4HQSA

Crystal structure of the pneumoccocal exposed lipoprotein thioredoxin sp_0659 (etrx1) from streptococcus pneumoniae strain tigr4
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
135
Chain Sequence
ADFELMGVDGKTYRLSDYKGKKVYLKFWASWCSICLASLPDTDEIAKEAGDDYVVLTVVSPGHKGEQSEADFKNWYKGLDYKNLPVLVDPSGKLLETYGVRSYPTQAFIDKEGKLVKTHPGFMEKDAILQTLKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin family protein
publication title Molecular architecture of Streptococcus pneumoniae surface thioredoxin-fold lipoproteins crucial for extracellular oxidative stress resistance and maintenance of virulence.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 38
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2012-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4hqsA00
1WPIA 4NHWA 5CYYA 4QL9A 4TR3A 1TW9A 3C8EA 2I1UA 4XS6A 2LQOA 2REMA 3GL3A 3F3QA 4NAXA 4QL7A 5AGYA 4TXOA 1V57A 1J08A 3UVHA 2CA8A 1BJXA 1OKDA 4YQVA 4AJ8A 2C3TA 3N9JA 4WF5A 4ML1A 4O32A 4MF7A 4JR4A 3WYWA 4TXVA 4LMVA 7GSSA 4IQAA 1K0AA 4KDUA 2H6ZA 3ERGA 1O73A 1PKWA 2YJHA 4MZWA 1PKZA 4IJIA 2I81A 4IELA 4XS1A 1O8XA 1GSFA 4MK3A 4H86A 2E0QA 1SU9A 3UMAA 3HKRA 1TOFA 3FZ4A 4OFMA 4Q5NA 3M9JA 4CDOA 3TDGA 2LRCA 4I2TA 1A24A 1BG5A 1PGTA 1H75A 2RUEA 2OBKA 1EGRA 5FWGA 1A2MA 4KDXA 1V9WA 4HOJA 2C0DA 3IA1A 1ZOFA 1R5PA 5CRHA 1WMJA 3CRTA 2L59A 1ON4A 2J23A 3H4KA 2DJ2A 4K0NA 3UBLA 5HR3A 2DBCA 3F9UA 3ZYWA 2B7KA 3ZITA 2H73A 4LL4B 5LNKe 1LBKA 2H01A 3LORA 2L4QA 1YQ1A 1XW9A 2P0GA 2NBSA 3Q6OA 4YAVA 5F06A 3VWWA 1DSBA 1YZXA 4O5RA 3DVXA 5KN3A 5LD0A 4L5LA 3ED3A 2I3YA 1ERTA 2FWFA 3IAM2 4RUVA 4G10A 5HQPA 2WZ9A 3ZVJA 1TK8B 5IQYA 2CAQA 1LU4A 2GT5A 4X0XA 2PWJA 1AQWA 3BCIA 2C8UA 1ILOA 3TKQA 1B9YC 3AY8A 4LA1A 4V1Ag 1ZCPA 1MEKA 1VF1A 4HDEA 2R4VA 2GGTA 3VI7A 1W4VA 1SKSB 3RPPA 3KCMA 1Z7RA 3QD9A 2MMAA 2HZEB 4KB3A 6GSYA 2TIRA 4J2FA 2ALBA 1MD4A 1SK0A 4FYBA 4IHUA 2R6KA 4FYCA 2N5AA 2H1BA 4G2EA 4BL7A 3HJPA 5G1LA 4BVXA 5F0GA 3QPMA 2X8GA 2H0HA 2LNSA 1VGLA 5JWOB 1PRXA 2CVDA 2F8AA 2DIZA 3KIJA 4Q5RA 2XPEA 2OADA 3LG6A 1C72A 4JZQA 1MDJA 6GSVA 2GDRA 2LJAA 2HZFA 3F6DA 2A4VA 2VD1A 6GSWA 2FNOA 4I6XA 3IAS2 5DVBA 1MDKA 2IMKA 2AUVA 3Q18A 2V1MA 4XTSA 3TKSC 4NV2A 4KW6A 1PL2A 2M46A 2LUSA 1YF1A 3IE3A 1F3BA 2P5QA 3L9VA 3RBTA 4HUAA 1K0NA 1ABAA 3APSA 3GHAA 5DCGA 12GSA 3CSIA 5EY6A 2HXKA 3W6GA 3WGEA 4BVYA 3GX0A 3IRAA 4BPYA 3MWHA 3D6IA 2H72A 4ULXA 1GL8A 2QGVA 1FHEA 3PR8A 3VPQA 1R7HA 2LRTA 2B7JA 2IMFA 3QDNA 2GSTA 2J9HA 2WRTA 1K0OA 3F8UA 3GH6A 1XVWA 2ES7A 3APQA 2QKEA 3IHQA 1F37A 4L5OA 2IPAA 1S3CA 3FR6A 1TRSA 4K6XA 3EE2A 3UEMA 5IMAA 2R37A 1IYIA 9GSSA 3J7Yk 1AXDA 4F82A 1Z7PA 2VM1A 5A4WA 2B3SA 2O87A 5D9XA 1EP7A 1YDKA 5DALB 4CW9A 1Z6NA 3C1SA 1GWCA 2HT9A 5JWQB 3VI5A 2CAIA 5D96A 2X99A 3ISOA 4MMMA 3GTUB 3QFBC 4PQ1A 4TKYA 5E59A 1CQGA 3P2AA 19GSA 5DAKB 2CZ2A 5CRWA 3GKMA 4LLRA 4ISDA 1T3BA 4FH8A 3VLNA 4GWRA 2KHPA 2KP1A 2FA8A 5LCZA 5D8IA 5JWRB 3H8QA 3GV1A 3O6TA 5GAND 1WWJA 3GURA 2R3XA 2DC5A 3GMFA 1B8XA 2H75A 5AISA 1X9SB 2PVOC 4FO5A 1B9XC 2MZCA 4AF2A 1FAAA 2GSQA 1S3DA 1U88A 1THOA 1USBA 5DQSA 3EYTA 2I9HA 5G31A 1T4ZA 3TOUA 1A0FA 2X64A 4ZL9A 3UVTA 3L0HA 1XW5A 3P8WA 5ABRA 4DSQA 4JE1A 1N2AA 1G0TA 5G1KA 2OE1A 2B5EA 4KNDA 5ECMB 4PNGA 1U6TA 1O81A 4OFNA 4X1UA 5J3RA 1K3LA 2VL2C 2FY6A 2H66A 3TUEA 4DVCA 1GSUA 3GKNA 4BA7A 3I69A 3W8JA 3F4TA 2G2QA 1O7UA 4N30A 2AV4A 2B1KA 3GN3A 3H93A 3TJKA 1R4WA 2X8HA 5H5RA 2WB9A 3QAVA 2P31A 1EZKA 4Q5FA 1DE2A 2PVQA 3DGQA 3WT1A 5H5QA 4PURA 1IYHA 3CXGA 2FGXA 2M72A 3D4MA 2VL2A 3A5WA 5C00A 2CZ3A 3K8NA 2O8VB 5J41A 4ID0A 4MF6A 2AYTA 3LYPA 2KUCA 1XW6A 1JZWA 1SJ6A 3A2XA 2ZCTA 2HRNA 2L5OA 1BX9A 1HNAA 5HR2A 2JU5A 1I5GA 1GUKA 4GSSA 1MD3A 1WP0A 3PH9A 1G6WA 5COHA 1I9DA 4EF0A 2H1AA 5IM9A 3ERFA 2K18A 4O7HA 1XOBA 2V6KA 3FR9A 2WCIA 4I2UA 2VM2A 2E7PA 1DE1A 3KMOA 4O92A 2ZNMA 4Z7XA 2HZEA 1OE8A 4NV5A 2X8CA 1DBYA 1XWGA 4HZ2A 3ME7A 4K7OA 3DKSA 3CBUA 3EURA 1A2LA 3MDKA 2CVKA 3DYRA 2DJKA 1XOAA 4QQ7A 2LJKA 3EWLA 3LWAA 2YZHA 3UAPA 2H6XA 5L71A 3DWVA 3IK9A 2OBIA 1K0CA 4V2MA 3DRNA 20GSA 2N5FA 3CSHA 1JHBA 3QMXA 2YNXA 4HS1A 3WD6A 4FYUA 5D9VA 4GCIA 4V2LA 5ELAA 4ZB8A 1EEJA 1XCCA 2FA4A 3KTBA 3IC4A 5GZZB 3ZREA 2XBIA 4RI6A 3KD0A 5IMZA 4ECBA 2K9FA 1TRUA 1SJZA 4MZBA 3RDWA 1FG4A 1K0BA 4WR5A 1SD9A 4XCSA 2LSTA 4IJ3A 1LJRA 4OFTA 2G0FA 4RI7A 2H0IA 3KZQA 4MJBA 1GSDA 1PMTA 3TJJA 3BD2A 3EVIA 5KN1A 3QAGA 5A4VA 1JZOA 4TRXA 1EWXA 1V98A 3EU3A 2GQMA 3IV4A 2XPDA 2RM5A 2H6YA 3M8NA 3MAKA 5DALA 3QOUA 2PPTA 3DIEA 4WR4A 4AJ7A 3LSZA 5GAPD 3M0FA 5ECLB 3GTUA 1GSYA 2IL3A 5IPGA 1SJIA 4ECJA 3D4TA 3PGTA 1F9MA 2VD0A 4MZCA 2E2MA 4PNFA 4GF0A 2YJ7A 4YH2A 4K7NA 3FKFA 4MJEA 5DAKA 4PUFC 4NWYA 4MDCA 5IO2A 1M2AA 1QMVA 2VCXA 2PBJA 4KCAA 2V2GA 4WXTA 4GLTA 2PERA 1SL1B 5B8BA 2F51A 3TKSE 1GSSA 3FZAA 4OWYA 3ZZXA 2OKAA 2WGRA 5B6MA 5GSSA 2QC7A 1PA3A 4V1Ap 4N0ZA 4DSSB 3C73A 1SK2A 2AAWA 2NVLA 3U6VA 1M9AA 2IFQA 2YWOA 6GSSA 2VL3A 2ON7A 3L4NA 3FK8A 4POMA 2C3NA 2OACA 2V32A 3ZTLA 2YWMA 3HZ4A 3NZNA 2V6OA 2XC2A 3PINA 5B6NA 1TK0B 5ECRB 1GUMA 3WGXA 5AN1A 1XWKA 4K2DA 3FZ9A 1TRVA 1U3IA 2CVBA 4POBA 2QSIA 1TJDA 1EGOA 10GSA 2LRNA 3RPNA 5CNWA 1VRSD 1V2AA 2H1GA 1Z5YE 4KGIA 2MBTA 3DMLA 5ECIB 2VIMA 1YKAA 4WETA 3LQ7A 4F2IA 3G7IA 2LV3A 2L57A 3I43A 5AIXA 3VPTA 2HSYA 3LYKA 1XXUA 4CHSA 5CO3A 1A2JA 4KA0A 3HVSA 1SENA 3SWLA 2F8FA 4MABA 3TKPA 1E6BA 1Z6MA 5IO0A 3ZFBA 2PU9C 2VLTA 1A8LA 3I9V2 3ZVJD 1GRXA 4JR6A 1KNGA 5KN2A 2LQQA 3TKSA 3TCOA 2HSHA 5ECPB 5A4UA 3E3EA 1T7PB 3CSJA 1F2EA 3HXSA 3IBHA 1PL1A 3CYNA 2GQLA 5D9WA 2ON5A 2H19A 1GSQA 2JL4A 5ID2B 2L6DA 4JRRA 1Y6EA 2A2SA 1GUHA 5EL8A 2MYGA 4BWQA 1NSWA 4LMWA 2CX4A 4KH7A 1JFUA 5CAXA 4EC0A 1V58A 2M80A 1K0MA 2C4JA 1RW1A 3KH7A 4KX4A 4XHMA 1OAZA 4MA9A 4G19A 3TOTA 4MP4A 1OC9B 3A3TA 2KLXA 2C0EA 3D0ZA 4MH3A 1UC7A 1ZYQB 1Q98A 2WJUA 4POKA 4KSOA 5D73A 2YCDA 3RHBA 1HNBA 3HJOA 4GQFA 1ZL9A 3HVXA 5JCUA 1TU8A 2R5GA 3HHVA 2HYXA 3VWVA 3HJMA 3UIWA 2VLVA 1AC1A 2EIRA 3HY2A 1AW9A 1WE0A 3EMXA 4JBBA 1NW2A 1EEMA 2V41A 2O7KA 1QUWA 4IKHA 4IP1A 4FIWA 1GTAA 3ZFLA 5JCWA 2OE3A 4PGTA 1PX7A 2NPBA 1YY7A 2K6VA 1BAYA 1PSQA 2EIQA 1J9BA 3TJFA 4OMVA 3US3A 1KTEA 2KOKA 4RQRA 3E0UA 1TP9A 4EUYA 4N10A 3RAZA 5GSTA 2VAFA 2TRCP 5D93A 5ECQB 2IFQB 5AIVA 2F3MA 1GULA 1XVQA 3Q74A 1O85A 2B6MA 1EOGA 1HQOA 1SL2B 3N5OA 2BTOT 4Q5QA 4ZB9A 5HFGA 1NM3A 4PQHA 4D73B 1PQNA 1QQ2A 1ZMAA 3F0IA 1WJKA 3DEXA 1SYXA 1VF4A 3QAWA 4IN0A 4V2NA 1ERWA 4HU7A 1A0RP 3IPZA 3UJ1A 3O3TA 3MSZA 3CMIA 4I5QA 1K3OA 2FWEA 3GH9A 3GUSA 1QXHA 3TRXA 4F03A 2GQKA 5ECKB 2GT6A 1M2DA 5IMFA 3TKRA 2VCVA 3KH9A 1BQ7A 3P90A 4F0BA 5J9BA 1GNEA 3Q19A 5IIZA 2GTUA 4TR4A 1EV9A 2JSZA 3GYKA 2FUG2 5IMCA 4XIHA 4JEDA 1FB0A 2PN8A 3KJYA 2FLSA 4GSNA 3KM6A 3ZIVA 4ILFA 2IMDA 1XWCA 18GSA 3HD5A 2GZYA 1GTBA 4TR1B 2EC4A 8GSSA 3FW2A 3GNJA 4TN8A 4DSSA 3U5RE 3W8SA 2AJQB 2JZTA 3LFLA 1EV4A 3KXOA 3G9BA 5F07A 4ZB6A 2WFCA 2F9SA 1ST9A 2I4AA 4MJAA 2B5XA 2YWNA 1ERVA 3FEUA 5B8AA 6GSXA 3LXZA 14GSA 3JCML 5FT3A 5KEJA 1NHOA 1ZGNA 1TI3A 2C80A 4AGSA 4IQ1A 4XS4B 2L6CA 3WGDA 4MF5A 4YQMA 3HYPA 3KMNA 1M2BA 3LJRA 4PX1A 2NTOA 2LEGA 5IOXA 6GSUA 5EPFA 4EXJA 2JZSA 1OKTA 4L8EA 5E4WA 4K8MA 4POLA 1YKCA 3KGKA 2H70A 1SYRA 4L0WA 2K8SA 3F63A 2JADA 2VCTA 4EE0A 5IOWA 4WBRD 2XHFA 2DMLA 4YAPA 3FYGA 1XWAA 2XBQA 2GSSA 1BYEA 2DSAA 4LL1B 5C04A 3ZMLA 1CQHA 5DDLA 3GL5A 3GRXA 3G7JA 1U87A 4HJMA 1T4YA 1URMA 1GTIA 4E8EA 1ZYEA 4GQCA 1X0RA 4MLYA 4EL1A 5HFKA 3VWUA 3ERWA 2RLIA 1UVZA 2HE3A 2MBSA 2VCZA 4P3YB 5ID2A 1HD2A 4L0UA 1S3AA 1Y25A 4TOPA 1RQMA 3QCPA 3M1GA 2H0GA 1FB6A 3GSTA 1YEPA 3FZ5A 2AHEA 1GLPA 17GSA 1M7TA 1OC9A 1YEXA 4MPGA 1AIUA 1SL0B 4PXOA 1PN9A 1OYJA 2VCQA 2VL9A 3TGZA 2TRXA 2N5BA 4N0VA 2AB6A 1ZZYA 4KCEA 1YJ6A 4EVMA 4NXIA 3H79A 3UOMA 1MTCA 5J4UA 1FO5A 3WT2A 1TDIA 5HR0A 3C7MA 4ZILA 1AQVA 2HLSA 2OJLA 3TJBA 1R5AA 2GS3A 5ECOB 3S9FA 1T1VA 3FR3A 1B4PA 4IBPA 2GSRA 3TB2A 6GSTA 2YV9A 1VF3A 2IJYA 3CRUA 4DEJA 5IMVA 4OCEA 2WS2A 2GZZA 4F0CA 2C3QA 3TRPA 1UA5A 3R2QA 2R2JA 4OO5A 3KEBA 4ZXGA 3FY7A 3H1NA 3LXTA 1HNCA 4BWSA 5G5EA 3HZ8A 2LJRA 3C1RA 3GX8A 3A2VA 2C1YA 4GRFA 2H76A 1OVNA 2GVPA 2HNLA 4OO4A 1NHYA 3G7YA 3EMPA 3ZIJA 5H5SA 1TXXA 2VO4A 3HDCA 3GKXA 4OD7A 2CV4A 2FCHA 2MMNA 3MNGA 3IK7A 4X43A 4D73A 1EOHA 4KAEA 3J7Yb 4KUNA 1JLVA 4G9HA 3M3MA 1F3AA 1T00A 4I97A 4K1FA 3VURA 3GIXA 5JCGA 4ACSA 3O76A 2BMXA 4HQZA 1OC3A 1GH2A 4HJ2A 2E2GA 1K0DA 3CTGA 4HZ4A 2PMTA 4YQUA 3TJGA 1YF0A 1GNWA 1SKWB 2PUKC 3FRCA 4IS0A 4GTUA 4ECIA 4N11A 3SBCA 4EO3A 3F4RA 2LTKA 5A5KA 1U3AA 2C0FA 1ERUA 5G5FA 1ACVA 3IDVA 1M9BA 3TRQA 5CP1A 5DBQA 1OC8A 2CX3A 5DJLA 3D21A 1H4OA 2YANA 4TR0A 1X5EA 1O6JA 2D2ZA 3D22A 2YOIA 3F4SA 1SK1A 1QFNA 2BJXA 4E8HA 3EU4A 4ZL7A 5CRGA 4TXOB 3UARA 1EP8A 1X5CA 3DVWA 2A2RA 2H1DA 2WDUA 4K7IA 4DSRA 2IIYA 3QR6A 5INYA 1GSEA 1WRYA 4TR1A 4IGJA 3BBYA 4ECCA 4IP6A 4EKZA 5FHIA 1X5DA 4TW5A 2YV7A 2P5RA 1Q4JA 4OCFA 2ZUPA 3IOSA 2OA7A 5DCHA 1F6MC 2KP2A 4AJ6A 3NOFA 5G2ZA 3E9JB 2LKUA 1A23A 5EVOA 3ME8A 5KN0A 1MDIA 3HA9A 4EDYA 2IMIA 4XS4A 3UL3A 3HCZA 3GKKA 1WIKA 4ML6A 3D5JA 3HVVA 2LNTA 1G6YA 1AAZA 4IVFA 5F8BA 1RK4A 3DXBA 4MJCA 4WEYA 5ELGA 2FWGA 1AUCA 5J5NA 4NPBA 3KP8A 4ZBAA 5CREA 2RIIA 1VF2A 2DLXA 4TVEA 2YN1A 1TI1A 5IPHA 1E2YA 5CRDA 2YP6A 2C0GA 4K9ZA 2DJJA 2DJ1A 4KDYA 3I6AA 3VK9A 2VOCA 1B48A 3F3RA 4HEA2 1PD21 3P7XA 4GSTA 2FHEA 2WULA 1B4QA 3LEFA 5F05A 1G7EA 1N8JA 2VCWA 2RUFA 1TK5B 4ZBBA 3IR4A 3APOA 3OR5A 2JACA 3RHCA 1Z9HA 3L9UA 1XFLA 5J9CA 1A8YA 2IMEA 4HU9A 1FVJA 2YZUA 1UN2A 1KBNA 2B5YA 1THXA 1WOUA 4WF4A 2MMOA 5D9TA 4J57E 3BJ5A 2B1LA 5ECSA 2H30A 1J0FA 1O8WA 1QGVA 3DD3A 3ZLPA 3EC3A 2IWTA 5HR1A 2VLUA 3GSSA 4F9ZA 1SD8A 1ML6A 3CTFA 1FOVA 4NHZA 1PX6A 1TU7A 4WKWA 3NIVA 1JLWA 2DMMA 2GLRA 4MH2A 1XBSA 5IMDA 3IXRA 3ZL5A 4PUAA 3UBKA 16GSA 1X9WB 1HYUA 1M0UA 2NDOA 2O89A 4JU5A 1XPVA 1XZOA 2Z9SA 2JSYA 1G7OA 1W89A 2CT6A 2HRFA 2PGTA 4ZBDA 2MMZA 4XRDA 3F6FA 4XRAA 4NMUA 1GTUA 3L9SA 2LS5A 1KEBA 2K8VA 2VUPA 4EDZA 4WBJA 3KTLA 5G30A 3EINA 4I8BA 2HFDA 1JZDA 4GXZA 1GP1A 1GLQA 2O85A 1R26A 4J56E 1TKDB 2H74A 2CQ9A 1QK8A 1K3YA 1M99A 4ZIJA 2RM6A 1FW1A 1FVKA 3GA4A 2GZPA 4KE3A 1AQXA 3FHKA 3C71A 4ZL8A 3A2WA 1XIYA 1BEDA 3LGCA 1XWBA 5B7CA 2HI7A 5DJMA 2DJ3A 4IW9A 3KP9A 2L5LA 4HQSA 1OE7A 13GSA 5HFIA 4K0GA 1Z3EA 4KSMA 3GFKA 1JZRA 1SKRB 2DIYA 2YWIA 2OE0A 4HI7A 2YPMA 3VFIA 4PQIA 3QFAC 5ECNB 1X9MB 4MPFA 2JZRA 3M9KA 2DJ0A 2FWHA 5DQYA 4MCUA 4RQXA 3ZRDA 1DUGA 11GSA 3BOAA 3VWXA 3L78A 1TTZA 2IN3A 5ENUA 3V1WA 1TRWA 2EIOA 2FD3A 2L4CA 2H8LA 3ZMKA 1V40A 22GSA 5ECHB 1T8EB 3BCKA 2H71A
