4HQSA

Crystal structure of the pneumoccocal exposed lipoprotein thioredoxin sp_0659 (etrx1) from streptococcus pneumoniae strain tigr4
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
135
Chain Sequence
ADFELMGVDGKTYRLSDYKGKKVYLKFWASWCSICLASLPDTDEIAKEAGDDYVVLTVVSPGHKGEQSEADFKNWYKGLDYKNLPVLVDPSGKLLETYGVRSYPTQAFIDKEGKLVKTHPGFMEKDAILQTLKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin family protein
publication title Molecular architecture of Streptococcus pneumoniae surface thioredoxin-fold lipoproteins crucial for extracellular oxidative stress resistance and maintenance of virulence.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Oxidoreductase
total genus 38
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2012-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4hqsA00
3IV4A 5ECIB 2HXKA 2GQLA 5IMZA 1HNBA 2PUKC 3LYPA 1QGVA 3VWXA 2EIQA 1G6WA 1SL0B 5DAKB 1F6MC 1GWCA 1TK0B 4GSNA 1PQNA 1Z9HA 2LSTA 2H1AA 4F82A 2CA8A 2XHFA 4MZCA 5H5RA 2N5AA 3RPPA 3HDCA 1XW5A 1V40A 1FB0A 4KE3A 5E59A 2OBIA 1NM3A 4GQFA 2HFDA 5D9XA 1UA5A 1K3YA 3LYKA 1QUWA 1JZRA 4MJCA 2L4QA 5ECSA 1C72A 3VURA 3FHKA 3NIVA 2C3NA 1GTBA 5D8IA 4KW6A 4KA0A 5DBQA 3HZ8A 2G0FA 4I97A 3VI7A 2DIYA 2IMDA 2DMMA 4MJAA 2EIOA 2XPEA 5FHIA 10GSA 2C0DA 4NHWA 2P5QA 3F4RA 4MF7A 1K0DA 1F37A 3GSTA 1I9DA 3W8SA 4HDEA 1XZOA 2WCIA 4IHUA 4WF5A 1M0UA 4NAXA 1GUHA 1GULA 4K1FA 1O7UA 2C8UA 4D73A 1B48A 4YQUA 3SBCA 1BJXA 2VAFA 2VL2C 4MP4A 1GSFA 1PGTA 1PRXA 3O3TA 3A2WA 3WGEA 3KIJA 2VCTA 2PBJA 3EYTA 2CX3A 2PVOC 2PERA 4YAVA 4WF4A 3FYGA 2P0GA 4J57E 4J56E 1PMTA 5KN1A 1XW6A 4WKWA 3F3RA 4Q5FA 2HYXA 5J41A 4IJIA 4ISDA 3ZITA 2I9HA 2DJ3A 1QK8A 3IBHA 1AQWA 1PSQA 2OKAA 3APSA 4K7IA 1BQ7A 2FD3A 1VF4A 2HRNA 2B5XA 4IJ3A 3UL3A 5DQSA 4V2MA 1NW2A 3KMNA 3VFIA 4BWSA 1W4VA 3QPMA 4ZL9A 1FG4A 1RK4A 2ZNMA 1HNAA 3KTLA 2EC4A 1K3OA 1RW1A 1T3BA 4L8EA 5ECMB 3QAVA 2FWHA 4POKA 3QAGA 5DCGA 2HLSA 3G7JA 3QMXA 2K9FA 2QSIA 2TRCP 3FR9A 2H6ZA 4TR1B 4DSSA 1OVNA 5IQYA 4YAPA 1EV4A 3M8NA 1JHBA 2BTOT 4ZIJA 4NPBA 2X64A 3GYKA 3L9VA 1S3AA 5F8BA 2HSYA 3TUEA 4O32A 1DE2A 2VOCA 4PXOA 2MMOA 4RI7A 2VLVA 4GF0A 1Y6EA 4V2LA 1T1VA 1PA3A 2GTUA 3KEBA 4MMMA 4PQHA 3LQ7A 1XVQA 1MD3A 2XC2A 1R7HA 2DSAA 3APOA 2JZRA 1ERUA 2CZ2A 5B6MA 1TU8A 3GKMA 5AISA 3L4NA 1BYEA 2XPDA 2IIYA 2H71A 5ECKB 1OYJA 1BX9A 2H0IA 1XOBA 3GL3A 4NMUA 1F9MA 1SKWB 5HR1A 3GKXA 5LCZA 2TIRA 1WRYA 4PGTA 1F2EA 3HY2A 4OMVA 2AHEA 3LFLA 5DDLA 1WWJA 2H1DA 4ZBDA 3H1NA 1YZXA 2CV4A 4ZBAA 1U3AA 4IP6A 4ZB9A 5LNKe 3HD5A 5ECNB 1V2AA 3E0UA 1SKRB 6GSSA 2LRTA 1G7OA 4HOJA 2WGRA 2GT6A 3BOAA 2VL3A 4Z7XA 2KLXA 2VCQA 2J23A 1SK1A 3FR6A 2V32A 3HYPA 1PL1A 1Z6MA 4KAEA 4ECIA 1JZOA 1G6YA 2MYGA 3FZAA 4WETA 4PNGA 4HU9A 1XCCA 1USBA 3HHVA 3KH9A 3L0HA 4E8HA 2GZPA 3P90A 4TKYA 1RQMA 3VPTA 3UVHA 5IMCA 1B4QA 1XWGA 4ULXA 2IMEA 4N0ZA 2C4JA 2GSRA 2K8SA 3RPNA 3GHAA 1TRUA 5EVOA 4Q5NA 5ABRA 2IFQA 4OFNA 3L9UA 2GSQA 18GSA 3TKPA 3ME7A 4GSTA 2B5EA 1EOHA 2IMKA 4N11A 1KNGA 5G2ZA 1GTAA 3LORA 3GTUA 5AN1A 5CRHA 4K7NA 2XBIA 4HQZA 4WBRD 4QL7A 5JCWA 1GNWA 2CVDA 2DJ1A 5JCGA 5IMVA 3FZ4A 4IQ1A 3GSSA 5HQPA 2YZHA 5KN3A 3H4KA 3CRTA 5A4VA 2JL4A 4HU7A 2ALBA 1FHEA 4IVFA 1M2DA 3ZFBA 3LG6A 4WEYA 5CYYA 2H76A 5ECRB 3D4TA 5IIZA 4I2UA 4MH2A 3VLNA 4O7HA 3ZIVA 5JCUA 3ZYWA 3KZQA 5H5QA 1LJRA 2GQMA 4MDCA 5IMAA 5EY6A 4PX1A 1HNCA 4NV2A 2OBKA 3J7Yb 4EF0A 1GH2A 2HSHA 3GA4A 3LSZA 3VPQA 2RM5A 4ZXGA 1OC9A 2LJRA 1ZYQB 4POMA 1URMA 4ID0A 1M2AA 1ON4A 1CQGA 1F3BA 5ELAA 2ON5A 2JZTA 2M80A 3TKSE 4I2TA 2FHEA 4G9HA 2HT9A 4FYCA 1IYHA 1FAAA 4BVYA 3ED3A 5GSSA 3EC3A 1Z7RA 1SJ6A 5B6NA 2L5OA 2H0GA 2RUEA 3EU3A 5DALA 3CXGA 1M2BA 4FIWA 3FRCA 1AUCA 3C8EA 3ZFLA 1XWKA 1DE1A 4KGIA 4N10A 3GKNA 1GSQA 5COHA 1TXXA 1A24A 4XS6A 2VIMA 2PMTA 2H8LA 2IL3A 3FK8A 3MWHA 3LGCA 3HCZA 3ME8A 3BCIA 1YQ1A 1M7TA 2G2QA 4OO4A 4HEA2 5AGYA 4ZB6A 4KDUA 3RHCA 3BCKA 1XXUA 3Q74A 3ISOA 4JE1A 2NVLA 2DBCA 4RI6A 2OE3A 5ID2A 2VL2A 3DIEA 3F6FA 4HQSA 4TRXA 3CRUA 3GKKA 3M3MA 2LJKA 1TDIA 4EXJA 4XIHA 3I43A 1S3DA 1PX6A 1EZKA 3EURA 4D73B 5ECOB 2LJAA 1ML6A 5IOWA 4KB3A 5G1LA 3LXZA 4WR5A 3I6AA 5CRGA 1ZZYA 4K6XA 5D9VA 3IPZA 2GLRA 3TRXA 1ERWA 1EP7A 1WIKA 3FKFA 3Q6OA 3RHBA 2O7KA 2FGXA 3TRPA 3PH9A 4F9ZA 1JZWA 4JEDA 4RQRA 5A4UA 3QFAC 5EPFA 1SYXA 4TXVA 3GX0A 1V57A 3E3EA 2YWIA 4X0XA 5DQYA 4NV5A 4HJMA 3KM6A 4O5RA 1AQXA 6GSYA 5JWRB 1DSBA 3TKQA 1Y25A 3TKRA 2LUSA 3C7MA 4XRAA 2B1LA 3ZREA 2YV9A 3TB2A 3DKSA 2VUPA 1U6TA 3UIWA 4DEJA 3PINA 2O8VB 3P8WA 1ERTA 2RM6A 4KDYA 1ABAA 3LWAA 4OFTA 3TJBA 2F8FA 3KH7A 5CREA 2VM1A 2O85A 5E4WA 3IK7A 2H1GA 3TGZA 3KTBA 2YWMA 2GT5A 1VF1A 3GFKA 2GS3A 4CDOA 1WP0A 5KEJA 1SD8A 4DSSB 1N8JA 2B7JA 4POLA 3GH6A 2YOIA 2H70A 1I5GA 4F03A 1FVKA 5IM9A 2B5YA 2DLXA 3IE3A 4EC0A 2GSTA 3ERWA 1GUMA 1S3CA 1TI1A 3GRXA 1SJZA 2FNOA 3G9BA 3QOUA 2ES7A 3ZMKA 4HUAA 5CO3A 4JRRA 4K7OA 4MK3A 2L6CA 4DSQA 1Q4JA 2X8GA 4MA9A 6GSUA 3TDGA 1VF2A 2DJ2A 4GLTA 4AJ7A 3CYNA 5ECHB 2VD0A 4HZ2A 1ERVA 4LMWA 4ECBA 12GSA 1B8XA 4ILFA 2F8AA 4X43A 3VWUA 3IRAA 5DAKA 4XS4A 1G0TA 3GN3A 3DEXA 5D93A 3F4SA 3IXRA 3QAWA 2VCVA 3EINA 4ML1A 2K18A 1X0RA 3QFBC 4IN0A 1SL2B 3PR8A 2LV3A 2CT6A 5CAXA 1K0AA 1QMVA 4EDYA 4MZWA 5F0GA 4RQXA 1UC7A 2FUG2 1F3AA 1GRXA 2YANA 3P7XA 2AV4A 4DVCA 3AY8A 2OA7A 1YJ6A 5J5NA 2K6VA 2P5RA 2L57A 2YCDA 5AIXA 3ZLPA 3FEUA 3DWVA 5HFKA 1YEPA 4MH3A 3BD2A 1K0OA 2WFCA 3C1SA 3P2AA 2L4CA 2FA8A 5G31A 3MDKA 3TKSC 1HYUA 7GSSA 4GQCA 4HI7A 2VCWA 3VWVA 4EO3A 1YF0A 2M46A 2CAQA 2XBQA 2LRCA 3HJPA 1J9BA 1EV9A 2WS2A 3TCOA 1X9WB 1GSYA 1OE7A 3ZTLA 5F07A 3UBLA 1A2LA 5D9WA 1YKAA 2H01A 1T4YA 4JU5A 4TN8A 1GSSA 2HRFA 5LD0A 3ZIJA 4MF5A 4L5OA 2CAIA 3KJYA 1PN9A 1WPIA 4K0GA 3D0ZA 2A4VA 2KHPA 4IGJA 4LL1B 5J9BA 2DJ0A 1FOVA 2GSSA 4TR3A 2WULA 1ZL9A 3HA9A 2PVQA 3HJMA 3TOUA 3KD0A 4MPFA 5CNWA 3UBKA 1EGOA 4KDXA 4ZB8A 1OC9B 4YQMA 3TOTA 3C1RA 3EVIA 3H8QA 2ZCTA 2N5FA 2YJHA 5DVBA 2YWNA 3NOFA 3CMIA 2DJJA 3QDNA 3F8UA 4KUNA 3C71A 4ECJA 1G7EA 4L0WA 2V6OA 1Z3EA 4PUAA 3DGQA 3WT2A 2H6YA 1SK0A 3UJ1A 5CP1A 3D4MA 5G30A 4N30A 3DXBA 4TR0A 1O85A 1WOUA 1X9MB 2H0HA 4FYUA 3HVXA 2B6MA 3EU4A 1GLQA 3F6DA 5J9CA 4XHMA 1TRSA 1MEKA 5CRWA 2DMLA 3M9KA 2J9HA 1NHYA 3TJGA 4V1Ap 4N0VA 4IS0A 1ZCPA 2R3XA 5JWQB 1EP8A 4BWQA 3O76A 2VLUA 3D22A 3WT1A 4CHSA 1FB6A 1K0BA 2VM2A 4H86A 4IQAA 3JCML 2E7PA 3ZL5A 4L0UA 2C0GA 2MMNA 4PQ1A 2B3SA 4JBBA 2GZZA 14GSA 2H6XA 3O6TA 1R5PA 3ZVJD 3DMLA 3LJRA 1GSDA 2H74A 4TXOA 1OC3A 1XPVA 1ST9A 3U5RE 2L59A 2R37A 2WRTA 1SENA 3F0IA 2B1KA 2VD1A 2OACA 3EMPA 2DJKA 1XBSA 1E6BA 5A4WA 2YN1A 2ZUPA 4HJ2A 5G5FA 2JSYA 4MLYA 4IKHA 3DVWA 1QXHA 1TRWA 3TJFA 3HXSA 1J0FA 1OKDA 5F06A 1TI3A 2GVPA 2C1YA 1LBKA 4K2DA 4YH2A 3Q18A 5B7CA 4FYBA 2YWOA 5GAPD 5ECQB 3I69A 4G10A 3G7YA 1U88A 1M9BA 1MD4A 3NZNA 1PL2A 2D2ZA 2GGTA 2KP2A 2QKEA 1A2JA 1TTZA 20GSA 5A5KA 3VK9A 2FCHA 2JADA 2C80A 3QR6A 1K3LA 2LQOA 4GRFA 3HZ4A 2BMXA 4Q5QA 2AUVA 5JWOB 3KP9A 4MF6A 2IJYA 1Z6NA 3IC4A 2OE1A 2DIZA 5HR0A 4AF2A 4EUYA 1XOAA 1THXA 3C73A 3CTFA 2C3QA 4X1UA 1O73A 4LLRA 2L5LA 1H75A 2MMZA 5IPGA 3VI5A 2AJQB 2N5BA 2HZFA 2IN3A 2LRNA 1XVWA 5G5EA 2LEGA 1M9AA 3F63A 3D5JA 4OWYA 2NBSA 4EVMA 1FVJA 4MPGA 4IBPA 2H19A 4BVXA 3FY7A 4YQVA 4POBA 3ZMLA 2LNSA 1Z7PA 1BG5A 3RAZA 1AC1A 1A8LA 1A2MA 2X8HA 2VL9A 4P3YB 4MZBA 2CVBA 3IA1A 1X5EA 1JFUA 2OADA 1K0NA 2QGVA 5INYA 2R4VA 2X99A 2CZ3A 2C3TA 1TJDA 16GSA 5HR2A 2GZYA 3L9SA 4ECCA 1E2YA 3FW2A 5HFIA 1AQVA 5KN0A 9GSSA 1JZDA 1XWCA 1EWXA 5D9TA 2IPAA 4IP1A 4XS4B 2TRXA 2HZEA 1MDKA 2KUCA 1EOGA 2FWFA 4KCAA 1O81A 1TOFA 3EWLA 1M99A 1R26A 4NWYA 3QD9A 4O92A 4ZL7A 4ZBBA 3FZ9A 2LQQA 1HD2A 2JU5A 2RUFA 6GSVA 2ON7A 3Q19A 5FT3A 3SWLA 2WZ9A 2V1MA 1T7PB 3W6GA 1OC8A 4Q5RA 3EE2A 2QC7A 1B9XC 3IHQA 5IOXA 4IW9A 5HFGA 3J7Yk 2BJXA 4J2FA 4EDZA 3A5WA 2NTOA 1SKSB 3TKSA 4PURA 1ACVA 4HS1A 4K9ZA 3S9FA 3DVXA 1SYRA 2VLTA 3ERFA 2YNXA 1K0MA 3TJKA 1WJKA 1BAYA 3CSHA 2RLIA 2E2MA 1XFLA 1T4ZA 4V1Ag 2VCXA 3F3QA 4GTUA 5G1KA 3W8JA 4BA7A 4XRDA 3ZVJA 2YPMA 4G2EA 3DD3A 19GSA 5FWGA 4IELA 1T8EB 3WD6A 4KCEA 2F51A 2H73A 3APQA 2HE3A 2PN8A 5IO0A 1TRVA 1V58A 4KNDA 2Z9SA 4ZL8A 2HNLA 1U87A 5ENUA 1IYIA 3GIXA 3WGXA 2B7KA 5J4UA 4LL4B 4JR6A 3N9JA 2I4AA 5AIVA 17GSA 4F0BA 2CVKA 2O89A 2WDUA 4OD7A 3F9UA 4PUFC 1ZYEA 3H93A 1SU9A 1YF1A 2P31A 1MDIA 3K8NA 3M0FA 3HVVA 2C0EA 5IMFA 2LTKA 2OE0A 3D6IA 1U3IA 11GSA 1O8XA 4KSOA 1B4PA 1AAZA 2MBSA 5EL8A 3HVSA 3FR3A 2H72A 4GSSA 3A3TA 5C04A 3IR4A 3ERGA 1UVZA 5GAND 2FWGA 2R6KA 3I9V2 5GSTA 2LNTA 2VO4A 1ZMAA 2H1BA 3V1WA 3KXOA 5L71A 5IMDA 1YKCA 2IWTA 1MDJA 2NDOA 1K0CA 2PWJA 1X5CA 1SJIA 3LEFA 5GZZB 3A2XA 1TU7A 3IK9A 1AW9A 1GSEA 2FY6A 4K0NA 4BL7A 1QQ2A 1WMJA 4XTSA 4TW5A 2PGTA 4AJ8A 4G19A 2CQ9A 2FLSA 2PPTA 2IFQB 2A2SA 2F3MA 3GMFA 2OJLA 4ML6A 3CBUA 3GX8A 2H66A 4MABA 2YV7A 4MJEA 1ILOA 3GTUB 1UN2A 3MAKA 3TRQA 1VF3A 4XS1A 5B8AA 4TOPA 4V2NA 3VWWA 1V9WA 1XWBA 1TW9A 1A0RP 6GSTA 5IO2A 3LXTA 1W89A 2M72A 3CSJA 4GWRA 8GSSA 1ZOFA 2V41A 3E9JB 2JSZA 1SD9A 2YP6A 2H30A 1YEXA 3A2VA 1GUKA 4GXZA 1R4WA 2LKUA 3DRNA 1NHOA 4AGSA 4TXOB 1B9YC 2C0FA 2A2RA 4OCFA 2LS5A 2NPBA 4WBJA 1H4OA 3FZ5A 3PGTA 1GTUA 1AIUA 3IAS2 3L78A 3IDVA 1NSWA 1OAZA 2GDRA 3M1GA 5ECLB 1GL8A 2JACA 4TR1A 3GNJA 1PKWA 2RIIA 1YDKA 1KEBA 1R5AA 4EL1A 5KN2A 5H5SA 1TP9A 2REMA 3N5OA 3CTGA 3H79A 4F2IA 4OFMA 1FO5A 1SK2A 2AB6A 5DALB 1GNEA 3ZZXA 5D96A 3HKRA 4LMVA 1GSUA 3R2QA 1EGRA 5DJMA 2WJUA 3MNGA 4I8BA 4K8MA 4RUVA 2L6DA 4EE0A 1EEJA 2E0QA 2K8VA 2MBTA 4ZILA 5HR3A 2EIRA 3KMOA 22GSA 1OE8A 1THOA 4NHZA 4XCSA 2R2JA 1TK5B 1ZGNA 4TVEA 6GSXA 1HQOA 5ELGA 2VCZA 2HI7A 1X9SB 1LU4A 3F4TA 1O8WA 2R5GA 4PNFA 1OKTA 1JLWA 5ID2B 1DBYA 3US3A 13GSA 2F9SA 3BBYA 1VRSD 2PU9C 1YY7A 1N2AA 4OO5A 1A23A 1O6JA 4ACSA 3GURA 1CQHA 3UMAA 2GQKA 3G7IA 1PKZA 1EEMA 4FO5A 4WXTA 4KH7A 4I5QA 4CW9A 2V6KA 1XWAA 5B8BA 1GP1A 4F0CA 4OCEA 1PD21 4KX4A 2JZSA 1TK8B 5D73A 3RDWA 2YJ7A 1SL1B 2FWEA 6GSWA 1XW9A 5CRDA 4JZQA 4LA1A 2MMAA 3OR5A 4FH8A 4KSMA 4E8EA 2E2GA 3GUSA 5ECPB 2KP1A 2O87A 5J3RA 3UEMA 4MJBA 1BEDA 1A8YA 1DUGA 1AXDA 3UOMA 2HZEB 2KOKA 1Q98A 3KGKA 3CSIA 1A0FA 1J08A 2YZUA 1GTIA 1GLPA 1V98A 3ZRDA 1PX7A 2I1UA 3QCPA 1KTEA 5F05A 1Z5YE 3HJOA 1XIYA 4NXIA 1T00A 5C00A 3TJJA 1X5DA 3IAM2 5DCHA 5IPHA 3WGDA 2DC5A 4GCIA 3GL5A 2H75A 5DJLA 1VGLA 4BPYA 2MZCA 2FA4A 2IMFA 1FW1A 4TR4A 3UAPA 3UVTA 4QL9A 3DYRA 4I6XA 1MTCA 3WYWA 3GH9A 2AYTA 3IOSA 2CX4A 2WB9A 3GV1A 2X8CA 1WE0A 1TKDB 4AJ6A 3KP8A 4PQIA 3MSZA 4DSRA 3D21A 3BJ5A 3M9JA 2I3YA 1QFNA 3EMXA 4JR4A 1KBNA 2V2GA 4MCUA 3U6VA 4WR4A 3RBTA 4QQ7A 1JLVA 4HZ4A 2I81A 4EKZA 2IMIA 4L5LA 3UARA 2AAWA 3KCMA
