A;  1QUW A;  1ILO A;  1EV4 A;  2DIY A;  3FW2 A;  1X5E A;  1I9D A;  4I2U A;  5ABR A;  1LJR A;  2GT6 A;  2YV7 A;  5HR0 A;  1GNE A;  1SK1 A;  1TK5 B;  5ECM B;  3F3Q A;  4IN0 A;  2VCT A;  2A4V A;  2YPM A;  5DDL A;  18GS A;  2NVL A;  2GZZ A;  1PD2 1;  4IP6 A;  5KN1 A;  1GSF A;  1V9W A;  4HEA 2;  2L6D A;  2O7K A;  3GKM A;  3KTL A;  4MPG A;  4TR0 A;  5ECI B;  3WYW A;  6GSS A;  3VI7 A;  3ED3 A;  3F63 A;  9GSS A;  3FHK A;  1F3B A;  1WMJ A;  2JAD A;  5A4W A;  1GSY A;  1EV9 A;  4AJ8 A;  1A0R P;  4KB3 A;  2TIR A;  1VF2 A;  4TRX A;  5IMA A;  4CDO A;  4DSQ A;  3KH7 A;  3BOA A;  2G2Q A;  2JZT A;  3F8U A;  4HU7 A;  2HSY A;  1MEK A;  3HJP A;  2OJL A;  2IME A;  2ZCT A;  1YZX A;  4YAV A;  3HY2 A;  3HVS A;  3FR6 A;  2H75 A;  5ELG A;  3C7M A;  5IPG A;  4E8E A;  4KE3 A;  2GDR A;  3G7Y A;  4KAE A;  2H30 A;  2X99 A;  1C72 A;  2C0D A;  5J9B A;  1SKW B;  4TR1 A;  4OFT A;  5ENU A;  2DJ3 A;  5DQS A;  2VCZ A;  3LEF A;  3APS A;  3VFI A;  1GH2 A;  1U87 A;  5DAL B;  5DAK B;  2YWM A;  4OO4 A;  3MDK A;  3QAV A;  3A2W A;  5H5R A;  3TKS A;  4WBJ A;  1H75 A;  2NBS A;  1O85 A;  4XRA A;  3FR3 A;  3TJF A;  3LOR A;  1DSB A;  2VCW A;  2CVB A;  1YDK A;  3KMO A;  5J41 A;  2B7J A;  4ECC A;  1M0U A;  2GVP A;  4DEJ A;  1HYU A;  3DVW A;  1EZK A;  2I81 A;  7GSS A;  4HOJ A;  3ZLP A;  5J9C A;  1YEP A;  4OWY A;  1GNW A;  5HFI A;  2HZE B;  4IJ3 A;  3IR4 A;  1FB0 A;  2L5O A;  1E2Y A;  3F9U A;  2X64 A;  2VOC A;  2LRN A;  2H01 A;  2ES7 A;  2GSQ A;  3ZFL A;  2H71 A;  3MAK A;  3E9J B;  5H5S A;  4QL7 A;  3VWV A;  5CP1 A;  3O3T A;  2YJ7 A;  4TKY A;  1SKS B;  3DIE A;  1W89 A;  1TK8 B;  1ABA A;  4JZQ A;  4K0G A;  4D73 A;  2Z9S A;  1GTB A;  4NV2 A;  1PL1 A;  2NDO A;  1OAZ A;  5DCH A;  1QQ2 A;  2IJY A;  4X43 A;  1AQW A;  3P2A A;  3WT2 A;  4ZIL A;  3HCZ A;  1F9M A;  4PGT A;  2MMO A;  2I4A A;  1I5G A;  5DQY A;  5D9W A;  3ISO A;  5CO3 A;  3U5R E;  3H1N A;  3J7Y k;  1O73 A;  1PX7 A;  1DUG A;  3G7I A;  1FW1 A;  5DVB A;  4PUR A;  2LUS A;  1YKC A;  4NWY A;  2GT5 A;  3FEU A;  2RM5 A;  2V41 A;  4MH3 A;  3GRX A;  4EDZ A;  1ZMA A;  3KM6 A;  3ZMK A;  2PWJ A;  4I97 A;  4V1A p;  3DGQ A;  2F3M A;  3FZ4 A;  1YF0 A;  3RAZ A;  3BJ5 A;  5FT3 A;  3GN3 A;  4I8B A;  2AUV A;  2WJU A;  2FD3 A;  1TDI A;  2DC5 A;  20GS A;  3NOF A;  3Q74 A;  4O32 A;  1K0B A;  2RLI A;  3RBT A;  3TDG A;  5HQP A;  3EE2 A;  2H1G A;  4LLR A;  2XPD A;  2FLS A;  3WT1 A;  2H73 A;  2YNX A;  5IOX A;  4TXO B;  1USB A;  5C00 A;  5IIZ A;  4MK3 A;  3E0U A;  1ERV A;  4DSR A;  3CSI A;  3MNG A;  4GST A;  5EL8 A;  2JSY A;  5AN1 A;  1V57 A;  2PU9 C;  1X9S B;  1GSQ A;  4HJ2 A;  1TU7 A;  1MD3 A;  2KOK A;  3EU4 A;  1KBN A;  4YQM A;  3PR8 A;  4EF0 A;  1TW9 A;  3IK7 A;  1EWX A;  2GS3 A;  1PX6 A;  4KUN A;  17GS A;  4Q5Q A;  2MZC A;  2IMF A;  2QC7 A;  1M2A A;  3F4R A;  3J7Y b;  1PA3 A;  3LXT A;  2H1A A;  3TKQ A;  4L0W A;  4EC0 A;  4MF7 A;  2C3Q A;  1EEJ A;  2O87 A;  2GSR A;  2O8V B;  3HYP A;  1TI1 A;  1R5P A;  5D9T A;  1GSD A;  3QAG A;  2AV4 A;  3C8E A;  2GLR A;  1Y6E A;  3H93 A;  2DJK A;  3A3T A;  1SEN A;  2VCX A;  1W4V A;  4EE0 A;  5DJM A;  2IMI A;  5IMC A;  5JCU A;  5LD0 A;  1JZR A;  1EP8 A;  2K6V A;  3VWX A;  4RQR A;  4IW9 A;  4EUY A;  1Z6M A;  6GSY A;  2PBJ A;  1TU8 A;  3GST A;  5DAL A;  5DAK A;  5D8I A;  2EIO A;  3VPT A;  4MJA A;  3GHA A;  1BYE A;  4HQS A;  2PVQ A;  4WF5 A;  5B6N A;  5H5Q A;  3WGD A;  4ML6 A;  2CAQ A;  1ERT A;  3HD5 A;  4Q5F A;  4O92 A;  1NHO A;  1XWA A;  3ZRE A;  3APO A;  1NSW A;  2WZ9 A;  2HZE A;  3KXO A;  2WFC A;  4GQF A;  3P90 A;  1T8E B;  4K9Z A;  5CYY A;  3PGT A;  4MP4 A;  2LNS A;  2X8C A;  4OFM A;  4PNF A;  5L71 A;  4K7I A;  3QCP A;  3HJO A;  4ZIJ A;  1EGO A;  5B7C A;  5G1K A;  3FKF A;  1R7H A;  1XFL A;  4KW6 A;  3C1R A;  1ZYQ B;  2R4V A;  5ELA A;  1JFU A;  4L0U A;  4MJE A;  2L5L A;  1YQ1 A;  3LXZ A;  4DVC A;  1SD9 A;  2H74 A;  4IKH A;  2KUC A;  1K0M A;  1YJ6 A;  5F8B A;  2YCD A;  2CZ2 A;  2VL3 A;  4V2L A;  3FY7 A;  3HHV A;  2LV3 A;  4POL A;  3FYG A;  1F3A A;  5KN3 A;  4GSN A;  1GSS A;  3EWL A;  4ZL9 A;  2MMA A;  4IGJ A;  2GTU A;  2DJ0 A;  4N0Z A;  1TRW A;  2FUG 2;  1TXX A;  2F8F A;  4OMV A;  2K9F A;  4LMV A;  2C0F A;  3HZ4 A;  1TJD A;  2H0G A;  2IFQ B;  2L4C A;  3KD0 A;  4ILF A;  5CRG A;  1PN9 A;  1RW1 A;  5ECQ B;  3GKK A;  4FYC A;  1HNB A;  1ZCP A;  2C0G A;  5G30 A;  3NIV A;  3QMX A;  1S3A A;  1B48 A;  5D73 A;  1GP1 A;  3EMX A;  3K8N A;  4KA0 A;  4PUA A;  1QGV A;  1X9W B;  3VPQ A;  5E4W A;  3GL3 A;  1V40 A;  3C71 A;  3GV1 A;  3F6D A;  3P7X A;  1OE7 A;  2VO4 A;  3L0H A;  1Z7P A;  3WGE A;  3RPN A;  3CMI A;  1AUC A;  4TXO A;  1XXU A;  6GSV A;  4XS1 A;  4EKZ A;  1XWG A;  1ST9 A;  2XBI A;  5CRE A;  2H6Z A;  1JZD A;  1O6J A;  4IP1 A;  3UL3 A;  2OAD A;  2P5Q A;  3TKS C;  3FK8 A;  1SD8 A;  1XVW A;  2YJH A;  1SK2 A;  3W8S A;  1PL2 A;  1G6Y A;  5IMF A;  1SL1 B;  2K8S A;  4JE1 A;  2E2G A;  3GTU B;  4EXJ A;  3D22 A;  2V2G A;  1A23 A;  2DJ1 A;  4V2M A;  2HFD A;  4KND A;  1AXD A;  3LYP A;  1G6W A;  5ECK B;  4BVX A;  2EIQ A;  1N8J A;  5ECL B;  1MDI A;  10GS A;  1Z3E A;  3D0Z A;  1R5A A;  1ZGN A;  4POK A;  4ZL8 A;  2J23 A;  2CAI A;  2TRX A;  1M99 A;  2PUK C;  1GLP A;  5C04 A;  3GKX A;  3JCM L;  2ON7 A;  3GYK A;  