5HR3A

Crystal structure of thioredoxin n106a mutant
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
107
structure length
107
Chain Sequence
DKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDAALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title Structural variability of E. coli thioredoxin captured in the crystal structures of single-point mutants.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 30
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5hr3A00
2I3YA 1BG5A 4I2TA 2R3XA 4MP4A 3IC4A 1S3CA 3HXSA 4D73A 1VGLA 3GH6A 1YF1A 3O6TA 3ZIJA 2L6DA 2AV4A 4MLYA 5D9VA 2B6MA 3LFLA 1XPVA 3F6FA 5F0GA 2KHPA 3HZ4A 4ZL7A 5IOWA 4HOJA 5KEJA 2KUCA 1TDIA 4TVEA 2IFQB 5IMAA 1EP8A 4KDXA 3ERFA 2HZEB 3EMXA 1T3BA 1T4ZA 1ACVA 6GSWA 3FZ9A 2A2RA 4K9ZA 3H1NA 4K7OA 1SENA 2GQKA 1X5EA 2RUFA 1KNGA 3RBTA 4J57E 4XRDA 1B9XC 3O3TA 5IO2A 1PN9A 4LL1B 2FNOA 3GL5A 5G5EA 2L5LA 1G6WA 4CW9A 2LQOA 3ZVJD 4PX1A 4JRRA 2C0DA 1TXXA 2I81A 2MMZA 1ZYQB 4POMA 4QQ7A 3DKSA 4WETA 2A4VA 1GUKA 2L6CA 3ME8A 1T1VA 3CSIA 1GSYA 2VAFA 1WOUA 3CXGA 2PU9C 3BD2A 4JR6A 2H1AA 4KAEA 4PNGA 4YH2A 2C3QA 1FAAA 1G7OA 5GAND 3H8QA 3IAM2 2OE0A 4EUYA 2O85A 3QMXA 2DLXA 1MDKA 2OJLA 4POBA 1FVJA 1VF2A 1YY7A 4TN8A 2IFQA 4JEDA 3QAVA 4HS1A 2DIYA 1G0TA 2OBKA 2QC7A 2B1LA 4J56E 1HYUA 5KN0A 19GSA 3BCKA 3L0HA 3WGXA 2H75A 4N10A 1BAYA 4FYUA 5COHA 1SL2B 4GQFA 1XWGA 1N8JA 3P90A 3I69A 5D9WA 1TP9A 5KN2A 1VRSD 4QL9A 3GHAA 2QKEA 5ABRA 1M9AA 3MNGA 3ME7A 2LRTA 3DVWA 4ZXGA 4EC0A 1GSUA 1QGVA 3ZRDA 1USBA 2FD3A 4XS6A 1ON4A 2CQ9A 3ZL5A 4F2IA 4IQAA 4EF0A 4ZB6A 4G9HA 3UL3A 1X5CA 3L9SA 4V2MA 1EGRA 2G0FA 4IVFA 2WDUA 3A5WA 1W89A 3CSJA 1IYIA 3UVHA 6GSVA 2LNTA 10GSA 2FGXA 4MF5A 20GSA 1GTAA 3TJGA 4XS1A 2GZZA 4MDCA 3EYTA 5G31A 2FUG2 5A4UA 3D0ZA 1PA3A 3PINA 3UBKA 3I43A 4EDZA 1M7TA 4F0CA 3KTBA 4GTUA 4IELA 2F9SA 2DMLA 5CRHA 4PUAA 4NAXA 1G7EA 2IPAA 3VI5A 1U88A 1GTIA 1XBSA 5H5SA 2F51A 2ALBA 2VL3A 1OC9A 1AW9A 2C0GA 3VWXA 3L4NA 1A23A 5HFKA 4ML6A 2AHEA 2LUSA 3LJRA 5DAKB 3HKRA 1F6MC 2CAIA 5GSTA 1YEXA 2PERA 3LXZA 2M46A 4DSSB 3ISOA 3HY2A 2LQQA 4FYBA 2AJQB 2HLSA 1MD4A 3I9V2 3VWVA 4GXZA 4O32A 2V32A 1MD3A 2IMDA 1YQ1A 2NDOA 2OADA 4MZCA 3M9KA 2OBIA 4ID0A 1G6YA 2YJHA 3TKSA 4BVXA 3ZIVA 5E4WA 1R26A 3TJJA 1XW5A 1XXUA 2VCXA 2XBQA 2PN8A 1C72A 2J23A 3IXRA 1KBNA 2TRCP 