chains in the Genus database with same CATH superfamily
3IV4A 5ECIB 2HXKA 2GQLA 5IMZA 1HNBA 2PUKC 3LYPA 1QGVA 3VWXA 2EIQA 1G6WA 1SL0B 5DAKB 1F6MC 1GWCA 1TK0B 4GSNA 1PQNA 1Z9HA 2LSTA 2H1AA 4F82A 2CA8A 2XHFA 4MZCA 5H5RA 2N5AA 3RPPA 3HDCA 1XW5A 1V40A 1FB0A 4KE3A 5E59A 2OBIA 1NM3A 4GQFA 2HFDA 5D9XA 1UA5A 1K3YA 3LYKA 1QUWA 1JZRA 4MJCA 2L4QA 5ECSA 1C72A 3VURA 3FHKA 3NIVA 2C3NA 1GTBA 5D8IA 4KW6A 4KA0A 5DBQA 3HZ8A 2G0FA 4I97A 3VI7A 2DIYA 2IMDA 2DMMA 4MJAA 2EIOA 2XPEA 5FHIA 10GSA 2C0DA 4NHWA 2P5QA 3F4RA 4MF7A 1K0DA 1F37A 3GSTA 1I9DA 3W8SA 4HDEA 1XZOA 4O5UA 2WCIA 4IHUA 4WF5A 1M0UA 4NAXA 1GUHA 1XG8A 1GULA 4K1FA 1O7UA 2C8UA 4D73A 1B48A 4YQUA 3SBCA 1BJXA 2VAFA 2VL2C 4MP4A 1GSFA 1PGTA 1PRXA 3O3TA 3A2WA 3WGEA 3KIJA 2VCTA 2PBJA 3EYTA 2CX3A 2PVOC 2PERA 4YAVA 4WF4A 3FYGA 2P0GA 4J57E 4J56E 1PMTA 5KN1A 3CQFA 1XW6A 4WKWA 3F3RA 4Q5FA 2HYXA 5J41A 4IJIA 4ISDA 3ZITA 2I9HA 2DJ3A 1QK8A 3IBHA 1AQWA 1PSQA 2OKAA 3APSA 4K7IA 1BQ7A 3IHGA 2FD3A 1VF4A 2HRNA 2B5XA 4IJ3A 3UL3A 5DQSA 4V2MA 1NW2A 3KMNA 3VFIA 4BWSA 1W4VA 3QPMA 4ZL9A 1FG4A 1RK4A 2ZNMA 1HNAA 3KTLA 2EC4A 1K3OA 1RW1A 1T3BA 4L8EA 5ECMB 3QAVA 2FWHA 4POKA 3QAGA 5DCGA 2HLSA 3G7JA 3QMXA 2K9FA 2QSIA 2TRCP 3FR9A 4X4JA 2H6ZA 4TR1B 4DSSA 1OVNA 5IQYA 4YAPA 1EV4A 3M8NA 1JHBA 2BTOT 2QA1A 4ZIJA 4NPBA 2X64A 3GYKA 3L9VA 1S3AA 5F8BA 2HSYA 3TUEA 4O32A 1DE2A 2VOCA 4PTSA 4PXOA 2MMOA 4RI7A 2VLVA 4GF0A 1Y6EA 4V2LA 1T1VA 1PA3A 2GTUA 3KEBA 4MMMA 4PQHA 3LQ7A 1XVQA 1MD3A 2XC2A 1R7HA 2DSAA 2X4AA 3APOA 2JZRA 1ERUA 2CZ2A 5B6MA 1TU8A 3GKMA 5AISA 3L4NA 1BYEA 2XPDA 2IIYA 2H71A 5ECKB 1OYJA 1BX9A 2H0IA 1XOBA 3GL3A 4NMUA 1F9MA 1SKWB 5HR1A 3GKXA 5LCZA 2TIRA 1WRYA 4KF9A 4PGTA 1F2EA 3HY2A 4OMVA 2AHEA 3LFLA 5DDLA 1WWJA 2H1DA 4ZBDA 3H1NA 1YZXA 2CV4A 4ZBAA 1U3AA 4IP6A 4ZB9A 5LNKe 3HD5A 5ECNB 1V2AA 1PN0A 3E0UA 1SKRB 6GSSA 2LRTA 1G7OA 4USSA 4HOJA 2WGRA 2GT6A 3BOAA 2VL3A 4Z7XA 2KLXA 2VCQA 2J23A 1SK1A 3FR6A 2V32A 3HYPA 1PL1A 1Z6MA 4KAEA 4ECIA 1JZOA 1G6YA 2MYGA 3FZAA 4WETA 4PNGA 4HU9A 1XCCA 1USBA 3HHVA 3KH9A 3L0HA 4E8HA 2GZPA 3P90A 4TKYA 1RQMA 3VPTA 3UVHA 5IMCA 1B4QA 1XWGA 4ULXA 2IMEA 4N0ZA 2C4JA 2GSRA 2K8SA 3RPNA 3GHAA 1TRUA 5EVOA 4Q5NA 5ABRA 2IFQA 4OFNA 3L9UA 2GSQA 18GSA 3TKPA 3ME7A 4GSTA 2B5EA 1EOHA 2IMKA 4N11A 1KNGA 5G2ZA 1GTAA 3LORA 3GTUA 5AN1A 5CRHA 4K7NA 2XBIA 4HQZA 4BIKA 4WBRD 4QL7A 5JCWA 1GNWA 2CVDA 2DJ1A 5JCGA 5IMVA 3FZ4A 4IQ1A 3GSSA 5HQPA 2YZHA 5KN3A 3H4KA 3CRTA 5A4VA 2JL4A 4HU7A 2ALBA 1FHEA 4IVFA 1M2DA 3ZFBA 3LG6A 4WEYA 5CYYA 2H76A 4BVXB 5ECRB 3D4TA 5IIZA 4I2UA 4MH2A 3VLNA 4O7HA 3ZIVA 5JCUA 3ZYWA 3KZQA 5H5QA 1LJRA 4Z2UA 2GQMA 4MDCA 5IMAA 5EY6A 4PX1A 1HNCA 4NV2A 2OBKA 3J7Yb 4EF0A 1GH2A 2HSHA 3GA4A 3LSZA 3VPQA 2RM5A 4ZXGA 1OC9A 2LJRA 1ZYQB 4POMA 1URMA 4ID0A 1M2AA 1ON4A 1CQGA 1F3BA 5ELAA 2ON5A 2JZTA 2M80A 3TKSE 4I2TA 2FHEA 4G9HA 2HT9A 4FYCA 1IYHA 1FAAA 4BVYA 3ED3A 5GSSA 3EC3A 1Z7RA 1SJ6A 5B6NA 2L5OA 2H0GA 2RUEA 3EU3A 5DALA 3CXGA 1M2BA 4FIWA 3FRCA 1AUCA 3C8EA 3ZFLA 1XWKA 1DE1A 4KGIA 4N10A 3GKNA 1GSQA 3R3EA 5COHA 1TXXA 1A24A 4XS6A 2VIMA 2PMTA 2H8LA 1S3RA 2IL3A 3FK8A 3MWHA 3LGCA 3HCZA 3ME8A 3BCIA 1YQ1A 1M7TA 2G2QA 4OO4A 4HEA2 5AGYA 4ZB6A 4KDUA 2HRKA 3RHCA 3BCKA 1XXUA 3Q74A 3ISOA 4JE1A 2NVLA 2DBCA 4RI6A 2OE3A 5ID2A 2VL2A 3DIEA 3F6FA 4HQSA 4TRXA 3CRUA 3GKKA 3M3MA 2LJKA 1TDIA 4EXJA 4XIHA 3I43A 1S3DA 1PX6A 1EZKA 3EURA 4D73B 5ECOB 2LJAA 1ML6A 5IOWA 4KB3A 5G1LA 3LXZA 4WR5A 3I6AA 5CRGA 1ZZYA 4K6XA 5D9VA 3IPZA 4ICYA 2GLRA 3TRXA 1ERWA 1EP7A 1WIKA 3FKFA 3Q6OA 3RHBA 2O7KA 2FGXA 3TRPA 3PH9A 3IC8A 4F9ZA 1JZWA 4JEDA 4RQRA 5A4UA 3QFAC 5EPFA 1M3IA 1SYXA 4TXVA 3GX0A 1V57A 3E3EA 2YWIA 4X0XA 5DQYA 4NV5A 4HJMA 3KM6A 4O5RA 1AQXA 6GSYA 5JWRB 1DSBA 3TKQA 1Y25A 3TKRA 2LUSA 1M3JA 3C7MA 4XRAA 2B1LA 3ZREA 2YV9A 3TB2A 3DKSA 2VUPA 1U6TA 3UIWA 4DEJA 3PINA 2O8VB 3P8WA 1ERTA 2RM6A 4KDYA 1ABAA 3LWAA 4OFTA 3TJBA 2F8FA 3KH7A 5CREA 2VM1A 2O85A 5E4WA 3IK7A 2H1GA 3TGZA 3KTBA 2YWMA 2GT5A 1VF1A 3GFKA 2GS3A 4CDOA 1WP0A 5KEJA 1SD8A 4DSSB 1N8JA 2B7JA 4POLA 3GH6A 2YOIA 2H70A 1I5GA 4F03A 1FVKA 5IM9A 2B5YA 2DLXA 3IE3A 4BL7B 4EC0A 2GSTA 3ERWA 3A5IA 1GUMA 1S3CA 1TI1A 3GRXA 1SJZA 2FNOA 3G9BA 3QOUA 2ES7A 3ZMKA 4HUAA 5CO3A 4JRRA 4K7OA 4MK3A 2L6CA 4DSQA 1Q4JA 2X8GA 4MA9A 6GSUA 3TDGA 1VF2A 2DJ2A 4GLTA 4AJ7A 3CYNA 5ECHB 2VD0A 4HZ2A 1ERVA 4LMWA 4ECBA 12GSA 1B8XA 4ILFA 2F8AA 4X43A 3VWUA 3IRAA 5DAKA 4XS4A 1G0TA 2DKIA 3GN3A 3DEXA 5D93A 3F4SA 3IXRA 3QAWA 2VCVA 3EINA 4ML1A 2K18A 1X0RA 3QFBC 4IN0A 1SL2B 3PR8A 1PFOA 2LV3A 2CT6A 5CAXA 1K0AA 2DKHA 1QMVA 4EDYA 4MZWA 5F0GA 4RQXA 1UC7A 2FUG2 5BRTA 1F3AA 1GRXA 3PPUA 2YANA 3P7XA 2AV4A 4DVCA 3AY8A 2OA7A 1YJ6A 5J5NA 2K6VA 2P5RA 2L57A 2YCDA 5AIXA 3ZLPA 3FEUA 2HRAA 3DWVA 5HFKA 1YEPA 4MH3A 3BD2A 1K0OA 2WFCA 3C1SA 3P2AA 2L4CA 2FA8A 5G31A 3MDKA 3TKSC 1HYUA 7GSSA 4GQCA 4HI7A 3FMWA 2VCWA 3VWVA 4EO3A 1YF0A 2M46A 2CAQA 2XBQA 2LRCA 5BMUA 3HJPA 1J9BA 1EV9A 2WS2A 3EPTA 3TCOA 1X9WB 1GSYA 1OE7A 3ZTLA 5F07A 3UBLA 1A2LA 5D9WA 1YKAA 2H01A 1T4YA 4JU5A 4TN8A 1GSSA 2HRFA 5LD0A 3ZIJA 4MF5A 4L5OA 2CAIA 3KJYA 1PN9A 1WPIA 4K0GA 3D0ZA 2A4VA 2KHPA 4IGJA 4LL1B 5J9BA 2DJ0A 1FOVA 2GSSA 4TR3A 2WULA 1ZL9A 3HA9A 2PVQA 3HJMA 3TOUA 3KD0A 4MPFA 5CNWA 3UBKA 1EGOA 4KDXA 4ZB8A 1OC9B 4YQMA 3TOTA 3C1RA 3EVIA 3H8QA 2ZCTA 1ZYPA 2N5FA 2YJHA 5DVBA 2YWNA 3NOFA 3CMIA 2DJJA 3QDNA 3F8UA 4KUNA 3C71A 2A2PA 4ECJA 1G7EA 4L0WA 2V6OA 1Z3EA 4PUAA 4CY6A 3MIXA 3DGQA 3WT2A 2H6YA 1SK0A 3UJ1A 5CP1A 4BVYB 3D4MA 5G30A 4N30A 3DXBA 4TR0A 1O85A 1WOUA 1X9MB 2H0HA 4FYUA 3HVXA 2B6MA 3EU4A 1GLQA 3F6DA 5J9CA 4XHMA 1TRSA 1MEKA 5CRWA 2DMLA 3M9KA 2J9HA 1NHYA 3TJGA 4V1Ap 4N0VA 4IS0A 1ZCPA 2R3XA 5JWQB 1EP8A 4BWQA 3O76A 2VLUA 3D22A 3WT1A 4CHSA 1FB6A 1K0BA 2VM2A 4H86A 4IQAA 3JCML 5KOWA 2E7PA 3ZL5A 4L0UA 2C0GA 2MMNA 4PQ1A 2B3SA 4JBBA 2GZZA 14GSA 2H6XA 3O6TA 1R5PA 3ZVJD 3DMLA 3LJRA 1GSDA 2H74A 4TXOA 1OC3A 1XPVA 1ST9A 3U5RE 2L59A 2R37A 2WRTA 1SENA 3F0IA 2B1KA 2VD1A 2OACA 3EMPA 2DJKA 1XBSA 1E6BA 5A4WA 2YN1A 2ZUPA 4HJ2A 5G5FA 2JSYA 4MLYA 4IKHA 3DVWA 2QA2A 3HVNA 1QXHA 1TRWA 3TJFA 3HXSA 1J0FA 1OKDA 5F06A 1TI3A 2GVPA 2C1YA 1LBKA 4K2DA 4YH2A 3Q18A 5B7CA 4FYBA 2YWOA 4O5QA 5GAPD 5ECQB 3I69A 4G10A 3G7YA 1U88A 1M9BA 1FOHA 1MD4A 3NZNA 1PL2A 2D2ZA 2GGTA 2KP2A 2QKEA 1A2JA 1TTZA 20GSA 5A5KA 4YKGA 3VK9A 2FCHA 2JADA 2C80A 3QR6A 1K3LA 2LQOA 4GRFA 3HZ4A 2BMXA 4Q5QA 2AUVA 5JWOB 3KP9A 4MF6A 2IJYA 1Z6NA 3IC4A 2OE1A 2DIZA 5HR0A 4AF2A 4EUYA 1XOAA 1THXA 3C73A 3CTFA 2C3QA 4X1UA 1O73A 4LLRA 2L5LA 1H75A 2MMZA 5IPGA 3VI5A 2AJQB 2N5BA 2HZFA 2IN3A 2LRNA 1XVWA 5G5EA 2LEGA 1M9AA 3F63A 3D5JA 4OWYA 2NBSA 4EVMA 1FVJA 4MPGA 1ZYNA 4IBPA 2H19A 4BVXA 3FY7A 4YQVA 4POBA 3ZMLA 2LNSA 1Z7PA 1BG5A 3RAZA 1AC1A 1A8LA 1A2MA 2X8HA 2VL9A 4G0KA 4P3YB 4MZBA 2CVBA 3IA1A 1X5EA 1JFUA 2OADA 1K0NA 2QGVA 5INYA 2R4VA 2X99A 2CZ3A 2C3TA 1TJDA 16GSA 5HR2A 2GZYA 3L9SA 4ECCA 1E2YA 3FW2A 5HFIA 1AQVA 5KN0A 9GSSA 1JZDA 1XWCA 1EWXA 5D9TA 5KOXA 2IPAA 4IP1A 4XS4B 2TRXA 2HZEA 1MDKA 2KUCA 1EOGA 2FWFA 4Z2RA 4KCAA 1O81A 1TOFA 3EWLA 1M99A 1R26A 4NWYA 3QD9A 4O92A 4ZL7A 4ZBBA 3FZ9A 2LQQA 1HD2A 2JU5A 2RUFA 6GSVA 2ON7A 3Q19A 5FT3A 3SWLA 2WZ9A 2V1MA 1T7PB 3W6GA 1OC8A 4Q5RA 3EE2A 4K2XA 2QC7A 1B9XC 3IHQA 5IOXA 4IW9A 5HFGA 3J7Yk 2BJXA 4J2FA 4EDZA 3A5WA 2NTOA 1SKSB 3TKSA 4PURA 1ACVA 4HS1A 4K9ZA 3S9FA 3DVXA 1SYRA 2VLTA 3ERFA 2YNXA 1K0MA 3TJKA 1WJKA 1BAYA 3CSHA 2RLIA 2E2MA 1XFLA 1T4ZA 4V1Ag 2VCXA 3F3QA 4GTUA 5G1KA 3W8JA 4BA7A 4XRDA 3ZVJA 4EIQA 2YPMA 4G2EA 3DD3A 19GSA 4K5SA 5FWGA 4IELA 1T8EB 3WD6A 4KCEA 2F51A 2H73A 3APQA 2HE3A 2PN8A 5IO0A 1TRVA 1V58A 4KNDA 2Z9SA 4ZL8A 2HNLA 1U87A 5ENUA 1IYIA 3GIXA 3WGXA 2B7KA 5J4UA 4LL4B 4JR6A 3N9JA 2I4AA 5AIVA 17GSA 4F0BA 2CVKA 2O89A 2WDUA 4OD7A 3F9UA 4PUFC 1ZYEA 3H93A 1SU9A 1YF1A 2P31A 1MDIA 3K8NA 3M0FA 3HVVA 2C0EA 5IMFA 2LTKA 2OE0A 3D6IA 1U3IA 11GSA 1O8XA 4KSOA 1B4PA 1AAZA 2MBSA 5EL8A 3HVSA 3FR3A 2H72A 4GSSA 3A3TA 5C04A 3IR4A 3ERGA 1UVZA 5GAND 2FWGA 2R6KA 3I9V2 5GSTA 2LNTA 2VO4A 1ZMAA 2H1BA 3V1WA 3KXOA 5L71A 5IMDA 1YKCA 2IWTA 1MDJA 2NDOA 1K0CA 2PWJA 1X5CA 1SJIA 3LEFA 5GZZB 3A2XA 1TU7A 3IK9A 1AW9A 1GSEA 2FY6A 4K0NA 4BL7A 1QQ2A 1WMJA 4XTSA 4TW5A 2PGTA 4AJ8A 4G19A 2CQ9A 2FLSA 2PPTA 2IFQB 2A2SA 2F3MA 3GMFA 2OJLA 4HSCX 4ML6A 3CBUA 3GX8A 2H66A 4YKFA 4MABA 2YV7A 4MJEA 1ILOA 3GTUB 1UN2A 3MAKA 3TRQA 1VF3A 4K5RA 4A5PA 4XS1A 5B8AA 4TOPA 3LW9A 4V2NA 3VWWA 1V9WA 1XWBA 1TW9A 1A0RP 6GSTA 5IO2A 3LXTA 1W89A 2M72A 