4X1U A;  2I1U A;  2I9H A;  1WE0 A;  3EC3 A;  3UBK A;  2LJA A;  1S3C A;  2MMN A;  4KDX A;  4GWR A;  2ZUP A;  2OE3 A;  4NV5 A;  5F07 A;  2H8L A;  2VL2 A;  3EYT A;  1PGT A;  4JU5 A;  3I6A A;  2F8A A;  2VIM A;  6GST A;  1R26 A;  5E59 A;  3IRA A;  5EPF A;  2OBI A;  2AAW A;  1X5D A;  1G7E A;  1THO A;  2DJ2 A;  3AY8 A;  1OYJ A;  2HZF A;  2FA8 A;  5GAN D;  2GSS A;  1XW6 A;  4OCF A;  3KIJ A;  4F82 A;  4LL4 B;  5D9X A;  4EL1 A;  4FH8 A;  4NHW A;  2LKU A;  1YF1 A;  11GS A;  2GGT A;  2MMZ A;  5B6M A;  4XS4 B;  2VLV A;  3ZVJ D;  5ECH B;  2KP1 A;  3TKR A;  1X5C A;  3H79 A;  3KJY A;  1V58 A;  3D5J A;  2QSI A;  1NM3 A;  1B9Y C;  1YY7 A;  3UMA A;  2H6X A;  3W6G A;  3KMN A;  2C8U A;  2RUE A;  6GSW A;  2CQ9 A;  2HT9 A;  4ZBD A;  2JSZ A;  4BWS A;  3HJM A;  3IAS 2;  3U6V A;  1XVQ A;  4MAB A;  4KCE A;  3CSH A;  2CT6 A;  3IXR A;  3UOM A;  4KGI A;  1MTC A;  2AYT A;  1QMV A;  3L9V A;  1FVK A;  2H1D A;  1TP9 A;  2PGT A;  22GS A;  3D6I A;  4Q5R A;  1OC3 A;  3TRX A;  3LJR A;  2V32 A;  1XWB A;  1A24 A;  5KN2 A;  3TRQ A;  5ID2 B;  3GX8 A;  2L6C A;  4WKW A;  2CVD A;  5IQY A;  4PNG A;  1PKW A;  1OC9 B;  3ZVJ A;  2B5Y A;  3GUR A;  3Q19 A;  1XWC A;  5IO2 A;  3CTG A;  1SJZ A;  2LEG A;  3GIX A;  3FZA A;  4POB A;  4NHZ A;  1FO5 A;  4GLT A;  3QFA C;  1SKR B;  2KLX A;  4MH2 A;  3TJK A;  4PUF C;  1OC8 A;  4MLY A;  5D96 A;  3NZN A;  3G7J A;  2RII A;  1YEX A;  2HI7 A;  2DML A;  2IFQ A;  1O7U A;  5DBQ A;  2JL4 A;  4IHU A;  1FG4 A;  1PRX A;  5A4V A;  2HXK A;  3LQ7 A;  1N2A A;  2CX4 A;  2MYG A;  2E7P A;  1T3B A;  3HVX A;  1PKZ A;  2AJQ B;  4XCS A;  3F0I A;  3HDC A;  2ON5 A;  2QKE A;  2P0G A;  2HRF A;  2XHF A;  3F4S A;  5F06 A;  3CRT A;  4N10 A;  1XBS A;  4NPB A;  4N11 A;  2CVK A;  3M1G A;  1A8L A;  3GKN A;  3UVH A;  4AJ6 A;  5J5N A;  3DXB A;  2FWE A;  4IEL A;  4V1A g;  1NW2 A;  5HFG A;  1J0F A;  2VCQ A;  3EMP A;  1H4O A;  3UBL A;  4LA1 A;  2O85 A;  4OO5 A;  2GZY A;  5D9V A;  4KSO A;  4Q5N A;  4ML1 A;  3GTU A;  2PN8 A;  1HNC A;  5GAP D;  1TK0 B;  4F9Z A;  1AAZ A;  1BX9 A;  1ZL9 A;  4EVM A;  3QFB C;  1ON4 A;  4AJ7 A;  5AIV A;  3N9J A;  4G9H A;  3ZYW A;  1QFN A;  4I6X A;  1GUL A;  3A5W A;  3LGC A;  3TRP A;  1WRY A;  5JWQ B;  2WGR A;  4TVE A;  4WEY A;  1T4Z A;  1OVN A;  2FNO A;  4HJM A;  2PPT A;  2CZ3 A;  1ZOF A;  1WWJ A;  4MA9 A;  1SL2 B;  5INY A;  2CX3 A;  4P3Y B;  5CRW A;  4ZBB A;  4RUV A;  14GS A;  2WB9 A;  3TOT A;  1Q4J A;  4FO5 A;  4G19 A;  3TKP A;  3GA4 A;  3GNJ A;  3CBU A;  2GST A;  5KEJ A;  2N5A A;  3ZML A;  1IYI A;  1GUK A;  1X9M B;  4ID0 A;  3V1W A;  3PH9 A;  3ZIJ A;  2MBT A;  2VLT A;  4FYU A;  3L78 A;  2V1M A;  5ECR B;  1BJX A;  3KGK A;  3DD3 A;  1Y25 A;  3CYN A;  5FHI A;  3IK9 A;  4JRR A;  3GL5 A;  4XS4 A;  2QGV A;  5AIS A;  2M80 A;  3KTB A;  5JWO B;  1GTU A;  3APQ A;  2M72 A;  4RQX A;  5IMV A;  5HR3 A;  4MPF A;  5ECN B;  3H4K A;  4ZB8 A;  3TJJ A;  5IPH A;  3EU3 A;  4FYB A;  1XZO A;  2H6Y A;  2OAC A;  2LRC A;  2WCI A;  2C4J A;  4AGS A;  5G5F A;  3QOU A;  2B1L A;  4TOP A;  1HNA A;  4XTS A;  1XCC A;  5ECO B;  1ZZY A;  3I9V 2;  2HNL A;  2VL9 A;  5EVO A;  1LU4 A;  2H1B A;  3GH6 A;  5HR1 A;  4IBP A;  2YZU A;  2FGX A;  3E3E A;  3SBC A;  4H86 A;  1RQM A;  3MWH A;  4ECI A;  4HS1 A;  4XIH A;  5ID2 A;  3GMF A;  2DIZ A;  2PER A;  2FY6 A;  2YV9 A;  1EP7 A;  3ZTL A;  1OC9 A;  3DEX A;  2YP6 A;  1LBK A;  4ECJ A;  4XS6 A;  4YQV A;  2CA8 A;  3IC4 A;  5F0G A;  3GFK A;  4G10 A;  2LS5 A;  1FOV A;  4HUA A;  2R3X A;  4PQH A;  1SK0 A;  3Q6O A;  1DE1 A;  3DVX A;  2OE0 A;  2PVO C;  2NTO A;  3KZQ A;  1K0N A;  1K3O A;  2V6O A;  4YAP A;  5ECP B;  5G1L A;  4PQI A;  1FB6 A;  3KP9 A;  2LQQ A;  5CRD A;  1PQN A;  3M9K A;  1XW9 A;  1AW9 A;  13GS A;  3KP8 A;  3KCM A;  2LNT A;  4HI7 A;  2B5X A;  3FRC A;  3BCI A;  1FAA A;  1JLV A;  3QD9 A;  3UVT A;  1TKD B;  1MDJ A;  2VL2 C;  2IMK A;  1J9B A;  5IM9 A;  4ACS A;  2B3S A;  5J4U A;  5G5E A;  1KNG A;  4CHS A;  4BWQ A;  4F03 A;  4IQA A;  1OKT A;  3TCO A;  3D4T A;  3IDV A;  1BG5 A;  2H19 A;  4X0X A;  4ZBA A;  4IJI A;  1Z5Y E;  5CRH A;  3HZ8 A;  4K8M A;  4WXT A;  3ZFB A;  4FIW A;  4EO3 A;  2WUL A;  4PQ1 A;  1BQ7 A;  2YN1 A;  1SL0 B;  1XPV A;  1PSQ A;  3IAM 2;  1GUM A;  1K0D A;  4OD7 A;  5HFK A;  4K1F A;  2IIY A;  3EVI A;  3QAW A;  2JU5 A;  4GQC A;  3M3M A;  1M9A A;  1Q98 A;  1WJK A;  4ULX A;  2IPA A;  3L4N A;  3IBH A;  3IV4 A;  4JBB A;  3CTF A;  5D93 A;  3GH9 A;  1U3A A;  1Z6N A;  1YKA A;  2REM A;  1K0A A;  2LRT A;  2K18 A;  2OE1 A;  3ZIT A;  4IVF A;  4QQ7 A;  3LG6 A;  4POM A;  1OKD A;  2JAC A;  1GWC A;  3P8W A;  3ZIV A;  16GS A;  1ERW A;  4WET A;  1JLW A;  3MSZ A;  1ACV A;  3TUE A;  3UAP A;  2CV4 A;  2R37 A;  3RPP A;  4MF6 A;  1TRU A;  1WIK A;  4F0B A;  1GRX A;  2D2Z A;  2F9S A;  5G2Z A;  5GST A;  3DRN A;  2R6K A;  4KDU A;  2VM1 A;  2IN3 A;  4L5L A;  4E8H A;  1A2L A;  3CSJ A;  3IA1 A;  1JZW A;  3ZZX A;  5F05 A;  2HYX A;  3C1S A;  2BTO T;  4L5O A;  3L9U A;  4Z7X A;  3IE3 A;  1M2D A;  1T4Y A;  3QDN A;  1THX A;  4NAX A;  4WBR D;  3IHQ A;  3US3 A;  1JHB A;  3DML A;  5KN0 A;  4MF5 A;  3VWU A;  1MDK A;  2FHE A;  4MZB A;  4K7O A;  2H66 A;  4RI7 A;  1R4W A;  3I43 A;  4F0C A;  4O5R A;  4CW9 A;  4MZC A;  3UEM A;  2BMX A;  4HZ4 A;  3EIN