chains in the Genus database with same CATH superfamily
1WPIA 2HRKA 4NHWA 5CYYA 4QL9A 4TR3A 1TW9A 3C8EA 2I1UA 4XS6A 2LQOA 2REMA 3GL3A 3F3QA 4NAXA 4QL7A 5AGYA 4TXOA 1V57A 1J08A 3UVHA 2CA8A 1BJXA 1OKDA 4YQVA 4AJ8A 2C3TA 3N9JA 4WF5A 4ML1A 4O32A 4MF7A 4JR4A 3WYWA 4TXVA 4LMVA 7GSSA 4IQAA 1K0AA 2QA2A 4KDUA 2H6ZA 3ERGA 1O73A 1PKWA 2YJHA 4MZWA 1PKZA 4IJIA 2I81A 4IELA 4XS1A 1O8XA 1GSFA 4MK3A 4H86A 2E0QA 1SU9A 3UMAA 3HKRA 1TOFA 3FZ4A 4OFMA 4Q5NA 3M9JA 4CDOA 3TDGA 2LRCA 4I2TA 1A24A 1BG5A 1PGTA 4KF9A 1H75A 2RUEA 2OBKA 1EGRA 5FWGA 1A2MA 4KDXA 1V9WA 4HOJA 2C0DA 3IA1A 1ZOFA 1R5PA 5CRHA 1WMJA 3CRTA 2L59A 1ON4A 2J23A 3H4KA 2DJ2A 4K0NA 3UBLA 5HR3A 2DBCA 3F9UA 3ZYWA 2B7KA 3ZITA 2H73A 4LL4B 5LNKe 1LBKA 2H01A 3LORA 4YKGA 2L4QA 1YQ1A 1XW9A 2P0GA 2NBSA 3Q6OA 4YAVA 5F06A 3VWWA 1DSBA 1YZXA 4O5RA 3DVXA 5KN3A 5LD0A 4L5LA 3ED3A 2I3YA 1ERTA 2FWFA 3IAM2 4RUVA 4G10A 5HQPA 4ICYA 2WZ9A 3ZVJA 1TK8B 5IQYA 2CAQA 1LU4A 2GT5A 4X0XA 2PWJA 1AQWA 3BCIA 2C8UA 1ILOA 3TKQA 1B9YC 3AY8A 4LA1A 4V1Ag 1ZCPA 1MEKA 5KOXA 1VF1A 2HRAA 4HDEA 2R4VA 2GGTA 3VI7A 1W4VA 1SKSB 3RPPA 3KCMA 1Z7RA 3QD9A 2MMAA 2HZEB 4KB3A 6GSYA 2TIRA 4J2FA 2ALBA 1MD4A 1SK0A 4FYBA 4IHUA 2R6KA 4FYCA 2N5AA 2H1BA 4G2EA 4BL7A 3HJPA 5G1LA 4BVXA 5F0GA 3QPMA 2X8GA 2H0HA 2LNSA 1VGLA 5JWOB 1PRXA 2CVDA 2F8AA 2DIZA 3KIJA 4Q5RA 2XPEA 2OADA 3LG6A 1C72A 4JZQA 1MDJA 6GSVA 2GDRA 2LJAA 2HZFA 3F6DA 2A4VA 2VD1A 6GSWA 2FNOA 4I6XA 3IAS2 5DVBA 1MDKA 2IMKA 2AUVA 3Q18A 2V1MA 4XTSA 3TKSC 4NV2A 4KW6A 1PL2A 2M46A 2LUSA 1YF1A 3IE3A 1F3BA 2P5QA 3MIXA 3L9VA 3RBTA 4HUAA 1K0NA 1ABAA 3APSA 3GHAA 4CY8A 5DCGA 12GSA 3CSIA 5EY6A 2A4HA 2HXKA 3W6GA 3WGEA 4BVYA 3GX0A 3IRAA 4BPYA 3MWHA 3D6IA 2H72A 4ULXA 1GL8A 2QGVA 1FHEA 3PR8A 3VPQA 1R7HA 2LRTA 2B7JA 2HSMA 2IMFA 3IC8A 3QDNA 2GSTA 2J9HA 2WRTA 1K0OA 3F8UA 3GH6A 1XVWA 2ES7A 3APQA 2QKEA 3IHQA 1F37A 4L5OA 2IPAA 1S3CA 3FR6A 1TRSA 4K6XA 3EE2A 3UEMA 5IMAA 2R37A 3A5IA 1IYIA 9GSSA 3J7Yk 1AXDA 4F82A 1Z7PA 2VM1A 4USSA 5A4WA 2B3SA 2O87A 5D9XA 1EP7A 1YDKA 5DALB 4CW9A 1Z6NA 3C1SA 1GWCA 2HT9A 5JWQB 3VI5A 2CAIA 5D96A 2X99A 3ISOA 4MMMA 3GTUB 3QFBC 4PQ1A 4TKYA 5E59A 1CQGA 3P2AA 19GSA 5DAKB 2CZ2A 5CRWA 2X49A 3GKMA 4LLRA 4ISDA 1T3BA 4FH8A 3VLNA 4GWRA 2KHPA 4O5UA 2KP1A 2FA8A 5LCZA 5D8IA 5JWRB 3H8QA 3GV1A 3O6TA 5GAND 1WWJA 3GURA 2R3XA 2DC5A 3GMFA 1B8XA 2H75A 5AISA 1X9SB 4G0IA 2PVOC 4FO5A 4Z2TA 1B9XC 2MZCA 4AF2A 1FAAA 2GSQA 1S3DA 1U88A 1THOA 1USBA 3FMWA 5DQSA 3EYTA 2I9HA 4EIQA 5G31A 1T4ZA 3TOUA 1A0FA 1M3JA 2X64A 4ZL9A 3UVTA 3L0HA 1XW5A 3P8WA 5ABRA 4DSQA 4JE1A 4HSCX 1N2AA 1G0TA 5G1KA 2OE1A 4MNNA 2B5EA 4KNDA 5ECMB 4PNGA 1U6TA 1O81A 4OFNA 4X1UA 5J3RA 1K3LA 2VL2C 2FY6A 2H66A 3TUEA 4DVCA 1GSUA 3GKNA 4BA7A 3I69A 3W8JA 3F4TA 2G2QA 1O7UA 4N30A 3EPTA 2AV4A 2B1KA 3GN3A 3H93A 3TJKA 1R4WA 2X8HA 5H5RA 2WB9A 3QAVA 2P31A 1EZKA 4Z2RA 4Q5FA 1DE2A 2PVQA 3DGQA 3WT1A 5H5QA 4PURA 1IYHA 3CXGA 2FGXA 2M72A 3D4MA 2VL2A 3A5WA 5C00A 2CZ3A 3K8NA 2O8VB 5J41A 4ID0A 4MF6A 2AYTA 3LYPA 2KUCA 1XW6A 1JZWA 1SJ6A 3A2XA 2ZCTA 2HRNA 2R0CA 2L5OA 1BX9A 1HNAA 5HR2A 2JU5A 1I5GA 1GUKA 4GSSA 1MD3A 1WP0A 3PH9A 1G6WA 5COHA 1I9DA 4EF0A 2H1AA 5IM9A 3ERFA 2K18A 4O7HA 1XOBA 2V6KA 3FR9A 2WCIA 4I2UA 2VM2A 2E7PA 1DE1A 3KMOA 4O92A 2ZNMA 4Z7XA 2HZEA 1OE8A 4NV5A 2X8CA 1DBYA 1XWGA 4HZ2A 3ME7A 4K7OA 3DKSA 3CBUA 3EURA 1A2LA 3MDKA 2CVKA 3DYRA 2DJKA 1XOAA 4QQ7A 2LJKA 3EWLA 3LWAA 2YZHA 3UAPA 2H6XA 5L71A 3DWVA 3IK9A 2OBIA 1K0CA 4V2MA 3DRNA 2R0GA 20GSA 2N5FA 3CSHA 1JHBA 3QMXA 2YNXA 4HS1A 3WD6A 4FYUA 5D9VA 4GCIA 4V2LA 5ELAA 4ZB8A 1EEJA 1XCCA 2FA4A 3KTBA 3IC4A 5GZZB 3ZREA 2XBIA 4RI6A 3KD0A 5IMZA 4ECBA 2K9FA 1TRUA 1SJZA 4MZBA 3RDWA 1FG4A 1K0BA 4WR5A 1SD9A 4XCSA 2LSTA 4IJ3A 1LJRA 4OFTA 2G0FA 1ZYNA 4RI7A 2H0IA 3KZQA 4MJBA 1XG8A 1GSDA 1PMTA 3TJJA 3BD2A 3EVIA 5KN1A 3QAGA 5A4VA 4G0LA 1JZOA 4TRXA 1EWXA 1V98A 3EU3A 4G0KA 2GQMA 3IV4A 2XPDA 2RM5A 2H6YA 3M8NA 3MAKA 5DALA 3QOUA 2PPTA 3DIEA 4WR4A 4AJ7A 3LSZA 5GAPD 3M0FA 5ECLB 3GTUA 1GSYA 2IL3A 5IPGA 1SJIA 4ECJA 3D4TA 4MZCA 1F9MA 2VD0A 3PGTA 2E2MA 4PNFA 4EIPA 4GF0A 2YJ7A 4YH2A 4K7NA 3FKFA 4MJEA 5DAKA 2A2PA 4PUFC 4NWYA 4MDCA 5IO2A 1M2AA 1QMVA 3LW9A 2VCXA 2PBJA 4KCAA 2V2GA 4WXTA 4GLTA 2PERA 1SL1B 5B8BA 2F51A 3TKSE 1GSSA 3FZAA 4OWYA 3ZZXA 2OKAA 2WGRA 5B6MA 5GSSA 2QC7A 1PA3A 4V1Ap 4N0ZA 4DSSB 3C73A 1SK2A 2AAWA 2NVLA 3U6VA 1M9AA 2IFQA 2YWOA 6GSSA 2VL3A 2ON7A 3L4NA 3FK8A 4POMA 2C3NA 2OACA 2V32A 3ZTLA 2YWMA 3HZ4A 3NZNA 2V6OA 2XC2A 3PINA 5B6NA 1TK0B 5ECRB 1GUMA 3WGXA 5AN1A 1XWKA 4K2DA 3FZ9A 1TRVA 1U3IA 2CVBA 4POBA 2QSIA 1TJDA 1EGOA 10GSA 2LRNA 3RPNA 5CNWA 1VRSD 1V2AA 2H1GA 1Z5YE 4KGIA 2MBTA 3DMLA 5ECIB 2VIMA 1YKAA 4WETA 3LQ7A 4F2IA 3G7IA 2LV3A 2L57A 3I43A 5AIXA 3VPTA 2HSYA 3LYKA 1XXUA 2R0PA 4CHSA 5CO3A 1A2JA 4KA0A 3HVSA 1SENA 3SWLA 2F8FA 4MABA 3TKPA 1E6BA 1Z6MA 5IO0A 3ZFBA 2PU9C 2VLTA 1A8LA 3I9V2 3ZVJD 1GRXA 4JR6A 1KNGA 5KN2A 2LQQA 3TKSA 3TCOA 2HSHA 5ECPB 5A4UA 3E3EA 1T7PB 3CSJA 1F2EA 3HXSA 3IBHA 1PL1A 3CYNA 2GQLA 5D9WA 2ON5A 2H19A 1GSQA 2JL4A 5ID2B 2L6DA 4JRRA 1Y6EA 2A2SA 1GUHA 5EL8A 2MYGA 4BWQA 1NSWA 4LMWA 2CX4A 4KH7A 1JFUA 5CAXA 4EC0A 1V58A 2M80A 1K0MA 2C4JA 4X4JA 1RW1A 3KH7A 4KX4A 4XHMA 1OAZA 4MA9A 4G19A 3TOTA 4MP4A 1OC9B 3A3TA 2KLXA 2C0EA 3D0ZA 4MH3A 1UC7A 1ZYQB 1Q98A 2WJUA 4POKA 4KSOA 5D73A 2YCDA 3RHBA 1HNBA 3HJOA 4GQFA 1ZL9A 3HVXA 5JCUA 1TU8A 2R5GA 3HHVA 2HYXA 3VWVA 3HJMA 3UIWA 2VLVA 1AC1A 2EIRA 3HY2A 1AW9A 1WE0A 4O5QA 3EMXA 4JBBA 1NW2A 1EEMA 2V41A 2O7KA 1QUWA 4IKHA 4IP1A 4FIWA 1GTAA 3ZFLA 5JCWA 2OE3A 4PGTA 1PX7A 2NPBA 1YY7A 2K6VA 1BAYA 1PSQA 2EIQA 1J9BA 3TJFA 4OMVA 3US3A 1KTEA 2KOKA 4RQRA 3E0UA 1TP9A 4EUYA 4N10A 3RAZA 5GSTA 2VAFA 2TRCP 5D93A 5ECQB 2IFQB 5AIVA 2F3MA 1GULA 1XVQA 3Q74A 1O85A 2B6MA 1EOGA 1HQOA 1SL2B 3N5OA 2BTOT 4Q5QA 4ZB9A 5HFGA 1NM3A 4PQHA 4D73B 1PQNA 1QQ2A 1ZMAA 3F0IA 1WJKA 3DEXA 1SYXA 1VF4A 3QAWA 4IN0A 4V2NA 1ERWA 4HU7A 1A0RP 3IPZA 2QA1A 3UJ1A 3O3TA 3MSZA 3CMIA 4I5QA 1K3OA 2FWEA 3GH9A 3GUSA 1QXHA 3TRXA 3HVNA 4F03A 2GQKA 5ECKB 2GT6A 1M2DA 3PPUA 4FQUA 2DKIA 5IMFA 3TKRA 2VCVA 2UZ8A 3KH9A 1BQ7A 3P90A 4F0BA 5J9BA 1GNEA 3Q19A 1FOHA 5IIZA 2GTUA 4TR4A 1EV9A 2JSZA 3GYKA 2FUG2 5IMCA 4XIHA 4JEDA 1FB0A 2PN8A 3KJYA 2FLSA 4GSNA 3KM6A 3ZIVA 4ILFA 2IMDA 1XWCA 18GSA 3HD5A 2GZYA 1GTBA 4TR1B 2EC4A 8GSSA 3FW2A 3GNJA 4TN8A 4DSSA 3U5RE 3W8SA 2AJQB 2JZTA 3LFLA 1EV4A 3KXOA 3G9BA 5F07A 4ZB6A 2WFCA 2F9SA 1ST9A 2I4AA 4MJAA 2B5XA 2YWNA 1ERVA 3FEUA 5B8AA 6GSXA 3LXZA 14GSA 3JCML 5FT3A 5KEJA 1NHOA 1ZGNA 1TI3A 2C80A 4AGSA 4IQ1A 4XS4B 2L6CA 3WGDA 4MF5A 4YQMA 3HYPA 3KMNA 1M2BA 3LJRA 4PX1A 2NTOA 2LEGA 5IOXA 6GSUA 4YKFA 5EPFA 4EXJA 2JZSA 4BIKA 1OKTA 1ZYPA 4L8EA 5E4WA 4K8MA 4POLA 1YKCA 3KGKA 2H70A 1SYRA 4L0WA 2K8SA 3F63A 2JADA 2VCTA 4EE0A 5IOWA 4WBRD 2XHFA 2DMLA 4YAPA 3FYGA 1XWAA 2XBQA 2GSSA 1BYEA 2DSAA 4LL1B 5C04A 3ZMLA 1CQHA 5DDLA 3GL5A 3GRXA 3G7JA 1U87A 4HJMA 1T4YA 1URMA 1GTIA 4E8EA 1ZYEA 4GQCA 1X0RA 4MLYA 4EL1A 5HFKA 3VWUA 3ERWA 2RLIA 1UVZA 2HE3A 2MBSA 2VCZA 4P3YB 5ID2A 1HD2A 4L0UA 1S3AA 1Y25A 4TOPA 1RQMA 3QCPA 3M1GA 2H0GA 1FB6A 3GSTA 1YEPA 3FZ5A 2AHEA 1GLPA 3CQFA 17GSA 4A5PA 1M7TA 2DKHA 1OC9A 1YEXA 4MPGA 1AIUA 1SL0B 3R3EA 4PXOA 1PN9A 1OYJA 2VCQA 2VL9A 3TGZA 2TRXA 2N5BA 4N0VA 2AB6A 1ZZYA 4KCEA 1YJ6A 4EVMA 4NXIA 3H79A 3UOMA 1MTCA 5J4UA 1FO5A 3WT2A 1TDIA 4CY6A 5HR0A 3C7MA 4ZILA 1AQVA 2HLSA 2OJLA 3TJBA 1R5AA 2GS3A 5ECOB 3S9FA 1T1VA 3FR3A 1B4PA 4IBPA 2GSRA 3TB2A 6GSTA 2YV9A 1VF3A 2IJYA 3CRUA 4DEJA 5IMVA 4OCEA 2WS2A 2GZZA 4F0CA 2C3QA 3TRPA 1UA5A 3R2QA 2R2JA 4OO5A 3KEBA 4ZXGA 3FY7A 3H1NA 3LXTA 1HNCA 4BWSA 5G5EA 3HZ8A 3IHGA 2LJRA 3C1RA 3GX8A 3A2VA 2C1YA 4GRFA 2H76A 1OVNA 2GVPA 2HNLA 4OO4A 1NHYA 3G7YA 3EMPA 3ZIJA 5H5SA 1TXXA 2VO4A 3HDCA 3GKXA 4OD7A 2CV4A 2FCHA 2MMNA 3MNGA 3IK7A 4X43A 4D73A 1EOHA 4KAEA 3J7Yb 4KUNA 1JLVA 4G9HA 3M3MA 1F3AA 1T00A 4I97A 4K1FA 3VURA 3GIXA 5JCGA 4ACSA 3O76A 2BMXA 4HQZA 1OC3A 1GH2A 4HJ2A 2E2GA 1K0DA 3CTGA 4HZ4A 2PMTA 4YQUA 3TJGA 1YF0A 1GNWA 1SKWB 2PUKC 3FRCA 4K5SA 4Z2UA 3MYDA 1S3RA 4GTUA 4IS0A 4ECIA 4N11A 3SBCA 4EO3A 3F4RA 2LTKA 5A5KA 1U3AA 2C0FA 1ERUA 5G5FA 5BRTA 1ACVA 3IDVA 1M9BA 3TRQA 5CP1A 5DBQA 1OC8A 2CX3A 5DJLA 3D21A 1H4OA 2YANA 4TR0A 1X5EA 1O6JA 2D2ZA 3D22A 2YOIA 3F4SA 1SK1A 1QFNA 2BJXA 4E8HA 3EU4A 4ZL7A 5CRGA 5BMUA 4TXOB 3UARA 1EP8A 1X5CA 3DVWA 2A2RA 2H1DA 2WDUA 4K7IA 4PTSA 4DSRA 2IIYA 3QR6A 5INYA 1GSEA 1WRYA 4TR1A 4IGJA 3BBYA 4ECCA 4IP6A 4EKZA 5FHIA 1X5DA 1PN0A 4TW5A 