4XS4B 1M2BA 3KD0A 1SKRB 3APOA 2PPTA 4G19A 4OWYA 4WEYA 2YV7A 3DIEA 3EC3A 4IW9A 3DVXA 5IPHA 2PUKC 1HD2A 1ERUA 5B6MA 3CBUA 1F3AA 3G7JA 5H5QA 2IL3A 5A4WA 1XWKA 5CRDA 1HNAA 1YEPA 4MH3A 4HDEA 2FA4A 3P7XA 5ECOB 1PGTA 1LU4A 2DJKA 4K6XA 3F9UA 3G7YA 4TXOB 5HR3A 1O81A 2VL9A 3IPZA 2YWOA 2CAQA 3DMLA 2VO4A 2VIMA 1O85A 2CZ2A 1B8XA 5CAXA 5KN1A 3F4TA 1XZOA 2X99A 1GLQA 2VCVA 4NMUA 3WYWA 4LMWA 5IMDA 2P31A 2RUEA 2GVPA 4FYCA 3UIWA 2R6KA 4GWRA 4N30A 2K18A 1BX9A 1FHEA 3UEMA 1EWXA 2MMAA 2AAWA 1R5PA 1UC7A 4K2DA 2XHFA 3F0IA 4OCEA 5LNKe 2XC2A 5IO0A 1WJKA 1KTEA 1GH2A 1SK2A 4OCFA 1O8WA 2H30A 4BA7A 1A8LA 3GYKA 1NSWA 6GSUA 3GTUA 4F0BA 2V1MA 5B6NA 5G1KA 1TU7A 2QSIA 3MAKA 5HFIA 4PNFA 4HJMA 1H75A 1AXDA 3IHQA 2GSSA 4AJ7A 2YWNA 2YPMA 1YZXA 1EV9A 2V6KA 1F2EA 2VCWA 2B3SA 6GSTA 2C1YA 3DEXA 2CT6A 3TKRA 2DJ2A 3TJBA 4OFMA 2EC4A 1O73A 4ACSA 4LA1A 3QAWA 5JCGA 3KTLA 3HZ8A 4L0WA 1XVWA 1KEBA 1O6JA 5FT3A 5AISA 5DJMA 1SK1A 1BYEA 4PUFC 5FWGA 5CP1A 1S3DA 5F8BA 5EY6A 1Q4JA 2MMOA 1XFLA 1V98A 1K0DA 4DVCA 2L59A 5G30A 2H1GA 3HVXA 1QMVA 3IK9A 3SWLA 3D5JA 4BWQA 1SJZA 2M80A 2C3TA 1TTZA 2EIRA 3RAZA 1GSEA 4GRFA 1XWAA 2LNSA 3GV1A 3H79A 4PGTA 1TI3A 4L0UA 1GTBA 5L71A 1XIYA 4H86A 4V2NA 1A2JA 3UMAA 3TOUA 5JWQB 1ERWA 4ML1A 8GSSA 3ZTLA 1SK0A 3WD6A 4XIHA 1A8YA 2IMEA 2VCTA 1Z6NA 2VD0A 2WRTA 2MZCA 1WRYA 2HFDA 3LEFA 3GKXA 3Q74A 3UOMA 1T4YA 3PR8A 3ZZXA 5ECQB 3F3QA 3S9FA 1V9WA 2JZRA 4GSTA 5HFGA 3FYGA 5AN1A 2HXKA 2B5EA 2WB9A 4EXJA 2WGRA 4ZBBA 1TRUA 4OFTA 2M72A 1GUMA 3VFIA 2F8FA 1EP7A 3APSA 3ED3A 2CX3A 12GSA 4WBRD 1ZCPA 3KZQA 3VWWA 4EL1A 2V6OA 2H72A 2PBJA 3GKKA 5CYYA 22GSA 1QUWA 4NV5A 4EDYA 1DSBA 4WF4A 2HYXA 2EIOA 4L5OA 4GSNA 5F05A 1O8XA 2BJXA 2H66A 5LD0A 5DBQA 1UVZA 1HNCA 1FB6A 1Z7PA 5KN3A 3DWVA 4I2UA 4KE3A 4K0GA 1Z7RA 3J7Yk 5C00A 4IN0A 4X0XA 2C4JA 2V2GA 1M99A 2B5YA 3QPMA 5E59A 2DC5A 2XBIA 2R4VA 1BJXA 1Y6EA 3GMFA 4POLA 4KUNA 1X9WB 3WGDA 1RK4A 1SJ6A 3A2WA 1TKDB 2E2MA 4KGIA 4JR4A 1LJRA 2OE1A 2CVBA 3L9UA 4ZL8A 1AQWA 1GLPA 3GH9A 2HZEA 2X8GA 2TIRA 1X5DA 2K6VA 4ILFA 5D96A 4OFNA 1GNEA 1YF0A 3EVIA 4ZB9A 1XWBA 2TRXA 4TR3A 3F6DA 5DALB 5D9XA 1T8EB 3TDGA 5HR2A 2L4CA 3SBCA 2H70A 2GSRA 4YAPA 11GSA 4ECCA 2IWTA 4JBBA 4GF0A 4DEJA 2VUPA 4POKA 3M0FA 3RHBA 1O7UA 1AIUA 1W4VA 3D22A 2XPDA 3QR6A 3F8UA 3EE2A 5J5NA 1ZL9A 1WIKA 2L5OA 2CX4A 4TR1B 2X8CA 1YDKA 