A;  2LJK A;  3WD6 A;  5CAX A;  4ZXG A;  4QL9 A;  1DBY A;  2IMD A;  5J3R A;  1SYR A;  2ZNM A;  1GL8 A;  5B8B A;  2VM2 A;  2HE3 A;  3M8N A;  2FWG A;  4JED A;  4JR4 A;  3IOS A;  4ZB9 A;  4K6X A;  5A4U A;  5DJL A;  2ALB A;  2HLS A;  2R2J A;  2YWI A;  2WS2 A;  4WR4 A;  1A0F A;  3O76 A;  1A8Y A;  1JZO A;  2C1Y A;  3ERW A;  1EOH A;  4I2T A;  2P31 A;  4HDE A;  5AIX A;  4IS0 A;  2H70 A;  4HZ2 A;  3TOU A;  3OR5 A;  5JCW A;  4WF4 A;  1X0R A;  1O8X A;  3RHC A;  4OCE A;  2GQM A;  3R2Q A;  1VF4 A;  4PXO A;  1SJI A;  1K0O A;  1A2J A;  1O81 A;  2JZR A;  1FVJ A;  1XWK A;  3FR9 A;  2X8G A;  4ECB A;  4NMU A;  3RHB A;  2C80 A;  3UJ1 A;  1M9B A;  5G31 A;  2AHE A;  2G0F A;  3W8J A;  3UAR A;  3QR6 A;  4TR4 A;  4IQ1 A;  2B1K A;  4XHM A;  3VLN A;  1B8X A;  1UA5 A;  3N5O A;  4L8E A;  4DSS B;  1U88 A;  1V98 A;  4GXZ A;  4N30 A;  3HXS A;  1Z9H A;  3Q18 A;  1FHE A;  1K3Y A;  1BED A;  2FWF A;  2YWO A;  4KH7 A;  3ZRD A;  3D21 A;  2N5F A;  3ERG A;  19GS A;  3H8Q A;  1F2E A;  3HVV A;  3BCK A;  5ECS A;  2PMT A;  4TR3 A;  2GQK A;  1HD2 A;  2R5G A;  1ML6 A;  5IMD A;  1AQV A;  1GTI A;  2H72 A;  5JWR B;  4V2N A;  3L9S A;  2KP2 A;  4AF2 A;  3PIN A;  5IO0 A;  2H0H A;  4GTU A;  3LWA A;  4GF0 A;  3DYR A;  2DLX A;  2DBC A;  5LNK e;  2GZP A;  4F2I A;  1K0C A;  3M0F A;  2B5E A;  4K0N A;  4ISD A;  2WDU A;  4GSS A;  2TRC P;  4GCI A;  2V6K A;  2X8H A;  2E2M A;  3ERF A;  1V2A A;  1SU9 A;  5JCG A;  3RDW A;  3FZ5 A;  3WGX A;  2C3T A;  3GUS A;  2H0I A;  5GZZ B;  1TRS A;  1M2B A;  3HA9 A; 
#chains in the Genus database with same CATH topology
 2VCV A;  2RM6 A;  4ZB6 A;  1UC7 A;  3ME8 A;  4FQU A;  1UVZ A;  1B4P A;  3GX0 A;  4K2D A;  2DJJ A;  2KHP A;  2HRK A;  5B8A A;  2VAF A;  12GS A;  4A5P A;  1K3L A;  4BA7 A;  1XW5 A;  2LTK A;  1TRV A;  1SYX A;  1EGR A;  1QK8 A;  4WR5 A;  4EDY A;  1URM A;  3UIW A;  2LQO A;  1VGL A;  3HKR A;  2OA7 A;  2EIR A;  2L4Q A;  4YH2 A;  2C0E A;  5COH A;  3TJG A;  4NXI A;  5IOW A;  2L57 A;  1XIY A;  3QPM A;  2P5R A;  2DMM A;  3S9F A;  1AC1 A;  1EOG A;  1ERU A;  5A5K A;  1PMT A;  2L59 A;  3F3R A;  3CXG A;  1XOA A;  1GSU A;  3ZL5 A;  3A2V A;  4MCU A;  3F4T A;  2AB6 A;  4MJC A;  1AIU A;  1G0T A;  1RK4 A;  2B7K A;  2WRT A;  4MJB A;  4J2F A;  2XPE A;  4OFN A;  1TTZ A;  6GSU A;  5EY6 A;  4TR1 B;  4KDY A;  3IPZ A;  2GQL A;  2F51 A;  2RUF A;  5DCG A;  1PFO A;  1A2M A;  3BBY A;  2BJX A;  4ICY A;  5HR2 A;  3G9B A;  1WPI A;  2IL3 A;  1U3I A;  8GSS A;  1J08 A;  1G7O A;  1AQX A;  1UN2 A;  4PX1 A;  4J57 E;  2YAN A;  2H76 A;  4KCA A;  2A2R A;  4K7N A;  4XRD A;  5GSS A;  1T7P B;  2I3Y A;  1Z7R A;  4JR6 A;  1ZYE A;  2VLU A;  3TJB A;  4TXV A;  2LST A;  1GTA A;  1GLQ A;  1TI3 A;  1GUH A;  3GSS A;  2YZH A;  2EC4 A;  1WP0 A;  1VRS D;  1F37 A;  4ZL7 A;  3BD2 A;  1B9X C;  1NHY A;  4HQZ A;  2HSH A;  1BAY A;  1CQH A;  4YQU A;  3DWV A;  2J9H A;  4N0V A;  1EEM A;  2O89 A;  3VWW A;  3I69 A;  4J56 E;  2FA4 A;  1KTE A;  4I5Q A;  4D73 B;  1S3D A;  1OE8 A;  4TN8 A;  3ME7 A;  2DSA A;  4G2E A;  2YWN A;  1QXH A;  2XC2 A;  3M9J A;  1M7T A;  5FWG A;  2VD1 A;  2HRN A;  2M46 A;  1F6M C;  1WOU A;  5CNW A;  3D4M A;  1CQG A;  3C73 A;  3CRU A;  1E6B A;  4DSS A;  1TOF A;  5AGY A;  3FZ9 A;  3LYK A;  3KH9 A;  4GRF A;  1U6T A;  5IMZ A;  3LSZ A;  2JZS A;  1GSE A;  4RI6 A;  5LCZ A;  3F6F A;  4MMM A;  1MD4 A;  2OBK A;  3LFL A;  2FCH A;  2C3N A;  3SWL A;  4O7H A;  1S3R A;  2VUP A;  3A2X A;  4KX4 A;  4KSM A;  1HQO A;  3TGZ A;  3VK9 A;  1KEB A;  4MZW A;  3O6T A;  2B6M A;  2XBQ A;  1SJ6 A;  3DKS A;  2MBS A;  4BPY A;  3TKS E;  3EUR A;  1O8W A;  6GSX A;  2VD0 A;  2LJR A;  3KEB A;  2OKA A;  4BVY A;  4HU9 A;  1IYH A;  2E0Q A;  2YOI A;  1DE2 A;  1VF3 A;  2FWH A;  1T00 A;  1T1V A;  3VUR A;  2NPB A;  4BL7 A;  4TW5 A;  3TB2 A;  3VI5 A;  2A2S A;  4LMW A;  1XOB A;  2IWT A;  2K8V A;  4LL1 B;  2N5B A;  1B4Q A;  4MDC A;  1VF1 A;  1QUW A;  1ILO A;  1EV4 A;  2DIY A;  3FW2 A;  3MYD A;  1X5E A;  1I9D A;  4I2U A;  5ABR A;  1LJR A;  2GT6 A;  2YV7 A;  5HR0 A;  1GNE A;  1SK1 A;  1TK5 B;  5ECM B;  3F3Q A;  4IN0 A;  2VCT A;  2A4V A;  2YPM A;  5DDL A;  18GS A;  2NVL A;  2GZZ A;  1PD2 1;  4IP6 A;  5KN1 A;  1GSF A;  1V9W A;  4HEA 2;  2L6D A;  2O7K A;  3GKM A;  3KTL A;  2DKI A;  2R0G A;  4MPG A;  4TR0 A;  5ECI B;  3WYW A;  6GSS A;  3VI7 A;  3ED3 A;  3F63 A;  9GSS A;  3FHK A;  1F3B A;  1WMJ A;  2JAD A;  5A4W A;  1GSY A;  1EV9 A;  4Z2U A;  4AJ8 A;  1A0R P;  4KB3 A;  2TIR A;  1VF2 A;  4TRX A;  5IMA A;  4CDO A;  4DSQ A;  3KH7 A;  3BOA A;  2G2Q A;  2JZT A;  3F8U A;  4HU7 A;  2HSY A;  1MEK A;  3HJP A;  2OJL A;  2IME A;  2ZCT A;  1YZX A;  3HVS A;  3HY2 A;  4YAV A;  3FR6 A;  2H75 A;  5ELG A;  3C7M A;  5IPG A;  4E8E A;  4KE3 A;  2GDR A;  3G7Y A;  4KAE A;  2H30 A;  3LW9 A;  2X99 A;  1C72 A;  4Z2T A;  2C0D A;  5J9B A;  1SKW B;  4TR1 A;  4OFT A;  5ENU A;  2DJ3 A;  5DQS A;  2VCZ A;  3LEF A;  3APS A;  3VFI A;  1GH2 A;  1U87 A;  5DAL B;  5DAK B;  2YWM A;  4OO4 A;  3MDK A;  3QAV A;  3A2W A;  5H5R A;  3TKS A;  4WBJ A;  1H75 A;  2NBS A;  1O85 A;  4XRA A;  3FR3 A;  3TJF A;  3LOR A;  1DSB A;  2VCW A;  2CVB A;  1YDK A;  3KMO A;  5J41 A;  2B7J A;  4ECC A;  1M0U A;  2GVP A;  4DEJ A;  1HYU A;  3DVW A;  1EZK A;  2I81 A;  7GSS A;  