2YV7A 2P5RA 1Q4JA 4OCFA 2ZUPA 3IOSA 2OA7A 5DCHA 1F6MC 2KP2A 4AJ6A 3NOFA 5G2ZA 3E9JB 2LKUA 1A23A 5EVOA 3ME8A 5KN0A 1MDIA 3HA9A 4EDYA 2IMIA 4XS4A 3UL3A 3HCZA 3GKKA 1WIKA 4ML6A 3D5JA 3HVVA 2LNTA 1G6YA 1AAZA 4IVFA 5F8BA 1RK4A 3DXBA 4MJCA 4WEYA 5ELGA 2FWGA 1AUCA 5J5NA 4NPBA 3KP8A 4ZBAA 5CREA 2RIIA 1VF2A 2DLXA 4TVEA 2YN1A 1TI1A 5IPHA 1E2YA 5CRDA 2YP6A 2C0GA 4K9ZA 2DJJA 2DJ1A 4KDYA 3I6AA 3VK9A 2VOCA 1B48A 3F3RA 4HEA2 1PD21 1M3IA 3P7XA 4GSTA 2FHEA 2WULA 1B4QA 3LEFA 5F05A 1G7EA 1N8JA 2VCWA 2RUFA 1TK5B 4ZBBA 3IR4A 3APOA 3OR5A 2JACA 3RHCA 1Z9HA 3L9UA 1XFLA 5J9CA 1A8YA 2IMEA 4HU9A 1FVJA 1PFOA 2YZUA 1UN2A 1KBNA 2B5YA 1THXA 4BL7B 4BVXB 1WOUA 4WF4A 2MMOA 5D9TA 4J57E 3BJ5A 2B1LA 5ECSA 2H30A 1J0FA 1O8WA 1QGVA 3DD3A 4K5RA 3ZLPA 3EC3A 2IWTA 5HR1A 2VLUA 3GSSA 4F9ZA 1SD8A 1ML6A 3CTFA 1FOVA 4NHZA 1PX6A 1TU7A 4WKWA 3NIVA 1JLWA 2DMMA 2GLRA 4MH2A 1XBSA 5IMDA 3IXRA 3ZL5A 4PUAA 3UBKA 16GSA 1X9WB 1HYUA 1M0UA 2NDOA 2O89A 4JU5A 1XPVA 1XZOA 2Z9SA 2JSYA 1G7OA 1W89A 2CT6A 2HRFA 2PGTA 4K2XA 4ZBDA 2MMZA 4XRDA 3F6FA 4XRAA 4NMUA 1GTUA 3L9SA 2LS5A 1KEBA 4BVYB 2K8VA 2VUPA 5KOWA 4EDZA 4WBJA 3KTLA 5G30A 3EINA 4I8BA 2HFDA 1JZDA 4GXZA 1GP1A 1GLQA 2O85A 1R26A 4J56E 1TKDB 2H74A 2CQ9A 1QK8A 1K3YA 1M99A 4ZIJA 2RM6A 1FW1A 1FVKA 3GA4A 2GZPA 4KE3A 1AQXA 3FHKA 3C71A 4ZL8A 3A2WA 1XIYA 1BEDA 3LGCA 1XWBA 5B7CA 2HI7A 5DJMA 2DJ3A 4IW9A 3KP9A 2L5LA 4HQSA 1OE7A 13GSA 5HFIA 4K0GA 1Z3EA 4KSMA 3GFKA 1JZRA 1SKRB 2DIYA 2YWIA 2OE0A 4HI7A 2YPMA 3VFIA 4PQIA 3QFAC 5ECNB 1X9MB 4MPFA 2JZRA 3M9KA 2DJ0A 2FWHA 5DQYA 4MCUA 4RQXA 3ZRDA 1DUGA 11GSA 3BOAA 3VWXA 3L78A 1TTZA 2IN3A 5ENUA 3V1WA 1TRWA 2EIOA 2FD3A 2L4CA 2H8LA 3ZMKA 1V40A 22GSA 5ECHB 2X4AA 1T8EB 3BCKA 2H71A
chains in the Genus database with same CATH topology
1WPIA 2HRKA 4NHWA 5CYYA 4QL9A 4TR3A 1TW9A 3C8EA 2I1UA 4XS6A 2LQOA 2REMA 3GL3A 3F3QA 4NAXA 4QL7A 5AGYA 4TXOA 1V57A 1J08A 3UVHA 2CA8A 1BJXA 1OKDA 4YQVA 4AJ8A 2C3TA 3N9JA 4WF5A 4ML1A 4O32A 4MF7A 4JR4A 3WYWA 4TXVA 4LMVA 7GSSA 4IQAA 1K0AA 2QA2A 4KDUA 2H6ZA 3ERGA 1O73A 1PKWA 2YJHA 4MZWA 1PKZA 4IJIA 2I81A 4IELA 4XS1A 1O8XA 1GSFA 4MK3A 4H86A 2E0QA 1SU9A 3UMAA 3HKRA 1TOFA 3FZ4A 4OFMA 4Q5NA 3M9JA 4CDOA 3TDGA 2LRCA 4I2TA 1A24A 1BG5A 1PGTA 4KF9A 1H75A 2RUEA 2OBKA 1EGRA 5FWGA 1A2MA 4KDXA 1V9WA 4HOJA 2C0DA 3IA1A 1ZOFA 1R5PA 5CRHA 1WMJA 3CRTA 2L59A 1ON4A 2J23A 3H4KA 2DJ2A 4K0NA 3UBLA 5HR3A 2DBCA 3F9UA 3ZYWA 2B7KA 3ZITA 2H73A 4LL4B 5LNKe 1LBKA 2H01A 3LORA 4YKGA 2L4QA 1YQ1A 1XW9A 2P0GA 2NBSA 3Q6OA 4YAVA 5F06A 3VWWA 1DSBA 1YZXA 4O5RA 3DVXA 5KN3A 5LD0A 4L5LA 3ED3A 2I3YA 1ERTA 2FWFA 3IAM2 4RUVA 4G10A 5HQPA 4ICYA 2WZ9A 3ZVJA 1TK8B 5IQYA 2CAQA 1LU4A 2GT5A 4X0XA 2PWJA 1AQWA 3BCIA 2C8UA 1ILOA 3TKQA 1B9YC 3AY8A 4LA1A 4V1Ag 1ZCPA 1MEKA 5KOXA 1VF1A 2HRAA 4HDEA 2R4VA 2GGTA 3VI7A 1W4VA 1SKSB 3RPPA 3KCMA 1Z7RA 3QD9A 2MMAA 2HZEB 4KB3A 6GSYA 2TIRA 4J2FA 2ALBA 1MD4A 1SK0A 4FYBA 4IHUA 2R6KA 4FYCA 2N5AA 2H1BA 4G2EA 4BL7A 3HJPA 5G1LA 4BVXA 5F0GA 3QPMA 2X8GA 2H0HA 2LNSA 1VGLA 5JWOB 1PRXA 2CVDA 2F8AA 2DIZA 3KIJA 4Q5RA 2XPEA 2OADA 3LG6A 1C72A 4JZQA 1MDJA 6GSVA 2GDRA 2LJAA 2HZFA 3F6DA 2A4VA 2VD1A 6GSWA 2FNOA 4I6XA 3IAS2 5DVBA 1MDKA 2IMKA 2AUVA 3Q18A 2V1MA 4XTSA 3TKSC 4NV2A 4KW6A 1PL2A 2M46A 2LUSA 1YF1A 3IE3A 1F3BA 2P5QA 3MIXA 3L9VA 3RBTA 4HUAA 1K0NA 1ABAA 3APSA 3GHAA 4CY8A 5DCGA 12GSA 3CSIA 5EY6A 2A4HA 2HXKA 3W6GA 3WGEA 4BVYA 3GX0A 3IRAA 4BPYA 3MWHA 3D6IA 2H72A 4ULXA 1GL8A 2QGVA 1FHEA 3PR8A 3VPQA 1R7HA 2LRTA 2B7JA 2HSMA 2IMFA 3IC8A 3QDNA 2GSTA 2J9HA 2WRTA 1K0OA 3F8UA 3GH6A 1XVWA 2ES7A 3APQA 2QKEA 3IHQA 1F37A 4L5OA 2IPAA 1S3CA 3FR6A 1TRSA 4K6XA 3EE2A 3UEMA 5IMAA 2R37A 3A5IA 1IYIA 9GSSA 3J7Yk 1AXDA 4F82A 1Z7PA 2VM1A 4USSA 5A4WA 2B3SA 2O87A 5D9XA 1EP7A 1YDKA 5DALB 4CW9A 1Z6NA 3C1SA 1GWCA 2HT9A 5JWQB 3VI5A 2CAIA 5D96A 2X99A 3ISOA 4MMMA 3GTUB 3QFBC 4PQ1A 4TKYA 5E59A 1CQGA 3P2AA 19GSA 5DAKB 2CZ2A 5CRWA 2X49A 3GKMA 4LLRA 4ISDA 1T3BA 4FH8A 3VLNA 4GWRA 2KHPA 4O5UA 2KP1A 2FA8A 5LCZA 5D8IA 5JWRB 3H8QA 3GV1A 3O6TA 5GAND 1WWJA 3GURA 2R3XA 2DC5A 3GMFA 1B8XA 2H75A 5AISA 1X9SB 4G0IA 2PVOC 4FO5A 4Z2TA 1B9XC 2MZCA 4AF2A 1FAAA 2GSQA 1S3DA 1U88A 1THOA 1USBA 3FMWA 5DQSA 3EYTA 2I9HA 4EIQA 5G31A 1T4ZA 3TOUA 1A0FA 2X64A 4ZL9A 3UVTA 3L0HA 1XW5A 3P8WA 5ABRA 4DSQA 4JE1A 1N2AA 1G0TA 5G1KA 2OE1A 4MNNA 2B5EA 4KNDA 5ECMB 4PNGA 1U6TA 1O81A 4OFNA 4X1UA 5J3RA 1K3LA 2VL2C 2FY6A 2H66A 3TUEA 4DVCA 1GSUA 3GKNA 4BA7A 3I69A 3W8JA 3F4TA 2G2QA 1O7UA 4N30A 3EPTA 2AV4A 2B1KA 3GN3A 3H93A 3TJKA 1R4WA 2X8HA 5H5RA 2WB9A 3QAVA 2P31A 1EZKA 4Z2RA 4Q5FA 1DE2A 2PVQA 3DGQA 3WT1A 5H5QA 4PURA 1IYHA 3CXGA 2FGXA 2M72A 3D4MA 2VL2A 3A5WA 5C00A 2CZ3A 3K8NA 2O8VB 5J41A 4ID0A 4MF6A 2AYTA 3LYPA 2KUCA 1XW6A 1JZWA 1SJ6A 3A2XA 2ZCTA 2HRNA 2R0CA 2L5OA 1BX9A 1HNAA 5HR2A 2JU5A 1I5GA 1GUKA 4GSSA 1MD3A 1WP0A 3PH9A 1G6WA 5COHA 1I9DA 4EF0A 2H1AA 5IM9A 3ERFA 2K18A 4O7HA 1XOBA 2V6KA 3FR9A 2WCIA 4I2UA 2VM2A 2E7PA 1DE1A 3KMOA 4O92A 2ZNMA 4Z7XA 2HZEA 1OE8A 4NV5A 2X8CA 1DBYA 1XWGA 4HZ2A 3ME7A 4K7OA 3DKSA 3CBUA 3EURA 1A2LA 3MDKA 2CVKA 3DYRA 2DJKA 1XOAA 4QQ7A 2LJKA 3EWLA 3LWAA 2YZHA 3UAPA 2H6XA 5L71A 3DWVA 3IK9A 2OBIA 1K0CA 4V2MA 3DRNA 2R0GA 20GSA 2N5FA 3CSHA 1JHBA 3QMXA 2YNXA 4HS1A 3WD6A 4FYUA 5D9VA 4GCIA 4V2LA 5ELAA 4ZB8A 1EEJA 1XCCA 2FA4A 3KTBA 3IC4A 5GZZB 3ZREA 2XBIA 4RI6A 3KD0A 5IMZA 4ECBA 2K9FA 1TRUA 1SJZA 4MZBA 3RDWA 1FG4A 1K0BA 4WR5A 1SD9A 4XCSA 2LSTA 4IJ3A 1LJRA 4OFTA 2G0FA 1ZYNA 4RI7A 2H0IA 3KZQA 4MJBA 1GSDA 1PMTA 3TJJA 3BD2A 3EVIA 5KN1A 3QAGA 5A4VA 4G0LA 1JZOA 4TRXA 1EWXA 1V98A 3EU3A 4G0KA 2GQMA 3IV4A 2XPDA 2RM5A 2H6YA 3M8NA 3MAKA 5DALA 3QOUA 2PPTA 3DIEA 4WR4A 4AJ7A 3LSZA 5GAPD 3M0FA 5ECLB 3GTUA 1GSYA 2IL3A 5IPGA 1SJIA 4ECJA 3D4TA 3PGTA 1F9MA 2VD0A 4MZCA 2E2MA 4PNFA 4EIPA 4GF0A 2YJ7A 4YH2A 4K7NA 3FKFA 4MJEA 5DAKA 2A2PA 4PUFC 4NWYA 4MDCA 5IO2A 1M2AA 1QMVA 3LW9A 2VCXA 2PBJA 4KCAA 2V2GA 4WXTA 4GLTA 2PERA 1SL1B 5B8BA 2F51A 3TKSE 1GSSA 3FZAA 4OWYA 3ZZXA 2OKAA 2WGRA 5B6MA 5GSSA 2QC7A 1PA3A 4V1Ap 4N0ZA 4DSSB 3C73A 1SK2A 2AAWA 2NVLA 3U6VA 1M9AA 2IFQA 2YWOA 6GSSA 2VL3A 2ON7A 3L4NA 3FK8A 4POMA 2C3NA 2OACA 2V32A 3ZTLA 2YWMA 3HZ4A 3NZNA 2V6OA 2XC2A 3PINA 5B6NA 1TK0B 5ECRB 1GUMA 3WGXA 5AN1A 1XWKA 4K2DA 3FZ9A 1TRVA 1U3IA 2CVBA 4POBA 2QSIA 1TJDA 1EGOA 10GSA 2LRNA 3RPNA 5CNWA 1VRSD 1V2AA 2H1GA 1Z5YE 4KGIA 2MBTA 3DMLA 5ECIB 2VIMA 1YKAA 4WETA 3LQ7A 4F2IA 3G7IA 2LV3A 2L57A 3I43A 5AIXA 3VPTA 2HSYA 3LYKA 1XXUA 2R0PA 4CHSA 5CO3A 1A2JA 4KA0A 3HVSA 1SENA 3SWLA 2F8FA 4MABA 3TKPA 1E6BA 1Z6MA 5IO0A 3ZFBA 2PU9C 2VLTA 1A8LA 3I9V2 3ZVJD 1GRXA 4JR6A 1KNGA 5KN2A 2LQQA 3TKSA 3TCOA 2HSHA 5ECPB 5A4UA 3E3EA 1T7PB 3CSJA 1F2EA 3HXSA 3IBHA 1PL1A 3CYNA 2GQLA 5D9WA 2ON5A 2H19A 1GSQA 2JL4A 5ID2B 2L6DA 4JRRA 1Y6EA 2A2SA 1GUHA 5EL8A 2MYGA 4BWQA 1NSWA 4LMWA 2CX4A 4KH7A 1JFUA 5CAXA 4EC0A 1V58A 2M80A 1K0MA 2C4JA 4X4JA 1RW1A 3KH7A 4KX4A 4XHMA 1OAZA 4MA9A 4G19A 3TOTA 4MP4A 1OC9B 3A3TA 2KLXA 2C0EA 3D0ZA 4MH3A 1UC7A 1ZYQB 1Q98A 2WJUA 4POKA 4KSOA 5D73A 2YCDA 3RHBA 1HNBA 3HJOA 4GQFA 1ZL9A 3HVXA 5JCUA 1TU8A 2R5GA 3HHVA 2HYXA 3VWVA 3HJMA 3UIWA 2VLVA 1AC1A 2EIRA 3HY2A 1AW9A 1WE0A 4O5QA 3EMXA 4JBBA 1NW2A 1EEMA 2V41A 2O7KA 1QUWA 4IKHA 4IP1A 4FIWA 1GTAA 3ZFLA 5JCWA 2OE3A 4PGTA 1PX7A 2NPBA 1YY7A 2K6VA 1BAYA 1PSQA 2EIQA 1J9BA 3TJFA 4OMVA 3US3A 1KTEA 2KOKA 4RQRA 3E0UA 1TP9A 4EUYA 4N10A 3RAZA 5GSTA 2VAFA 2TRCP 5D93A 5ECQB 2IFQB 5AIVA 2F3MA 1GULA 1XVQA 3Q74A 1O85A 2B6MA 1EOGA 1HQOA 1SL2B 3N5OA 2BTOT 4Q5QA 4ZB9A 5HFGA 1NM3A 4PQHA 4D73B 1PQNA 1QQ2A 1ZMAA 3F0IA 1WJKA 3DEXA 1SYXA 1VF4A 3QAWA 4IN0A 4V2NA 1ERWA 4HU7A 1A0RP 3IPZA 2QA1A 3UJ1A 3O3TA 3MSZA 3CMIA 4I5QA 1K3OA 2FWEA 3GH9A 3GUSA 1QXHA 3TRXA 4F03A 2GQKA 5ECKB 2GT6A 1M2DA 3PPUA 4FQUA 2DKIA 5IMFA 3TKRA 2VCVA 2UZ8A 3KH9A 1BQ7A 3P90A 4F0BA 5J9BA 1GNEA 3Q19A 1FOHA 5IIZA 2GTUA 4TR4A 1EV9A 2JSZA 3GYKA 2FUG2 5IMCA 4XIHA 4JEDA 1FB0A 2PN8A 3KJYA 2FLSA 4GSNA 3KM6A 3ZIVA 4ILFA 2IMDA 1XWCA 18GSA 3HD5A 2GZYA 1GTBA 4TR1B 2EC4A 8GSSA 3FW2A 3GNJA 4TN8A 4DSSA 3U5RE 3W8SA 2AJQB 2JZTA 3LFLA 1EV4A 3KXOA 3G9BA 5F07A 4ZB6A 2WFCA 2F9SA 1ST9A 2I4AA 4MJAA 2B5XA 2YWNA 1ERVA 3FEUA 5B8AA 6GSXA 3LXZA 14GSA 3JCML 5FT3A 5KEJA 1NHOA 1ZGNA 1TI3A 2C80A 4AGSA 4IQ1A 4XS4B 2L6CA 3WGDA 4MF5A 4YQMA 3HYPA 3KMNA 1M2BA 3LJRA 4PX1A 2NTOA 2LEGA 5IOXA 6GSUA 4YKFA 5EPFA 4EXJA 2JZSA 1OKTA 1ZYPA 4L8EA 5E4WA 4K8MA 4POLA 1YKCA 3KGKA 2H70A 1SYRA 4L0WA 2K8SA 3F63A 2JADA 2VCTA 4EE0A 5IOWA 4WBRD 2XHFA 2DMLA 4YAPA 3FYGA 1XWAA 2XBQA 2GSSA 1BYEA 2DSAA 4LL1B 5C04A 3ZMLA 1CQHA 5DDLA 3GL5A 3GRXA 3G7JA 1U87A 4HJMA 1T4YA 1URMA 1GTIA 4E8EA 1ZYEA 4GQCA 1X0RA 4MLYA 4EL1A 5HFKA 3VWUA 3ERWA 2RLIA 1UVZA 2HE3A 2MBSA 2VCZA 4P3YB 5ID2A 1HD2A 4L0UA 1S3AA 1Y25A 4TOPA 1RQMA 3QCPA 3M1GA 2H0GA 1FB6A 3GSTA 1YEPA 3FZ5A 2AHEA 1GLPA 17GSA 4A5PA 1M7TA 2DKHA 1OC9A 1YEXA 4MPGA 1AIUA 1SL0B 3R3EA 4PXOA 1PN9A 1OYJA 2VCQA 2VL9A 3TGZA 2TRXA 2N5BA 4N0VA 2AB6A 1ZZYA 4KCEA 1YJ6A 4EVMA 4NXIA 3H79A 3UOMA 1MTCA 5J4UA 1FO5A 3WT2A 1TDIA 4CY6A 5HR0A 3C7MA 4ZILA 1AQVA 2HLSA 2OJLA 3TJBA 1R5AA 2GS3A 5ECOB 3S9FA 1T1VA 3FR3A 1B4PA 4IBPA 2GSRA 3TB2A 6GSTA 2YV9A 1VF3A 2IJYA 3CRUA 4DEJA 5IMVA 4OCEA 2WS2A 2GZZA 4F0CA 2C3QA 3TRPA 1UA5A 3R2QA 2R2JA 4OO5A 3KEBA 4ZXGA 3FY7A 3H1NA 3LXTA 1HNCA 4BWSA 5G5EA 3HZ8A 3IHGA 2LJRA 3C1RA 3GX8A 3A2VA 2C1YA 4GRFA 2H76A 1OVNA 2GVPA 2HNLA 4OO4A 1NHYA 3G7YA 3EMPA 3ZIJA 5H5SA 1TXXA 2VO4A 3HDCA 3GKXA 4OD7A 2CV4A 2FCHA 2MMNA 3MNGA 3IK7A 4X43A 4D73A 1EOHA 