3NZNA 4P3YB 2REMA 1QQ2A 2NBSA 4F03A 3HJOA 4TKYA 4MCUA 4IGJA 4X43A 1CQHA 2MBTA 4BL7A 1SKWB 2FWEA 3TKSE 2WS2A 2VM1A 4FIWA 1M9BA 4OD7A 2PVOC 1I5GA 3NIVA 3DRNA 2ON7A 1XCCA 1TOFA 3C8EA 1WWJA 2R37A 14GSA 2OA7A 2KOKA 2GT6A 2I1UA 1THOA 3FZ4A 5G1LA 4KB3A 4RQRA 3N5OA 2WULA 2P5QA 4KA0A 1TI1A 4PURA 1GTUA 2WFCA 5IMCA 1YKAA 1X9SB 4IQ1A 3O76A 4WKWA 1PX7A 1X0RA 5J4UA 4LL4B 1XW9A 4KH7A 1H4OA 2BTOT 2K8SA 2N5FA 4IP6A 5G2ZA 2WZ9A 4ZBDA 2H8LA 2B7JA 3FR3A 4KDUA 4LLRA 1SD9A 2GZPA 2HRNA 5ECSA 3Q19A 2H6XA 3GX0A 1PX6A 2AYTA 3QD9A 5JCWA 1FW1A 4BPYA 3TRPA 1SL0B 4G2EA 3QAGA 1TW9A 1UA5A 3CTFA 2C0EA 2JSYA 3BOAA 1A2LA 2C80A 1MDIA 3LYKA 3ZFBA 1GRXA 2H1DA 1DBYA 4HZ4A 4HI7A 2DIZA 3L78A 4E8HA 1R7HA 5JWRB 1LBKA 3F63A 3HVVA 2FHEA 2JU5A 3NOFA 3D4MA 5DVBA 4Q5NA 4K7IA 3QOUA 4KSMA 4PQHA 2XPEA 4YQMA 2YJ7A 2K9FA 2FA8A 3BBYA 3HJMA 17GSA 3AY8A 1Y25A 4I5QA 1WMJA 3KP8A 3DD3A 1SU9A 1PD21 2GTUA 3IA1A 1Z3EA 2JL4A 5ID2B 2B5XA 1K0OA 4MJAA 4YAVA 5GZZB 4MA9A 5DAKA 4JZQA 1Z5YE 3C7MA 1OAZA 1PKZA 2RM6A 1ERTA 4HEA2 4DSSA 3EURA 2LRNA 1OVNA 3TCOA 4MJBA 1K3LA 2JADA 3C1SA 1PRXA 3LG6A 3R2QA 4V1Ap 3C71A 2WJUA 4ECJA 4XCSA 2DJ1A 4YQUA 4I6XA 1HNBA 2H0IA 3FZAA 5D9TA 1BEDA 3ZVJA 1ABAA 1VF1A 4EO3A 3LXTA 3HCZA 4K7NA 4MH2A 3W8SA 2IN3A 3ZITA 1R4WA 1E6BA 3V1WA 4XS4A 4O5RA 4WR4A 1IYHA 3E0UA 3MDKA 3TRXA 3LYPA 2YANA 1DE2A 1EGOA 4NXIA 1FOVA 1NW2A 3HHVA 2R5GA 2RIIA 4V1Ag 4F9ZA 5D93A 5INYA 2B7KA 4BWSA 2GDRA 4EKZA 3ZYWA 5FHIA 2GSQA 5J9BA 4D73B 2YWMA 5AGYA 2F3MA 4GCIA 5ECIB 2PGTA 1DE1A 4L8EA 2YZHA 2WCIA 3IDVA 2HSYA 6GSSA 4TXOA 1V40A 1OYJA 5D73A 1U3AA 2IJYA 5C04A 5A4VA 1OC3A 1NHYA 2I9HA 4ZL9A 5IMFA 4Q5FA 4X1UA 5B8AA 1SYXA 1WP0A 5ENUA 3GL3A 18GSA 1QXHA 3IOSA 2L4QA 2HI7A 3QFBC 6GSXA 1XOAA 4MPFA 2GZYA 1ERVA 2H76A 2LJRA 4TR4A 1PSQA 1EEJA 4E8EA 4CDOA 2DJ0A 1EZKA 3ZFLA 1TK8B 5B8BA 3KH9A 1M2DA 3VI7A 1PMTA 3TB2A 4BVYA 1GP1A 1GWCA 4MF6A 2NVLA 3UJ1A 2E0QA 3IR4A 2YP6A 1J9BA 2HNLA 3GIXA 3EWLA 3K8NA 2C0FA 1HQOA 2P5RA 3ERWA 2VLVA 2ES7A 2BMXA 2Z9SA 4NPBA 4KCEA 4RI7A 1THXA 2N5AA 1SKSB 1V57A 1AQXA 3D21A 4KSOA 2NPBA 1TRWA 2YOIA 1A2MA 2DMMA 5A5KA 3TGZA 4ZILA 5EPFA 2X8HA 2CA8A 4ECBA 3F4RA 2DJ3A 3GSSA 4V2LA 2IMIA 2OACA 1K0NA 4TXVA 4WXTA 1XWCA 1OKTA 2C3NA 3PH9A 4MF7A 1ML6A 2VL2C 4O7HA 2GQLA 6GSYA 3FKFA 1MEKA 1I9DA 2JSZA 4HJ2A 1JLWA 4NV2A 4KCAA 2H73A 1V58A 1A0RP 