4HOJ A;  3ZLP A;  5J9C A;  1YEP A;  4OWY A;  1GNW A;  5HFI A;  2HZE B;  4IJ3 A;  3IR4 A;  1FB0 A;  2L5O A;  1E2Y A;  3F9U A;  2X64 A;  2VOC A;  2LRN A;  2H01 A;  4PTS A;  2ES7 A;  2GSQ A;  3ZFL A;  2H71 A;  3MAK A;  3E9J B;  4KF9 A;  5H5S A;  4QL7 A;  3VWV A;  5CP1 A;  3O3T A;  2YJ7 A;  4TKY A;  1SKS B;  2QA2 A;  2HSM A;  3DIE A;  3FMW A;  1W89 A;  1TK8 B;  1ABA A;  2R0P A;  4JZQ A;  4K0G A;  4D73 A;  2Z9S A;  1GTB A;  4NV2 A;  1PL1 A;  2NDO A;  1OAZ A;  5DCH A;  1QQ2 A;  2IJY A;  4X43 A;  1AQW A;  3P2A A;  3WT2 A;  4ZIL A;  3HCZ A;  1F9M A;  4PGT A;  2MMO A;  2I4A A;  1I5G A;  5DQY A;  5D9W A;  3ISO A;  5CO3 A;  3U5R E;  3H1N A;  3J7Y k;  1O73 A;  1PX7 A;  1DUG A;  3G7I A;  1FW1 A;  5DVB A;  4PUR A;  2LUS A;  1YKC A;  4NWY A;  2GT5 A;  3FEU A;  2RM5 A;  2V41 A;  4MH3 A;  3GRX A;  4EDZ A;  1ZMA A;  3KM6 A;  3ZMK A;  2PWJ A;  4I97 A;  4V1A p;  3DGQ A;  2F3M A;  3FZ4 A;  1YF0 A;  3RAZ A;  3BJ5 A;  5FT3 A;  3GN3 A;  4I8B A;  2AUV A;  3PPU A;  2WJU A;  2FD3 A;  1TDI A;  2DC5 A;  20GS A;  3NOF A;  3Q74 A;  4O32 A;  1K0B A;  2RLI A;  1M3J A;  3RBT A;  3TDG A;  5HQP A;  3EE2 A;  2H1G A;  4LLR A;  2XPD A;  2FLS A;  3WT1 A;  2H73 A;  2YNX A;  5IOX A;  4TXO B;  1USB A;  5C00 A;  5IIZ A;  4MK3 A;  3E0U A;  1ERV A;  4DSR A;  3CSI A;  3MNG A;  4GST A;  5EL8 A;  2JSY A;  5AN1 A;  1V57 A;  2PU9 C;  1X9S B;  1GSQ A;  4HJ2 A;  1TU7 A;  1MD3 A;  2KOK A;  3EU4 A;  1KBN A;  4YQM A;  3PR8 A;  4EF0 A;  1TW9 A;  3IK7 A;  1EWX A;  2GS3 A;  1PX6 A;  4KUN A;  17GS A;  4Q5Q A;  2MZC A;  2IMF A;  1ZYP A;  2QC7 A;  1M2A A;  3F4R A;  3J7Y b;  1PA3 A;  4BVX B;  3LXT A;  2H1A A;  3TKQ A;  4L0W A;  4EC0 A;  4MF7 A;  2C3Q A;  1EEJ A;  2O87 A;  3IC8 A;  2GSR A;  2O8V B;  3HYP A;  1TI1 A;  1R5P A;  5D9T A;  1GSD A;  3QAG A;  2AV4 A;  3C8E A;  2GLR A;  1Y6E A;  3H93 A;  2DJK A;  3A3T A;  1SEN A;  2VCX A;  1W4V A;  4EE0 A;  5DJM A;  2IMI A;  4O5Q A;  5IMC A;  5JCU A;  5LD0 A;  1JZR A;  1EP8 A;  2K6V A;  3VWX A;  4RQR A;  4IW9 A;  4EUY A;  1Z6M A;  6GSY A;  2PBJ A;  1TU8 A;  3GST A;  5DAL A;  5DAK A;  5D8I A;  2EIO A;  3VPT A;  4MJA A;  3GHA A;  1BYE A;  4HQS A;  2PVQ A;  4WF5 A;  5B6N A;  5H5Q A;  3WGD A;  4ML6 A;  2CAQ A;  1ERT A;  3HD5 A;  4Q5F A;  4O92 A;  1NHO A;  1XWA A;  3ZRE A;  3APO A;  1NSW A;  2WZ9 A;  2HZE A;  3KXO A;  2WFC A;  4GQF A;  3P90 A;  1T8E B;  4K9Z A;  5CYY A;  3PGT A;  4MP4 A;  2LNS A;  2X8C A;  4OFM A;  4PNF A;  5L71 A;  4K7I A;  2X49 A;  3QCP A;  3HJO A;  4ZIJ A;  1EGO A;  5B7C A;  3IHG A;  5G1K A;  3FKF A;  1R7H A;  1XFL A;  4KW6 A;  3C1R A;  1ZYQ B;  2R4V A;  5ELA A;  1JFU A;  4L0U A;  4MJE A;  2L5L A;  1YQ1 A;  3LXZ A;  4DVC A;  1SD9 A;  5BRT A;  2H74 A;  4IKH A;  2KUC A;  1K0M A;  1YJ6 A;  5F8B A;  2YCD A;  2CZ2 A;  2VL3 A;  4V2L A;  3FY7 A;  3HHV A;  2LV3 A;  4POL A;  3FYG A;  1F3A A;  5KN3 A;  4GSN A;  4BIK A;  1GSS A;  3EWL A;  4ZL9 A;  2MMA A;  4IGJ A;  2GTU A;  2DJ0 A;  4N0Z A;  1TRW A;  2FUG 2;  1TXX A;  2F8F A;  4OMV A;  2K9F A;  4LMV A;  2C0F A;  3HZ4 A;  4YKF A;  1TJD A;  2H0G A;  2IFQ B;  2L4C A;  3KD0 A;  4ILF A;  5CRG A;  1PN9 A;  1RW1 A;  5ECQ B;  3GKK A;  4FYC A;  1HNB A;  1ZCP A;  2C0G A;  5G30 A;  3NIV A;  3QMX A;  1S3A A;  1B48 A;  5D73 A;  1GP1 A;  3EMX A;  4PUA A;  3K8N A;  4KA0 A;  1QGV A;  1X9W B;  3VPQ A;  5E4W A;  3GL3 A;  1V40 A;  3C71 A;  3GV1 A;  3F6D A;  3P7X A;  1OE7 A;  2VO4 A;  3L0H A;  1Z7P A;  3WGE A;  4EIQ A;  3RPN A;  3CMI A;  1AUC A;  4TXO A;  1XXU A;  6GSV A;  4XS1 A;  4EKZ A;  1XWG A;  1ST9 A;  2XBI A;  5CRE A;  2H6Z A;  1JZD A;  1O6J A;  4IP1 A;  3UL3 A;  2OAD A;  2P5Q A;  3TKS C;  3FK8 A;  1SD8 A;  1XVW A;  2YJH A;  1SK2 A;  3W8S A;  1PL2 A;  1G6Y A;  5IMF A;  3CQF A;  1SL1 B;  2K8S A;  4JE1 A;  2E2G A;  3GTU B;  4EXJ A;  3D22 A;  2V2G A;  1A23 A;  2DJ1 A;  4V2M A;  2A2P A;  2HFD A;  4KND A;  1AXD A;  3LYP A;  1G6W A;  5ECK B;  4BVX A;  2EIQ A;  1N8J A;  5ECL B;  4EIP A;  1MDI A;  10GS A;  1Z3E A;  3D0Z A;  1R5A A;  1ZGN A;  4POK A;  4ZL8 A;  2J23 A;  2CAI A;  2TRX A;  1M99 A;  2PUK C;  1GLP A;  5C04 A;  3GKX A;  3JCM L;  2ON7 A;  3GYK A;  4X1U A;  2I1U A;  2I9H A;  1WE0 A;  3EC3 A;  3UBK A;  2LJA A;  1S3C A;  2MMN A;  4KDX A;  4GWR A;  2ZUP A;  2OE3 A;  4NV5 A;  5F07 A;  2H8L A;  2VL2 A;  3EYT A;  1PGT A;  4JU5 A;  3I6A A;  2F8A A;  2VIM A;  6GST A;  1R26 A;  5E59 A;  3IRA A;  5EPF A;  2OBI A;  2AAW A;  1X5D A;  1G7E A;  1THO A;  2DJ2 A;  3AY8 A;  1OYJ A;  2HZF A;  2FA8 A;  5GAN D;  2GSS A;  1XW6 A;  4OCF A;  2A4H A;  3KIJ A;  4F82 A;  4LL4 B;  5D9X A;  4EL1 A;  4FH8 A;  4NHW A;  2LKU A;  1YF1 A;  11GS A;  2GGT A;  2MMZ A;  5B6M A;  4XS4 B;  2VLV A;  3ZVJ D;  5ECH B;  2KP1 A;  3TKR A;  1X5C A;  4K5R A;  3H79 A;  3KJY A;  1V58 A;  3D5J A;  2QSI A;  1NM3 A;  1B9Y C;  1YY7 A;  3UMA A;  2H6X A;  3W6G A;  3KMN A;  2C8U A;  2RUE A;  6GSW A;  2CQ9 A;  2HT9 A;  4ZBD A;  2JSZ A;  4BWS A;  3HJM A;  3IAS 2;  3U6V A;  1XVQ A;  4MAB A;  4KCE A;  3CSH A;  2CT6 A;  3IXR A;  3UOM A;  4KGI A;  1MTC A;  2AYT A;  1QMV A;  3L9V A;  1FVK A;  2H1D A;  1TP9 A;  2PGT A;  22GS A;  3D6I A;  4Q5R A;  1OC3 A;  3TRX A;  3LJR A;  4Z2R A;  2V32 A;  1XWB A;  1A24 A;  5KN2 A;  3TRQ A;  5ID2 B;  3GX8 