4KAEA 3J7Yb 4KUNA 1JLVA 4G9HA 3M3MA 1F3AA 1T00A 4I97A 4K1FA 3VURA 3GIXA 5JCGA 4ACSA 3O76A 2BMXA 4HQZA 1OC3A 1GH2A 4HJ2A 2E2GA 1K0DA 3CTGA 4HZ4A 2PMTA 4YQUA 3TJGA 1YF0A 1GNWA 1SKWB 2PUKC 3FRCA 4K5SA 4Z2UA 3MYDA 4GTUA 4IS0A 4ECIA 4N11A 3SBCA 4EO3A 3F4RA 2LTKA 5A5KA 1U3AA 2C0FA 1ERUA 5G5FA 5BRTA 1ACVA 3IDVA 1M9BA 3TRQA 5CP1A 5DBQA 1OC8A 2CX3A 5DJLA 3D21A 1H4OA 2YANA 4TR0A 1X5EA 1O6JA 2D2ZA 3D22A 2YOIA 3F4SA 1SK1A 1QFNA 2BJXA 4E8HA 3EU4A 4ZL7A 5CRGA 5BMUA 4TXOB 3UARA 1EP8A 1X5CA 3DVWA 2A2RA 2H1DA 2WDUA 4K7IA 4PTSA 4DSRA 2IIYA 3QR6A 5INYA 1GSEA 1WRYA 4TR1A 4IGJA 3BBYA 4ECCA 4IP6A 4EKZA 5FHIA 1X5DA 1PN0A 4TW5A 2YV7A 2P5RA 1Q4JA 4OCFA 2ZUPA 3IOSA 2OA7A 5DCHA 1F6MC 2KP2A 4AJ6A 3NOFA 5G2ZA 3E9JB 2LKUA 1A23A 5EVOA 3ME8A 5KN0A 1MDIA 3HA9A 4EDYA 2IMIA 4XS4A 3UL3A 3HCZA 3GKKA 1WIKA 4ML6A 3D5JA 3HVVA 2LNTA 1G6YA 1AAZA 4IVFA 5F8BA 1RK4A 3DXBA 4MJCA 4WEYA 5ELGA 2FWGA 1AUCA 5J5NA 4NPBA 3KP8A 4ZBAA 5CREA 2RIIA 1VF2A 2DLXA 4TVEA 2YN1A 1TI1A 5IPHA 1E2YA 5CRDA 2YP6A 2C0GA 4K9ZA 2DJJA 2DJ1A 4KDYA 3I6AA 3VK9A 2VOCA 1B48A 3F3RA 4HEA2 1PD21 3P7XA 4GSTA 2FHEA 2WULA 1B4QA 3LEFA 5F05A 1G7EA 1N8JA 2VCWA 2RUFA 1TK5B 4ZBBA 3IR4A 3APOA 3OR5A 2JACA 3RHCA 1Z9HA 3L9UA 1XFLA 5J9CA 1A8YA 2IMEA 4HU9A 1FVJA 2YZUA 1UN2A 1KBNA 2B5YA 1THXA 4BL7B 4BVXB 1WOUA 4WF4A 2MMOA 5D9TA 4J57E 3BJ5A 2B1LA 5ECSA 2H30A 1J0FA 1O8WA 1QGVA 3DD3A 4K5RA 3ZLPA 3EC3A 2IWTA 5HR1A 2VLUA 3GSSA 4F9ZA 1SD8A 1ML6A 3CTFA 1FOVA 4NHZA 1PX6A 1TU7A 4WKWA 3NIVA 1JLWA 2DMMA 2GLRA 4MH2A 1XBSA 5IMDA 3IXRA 3ZL5A 4PUAA 3UBKA 16GSA 1X9WB 1HYUA 1M0UA 2NDOA 2O89A 4JU5A 1XPVA 1XZOA 2Z9SA 2JSYA 1G7OA 1W89A 2CT6A 2HRFA 2PGTA 4K2XA 4ZBDA 2MMZA 4XRDA 3F6FA 4XRAA 4NMUA 1GTUA 3L9SA 2LS5A 1KEBA 4BVYB 2K8VA 2VUPA 5KOWA 4EDZA 4WBJA 3KTLA 5G30A 3EINA 4I8BA 2HFDA 1JZDA 4GXZA 1GP1A 1GLQA 2O85A 1R26A 4J56E 1TKDB 2H74A 2CQ9A 1QK8A 1K3YA 1M99A 4ZIJA 2RM6A 1FW1A 1FVKA 3GA4A 2GZPA 4KE3A 1AQXA 3FHKA 3C71A 4ZL8A 3A2WA 1XIYA 1BEDA 3LGCA 1XWBA 5B7CA 2HI7A 5DJMA 2DJ3A 4IW9A 3KP9A 2L5LA 4HQSA 1OE7A 13GSA 5HFIA 4K0GA 1Z3EA 4KSMA 3GFKA 1JZRA 1SKRB 2DIYA 2YWIA 2OE0A 4HI7A 2YPMA 3VFIA 4PQIA 3QFAC 5ECNB 1X9MB 4MPFA 2JZRA 3M9KA 2DJ0A 2FWHA 5DQYA 4MCUA 4RQXA 3ZRDA 1DUGA 11GSA 3BOAA 3VWXA 3L78A 1TTZA 2IN3A 5ENUA 3V1WA 1TRWA 2EIOA 2FD3A 2L4CA 2H8LA 3ZMKA 1V40A 22GSA 5ECHB 2X4AA 1T8EB 3BCKA 2H71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WPI A;  4NHW A;  5CYY A;  4QL9 A;  4TR3 A;  1TW9 A;  3C8E A;  2I1U A;  4XS6 A;  2LQO A;  2REM A;  3GL3 A;  3F3Q A;  4NAX A;  4QL7 A;  5AGY A;  4TXO A;  1V57 A;  1J08 A;  3UVH A;  2CA8 A;  1BJX A;  1OKD A;  4YQV A;  4AJ8 A;  2C3T A;  3N9J A;  4WF5 A;  4ML1 A;  4O32 A;  4MF7 A;  4JR4 A;  3WYW A;  4TXV A;  4LMV A;  7GSS A;  4IQA A;  1K0A A;  4KDU A;  2H6Z A;  3ERG A;  1O73 A;  1PKW A;  2YJH A;  4MZW A;  1PKZ A;  4IJI A;  2I81 A;  4IEL A;  4XS1 A;  1O8X A;  1GSF A;  4MK3 A;  4H86 A;  2E0Q A;  1SU9 A;  3UMA A;  3HKR A;  1TOF A;  3FZ4 A;  4OFM A;  4Q5N A;  3M9J A;  4CDO A;  3TDG A;  2LRC A;  4I2T A;  1A24 A;  1BG5 A;  1PGT A;  1H75 A;  2RUE A;  2OBK A;  1EGR A;  5FWG A;  1A2M A;  4KDX A;  1V9W A;  4HOJ A;  2C0D A;  3IA1 A;  1ZOF A;  1R5P A;  5CRH A;  1WMJ A;  3CRT A;  2L59 A;  1ON4 A;  2J23 A;  3H4K A;  2DJ2 A;  4K0N A;  3UBL A;  5HR3 A;  2DBC A;  3F9U A;  3ZYW A;  2B7K A;  3ZIT A;  2H73 A;  4LL4 B;  5LNK e;  1LBK A;  2H01 A;  3LOR A;  2L4Q A;  1YQ1 A;  1XW9 A;  2P0G A;  2NBS A;  3Q6O A;  4YAV A;  5F06 A;  3VWW A;  1DSB A;  1YZX A;  4O5R A;  3DVX A;  5KN3 A;  5LD0 A;  4L5L A;  3ED3 A;  2I3Y A;  1ERT A;  2FWF A;  3IAM 2;  4RUV A;  4G10 A;  5HQP A;  2WZ9 A;  3ZVJ A;  1TK8 B;  5IQY A;  2CAQ A;  1LU4 A;  2GT5 A;  4X0X A;  2PWJ A;  1AQW A;  3BCI A;  2C8U A;  1ILO A;  3TKQ A;  1B9Y C;  3AY8 A;  4LA1 A;  4V1A g;  1ZCP A;  1MEK A;  1VF1 A;  4HDE A;  2R4V A;  2GGT A;  3VI7 A;  1W4V A;  1SKS B;  3RPP A;  3KCM A;  1Z7R A;  3QD9 A;  2MMA A;  2HZE B;  4KB3 A;  6GSY A;  2TIR A;  4J2F A;  2ALB A;  1MD4 A;  1SK0 A;  4FYB A;  4IHU A;  2R6K A;  4FYC A;  2N5A A;  2H1B A;  4G2E A;  4BL7 A;  3HJP A;  5G1L A;  4BVX A;  5F0G A;  3QPM A;  2X8G A;  2H0H A;  2LNS A;  1VGL A;  5JWO B;  1PRX A;  2CVD A;  2F8A A;  2DIZ A;  3KIJ A;  4Q5R A;  2XPE A;  2OAD A;  3LG6 A;  1C72 A;  4JZQ A;  1MDJ A;  6GSV A;  2GDR A;  2LJA A;  2HZF A;  3F6D A;  2A4V A;  2VD1 A;  6GSW A;  2FNO A;  4I6X A;  3IAS 2;  5DVB A;  1MDK A;  2IMK A;  2AUV A;  3Q18 A;  2V1M A;  4XTS A;  3TKS C;  4NV2 A;  4KW6 A;  1PL2 A;  2M46 A;  2LUS A;  1YF1 A;  3IE3 A;  1F3B A;  2P5Q A;  3L9V A;  3RBT A;  4HUA A;  1K0N A;  1ABA A;  3APS A;  3GHA A;  5DCG A;  12GS A;  3CSI A;  5EY6 A;  2HXK A;  3W6G A;  3WGE A;  4BVY A;  3GX0 A;  3IRA A;  4BPY A;  3MWH A;  3D6I A;  2H72 A;  4ULX A;  1GL8 A;  2QGV A;  1FHE A;  3PR8 A;  3VPQ A;  1R7H A;  2LRT A;  2B7J A;  2IMF A;  3QDN A;  2GST A;  2J9H A;  2WRT A;  1K0O A;  3F8U A;  3GH6 A;  1XVW A;  2ES7 A;  3APQ A;  2QKE A;  3IHQ A;  1F37 A;  4L5O A;  2IPA A;  1S3C A;  3FR6 A;  1TRS A;  4K6X A;  3EE2 A;  3UEM A;  5IMA A;  2R37 A;  1IYI A;  9GSS A;  3J7Y k;  1AXD A;  4F82 A;  1Z7P A;  2VM1 A;  5A4W A;  2B3S A;  2O87 A;  5D9X A;  1EP7 A;  1YDK A;  5DAL B;  4CW9 A;  1Z6N A;  3C1S A;  1GWC A;  2HT9 A;  5JWQ B;  3VI5 A;  2CAI A;  5D96 A;  2X99 A;  3ISO A;  4MMM A;  3GTU B;  3QFB C;  4PQ1 A;  4TKY A;  5E59 A;  1CQG A;  3P2A A;  19GS A;  5DAK B;  2CZ2 A;  5CRW A;  3GKM A;  4LLR A;  4ISD A;  1T3B A;  4FH8 A;  3VLN A;  4GWR A;  2KHP A;  2KP1 A;  2FA8 A;  5LCZ A;  5D8I A;  5JWR B;  3H8Q A;  3GV1 A;  3O6T A;  5GAN D;  1WWJ A;  3GUR A;  2R3X A;  2DC5 A;  3GMF A;  1B8X A;  2H75 A;  5AIS A;  1X9S B;  2PVO C;  4FO5 A;  1B9X C;  2MZC A;  4AF2 A;  1FAA A;  2GSQ A;  1S3D A;  1U88 A;  1THO A;  1USB A;  5DQS A;  3EYT A;  2I9H A;  5G31 A;  1T4Z A;  3TOU A;  1A0F A;  2X64 A;  4ZL9 A;  3UVT A;  3L0H A;  1XW5 A;  3P8W A;  5ABR A;  4DSQ A;  4JE1 A;  1N2A A;  1G0T A;  5G1K A;  2OE1 A;  2B5E A;  4KND A;  5ECM B;  4PNG A;  1U6T A;  1O81 A;  4OFN A;  4X1U A;  5J3R A;  1K3L A;  2VL2 C;  2FY6 A;  2H66 A;  3TUE A;  4DVC A;  1GSU A;  3GKN A;  4BA7 A;  3I69 A;  3W8J A;  3F4T A;  2G2Q A;  1O7U A;  4N30 A;  2AV4 A;  2B1K A;  3GN3 A;  3H93 A;  3TJK A;  1R4W A;  2X8H A;  5H5R A;  2WB9 A;  3QAV A;  2P31 A;  1EZK A;  4Q5F A;  1DE2 A;  2PVQ A;  3DGQ A;  3WT1 A;  5H5Q A;  4PUR A;  1IYH A;  3CXG A;  2FGX A;  2M72 A;  3D4M A;  2VL2 A;  3A5W A;  5C00 A;  2CZ3 A;  3K8N A;  2O8V B;  5J41 A;  4ID0 A;  4MF6 A;  2AYT A;  3LYP A;  2KUC A;  1XW6 A;  1JZW A;  1SJ6 A;  3A2X A;  2ZCT A;  2HRN A;  2L5O A;  1BX9 A;  1HNA A;  5HR2 A;  2JU5 A;  1I5G A;  1GUK A;  4GSS A;  1MD3 A;  1WP0 A;  3PH9 A;  1G6W A;  5COH A;  1I9D A;  4EF0 A;  2H1A A;  5IM9 A;  3ERF A;  2K18 A;  4O7H A;  1XOB A;  2V6K A;  3FR9 A;  2WCI A;  4I2U A;  2VM2 A;  2E7P A;  1DE1 A;  3KMO A;  4O92 A;  2ZNM A;  4Z7X A;  2HZE A;  1OE8 A;  4NV5 A;  2X8C A;  1DBY A;  1XWG A;  4HZ2 A;  3ME7 A;  4K7O A;  3DKS A;  3CBU A;  3EUR A;  1A2L A;  3MDK A;  2CVK A;  3DYR A;  2DJK A;  1XOA A;  4QQ7 A;  2LJK A;  3EWL A;  3LWA A;  2YZH A;  3UAP A;  2H6X A;  5L71 A;  3DWV A;  3IK9 A;  2OBI A;  1K0C A;  4V2M A;  3DRN A;  20GS A;  2N5F A;  3CSH A;  1JHB A;  3QMX A;  2YNX A;  4HS1 A;  3WD6 A;  4FYU A;  5D9V A;  4GCI A;  4V2L A;  5ELA A;  4ZB8 A;  1EEJ A;  1XCC A;  2FA4 A;  3KTB A;  3IC4 A;  5GZZ B;  3ZRE A;  2XBI A;  4RI6 A;  3KD0 A;  5IMZ A;  4ECB A;  2K9F A;  1TRU A;  1SJZ A;  4MZB A;  3RDW A;  1FG4 A;  1K0B A;  4WR5 A;  1SD9 A;  4XCS A;  2LST A;  4IJ3 A;  1LJR A;  4OFT A;  2G0F A;  4RI7 A;  2H0I A;  3KZQ A;  4MJB A;  1GSD A;  1PMT A;  3TJJ A;  3BD2 A;  3EVI A;  5KN1 A;  3QAG A;  5A4V A;  1JZO A;  4TRX A;  1EWX A;  1V98 A;  3EU3 A;  2GQM A;  3IV4 A;  2XPD A;  2RM5 A;  2H6Y A;  3M8N A;  3MAK A;  5DAL A;  3QOU A;  2PPT A;  3DIE A;  4WR4 A;  4AJ7 A;  3LSZ A;  5GAP D;  3M0F A;  5ECL B;  3GTU A;  1GSY A;  2IL3 A;  5IPG A;  1SJI A;  4ECJ A;  3D4T A;  3PGT A;  1F9M A;  2VD0 A;  4MZC A;  2E2M A;  4PNF A;  4GF0 A;  2YJ7 A;  4YH2 A;  4K7N A;  3FKF A;  4MJE A;  5DAK A;  4PUF C;  4NWY A;  4MDC A;  5IO2 A;  1M2A A;  1QMV A;  2VCX A;  2PBJ A;  4KCA A;  2V2G A;  4WXT A;  4GLT A;  2PER A;  1SL1 B;  5B8B A;  2F51 A;  3TKS E;  1GSS A;  3FZA A;  4OWY A;  3ZZX A;  2OKA A;  2WGR A;  5B6M A;  5GSS A;  2QC7 A;  1PA3 A;  4V1A p;  4N0Z A;  4DSS B;  3C73 A;  1SK2 A;  2AAW A;  2NVL A;  3U6V A;  1M9A A;  2IFQ A;  2YWO A;  6GSS A;  2VL3 A;  2ON7 A;  3L4N A;  3FK8 A;  4POM A;  2C3N A;  2OAC A;  2V32 A;  3ZTL A;  2YWM A;  3HZ4 A;  3NZN A;  2V6O A;  2XC2 A;  3PIN A;  5B6N A;  1TK0 B;  5ECR B;  1GUM A;  3WGX A;  5AN1 A;  1XWK A;  4K2D A;  3FZ9 A;  1TRV A;  1U3I A;  2CVB A;  4POB A;  2QSI A;  1TJD A;  1EGO A;  10GS A;  2LRN A;  3RPN A;  5CNW A;  1VRS D;  1V2A A;  2H1G A;  1Z5Y E;  4KGI A;  2MBT A;  3DML A;  5ECI B;  2VIM A;  1YKA A;  4WET A;  3LQ7 A;  4F2I A;  3G7I A;  2LV3 A;  2L57 A;  3I43 A;  5AIX A;  3VPT A;  2HSY A;  3LYK A;  1XXU A;  4CHS A;  5CO3 A;  1A2J A;  4KA0 A;  3HVS A;  1SEN A;  3SWL A;  2F8F A;  4MAB A;  3TKP A;  1E6B A;  1Z6M A;  5IO0 A;  3ZFB A;  2PU9 C;  2VLT A;  1A8L A;  3I9V 2;  3ZVJ D;  1GRX A;  4JR6 A;  1KNG A;  5KN2 A;  2LQQ A;  3TKS A;  3TCO A;  2HSH A;  5ECP B;  5A4U A;  3E3E A;  1T7P B;  3CSJ A;  1F2E A;  3HXS A;  3IBH A;  1PL1 A;  3CYN