3CSJA 4GWRA 8GSSA 1ZOFA 2V41A 3E9JB 4EIPA 2JSZA 1SD9A 2YP6A 2H30A 1YEXA 3A2VA 1GUKA 4GXZA 1R4WA 2LKUA 3DRNA 1NHOA 4AGSA 4TXOB 1B9YC 2C0FA 2A2RA 4OCFA 2LS5A 2NPBA 4WBJA 1H4OA 3FZ5A 3PGTA 1GTUA 1AIUA 3IAS2 3L78A 3IDVA 1NSWA 1OAZA 2GDRA 3M1GA 5ECLB 1GL8A 2UZ8A 2JACA 2R0CA 4TR1A 3GNJA 1PKWA 2RIIA 1YDKA 1KEBA 1R5AA 4EL1A 3MYDA 5KN2A 5H5SA 1TP9A 2REMA 3N5OA 3CTGA 3H79A 4F2IA 4OFMA 1FO5A 1SK2A 2AB6A 5DALB 1GNEA 3ZZXA 5D96A 3HKRA 4LMVA 1GSUA 3R2QA 1EGRA 5DJMA 2WJUA 3MNGA 4I8BA 4K8MA 4RUVA 2L6DA 4EE0A 1EEJA 2E0QA 2K8VA 2MBTA 4ZILA 5HR3A 2EIRA 4G0IA 3KMOA 22GSA 1OE8A 1THOA 4NHZA 4XCSA 2R2JA 1TK5B 1ZGNA 4TVEA 6GSXA 1HQOA 5ELGA 2VCZA 2HI7A 1X9SB 2A4HA 1LU4A 4Z2TA 3F4TA 1O8WA 2R5GA 4PNFA 1OKTA 1JLWA 5ID2B 1DBYA 3US3A 13GSA 2F9SA 3BBYA 1VRSD 2PU9C 1YY7A 1N2AA 4OO5A 1A23A 1O6JA 4ACSA 3GURA 1CQHA 3UMAA 2GQKA 3G7IA 1PKZA 1EEMA 4FO5A 4WXTA 4KH7A 4I5QA 4CW9A 2V6KA 1XWAA 4CY8A 5B8BA 1GP1A 4F0CA 4OCEA 1PD21 4KX4A 2JZSA 1TK8B 5D73A 3RDWA 2YJ7A 1SL1B 2FWEA 6GSWA 1XW9A 5CRDA 4JZQA 4LA1A 2MMAA 3OR5A 4FH8A 4KSMA 4E8EA 2E2GA 3GUSA 5ECPB 2KP1A 2O87A 4FQUA 5J3RA 3UEMA 4MJBA 1BEDA 1A8YA 1DUGA 1AXDA 3UOMA 2HZEB 2KOKA 1Q98A 3KGKA 3CSIA 1A0FA 1J08A 2R0GA 2YZUA 2HSMA 1GTIA 1GLPA 1V98A 2X49A 3ZRDA 1PX7A 2I1UA 3QCPA 1KTEA 5F05A 1Z5YE 3HJOA 1XIYA 4NXIA 1T00A 5C00A 3TJJA 1X5DA 3IAM2 5DCHA 5IPHA 3WGDA 2DC5A 4G0LA 4GCIA 3GL5A 2H75A 5DJLA 2R0PA 1VGLA 4BPYA 2MZCA 2FA4A 2IMFA 1FW1A 4TR4A 3UAPA 3UVTA 4QL9A 3DYRA 4I6XA 1MTCA 3WYWA 3GH9A 2AYTA 3IOSA 2CX4A 2WB9A 3GV1A 2X8CA 1WE0A 1TKDB 4MNNA 4AJ6A 3KP8A 4PQIA 3MSZA 4DSRA 3D21A 3BJ5A 3M9JA 2I3YA 1QFNA 3EMXA 4JR4A 1KBNA 2V2GA 4MCUA 3U6VA 4WR4A 3RBTA 4QQ7A 1JLVA 4HZ4A 2I81A 4EKZA 2IMIA 4L5LA 3UARA 2AAWA 3KCMA
chains in the Genus database with same CATH topology
3IV4A 5ECIB 2HXKA 2GQLA 5IMZA 1HNBA 2PUKC 3LYPA 1QGVA 3VWXA 2EIQA 1G6WA 1SL0B 5DAKB 1F6MC 1GWCA 1TK0B 4GSNA 1PQNA 1Z9HA 2LSTA 2H1AA 4F82A 2CA8A 2XHFA 4MZCA 5H5RA 2N5AA 3RPPA 3HDCA 1XW5A 1V40A 1FB0A 4KE3A 5E59A 2OBIA 1NM3A 4GQFA 2HFDA 5D9XA 1UA5A 1K3YA 3LYKA 1QUWA 1JZRA 4MJCA 2L4QA 5ECSA 1C72A 3VURA 3FHKA 3NIVA 2C3NA 1GTBA 5D8IA 4KW6A 4KA0A 5DBQA 3HZ8A 2G0FA 4I97A 3VI7A 2DIYA 2IMDA 2DMMA 4MJAA 2EIOA 2XPEA 5FHIA 10GSA 2C0DA 4NHWA 2P5QA 3F4RA 4MF7A 1K0DA 1F37A 3GSTA 1I9DA 3W8SA 4HDEA 1XZOA 4O5UA 2WCIA 4IHUA 4WF5A 1M0UA 4NAXA 1GUHA 1GULA 4K1FA 1O7UA 2C8UA 4D73A 1B48A 4YQUA 3SBCA 1BJXA 2VAFA 2VL2C 4MP4A 1GSFA 1PGTA 1PRXA 3O3TA 3A2WA 3WGEA 3KIJA 2VCTA 2PBJA 3EYTA 2CX3A 2PVOC 2PERA 4YAVA 4WF4A 3FYGA 2P0GA 4J57E 4J56E 1PMTA 5KN1A 1XW6A 4WKWA 3F3RA 4Q5FA 2HYXA 5J41A 4IJIA 4ISDA 3ZITA 2I9HA 2DJ3A 1QK8A 3IBHA 1AQWA 1PSQA 2OKAA 3APSA 4K7IA 1BQ7A 3IHGA 2FD3A 1VF4A 2HRNA 2B5XA 4IJ3A 3UL3A 5DQSA 4V2MA 1NW2A 3KMNA 3VFIA 4BWSA 1W4VA 3QPMA 4ZL9A 1FG4A 1RK4A 2ZNMA 1HNAA 3KTLA 2EC4A 1K3OA 1RW1A 1T3BA 4L8EA 5ECMB 3QAVA 2FWHA 4POKA 3QAGA 5DCGA 2HLSA 3G7JA 3QMXA 2K9FA 2QSIA 2TRCP 3FR9A 4X4JA 2H6ZA 4TR1B 4DSSA 1OVNA 5IQYA 4YAPA 1EV4A 3M8NA 1JHBA 2BTOT 2QA1A 4ZIJA 4NPBA 2X64A 3GYKA 3L9VA 1S3AA 5F8BA 2HSYA 3TUEA 4O32A 1DE2A 2VOCA 4PTSA 4PXOA 2MMOA 4RI7A 2VLVA 4GF0A 1Y6EA 4V2LA 1T1VA 1PA3A 2GTUA 3KEBA 4MMMA 4PQHA 3LQ7A 1XVQA 1MD3A 2XC2A 1R7HA 2DSAA 2X4AA 3APOA 2JZRA 1ERUA 2CZ2A 5B6MA 1TU8A 3GKMA 5AISA 3L4NA 1BYEA 2XPDA 2IIYA 2H71A 5ECKB 1OYJA 1BX9A 2H0IA 1XOBA 3GL3A 4NMUA 1F9MA 1SKWB 5HR1A 3GKXA 5LCZA 2TIRA 1WRYA 4KF9A 4PGTA 1F2EA 3HY2A 4OMVA 2AHEA 3LFLA 5DDLA 1WWJA 2H1DA 4ZBDA 3H1NA 1YZXA 2CV4A 4ZBAA 1U3AA 4IP6A 4ZB9A 5LNKe 3HD5A 5ECNB 1V2AA 1PN0A 3E0UA 1SKRB 6GSSA 2LRTA 1G7OA 4USSA 4HOJA 2WGRA 2GT6A 3BOAA 2VL3A 4Z7XA 2KLXA 2VCQA 2J23A 1SK1A 3FR6A 2V32A 3HYPA 1PL1A 1Z6MA 4KAEA 4ECIA 1JZOA 1G6YA 2MYGA 3FZAA 4WETA 4PNGA 4HU9A 1XCCA 1USBA 3HHVA 3KH9A 3L0HA 4E8HA 2GZPA 3P90A 4TKYA 1RQMA 3VPTA 3UVHA 5IMCA 1B4QA 1XWGA 4ULXA 2IMEA 4N0ZA 2C4JA 2GSRA 2K8SA 3RPNA 3GHAA 1TRUA 5EVOA 4Q5NA 5ABRA 2IFQA 4OFNA 3L9UA 2GSQA 18GSA 3TKPA 3ME7A 4GSTA 2B5EA 1EOHA 2IMKA 4N11A 1KNGA 5G2ZA 1GTAA 3LORA 3GTUA 5AN1A 5CRHA 4K7NA 2XBIA 4HQZA 4WBRD 4QL7A 5JCWA 1GNWA 2CVDA 2DJ1A 5JCGA 5IMVA 3FZ4A 4IQ1A 3GSSA 5HQPA 2YZHA 5KN3A 3H4KA 3CRTA 5A4VA 2JL4A 4HU7A 2ALBA 1FHEA 4IVFA 1M2DA 3ZFBA 3LG6A 4WEYA 5CYYA 2H76A 4BVXB 5ECRB 3D4TA 5IIZA 4I2UA 4MH2A 3VLNA 4O7HA 3ZIVA 5JCUA 3ZYWA 3KZQA 5H5QA 1LJRA 4Z2UA 2GQMA 4MDCA 5IMAA 5EY6A 4PX1A 1HNCA 4NV2A 2OBKA 3J7Yb 4EF0A 1GH2A 2HSHA 3GA4A 3LSZA 3VPQA 2RM5A 4ZXGA 1OC9A 2LJRA 1ZYQB 4POMA 1URMA 4ID0A 1M2AA 1ON4A 1CQGA 1F3BA 5ELAA 2ON5A 2JZTA 2M80A 3TKSE 4I2TA 2FHEA 4G9HA 2HT9A 4FYCA 1IYHA 1FAAA 4BVYA 3ED3A 5GSSA 3EC3A 1Z7RA 1SJ6A 5B6NA 2L5OA 2H0GA 2RUEA 3EU3A 5DALA 3CXGA 1M2BA 4FIWA 3FRCA 1AUCA 3C8EA 3ZFLA 1XWKA 1DE1A 4KGIA 4N10A 3GKNA 1GSQA 3R3EA 5COHA 1TXXA 1A24A 4XS6A 2VIMA 2PMTA 2H8LA 2IL3A 3FK8A 3MWHA 3LGCA 3HCZA 3ME8A 3BCIA 1YQ1A 1M7TA 2G2QA 4OO4A 4HEA2 5AGYA 4ZB6A 4KDUA 2HRKA 3RHCA 3BCKA 1XXUA 3Q74A 3ISOA 4JE1A 2NVLA 2DBCA 4RI6A 2OE3A 5ID2A 2VL2A 3DIEA 3F6FA 4HQSA 4TRXA 3CRUA 3GKKA 3M3MA 2LJKA 1TDIA 4EXJA 4XIHA 3I43A 1S3DA 1PX6A 1EZKA 3EURA 4D73B 5ECOB 2LJAA 1ML6A 5IOWA 4KB3A 5G1LA 3LXZA 4WR5A 3I6AA 5CRGA 1ZZYA 4K6XA 5D9VA 3IPZA 4ICYA 2GLRA 3TRXA 1ERWA 1EP7A 1WIKA 3FKFA 3Q6OA 3RHBA 2O7KA 2FGXA 3TRPA 3PH9A 3IC8A 4F9ZA 1JZWA 4JEDA 4RQRA 5A4UA 3QFAC 5EPFA 1SYXA 4TXVA 3GX0A 1V57A 3E3EA 2YWIA 4X0XA 5DQYA 4NV5A 4HJMA 3KM6A 4O5RA 1AQXA 6GSYA 5JWRB 1DSBA 3TKQA 1Y25A 3TKRA 2LUSA 3C7MA 4XRAA 2B1LA 3ZREA 2YV9A 3TB2A 3DKSA 2VUPA 1U6TA 3UIWA 4DEJA 3PINA 2O8VB 3P8WA 1ERTA 2RM6A 4KDYA 1ABAA 3LWAA 4OFTA 3TJBA 2F8FA 3KH7A 5CREA 2VM1A 2O85A 5E4WA 3IK7A 2H1GA 3TGZA 3KTBA 2YWMA 2GT5A 1VF1A 3GFKA 2GS3A 4CDOA 1WP0A 5KEJA 1SD8A 4DSSB 1N8JA 2B7JA 4POLA 3GH6A 2YOIA 2H70A 1I5GA 4F03A 1FVKA 5IM9A 2B5YA 2DLXA 3IE3A 4BL7B 4EC0A 2GSTA 3ERWA 3A5IA 1GUMA 1S3CA 1TI1A 3GRXA 1SJZA 2FNOA 3G9BA 3QOUA 2ES7A 3ZMKA 4HUAA 5CO3A 4JRRA 4K7OA 4MK3A 2L6CA 4DSQA 1Q4JA 2X8GA 4MA9A 6GSUA 3TDGA 1VF2A 2DJ2A 4GLTA 4AJ7A 3CYNA 5ECHB 2VD0A 4HZ2A 1ERVA 4LMWA 4ECBA 12GSA 1B8XA 4ILFA 2F8AA 4X43A 3VWUA 3IRAA 5DAKA 4XS4A 1G0TA 2DKIA 3GN3A 3DEXA 5D93A 3F4SA 3IXRA 3QAWA 2VCVA 3EINA 4ML1A 2K18A 1X0RA 3QFBC 4IN0A 1SL2B 3PR8A 2LV3A 2CT6A 5CAXA 1K0AA 2DKHA 1QMVA 4EDYA 4MZWA 5F0GA 4RQXA 1UC7A 2FUG2 5BRTA 1F3AA 1GRXA 3PPUA 2YANA 3P7XA 2AV4A 4DVCA 3AY8A 2OA7A 1YJ6A 5J5NA 2K6VA 2P5RA 2L57A 2YCDA 5AIXA 3ZLPA 3FEUA 2HRAA 3DWVA 5HFKA 1YEPA 4MH3A 3BD2A 1K0OA 2WFCA 3C1SA 3P2AA 2L4CA 2FA8A 5G31A 3MDKA 3TKSC 1HYUA 7GSSA 4GQCA 4HI7A 3FMWA 2VCWA 3VWVA 4EO3A 1YF0A 2M46A 2CAQA 2XBQA 2LRCA 5BMUA 3HJPA 1J9BA 1EV9A 2WS2A 3EPTA 3TCOA 1X9WB 1GSYA 1OE7A 3ZTLA 5F07A 3UBLA 1A2LA 5D9WA 1YKAA 2H01A 1T4YA 4JU5A 4TN8A 1GSSA 2HRFA 5LD0A 3ZIJA 4MF5A 4L5OA 2CAIA 3KJYA 1PN9A 1WPIA 4K0GA 3D0ZA 2A4VA 2KHPA 4IGJA 4LL1B 5J9BA 2DJ0A 1FOVA 2GSSA 4TR3A 2WULA 1ZL9A 3HA9A 2PVQA 3HJMA 3TOUA 3KD0A 4MPFA 5CNWA 3UBKA 1EGOA 4KDXA 4ZB8A 1OC9B 4YQMA 3TOTA 3C1RA 3EVIA 3H8QA 2ZCTA 1ZYPA 2N5FA 2YJHA 5DVBA 2YWNA 3NOFA 3CMIA 2DJJA 3QDNA 3F8UA 4KUNA 3C71A 2A2PA 4ECJA 1G7EA 4L0WA 2V6OA 1Z3EA 4PUAA 4CY6A 3MIXA 3DGQA 3WT2A 2H6YA 1SK0A 3UJ1A 5CP1A 4BVYB 3D4MA 5G30A 4N30A 3DXBA 4TR0A 1O85A 1WOUA 1X9MB 2H0HA 4FYUA 3HVXA 2B6MA 3EU4A 1GLQA 3F6DA 5J9CA 4XHMA 1TRSA 1MEKA 5CRWA 2DMLA 3M9KA 2J9HA 1NHYA 3TJGA 4V1Ap 4N0VA 4IS0A 1ZCPA 2R3XA 5JWQB 1EP8A 4BWQA 3O76A 2VLUA 3D22A 3WT1A 4CHSA 1FB6A 1K0BA 2VM2A 4H86A 4IQAA 3JCML 5KOWA 2E7PA 3ZL5A 4L0UA 2C0GA 2MMNA 4PQ1A 2B3SA 4JBBA 2GZZA 14GSA 2H6XA 3O6TA 1R5PA 3ZVJD 3DMLA 3LJRA 1GSDA 2H74A 4TXOA 1OC3A 1XPVA 1ST9A 3U5RE 2L59A 2R37A 2WRTA 1SENA 3F0IA 2B1KA 2VD1A 2OACA 3EMPA 2DJKA 1XBSA 1E6BA 5A4WA 2YN1A 2ZUPA 4HJ2A 5G5FA 2JSYA 4MLYA 4IKHA 3DVWA 2QA2A 1QXHA 1TRWA 3TJFA 3HXSA 1J0FA 1OKDA 5F06A 1TI3A 2GVPA 2C1YA 1LBKA 4K2DA 4YH2A 3Q18A 5B7CA 4FYBA 2YWOA 4O5QA 5GAPD 5ECQB 3I69A 4G10A 3G7YA 1U88A 1M9BA 1FOHA 1MD4A 3NZNA 1PL2A 2D2ZA 2GGTA 2KP2A 2QKEA 1A2JA 1TTZA 20GSA 5A5KA 4YKGA 3VK9A 2FCHA 2JADA 2C80A 3QR6A 1K3LA 2LQOA 4GRFA 3HZ4A 2BMXA 4Q5QA 2AUVA 5JWOB 3KP9A 4MF6A 2IJYA 1Z6NA 3IC4A 2OE1A 2DIZA 5HR0A 4AF2A 4EUYA 1XOAA 1THXA 3C73A 3CTFA 2C3QA 4X1UA 1O73A 4LLRA 2L5LA 1H75A 2MMZA 5IPGA 3VI5A 2AJQB 2N5BA 2HZFA 2IN3A 2LRNA 1XVWA 5G5EA 2LEGA 1M9AA 3F63A 3D5JA 4OWYA 2NBSA 4EVMA 1FVJA 4MPGA 1ZYNA 4IBPA 2H19A 4BVXA 3FY7A 4YQVA 4POBA 3ZMLA 2LNSA 1Z7PA 1BG5A 3RAZA 1AC1A 1A8LA 1A2MA 2X8HA 2VL9A 4G0KA 4P3YB 4MZBA 2CVBA 3IA1A 1X5EA 1JFUA 2OADA 1K0NA 2QGVA 5INYA 2R4VA 2X99A 2CZ3A 2C3TA 1TJDA 16GSA 5HR2A 2GZYA 3L9SA 4ECCA 1E2YA 3FW2A 5HFIA 1AQVA 5KN0A 9GSSA 1JZDA 1XWCA 1EWXA 5D9TA 5KOXA 2IPAA 4IP1A 4XS4B 2TRXA 2HZEA 1MDKA 2KUCA 1EOGA 2FWFA 4Z2RA 4KCAA 1O81A 1TOFA 3EWLA 1M99A 1R26A 4NWYA 3QD9A 4O92A 4ZL7A 4ZBBA 3FZ9A 2LQQA 1HD2A 2JU5A 2RUFA 6GSVA 2ON7A 3Q19A 5FT3A 3SWLA 2WZ9A 2V1MA 1T7PB 3W6GA 1OC8A 4Q5RA 3EE2A 4K2XA 2QC7A 1B9XC 3IHQA 5IOXA 4IW9A 5HFGA 3J7Yk 2BJXA 4J2FA 4EDZA 3A5WA 2NTOA 1SKSB 3TKSA 4PURA 1ACVA 4HS1A 4K9ZA 3S9FA 3DVXA 1SYRA 2VLTA 3ERFA 2YNXA 1K0MA 3TJKA 1WJKA 1BAYA 3CSHA 2RLIA 2E2MA 1XFLA 1T4ZA 4V1Ag 2VCXA 3F3QA 4GTUA 5G1KA 3W8JA 4BA7A 4XRDA 3ZVJA 4EIQA 2YPMA 4G2EA 3DD3A 19GSA 4K5SA 5FWGA 4IELA 1T8EB 3WD6A 4KCEA 2F51A 2H73A 3APQA 2HE3A 2PN8A 5IO0A 1TRVA 1V58A 4KNDA 2Z9SA 4ZL8A 2HNLA 1U87A 5ENUA 1IYIA 3GIXA 3WGXA 2B7KA 5J4UA 4LL4B 4JR6A 3N9JA 2I4AA 5AIVA 17GSA 4F0BA 2CVKA 2O89A 2WDUA 4OD7A 3F9UA 4PUFC 1ZYEA 3H93A 1SU9A 1YF1A 2P31A 1MDIA 3K8NA 3M0FA 