A;  2L6C A;  4WKW A;  2CVD A;  4YKG A;  5IQY A;  4PNG A;  1PKW A;  1OC9 B;  3ZVJ A;  2B5Y A;  3GUR A;  3Q19 A;  1XWC A;  5IO2 A;  3CTG A;  1SJZ A;  2LEG A;  3GIX A;  3FZA A;  4POB A;  4NHZ A;  1FO5 A;  4MNN A;  4GLT A;  3QFA C;  1SKR B;  2KLX A;  2X4A A;  4MH2 A;  3TJK A;  4PUF C;  1OC8 A;  4MLY A;  5D96 A;  3NZN A;  3G7J A;  2RII A;  1YEX A;  2HI7 A;  2DML A;  2IFQ A;  1O7U A;  5DBQ A;  2JL4 A;  4X4J A;  4IHU A;  1FG4 A;  1PRX A;  5A4V A;  2HXK A;  3LQ7 A;  1N2A A;  2CX4 A;  2MYG A;  2E7P A;  1T3B A;  3HVX A;  1PKZ A;  2AJQ B;  4XCS A;  3F0I A;  3HDC A;  2ON5 A;  2QKE A;  2P0G A;  2HRF A;  2XHF A;  3F4S A;  5F06 A;  3CRT A;  4N10 A;  1XBS A;  4NPB A;  4N11 A;  2CVK A;  3M1G A;  1A8L A;  3GKN A;  3UVH A;  4AJ6 A;  5J5N A;  3DXB A;  2FWE A;  4IEL A;  4V1A g;  1NW2 A;  5HFG A;  1J0F A;  2VCQ A;  3EMP A;  1H4O A;  3UBL A;  4LA1 A;  2O85 A;  4OO5 A;  2GZY A;  5D9V A;  4KSO A;  4Q5N A;  4ML1 A;  3GTU A;  2PN8 A;  1HNC A;  5GAP D;  1TK0 B;  4F9Z A;  1AAZ A;  1BX9 A;  4CY6 A;  1ZL9 A;  4EVM A;  3QFB C;  1ON4 A;  4AJ7 A;  5AIV A;  3N9J A;  4G9H A;  3ZYW A;  1QFN A;  4I6X A;  1GUL A;  3A5W A;  3LGC A;  3TRP A;  1WRY A;  5JWQ B;  2WGR A;  4TVE A;  4WEY A;  1T4Z A;  1OVN A;  2FNO A;  4HJM A;  2PPT A;  2CZ3 A;  1ZOF A;  4HSC X;  1WWJ A;  4MA9 A;  1SL2 B;  5INY A;  2CX3 A;  4P3Y B;  5CRW A;  4ZBB A;  4RUV A;  14GS A;  2WB9 A;  3TOT A;  1Q4J A;  4FO5 A;  4G19 A;  3TKP A;  3GA4 A;  3GNJ A;  3CBU A;  2GST A;  5KEJ A;  2N5A A;  3ZML A;  1IYI A;  1GUK A;  1X9M B;  4ID0 A;  3V1W A;  3PH9 A;  3ZIJ A;  2MBT A;  2VLT A;  4FYU A;  3L78 A;  2V1M A;  5ECR B;  1BJX A;  3KGK A;  3DD3 A;  1Y25 A;  3CYN A;  5FHI A;  3IK9 A;  4JRR A;  3GL5 A;  4XS4 A;  2QGV A;  4G0K A;  5AIS A;  2M80 A;  3KTB A;  5JWO B;  1GTU A;  3APQ A;  2M72 A;  4RQX A;  5IMV A;  5HR3 A;  4MPF A;  5ECN B;  3H4K A;  4ZB8 A;  3TJJ A;  5IPH A;  3EU3 A;  4FYB A;  1XZO A;  2H6Y A;  2OAC A;  2LRC A;  2WCI A;  2C4J A;  4AGS A;  5G5F A;  3QOU A;  2B1L A;  4TOP A;  1HNA A;  4XTS A;  1XCC A;  5ECO B;  1ZZY A;  3I9V 2;  2HNL A;  2VL9 A;  5EVO A;  1LU4 A;  2H1B A;  3GH6 A;  5HR1 A;  4IBP A;  2YZU A;  2FGX A;  3E3E A;  3SBC A;  4H86 A;  1RQM A;  3MWH A;  4ECI A;  4HS1 A;  4XIH A;  5ID2 A;  3GMF A;  2DIZ A;  2PER A;  2FY6 A;  2YV9 A;  1EP7 A;  3ZTL A;  1OC9 A;  3DEX A;  2YP6 A;  1LBK A;  4ECJ A;  4XS6 A;  4YQV A;  2CA8 A;  3IC4 A;  5F0G A;  3GFK A;  4G10 A;  2LS5 A;  1FOV A;  4HUA A;  4G0L A;  2R3X A;  4PQH A;  1SK0 A;  3Q6O A;  1DE1 A;  3DVX A;  2OE0 A;  2PVO C;  2NTO A;  3KZQ A;  1K0N A;  1K3O A;  2V6O A;  4YAP A;  5ECP B;  5G1L A;  4PQI A;  1FB6 A;  3KP9 A;  2LQQ A;  5CRD A;  1PQN A;  3M9K A;  1XW9 A;  1AW9 A;  13GS A;  3KP8 A;  3KCM A;  2LNT A;  4HI7 A;  2B5X A;  3FRC A;  3BCI A;  1FAA A;  1JLV A;  3QD9 A;  3UVT A;  1TKD B;  1MDJ A;  2VL2 C;  2IMK A;  1J9B A;  5IM9 A;  4G0I A;  4ACS A;  2B3S A;  5J4U A;  5G5E A;  1KNG A;  4CHS A;  4O5U A;  4BWQ A;  4F03 A;  4IQA A;  1OKT A;  3TCO A;  3D4T A;  1M3I A;  1BG5 A;  3IDV A;  2H19 A;  4X0X A;  4ZBA A;  4IJI A;  1Z5Y E;  5CRH A;  3HZ8 A;  4K8M A;  4WXT A;  3ZFB A;  4FIW A;  4EO3 A;  2WUL A;  4PQ1 A;  1BQ7 A;  2YN1 A;  1SL0 B;  1XPV A;  1PSQ A;  3IAM 2;  1GUM A;  1K0D A;  3EPT A;  4OD7 A;  5HFK A;  4K1F A;  3A5I A;  2IIY A;  3EVI A;  3QAW A;  2JU5 A;  4GQC A;  3M3M A;  1M9A A;  5BMU A;  1Q98 A;  1WJK A;  4ULX A;  2IPA A;  3L4N A;  3IBH A;  3IV4 A;  4USS A;  4JBB A;  3CTF A;  5D93 A;  3GH9 A;  1U3A A;  1Z6N A;  1YKA A;  2REM A;  1K0A A;  2LRT A;  2K18 A;  2QA1 A;  2OE1 A;  3ZIT A;  4IVF A;  4QQ7 A;  3LG6 A;  4POM A;  1OKD A;  2JAC A;  1GWC A;  3P8W A;  3ZIV A;  16GS A;  1ERW A;  4WET A;  1JLW A;  3MSZ A;  1ACV A;  3TUE A;  3UAP A;  2CV4 A;  2R37 A;  3RPP A;  4MF6 A;  1TRU A;  1WIK A;  4F0B A;  1GRX A;  2D2Z A;  1XG8 A;  2F9S A;  5G2Z A;  5GST A;  3DRN A;  2R6K A;  4KDU A;  2VM1 A;  2IN3 A;  4L5L A;  4E8H A;  1A2L A;  3CSJ A;  3IA1 A;  1JZW A;  3ZZX A;  5F05 A;  2HYX A;  3C1S A;  2BTO T;  4L5O A;  3L9U A;  5KOW A;  4Z7X A;  3IE3 A;  1M2D A;  4CY8 A;  1T4Y A;  3QDN A;  1THX A;  4NAX A;  4WBR D;  3IHQ A;  3US3 A;  1JHB A;  3DML A;  5KN0 A;  4MF5 A;  3VWU A;  1MDK A;  2FHE A;  4MZB A;  4K7O A;  2H66 A;  4RI7 A;  1R4W A;  3I43 A;  4F0C A;  4O5R A;  4CW9 A;  4MZC A;  3UEM A;  2BMX A;  4HZ4 A;  1FOH A;  3EIN A;  2LJK A;  3WD6 A;  5CAX A;  4ZXG A;  4K5S A;  4QL9 A;  1DBY A;  2IMD A;  5J3R A;  1SYR A;  2ZNM A;  1GL8 A;  5B8B A;  2VM2 A;  2HE3 A;  4K2X A;  3M8N A;  2FWG A;  4JED A;  4JR4 A;  3IOS A;  4ZB9 A;  4K6X A;  2HRA A;  1ZYN A;  5A4U A;  5DJL A;  2ALB A;  2HLS A;  2R2J A;  2YWI A;  2WS2 A;  4WR4 A;  1A0F A;  3O76 A;  1A8Y A;  1JZO A;  2C1Y A;  3ERW A;  1EOH A;  4I2T A;  2P31 A;  4HDE A;  5AIX A;  4IS0 A;  2H70 A;  4HZ2 A;  3TOU A;  3OR5 A;  5JCW A;  4WF4 A;  1X0R A;  1O8X A;  3RHC A;  4OCE A;  2GQM A;  3R2Q A;  1VF4 A;  3MIX A;  4PXO A;  1SJI A;  1K0O A;  1A2J A;  1O81 A;  2JZR A;  1FVJ A;  1XWK A;  1PN0 A;  3FR9 A;  2X8G A;  4ECB A;  4NMU A;  3RHB A;  2C80 A;  3UJ1 A;  1M9B A;  5G31 A;  2AHE A;  2G0F A;  3R3E A;  3W8J A;  3UAR A;  3QR6 A;  4TR4 A;  4IQ1 A;  2B1K A;  3HVN A;  4XHM A;  3VLN A;  1B8X A;  1UA5 A;  3N5O A;  2UZ8 A;  4L8E A;  4DSS B;  1U88 A;  1V98 A;  4GXZ A;  4N30 A;  3HXS A;  1Z9H A;  3Q18 A;  1FHE A;  5KOX A;  1K3Y A;  1BED A;  2FWF A;  2YWO A;  4KH7 A;  3ZRD A;  3D21 A;  2N5F A;  3ERG A;  19GS A;  3H8Q A;  1F2E A;  3HVV A;  2R0C A;  3BCK A;  5ECS A;  2PMT A;  4TR3 A;  2GQK A;  1HD2 A;  2R5G A;  1ML6 A;  5IMD A;  1AQV A;  1GTI A;  2H72 A;  5JWR B;  4V2N A;  3L9S A;  2KP2 A;  4AF2 A;  3PIN A;  5IO0 A;  2H0H A;  4GTU A;  3LWA A;  4GF0 A;  3DYR A;  2DLX A;  2DBC A;  5LNK e;  2GZP A;  4F2I A;  1K0C A;  4BVY B;  3M0F A;  2B5E A;  4K0N A;  4ISD A;  2WDU A;  4BL7 B;  4GSS A;  2TRC P;  4GCI A;  2V6K A;  2DKH A;  2X8H A;  2E2M A;  3ERF A;  1V2A A;  1SU9 A;  5JCG A;  3RDW A;  3FZ5 A;  3WGX A;  2C3T A;  3GUS A;  2H0I A;  5GZZ B;  1TRS A;  1M2B A;  3HA9 A; 