2VOCA 4RI6A 2FCHA 4PQ1A 1TK5B 2J9HA 3RPNA 3EINA 2NTOA 3MWHA 1TU8A 4OO4A 4AJ6A 3GURA 1AUCA 3A2XA 1T7PB 3E3EA 2HSHA 3F4SA 2IIYA 2O8VB 3M1GA 1GL8A 1J0FA 3KP9A 2PVQA 4WR5A 2LS5A 5ECLB 3VLNA 5F06A 3RDWA 4GSSA 4JU5A 4DSQA 2V41A 4N0ZA 1DUGA 3IBHA 3LWAA 3FK8A 4XHMA 2LV3A 3FR6A 2MYGA 1OC8A 2LTKA 1F37A 1GSDA 1GSFA 3G9BA 5DCGA 5G5FA 1RW1A 1T00A 3HYPA 3GX8A 3IV4A 5DCHA 2KP1A 4KX4A 2YN1A 2IMFA 1GSQA 1JZRA 2VLTA 1AC1A 3EU4A 3HD5A 2VM2A 1MDJA 1JFUA 5IPGA 5ECMB 4AGSA 2MBSA 5D8IA 2I4AA 3LQ7A 2H71A 4FH8A 3U6VA 4AF2A 3ERGA 3N9JA 5ECPB 3CTGA 2HRFA 1B4QA 1OE7A 3HJPA 4F82A 2DBCA 3U5RE 3OR5A 1ZGNA 1S3AA 1U87A 3ZMKA 1GNWA 4HQSA 5IOXA 2A2SA 2H0GA 2LSTA 4NHWA 4N0VA 3TUEA 2O7KA 4HU7A 2ON5A 5IQYA 2GT5A 5HR1A 2HT9A 3ZMLA 3TJKA 1FVKA 3EU3A 3HA9A 5IM9A 4ZIJA 3FW2A 3ZREA 4I97A 2JACA 2CV4A 2ZNMA 3ZLPA 1X9MB 3IAS2 2EIQA 5ELAA 5LCZA 1ILOA 2LJKA 4WBJA 3FR9A 3VK9A 3D4TA 2LRCA 3M3MA 3GKMA 3UAPA 4OO5A 1ST9A 3LGCA 4AJ8A 1PL1A 4L5LA 5HQPA 3P8WA 1AAZA 1OC9B 3CMIA 1N2AA 2O89A 2FLSA 3GA4A 3IRAA 1B48A 1ZZYA 2GLRA 4PQIA 5IMVA 2VLUA 3F3RA 3J7Yb 5F07A 1K0CA 3KH7A 4K0NA 2H01A 1JHBA 2LEGA 4MK3A 2PMTA 2FWFA 2K8VA 5DQYA 7GSSA 5B7CA 2H74A 3M8NA 1U6TA 3TKQA 1B9YC 2L57A 3LORA 1M2AA 4K8MA 4RUVA 5CRWA 3C73A 2QGVA 3W6GA 3PGTA 3D6IA 1K3OA 4HZ2A 3UVTA 4I8BA 2OKAA 5CNWA 1TK0B 4ULXA 4K1FA 4KNDA 4MJCA 4IBPA 1XW6A 4Q5QA 3US3A 2H0HA 2C8UA 4QL7A 5ECNB 3IE3A 5CRGA 1WPIA 1VF3A 1RQMA 2FWGA 3CSHA 5DALA 3GUSA 1YKCA 2VCZA 4MJEA 3Q6OA 3VPQA 1ZOFA 4NHZA 3C1RA 5JWOB 1B4PA 3A3TA 3KIJA 2GQMA 3KXOA 1Z9HA 3VPTA 3QCPA 1M0UA 1E2YA 4OMVA 3RPPA 4XRAA 2AB6A 2JZTA 3I6AA 2JZSA 4IJ3A 4MMMA 2H6ZA 4YQVA 3FHKA 3QFAC 5AIVA 5IMZA 1K3YA 1TJDA 3CRTA 3A2VA 4TR1A 4JE1A 1SD8A 1OE8A 1UN2A 3LSZA 4RQXA 3UBLA 2CVDA 1AQVA 3GRXA 1JZOA 4GQCA 3G7IA 1PQNA 3WT2A 2D2ZA 5H5RA 3TRQA 2DSAA 3IK7A 4HU9A 2R2JA 4EE0A 2H6YA 2CZ3A 5J9CA 3HDCA 4DSRA 2YNXA 4LMVA 2G2QA 4O92A 16GSA 2YCDA 1FO5A 5DDLA 2RM5A 3VURA 1F9MA 3GFKA 3BCIA 3FEUA 4HUAA 4ISDA 2F8AA 3DGQA 3KM6A 4EVMA 1F3BA 2N5BA 1OKDA 3H4KA 4TRXA 3TKPA 1JZDA 4KW6A 4KDYA 3APQA 5IIZA 1Z6MA 2IMKA 1YJ6A 3GTUB 5ECHB 2RLIA 2CVKA 2H1BA 2MMNA 4WF5A 1JLVA 3CRUA 4ZB8A 3VWUA 4N11A 3GNJA 4GLTA 2FWHA 3KMNA 4MZWA 4ZBAA 2P0GA 2FY6A 3DXBA 5DJLA 1A24A 5GAPD 4MZBA 1V2AA 2VL2A 3KGKA 3FY7A 4ECIA 1K0BA 3GKNA 3KEBA 13GSA 2YZUA 5CO3A 1SYRA 4Z7XA 