3HVVA 2C0EA 5IMFA 2LTKA 2OE0A 3D6IA 1U3IA 11GSA 1O8XA 4KSOA 1B4PA 1AAZA 2MBSA 5EL8A 3HVSA 3FR3A 2H72A 4GSSA 3A3TA 5C04A 3IR4A 3ERGA 1UVZA 5GAND 2FWGA 2R6KA 3I9V2 5GSTA 2LNTA 2VO4A 1ZMAA 2H1BA 3V1WA 3KXOA 5L71A 5IMDA 1YKCA 2IWTA 1MDJA 2NDOA 1K0CA 2PWJA 1X5CA 1SJIA 3LEFA 5GZZB 3A2XA 1TU7A 3IK9A 1AW9A 1GSEA 2FY6A 4K0NA 4BL7A 1QQ2A 1WMJA 4XTSA 4TW5A 2PGTA 4AJ8A 4G19A 2CQ9A 2FLSA 2PPTA 2IFQB 2A2SA 2F3MA 3GMFA 2OJLA 4ML6A 3CBUA 3GX8A 2H66A 4YKFA 4MABA 2YV7A 4MJEA 1ILOA 3GTUB 1UN2A 3MAKA 3TRQA 1VF3A 4K5RA 4A5PA 4XS1A 5B8AA 4TOPA 3LW9A 4V2NA 3VWWA 1V9WA 1XWBA 1TW9A 1A0RP 6GSTA 5IO2A 3LXTA 1W89A 2M72A 3CSJA 4GWRA 8GSSA 1ZOFA 2V41A 3E9JB 4EIPA 2JSZA 1SD9A 2YP6A 2H30A 1YEXA 3A2VA 1GUKA 4GXZA 1R4WA 2LKUA 3DRNA 1NHOA 4AGSA 4TXOB 1B9YC 2C0FA 2A2RA 4OCFA 2LS5A 2NPBA 4WBJA 1H4OA 3FZ5A 3PGTA 1GTUA 1AIUA 3IAS2 3L78A 3IDVA 1NSWA 1OAZA 2GDRA 3M1GA 5ECLB 1GL8A 2UZ8A 2JACA 2R0CA 4TR1A 3GNJA 1PKWA 2RIIA 1YDKA 1KEBA 1R5AA 4EL1A 3MYDA 5KN2A 5H5SA 1TP9A 2REMA 3N5OA 3CTGA 3H79A 4F2IA 4OFMA 1FO5A 1SK2A 2AB6A 5DALB 1GNEA 3ZZXA 5D96A 3HKRA 4LMVA 1GSUA 3R2QA 1EGRA 5DJMA 2WJUA 3MNGA 4I8BA 4K8MA 4RUVA 2L6DA 4EE0A 1EEJA 2E0QA 2K8VA 2MBTA 4ZILA 5HR3A 2EIRA 4G0IA 3KMOA 22GSA 1OE8A 1THOA 4NHZA 4XCSA 2R2JA 1TK5B 1ZGNA 4TVEA 6GSXA 1HQOA 5ELGA 2VCZA 2HI7A 1X9SB 2A4HA 1LU4A 4Z2TA 3F4TA 1O8WA 2R5GA 4PNFA 1OKTA 1JLWA 5ID2B 1DBYA 3US3A 13GSA 2F9SA 3BBYA 1VRSD 2PU9C 1YY7A 1N2AA 4OO5A 1A23A 1O6JA 4ACSA 3GURA 1CQHA 3UMAA 2GQKA 3G7IA 1PKZA 1EEMA 4FO5A 4WXTA 4KH7A 4I5QA 4CW9A 2V6KA 1XWAA 4CY8A 5B8BA 1GP1A 4F0CA 4OCEA 1PD21 4KX4A 2JZSA 1TK8B 5D73A 3RDWA 2YJ7A 1SL1B 2FWEA 6GSWA 1XW9A 5CRDA 4JZQA 4LA1A 2MMAA 3OR5A 4FH8A 4KSMA 4E8EA 2E2GA 3GUSA 5ECPB 2KP1A 2O87A 4FQUA 5J3RA 3UEMA 4MJBA 1BEDA 1A8YA 1DUGA 1AXDA 3UOMA 2HZEB 2KOKA 1Q98A 3KGKA 3CSIA 1A0FA 1J08A 2R0GA 2YZUA 2HSMA 1GTIA 1GLPA 1V98A 2X49A 3ZRDA 1PX7A 2I1UA 3QCPA 1KTEA 5F05A 1Z5YE 3HJOA 1XIYA 4NXIA 1T00A 5C00A 3TJJA 1X5DA 3IAM2 5DCHA 5IPHA 3WGDA 2DC5A 4G0LA 4GCIA 3GL5A 2H75A 5DJLA 2R0PA 1VGLA 4BPYA 2MZCA 2FA4A 2IMFA 1FW1A 4TR4A 3UAPA 3UVTA 4QL9A 3DYRA 4I6XA 1MTCA 3WYWA 3GH9A 2AYTA 3IOSA 2CX4A 2WB9A 3GV1A 2X8CA 1WE0A 1TKDB 4MNNA 4AJ6A 3KP8A 4PQIA 3MSZA 4DSRA 3D21A 3BJ5A 3M9JA 2I3YA 1QFNA 3EMXA 4JR4A 1KBNA 2V2GA 4MCUA 3U6VA 4WR4A 3RBTA 4QQ7A 1JLVA 4HZ4A 2I81A 4EKZA 2IMIA 4L5LA 3UARA 2AAWA 3KCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IV4 A;  5ECI B;  2HXK A;  2GQL A;  5IMZ A;  1HNB A;  2PUK C;  3LYP A;  1QGV A;  3VWX A;  2EIQ A;  1G6W A;  1SL0 B;  5DAK B;  1F6M C;  1GWC A;  1TK0 B;  4GSN A;  1PQN A;  1Z9H A;  2LST A;  2H1A A;  4F82 A;  2CA8 A;  2XHF A;  4MZC A;  5H5R A;  2N5A A;  3RPP A;  3HDC A;  1XW5 A;  1V40 A;  1FB0 A;  4KE3 A;  5E59 A;  2OBI A;  1NM3 A;  4GQF A;  2HFD A;  5D9X A;  1UA5 A;  1K3Y A;  3LYK A;  1QUW A;  1JZR A;  4MJC A;  2L4Q A;  5ECS A;  1C72 A;  3VUR A;  3FHK A;  3NIV A;  2C3N A;  1GTB A;  5D8I A;  4KW6 A;  4KA0 A;  5DBQ A;  3HZ8 A;  2G0F A;  4I97 A;  3VI7 A;  2DIY A;  2IMD A;  2DMM A;  4MJA A;  2EIO A;  2XPE A;  5FHI A;  10GS A;  2C0D A;  4NHW A;  2P5Q A;  3F4R A;  4MF7 A;  1K0D A;  1F37 A;  3GST A;  1I9D A;  3W8S A;  4HDE A;  1XZO A;  2WCI A;  4IHU A;  4WF5 A;  1M0U A;  4NAX A;  1GUH A;  1GUL A;  4K1F A;  1O7U A;  2C8U A;  4D73 A;  1B48 A;  4YQU A;  3SBC A;  1BJX A;  2VAF A;  2VL2 C;  4MP4 A;  1GSF A;  1PGT A;  1PRX A;  3O3T A;  3A2W A;  3WGE A;  3KIJ A;  2VCT A;  2PBJ A;  3EYT A;  2CX3 A;  2PVO C;  2PER A;  4YAV A;  4WF4 A;  3FYG A;  2P0G A;  4J57 E;  4J56 E;  1PMT A;  5KN1 A;  1XW6 A;  4WKW A;  3F3R A;  4Q5F A;  2HYX A;  5J41 A;  4IJI A;  4ISD A;  3ZIT A;  2I9H A;  2DJ3 A;  1QK8 A;  3IBH A;  1AQW A;  1PSQ A;  2OKA A;  3APS A;  4K7I A;  1BQ7 A;  2FD3 A;  1VF4 A;  2HRN A;  2B5X A;  4IJ3 A;  3UL3 A;  5DQS A;  4V2M A;  1NW2 A;  3KMN A;  3VFI A;  4BWS A;  1W4V A;  3QPM A;  4ZL9 A;  1FG4 A;  1RK4 A;  2ZNM A;  1HNA A;  3KTL A;  2EC4 A;  1K3O A;  1RW1 A;  1T3B A;  4L8E A;  5ECM B;  3QAV A;  2FWH A;  4POK A;  3QAG A;  5DCG A;  2HLS A;  3G7J A;  3QMX A;  2K9F A;  2QSI A;  2TRC P;  3FR9 A;  2H6Z A;  4TR1 B;  4DSS A;  1OVN A;  5IQY A;  4YAP A;  1EV4 A;  3M8N A;  1JHB A;  2BTO T;  4ZIJ A;  4NPB A;  2X64 A;  3GYK A;  3L9V A;  1S3A A;  5F8B A;  2HSY A;  3TUE A;  4O32 A;  1DE2 A;  2VOC A;  4PXO A;  2MMO A;  4RI7 A;  2VLV A;  4GF0 A;  1Y6E A;  4V2L A;  1T1V A;  1PA3 A;  2GTU A;  3KEB A;  4MMM A;  4PQH A;  3LQ7 A;  1XVQ A;  1MD3 A;  2XC2 A;  1R7H A;  2DSA A;  3APO A;  2JZR A;  1ERU A;  2CZ2 A;  5B6M A;  1TU8 A;  3GKM A;  5AIS A;  3L4N A;  1BYE A;  2XPD A;  2IIY A;  2H71 A;  5ECK B;  1OYJ A;  1BX9 A;  2H0I A;  1XOB A;  3GL3 A;  4NMU A;  1F9M A;  1SKW B;  5HR1 A;  3GKX A;  5LCZ A;  2TIR A;  1WRY A;  4PGT A;  1F2E A;  3HY2 A;  4OMV A;  2AHE A;  3LFL A;  5DDL A;  1WWJ A;  2H1D A;  4ZBD A;  3H1N A;  1YZX A;  2CV4 A;  4ZBA A;  1U3A A;  4IP6 A;  4ZB9 A;  5LNK e;  3HD5 A;  5ECN B;  1V2A A;  3E0U A;  1SKR B;  6GSS A;  2LRT A;  1G7O A;  4HOJ A;  2WGR A;  2GT6 A;  3BOA A;  2VL3 A;  4Z7X A;  2KLX A;  2VCQ A;  2J23 A;  1SK1 A;  3FR6 A;  2V32 A;  3HYP A;  1PL1 A;  1Z6M A;  4KAE A;  4ECI A;  1JZO A;  1G6Y A;  2MYG A;  3FZA A;  4WET A;  4PNG A;  4HU9 A;  1XCC A;  1USB A;  3HHV A;  3KH9 A;  3L0H A;  4E8H A;  2GZP A;  3P90 A;  4TKY A;  1RQM A;  3VPT A;  3UVH A;  5IMC A;  1B4Q A;  1XWG A;  4ULX A;  2IME A;  4N0Z A;  2C4J A;  2GSR A;  2K8S A;  3RPN A;  3GHA A;  1TRU A;  5EVO A;  4Q5N A;  5ABR A;  2IFQ A;  4OFN A;  3L9U A;  2GSQ A;  18GS A;  3TKP A;  3ME7 A;  4GST A;  2B5E A;  1EOH A;  2IMK A;  4N11 A;  1KNG A;  5G2Z A;  1GTA A;  3LOR A;  3GTU A;  5AN1 A;  5CRH A;  4K7N A;  2XBI A;  4HQZ A;  4WBR D;  4QL7 A;  5JCW A;  1GNW A;  2CVD A;  2DJ1 A;  5JCG A;  5IMV A;  3FZ4 A;  4IQ1 A;  3GSS A;  5HQP A;  2YZH A;  5KN3 A;  3H4K A;  3CRT A;  5A4V A;  2JL4 A;  4HU7 A;  2ALB A;  1FHE A;  4IVF A;  1M2D A;  3ZFB A;  3LG6 A;  4WEY A;  5CYY A;  2H76 A;  5ECR B;  3D4T A;  5IIZ A;  4I2U A;  4MH2 A;  3VLN A;  4O7H A;  3ZIV A;  5JCU A;  3ZYW A;  3KZQ A;  5H5Q A;  1LJR A;  2GQM A;  4MDC A;  5IMA A;  5EY6 A;  4PX1 A;  1HNC A;  4NV2 A;  2OBK A;  3J7Y b;  4EF0 A;  1GH2 A;  2HSH A;  3GA4 A;  3LSZ A;  3VPQ A;  2RM5 A;  4ZXG A;  1OC9 A;  2LJR A;  1ZYQ B;  4POM A;  1URM A;  4ID0 A;  1M2A A;  1ON4 A;  1CQG A;  1F3B A;  5ELA A;  2ON5 A;  2JZT A;  2M80 A;  3TKS E;  4I2T A;  2FHE A;  4G9H A;  2HT9 A;  4FYC A;  1IYH A;  1FAA A;  4BVY A;  3ED3 A;  5GSS A;  3EC3 A;  1Z7R A;  1SJ6 A;  5B6N A;  2L5O A;  2H0G A;  2RUE A;  3EU3 A;  5DAL A;  3CXG A;  1M2B A;  4FIW A;  3FRC A;  1AUC A;  3C8E A;  3ZFL A;  1XWK A;  1DE1 A;  4KGI A;  4N10 A;  3GKN A;  1GSQ A;  5COH A;  1TXX A;  1A24 A;  4XS6 A;  2VIM A;  2PMT A;  2H8L A;  2IL3 A;  3FK8 A;  3MWH A;  3LGC A;  3HCZ A;  3ME8 A;  3BCI A;  1YQ1 A;  1M7T A;  2G2Q A;  4OO4 A;  4HEA 2;  5AGY A;  4ZB6 A;  4KDU A;  3RHC A;  3BCK A;  1XXU A;  3Q74 A;  3ISO A;  4JE1 A;  2NVL A;  2DBC A;  4RI6 A;  2OE3 A;  5ID2 A;  2VL2 A;  3DIE A;  3F6F A;  4HQS A;  4TRX A;  3CRU A;  3GKK A;  3M3M A;  2LJK A;  1TDI A;  4EXJ A;  4XIH A;  3I43 A;  1S3D A;  1PX6 A;  1EZK A;  3EUR A;  4D73 B;  5ECO B;  2LJA A;  1ML6 A;  5IOW A;  4KB3 A;  5G1L A;  3LXZ A;  4WR5 A;  3I6A A;  5CRG A;  1ZZY A;  4K6X A;  5D9V A;  3IPZ A;  2GLR A;  3TRX A;  1ERW A;  1EP7 A;  1WIK A;  3FKF A;  3Q6O A;  3RHB A;  2O7K A;  2FGX A;  3TRP A;  3PH9 A;  4F9Z A;  1JZW A;  4JED A;  4RQR A;  5A4U A;  3QFA C;  5EPF A;  1SYX A;  4TXV A;  3GX0 A;  1V57 A;  3E3E A;  2YWI A;  4X0X A;  5DQY A;  4NV5 A;  4HJM A;  3KM6 A;  4O5R A;  1AQX A;  6GSY A;  5JWR B;  1DSB A;  3TKQ A;  1Y25 A;  3TKR A;  2LUS A;  3C7M A;  4XRA A;  2B1L A;  3ZRE A;  2YV9 A;  3TB2 A;  3DKS A;  2VUP A;  1U6T A;  3UIW A;  4DEJ A;  3PIN A;  2O8V B;  3P8W A;  1ERT A;  2RM6 A;  4KDY A;  1ABA A;  3LWA A;  4OFT A;  3TJB A;  2F8F A;  3KH7 A;  5CRE A;  2VM1 A;  2O85 A;  5E4W A;  3IK7 A;  2H1G A;  3TGZ A;  3KTB A;  2YWM A;  2GT5 A;  1VF1 A;  3GFK A;  2GS3 A;  4CDO A;  1WP0 A;  5KEJ A;  1SD8 A;  4DSS B;  1N8J A;  2B7J A;  4POL A;  3GH6 A;  2YOI A;  2H70 A;  1I5G A;  4F03 A;  1FVK A;  5IM9 A;  2B5Y A;  2DLX A;  3IE3 A;  4EC0 A;  2GST A;  3ERW A;  1GUM A;  1S3C A;  1TI1 A;  3GRX A;  1SJZ A;  2FNO A;  3G9B A;  3QOU A;  2ES7 A;  3ZMK A;  4HUA A;  5CO3 A;  4JRR A;  4K7O A;  4MK3 A;  2L6C A;  4DSQ A;  1Q4J A;  2X8G A;  4MA9 A;  6GSU A;  3TDG A;  1VF2 A;  2DJ2 A;  4GLT A;  4AJ7 A;  3CYN A;  5ECH B;  2VD0 A;  4HZ2 A;  1ERV A;  4LMW A;  4ECB A;  12GS A;  1B8X A;  4ILF A;  2F8A A;  4X43 A;  3VWU A;  3IRA A;  5DAK A;  4XS4 A;  1G0T A;  3GN3 A;  3DEX A;  5D93 A;  3F4S A;  3IXR A;  3QAW A;  2VCV A;  3EIN A;  4ML1 A;  2K18 A;  1X0R A;  3QFB C;  4IN0 A;  1SL2 B;  3PR8 A;  2LV3 A;  2CT6 A;  5CAX A;  1K0A A;  1QMV A;  4EDY A;  4MZW A;  5F0G A;  4RQX A;  1UC7 A;  2FUG 2;  1F3A A;  1GRX A;  2YAN A;  3P7X A;  2AV4 A;  4DVC A;  3AY8 A;  2OA7 A;  1YJ6 A;  5J5N A;  2K6V A;  2P5R A;  2L57 A;  2YCD A;  5AIX A;  3ZLP A;  3FEU A;  3DWV A;  5HFK A;  1YEP A;  4MH3 A;  3BD2 A;  1K0O A;  2WFC A;  3C1S A;  3P2A A;  2L4C A;  2FA8 A;  5G31 A;  3MDK A;  3TKS C;  1HYU A;  7GSS A;  4GQC A;  4HI7 A;  2VCW A;  3VWV A;  4EO3 A;  1YF0 A;  2M46 A;  2CAQ A;  2XBQ A;  2LRC A;  3HJP A;  1J9B A;  1EV9 A;  2WS2 A;  3TCO A;  1X9W B;  1GSY A;  1OE7 A;  