#chains in the Genus database with same CATH homology
 2VCV A;  2RM6 A;  4ZB6 A;  1UC7 A;  3ME8 A;  4FQU A;  1UVZ A;  1B4P A;  3GX0 A;  4K2D A;  2DJJ A;  2KHP A;  2HRK A;  5B8A A;  2VAF A;  12GS A;  4A5P A;  1K3L A;  4BA7 A;  1XW5 A;  2LTK A;  1TRV A;  1SYX A;  1EGR A;  1QK8 A;  4WR5 A;  4EDY A;  1URM A;  3UIW A;  2LQO A;  1VGL A;  3HKR A;  2OA7 A;  2EIR A;  2L4Q A;  4YH2 A;  2C0E A;  5COH A;  3TJG A;  4NXI A;  5IOW A;  2L57 A;  1XIY A;  3QPM A;  2P5R A;  2DMM A;  3S9F A;  1AC1 A;  1EOG A;  1ERU A;  5A5K A;  1PMT A;  2L59 A;  3F3R A;  3CXG A;  1XOA A;  1GSU A;  3ZL5 A;  3A2V A;  4MCU A;  3F4T A;  2AB6 A;  4MJC A;  1AIU A;  1G0T A;  1RK4 A;  2B7K A;  2WRT A;  4MJB A;  4J2F A;  2XPE A;  4OFN A;  1TTZ A;  6GSU A;  5EY6 A;  4TR1 B;  4KDY A;  3IPZ A;  2GQL A;  2F51 A;  2RUF A;  5DCG A;  1A2M A;  3BBY A;  2BJX A;  4ICY A;  5HR2 A;  3G9B A;  1WPI A;  2IL3 A;  1U3I A;  8GSS A;  1J08 A;  1G7O A;  1AQX A;  1UN2 A;  4PX1 A;  4J57 E;  2YAN A;  2H76 A;  4KCA A;  2A2R A;  4K7N A;  4XRD A;  5GSS A;  1T7P B;  2I3Y A;  1Z7R A;  4JR6 A;  1ZYE A;  2VLU A;  3TJB A;  4TXV A;  2LST A;  1GTA A;  1GLQ A;  1TI3 A;  1GUH A;  3GSS A;  2YZH A;  2EC4 A;  1WP0 A;  1VRS D;  1F37 A;  4ZL7 A;  3BD2 A;  1B9X C;  1NHY A;  4HQZ A;  2HSH A;  1BAY A;  1CQH A;  4YQU A;  3DWV A;  2J9H A;  4N0V A;  1EEM A;  2O89 A;  3VWW A;  3I69 A;  4J56 E;  2FA4 A;  1KTE A;  4I5Q A;  4D73 B;  1S3D A;  1OE8 A;  4TN8 A;  3ME7 A;  2DSA A;  4G2E A;  2YWN A;  1QXH A;  2XC2 A;  3M9J A;  1M7T A;  5FWG A;  2VD1 A;  2HRN A;  2M46 A;  1F6M C;  1WOU A;  5CNW A;  3D4M A;  1CQG A;  3C73 A;  3CRU A;  1E6B A;  4DSS A;  1TOF A;  5AGY A;  3FZ9 A;  3LYK A;  3KH9 A;  4GRF A;  1U6T A;  5IMZ A;  3LSZ A;  2JZS A;  1GSE A;  4RI6 A;  5LCZ A;  3F6F A;  4MMM A;  1MD4 A;  2OBK A;  3LFL A;  2FCH A;  2C3N A;  3SWL A;  4O7H A;  2VUP A;  3A2X A;  4KX4 A;  4KSM A;  1HQO A;  3TGZ A;  3VK9 A;  1KEB A;  4MZW A;  3O6T A;  2B6M A;  2XBQ A;  1SJ6 A;  3DKS A;  2MBS A;  4BPY A;  3TKS E;  3EUR A;  1O8W A;  6GSX A;  2VD0 A;  2LJR A;  3KEB A;  2OKA A;  4BVY A;  4HU9 A;  1IYH A;  2E0Q A;  2YOI A;  1DE2 A;  1VF3 A;  2FWH A;  1T00 A;  1T1V A;  3VUR A;  2NPB A;  4BL7 A;  4TW5 A;  3TB2 A;  3VI5 A;  2A2S A;  4LMW A;  1XOB A;  2IWT A;  2K8V A;  4LL1 B;  2N5B A;  1B4Q A;  4MDC A;  1VF1 A;  1QUW A;  1ILO A;  1EV4 A;  2DIY A;  3FW2 A;  3MYD A;  1X5E A;  1I9D A;  4I2U A;  5ABR A;  1LJR A;  2GT6 A;  2YV7 A;  5HR0 A;  1GNE A;  1SK1 A;  1TK5 B;  5ECM B;  3F3Q A;  4IN0 A;  2VCT A;  2A4V A;  2YPM A;  5DDL A;  18GS A;  2NVL A;  2GZZ A;  1PD2 1;  4IP6 A;  5KN1 A;  1GSF A;  1V9W A;  4HEA 2;  2L6D A;  2O7K A;  3GKM A;  3KTL A;  2DKI A;  2R0G A;  4MPG A;  4TR0 A;  5ECI B;  3WYW A;  6GSS A;  3VI7 A;  3ED3 A;  3F63 A;  9GSS A;  3FHK A;  1F3B A;  1WMJ A;  2JAD A;  5A4W A;  1GSY A;  1EV9 A;  4Z2U A;  4AJ8 A;  1A0R P;  4KB3 A;  2TIR A;  1VF2 A;  4TRX A;  5IMA A;  4CDO A;  4DSQ A;  3KH7 A;  3BOA A;  2G2Q A;  2JZT A;  3F8U A;  4HU7 A;  2HSY A;  1MEK A;  3HJP A;  2OJL A;  2IME A;  2ZCT A;  1YZX A;  4YAV A;  3HY2 A;  3HVS A;  3FR6 A;  2H75 A;  5ELG A;  3C7M A;  5IPG A;  4E8E A;  4KE3 A;  2GDR A;  3G7Y A;  4KAE A;  2H30 A;  3LW9 A;  2X99 A;  1C72 A;  4Z2T A;  2C0D A;  5J9B A;  1SKW B;  4TR1 A;  4OFT A;  5ENU A;  2DJ3 A;  5DQS A;  2VCZ A;  3LEF A;  3APS A;  3VFI A;  1GH2 A;  1U87 A;  5DAL B;  5DAK B;  2YWM A;  4OO4 A;  3MDK A;  3QAV A;  3A2W A;  5H5R A;  3TKS A;  4WBJ A;  1H75 A;  2NBS A;  1O85 A;  4XRA A;  3FR3 A;  3TJF A;  3LOR A;  1DSB A;  2VCW A;  2CVB A;  1YDK A;  3KMO A;  5J41 A;  2B7J A;  4ECC A;  1M0U A;  2GVP A;  4DEJ A;  1HYU A;  3DVW A;  1EZK A;  2I81 A;  7GSS A;  4HOJ A;  3ZLP A;  5J9C A;  1YEP A;  4OWY A;  1GNW A;  5HFI A;  2HZE B;  4IJ3 A;  3IR4 A;  1FB0 A;  2L5O A;  1E2Y A;  3F9U A;  2X64 A;  2VOC A;  2LRN A;  2H01 A;  4PTS A;  2ES7 A;  2GSQ A;  3ZFL A;  2H71 A;  3MAK A;  3E9J B;  4KF9 A;  5H5S A;  4QL7 A;  3VWV A;  5CP1 A;  3O3T A;  2YJ7 A;  4TKY A;  1SKS B;  2QA2 A;  2HSM A;  3DIE A;  3FMW A;  1W89 A;  1TK8 B;  1ABA A;  2R0P A;  4JZQ A;  4K0G A;  4D73 A;  2Z9S A;  1GTB A;  4NV2 A;  1PL1 A;  2NDO A;  1OAZ A;  5DCH A;  1QQ2 A;  2IJY A;  4X43 A;  1AQW A;  3P2A A;  3WT2 A;  4ZIL A;  3HCZ A;  1F9M A;  4PGT A;  2MMO A;  2I4A A;  1I5G A;  5DQY A;  5D9W A;  3ISO A;  5CO3 A;  3U5R E;  3H1N A;  3J7Y k;  1O73 A;  1PX7 A;  1DUG A;  3G7I A;  1FW1 A;  5DVB A;  4PUR A;  2LUS A;  1YKC A;  4NWY