A;  2GQL A;  5D9W A;  2ON5 A;  2H19 A;  1GSQ A;  2JL4 A;  5ID2 B;  2L6D A;  4JRR A;  1Y6E A;  2A2S A;  1GUH A;  5EL8 A;  2MYG A;  4BWQ A;  1NSW A;  4LMW A;  2CX4 A;  4KH7 A;  1JFU A;  5CAX A;  4EC0 A;  1V58 A;  2M80 A;  1K0M A;  2C4J A;  1RW1 A;  3KH7 A;  4KX4 A;  4XHM A;  1OAZ A;  4MA9 A;  4G19 A;  3TOT A;  4MP4 A;  1OC9 B;  3A3T A;  2KLX A;  2C0E A;  3D0Z A;  4MH3 A;  1UC7 A;  1ZYQ B;  1Q98 A;  2WJU A;  4POK A;  4KSO A;  5D73 A;  2YCD A;  3RHB A;  1HNB A;  3HJO A;  4GQF A;  1ZL9 A;  3HVX A;  5JCU A;  1TU8 A;  2R5G A;  3HHV A;  2HYX A;  3VWV A;  3HJM A;  3UIW A;  2VLV A;  1AC1 A;  2EIR A;  3HY2 A;  1AW9 A;  1WE0 A;  3EMX A;  4JBB A;  1NW2 A;  1EEM A;  2V41 A;  2O7K A;  1QUW A;  4IKH A;  4IP1 A;  4FIW A;  1GTA A;  3ZFL A;  5JCW A;  2OE3 A;  4PGT A;  1PX7 A;  2NPB A;  1YY7 A;  2K6V A;  1BAY A;  1PSQ A;  2EIQ A;  1J9B A;  3TJF A;  4OMV A;  3US3 A;  1KTE A;  2KOK A;  4RQR A;  3E0U A;  1TP9 A;  4EUY A;  4N10 A;  3RAZ A;  5GST A;  2VAF A;  2TRC P;  5D93 A;  5ECQ B;  2IFQ B;  5AIV A;  2F3M A;  1GUL A;  1XVQ A;  3Q74 A;  1O85 A;  2B6M A;  1EOG A;  1HQO A;  1SL2 B;  3N5O A;  2BTO T;  4Q5Q A;  4ZB9 A;  5HFG A;  1NM3 A;  4PQH A;  4D73 B;  1PQN A;  1QQ2 A;  1ZMA A;  3F0I A;  1WJK A;  3DEX A;  1SYX A;  1VF4 A;  3QAW A;  4IN0 A;  4V2N A;  1ERW A;  4HU7 A;  1A0R P;  3IPZ A;  3UJ1 A;  3O3T A;  3MSZ A;  3CMI A;  4I5Q A;  1K3O A;  2FWE A;  3GH9 A;  3GUS A;  1QXH A;  3TRX A;  4F03 A;  2GQK A;  5ECK B;  2GT6 A;  1M2D A;  5IMF A;  3TKR A;  2VCV A;  3KH9 A;  1BQ7 A;  3P90 A;  4F0B A;  5J9B A;  1GNE A;  3Q19 A;  5IIZ A;  2GTU A;  4TR4 A;  1EV9 A;  2JSZ A;  3GYK A;  2FUG 2;  5IMC A;  4XIH A;  4JED A;  1FB0 A;  2PN8 A;  3KJY A;  2FLS A;  4GSN A;  3KM6 A;  3ZIV A;  4ILF A;  2IMD A;  1XWC A;  18GS A;  3HD5 A;  2GZY A;  1GTB A;  4TR1 B;  2EC4 A;  8GSS A;  3FW2 A;  3GNJ A;  4TN8 A;  4DSS A;  3U5R E;  3W8S A;  2AJQ B;  2JZT A;  3LFL A;  1EV4 A;  3KXO A;  3G9B A;  5F07 A;  4ZB6 A;  2WFC A;  2F9S A;  1ST9 A;  2I4A A;  4MJA A;  2B5X A;  2YWN A;  1ERV A;  3FEU A;  5B8A A;  6GSX A;  3LXZ A;  14GS A;  3JCM L;  5FT3 A;  5KEJ A;  1NHO A;  1ZGN A;  1TI3 A;  2C80 A;  4AGS A;  4IQ1 A;  4XS4 B;  2L6C A;  3WGD A;  4MF5 A;  4YQM A;  3HYP A;  3KMN A;  1M2B A;  3LJR A;  4PX1 A;  2NTO A;  2LEG A;  5IOX A;  6GSU A;  5EPF A;  4EXJ A;  2JZS A;  1OKT A;  4L8E A;  5E4W A;  4K8M A;  4POL A;  1YKC A;  3KGK A;  2H70 A;  1SYR A;  4L0W A;  2K8S A;  3F63 A;  2JAD A;  2VCT A;  4EE0 A;  5IOW A;  4WBR D;  2XHF A;  2DML A;  4YAP A;  3FYG A;  1XWA A;  2XBQ A;  2GSS A;  1BYE A;  2DSA A;  4LL1 B;  5C04 A;  3ZML A;  1CQH A;  5DDL A;  3GL5 A;  3GRX A;  3G7J A;  1U87 A;  4HJM A;  1T4Y A;  1URM A;  1GTI A;  4E8E A;  1ZYE A;  4GQC A;  1X0R A;  4MLY A;  4EL1 A;  5HFK A;  3VWU A;  3ERW A;  2RLI A;  1UVZ A;  2HE3 A;  2MBS A;  2VCZ A;  4P3Y B;  5ID2 A;  1HD2 A;  4L0U A;  1S3A A;  1Y25 A;  4TOP A;  1RQM A;  3QCP A;  3M1G A;  2H0G A;  1FB6 A;  3GST A;  1YEP A;  3FZ5 A;  2AHE A;  1GLP A;  17GS A;  1M7T A;  1OC9 A;  1YEX A;  4MPG A;  1AIU A;  1SL0 B;  4PXO A;  1PN9 A;  1OYJ A;  2VCQ A;  2VL9 A;  3TGZ A;  2TRX A;  2N5B A;  4N0V A;  2AB6 A;  1ZZY A;  4KCE A;  1YJ6 A;  4EVM A;  4NXI A;  3H79 A;  3UOM A;  1MTC A;  5J4U A;  1FO5 A;  3WT2 A;  1TDI A;  5HR0 A;  3C7M A;  4ZIL A;  1AQV A;  2HLS A;  2OJL A;  3TJB A;  1R5A A;  2GS3 A;  5ECO B;  3S9F A;  1T1V A;  3FR3 A;  1B4P A;  4IBP A;  2GSR A;  3TB2 A;  6GST A;  2YV9 A;  1VF3 A;  2IJY A;  3CRU A;  4DEJ A;  5IMV A;  4OCE A;  2WS2 A;  2GZZ A;  4F0C A;  2C3Q A;  3TRP A;  1UA5 A;  3R2Q A;  2R2J A;  4OO5 A;  3KEB A;  4ZXG A;  3FY7 A;  3H1N A;  3LXT A;  1HNC A;  4BWS A;  5G5E A;  3HZ8 A;  2LJR A;  3C1R A;  3GX8 A;  3A2V A;  2C1Y A;  4GRF A;  2H76 A;  1OVN A;  2GVP A;  2HNL A;  4OO4 A;  1NHY A;  3G7Y A;  3EMP A;  3ZIJ A;  5H5S A;  1TXX A;  2VO4 A;  3HDC A;  3GKX A;  4OD7 A;  2CV4 A;  2FCH A;  2MMN A;  3MNG A;  3IK7 A;  4X43 A;  4D73 A;  1EOH A;  4KAE A;  3J7Y b;  4KUN A;  1JLV A;  4G9H A;  3M3M A;  1F3A A;  1T00 A;  4I97 A;  4K1F A;  3VUR A;  3GIX A;  5JCG A;  4ACS A;  3O76 A;  2BMX A;  4HQZ A;  1OC3 A;  1GH2 A;  4HJ2 A;  2E2G A;  1K0D A;  3CTG A;  4HZ4 A;  2PMT A;  4YQU A;  3TJG A;  1YF0 A;  1GNW A;  1SKW B;  2PUK C;  3FRC A;  4IS0 A;  4GTU A;  4ECI A;  4N11 A;  3SBC A;  4EO3 A;  3F4R A;  2LTK A;  5A5K A;  1U3A A;  2C0F A;  1ERU A;  5G5F A;  1ACV A;  3IDV A;  1M9B A;  3TRQ A;  5CP1 A;  5DBQ A;  1OC8 A;  2CX3 A;  5DJL A;  3D21 A;  1H4O A;  2YAN A;  4TR0 A;  1X5E A;  1O6J A;  2D2Z A;  3D22 A;  2YOI A;  3F4S A;  1SK1 A;  1QFN A;  2BJX A;  4E8H A;  3EU4 A;  4ZL7 A;  5CRG A;  4TXO B;  3UAR A;  1EP8 A;  1X5C A;  3DVW A;  2A2R A;  2H1D A;  2WDU A;  4K7I A;  4DSR A;  2IIY A;  3QR6 A;  5INY A;  1GSE A;  1WRY A;  4TR1 A;  4IGJ A;  3BBY A;  4ECC A;  4IP6 A;  4EKZ A;  5FHI A;  1X5D A;  4TW5 A;  2YV7 A;  2P5R A;  1Q4J A;  4OCF A;  2ZUP A;  3IOS A;  2OA7 A;  5DCH A;  1F6M C;  2KP2 A;  4AJ6 A;  3NOF A;  5G2Z A;  3E9J B;  2LKU A;  1A23 A;  5EVO A;  3ME8 A;  5KN0 A;  1MDI A;  3HA9 A;  4EDY A;  2IMI A;  4XS4 A;  3UL3 A;  3HCZ A;  3GKK A;  1WIK A;  4ML6 A;  3D5J A;  3HVV A;  2LNT A;  1G6Y A;  1AAZ A;  4IVF A;  5F8B A;  1RK4 A;  3DXB A;  4MJC A;  4WEY A;  5ELG A;  2FWG A;  1AUC A;  5J5N A;  4NPB A;  3KP8 A;  4ZBA A;  5CRE A;  2RII A;  1VF2 A;  2DLX A;  4TVE A;  2YN1 A;  1TI1 A;  5IPH A;  1E2Y A;  5CRD A;  2YP6 A;  2C0G A;  4K9Z A;  2DJJ A;  2DJ1 A;  4KDY A;  3I6A A;  3VK9 A;  2VOC A;  1B48 A;  3F3R A;  4HEA 2;  1PD2 1;  3P7X A;  4GST A;  2FHE A;  2WUL A;  1B4Q A;  3LEF A;  5F05 A;  1G7E A;  1N8J A;  2VCW A;  2RUF A;  1TK5 B;  4ZBB A;  3IR4 A;  3APO A;  3OR5 A;  2JAC A;  3RHC A;  1Z9H A;  3L9U A;  1XFL A;  5J9C A;  1A8Y A;  2IME A;  4HU9 A;  1FVJ A;  2YZU A;  1UN2 A;  1KBN A;  2B5Y A;  1THX A;  1WOU A;  4WF4 A;  2MMO A;  5D9T A;  4J57 E;  3BJ5 A;  2B1L A;  5ECS A;  2H30 A;  1J0F A;  1O8W A;  1QGV A;  3DD3 A;  3ZLP A;  3EC3 A;  2IWT A;  5HR1 A;  2VLU A;  3GSS A;  4F9Z A;  1SD8 A;  1ML6 A;  3CTF A;  1FOV A;  4NHZ A;  1PX6 A;  1TU7 A;  4WKW A;  3NIV A;  1JLW A;  2DMM A;  2GLR A;  4MH2 A;  1XBS A;  5IMD A;  3IXR A;  3ZL5 A;  4PUA A;  3UBK A;  16GS A;  1X9W B;  1HYU A;  1M0U A;  2NDO A;  2O89 A;  4JU5 A;  1XPV A;  1XZO A;  2Z9S A;  2JSY A;  1G7O A;  1W89 A;  2CT6 A;  2HRF A;  2PGT A;  4ZBD A;  2MMZ A;  4XRD A;  3F6F A;  4XRA A;  4NMU A;  1GTU A;  3L9S A;  2LS5 A;  1KEB A;  2K8V A;  2VUP A;  4EDZ A;  4WBJ A;  3KTL A;  5G30 A;  3EIN A;  4I8B A;  2HFD A;  1JZD A;  4GXZ A;  1GP1 A;  1GLQ A;  2O85 A;  1R26 A;  4J56 E;  1TKD B;  2H74 A;  2CQ9 A;  1QK8 A;  1K3Y A;  1M99 A;  4ZIJ A;  2RM6 A;  1FW1 A;  1FVK A;  3GA4 A;  2GZP A;  4KE3 A;  1AQX A;  3FHK A;  3C71 A;  4ZL8 A;  3A2W A;  1XIY A;  1BED A;  3LGC A;  1XWB A;  5B7C A;  2HI7 A;  5DJM A;  2DJ3 A;  4IW9 A;  3KP9 A;  2L5L A;  4HQS A;  1OE7 A;  13GS A;  5HFI A;  4K0G A;  1Z3E A;  4KSM A;  3GFK A;  1JZR A;  1SKR B;  2DIY A;  2YWI A;  2OE0 A;  4HI7 A;  2YPM A;  3VFI A;  4PQI A;  3QFA C;  5ECN B;  1X9M B;  4MPF A;  2JZR A;  3M9K A;  2DJ0 A;  2FWH A;  5DQY A;  4MCU A;  4RQX A;  3ZRD A;  1DUG A;  11GS A;  3BOA A;  3VWX A;  3L78 A;  1TTZ A;  2IN3 A;  5ENU A;  3V1W A;  1TRW A;  2EIO A;  2FD3 A;  2L4C A;  2H8L A;  3ZMK A;  1V40 A;  22GS A;  5ECH B;  1T8E B;  3BCK A;  2H71 A; 
#chains in the Genus database with same CATH topology
 1WPI A;  2HRK A;  4NHW A;  5CYY A;  4QL9 A;  4TR3 A;  1TW9 A;  3C8E A;  2I1U A;  4XS6 A;  2LQO A;  2REM A;  3GL3 A;  3F3Q A;  4NAX A;  4QL7 A;  5AGY A;  4TXO A;  1V57 A;  1J08 A;  3UVH A;  2CA8 A;  1BJX A;  1OKD A;  4YQV A;  4AJ8 A;  2C3T A;  3N9J A;  4WF5 A;  4ML1 A;  4O32 A;  4MF7 A;  4JR4 A;  3WYW A;  4TXV A;  4LMV A;  7GSS A;  4IQA A;  1K0A A;  2QA2 A;  4KDU A;  2H6Z A;  3ERG A;  1O73 A;  1PKW A;  2YJH A;  4MZW A;  1PKZ A;  4IJI A;  2I81 A;  4IEL A;  4XS1 A;  1O8X A;  1GSF A;  4MK3 A;  4H86 A;  2E0Q A;  1SU9 A;  3UMA A;  3HKR A;  1TOF A;  3FZ4 A;  4OFM A;  4Q5N A;  3M9J A;  4CDO A;  3TDG A;  2LRC A;  4I2T A;  1A24 A;  1BG5 A;  1PGT A;  4KF9 A;  1H75 A;  2RUE A;  2OBK A;  1EGR A;  5FWG A;  1A2M A;  4KDX A;  1V9W A;  4HOJ A;  2C0D A;  3IA1 A;  1ZOF A;  1R5P A;  5CRH A;  1WMJ A;  3CRT A;  2L59 A;  1ON4 A;  2J23 A;  3H4K A;  2DJ2 A;  4K0N A;  3UBL A;  5HR3 A;  2DBC A;  3F9U A;  3ZYW A;  2B7K A;  3ZIT A;  2H73 A;  4LL4 B;  5LNK e;  1LBK A;  2H01 A;  3LOR A;  4YKG A;  2L4Q A;  1YQ1 A;  1XW9 A;  2P0G A;  2NBS A;  3Q6O A;  4YAV A;  5F06 A;  3VWW A;  1DSB A;  1YZX A;  4O5R A;  3DVX A;  5KN3 A;  5LD0 A;  4L5L A;  3ED3 A;  2I3Y A;  1ERT A;  2FWF A;  3IAM 2;  4RUV A;  4G10 A;  5HQP A;  4ICY A;  2WZ9 A;  3ZVJ A;  1TK8 B;  5IQY A;  2CAQ A;  1LU4 A;  2GT5 A;  4X0X A;  2PWJ A;  1AQW A;  3BCI A;  2C8U A;  1ILO A;  3TKQ A;  1B9Y C;  3AY8 A;  4LA1 A;  4V1A g;  1ZCP A;  1MEK A;  5KOX A;  1VF1 A;  2HRA A;  4HDE A;  2R4V A;  2GGT A;  3VI7 A;  1W4V A;  1SKS B;  3RPP A;  3KCM A;  1Z7R A;  3QD9 A;  2MMA A;  2HZE B;  4KB3 A;  6GSY A;  2TIR A;  4J2F A;  2ALB A;  1MD4 A;  1SK0 A;  4FYB A;  4IHU A;  2R6K A;  4FYC A;  2N5A A;  2H1B A;  4G2E A;  4BL7 A;  3HJP A;  5G1L A;  4BVX A;  5F0G A;  3QPM A;  2X8G A;  2H0H A;  2LNS A;  1VGL A;  5JWO B;  1PRX A;  2CVD A;  2F8A A;  2DIZ A;  3KIJ A;  4Q5R A;  2XPE A;  2OAD A;  3LG6 A;  1C72 