3ZTL A;  5F07 A;  3UBL A;  1A2L A;  5D9W A;  1YKA A;  2H01 A;  1T4Y A;  4JU5 A;  4TN8 A;  1GSS A;  2HRF A;  5LD0 A;  3ZIJ A;  4MF5 A;  4L5O A;  2CAI A;  3KJY A;  1PN9 A;  1WPI A;  4K0G A;  3D0Z A;  2A4V A;  2KHP A;  4IGJ A;  4LL1 B;  5J9B A;  2DJ0 A;  1FOV A;  2GSS A;  4TR3 A;  2WUL A;  1ZL9 A;  3HA9 A;  2PVQ A;  3HJM A;  3TOU A;  3KD0 A;  4MPF A;  5CNW A;  3UBK A;  1EGO A;  4KDX A;  4ZB8 A;  1OC9 B;  4YQM A;  3TOT A;  3C1R A;  3EVI A;  3H8Q A;  2ZCT A;  2N5F A;  2YJH A;  5DVB A;  2YWN A;  3NOF A;  3CMI A;  2DJJ A;  3QDN A;  3F8U A;  4KUN A;  3C71 A;  4ECJ A;  1G7E A;  4L0W A;  2V6O A;  1Z3E A;  4PUA A;  3DGQ A;  3WT2 A;  2H6Y A;  1SK0 A;  3UJ1 A;  5CP1 A;  3D4M A;  5G30 A;  4N30 A;  3DXB A;  4TR0 A;  1O85 A;  1WOU A;  1X9M B;  2H0H A;  4FYU A;  3HVX A;  2B6M A;  3EU4 A;  1GLQ A;  3F6D A;  5J9C A;  4XHM A;  1TRS A;  1MEK A;  5CRW A;  2DML A;  3M9K A;  2J9H A;  1NHY A;  3TJG A;  4V1A p;  4N0V A;  4IS0 A;  1ZCP A;  2R3X A;  5JWQ B;  1EP8 A;  4BWQ A;  3O76 A;  2VLU A;  3D22 A;  3WT1 A;  4CHS A;  1FB6 A;  1K0B A;  2VM2 A;  4H86 A;  4IQA A;  3JCM L;  2E7P A;  3ZL5 A;  4L0U A;  2C0G A;  2MMN A;  4PQ1 A;  2B3S A;  4JBB A;  2GZZ A;  14GS A;  2H6X A;  3O6T A;  1R5P A;  3ZVJ D;  3DML A;  3LJR A;  1GSD A;  2H74 A;  4TXO A;  1OC3 A;  1XPV A;  1ST9 A;  3U5R E;  2L59 A;  2R37 A;  2WRT A;  1SEN A;  3F0I A;  2B1K A;  2VD1 A;  2OAC A;  3EMP A;  2DJK A;  1XBS A;  1E6B A;  5A4W A;  2YN1 A;  2ZUP A;  4HJ2 A;  5G5F A;  2JSY A;  4MLY A;  4IKH A;  3DVW A;  1QXH A;  1TRW A;  3TJF A;  3HXS A;  1J0F A;  1OKD A;  5F06 A;  1TI3 A;  2GVP A;  2C1Y A;  1LBK A;  4K2D A;  4YH2 A;  3Q18 A;  5B7C A;  4FYB A;  2YWO A;  5GAP D;  5ECQ B;  3I69 A;  4G10 A;  3G7Y A;  1U88 A;  1M9B A;  1MD4 A;  3NZN A;  1PL2 A;  2D2Z A;  2GGT A;  2KP2 A;  2QKE A;  1A2J A;  1TTZ A;  20GS A;  5A5K A;  3VK9 A;  2FCH A;  2JAD A;  2C80 A;  3QR6 A;  1K3L A;  2LQO A;  4GRF A;  3HZ4 A;  2BMX A;  4Q5Q A;  2AUV A;  5JWO B;  3KP9 A;  4MF6 A;  2IJY A;  1Z6N A;  3IC4 A;  2OE1 A;  2DIZ A;  5HR0 A;  4AF2 A;  4EUY A;  1XOA A;  1THX A;  3C73 A;  3CTF A;  2C3Q A;  4X1U A;  1O73 A;  4LLR A;  2L5L A;  1H75 A;  2MMZ A;  5IPG A;  3VI5 A;  2AJQ B;  2N5B A;  2HZF A;  2IN3 A;  2LRN A;  1XVW A;  5G5E A;  2LEG A;  1M9A A;  3F63 A;  3D5J A;  4OWY A;  2NBS A;  4EVM A;  1FVJ A;  4MPG A;  4IBP A;  2H19 A;  4BVX A;  3FY7 A;  4YQV A;  4POB A;  3ZML A;  2LNS A;  1Z7P A;  1BG5 A;  3RAZ A;  1AC1 A;  1A8L A;  1A2M A;  2X8H A;  2VL9 A;  4P3Y B;  4MZB A;  2CVB A;  3IA1 A;  1X5E A;  1JFU A;  2OAD A;  1K0N A;  2QGV A;  5INY A;  2R4V A;  2X99 A;  2CZ3 A;  2C3T A;  1TJD A;  16GS A;  5HR2 A;  2GZY A;  3L9S A;  4ECC A;  1E2Y A;  3FW2 A;  5HFI A;  1AQV A;  5KN0 A;  9GSS A;  1JZD A;  1XWC A;  1EWX A;  5D9T A;  2IPA A;  4IP1 A;  4XS4 B;  2TRX A;  2HZE A;  1MDK A;  2KUC A;  1EOG A;  2FWF A;  4KCA A;  1O81 A;  1TOF A;  3EWL A;  1M99 A;  1R26 A;  4NWY A;  3QD9 A;  4O92 A;  4ZL7 A;  4ZBB A;  3FZ9 A;  2LQQ A;  1HD2 A;  2JU5 A;  2RUF A;  6GSV A;  2ON7 A;  3Q19 A;  5FT3 A;  3SWL A;  2WZ9 A;  2V1M A;  1T7P B;  3W6G A;  1OC8 A;  4Q5R A;  3EE2 A;  2QC7 A;  1B9X C;  3IHQ A;  5IOX A;  4IW9 A;  5HFG A;  3J7Y k;  2BJX A;  4J2F A;  4EDZ A;  3A5W A;  2NTO A;  1SKS B;  3TKS A;  4PUR A;  1ACV A;  4HS1 A;  4K9Z A;  3S9F A;  3DVX A;  1SYR A;  2VLT A;  3ERF A;  2YNX A;  1K0M A;  3TJK A;  1WJK A;  1BAY A;  3CSH A;  2RLI A;  2E2M A;  1XFL A;  1T4Z A;  4V1A g;  2VCX A;  3F3Q A;  4GTU A;  5G1K A;  3W8J A;  4BA7 A;  4XRD A;  3ZVJ A;  2YPM A;  4G2E A;  3DD3 A;  19GS A;  5FWG A;  4IEL A;  1T8E B;  3WD6 A;  4KCE A;  2F51 A;  2H73 A;  3APQ A;  2HE3 A;  2PN8 A;  5IO0 A;  1TRV A;  1V58 A;  4KND A;  2Z9S A;  4ZL8 A;  2HNL A;  1U87 A;  5ENU A;  1IYI A;  3GIX A;  3WGX A;  2B7K A;  5J4U A;  4LL4 B;  4JR6 A;  3N9J A;  2I4A A;  5AIV A;  17GS A;  4F0B A;  2CVK A;  2O89 A;  2WDU A;  4OD7 A;  3F9U A;  4PUF C;  1ZYE A;  3H93 A;  1SU9 A;  1YF1 A;  2P31 A;  1MDI A;  3K8N A;  3M0F A;  3HVV A;  2C0E A;  5IMF A;  2LTK A;  2OE0 A;  3D6I A;  1U3I A;  11GS A;  1O8X A;  4KSO A;  1B4P A;  1AAZ A;  2MBS A;  5EL8 A;  3HVS A;  3FR3 A;  2H72 A;  4GSS A;  3A3T A;  5C04 A;  3IR4 A;  3ERG A;  1UVZ A;  5GAN D;  2FWG A;  2R6K A;  3I9V 2;  5GST A;  2LNT A;  2VO4 A;  1ZMA A;  2H1B A;  3V1W A;  3KXO A;  5L71 A;  5IMD A;  1YKC A;  2IWT A;  1MDJ A;  2NDO A;  1K0C A;  2PWJ A;  1X5C A;  1SJI A;  3LEF A;  5GZZ B;  3A2X A;  1TU7 A;  3IK9 A;  1AW9 A;  1GSE A;  2FY6 A;  4K0N A;  4BL7 A;  1QQ2 A;  1WMJ A;  4XTS A;  4TW5 A;  2PGT A;  4AJ8 A;  4G19 A;  2CQ9 A;  2FLS A;  2PPT A;  2IFQ B;  2A2S A;  2F3M A;  3GMF A;  2OJL A;  4ML6 A;  3CBU A;  3GX8 A;  2H66 A;  4MAB A;  2YV7 A;  4MJE A;  1ILO A;  3GTU B;  1UN2 A;  3MAK A;  3TRQ A;  1VF3 A;  4XS1 A;  5B8A A;  4TOP A;  4V2N A;  3VWW A;  1V9W A;  1XWB A;  1TW9 A;  1A0R P;  6GST A;  5IO2 A;  3LXT A;  1W89 A;  2M72 A;  3CSJ A;  4GWR A;  8GSS A;  1ZOF A;  2V41 A;  3E9J B;  2JSZ A;  1SD9 A;  2YP6 A;  2H30 A;  1YEX A;  3A2V A;  1GUK A;  4GXZ A;  1R4W A;  2LKU A;  3DRN A;  1NHO A;  4AGS A;  4TXO B;  1B9Y C;  2C0F A;  2A2R A;  4OCF A;  2LS5 A;  2NPB A;  4WBJ A;  1H4O A;  3FZ5 A;  3PGT A;  1GTU A;  1AIU A;  3IAS 2;  3L78 A;  3IDV A;  1NSW A;  1OAZ A;  2GDR A;  3M1G A;  5ECL B;  1GL8 A;  2JAC A;  4TR1 A;  3GNJ A;  1PKW A;  2RII A;  1YDK A;  1KEB A;  1R5A A;  4EL1 A;  5KN2 A;  5H5S A;  1TP9 A;  2REM A;  3N5O A;  3CTG A;  3H79 A;  4F2I A;  4OFM A;  1FO5 A;  1SK2 A;  2AB6 A;  5DAL B;  1GNE A;  3ZZX A;  5D96 A;  3HKR A;  4LMV A;  1GSU A;  3R2Q A;  1EGR A;  5DJM A;  2WJU A;  3MNG A;  4I8B A;  4K8M A;  4RUV A;  2L6D A;  4EE0 A;  1EEJ A;  2E0Q A;  2K8V A;  2MBT A;  4ZIL A;  5HR3 A;  2EIR A;  3KMO A;  22GS A;  1OE8 A;  1THO A;  4NHZ A;  4XCS A;  2R2J A;  1TK5 B;  1ZGN A;  4TVE A;  6GSX A;  1HQO A;  5ELG A;  2VCZ A;  2HI7 A;  1X9S B;  1LU4 A;  3F4T A;  1O8W A;  2R5G A;  4PNF A;  1OKT A;  1JLW A;  5ID2 B;  1DBY A;  3US3 A;  13GS A;  2F9S A;  3BBY A;  1VRS D;  2PU9 C;  1YY7 A;  1N2A A;  4OO5 A;  1A23 A;  1O6J A;  4ACS A;  3GUR A;  1CQH A;  3UMA A;  2GQK A;  3G7I A;  1PKZ A;  1EEM A;  4FO5 A;  4WXT A;  4KH7 A;  4I5Q A;  4CW9 A;  2V6K A;  1XWA A;  5B8B A;  1GP1 A;  4F0C A;  4OCE A;  1PD2 1;  4KX4 A;  2JZS A;  1TK8 B;  5D73 A;  3RDW A;  2YJ7 A;  1SL1 B;  2FWE A;  6GSW A;  1XW9 A;  5CRD A;  4JZQ A;  4LA1 A;  2MMA A;  3OR5 A;  4FH8 A;  4KSM A;  4E8E A;  2E2G A;  3GUS A;  5ECP B;  2KP1 A;  2O87 A;  5J3R A;  3UEM A;  4MJB A;  1BED A;  1A8Y A;  1DUG A;  1AXD A;  3UOM A;  2HZE B;  2KOK A;  1Q98 A;  3KGK A;  3CSI A;  1A0F A;  1J08 A;  2YZU A;  1GTI A;  1GLP A;  1V98 A;  3ZRD A;  1PX7 A;  2I1U A;  3QCP A;  1KTE A;  5F05 A;  1Z5Y E;  3HJO A;  1XIY A;  4NXI A;  1T00 A;  5C00 A;  3TJJ A;  1X5D A;  3IAM 2;  5DCH A;  5IPH A;  3WGD A;  2DC5 A;  4GCI A;  3GL5 A;  2H75 A;  5DJL A;  1VGL A;  4BPY A;  2MZC A;  2FA4 A;  2IMF A;  1FW1 A;  4TR4 A;  3UAP A;  3UVT A;  4QL9 A;  3DYR A;  4I6X A;  1MTC A;  3WYW A;  3GH9 A;  2AYT A;  3IOS A;  2CX4 A;  2WB9 A;  3GV1 A;  2X8C A;  1WE0 A;  1TKD B;  4AJ6 A;  3KP8 A;  4PQI A;  3MSZ A;  4DSR A;  3D21 A;  3BJ5 A;  3M9J A;  2I3Y A;  1QFN A;  3EMX A;  4JR4 A;  1KBN A;  2V2G A;  4MCU A;  3U6V A;  4WR4 A;  3RBT A;  4QQ7 A;  1JLV A;  4HZ4 A;  2I81 A;  4EKZ A;  2IMI A;  4L5L A;  3UAR A;  2AAW A;  3KCM A; 
#chains in the Genus database with same CATH topology
 3IV4 A;  5ECI B;  2HXK A;  2GQL A;  5IMZ A;  1HNB A;  2PUK C;  3LYP A;  1QGV A;  3VWX A;  2EIQ A;  1G6W A;  1SL0 B;  5DAK B;  1F6M C;  1GWC A;  1TK0 B;  4GSN A;  1PQN A;  1Z9H A;  2LST A;  2H1A A;  4F82 A;  2CA8 A;  2XHF A;  4MZC A;  5H5R A;  2N5A A;  3RPP A;  3HDC A;  1XW5 A;  1V40 A;  1FB0 A;  4KE3 A;  5E59 A;  2OBI A;  1NM3 A;  4GQF A;  2HFD A;  5D9X A;  1UA5 A;  1K3Y A;  3LYK A;  1QUW A;  1JZR A;  4MJC A;  2L4Q A;  5ECS A;  1C72 A;  3VUR A;  3FHK A;  3NIV A;  2C3N A;  1GTB A;  5D8I A;  4KW6 A;  4KA0 A;  5DBQ A;  3HZ8 A;  2G0F A;  4I97 A;  3VI7 A;  2DIY A;  2IMD A;  2DMM A;  4MJA A;  2EIO A;  2XPE A;  5FHI A;  10GS A;  2C0D A;  4NHW A;  2P5Q A;  3F4R A;  4MF7 A;  1K0D A;  1F37 A;  3GST A;  1I9D A;  3W8S A;  4HDE A;  1XZO A;  4O5U A;  2WCI A;  4IHU A;  4WF5 A;  1M0U A;  4NAX A;  1GUH A;  1XG8 A;  1GUL A;  4K1F A;  1O7U A;  2C8U A;  4D73 A;  1B48 A;  4YQU A;  3SBC A;  1BJX A;  2VAF A;  2VL2 C;  4MP4 A;  1GSF A;  1PGT A;  1PRX A;  3O3T A;  3A2W A;  3WGE A;  3KIJ A;  2VCT A;  2PBJ A;  3EYT A;  2CX3 A;  2PVO C;  2PER A;  4YAV A;  4WF4 A;  3FYG A;  2P0G A;  4J57 E;  4J56 E;  1PMT A;  5KN1 A;  3CQF A;  1XW6 A;  4WKW A;  3F3R A;  4Q5F A;  2HYX A;  5J41 A;  4IJI A;  4ISD A;  3ZIT A;  2I9H A;  2DJ3 A;  1QK8 A;  3IBH A;  1AQW A;  1PSQ A;  2OKA A;  3APS A;  4K7I A;  1BQ7 A;  3IHG A;  2FD3 A;  1VF4 A;  2HRN A;  2B5X A;  4IJ3 A;  3UL3 A;  5DQS A;  4V2M A;  1NW2 A;  3KMN A;  3VFI A;  4BWS A;  1W4V A;  3QPM A;  4ZL9 A;  1FG4 A;  1RK4 A;  2ZNM A;  1HNA A;  3KTL A;  2EC4 A;  1K3O A;  1RW1 A;  1T3B A;  4L8E A;  5ECM B;  3QAV A;  2FWH A;  4POK A;  3QAG A;  5DCG A;  2HLS A;  3G7J A;  3QMX A;  2K9F A;  2QSI A;  2TRC P;  3FR9 A;  4X4J A;  2H6Z A;  4TR1 B;  4DSS A;  1OVN A;  5IQY A;  4YAP A;  1EV4 A;  3M8N A;  1JHB A;  2BTO T;  2QA1 A;  4ZIJ A;  4NPB A;  2X64 A;  3GYK A;  3L9V A;  1S3A A;  5F8B A;  2HSY A;  3TUE