3BJ5A 4PXOA 1Q98A 4Q5RA 2LKUA 5EVOA 3EMPA 1VF4A 3QDNA 3DYRA 2GS3A 2E2GA 2H19A 9GSSA 3HVSA 1CQGA 3TOTA 5J3RA 3WGEA 1EOHA 1EOGA 2ZCTA 5EL8A 4IP1A 1XVQA 3CYNA 1TRSA 2AUVA 2KLXA 4TR0A 2LJAA 3KMOA 3KCMA 2YV9A 3GSTA 3W8JA 3KJYA 2X64A 4MABA 3FZ5A 1A0FA 2O87A 1PL2A 5ECRB 4FO5A 4HQZA 4IKHA 1FB0A 2GGTA 3M9JA 3UARA 4TOPA 5ID2A 4XTSA 1SL1B 3P2AA 2ZUPA 5CREA 1PKWA 1URMA 2VCQA 3RHCA 1JZWA 1BQ7A 1J08A 1MTCA 4G10A 1K0MA 3FRCA 4MPGA 5DQSA 1GUHA 4CHSA 2E7PA 1EV4A 3MSZA 3L9VA 4IJIA 1NM3A 2HZFA 1TRVA 5ELGA 3H93A 1R5AA 4J2FA 1ZMAA 3TKSC 5AIXA 2OE3A 3Q18A 3TJFA 3JCML 1SJIA 4TW5A 2B1KA 4IHUA 1QK8A 1GSSA 3E9JB 5ECKB 2HE3A 5J41A 1EEMA 5GSSA 1U3IA 3GN3A 2VD1A 1FG4A 2PWJA 2DJJA 4IS0A 1NHOA 1ZYEA 1K0AA 1QFNA 3WT1A 2GSTA 5HR0A 1WE0A 2YWIA 4NWYA 2KP2A 1XOBA 5JCUA 1GULA
chains in the Genus database with same CATH superfamily
2I3YA 1BG5A 4I2TA 2R3XA 4MP4A 3IC4A 1S3CA 3HXSA 4D73A 1VGLA 3GH6A 1YF1A 3O6TA 3ZIJA 2L6DA 2AV4A 4MLYA 5D9VA 2B6MA 3LFLA 1XPVA 3F6FA 5F0GA 2KHPA 3HZ4A 4ZL7A 5IOWA 4HOJA 5KEJA 2KUCA 1TDIA 4TVEA 2IFQB 5IMAA 1EP8A 4KDXA 3ERFA 2HZEB 3EMXA 1T3BA 1T4ZA 1ACVA 6GSWA 3FZ9A 2A2RA 4K9ZA 3H1NA 4K7OA 1SENA 2GQKA 1X5EA 2RUFA 1KNGA 3RBTA 4J57E 4XRDA 1B9XC 3O3TA 5IO2A 1PN9A 4LL1B 2FNOA 3GL5A 5G5EA 2L5LA 1G6WA 4CW9A 2LQOA 3ZVJD 4PX1A 4JRRA 2C0DA 1TXXA 2I81A 2MMZA 1ZYQB 4POMA 4QQ7A 3DKSA 4WETA 2A4VA 3MYDA 1GUKA 2L6CA 3ME8A 1T1VA 3CSIA 1GSYA 2VAFA 1WOUA 3CXGA 2PU9C 3BD2A 4JR6A 3IC8A 2H1AA 4KAEA 4PNGA 4YH2A 2C3QA 1FAAA 1G7OA 5GAND 3H8QA 3IAM2 2OE0A 4EUYA 2O85A 2DKIA 3QMXA 2DLXA 4BL7B 1MDKA 2OJLA 4POBA 1FVJA 1VF2A 1YY7A 4TN8A 2IFQA 4JEDA 3QAVA 4HS1A 2DIYA 1G0TA 2OBKA 2QC7A 2B1LA 4J56E 1HYUA 5KN0A 19GSA 3BCKA 3L0HA 3WGXA 2H75A 4N10A 1BAYA 4FYUA 5COHA 1ZYPA 1SL2B 4GQFA 1XWGA 1N8JA 4CY6A 3P90A 3I69A 5D9WA 1TP9A 4O5QA 5KN2A 1VRSD 4QL9A 3GHAA 2QKEA 5ABRA 1M9AA 3MNGA 3ME7A 2LRTA 3DVWA 4ZXGA 4EC0A 1GSUA 1QGVA 3ZRDA 1USBA 2FD3A 4XS6A 1ON4A 2CQ9A 3ZL5A 4F2IA 4IQAA 4EF0A 4ZB6A 4G9HA 3UL3A 1X5CA 3L9SA 4V2MA 1EGRA 2G0FA 4IVFA 2WDUA 3A5WA 1W89A 3CSJA 4BVXB 1IYIA 3UVHA 6GSVA 2LNTA 10GSA 2FGXA 4MF5A 20GSA 1GTAA 3TJGA 4XS1A 2GZZA 4MDCA 3EYTA 5G31A 2FUG2 5A4UA 3D0ZA 1PA3A 3PINA 3UBKA 3I43A 4EDZA 1M7TA 4F0CA 3KTBA 4GTUA 4IELA 2F9SA 2DMLA 5CRHA 4PUAA 4NAXA 1G7EA 2IPAA 3VI5A 1U88A 1GTIA 1XBSA 5H5SA 2F51A 2ALBA 