A;  4JZQ A;  1MDJ A;  6GSV A;  2GDR A;  2LJA A;  2HZF A;  3F6D A;  2A4V A;  2VD1 A;  6GSW A;  2FNO A;  4I6X A;  3IAS 2;  5DVB A;  1MDK A;  2IMK A;  2AUV A;  3Q18 A;  2V1M A;  4XTS A;  3TKS C;  4NV2 A;  4KW6 A;  1PL2 A;  2M46 A;  2LUS A;  1YF1 A;  3IE3 A;  1F3B A;  2P5Q A;  3MIX A;  3L9V A;  3RBT A;  4HUA A;  1K0N A;  1ABA A;  3APS A;  3GHA A;  4CY8 A;  5DCG A;  12GS A;  3CSI A;  5EY6 A;  2A4H A;  2HXK A;  3W6G A;  3WGE A;  4BVY A;  3GX0 A;  3IRA A;  4BPY A;  3MWH A;  3D6I A;  2H72 A;  4ULX A;  1GL8 A;  2QGV A;  1FHE A;  3PR8 A;  3VPQ A;  1R7H A;  2LRT A;  2B7J A;  2HSM A;  2IMF A;  3IC8 A;  3QDN A;  2GST A;  2J9H A;  2WRT A;  1K0O A;  3F8U A;  3GH6 A;  1XVW A;  2ES7 A;  3APQ A;  2QKE A;  3IHQ A;  1F37 A;  4L5O A;  2IPA A;  1S3C A;  3FR6 A;  1TRS A;  4K6X A;  3EE2 A;  3UEM A;  5IMA A;  2R37 A;  3A5I A;  1IYI A;  9GSS A;  3J7Y k;  1AXD A;  4F82 A;  1Z7P A;  2VM1 A;  4USS A;  5A4W A;  2B3S A;  2O87 A;  5D9X A;  1EP7 A;  1YDK A;  5DAL B;  4CW9 A;  1Z6N A;  3C1S A;  1GWC A;  2HT9 A;  5JWQ B;  3VI5 A;  2CAI A;  5D96 A;  2X99 A;  3ISO A;  4MMM A;  3GTU B;  3QFB C;  4PQ1 A;  4TKY A;  5E59 A;  1CQG A;  3P2A A;  19GS A;  5DAK B;  2CZ2 A;  5CRW A;  2X49 A;  3GKM A;  4LLR A;  4ISD A;  1T3B A;  4FH8 A;  3VLN A;  4GWR A;  2KHP A;  4O5U A;  2KP1 A;  2FA8 A;  5LCZ A;  5D8I A;  5JWR B;  3H8Q A;  3GV1 A;  3O6T A;  5GAN D;  1WWJ A;  3GUR A;  2R3X A;  2DC5 A;  3GMF A;  1B8X A;  2H75 A;  5AIS A;  1X9S B;  4G0I A;  2PVO C;  4FO5 A;  4Z2T A;  1B9X C;  2MZC A;  4AF2 A;  1FAA A;  2GSQ A;  1S3D A;  1U88 A;  1THO A;  1USB A;  3FMW A;  5DQS A;  3EYT A;  2I9H A;  4EIQ A;  5G31 A;  1T4Z A;  3TOU A;  1A0F A;  1M3J A;  2X64 A;  4ZL9 A;  3UVT A;  3L0H A;  1XW5 A;  3P8W A;  5ABR A;  4DSQ A;  4JE1 A;  4HSC X;  1N2A A;  1G0T A;  5G1K A;  2OE1 A;  4MNN A;  2B5E A;  4KND A;  5ECM B;  4PNG A;  1U6T A;  1O81 A;  4OFN A;  4X1U A;  5J3R A;  1K3L A;  2VL2 C;  2FY6 A;  2H66 A;  3TUE A;  4DVC A;  1GSU A;  3GKN A;  4BA7 A;  3I69 A;  3W8J A;  3F4T A;  2G2Q A;  1O7U A;  4N30 A;  3EPT A;  2AV4 A;  2B1K A;  3GN3 A;  3H93 A;  3TJK A;  1R4W A;  2X8H A;  5H5R A;  2WB9 A;  3QAV A;  2P31 A;  1EZK A;  4Z2R A;  4Q5F A;  1DE2 A;  2PVQ A;  3DGQ A;  3WT1 A;  5H5Q A;  4PUR A;  1IYH A;  3CXG A;  2FGX A;  2M72 A;  3D4M A;  2VL2 A;  3A5W A;  5C00 A;  2CZ3 A;  3K8N A;  2O8V B;  5J41 A;  4ID0 A;  4MF6 A;  2AYT A;  3LYP A;  2KUC A;  1XW6 A;  1JZW A;  1SJ6 A;  3A2X A;  2ZCT A;  2HRN A;  2R0C A;  2L5O A;  1BX9 A;  1HNA A;  5HR2 A;  2JU5 A;  1I5G A;  1GUK A;  4GSS A;  1MD3 A;  1WP0 A;  3PH9 A;  1G6W A;  5COH A;  1I9D A;  4EF0 A;  2H1A A;  5IM9 A;  3ERF A;  2K18 A;  4O7H A;  1XOB A;  2V6K A;  3FR9 A;  2WCI A;  4I2U A;  2VM2 A;  2E7P A;  1DE1 A;  3KMO A;  4O92 A;  2ZNM A;  4Z7X A;  2HZE A;  1OE8 A;  4NV5 A;  2X8C A;  1DBY A;  1XWG A;  4HZ2 A;  3ME7 A;  4K7O A;  3DKS A;  3CBU A;  3EUR A;  1A2L A;  3MDK A;  2CVK A;  3DYR A;  2DJK A;  1XOA A;  4QQ7 A;  2LJK A;  3EWL A;  3LWA A;  2YZH A;  3UAP A;  2H6X A;  5L71 A;  3DWV A;  3IK9 A;  2OBI A;  1K0C A;  4V2M A;  3DRN A;  2R0G A;  20GS A;  2N5F A;  3CSH A;  1JHB A;  3QMX A;  2YNX A;  4HS1 A;  3WD6 A;  4FYU A;  5D9V A;  4GCI A;  4V2L A;  5ELA A;  4ZB8 A;  1EEJ A;  1XCC A;  2FA4 A;  3KTB A;  3IC4 A;  5GZZ B;  3ZRE A;  2XBI A;  4RI6 A;  3KD0 A;  5IMZ A;  4ECB A;  2K9F A;  1TRU A;  1SJZ A;  4MZB A;  3RDW A;  1FG4 A;  1K0B A;  4WR5 A;  1SD9 A;  4XCS A;  2LST A;  4IJ3 A;  1LJR A;  4OFT A;  2G0F A;  1ZYN A;  4RI7 A;  2H0I A;  3KZQ A;  4MJB A;  1XG8 A;  1GSD A;  1PMT A;  3TJJ A;  3BD2 A;  3EVI A;  5KN1 A;  3QAG A;  5A4V A;  4G0L A;  1JZO A;  4TRX A;  1EWX A;  1V98 A;  3EU3 A;  4G0K A;  2GQM A;  3IV4 A;  2XPD A;  2RM5 A;  2H6Y A;  3M8N A;  3MAK A;  5DAL A;  3QOU A;  2PPT A;  3DIE A;  4WR4 A;  4AJ7 A;  3LSZ A;  5GAP D;  3M0F A;  5ECL B;  3GTU A;  1GSY A;  2IL3 A;  5IPG A;  1SJI A;  4ECJ A;  3D4T A;  4MZC A;  1F9M A;  2VD0 A;  3PGT A;  2E2M A;  4PNF A;  4EIP A;  4GF0 A;  2YJ7 A;  4YH2 A;  4K7N A;  3FKF A;  4MJE A;  5DAK A;  2A2P A;  4PUF C;  4NWY A;  4MDC A;  5IO2 A;  1M2A A;  1QMV A;  3LW9 A;  2VCX A;  2PBJ A;  4KCA A;  2V2G A;  4WXT A;  4GLT A;  2PER A;  1SL1 B;  5B8B A;  2F51 A;  3TKS E;  1GSS A;  3FZA A;  4OWY A;  3ZZX A;  2OKA A;  2WGR A;  5B6M A;  5GSS A;  2QC7 A;  1PA3 A;  4V1A p;  4N0Z A;  4DSS B;  3C73 A;  1SK2 A;  2AAW A;  2NVL A;  3U6V A;  1M9A A;  2IFQ A;  2YWO A;  6GSS A;  2VL3 A;  2ON7 A;  3L4N A;  3FK8 A;  4POM A;  2C3N A;  2OAC A;  2V32 A;  3ZTL A;  2YWM A;  3HZ4 A;  3NZN A;  2V6O A;  2XC2 A;  3PIN A;  5B6N A;  1TK0 B;  5ECR B;  1GUM A;  3WGX A;  5AN1 A;  1XWK A;  4K2D A;  3FZ9 A;  1TRV A;  1U3I A;  2CVB A;  4POB A;  2QSI A;  1TJD A;  1EGO A;  10GS A;  2LRN A;  3RPN A;  5CNW A;  1VRS D;  1V2A A;  2H1G A;  1Z5Y E;  4KGI A;  2MBT A;  3DML A;  5ECI B;  2VIM A;  1YKA A;  4WET A;  3LQ7 A;  4F2I A;  3G7I A;  2LV3 A;  2L57 A;  3I43 A;  5AIX A;  3VPT A;  2HSY A;  3LYK A;  1XXU A;  2R0P A;  4CHS A;  5CO3 A;  1A2J A;  4KA0 A;  3HVS A;  1SEN A;  3SWL A;  2F8F A;  4MAB A;  3TKP A;  1E6B A;  1Z6M A;  5IO0 A;  3ZFB A;  2PU9 C;  2VLT A;  1A8L A;  3I9V 2;  3ZVJ D;  1GRX A;  4JR6 A;  1KNG A;  5KN2 A;  2LQQ A;  3TKS A;  3TCO A;  2HSH A;  5ECP B;  5A4U A;  3E3E A;  1T7P B;  3CSJ A;  1F2E A;  3HXS A;  3IBH A;  1PL1 A;  3CYN A;  2GQL A;  5D9W A;  2ON5 A;  2H19 A;  1GSQ A;  2JL4 A;  5ID2 B;  2L6D A;  4JRR A;  1Y6E A;  2A2S A;  1GUH A;  5EL8 A;  2MYG A;  4BWQ A;  1NSW A;  4LMW A;  2CX4 A;  4KH7 A;  1JFU A;  5CAX A;  4EC0 A;  1V58 A;  2M80 A;  1K0M A;  2C4J A;  4X4J A;  1RW1 A;  3KH7 A;  4KX4 A;  4XHM A;  1OAZ A;  4MA9 A;  4G19 A;  3TOT A;  4MP4 A;  1OC9 B;  3A3T A;  2KLX A;  2C0E A;  3D0Z A;  4MH3 A;  1UC7 A;  1ZYQ B;  1Q98 A;  2WJU A;  4POK A;  4KSO A;  5D73 A;  2YCD A;  3RHB A;  1HNB A;  3HJO A;  4GQF A;  1ZL9 A;  3HVX A;  5JCU A;  1TU8 A;  2R5G A;  3HHV A;  2HYX A;  3VWV A;  3HJM A;  3UIW A;  2VLV A;  1AC1 A;  2EIR A;  3HY2 A;  1AW9 A;  1WE0 A;  4O5Q A;  3EMX A;  4JBB A;  1NW2 A;  1EEM A;  2V41 A;  2O7K A;  1QUW A;  4IKH A;  4IP1 A;  4FIW A;  1GTA A;  3ZFL A;  5JCW A;  2OE3 A;  4PGT A;  1PX7 A;  2NPB A;  1YY7 A;  2K6V A;  1BAY A;  1PSQ A;  2EIQ A;  1J9B A;  3TJF A;  4OMV A;  3US3 A;  1KTE A;  2KOK A;  4RQR A;  3E0U A;  1TP9 A;  4EUY A;  4N10 A;  3RAZ A;  5GST A;  2VAF A;  2TRC P;  5D93 A;  5ECQ B;  2IFQ B;  5AIV A;  2F3M A;  1GUL A;  1XVQ A;  3Q74 A;  1O85 A;  2B6M A;  1EOG A;  1HQO A;  1SL2 B;  3N5O A;  2BTO T;  4Q5Q A;  4ZB9 A;  5HFG A;  1NM3 A;  4PQH A;  4D73 B;  1PQN A;  1QQ2 A;  1ZMA A;  3F0I A;  1WJK A;  3DEX A;  1SYX A;  1VF4 A;  3QAW A;  4IN0 A;  4V2N A;  1ERW A;  4HU7 A;  1A0R P;  3IPZ A;  2QA1 A;  3UJ1 A;  3O3T A;  3MSZ A;  3CMI A;  4I5Q A;  1K3O A;  2FWE A;  3GH9 A;  3GUS A;  1QXH A;  3TRX A;  3HVN A;  4F03 A;  2GQK A;  5ECK B;  2GT6 A;  1M2D A;  3PPU A;  4FQU A;  2DKI A;  5IMF A;  3TKR A;  2VCV A;  2UZ8 A;  3KH9 A;  1BQ7 A;  3P90 A;  4F0B A;  5J9B A;  1GNE A;  3Q19 A;  1FOH A;  5IIZ A;  2GTU A;  4TR4 A;  1EV9 A;  2JSZ A;  3GYK A;  2FUG 2;  5IMC A;  4XIH A;  4JED A;  1FB0 A;  2PN8 A;  3KJY A;  2FLS A;  4GSN A;  3KM6 A;  3ZIV A;  4ILF A;  2IMD A;  1XWC A;  18GS A;  3HD5 A;  2GZY A;  1GTB A;  4TR1 B;  2EC4 A;  8GSS A;  3FW2 A;  3GNJ A;  4TN8 A;  4DSS A;  3U5R E;  3W8S A;  2AJQ B;  2JZT A;  3LFL A;  1EV4 A;  3KXO A;  3G9B A;  5F07 A;  4ZB6 A;  2WFC A;  2F9S A;  1ST9 A;  2I4A A;  4MJA A;  2B5X A;  2YWN A;  1ERV A;  3FEU A;  5B8A A;  6GSX A;  3LXZ A;  14GS A;  3JCM L;  5FT3 A;  5KEJ A;  1NHO A;  1ZGN A;  1TI3 A;  2C80 A;  4AGS A;  4IQ1 A;  4XS4 B;  2L6C A;  3WGD A;  4MF5 A;  4YQM A;  3HYP A;  3KMN A;  1M2B A;  3LJR A;  4PX1 A;  2NTO A;  2LEG A;  5IOX A;  6GSU A;  4YKF A;  5EPF A;  4EXJ A;  2JZS A;  4BIK A;  1OKT A;  1ZYP A;  4L8E A;  5E4W A;  4K8M A;  4POL A;  1YKC A;  3KGK A;  2H70 A;  1SYR A;  4L0W A;  2K8S A;  3F63 A;  2JAD A;  2VCT A;  4EE0 A;  5IOW A;  4WBR D;  2XHF A;  2DML A;  4YAP A;  3FYG A;  1XWA A;  2XBQ A;  2GSS A;  1BYE A;  2DSA A;  4LL1 B;  5C04 A;  3ZML A;  1CQH A;  5DDL A;  3GL5 A;  3GRX A;  3G7J A;  1U87 A;  4HJM A;  1T4Y A;  1URM A;  1GTI A;  4E8E A;  1ZYE A;  4GQC A;  1X0R A;  4MLY A;  4EL1 A;  5HFK A;  3VWU A;  3ERW A;  2RLI A;  1UVZ A;  2HE3 A;  2MBS A;  2VCZ A;  4P3Y B;  5ID2 A;  1HD2 A;  4L0U A;  1S3A A;  1Y25 A;  4TOP A;  1RQM A;  3QCP A;  3M1G A;  2H0G A;  1FB6 A;  3GST A;  1YEP A;  3FZ5 A;  2AHE A;  1GLP A;  3CQF A;  17GS A;  4A5P A;  1M7T A;  2DKH A;  1OC9 A;  1YEX A;  4MPG A;  1AIU A;  1SL0 B;  3R3E A;  4PXO A;  1PN9 A;  1OYJ A;  2VCQ A;  2VL9 A;  3TGZ A;  2TRX A;  2N5B A;  4N0V A;  2AB6 A;  1ZZY A;  4KCE A;  1YJ6 A;  4EVM A;  4NXI A;  3H79 A;  3UOM A;  1MTC A;  5J4U A;  1FO5 A;  3WT2 A;  1TDI A;  4CY6 A;  5HR0 A;  3C7M A;  4ZIL A;  1AQV A;  2HLS A;  2OJL A;  3TJB A;  1R5A A;  2GS3 A;  5ECO B;  3S9F A;  1T1V A;  3FR3 A;  1B4P A;  4IBP A;  2GSR A;  3TB2 A;  6GST A;  2YV9 A;  1VF3 A;  2IJY A;  3CRU A;  4DEJ A;  5IMV A;  4OCE A;  2WS2 A;  2GZZ A;  4F0C A;  2C3Q A;  3TRP A;  1UA5 A;  3R2Q A;  2R2J A;  4OO5 A;  3KEB A;  4ZXG A;  3FY7 A;  3H1N A;  3LXT A;  1HNC A;  4BWS A;  5G5E A;  3HZ8 A;  3IHG A;  2LJR A;  3C1R A;  3GX8 A;  3A2V A;  2C1Y A;  4GRF A;  2H76 A;  1OVN A;  2GVP A;  2HNL A;  4OO4 A;  1NHY A;  3G7Y