A;  2GT5 A;  3FEU A;  2RM5 A;  2V41 A;  4MH3 A;  3GRX A;  4EDZ A;  1ZMA A;  3KM6 A;  3ZMK A;  2PWJ A;  4I97 A;  4V1A p;  3DGQ A;  2F3M A;  3FZ4 A;  1YF0 A;  3RAZ A;  3BJ5 A;  5FT3 A;  3GN3 A;  4I8B A;  2AUV A;  3PPU A;  2WJU A;  2FD3 A;  1TDI A;  2DC5 A;  20GS A;  3NOF A;  3Q74 A;  4O32 A;  1K0B A;  2RLI A;  3RBT A;  3TDG A;  5HQP A;  3EE2 A;  2H1G A;  4LLR A;  2XPD A;  2FLS A;  3WT1 A;  2H73 A;  2YNX A;  5IOX A;  4TXO B;  1USB A;  5C00 A;  5IIZ A;  4MK3 A;  3E0U A;  1ERV A;  4DSR A;  3CSI A;  3MNG A;  4GST A;  5EL8 A;  2JSY A;  5AN1 A;  1V57 A;  2PU9 C;  1X9S B;  1GSQ A;  4HJ2 A;  1TU7 A;  1MD3 A;  2KOK A;  3EU4 A;  1KBN A;  4YQM A;  3PR8 A;  4EF0 A;  1TW9 A;  3IK7 A;  1EWX A;  2GS3 A;  1PX6 A;  4KUN A;  17GS A;  4Q5Q A;  2MZC A;  2IMF A;  1ZYP A;  2QC7 A;  1M2A A;  3F4R A;  3J7Y b;  1PA3 A;  4BVX B;  3LXT A;  2H1A A;  3TKQ A;  4L0W A;  4EC0 A;  4MF7 A;  2C3Q A;  1EEJ A;  2O87 A;  3IC8 A;  2GSR A;  2O8V B;  3HYP A;  1TI1 A;  1R5P A;  5D9T A;  1GSD A;  3QAG A;  2AV4 A;  3C8E A;  2GLR A;  1Y6E A;  3H93 A;  2DJK A;  3A3T A;  1SEN A;  2VCX A;  1W4V A;  4EE0 A;  5DJM A;  2IMI A;  4O5Q A;  5IMC A;  5JCU A;  5LD0 A;  1JZR A;  1EP8 A;  2K6V A;  3VWX A;  4RQR A;  4IW9 A;  4EUY A;  1Z6M A;  6GSY A;  2PBJ A;  1TU8 A;  3GST A;  5DAL A;  5DAK A;  5D8I A;  2EIO A;  3VPT A;  4MJA A;  3GHA A;  1BYE A;  4HQS A;  2PVQ A;  4WF5 A;  5B6N A;  5H5Q A;  3WGD A;  4ML6 A;  2CAQ A;  1ERT A;  3HD5 A;  4Q5F A;  4O92 A;  1NHO A;  1XWA A;  3ZRE A;  3APO A;  1NSW A;  2WZ9 A;  2HZE A;  3KXO A;  2WFC A;  4GQF A;  3P90 A;  1T8E B;  4K9Z A;  5CYY A;  3PGT A;  4MP4 A;  2LNS A;  2X8C A;  4OFM A;  4PNF A;  5L71 A;  4K7I A;  2X49 A;  3QCP A;  3HJO A;  4ZIJ A;  1EGO A;  5B7C A;  3IHG A;  5G1K A;  3FKF A;  1R7H A;  1XFL A;  4KW6 A;  3C1R A;  1ZYQ B;  2R4V A;  5ELA A;  1JFU A;  4L0U A;  4MJE A;  2L5L A;  1YQ1 A;  3LXZ A;  4DVC A;  1SD9 A;  5BRT A;  2H74 A;  4IKH A;  2KUC A;  1K0M A;  1YJ6 A;  5F8B A;  2YCD A;  2CZ2 A;  2VL3 A;  4V2L A;  3FY7 A;  3HHV A;  2LV3 A;  4POL A;  3FYG A;  1F3A A;  5KN3 A;  4GSN A;  1GSS A;  3EWL A;  4ZL9 A;  2MMA A;  4IGJ A;  2GTU A;  2DJ0 A;  4N0Z A;  1TRW A;  2FUG 2;  1TXX A;  2F8F A;  4OMV A;  2K9F A;  4LMV A;  2C0F A;  3HZ4 A;  4YKF A;  1TJD A;  2H0G A;  2IFQ B;  2L4C A;  3KD0 A;  4ILF A;  5CRG A;  1PN9 A;  1RW1 A;  5ECQ B;  3GKK A;  4FYC A;  1HNB A;  1ZCP A;  2C0G A;  5G30 A;  3NIV A;  3QMX A;  1S3A A;  1B48 A;  5D73 A;  1GP1 A;  3EMX A;  4PUA A;  3K8N A;  4KA0 A;  1QGV A;  1X9W B;  3VPQ A;  5E4W A;  3GL3 A;  1V40 A;  3C71 A;  3GV1 A;  3F6D A;  3P7X A;  1OE7 A;  2VO4 A;  3L0H A;  1Z7P A;  3WGE A;  4EIQ A;  3RPN A;  3CMI A;  1AUC A;  4TXO A;  1XXU A;  6GSV A;  4XS1 A;  4EKZ A;  1XWG A;  1ST9 A;  2XBI A;  5CRE A;  2H6Z A;  1JZD A;  1O6J A;  4IP1 A;  3UL3 A;  2OAD A;  2P5Q A;  3TKS C;  3FK8 A;  1SD8 A;  1XVW A;  2YJH A;  1SK2 A;  3W8S A;  1PL2 A;  1G6Y A;  5IMF A;  1SL1 B;  2K8S A;  4JE1 A;  2E2G A;  3GTU B;  4EXJ A;  3D22 A;  2V2G A;  1A23 A;  2DJ1 A;  4V2M A;  2A2P A;  2HFD A;  4KND A;  1AXD A;  3LYP A;  1G6W A;  5ECK B;  4BVX A;  2EIQ A;  1N8J A;  5ECL B;  4EIP A;  1MDI A;  10GS A;  1Z3E A;  3D0Z A;  1R5A A;  1ZGN A;  4POK A;  4ZL8 A;  2J23 A;  2CAI A;  2TRX A;  1M99 A;  2PUK C;  1GLP A;  5C04 A;  3GKX A;  3JCM L;  2ON7 A;  3GYK A;  4X1U A;  2I1U A;  2I9H A;  1WE0 A;  3EC3 A;  3UBK A;  2LJA A;  1S3C A;  2MMN A;  4KDX A;  4GWR A;  2ZUP A;  2OE3 A;  4NV5 A;  5F07 A;  2H8L A;  2VL2 A;  3EYT A;  1PGT A;  4JU5 A;  3I6A A;  2F8A A;  2VIM A;  6GST A;  1R26 A;  5E59 A;  3IRA A;  5EPF A;  2OBI A;  2AAW A;  1X5D A;  1G7E A;  1THO A;  2DJ2 A;  3AY8 A;  1OYJ A;  2HZF A;  2FA8 A;  5GAN D;  2GSS A;  1XW6 A;  4OCF A;  2A4H A;  3KIJ A;  4F82 A;  4LL4 B;  5D9X A;  4EL1 A;  4FH8 A;  4NHW A;  2LKU A;  1YF1 A;  11GS A;  2GGT A;  2MMZ A;  5B6M A;  4XS4 B;  2VLV A;  3ZVJ D;  5ECH B;  2KP1 A;  3TKR A;  1X5C A;  4K5R A;  3H79 A;  3KJY A;  1V58 A;  3D5J A;  2QSI A;  1NM3 A;  1B9Y C;  1YY7 A;  3UMA A;  2H6X A;  3W6G A;  3KMN A;  2C8U A;  2RUE A;  6GSW A;  2CQ9 A;  2HT9 A;  4ZBD A;  2JSZ A;  4BWS A;  3HJM A;  3IAS 2;  3U6V A;  1XVQ A;  4MAB A;  4KCE A;  3CSH A;  2CT6 A;  3IXR A;  3UOM A;  4KGI A;  1MTC A;  2AYT A;  1QMV A;  3L9V A;  1FVK A;  2H1D A;  1TP9 A;  2PGT A;  22GS A;  3D6I A;  4Q5R A;  1OC3 A;  3TRX A;  3LJR A;  4Z2R A;  2V32 A;  1XWB A;  1A24 A;  5KN2 A;  3TRQ A;  5ID2 B;  3GX8 A;  2L6C A;  4WKW A;  2CVD A;  4YKG A;  5IQY A;  4PNG A;  1PKW A;  1OC9 B;  3ZVJ A;  2B5Y A;  3GUR A;  3Q19 A;  1XWC A;  5IO2 A;  3CTG A;  1SJZ A;  2LEG A;  3GIX A;  3FZA A;  4POB A;  4NHZ A;  1FO5 A;  4MNN A;  4GLT A;  3QFA C;  1SKR B;  2KLX A;  2X4A A;  4MH2 A;  3TJK A;  4PUF C;  1OC8 A;  4MLY A;  5D96 A;  3NZN A;  3G7J A;  2RII A;  1YEX A;  2HI7 A;  2DML A;  2IFQ A;  1O7U A;  5DBQ A;  2JL4 A;  4X4J A;  4IHU A;  1FG4 A;  1PRX A;  5A4V A;  2HXK A;  3LQ7 A;  1N2A A;  2CX4 A;  2MYG A;  2E7P A;  1T3B A;  3HVX A;  1PKZ A;  2AJQ B;  4XCS A;  3F0I A;  3HDC A;  2ON5 A;  2QKE A;  2P0G A;  2HRF A;  2XHF A;  3F4S A;  5F06 A;  3CRT A;  4N10 A;  1XBS A;  4NPB A;  4N11 A;  2CVK A;  3M1G A;  1A8L A;  3GKN A;  3UVH A;  4AJ6 A;  5J5N A;  3DXB A;  2FWE A;  4IEL A;  