2VL3A 1OC9A 1AW9A 2C0GA 3VWXA 3L4NA 3MIXA 1A23A 5HFKA 4ML6A 2AHEA 2LUSA 3LJRA 5DAKB 3HKRA 1F6MC 2CAIA 5GSTA 1YEXA 2PERA 3LXZA 2M46A 4DSSB 3ISOA 3HY2A 2LQQA 4FYBA 2AJQB 2HLSA 1MD4A 3I9V2 3VWVA 4GXZA 5KOWA 4O32A 2V32A 1MD3A 2IMDA 1YQ1A 2NDOA 2OADA 4MZCA 3M9KA 2OBIA 4ID0A 1G6YA 2YJHA 3TKSA 4BVXA 3ZIVA 5E4WA 1R26A 3TJJA 1XW5A 1XXUA 2VCXA 2XBQA 2PN8A 1C72A 2J23A 3IXRA 1KBNA 2TRCP 4XS4B 1M2BA 2DKHA 3KD0A 1SKRB 3APOA 2PPTA 4G19A 4OWYA 4WEYA 2YV7A 3DIEA 3EC3A 4IW9A 3DVXA 5IPHA 2PUKC 1HD2A 1ERUA 5B6MA 3CBUA 1F3AA 3G7JA 5H5QA 2IL3A 5A4WA 1XWKA 5CRDA 1HNAA 1YEPA 4MH3A 4HDEA 2FA4A 3P7XA 5ECOB 1PGTA 1LU4A 2DJKA 4K6XA 3F9UA 3G7YA 4TXOB 5HR3A 1O81A 2VL9A 3IPZA 2YWOA 2CAQA 3DMLA 2VO4A 2VIMA 1O85A 2CZ2A 2A2PA 1B8XA 5CAXA 5KN1A 3F4TA 1XZOA 2X99A 1GLQA 2VCVA 4NMUA 3WYWA 4LMWA 4BVYB 5IMDA 2P31A 2RUEA 2GVPA 4FYCA 3UIWA 2R6KA 4GWRA 4N30A 2K18A 1BX9A 1FHEA 3UEMA 1EWXA 2MMAA 2AAWA 1R5PA 1UC7A 4K2DA 2XHFA 3F0IA 4OCEA 5LNKe 2XC2A 1XG8A 5IO0A 1WJKA 1KTEA 1GH2A 1SK2A 4OCFA 1O8WA 2H30A 4BA7A 1A8LA 3R3EA 3GYKA 1NSWA 6GSUA 3GTUA 4F0BA 2V1MA 5B6NA 5G1KA 1TU7A 2QSIA 4KF9A 3MAKA 5HFIA 4PNFA 4HJMA 1H75A 1AXDA 3IHQA 2GSSA 4AJ7A 2YWNA 2YPMA 1YZXA 4MNNA 1EV9A 2V6KA 1F2EA 2VCWA 2B3SA 6GSTA 2C1YA 3DEXA 2CT6A 3TKRA 2DJ2A 3TJBA 4OFMA 2EC4A 1O73A 4ACSA 4LA1A 3QAWA 5JCGA 3KTLA 3HZ8A 4L0WA 1XVWA 1KEBA 1O6JA 3EPTA 5FT3A 5AISA 1M3JA 5DJMA 1SK1A 1BYEA 4PUFC 5FWGA 5CP1A 1S3DA 5F8BA 5EY6A 4K5SA 1Q4JA 2MMOA 1XFLA 1V98A 1K0DA 4DVCA 2L59A 5G30A 2H1GA 3HVXA 1QMVA 3IK9A 3SWLA 3D5JA 4BWQA 1SJZA 2M80A 2C3TA 1TTZA 2EIRA 3RAZA 1GSEA 4GRFA 1XWAA 2LNSA 3GV1A 3H79A 4PGTA 1TI3A 4L0UA 1GTBA 5L71A 1XIYA 4H86A 4V2NA 1A2JA 3UMAA 3TOUA 5JWQB 1ERWA 4ML1A 8GSSA 3ZTLA 1SK0A 3WD6A 4XIHA 1A8YA 2IMEA 2VCTA 1Z6NA 2VD0A 2WRTA 2MZCA 1WRYA 2HFDA 3LEFA 3GKXA 3Q74A 4PTSA 3UOMA 1T4YA 3PR8A 3ZZXA 5ECQB 3F3QA 3S9FA 1V9WA 2JZRA 4GSTA 5HFGA 3FYGA 5AN1A 2HXKA 2B5EA 2WB9A 4EXJA 2WGRA 4ZBBA 1TRUA 4OFTA 2M72A 1GUMA 3VFIA 2F8FA 1EP7A 3APSA 3ED3A 2CX3A 12GSA 4WBRD 1ZCPA 3KZQA 3VWWA 2R0PA 4EL1A 2V6OA 2H72A 2PBJA 3GKKA 5CYYA 22GSA 1QUWA 4NV5A 4EDYA 1DSBA 4WF4A 2HYXA 2EIOA 4L5OA 4GSNA 5F05A 1O8XA 2BJXA 2H66A 5LD0A 5DBQA 1UVZA 1HNCA 1FB6A 1Z7PA 5KN3A 3DWVA 4I2UA 4KE3A 4K0GA 1Z7RA 3J7Yk 5C00A 4IN0A 4X0XA 2C4JA 2V2GA 1M99A 2B5YA 3QPMA 5E59A 2DC5A 2XBIA 