A;  3EMP A;  3ZIJ A;  5H5S A;  1TXX A;  2VO4 A;  3HDC A;  3GKX A;  4OD7 A;  2CV4 A;  2FCH A;  2MMN A;  3MNG A;  3IK7 A;  4X43 A;  4D73 A;  1EOH A;  4KAE A;  3J7Y b;  4KUN A;  1JLV A;  4G9H A;  3M3M A;  1F3A A;  1T00 A;  4I97 A;  4K1F A;  3VUR A;  3GIX A;  5JCG A;  4ACS A;  3O76 A;  2BMX A;  4HQZ A;  1OC3 A;  1GH2 A;  4HJ2 A;  2E2G A;  1K0D A;  3CTG A;  4HZ4 A;  2PMT A;  4YQU A;  3TJG A;  1YF0 A;  1GNW A;  1SKW B;  2PUK C;  3FRC A;  4K5S A;  4Z2U A;  3MYD A;  1S3R A;  4GTU A;  4IS0 A;  4ECI A;  4N11 A;  3SBC A;  4EO3 A;  3F4R A;  2LTK A;  5A5K A;  1U3A A;  2C0F A;  1ERU A;  5G5F A;  5BRT A;  1ACV A;  3IDV A;  1M9B A;  3TRQ A;  5CP1 A;  5DBQ A;  1OC8 A;  2CX3 A;  5DJL A;  3D21 A;  1H4O A;  2YAN A;  4TR0 A;  1X5E A;  1O6J A;  2D2Z A;  3D22 A;  2YOI A;  3F4S A;  1SK1 A;  1QFN A;  2BJX A;  4E8H A;  3EU4 A;  4ZL7 A;  5CRG A;  5BMU A;  4TXO B;  3UAR A;  1EP8 A;  1X5C A;  3DVW A;  2A2R A;  2H1D A;  2WDU A;  4K7I A;  4PTS A;  4DSR A;  2IIY A;  3QR6 A;  5INY A;  1GSE A;  1WRY A;  4TR1 A;  4IGJ A;  3BBY A;  4ECC A;  4IP6 A;  4EKZ A;  5FHI A;  1X5D A;  1PN0 A;  4TW5 A;  2YV7 A;  2P5R A;  1Q4J A;  4OCF A;  2ZUP A;  3IOS A;  2OA7 A;  5DCH A;  1F6M C;  2KP2 A;  4AJ6 A;  3NOF A;  5G2Z A;  3E9J B;  2LKU A;  1A23 A;  5EVO A;  3ME8 A;  5KN0 A;  1MDI A;  3HA9 A;  4EDY A;  2IMI A;  4XS4 A;  3UL3 A;  3HCZ A;  3GKK A;  1WIK A;  4ML6 A;  3D5J A;  3HVV A;  2LNT A;  1G6Y A;  1AAZ A;  4IVF A;  5F8B A;  1RK4 A;  3DXB A;  4MJC A;  4WEY A;  5ELG A;  2FWG A;  1AUC A;  5J5N A;  4NPB A;  3KP8 A;  4ZBA A;  5CRE A;  2RII A;  1VF2 A;  2DLX A;  4TVE A;  2YN1 A;  1TI1 A;  5IPH A;  1E2Y A;  5CRD A;  2YP6 A;  2C0G A;  4K9Z A;  2DJJ A;  2DJ1 A;  4KDY A;  3I6A A;  3VK9 A;  2VOC A;  1B48 A;  3F3R A;  4HEA 2;  1PD2 1;  1M3I A;  3P7X A;  4GST A;  2FHE A;  2WUL A;  1B4Q A;  3LEF A;  5F05 A;  1G7E A;  1N8J A;  2VCW A;  2RUF A;  1TK5 B;  4ZBB A;  3IR4 A;  3APO A;  3OR5 A;  2JAC A;  3RHC A;  1Z9H A;  3L9U A;  1XFL A;  5J9C A;  1A8Y A;  2IME A;  4HU9 A;  1FVJ A;  1PFO A;  2YZU A;  1UN2 A;  1KBN A;  2B5Y A;  1THX A;  4BL7 B;  4BVX B;  1WOU A;  4WF4 A;  2MMO A;  5D9T A;  4J57 E;  3BJ5 A;  2B1L A;  5ECS A;  2H30 A;  1J0F A;  1O8W A;  1QGV A;  3DD3 A;  4K5R A;  3ZLP A;  3EC3 A;  2IWT A;  5HR1 A;  2VLU A;  3GSS A;  4F9Z A;  1SD8 A;  1ML6 A;  3CTF A;  1FOV A;  4NHZ A;  1PX6 A;  1TU7 A;  4WKW A;  3NIV A;  1JLW A;  2DMM A;  2GLR A;  4MH2 A;  1XBS A;  5IMD A;  3IXR A;  3ZL5 A;  4PUA A;  3UBK A;  16GS A;  1X9W B;  1HYU A;  1M0U A;  2NDO A;  2O89 A;  4JU5 A;  1XPV A;  1XZO A;  2Z9S A;  2JSY A;  1G7O A;  1W89 A;  2CT6 A;  2HRF A;  2PGT A;  4K2X A;  4ZBD A;  2MMZ A;  4XRD A;  3F6F A;  4XRA A;  4NMU A;  1GTU A;  3L9S A;  2LS5 A;  1KEB A;  4BVY B;  2K8V A;  2VUP A;  5KOW A;  4EDZ A;  4WBJ A;  3KTL A;  5G30 A;  3EIN A;  4I8B A;  2HFD A;  1JZD A;  4GXZ A;  1GP1 A;  1GLQ A;  2O85 A;  1R26 A;  4J56 E;  1TKD B;  2H74 A;  2CQ9 A;  1QK8 A;  1K3Y A;  1M99 A;  4ZIJ A;  2RM6 A;  1FW1 A;  1FVK A;  3GA4 A;  2GZP A;  4KE3 A;  1AQX A;  3FHK A;  3C71 A;  4ZL8 A;  3A2W A;  1XIY A;  1BED A;  3LGC A;  1XWB A;  5B7C A;  2HI7 A;  5DJM A;  2DJ3 A;  4IW9 A;  3KP9 A;  2L5L A;  4HQS A;  1OE7 A;  13GS A;  5HFI A;  4K0G A;  1Z3E A;  4KSM A;  3GFK A;  1JZR A;  1SKR B;  2DIY A;  2YWI A;  2OE0 A;  4HI7 A;  2YPM A;  3VFI A;  4PQI A;  3QFA C;  5ECN B;  1X9M B;  4MPF A;  2JZR A;  3M9K A;  2DJ0 A;  2FWH A;  5DQY A;  4MCU A;  4RQX A;  3ZRD A;  1DUG A;  11GS A;  3BOA A;  3VWX A;  3L78 A;  1TTZ A;  2IN3 A;  5ENU A;  3V1W A;  1TRW A;  2EIO A;  2FD3 A;  2L4C A;  2H8L A;  3ZMK A;  1V40 A;  22GS A;  5ECH B;  2X4A A;  1T8E B;  3BCK A;  2H71 A; 
#chains in the Genus database with same CATH homology
 1WPI A;  2HRK A;  4NHW A;  5CYY A;  4QL9 A;  4TR3 A;  1TW9 A;  3C8E A;  2I1U A;  4XS6 A;  2LQO A;  2REM A;  3GL3 A;  3F3Q A;  4NAX A;  4QL7 A;  5AGY A;  4TXO A;  1V57 A;  1J08 A;  3UVH A;  2CA8 A;  1BJX A;  1OKD A;  4YQV A;  4AJ8 A;  2C3T A;  3N9J A;  4WF5 A;  4ML1 A;  4O32 A;  4MF7 A;  4JR4 A;  3WYW A;  4TXV A;  4LMV A;  7GSS A;  4IQA A;  1K0A A;  2QA2 A;  4KDU A;  2H6Z A;  3ERG A;  1O73 A;  1PKW A;  2YJH A;  4MZW A;  1PKZ A;  4IJI A;  2I81 A;  4IEL A;  4XS1 A;  1O8X A;  1GSF A;  4MK3 A;  4H86 A;  2E0Q A;  1SU9 A;  3UMA A;  3HKR A;  1TOF A;  3FZ4 A;  4OFM A;  4Q5N A;  3M9J A;  4CDO A;  3TDG A;  2LRC A;  4I2T A;  1A24 A;  1BG5 A;  1PGT A;  4KF9 A;  1H75 A;  2RUE A;  2OBK A;  1EGR A;  5FWG A;  1A2M A;  4KDX A;  1V9W A;  4HOJ A;  2C0D A;  3IA1 A;  1ZOF A;  1R5P A;  5CRH A;  1WMJ A;  3CRT A;  2L59 A;  1ON4 A;  2J23 A;  3H4K A;  2DJ2 A;  4K0N A;  3UBL A;  5HR3 A;  2DBC A;  3F9U A;  3ZYW A;  2B7K A;  3ZIT A;  2H73 A;  4LL4 B;  5LNK e;  1LBK A;  2H01 A;  3LOR A;  4YKG A;  2L4Q A;  1YQ1 A;  1XW9 A;  2P0G A;  2NBS A;  3Q6O A;  4YAV A;  5F06 A;  3VWW A;  1DSB A;  1YZX A;  4O5R A;  3DVX A;  5KN3 A;  5LD0 A;  4L5L A;  3ED3 A;  2I3Y A;  1ERT A;  2FWF A;  3IAM 2;  4RUV A;  4G10 A;  5HQP A;  4ICY A;  2WZ9 A;  3ZVJ A;  1TK8 B;  5IQY A;  2CAQ A;  1LU4 A;  2GT5 A;  4X0X A;  2PWJ A;  1AQW A;  3BCI A;  2C8U A;  1ILO A;  3TKQ A;  1B9Y C;  3AY8 A;  4LA1 A;  4V1A g;  1ZCP A;  1MEK A;  5KOX A;  1VF1 A;  2HRA A;  4HDE A;  2R4V A;  2GGT A;  3VI7 A;  1W4V A;  1SKS B;  3RPP A;  3KCM A;  1Z7R A;  3QD9 A;  2MMA A;  2HZE B;  4KB3 A;  6GSY A;  2TIR A;  4J2F A;  2ALB A;  1MD4 A;  1SK0 A;  4FYB A;  4IHU A;  2R6K A;  4FYC A;  2N5A A;  2H1B A;  4G2E A;  4BL7 A;  3HJP A;  5G1L A;  4BVX A;  5F0G A;  3QPM A;  2X8G A;  2H0H A;  2LNS A;  1VGL A;  5JWO B;  1PRX A;  2CVD A;  2F8A A;  2DIZ A;  3KIJ A;  4Q5R A;  2XPE A;  2OAD A;  3LG6 A;  1C72 A;  4JZQ A;  1MDJ A;  6GSV A;  2GDR A;  2LJA A;  2HZF A;  3F6D A;  2A4V A;  2VD1 A;  6GSW A;  2FNO A;  4I6X A;  3IAS 2;  5DVB A;  1MDK A;  2IMK A;  2AUV A;  3Q18 A;  2V1M A;  4XTS A;  3TKS C;  4NV2 A;  4KW6 A;  1PL2 A;  2M46 A;  2LUS A;  1YF1 A;  3IE3 A;  1F3B A;  2P5Q A;  3MIX A;  3L9V A;  3RBT A;  4HUA A;  1K0N A;  1ABA A;  3APS A;  3GHA A;  4CY8 A;  5DCG A;  12GS A;  3CSI A;  5EY6 A;  2A4H A;  2HXK A;  3W6G A;  3WGE A;  4BVY A;  3GX0 A;  3IRA A;  4BPY A;  3MWH A;  3D6I A;  2H72 A;  4ULX A;  1GL8 A;  2QGV A;  1FHE A;  3PR8 A;  3VPQ A;  1R7H A;  2LRT A;  2B7J A;  2HSM A;  2IMF A;  3IC8 A;  3QDN A;  2GST A;  2J9H A;  2WRT A;  1K0O A;  3F8U A;  3GH6 A;  1XVW A;  2ES7 A;  3APQ A;  2QKE A;  3IHQ A;  1F37 A;  4L5O A;  2IPA A;  1S3C A;  3FR6 A;  1TRS A;  4K6X A;  3EE2 A;  3UEM A;  5IMA A;  2R37 A;  3A5I A;  1IYI A;  9GSS A;  3J7Y k;  1AXD A;  4F82 A;  1Z7P A;  2VM1 A;  4USS A;  5A4W A;  2B3S A;  2O87 A;  5D9X A;  1EP7 A;  1YDK A;  5DAL B;  4CW9 A;  1Z6N A;  3C1S A;  1GWC A;  2HT9 A;  5JWQ B;  3VI5 A;  2CAI A;  5D96 A;  2X99 A;  3ISO A;  4MMM A;  3GTU B;  3QFB C;  4PQ1 A;  4TKY A;  5E59 A;  1CQG A;  3P2A A;  19GS A;  5DAK B;  2CZ2 A;  5CRW A;  2X49 A;  3GKM A;  4LLR A;  4ISD A;  1T3B A;  4FH8 A;  3VLN A;  4GWR A;  2KHP A;  4O5U A;  2KP1 A;  2FA8 A;  5LCZ A;  5D8I A;  5JWR B;  3H8Q A;  3GV1 A;  3O6T A;  5GAN D;  1WWJ A;  3GUR A;  2R3X A;  2DC5 A;  3GMF A;  1B8X A;  2H75 A;  5AIS A;  1X9S B;  4G0I A;  2PVO C;  4FO5 A;  4Z2T A;  1B9X C;  2MZC A;  4AF2 A;  1FAA A;  2GSQ A;  1S3D A;  1U88 A;  1THO A;  1USB A;  3FMW A;  5DQS A;  3EYT A;  2I9H A;  4EIQ A;  5G31 A;  1T4Z A;  3TOU A;  1A0F A;  2X64 A;  4ZL9 A;  3UVT A;  3L0H A;  1XW5 A;  3P8W A;  5ABR A;  4DSQ A;  4JE1 A;  1N2A A;  1G0T A;  5G1K A;  2OE1 A;  4MNN A;  2B5E A;  4KND A;  5ECM B;  4PNG A;  1U6T A;  1O81 A;  4OFN A;  4X1U A;  5J3R A;  1K3L A;  2VL2 C;  2FY6 A;  2H66 A;  3TUE A;  4DVC A;  1GSU A;  3GKN A;  4BA7 A;  3I69 A;  3W8J A;  3F4T A;  2G2Q A;  1O7U A;  4N30 A;  3EPT A;  2AV4 A;  2B1K A;  3GN3 A;  3H93 A;  3TJK A;  1R4W A;  2X8H A;  5H5R A;  2WB9 A;  3QAV A;  2P31 A;  1EZK A;  4Z2R A;  4Q5F A;  1DE2 A;  2PVQ A;  3DGQ A;  3WT1 A;  5H5Q A;  4PUR A;  1IYH A;  3CXG A;  2FGX A;  2M72 A;  3D4M A;  2VL2 A;  3A5W A;  5C00 A;  2CZ3 A;  3K8N A;  2O8V B;  5J41 A;  4ID0 A;  4MF6 A;  2AYT A;  3LYP A;  2KUC A;  1XW6 A;  1JZW A;  1SJ6 A;  3A2X A;  2ZCT A;  2HRN A;  2R0C A;  2L5O A;  1BX9 A;  1HNA A;  5HR2 A;  2JU5 A;  1I5G A;  1GUK A;  4GSS A;  1MD3 A;  1WP0 A;  3PH9 A;  1G6W A;  5COH A;  1I9D A;  4EF0 A;  2H1A A;  5IM9 A;  3ERF A;  2K18 A;  4O7H A;  1XOB A;  2V6K A;  3FR9 A;  2WCI A;  4I2U A;  2VM2 A;  2E7P A;  1DE1 A;  3KMO A;  4O92 A;  2ZNM A;  4Z7X A;  2HZE A;  1OE8 A;  4NV5 A;  2X8C A;  1DBY A;  1XWG A;  4HZ2 A;  3ME7 A;  4K7O A;  3DKS A;  3CBU A;  3EUR A;  1A2L A;  3MDK A;  2CVK A;  3DYR A;  2DJK A;  1XOA A;  4QQ7 A;  2LJK A;  3EWL A;  3LWA A;  2YZH A;  3UAP A;  2H6X A;  5L71 A;  3DWV A;  3IK9 A;  2OBI A;  1K0C A;  4V2M A;  3DRN A;  2R0G A;  20GS A;  2N5F A;  3CSH A;  1JHB A;  3QMX A;  2YNX A;  4HS1 A;  3WD6 A;  4FYU A;  5D9V A;  4GCI A;  4V2L A;  5ELA A;  4ZB8 A;  1EEJ A;  1XCC A;  2FA4 A;  3KTB A;  3IC4 A;  5GZZ B;  3ZRE A;  2XBI A;  4RI6 A;  3KD0 A;  5IMZ A;  4ECB A;  2K9F A;  1TRU A;  1SJZ A;  4MZB A;  3RDW A;  1FG4 A;  1K0B A;  4WR5 A;  1SD9 A;  4XCS A;  2LST A;  4IJ3 A;  1LJR A;  4OFT A;  2G0F A;  1ZYN A;  4RI7 A;  2H0I A;  3KZQ A;  4MJB A;  1GSD A;  1PMT A;  3TJJ A;  3BD2 A;  3EVI A;  5KN1 A;  3QAG A;  5A4V A;  4G0L A;  1JZO A;  4TRX A;  1EWX A;  1V98 A;  3EU3 