4V1A g;  1NW2 A;  5HFG A;  1J0F A;  2VCQ A;  3EMP A;  1H4O A;  3UBL A;  4LA1 A;  2O85 A;  4OO5 A;  2GZY A;  5D9V A;  4KSO A;  4Q5N A;  4ML1 A;  3GTU A;  2PN8 A;  1HNC A;  5GAP D;  1TK0 B;  4F9Z A;  1AAZ A;  1BX9 A;  4CY6 A;  1ZL9 A;  4EVM A;  3QFB C;  1ON4 A;  4AJ7 A;  5AIV A;  3N9J A;  4G9H A;  3ZYW A;  1QFN A;  4I6X A;  1GUL A;  3A5W A;  3LGC A;  3TRP A;  1WRY A;  5JWQ B;  2WGR A;  4TVE A;  4WEY A;  1T4Z A;  1OVN A;  2FNO A;  4HJM A;  2PPT A;  2CZ3 A;  1ZOF A;  1WWJ A;  4MA9 A;  1SL2 B;  5INY A;  2CX3 A;  4P3Y B;  5CRW A;  4ZBB A;  4RUV A;  14GS A;  2WB9 A;  3TOT A;  1Q4J A;  4FO5 A;  4G19 A;  3TKP A;  3GA4 A;  3GNJ A;  3CBU A;  2GST A;  5KEJ A;  2N5A A;  3ZML A;  1IYI A;  1GUK A;  1X9M B;  4ID0 A;  3V1W A;  3PH9 A;  3ZIJ A;  2MBT A;  2VLT A;  4FYU A;  3L78 A;  2V1M A;  5ECR B;  1BJX A;  3KGK A;  3DD3 A;  1Y25 A;  3CYN A;  5FHI A;  3IK9 A;  4JRR A;  3GL5 A;  4XS4 A;  2QGV A;  4G0K A;  5AIS A;  2M80 A;  3KTB A;  5JWO B;  1GTU A;  3APQ A;  2M72 A;  4RQX A;  5IMV A;  5HR3 A;  4MPF A;  5ECN B;  3H4K A;  4ZB8 A;  3TJJ A;  5IPH A;  3EU3 A;  4FYB A;  1XZO A;  2H6Y A;  2OAC A;  2LRC A;  2WCI A;  2C4J A;  4AGS A;  5G5F A;  3QOU A;  2B1L A;  4TOP A;  1HNA A;  4XTS A;  1XCC A;  5ECO B;  1ZZY A;  3I9V 2;  2HNL A;  2VL9 A;  5EVO A;  1LU4 A;  2H1B A;  3GH6 A;  5HR1 A;  4IBP A;  2YZU A;  2FGX A;  3E3E A;  3SBC A;  4H86 A;  1RQM A;  3MWH A;  4ECI A;  4HS1 A;  4XIH A;  5ID2 A;  3GMF A;  2DIZ A;  2PER A;  2FY6 A;  2YV9 A;  1EP7 A;  3ZTL A;  1OC9 A;  3DEX A;  2YP6 A;  1LBK A;  4ECJ A;  4XS6 A;  4YQV A;  2CA8 A;  3IC4 A;  5F0G A;  3GFK A;  4G10 A;  2LS5 A;  1FOV A;  4HUA A;  4G0L A;  2R3X A;  4PQH A;  1SK0 A;  3Q6O A;  1DE1 A;  3DVX A;  2OE0 A;  2PVO C;  2NTO A;  3KZQ A;  1K0N A;  1K3O A;  2V6O A;  4YAP A;  5ECP B;  5G1L A;  4PQI A;  1FB6 A;  3KP9 A;  2LQQ A;  5CRD A;  1PQN A;  3M9K A;  1XW9 A;  1AW9 A;  13GS A;  3KP8 A;  3KCM A;  2LNT A;  4HI7 A;  2B5X A;  3FRC A;  3BCI A;  1FAA A;  1JLV A;  3QD9 A;  3UVT A;  1TKD B;  1MDJ A;  2VL2 C;  2IMK A;  1J9B A;  5IM9 A;  4G0I A;  4ACS A;  2B3S A;  5J4U A;  5G5E A;  1KNG A;  4CHS A;  4O5U A;  4BWQ A;  4F03 A;  4IQA A;  1OKT A;  3TCO A;  3D4T A;  3IDV A;  1BG5 A;  2H19 A;  4X0X A;  4ZBA A;  4IJI A;  1Z5Y E;  5CRH A;  3HZ8 A;  4K8M A;  4WXT A;  3ZFB A;  4FIW A;  4EO3 A;  2WUL A;  4PQ1 A;  1BQ7 A;  2YN1 A;  1SL0 B;  1XPV A;  1PSQ A;  3IAM 2;  1GUM A;  1K0D A;  3EPT A;  4OD7 A;  5HFK A;  4K1F A;  3A5I A;  2IIY A;  3EVI A;  3QAW A;  2JU5 A;  4GQC A;  3M3M A;  1M9A A;  5BMU A;  1Q98 A;  1WJK A;  4ULX A;  2IPA A;  3L4N A;  3IBH A;  3IV4 A;  4USS A;  4JBB A;  3CTF A;  5D93 A;  3GH9 A;  1U3A A;  1Z6N A;  1YKA A;  2REM A;  1K0A A;  2LRT A;  2K18 A;  2QA1 A;  2OE1 A;  3ZIT A;  4IVF A;  4QQ7 A;  3LG6 A;  4POM A;  1OKD A;  2JAC A;  1GWC A;  3P8W A;  3ZIV A;  16GS A;  1ERW A;  4WET A;  1JLW A;  3MSZ A;  1ACV A;  3TUE A;  3UAP A;  2CV4 A;  2R37 A;  3RPP A;  4MF6 A;  1TRU A;  1WIK A;  4F0B A;  1GRX A;  2D2Z A;  2F9S A;  5G2Z A;  5GST A;  3DRN A;  2R6K A;  4KDU A;  2VM1 A;  2IN3 A;  4L5L A;  4E8H A;  1A2L A;  3CSJ A;  3IA1 A;  1JZW A;  3ZZX A;  5F05 A;  2HYX A;  3C1S A;  2BTO T;  4L5O A;  3L9U A;  5KOW A;  4Z7X A;  3IE3 A;  1M2D A;  4CY8 A;  1T4Y A;  3QDN A;  1THX A;  4NAX A;  4WBR D;  3IHQ A;  3US3 A;  1JHB A;  3DML A;  5KN0 A;  4MF5 A;  3VWU A;  1MDK A;  2FHE A;  4MZB A;  4K7O A;  2H66 A;  4RI7 A;  1R4W A;  3I43 A;  4F0C A;  4O5R A;  4CW9 A;  4MZC A;  3UEM A;  2BMX A;  4HZ4 A;  1FOH A;  3EIN A;  2LJK A;  3WD6 A;  5CAX A;  4ZXG A;  4K5S A;  4QL9 A;  1DBY A;  2IMD A;  5J3R A;  1SYR A;  2ZNM A;  1GL8 A;  5B8B A;  2VM2 A;  2HE3 A;  4K2X A;  3M8N A;  2FWG A;  4JED A;  4JR4 A;  3IOS A;  4ZB9 A;  4K6X A;  2HRA A;  1ZYN A;  5A4U A;  5DJL A;  2ALB A;  2HLS A;  2R2J A;  2YWI A;  2WS2 A;  4WR4 A;  1A0F A;  3O76 A;  1A8Y A;  1JZO A;  2C1Y A;  3ERW A;  1EOH A;  4I2T A;  2P31 A;  4HDE A;  5AIX A;  4IS0 A;  2H70 A;  4HZ2 A;  3TOU A;  3OR5 A;  5JCW A;  4WF4 A;  1X0R A;  1O8X A;  3RHC A;  4OCE A;  2GQM A;  3R2Q A;  1VF4 A;  3MIX A;  4PXO A;  1SJI A;  1K0O A;  1A2J A;  1O81 A;  2JZR A;  1FVJ A;  1XWK A;  1PN0 A;  3FR9 A;  2X8G A;  4ECB A;  4NMU A;  3RHB A;  2C80 A;  3UJ1 A;  1M9B A;  5G31 A;  2AHE A;  2G0F A;  3R3E A;  3W8J A;  3UAR A;  3QR6 A;  4TR4 A;  4IQ1 A;  2B1K A;  4XHM A;  3VLN A;  1B8X A;  1UA5 A;  3N5O A;  2UZ8 A;  4L8E A;  4DSS B;  1U88 A;  1V98 A;  4GXZ A;  4N30 A;  3HXS A;  1Z9H A;  3Q18 A;  1FHE A;  5KOX A;  1K3Y A;  1BED A;  2FWF A;  2YWO A;  4KH7 A;  3ZRD A;  3D21 A;  2N5F A;  3ERG A;  19GS A;  3H8Q A;  1F2E A;  3HVV A;  2R0C A;  3BCK A;  5ECS A;  2PMT A;  4TR3 A;  2GQK A;  1HD2 A;  2R5G A;  1ML6 A;  5IMD A;  1AQV A;  1GTI A;  2H72 A;  5JWR B;  4V2N A;  3L9S A;  2KP2 A;  4AF2 A;  3PIN A;  5IO0 A;  2H0H A;  4GTU A;  3LWA A;  4GF0 A;  3DYR A;  2DLX A;  2DBC A;  5LNK e;  2GZP A;  4F2I A;  1K0C A;  4BVY B;  3M0F A;  2B5E A;  4K0N A;  4ISD A;  2WDU A;  4BL7 B;  4GSS A;  2TRC P;  4GCI A;  2V6K A;  2DKH A;  2X8H A;  2E2M A;  3ERF A;  1V2A A;  1SU9 A;  5JCG A;  3RDW A;  3FZ5 A;  3WGX A;  2C3T A;  3GUS A;  2H0I A;  5GZZ B;  1TRS A;  1M2B A;  3HA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...