2R4VA 1BJXA 1Y6EA 3GMFA 4POLA 4KUNA 1X9WB 3WGDA 1RK4A 1SJ6A 3A2WA 1TKDB 2E2MA 4HSCX 4KGIA 4JR4A 1LJRA 2OE1A 2CVBA 3L9UA 4ZL8A 1AQWA 1GLPA 3GH9A 2HZEA 2X8GA 2TIRA 1X5DA 2K6VA 4ILFA 5D96A 4OFNA 1GNEA 1YF0A 4FQUA 3EVIA 4ZB9A 1XWBA 2TRXA 4TR3A 3F6DA 5DALB 5D9XA 1T8EB 3TDGA 5HR2A 2L4CA 3SBCA 2H70A 2GSRA 4YAPA 11GSA 4ECCA 2IWTA 4JBBA 4GF0A 4DEJA 2VUPA 4POKA 3M0FA 3RHBA 1O7UA 1AIUA 1W4VA 3D22A 2XPDA 3QR6A 3F8UA 3EE2A 5J5NA 2HRAA 1ZL9A 1WIKA 2L5OA 2CX4A 4BIKA 4TR1B 2X8CA 2A4HA 1YDKA 3NZNA 4P3YB 2REMA 1QQ2A 2NBSA 4F03A 3HJOA 4TKYA 4MCUA 4IGJA 4X43A 1CQHA 2MBTA 4BL7A 1SKWB 2FWEA 3TKSE 2WS2A 2VM1A 4FIWA 1M9BA 4OD7A 3PPUA 2PVOC 1I5GA 3NIVA 3DRNA 2ON7A 1XCCA 1TOFA 3C8EA 1WWJA 2R37A 14GSA 2OA7A 2KOKA 2GT6A 2I1UA 1THOA 3FZ4A 5G1LA 4KB3A 4RQRA 3N5OA 2WULA 2P5QA 4KA0A 1TI1A 4PURA 4G0KA 1GTUA 2WFCA 5IMCA 2HSMA 1YKAA 1X9SB 4IQ1A 3O76A 4WKWA 1PX7A 1X0RA 5J4UA 4LL4B 1XW9A 4KH7A 1H4OA 2BTOT 2K8SA 2N5FA 4IP6A 5G2ZA 2WZ9A 4ZBDA 2H8LA 2B7JA 3FR3A 4KDUA 4LLRA 1SD9A 2GZPA 2HRNA 5ECSA 3Q19A 2H6XA 3GX0A 1PX6A 2AYTA 3QD9A 5JCWA 1FW1A 4BPYA 3TRPA 1SL0B 4G2EA 3QAGA 1TW9A 1UA5A 3CTFA 2C0EA 2JSYA 3BOAA 1A2LA 2C80A 1MDIA 1S3RA 3LYKA 3ZFBA 1GRXA 2H1DA 1DBYA 4HZ4A 4HI7A 2DIZA 3L78A 4E8HA 1R7HA 5JWRB 1LBKA 3F63A 3HVVA 2FHEA 2JU5A 3NOFA 3D4MA 5DVBA 4Q5NA 4K7IA 3QOUA 4KSMA 4PQHA 2XPEA 4YQMA 2YJ7A 2K9FA 2FA8A 3BBYA 3HJMA 17GSA 3AY8A 4Z2TA 1Y25A 4I5QA 1WMJA 3KP8A 3DD3A 1SU9A 1PD21 2GTUA 3IA1A 1Z3EA 2JL4A 5ID2B 2B5XA 1K0OA 4Z2UA 2QA1A 5KOXA 4MJAA 4YAVA 5GZZB 4MA9A 5DAKA 4JZQA 1Z5YE 3C7MA 1OAZA 1PKZA 2RM6A 1ERTA 4HEA2 4DSSA 3EURA 2LRNA 1OVNA 4X4JA 3TCOA 4MJBA 1K3LA 2JADA 3C1SA 1PRXA 3LG6A 3R2QA 4V1Ap 3C71A 1ZYNA 3A5IA 1M3IA 2WJUA 4YKGA 4ECJA 4XCSA 4Z2RA 2DJ1A 4YQUA 4I6XA 1HNBA 2H0IA 3FZAA 5D9TA 1BEDA 3ZVJA 1ABAA 1VF1A 4EO3A 3LXTA 3HCZA 4K7NA 4MH2A 3W8SA 2IN3A 3ZITA 1R4WA 1E6BA 3V1WA 4XS4A 4O5RA 4WR4A 1IYHA 3E0UA 3MDKA 3TRXA 3LYPA 2YANA 1DE2A 1EGOA 4NXIA 1FOVA 1NW2A 1PN0A 3HHVA 2R5GA 2RIIA 4V1Ag 4F9ZA 5D93A 5INYA 2B7KA 4BWSA 2GDRA 4EKZA 3ZYWA 5FHIA 2GSQA 5J9BA 4D73B 2YWMA 5AGYA 2F3MA 4GCIA 5ECIB 2PGTA 1DE1A 4L8EA 2YZHA 2WCIA 3IDVA 2HSYA 6GSSA 4TXOA 1V40A 1OYJA 5D73A 1U3AA 2IJYA 5C04A 5A4VA 1OC3A 1NHYA 2I9HA 4ZL9A 5IMFA 4Q5FA 4X1UA 5B8AA 4CY8A 1SYXA 1WP0A 5ENUA 3GL3A 18GSA 1QXHA 3IOSA 2L4QA 2HI7A 3QFBC 