A;  4O32 A;  1DE2 A;  2VOC A;  4PTS A;  4PXO A;  2MMO A;  4RI7 A;  2VLV A;  4GF0 A;  1Y6E A;  4V2L A;  1T1V A;  1PA3 A;  2GTU A;  3KEB A;  4MMM A;  4PQH A;  3LQ7 A;  1XVQ A;  1MD3 A;  2XC2 A;  1R7H A;  2DSA A;  2X4A A;  3APO A;  2JZR A;  1ERU A;  2CZ2 A;  5B6M A;  1TU8 A;  3GKM A;  5AIS A;  3L4N A;  1BYE A;  2XPD A;  2IIY A;  2H71 A;  5ECK B;  1OYJ A;  1BX9 A;  2H0I A;  1XOB A;  3GL3 A;  4NMU A;  1F9M A;  1SKW B;  5HR1 A;  3GKX A;  5LCZ A;  2TIR A;  1WRY A;  4KF9 A;  4PGT A;  1F2E A;  3HY2 A;  4OMV A;  2AHE A;  3LFL A;  5DDL A;  1WWJ A;  2H1D A;  4ZBD A;  3H1N A;  1YZX A;  2CV4 A;  4ZBA A;  1U3A A;  4IP6 A;  4ZB9 A;  5LNK e;  3HD5 A;  5ECN B;  1V2A A;  1PN0 A;  3E0U A;  1SKR B;  6GSS A;  2LRT A;  1G7O A;  4USS A;  4HOJ A;  2WGR A;  2GT6 A;  3BOA A;  2VL3 A;  4Z7X A;  2KLX A;  2VCQ A;  2J23 A;  1SK1 A;  3FR6 A;  2V32 A;  3HYP A;  1PL1 A;  1Z6M A;  4KAE A;  4ECI A;  1JZO A;  1G6Y A;  2MYG A;  3FZA A;  4WET A;  4PNG A;  4HU9 A;  1XCC A;  1USB A;  3HHV A;  3KH9 A;  3L0H A;  4E8H A;  2GZP A;  3P90 A;  4TKY A;  1RQM A;  3VPT A;  3UVH A;  5IMC A;  1B4Q A;  1XWG A;  4ULX A;  2IME A;  4N0Z A;  2C4J A;  2GSR A;  2K8S A;  3RPN A;  3GHA A;  1TRU A;  5EVO A;  4Q5N A;  5ABR A;  2IFQ A;  4OFN A;  3L9U A;  2GSQ A;  18GS A;  3TKP A;  3ME7 A;  4GST A;  2B5E A;  1EOH A;  2IMK A;  4N11 A;  1KNG A;  5G2Z A;  1GTA A;  3LOR A;  3GTU A;  5AN1 A;  5CRH A;  4K7N A;  2XBI A;  4HQZ A;  4BIK A;  4WBR D;  4QL7 A;  5JCW A;  1GNW A;  2CVD A;  2DJ1 A;  5JCG A;  5IMV A;  3FZ4 A;  4IQ1 A;  3GSS A;  5HQP A;  2YZH A;  5KN3 A;  3H4K A;  3CRT A;  5A4V A;  2JL4 A;  4HU7 A;  2ALB A;  1FHE A;  4IVF A;  1M2D A;  3ZFB A;  3LG6 A;  4WEY A;  5CYY A;  2H76 A;  4BVX B;  5ECR B;  3D4T A;  5IIZ A;  4I2U A;  4MH2 A;  3VLN A;  4O7H A;  3ZIV A;  5JCU A;  3ZYW A;  3KZQ A;  5H5Q A;  1LJR A;  4Z2U A;  2GQM A;  4MDC A;  5IMA A;  5EY6 A;  4PX1 A;  1HNC A;  4NV2 A;  2OBK A;  3J7Y b;  4EF0 A;  1GH2 A;  2HSH A;  3GA4 A;  3LSZ A;  3VPQ A;  2RM5 A;  4ZXG A;  1OC9 A;  2LJR A;  1ZYQ B;  4POM A;  1URM A;  4ID0 A;  1M2A A;  1ON4 A;  1CQG A;  1F3B A;  5ELA A;  2ON5 A;  2JZT A;  2M80 A;  3TKS E;  4I2T A;  2FHE A;  4G9H A;  2HT9 A;  4FYC A;  1IYH A;  1FAA A;  4BVY A;  3ED3 A;  5GSS A;  3EC3 A;  1Z7R A;  1SJ6 A;  5B6N A;  2L5O A;  2H0G A;  2RUE A;  3EU3 A;  5DAL A;  3CXG A;  1M2B A;  4FIW A;  3FRC A;  1AUC A;  3C8E A;  3ZFL A;  1XWK A;  1DE1 A;  4KGI A;  4N10 A;  3GKN A;  1GSQ A;  3R3E A;  5COH A;  1TXX A;  1A24 A;  4XS6 A;  2VIM A;  2PMT A;  2H8L A;  1S3R A;  2IL3 A;  3FK8 A;  3MWH A;  3LGC A;  3HCZ A;  3ME8 A;  3BCI A;  1YQ1 A;  1M7T A;  2G2Q A;  4OO4 A;  4HEA 2;  5AGY A;  4ZB6 A;  4KDU A;  2HRK A;  3RHC A;  3BCK A;  1XXU A;  3Q74 A;  3ISO A;  4JE1 A;  2NVL A;  2DBC A;  4RI6 A;  2OE3 A;  5ID2 A;  2VL2 A;  3DIE A;  3F6F A;  4HQS A;  4TRX A;  3CRU A;  3GKK A;  3M3M A;  2LJK A;  1TDI A;  4EXJ A;  4XIH A;  3I43 A;  1S3D A;  1PX6 A;  1EZK A;  3EUR A;  4D73 B;  5ECO B;  2LJA A;  1ML6 A;  5IOW A;  4KB3 A;  5G1L A;  3LXZ A;  4WR5 A;  3I6A A;  5CRG A;  1ZZY A;  4K6X A;  5D9V A;  3IPZ A;  4ICY A;  2GLR A;  3TRX A;  1ERW A;  1EP7 A;  1WIK A;  3FKF A;  3Q6O A;  3RHB A;  2O7K A;  2FGX A;  3TRP A;  3PH9 A;  3IC8 A;  4F9Z A;  1JZW A;  4JED A;  4RQR A;  5A4U A;  3QFA C;  5EPF A;  1M3I A;  1SYX A;  4TXV A;  3GX0 A;  1V57 A;  3E3E A;  2YWI A;  4X0X A;  5DQY A;  4NV5 A;  4HJM A;  3KM6 A;  4O5R A;  1AQX A;  6GSY A;  5JWR B;  1DSB A;  3TKQ A;  1Y25 A;  3TKR A;  2LUS A;  1M3J A;  3C7M A;  4XRA A;  2B1L A;  3ZRE A;  2YV9 A;  3TB2 A;  3DKS A;  2VUP A;  1U6T A;  3UIW A;  4DEJ A;  3PIN A;  2O8V B;  3P8W A;  1ERT A;  2RM6 A;  4KDY A;  1ABA A;  3LWA A;  4OFT A;  3TJB A;  2F8F A;  3KH7 A;  5CRE A;  2VM1 A;  2O85 A;  5E4W A;  3IK7 A;  2H1G A;  3TGZ A;  3KTB A;  2YWM A;  2GT5 A;  1VF1 A;  3GFK A;  2GS3 A;  4CDO A;  1WP0 A;  5KEJ A;  1SD8 A;  4DSS B;  1N8J A;  2B7J A;  4POL A;  3GH6 A;  2YOI A;  2H70 A;  1I5G A;  4F03 A;  1FVK A;  5IM9 A;  2B5Y A;  2DLX A;  3IE3 A;  4BL7 B;  4EC0 A;  2GST A;  3ERW A;  3A5I A;  1GUM A;  1S3C A;  1TI1 A;  3GRX A;  1SJZ A;  2FNO A;  3G9B A;  3QOU A;  2ES7 A;  3ZMK A;  4HUA A;  5CO3 A;  4JRR A;  4K7O A;  4MK3 A;  2L6C A;  4DSQ A;  1Q4J A;  2X8G A;  4MA9 A;  6GSU A;  3TDG A;  1VF2 A;  2DJ2 A;  4GLT A;  4AJ7 A;  3CYN A;  5ECH B;  2VD0 A;  4HZ2 A;  1ERV A;  4LMW A;  4ECB A;  12GS A;  1B8X A;  4ILF A;  2F8A A;  4X43 A;  3VWU A;  3IRA A;  5DAK A;  4XS4 A;  1G0T A;  2DKI A;  3GN3 A;  3DEX A;  5D93 A;  3F4S A;  3IXR A;  3QAW A;  2VCV A;  3EIN A;  4ML1 A;  2K18 A;  1X0R A;  3QFB C;  4IN0 A;  1SL2 B;  3PR8 A;  1PFO A;  2LV3 A;  2CT6 A;  5CAX A;  1K0A A;  2DKH A;  1QMV A;  4EDY A;  4MZW A;  5F0G A;  4RQX A;  1UC7 A;  2FUG 2;  5BRT A;  1F3A A;  1GRX A;  3PPU A;  2YAN A;  3P7X A;  2AV4 A;  4DVC A;  3AY8 A;  2OA7 A;  1YJ6 A;  5J5N A;  2K6V A;  2P5R A;  2L57 A;  2YCD A;  5AIX A;  3ZLP A;  3FEU A;  2HRA A;  3DWV A;  5HFK A;  1YEP A;  4MH3 A;  3BD2 A;  1K0O A;  2WFC A;  3C1S A;  3P2A A;  2L4C A;  2FA8 A;  5G31 A;  3MDK A;  3TKS C;  1HYU A;  7GSS A;  4GQC A;  4HI7 A;  3FMW A;  2VCW A;  3VWV A;  4EO3 A;  1YF0 A;  2M46 A;  2CAQ A;  2XBQ A;  2LRC A;  5BMU A;  3HJP A;  1J9B A;  1EV9 A;  2WS2 A;  3EPT A;  3TCO A;  1X9W B;  1GSY A;  1OE7 A;  3ZTL A;  5F07 A;  3UBL A;  1A2L A;  5D9W A;  1YKA A;  2H01 A;  1T4Y A;  4JU5 A;  4TN8 A;  1GSS A;  2HRF A;  5LD0 A;  3ZIJ A;  4MF5 A;  4L5O A;  2CAI A;  3KJY A;  1PN9 A;  1WPI A;  4K0G A;  3D0Z A;  2A4V A;  2KHP A;  4IGJ A;  4LL1 B;  5J9B A;  2DJ0 A;  1FOV A;  2GSS A;  4TR3 A;  2WUL A;  1ZL9 A;  3HA9 A;  2PVQ A;  3HJM A;  3TOU A;  3KD0 A;  4MPF A;  5CNW A;  3UBK A;  1EGO A;  4KDX A;  4ZB8 A;  1OC9 B;  4YQM A;  3TOT A;  3C1R A;  3EVI A;  3H8Q A;  2ZCT A;  1ZYP A;  2N5F A;  2YJH A;  5DVB A;  2YWN A;  3NOF A;  3CMI A;  2DJJ A;  3QDN A;  3F8U A;  4KUN A;  3C71 A;  2A2P A;  4ECJ A;  1G7E A;  4L0W A;  2V6O A;  1Z3E A;  4PUA A;  4CY6 A;  3MIX A;  3DGQ A;  3WT2 A;  2H6Y A;  1SK0 A;  3UJ1 A;  5CP1 A;  4BVY B;  3D4M A;  5G30 A;  4N30 A;  3DXB A;  4TR0 A;  1O85 A;  1WOU A;  1X9M B;  2H0H A;  4FYU A;  3HVX A;  2B6M A;  3EU4 A;  1GLQ A;  3F6D A;  5J9C A;  4XHM A;  1TRS A;  1MEK A;  5CRW A;  2DML A;  3M9K A;  2J9H A;  1NHY A;  3TJG A;  4V1A p;  4N0V A;  4IS0 A;  1ZCP A;  2R3X A;  5JWQ B;  1EP8 A;  4BWQ A;  3O76 A;  2VLU A;  3D22 A;  3WT1 A;  4CHS A;  1FB6 A;  1K0B A;  2VM2 A;  4H86 A;  4IQA A;  3JCM L;  5KOW A;  2E7P A;  3ZL5 A;  4L0U A;  2C0G A;  2MMN A;  4PQ1 A;  2B3S A;  4JBB A;  2GZZ A;  14GS A;  2H6X A;  3O6T A;  1R5P A;  3ZVJ D;  3DML A;  3LJR A;  1GSD A;  2H74 A;  4TXO A;  1OC3 A;  1XPV A;  1ST9 A;  3U5R E;  2L59 A;  2R37 A;  2WRT A;  1SEN A;  3F0I A;  2B1K A;  2VD1 A;  2OAC A;  3EMP A;  2DJK A;  1XBS A;  1E6B A;  5A4W A;  2YN1 A;  2ZUP A;  4HJ2 A;  5G5F A;  2JSY A;  4MLY A;  4IKH A;  3DVW A;  2QA2 A;  3HVN A;  1QXH A;  1TRW A;  3TJF A;  3HXS A;  1J0F A;  1OKD A;  5F06 A;  1TI3 A;  2GVP A;  2C1Y A;  1LBK A;  4K2D A;  4YH2 A;  3Q18 A;  5B7C A;  4FYB A;  2YWO A;  4O5Q A;  5GAP D;  5ECQ B;  3I69 A;  4G10 A;  3G7Y A;  1U88 A;  1M9B A;  1FOH A;  1MD4 A;  3NZN A;  1PL2 A;  2D2Z A;  2GGT A;  2KP2 A;  2QKE A;  1A2J A;  1TTZ A;  20GS A;  5A5K A;  4YKG A;  3VK9 A;  2FCH A;  2JAD A;  2C80 A;  3QR6 A;  1K3L A;  2LQO A;  4GRF A;  3HZ4 A;  2BMX A;  4Q5Q A;  2AUV A;  5JWO B;  3KP9 A;  4MF6 A;  2IJY A;  1Z6N A;  3IC4 A;  2OE1 A;  2DIZ A;  5HR0 A;  4AF2 A;  4EUY A;  1XOA A;  1THX A;  3C73 A;  3CTF A;  2C3Q A;  4X1U A;  1O73 A;  4LLR A;  2L5L A;  1H75 A;  2MMZ A;  5IPG A;  3VI5 A;  2AJQ B;  2N5B A;  2HZF A;  2IN3 A;  2LRN A;  1XVW A;  5G5E A;  2LEG A;  1M9A A;  3F63 A;  3D5J A;  4OWY A;  2NBS A;  4EVM A;  1FVJ A;  4MPG A;  1ZYN A;  4IBP A;  2H19 A;  4BVX A;  3FY7 A;  4YQV A;  4POB A;  3ZML A;  2LNS A;  1Z7P A;  1BG5 A;  3RAZ A;  1AC1 A;  1A8L A;  1A2M A;  2X8H A;  2VL9 A;  4G0K A;  4P3Y B;  4MZB A;  2CVB A;  3IA1 A;  1X5E A;  1JFU A;  2OAD A;  1K0N A;  2QGV A;  5INY A;  2R4V A;  2X99 A;  2CZ3 A;  2C3T A;  1TJD A;  16GS A;  5HR2 A;  2GZY A;  3L9S A;  4ECC A;  1E2Y A;  3FW2 A;  5HFI A;  1AQV A;  5KN0 A;  9GSS A;  1JZD A;  1XWC A;  1EWX A;  5D9T A;  5KOX A;  2IPA A;  4IP1 A;  4XS4 B;  2TRX A;  2HZE A;  1MDK A;  2KUC A;  1EOG A;  2FWF A;  4Z2R A;  4KCA A;  1O81 A;  1TOF A;  3EWL A;  1M99 A;  1R26 A;  4NWY A;  3QD9 A;  4O92 A;  4ZL7 A;  4ZBB A;  3FZ9 A;  2LQQ A;  1HD2 A;  2JU5 A;  2RUF A;  6GSV A;  2ON7 A;  3Q19 A;  5FT3 A;  3SWL A;  2WZ9 A;  2V1M A;  1T7P B;  3W6G A;  1OC8 A;  4Q5R A;  3EE2 A;  4K2X A;  2QC7 A;  1B9X C;  3IHQ A;  5IOX A;  4IW9 A;  5HFG A;  3J7Y k;  2BJX A;  4J2F A;  4EDZ A;  3A5W A;  2NTO A;  1SKS B;  3TKS A;  4PUR A;  1ACV A;  4HS1 A;  4K9Z A;  3S9F A;  3DVX A;  1SYR A;  2VLT A;  3ERF A;  2YNX A;  1K0M A;  3TJK A;  1WJK A;  1BAY A;  3CSH A;  2RLI A;  2E2M A;  1XFL A;  1T4Z A;  4V1A g;  2VCX A;  3F3Q A;  4GTU A;  5G1K A;  3W8J A;  4BA7 A;  4XRD A;  3ZVJ A;  4EIQ A;  2YPM A;  4G2E A;  3DD3 A;  19GS A;  4K5S A;  5FWG A;  4IEL A;  1T8E B;  3WD6 A;  4KCE A;  2F51 A;  2H73 A;  3APQ A;  2HE3 A;  2PN8 A;  5IO0 A;  1TRV A;  1V58 A;  4KND A;  2Z9S A;  4ZL8 A;  2HNL A;  1U87 A;  5ENU A;  1IYI A;  3GIX A;  3WGX A;  2B7K A;  5J4U A;  4LL4 B;  4JR6 A;  3N9J A;  2I4A A;  5AIV A;  