A;  4G0K A;  2GQM A;  3IV4 A;  2XPD A;  2RM5 A;  2H6Y A;  3M8N A;  3MAK A;  5DAL A;  3QOU A;  2PPT A;  3DIE A;  4WR4 A;  4AJ7 A;  3LSZ A;  5GAP D;  3M0F A;  5ECL B;  3GTU A;  1GSY A;  2IL3 A;  5IPG A;  1SJI A;  4ECJ A;  3D4T A;  3PGT A;  1F9M A;  2VD0 A;  4MZC A;  2E2M A;  4PNF A;  4EIP A;  4GF0 A;  2YJ7 A;  4YH2 A;  4K7N A;  3FKF A;  4MJE A;  5DAK A;  2A2P A;  4PUF C;  4NWY A;  4MDC A;  5IO2 A;  1M2A A;  1QMV A;  3LW9 A;  2VCX A;  2PBJ A;  4KCA A;  2V2G A;  4WXT A;  4GLT A;  2PER A;  1SL1 B;  5B8B A;  2F51 A;  3TKS E;  1GSS A;  3FZA A;  4OWY A;  3ZZX A;  2OKA A;  2WGR A;  5B6M A;  5GSS A;  2QC7 A;  1PA3 A;  4V1A p;  4N0Z A;  4DSS B;  3C73 A;  1SK2 A;  2AAW A;  2NVL A;  3U6V A;  1M9A A;  2IFQ A;  2YWO A;  6GSS A;  2VL3 A;  2ON7 A;  3L4N A;  3FK8 A;  4POM A;  2C3N A;  2OAC A;  2V32 A;  3ZTL A;  2YWM A;  3HZ4 A;  3NZN A;  2V6O A;  2XC2 A;  3PIN A;  5B6N A;  1TK0 B;  5ECR B;  1GUM A;  3WGX A;  5AN1 A;  1XWK A;  4K2D A;  3FZ9 A;  1TRV A;  1U3I A;  2CVB A;  4POB A;  2QSI A;  1TJD A;  1EGO A;  10GS A;  2LRN A;  3RPN A;  5CNW A;  1VRS D;  1V2A A;  2H1G A;  1Z5Y E;  4KGI A;  2MBT A;  3DML A;  5ECI B;  2VIM A;  1YKA A;  4WET A;  3LQ7 A;  4F2I A;  3G7I A;  2LV3 A;  2L57 A;  3I43 A;  5AIX A;  3VPT A;  2HSY A;  3LYK A;  1XXU A;  2R0P A;  4CHS A;  5CO3 A;  1A2J A;  4KA0 A;  3HVS A;  1SEN A;  3SWL A;  2F8F A;  4MAB A;  3TKP A;  1E6B A;  1Z6M A;  5IO0 A;  3ZFB A;  2PU9 C;  2VLT A;  1A8L A;  3I9V 2;  3ZVJ D;  1GRX A;  4JR6 A;  1KNG A;  5KN2 A;  2LQQ A;  3TKS A;  3TCO A;  2HSH A;  5ECP B;  5A4U A;  3E3E A;  1T7P B;  3CSJ A;  1F2E A;  3HXS A;  3IBH A;  1PL1 A;  3CYN A;  2GQL A;  5D9W A;  2ON5 A;  2H19 A;  1GSQ A;  2JL4 A;  5ID2 B;  2L6D A;  4JRR A;  1Y6E A;  2A2S A;  1GUH A;  5EL8 A;  2MYG A;  4BWQ A;  1NSW A;  4LMW A;  2CX4 A;  4KH7 A;  1JFU A;  5CAX A;  4EC0 A;  1V58 A;  2M80 A;  1K0M A;  2C4J A;  4X4J A;  1RW1 A;  3KH7 A;  4KX4 A;  4XHM A;  1OAZ A;  4MA9 A;  4G19 A;  3TOT A;  4MP4 A;  1OC9 B;  3A3T A;  2KLX A;  2C0E A;  3D0Z A;  4MH3 A;  1UC7 A;  1ZYQ B;  1Q98 A;  2WJU A;  4POK A;  4KSO A;  5D73 A;  2YCD A;  3RHB A;  1HNB A;  3HJO A;  4GQF A;  1ZL9 A;  3HVX A;  5JCU A;  1TU8 A;  2R5G A;  3HHV A;  2HYX A;  3VWV A;  3HJM A;  3UIW A;  2VLV A;  1AC1 A;  2EIR A;  3HY2 A;  1AW9 A;  1WE0 A;  4O5Q A;  3EMX A;  4JBB A;  1NW2 A;  1EEM A;  2V41 A;  2O7K A;  1QUW A;  4IKH A;  4IP1 A;  4FIW A;  1GTA A;  3ZFL A;  5JCW A;  2OE3 A;  4PGT A;  1PX7 A;  2NPB A;  1YY7 A;  2K6V A;  1BAY A;  1PSQ A;  2EIQ A;  1J9B A;  3TJF A;  4OMV A;  3US3 A;  1KTE A;  2KOK A;  4RQR A;  3E0U A;  1TP9 A;  4EUY A;  4N10 A;  3RAZ A;  5GST A;  2VAF A;  2TRC P;  5D93 A;  5ECQ B;  2IFQ B;  5AIV A;  2F3M A;  1GUL A;  1XVQ A;  3Q74 A;  1O85 A;  2B6M A;  1EOG A;  1HQO A;  1SL2 B;  3N5O A;  2BTO T;  4Q5Q A;  4ZB9 A;  5HFG A;  1NM3 A;  4PQH A;  4D73 B;  1PQN A;  1QQ2 A;  1ZMA A;  3F0I A;  1WJK A;  3DEX A;  1SYX A;  1VF4 A;  3QAW A;  4IN0 A;  4V2N A;  1ERW A;  4HU7 A;  1A0R P;  3IPZ A;  2QA1 A;  3UJ1 A;  3O3T A;  3MSZ A;  3CMI A;  4I5Q A;  1K3O A;  2FWE A;  3GH9 A;  3GUS A;  1QXH A;  3TRX A;  4F03 A;  2GQK A;  5ECK B;  2GT6 A;  1M2D A;  3PPU A;  4FQU A;  2DKI A;  5IMF A;  3TKR A;  2VCV A;  2UZ8 A;  3KH9 A;  1BQ7 A;  3P90 A;  4F0B A;  5J9B A;  1GNE A;  3Q19 A;  1FOH A;  5IIZ A;  2GTU A;  4TR4 A;  1EV9 A;  2JSZ A;  3GYK A;  2FUG 2;  5IMC A;  4XIH A;  4JED A;  1FB0 A;  2PN8 A;  3KJY A;  2FLS A;  4GSN A;  3KM6 A;  3ZIV A;  4ILF A;  2IMD A;  1XWC A;  18GS A;  3HD5 A;  2GZY A;  1GTB A;  4TR1 B;  2EC4 A;  8GSS A;  3FW2 A;  3GNJ A;  4TN8 A;  4DSS A;  3U5R E;  3W8S A;  2AJQ B;  2JZT A;  3LFL A;  1EV4 A;  3KXO A;  3G9B A;  5F07 A;  4ZB6 A;  2WFC A;  2F9S A;  1ST9 A;  2I4A A;  4MJA A;  2B5X A;  2YWN A;  1ERV A;  3FEU A;  5B8A A;  6GSX A;  3LXZ A;  14GS A;  3JCM L;  5FT3 A;  5KEJ A;  1NHO A;  1ZGN A;  1TI3 A;  2C80 A;  4AGS A;  4IQ1 A;  4XS4 B;  2L6C A;  3WGD A;  4MF5 A;  4YQM A;  3HYP A;  3KMN A;  1M2B A;  3LJR A;  4PX1 A;  2NTO A;  2LEG A;  5IOX A;  6GSU A;  4YKF A;  5EPF A;  4EXJ A;  2JZS A;  1OKT A;  1ZYP A;  4L8E A;  5E4W A;  4K8M A;  4POL A;  1YKC A;  3KGK A;  2H70 A;  1SYR A;  4L0W A;  2K8S A;  3F63 A;  2JAD A;  2VCT A;  4EE0 A;  5IOW A;  4WBR D;  2XHF A;  2DML A;  4YAP A;  3FYG A;  1XWA A;  2XBQ A;  2GSS A;  1BYE A;  2DSA A;  4LL1 B;  5C04 A;  3ZML A;  1CQH A;  5DDL A;  3GL5 A;  3GRX A;  3G7J A;  1U87 A;  4HJM A;  1T4Y A;  1URM A;  1GTI A;  4E8E A;  1ZYE A;  4GQC A;  1X0R A;  4MLY A;  4EL1 A;  5HFK A;  3VWU A;  3ERW A;  2RLI A;  1UVZ A;  2HE3 A;  2MBS A;  2VCZ A;  4P3Y B;  5ID2 A;  1HD2 A;  4L0U A;  1S3A A;  1Y25 A;  4TOP A;  1RQM A;  3QCP A;  3M1G A;  2H0G A;  1FB6 A;  3GST A;  1YEP A;  3FZ5 A;  2AHE A;  1GLP A;  17GS A;  4A5P A;  1M7T A;  2DKH A;  1OC9 A;  1YEX A;  4MPG A;  1AIU A;  1SL0 B;  3R3E A;  4PXO A;  1PN9 A;  1OYJ A;  2VCQ A;  2VL9 A;  3TGZ A;  2TRX A;  2N5B A;  4N0V A;  2AB6 A;  1ZZY A;  4KCE A;  1YJ6 A;  4EVM A;  4NXI A;  3H79 A;  3UOM A;  1MTC A;  5J4U A;  1FO5 A;  3WT2 A;  1TDI A;  4CY6 A;  5HR0 A;  3C7M A;  4ZIL A;  1AQV A;  2HLS A;  2OJL A;  3TJB A;  1R5A A;  2GS3 A;  5ECO B;  3S9F A;  1T1V A;  3FR3 A;  1B4P A;  4IBP A;  2GSR A;  3TB2 A;  6GST A;  2YV9 A;  1VF3 A;  2IJY A;  3CRU A;  4DEJ A;  5IMV A;  4OCE A;  2WS2 A;  2GZZ A;  4F0C A;  2C3Q A;  3TRP A;  1UA5 A;  3R2Q A;  2R2J A;  4OO5 A;  3KEB A;  4ZXG A;  3FY7 A;  3H1N A;  3LXT A;  1HNC A;  4BWS A;  5G5E A;  3HZ8 A;  3IHG A;  2LJR A;  3C1R A;  3GX8 A;  3A2V A;  2C1Y A;  4GRF A;  2H76 A;  1OVN A;  2GVP A;  2HNL A;  4OO4 A;  1NHY A;  3G7Y A;  3EMP A;  3ZIJ A;  5H5S A;  1TXX A;  2VO4 A;  3HDC A;  3GKX A;  4OD7 A;  2CV4 A;  2FCH A;  2MMN A;  3MNG A;  3IK7 A;  4X43 A;  4D73 A;  1EOH A;  4KAE A;  3J7Y b;  4KUN A;  1JLV A;  4G9H A;  3M3M A;  1F3A A;  1T00 A;  4I97 A;  4K1F A;  3VUR A;  3GIX A;  5JCG A;  4ACS A;  3O76 A;  2BMX A;  4HQZ A;  1OC3 A;  1GH2 A;  4HJ2 A;  2E2G A;  1K0D A;  3CTG A;  4HZ4 A;  2PMT A;  4YQU A;  3TJG A;  1YF0 A;  1GNW A;  1SKW B;  2PUK C;  3FRC A;  4K5S A;  4Z2U A;  3MYD A;  4GTU A;  4IS0 A;  4ECI A;  4N11 A;  3SBC A;  4EO3 A;  3F4R A;  2LTK A;  5A5K A;  1U3A A;  2C0F A;  1ERU A;  5G5F A;  5BRT A;  1ACV A;  3IDV A;  1M9B A;  3TRQ A;  5CP1 A;  5DBQ A;  1OC8 A;  2CX3 A;  5DJL A;  3D21 A;  1H4O A;  2YAN A;  4TR0 A;  1X5E A;  1O6J A;  2D2Z A;  3D22 A;  2YOI A;  3F4S A;  1SK1 A;  1QFN A;  2BJX A;  4E8H A;  3EU4 A;  4ZL7 A;  5CRG A;  5BMU A;  4TXO B;  3UAR A;  1EP8 A;  1X5C A;  3DVW A;  2A2R A;  2H1D A;  2WDU A;  4K7I A;  4PTS A;  4DSR A;  2IIY A;  3QR6 A;  5INY A;  1GSE A;  1WRY A;  4TR1 A;  4IGJ A;  3BBY A;  4ECC A;  4IP6 A;  4EKZ A;  5FHI A;  1X5D A;  1PN0 A;  4TW5 A;  2YV7 A;  2P5R A;  1Q4J A;  4OCF A;  2ZUP A;  3IOS A;  2OA7 A;  5DCH A;  1F6M C;  2KP2 A;  4AJ6 A;  3NOF A;  5G2Z A;  3E9J B;  2LKU A;  1A23 A;  5EVO A;  3ME8 A;  5KN0 A;  1MDI A;  3HA9 A;  4EDY A;  2IMI A;  4XS4 A;  3UL3 A;  3HCZ A;  3GKK A;  1WIK A;  4ML6 A;  3D5J A;  3HVV A;  2LNT A;  1G6Y A;  1AAZ A;  4IVF A;  5F8B A;  1RK4 A;  3DXB A;  4MJC A;  4WEY A;  5ELG A;  2FWG A;  1AUC A;  5J5N A;  4NPB A;  3KP8 A;  4ZBA A;  5CRE A;  2RII A;  1VF2 A;  2DLX A;  4TVE A;  2YN1 A;  1TI1 A;  5IPH A;  1E2Y A;  5CRD A;  2YP6 A;  2C0G A;  4K9Z A;  2DJJ A;  2DJ1 A;  4KDY A;  3I6A A;  3VK9 A;  2VOC A;  1B48 A;  3F3R A;  4HEA 2;  1PD2 1;  3P7X A;  4GST A;  2FHE A;  2WUL A;  1B4Q A;  3LEF A;  5F05 A;  1G7E A;  1N8J A;  2VCW A;  2RUF A;  1TK5 B;  4ZBB A;  3IR4 A;  3APO A;  3OR5 A;  2JAC A;  3RHC A;  1Z9H A;  3L9U A;  1XFL A;  5J9C A;  1A8Y A;  2IME A;  4HU9 A;  1FVJ A;  2YZU A;  1UN2 A;  1KBN A;  2B5Y A;  1THX A;  4BL7 B;  4BVX B;  1WOU A;  4WF4 A;  2MMO A;  5D9T A;  4J57 E;  3BJ5 A;  2B1L A;  5ECS A;  2H30 A;  1J0F A;  1O8W A;  1QGV A;  3DD3 A;  4K5R A;  3ZLP A;  3EC3 A;  2IWT A;  5HR1 A;  2VLU A;  3GSS A;  4F9Z A;  1SD8 A;  1ML6 A;  3CTF A;  1FOV A;  4NHZ A;  1PX6 A;  1TU7 A;  4WKW A;  3NIV A;  1JLW A;  2DMM A;  2GLR A;  4MH2 A;  1XBS A;  5IMD A;  3IXR A;  3ZL5 A;  4PUA A;  3UBK A;  16GS A;  1X9W B;  1HYU A;  1M0U A;  2NDO A;  2O89 A;  4JU5 A;  1XPV A;  1XZO A;  2Z9S A;  2JSY A;  1G7O A;  1W89 A;  2CT6 A;  2HRF A;  2PGT A;  4K2X A;  4ZBD A;  2MMZ A;  4XRD A;  3F6F A;  4XRA A;  4NMU A;  1GTU A;  3L9S A;  2LS5 A;  1KEB A;  4BVY B;  2K8V A;  2VUP A;  5KOW A;  4EDZ A;  4WBJ A;  3KTL A;  5G30 A;  3EIN A;  4I8B A;  2HFD A;  1JZD A;  4GXZ A;  1GP1 A;  1GLQ A;  2O85 A;  1R26 A;  4J56 E;  1TKD B;  2H74 A;  2CQ9 A;  1QK8 A;  1K3Y A;  1M99 A;  4ZIJ A;  2RM6 A;  1FW1 A;  1FVK A;  3GA4 A;  2GZP A;  4KE3 A;  1AQX A;  3FHK A;  3C71 A;  4ZL8 A;  3A2W A;  1XIY A;  1BED A;  3LGC A;  1XWB A;  5B7C A;  2HI7 A;  5DJM A;  2DJ3 A;  4IW9 A;  3KP9 A;  2L5L A;  4HQS A;  1OE7 A;  13GS A;  5HFI A;  4K0G A;  1Z3E A;  4KSM A;  3GFK A;  1JZR A;  1SKR B;  2DIY A;  2YWI A;  2OE0 A;  4HI7 A;  2YPM A;  3VFI A;  4PQI A;  3QFA C;  5ECN B;  1X9M B;  4MPF A;  2JZR A;  3M9K A;  2DJ0 A;  2FWH A;  5DQY A;  4MCU A;  4RQX A;  3ZRD A;  1DUG A;  11GS A;  3BOA A;  3VWX A;  3L78 A;  1TTZ A;  2IN3 A;  5ENU A;  3V1W A;  1TRW A;  2EIO A;  2FD3 A;  2L4C A;  2H8L A;  3ZMK A;  1V40 A;  22GS A;  5ECH B;  2X4A A;  1T8E B;  3BCK A;  2H71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...