17GS A;  4F0B A;  2CVK A;  2O89 A;  2WDU A;  4OD7 A;  3F9U A;  4PUF C;  1ZYE A;  3H93 A;  1SU9 A;  1YF1 A;  2P31 A;  1MDI A;  3K8N A;  3M0F A;  3HVV A;  2C0E A;  5IMF A;  2LTK A;  2OE0 A;  3D6I A;  1U3I A;  11GS A;  1O8X A;  4KSO A;  1B4P A;  1AAZ A;  2MBS A;  5EL8 A;  3HVS A;  3FR3 A;  2H72 A;  4GSS A;  3A3T A;  5C04 A;  3IR4 A;  3ERG A;  1UVZ A;  5GAN D;  2FWG A;  2R6K A;  3I9V 2;  5GST A;  2LNT A;  2VO4 A;  1ZMA A;  2H1B A;  3V1W A;  3KXO A;  5L71 A;  5IMD A;  1YKC A;  2IWT A;  1MDJ A;  2NDO A;  1K0C A;  2PWJ A;  1X5C A;  1SJI A;  3LEF A;  5GZZ B;  3A2X A;  1TU7 A;  3IK9 A;  1AW9 A;  1GSE A;  2FY6 A;  4K0N A;  4BL7 A;  1QQ2 A;  1WMJ A;  4XTS A;  4TW5 A;  2PGT A;  4AJ8 A;  4G19 A;  2CQ9 A;  2FLS A;  2PPT A;  2IFQ B;  2A2S A;  2F3M A;  3GMF A;  2OJL A;  4HSC X;  4ML6 A;  3CBU A;  3GX8 A;  2H66 A;  4YKF A;  4MAB A;  2YV7 A;  4MJE A;  1ILO A;  3GTU B;  1UN2 A;  3MAK A;  3TRQ A;  1VF3 A;  4K5R A;  4A5P A;  4XS1 A;  5B8A A;  4TOP A;  3LW9 A;  4V2N A;  3VWW A;  1V9W A;  1XWB A;  1TW9 A;  1A0R P;  6GST A;  5IO2 A;  3LXT A;  1W89 A;  2M72 A;  3CSJ A;  4GWR A;  8GSS A;  1ZOF A;  2V41 A;  3E9J B;  4EIP A;  2JSZ A;  1SD9 A;  2YP6 A;  2H30 A;  1YEX A;  3A2V A;  1GUK A;  4GXZ A;  1R4W A;  2LKU A;  3DRN A;  1NHO A;  4AGS A;  4TXO B;  1B9Y C;  2C0F A;  2A2R A;  4OCF A;  2LS5 A;  2NPB A;  4WBJ A;  1H4O A;  3FZ5 A;  3PGT A;  1GTU A;  1AIU A;  3IAS 2;  3L78 A;  3IDV A;  1NSW A;  1OAZ A;  2GDR A;  3M1G A;  5ECL B;  1GL8 A;  2UZ8 A;  2JAC A;  2R0C A;  4TR1 A;  3GNJ A;  1PKW A;  2RII A;  1YDK A;  1KEB A;  1R5A A;  4EL1 A;  3MYD A;  5KN2 A;  5H5S A;  1TP9 A;  2REM A;  3N5O A;  3CTG A;  3H79 A;  4F2I A;  4OFM A;  1FO5 A;  1SK2 A;  2AB6 A;  5DAL B;  1GNE A;  3ZZX A;  5D96 A;  3HKR A;  4LMV A;  1GSU A;  3R2Q A;  1EGR A;  5DJM A;  2WJU A;  3MNG A;  4I8B A;  4K8M A;  4RUV A;  2L6D A;  4EE0 A;  1EEJ A;  2E0Q A;  2K8V A;  2MBT A;  4ZIL A;  5HR3 A;  2EIR A;  4G0I A;  3KMO A;  22GS A;  1OE8 A;  1THO A;  4NHZ A;  4XCS A;  2R2J A;  1TK5 B;  1ZGN A;  4TVE A;  6GSX A;  1HQO A;  5ELG A;  2VCZ A;  2HI7 A;  1X9S B;  2A4H A;  1LU4 A;  4Z2T A;  3F4T A;  1O8W A;  2R5G A;  4PNF A;  1OKT A;  1JLW A;  5ID2 B;  1DBY A;  3US3 A;  13GS A;  2F9S A;  3BBY A;  1VRS D;  2PU9 C;  1YY7 A;  1N2A A;  4OO5 A;  1A23 A;  1O6J A;  4ACS A;  3GUR A;  1CQH A;  3UMA A;  2GQK A;  3G7I A;  1PKZ A;  1EEM A;  4FO5 A;  4WXT A;  4KH7 A;  4I5Q A;  4CW9 A;  2V6K A;  1XWA A;  4CY8 A;  5B8B A;  1GP1 A;  4F0C A;  4OCE A;  1PD2 1;  4KX4 A;  2JZS A;  1TK8 B;  5D73 A;  3RDW A;  2YJ7 A;  1SL1 B;  2FWE A;  6GSW A;  1XW9 A;  5CRD A;  4JZQ A;  4LA1 A;  2MMA A;  3OR5 A;  4FH8 A;  4KSM A;  4E8E A;  2E2G A;  3GUS A;  5ECP B;  2KP1 A;  2O87 A;  4FQU A;  5J3R A;  3UEM A;  4MJB A;  1BED A;  1A8Y A;  1DUG A;  1AXD A;  3UOM A;  2HZE B;  2KOK A;  1Q98 A;  3KGK A;  3CSI A;  1A0F A;  1J08 A;  2R0G A;  2YZU A;  2HSM A;  1GTI A;  1GLP A;  1V98 A;  2X49 A;  3ZRD A;  1PX7 A;  2I1U A;  3QCP A;  1KTE A;  5F05 A;  1Z5Y E;  3HJO A;  1XIY A;  4NXI A;  1T00 A;  5C00 A;  3TJJ A;  1X5D A;  3IAM 2;  5DCH A;  5IPH A;  3WGD A;  2DC5 A;  4G0L A;  4GCI A;  3GL5 A;  2H75 A;  5DJL A;  2R0P A;  1VGL A;  4BPY A;  2MZC A;  2FA4 A;  2IMF A;  1FW1 A;  4TR4 A;  3UAP A;  3UVT A;  4QL9 A;  3DYR A;  4I6X A;  1MTC A;  3WYW A;  3GH9 A;  2AYT A;  3IOS A;  2CX4 A;  2WB9 A;  3GV1 A;  2X8C A;  1WE0 A;  1TKD B;  4MNN A;  4AJ6 A;  3KP8 A;  4PQI A;  3MSZ A;  4DSR A;  3D21 A;  3BJ5 A;  3M9J A;  2I3Y A;  1QFN A;  3EMX A;  4JR4 A;  1KBN A;  2V2G A;  4MCU A;  3U6V A;  4WR4 A;  3RBT A;  4QQ7 A;  1JLV A;  4HZ4 A;  2I81 A;  4EKZ A;  2IMI A;  4L5L A;  3UAR A;  2AAW A;  3KCM A; 
#chains in the Genus database with same CATH homology
 3IV4 A;  5ECI B;  2HXK A;  2GQL A;  5IMZ A;  1HNB A;  2PUK C;  3LYP A;  1QGV A;  3VWX A;  2EIQ A;  1G6W A;  1SL0 B;  5DAK B;  1F6M C;  1GWC A;  1TK0 B;  4GSN A;  1PQN A;  1Z9H A;  2LST A;  2H1A A;  4F82 A;  2CA8 A;  2XHF A;  4MZC A;  5H5R A;  2N5A A;  3RPP A;  3HDC A;  1XW5 A;  1V40 A;  1FB0 A;  4KE3 A;  5E59 A;  2OBI A;  1NM3 A;  4GQF A;  2HFD A;  5D9X A;  1UA5 A;  1K3Y A;  3LYK A;  1QUW A;  1JZR A;  4MJC A;  2L4Q A;  5ECS A;  1C72 A;  3VUR A;  3FHK A;  3NIV A;  2C3N A;  1GTB A;  5D8I A;  4KW6 A;  4KA0 A;  5DBQ A;  3HZ8 A;  2G0F A;  4I97 A;  3VI7 A;  2DIY A;  2IMD A;  2DMM A;  4MJA A;  2EIO A;  2XPE A;  5FHI A;  10GS A;  2C0D A;  4NHW A;  2P5Q A;  3F4R A;  4MF7 A;  1K0D A;  1F37 A;  3GST A;  1I9D A;  3W8S A;  4HDE A;  1XZO A;  4O5U A;  2WCI A;  4IHU A;  4WF5 A;  1M0U A;  4NAX A;  1GUH A;  1GUL A;  4K1F A;  1O7U A;  2C8U A;  4D73 A;  1B48 A;  4YQU A;  3SBC A;  1BJX A;  2VAF A;  2VL2 C;  4MP4 A;  1GSF A;  1PGT A;  1PRX A;  3O3T A;  3A2W A;  3WGE A;  3KIJ A;  2VCT A;  2PBJ A;  3EYT A;  2CX3 A;  2PVO C;  2PER A;  4YAV A;  4WF4 A;  3FYG A;  2P0G A;  4J57 E;  4J56 E;  1PMT A;  5KN1 A;  1XW6 A;  4WKW A;  3F3R A;  4Q5F A;  2HYX A;  5J41 A;  4IJI A;  4ISD A;  3ZIT A;  2I9H A;  2DJ3 A;  1QK8 A;  3IBH A;  1AQW A;  1PSQ A;  2OKA A;  3APS A;  4K7I A;  1BQ7 A;  3IHG A;  2FD3 A;  1VF4 A;  2HRN A;  2B5X A;  4IJ3 A;  3UL3 A;  5DQS A;  4V2M A;  1NW2 A;  3KMN A;  3VFI A;  4BWS A;  1W4V A;  3QPM A;  4ZL9 A;  1FG4 A;  1RK4 A;  2ZNM A;  1HNA A;  3KTL A;  2EC4 A;  1K3O A;  1RW1 A;  1T3B A;  4L8E A;  5ECM B;  3QAV A;  2FWH A;  4POK A;  3QAG A;  5DCG A;  2HLS A;  3G7J A;  3QMX A;  2K9F A;  2QSI A;  2TRC P;  3FR9 A;  4X4J A;  2H6Z A;  4TR1 B;  4DSS A;  1OVN A;  5IQY A;  4YAP A;  1EV4 A;  3M8N A;  1JHB A;  2BTO T;  2QA1 A;  4ZIJ A;  4NPB A;  2X64 A;  3GYK A;  3L9V A;  1S3A A;  5F8B A;  2HSY A;  3TUE A;  4O32 A;  1DE2 A;  2VOC A;  4PTS A;  4PXO A;  2MMO A;  4RI7 A;  2VLV A;  4GF0 A;  1Y6E A;  4V2L A;  1T1V A;  1PA3 A;  2GTU A;  3KEB A;  4MMM A;  4PQH A;  3LQ7 A;  1XVQ A;  1MD3 A;  2XC2 A;  1R7H A;  2DSA A;  2X4A A;  3APO A;  2JZR A;  1ERU A;  2CZ2 A;  5B6M A;  1TU8 A;  3GKM A;  5AIS A;  3L4N A;  1BYE A;  2XPD A;  2IIY A;  2H71 A;  5ECK B;  1OYJ A;  1BX9 A;  2H0I A;  1XOB A;  3GL3 A;  4NMU A;  1F9M A;  1SKW B;  5HR1 A;  3GKX A;  5LCZ A;  2TIR A;  1WRY A;  4KF9 A;  4PGT A;  1F2E A;  3HY2 A;  4OMV A;  2AHE A;  3LFL A;  5DDL A;  1WWJ A;  2H1D A;  4ZBD A;  3H1N A;  1YZX A;  2CV4 A;  4ZBA A;  1U3A A;  4IP6 A;  4ZB9 A;  5LNK e;  3HD5 A;  5ECN B;  1V2A A;  1PN0 A;  3E0U A;  1SKR B;  6GSS A;  2LRT A;  1G7O A;  4USS A;  4HOJ A;  2WGR A;  2GT6 A;  3BOA A;  2VL3 A;  4Z7X A;  2KLX A;  2VCQ A;  2J23 A;  1SK1 A;  3FR6 A;  2V32 A;  3HYP A;  1PL1 A;  1Z6M A;  4KAE A;  4ECI A;  1JZO A;  1G6Y A;  2MYG A;  3FZA A;  4WET A;  4PNG A;  4HU9 A;  1XCC A;  1USB A;  3HHV A;  3KH9 A;  3L0H A;  4E8H A;  2GZP A;  3P90 A;  4TKY A;  1RQM A;  3VPT A;  3UVH A;  5IMC A;  1B4Q A;  1XWG A;  4ULX A;  2IME A;  4N0Z A;  2C4J A;  2GSR A;  2K8S A;  3RPN A;  3GHA A;  1TRU A;  5EVO A;  4Q5N A;  5ABR A;  2IFQ A;  4OFN A;  3L9U A;  2GSQ A;  18GS A;  3TKP A;  3ME7 A;  4GST A;  2B5E A;  1EOH A;  2IMK A;  4N11 A;  1KNG A;  5G2Z A;  1GTA A;  3LOR A;  3GTU A;  5AN1 A;  5CRH A;  4K7N A;  2XBI A;  4HQZ A;  4WBR D;  4QL7 A;  5JCW A;  1GNW A;  2CVD A;  2DJ1 A;  5JCG A;  5IMV A;  3FZ4 A;  4IQ1 A;  3GSS A;  5HQP A;  2YZH A;  5KN3 A;  3H4K A;  3CRT A;  5A4V A;  2JL4 A;  4HU7 A;  2ALB A;  1FHE A;  4IVF A;  1M2D A;  3ZFB A;  3LG6 A;  4WEY A;  5CYY A;  2H76 A;  4BVX B;  5ECR B;  3D4T A;  5IIZ A;  4I2U A;  4MH2 A;  3VLN A;  4O7H A;  3ZIV A;  5JCU A;  3ZYW A;  3KZQ A;  5H5Q A;  1LJR A;  4Z2U A;  2GQM A;  4MDC A;  5IMA A;  5EY6 A;  4PX1 A;  1HNC A;  4NV2 A;  2OBK A;  3J7Y b;  4EF0 A;  1GH2 A;  2HSH A;  3GA4 A;  3LSZ A;  3VPQ A;  2RM5 A;  4ZXG A;  1OC9 A;  2LJR A;  1ZYQ B;  4POM A;  1URM A;  4ID0 A;  1M2A A;  1ON4 A;  1CQG A;  1F3B A;  5ELA A;  2ON5 A;  2JZT A;  2M80 A;  3TKS E;  4I2T A;  2FHE A;  4G9H A;  2HT9 A;  4FYC A;  1IYH A;  1FAA A;  4BVY A;  3ED3 A;  5GSS A;  3EC3 A;  1Z7R A;  1SJ6 A;  5B6N A;  2L5O A;  2H0G A;  2RUE A;  3EU3 A;  5DAL A;  3CXG A;  1M2B A;  4FIW A;  3FRC A;  1AUC A;  3C8E A;  3ZFL A;  1XWK A;  1DE1 A;  4KGI A;  4N10 A;  3GKN A;  1GSQ A;  3R3E A;  5COH A;  1TXX A;  1A24 A;  4XS6 A;  2VIM A;  2PMT A;  2H8L A;  2IL3 A;  3FK8 A;  3MWH A;  3LGC A;  3HCZ A;  3ME8 A;  3BCI A;  1YQ1 A;  1M7T A;  2G2Q A;  4OO4 A;  4HEA 2;  5AGY A;  4ZB6 A;  4KDU A;  2HRK A;  3RHC A;  3BCK A;  1XXU A;  3Q74 A;  3ISO A;  4JE1 A;  2NVL A;  2DBC A;  4RI6 A;  2OE3 A;  5ID2 A;  2VL2 A;  3DIE A;  3F6F A;  4HQS A;  4TRX A;  3CRU A;  3GKK A;  3M3M A;  2LJK A;  1TDI A;  4EXJ A;  4XIH A;  3I43 A;  1S3D A;  1PX6 A;  1EZK A;  3EUR A;  4D73 B;  5ECO B;  2LJA A;  1ML6 A;  5IOW A;  4KB3 A;  5G1L A;  3LXZ A;  4WR5 A;  3I6A A;  5CRG A;  1ZZY A;  4K6X A;  5D9V A;  3IPZ A;  4ICY A;  2GLR A;  3TRX A;  1ERW A;  1EP7 A;  1WIK A;  3FKF A;  3Q6O A;  3RHB A;  2O7K A;  2FGX A;  3TRP A;  3PH9 A;  3IC8 A;  4F9Z A;  1JZW A;  4JED A;  4RQR A;  5A4U A;  3QFA C;  5EPF A;  1SYX A;  4TXV A;  3GX0 A;  1V57 A;  3E3E A;  2YWI A;  4X0X A;  5DQY A;  4NV5 A;  4HJM A;  3KM6 A;  4O5R A;  1AQX A;  6GSY A;  5JWR B;  1DSB A;  3TKQ A;  1Y25 A;  3TKR A;  2LUS A;  3C7M A;  4XRA A;  2B1L A;  3ZRE A;  2YV9 A;  3TB2 A;  3DKS A;  2VUP A;  1U6T A;  3UIW A;  4DEJ A;  3PIN A;  2O8V B;  3P8W A;  1ERT A;  2RM6 A;  4KDY A;  1ABA A;  3LWA A;  4OFT A;  3TJB A;  2F8F A;  3KH7 A;  5CRE A;  2VM1 A;  2O85 A;  5E4W A;  3IK7 A;  2H1G A;  3TGZ A;  3KTB A;  2YWM A;  2GT5 A;  1VF1 A;  3GFK A;  2GS3 A;  4CDO A;  1WP0 A;  5KEJ A;  1SD8 A;  4DSS B;  1N8J A;  2B7J A;  4POL A;  3GH6 A;  2YOI A;  2H70 A;  1I5G A;  4F03 A;  1FVK A;  5IM9 A;  2B5Y A;  2DLX A;  3IE3 A;  4BL7 B;  4EC0 A;  2GST A;  3ERW A;  3A5I A;  1GUM A;  1S3C A;  1TI1 A;  3GRX A;  1SJZ A;  2FNO A;  3G9B A;  3QOU A;  2ES7 A;  3ZMK A;  4HUA A;  5CO3 A;  4JRR A;  4K7O A;  4MK3 A;  2L6C A;  4DSQ A;  1Q4J A;  2X8G A;  4MA9 A;  6GSU A;  3TDG A;  1VF2 A;  2DJ2 A;  4GLT A;  4AJ7 A;  3CYN A;  5ECH B;  2VD0 A;  4HZ2 A;  1ERV A;  4LMW A;  4ECB A;  12GS A;  1B8X A;  4ILF A;  2F8A A;  4X43 A;  3VWU A;  3IRA A;  5DAK A;  4XS4 A;  1G0T A;  2DKI A;  3GN3 A;  3DEX A;  5D93 A;  3F4S A;  3IXR A;  3QAW A;  2VCV A;  3EIN A;  4ML1 A;  2K18 A;  1X0R A;  3QFB C;  4IN0 A;  1SL2 B;  3PR8 A;  2LV3 A;  2CT6 A;  5CAX A;  1K0A A;  2DKH A;  1QMV A;  4EDY A;  4MZW A;  5F0G A;  4RQX A;  1UC7 A;  2FUG 2;  5BRT A;  1F3A A;  1GRX A;  3PPU A;  2YAN A;  3P7X A;  2AV4 A;  4DVC A;  3AY8 A;  2OA7 A;  1YJ6 A;  5J5N A;  2K6V A;  2P5R A;  2L57 A;  2YCD A;  5AIX A;  3ZLP A;  3FEU A;  2HRA A;  3DWV A;  5HFK A;  1YEP A;  4MH3 A;  3BD2 A;  1K0O A;  2WFC A;  3C1S A;  3P2A A;  2L4C A;  2FA8 A;  5G31 A;  3MDK A;  3TKS C;  1HYU A;  7GSS A;  4GQC A;  4HI7 A;  3FMW A;  2VCW A;  3VWV A;  4EO3 A;  1YF0 A;  2M46 A;  2CAQ A;  2XBQ A;  2LRC A;  5BMU A;  3HJP A;  1J9B A;  1EV9 A;  2WS2 A;  3EPT A;  3TCO A;  1X9W B;  1GSY A;  1OE7 A;  3ZTL A;  5F07 A;  3UBL A;  1A2L A;  5D9W A;  1YKA A;  2H01 A;  1T4Y A;  4JU5 A;  4TN8 A;  1GSS A;  2HRF A;  5LD0 A;  3ZIJ A;  4MF5 A;  4L5O A;  2CAI A;  3KJY A;  1PN9 A;  1WPI A;  4K0G A;  3D0Z A;  2A4V A;  2KHP A;  4IGJ A;  4LL1 B;  5J9B A;  2DJ0 A;  1FOV A;  2GSS A;  4TR3 A;  2WUL A;  1ZL9 A;  3HA9 A;  2PVQ A;  3HJM A;  3TOU A;  3KD0 A;  4MPF A;  5CNW A;  3UBK A;  1EGO A;  4KDX A;  4ZB8 A;  1OC9 B;  4YQM A;  3TOT A;  3C1R A;  3EVI A;  3H8Q A;  2ZCT A;  1ZYP A;  2N5F A;  2YJH A;  5DVB A;  2YWN A;  3NOF A;  3CMI A;  2DJJ A;  3QDN A;  3F8U A;  4KUN A;  3C71 A;  2A2P A;  4ECJ A;  1G7E A;  4L0W A;  2V6O A;  1Z3E A;  4PUA A;  4CY6 A;  3MIX A;  3DGQ A;  3WT2 A;  2H6Y A;  1SK0 A;  3UJ1 A;  5CP1 A;  4BVY B;  3D4M A;  5G30 A;  4N30 A;  3DXB A;  4TR0 A;  1O85 A;  1WOU A;  1X9M B;  2H0H A;  4FYU A;  3HVX A;  2B6M A;  3EU4 A;  1GLQ A;  3F6D A;  5J9C A;  4XHM A;  1TRS A;  1MEK A;  5CRW A;  2DML A;  3M9K A;  2J9H A;  1NHY A;  3TJG A;  4V1A p;  4N0V A;  4IS0 A;  1ZCP A;  2R3X A;  5JWQ B;  1EP8 A;  4BWQ A;  3O76 A;  2VLU A;  3D22 A;  3WT1 A;  4CHS A;  1FB6 A;  1K0B A;  2VM2 A;  4H86 A;  4IQA A;  3JCM L;  5KOW A;  2E7P A;  3ZL5 A;  4L0U A;  2C0G A;  2MMN A;  4PQ1 A;  2B3S A;  4JBB A;  2GZZ A;  14GS A;  2H6X A;  3O6T A;  1R5P A;  3ZVJ D;  3DML A;  3LJR A;  1GSD A;  2H74 A;  4TXO A;  1OC3 A;  1XPV A;  1ST9 A;  3U5R E;  2L59 A;  2R37 A;  2WRT A;  1SEN A;  3F0I A;  2B1K A;  2VD1 A;  2OAC A;  3EMP A;  2DJK A;  1XBS A;  1E6B A;  5A4W A;  2YN1 A;  2ZUP A;  4HJ2 A;  5G5F A;  2JSY A;  4MLY A;  4IKH A;  3DVW A;  2QA2 A;  1QXH A;  1TRW A;  3TJF A;  3HXS A;  1J0F A;  1OKD A;  5F06 A;  1TI3 A;  2GVP A;  2C1Y A;  1LBK A;  4K2D A;  4YH2 A;  3Q18 A;  5B7C A;  4FYB A;  2YWO A;  4O5Q A;  5GAP D;  5ECQ B;  3I69 A;  4G10 A;  3G7Y A;  1U88 A;  1M9B A;  1FOH A;  1MD4 A;  3NZN A;  1PL2 A;  2D2Z A;  2GGT A;  2KP2 A;  2QKE A;  1A2J A;  1TTZ A;  20GS A;  5A5K A;  4YKG A;  3VK9 A;  2FCH A;  2JAD A;  2C80 A;  3QR6 A;  1K3L A;  2LQO A;  4GRF A;  3HZ4 A;  2BMX A;  4Q5Q A;  2AUV A;  5JWO B;  3KP9 A;  4MF6 A;  2IJY A;  1Z6N A;  3IC4 A;  2OE1 A;  2DIZ A;  5HR0 A;  4AF2 A;  4EUY A;  1XOA A;  1THX A;  3C73 A;  3CTF A;  2C3Q A;  4X1U A;  1O73 A;  4LLR A;  2L5L A;  1H75 A;  2MMZ A;  5IPG A;  3VI5 A;  2AJQ B;  2N5B A;  2HZF A;  2IN3 A;  2LRN A;  1XVW A;  5G5E A;  2LEG A;  1M9A A;  3F63 A;  3D5J A;  4OWY A;  2NBS A;  4EVM A;  1FVJ A;  4MPG A;  1ZYN A;  4IBP A;  2H19 A;  4BVX A;  3FY7 A;  4YQV A;  4POB A;  3ZML A;  2LNS A;  1Z7P A;  1BG5 A;  3RAZ A;  1AC1 A;  1A8L A;  1A2M A;  2X8H A;  2VL9 A;  4G0K A;  4P3Y B;  4MZB A;  2CVB A;  3IA1 A;  1X5E A;  1JFU A;  2OAD A;  1K0N A;  2QGV A;  5INY A;  2R4V A;  2X99 A;  2CZ3 A;  2C3T A;  1TJD A;  16GS A;  5HR2 A;  2GZY A;  3L9S A;  4ECC A;  1E2Y A;  3FW2 A;  5HFI A;  1AQV A;  5KN0 A;  9GSS A;  1JZD A;  1XWC A;  1EWX A;  5D9T A;  5KOX A;  2IPA A;  4IP1 A;  4XS4 B;  2TRX A;  2HZE A;  1MDK A;  2KUC A;  1EOG A;  2FWF A;  4Z2R A;  4KCA A;  1O81 A;  1TOF A;  3EWL A;  1M99 A;  1R26 A;  4NWY A;  3QD9 A;  4O92 A;  4ZL7 A;  4ZBB A;  3FZ9 A;  2LQQ A;  1HD2 A;  2JU5 A;  2RUF A;  6GSV A;  2ON7 A;  3Q19 A;  5FT3 A;  3SWL A;  2WZ9 A;  2V1M A;  1T7P B;  3W6G A;  1OC8 A;  4Q5R A;  3EE2 A;  4K2X A;  2QC7 A;  1B9X C;  3IHQ A;  5IOX A;  4IW9 A;  5HFG A;  3J7Y k;  2BJX A;  4J2F A;  4EDZ A;  3A5W A;  2NTO A;  1SKS B;  3TKS A;  4PUR A;  1ACV A;  4HS1 A;  4K9Z A;  3S9F A;  3DVX A;  1SYR A;  2VLT A;  3ERF A;  2YNX A;  1K0M A;  3TJK A;  1WJK A;  1BAY A;  3CSH A;  2RLI A;  2E2M A;  1XFL A;  1T4Z A;  4V1A g;  2VCX A;  3F3Q A;  4GTU A;  5G1K A;  3W8J A;  4BA7 A;  4XRD A;  3ZVJ A;  4EIQ A;  2YPM A;  4G2E A;  3DD3 A;  19GS A;  4K5S A;  5FWG A;  4IEL A;  1T8E B;  3WD6 A;  4KCE A;  2F51 A;  2H73 A;  3APQ A;  2HE3 A;  2PN8 A;  5IO0 A;  1TRV A;  1V58 A;  4KND A;  2Z9S A;  4ZL8 A;  2HNL A;  1U87 A;  5ENU A;  1IYI A;  3GIX A;  3WGX A;  2B7K A;  5J4U A;  4LL4 B;  4JR6 A;  3N9J A;  2I4A A;  5AIV A;  17GS A;  4F0B A;  2CVK A;  2O89 A;  2WDU A;  4OD7 A;  3F9U A;  4PUF C;  1ZYE A;  3H93 A;  1SU9 A;  1YF1 A;  2P31 A;  1MDI A;  3K8N A;  3M0F A;  3HVV A;  2C0E A;  5IMF A;  2LTK A;  2OE0 A;  3D6I A;  1U3I A;  11GS A;  1O8X A;  4KSO A;  1B4P A;  1AAZ A;  2MBS A;  5EL8 A;  3HVS A;  3FR3 A;  2H72 A;  4GSS A;  3A3T A;  5C04 A;  3IR4 A;  3ERG A;  1UVZ A;  5GAN D;  2FWG A;  2R6K A;  3I9V 2;  5GST A;  2LNT A;  2VO4 A;  1ZMA A;  2H1B A;  3V1W A;  3KXO A;  5L71 A;  5IMD A;  1YKC A;  2IWT A;  1MDJ A;  2NDO A;  1K0C A;  2PWJ A;  1X5C A;  1SJI A;  3LEF A;  5GZZ B;  3A2X A;  1TU7 A;  3IK9 A;  1AW9 A;  1GSE A;  2FY6 A;  4K0N A;  4BL7 A;  1QQ2 A;  1WMJ A;  4XTS A;  4TW5 A;  2PGT A;  4AJ8 A;  4G19 A;  2CQ9 A;  2FLS A;  2PPT A;  2IFQ B;  2A2S A;  2F3M A;  3GMF A;  2OJL A;  4ML6 A;  3CBU A;  3GX8 A;  2H66 A;  4YKF A;  4MAB A;  2YV7 A;  4MJE A;  1ILO A;  3GTU B;  1UN2 A;  3MAK A;  3TRQ A;  1VF3 A;  4K5R A;  4A5P A;  4XS1 A;  5B8A A;  4TOP A;  3LW9 A;  4V2N A;  3VWW A;  1V9W A;  1XWB A;  1TW9 A;  1A0R P;  6GST A;  5IO2 A;  3LXT A;  1W89 A;  2M72 A;  3CSJ A;  4GWR A;  8GSS A;  1ZOF A;  2V41 A;  3E9J B;  4EIP A;  2JSZ A;  1SD9 A;  2YP6 A;  2H30 A;  1YEX A;  3A2V A;  1GUK A;  4GXZ A;  1R4W A;  2LKU A;  3DRN A;  1NHO A;  4AGS A;  4TXO B;  1B9Y C;  2C0F A;  2A2R A;  4OCF A;  2LS5 A;  2NPB A;  4WBJ A;  1H4O A;  3FZ5 A;  3PGT A;  1GTU A;  1AIU A;  3IAS 2;  3L78 A;  3IDV A;  1NSW A;  1OAZ A;  2GDR A;  3M1G A;  5ECL B;  1GL8 A;  2UZ8 A;  2JAC A;  2R0C A;  4TR1 A;  3GNJ A;  1PKW A;  2RII A;  1YDK A;  1KEB A;  1R5A A;  4EL1 A;  3MYD A;  5KN2 A;  5H5S A;  1TP9 A;  2REM A;  3N5O A;  3CTG A;  3H79 A;  4F2I A;  4OFM A;  1FO5 A;  1SK2 A;  2AB6 A;  5DAL B;  1GNE A;  3ZZX A;  5D96 A;  3HKR A;  4LMV A;  1GSU A;  3R2Q A;  1EGR A;  5DJM A;  2WJU A;  3MNG A;  4I8B A;  4K8M A;  4RUV A;  2L6D A;  4EE0 A;  1EEJ A;  2E0Q A;  2K8V A;  2MBT A;  4ZIL A;  5HR3 A;  2EIR A;  4G0I A;  3KMO A;  22GS A;  1OE8 A;  1THO A;  4NHZ A;  4XCS A;  2R2J A;  1TK5 B;  1ZGN A;  4TVE A;  6GSX A;  1HQO A;  5ELG A;  2VCZ A;  2HI7 A;  1X9S B;  2A4H A;  1LU4 A;  4Z2T A;  3F4T A;  1O8W A;  2R5G A;  4PNF A;  1OKT A;  1JLW A;  5ID2 B;  1DBY A;  3US3 A;  13GS A;  2F9S A;  3BBY A;  1VRS D;  2PU9 C;  1YY7 A;  1N2A A;  4OO5 A;  1A23 A;  1O6J A;  4ACS A;  3GUR A;  1CQH A;  3UMA A;  2GQK A;  3G7I A;  1PKZ A;  1EEM A;  4FO5 A;  4WXT A;  4KH7 A;  4I5Q A;  4CW9 A;  2V6K A;  1XWA A;  4CY8 A;  5B8B A;  1GP1 A;  4F0C A;  4OCE A;  1PD2 1;  4KX4 A;  2JZS A;  1TK8 B;  5D73 A;  3RDW A;  2YJ7 A;  1SL1 B;  2FWE A;  6GSW A;  1XW9 A;  5CRD A;  4JZQ A;  4LA1 A;  2MMA A;  3OR5 A;  4FH8 A;  4KSM A;  4E8E A;  2E2G A;  3GUS A;  5ECP B;  2KP1 A;  2O87 A;  4FQU A;  5J3R A;  3UEM A;  4MJB A;  1BED A;  1A8Y A;  1DUG A;  1AXD A;  3UOM A;  2HZE B;  2KOK A;  1Q98 A;  3KGK A;  3CSI A;  1A0F A;  1J08 A;  2R0G A;  2YZU A;  2HSM A;  1GTI A;  1GLP A;  1V98 A;  2X49 A;  3ZRD A;  1PX7 A;  2I1U A;  3QCP A;  1KTE A;  5F05 A;  1Z5Y E;  3HJO A;  1XIY A;  4NXI A;  1T00 A;  5C00 A;  3TJJ A;  1X5D A;  3IAM 2;  5DCH A;  5IPH A;  3WGD A;  2DC5 A;  4G0L A;  4GCI A;  3GL5 A;  2H75 A;  5DJL A;  2R0P A;  1VGL A;  4BPY A;  2MZC A;  2FA4 A;  2IMF A;  1FW1 A;  4TR4 A;  3UAP A;  3UVT A;  4QL9 A;  3DYR A;  4I6X A;  1MTC A;  3WYW A;  3GH9 A;  2AYT A;  3IOS A;  2CX4 A;  2WB9 A;  3GV1 A;  2X8C A;  1WE0 A;  1TKD B;  4MNN A;  4AJ6 A;  3KP8 A;  4PQI A;  3MSZ A;  4DSR A;  3D21 A;  3BJ5 A;  3M9J A;  2I3Y A;  1QFN A;  3EMX A;  4JR4 A;  1KBN A;  2V2G A;  4MCU A;  3U6V A;  4WR4 A;  3RBT A;  4QQ7 A;  1JLV A;  4HZ4 A;  2I81 A;  4EKZ A;  2IMI A;  4L5L A;  3UAR A;  2AAW A;  3KCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...