6GSXA 1XOAA 4MPFA 2GZYA 1ERVA 2H76A 2LJRA 4TR4A 1PSQA 1EEJA 4E8EA 4CDOA 2DJ0A 1EZKA 3ZFLA 1TK8B 5B8BA 3KH9A 1M2DA 3VI7A 1PMTA 3TB2A 4BVYA 1GP1A 1GWCA 4MF6A 2NVLA 3UJ1A 2E0QA 3IR4A 2YP6A 1J9BA 2HNLA 3GIXA 3EWLA 3K8NA 2C0FA 1HQOA 2P5RA 3ERWA 2VLVA 2ES7A 2BMXA 2Z9SA 4NPBA 4KCEA 4RI7A 1THXA 2N5AA 1SKSB 1V57A 1AQXA 3D21A 4KSOA 2NPBA 1TRWA 2YOIA 1A2MA 2DMMA 5A5KA 3TGZA 4ZILA 5EPFA 2X8HA 2CA8A 4ECBA 3F4RA 2DJ3A 3GSSA 4V2LA 2IMIA 2OACA 1K0NA 4TXVA 4WXTA 1XWCA 1OKTA 2C3NA 3PH9A 4MF7A 1ML6A 2VL2C 4O7HA 2GQLA 6GSYA 3FKFA 1MEKA 1I9DA 2JSZA 4HJ2A 1JLWA 4NV2A 4KCAA 5BMUA 2H73A 1V58A 1A0RP 2VOCA 4RI6A 2FCHA 4PQ1A 1TK5B 2J9HA 3RPNA 3EINA 2NTOA 3MWHA 1TU8A 4OO4A 4AJ6A 4EIPA 3GURA 1AUCA 3A2XA 1T7PB 3E3EA 2HSHA 3F4SA 2IIYA 2O8VB 3M1GA 1GL8A 1J0FA 3KP9A 3FMWA 2PVQA 4WR5A 2LS5A 5ECLB 3VLNA 5F06A 3RDWA 4GSSA 4JU5A 4ICYA 4DSQA 2V41A 4N0ZA 1DUGA 3IBHA 2X49A 3LWAA 3FK8A 4XHMA 3CQFA 2LV3A 3FR6A 3HVNA 2MYGA 1OC8A 2LTKA 1F37A 1GSDA 1GSFA 3G9BA 5DCGA 5G5FA 1RW1A 1T00A 3HYPA 3GX8A 3IV4A 5DCHA 2KP1A 4KX4A 2YN1A 2IMFA 1GSQA 1JZRA 2VLTA 1AC1A 3EU4A 2QA2A 3HD5A 2VM2A 1MDJA 1JFUA 5IPGA 5ECMB 4AGSA 2MBSA 5D8IA 2I4AA 3LQ7A 2H71A 4FH8A 3U6VA 4AF2A 3ERGA 3N9JA 5ECPB 4USSA 3CTGA 2HRFA 1B4QA 1OE7A 3HJPA 4F82A 2DBCA 3U5RE 3OR5A 4A5PA 1ZGNA 1S3AA 1U87A 3ZMKA 1GNWA 4HQSA 5IOXA 2A2SA 2H0GA 2LSTA 4NHWA 4N0VA 3TUEA 2O7KA 4HU7A 2ON5A 5IQYA 2GT5A 5HR1A 2HT9A 3ZMLA 3TJKA 1FVKA 3EU3A 3HA9A 5IM9A 4ZIJA 2R0CA 3FW2A 2R0GA 3ZREA 4I97A 2JACA 2CV4A 2ZNMA 3ZLPA 1X9MB 3IAS2 2EIQA 5ELAA 5LCZA 1ILOA 2LJKA 4WBJA 3FR9A 3VK9A 3D4TA 2LRCA 3M3MA 4O5UA 3GKMA 3UAPA 4OO5A 1ST9A 3LGCA 4AJ8A 1PL1A 4L5LA 5HQPA 3P8WA 1AAZA 1OC9B 3CMIA 1N2AA 2O89A 2FLSA 3GA4A 3IRAA 1B48A 1ZZYA 2GLRA 4PQIA 5IMVA 2VLUA 3F3RA 3J7Yb 5F07A 1K0CA 3KH7A 4K0NA 2H01A 1JHBA 2LEGA 4MK3A 2PMTA 4EIQA 2FWFA 2K8VA 5DQYA 7GSSA 5B7CA 2H74A 3M8NA 2HRKA 1U6TA 3TKQA 1B9YC 2L57A 3LORA 1M2AA 4K8MA 4RUVA 5CRWA 3C73A 2QGVA 3W6GA 3PGTA 3D6IA 1K3OA 4HZ2A 3UVTA 4I8BA 2OKAA 5CNWA 1TK0B 4ULXA 4K1FA 4KNDA 4MJCA 4IBPA 1XW6A 4Q5QA 3US3A 2H0HA 2C8UA 4QL7A 5ECNB 3IE3A 5CRGA 1WPIA 1VF3A 1RQMA 2FWGA 3CSHA 3IHGA 5DALA 3GUSA 1YKCA 2VCZA 4MJEA 3Q6OA 3VPQA 1ZOFA 4NHZA 3C1RA 5JWOB 1B4PA 3A3TA 3KIJA 2GQMA 3KXOA 1Z9HA 3VPTA 3QCPA 1M0UA 1E2YA 4OMVA 3RPPA 4XRAA 2AB6A 2JZTA 3I6AA 2JZSA 4IJ3A 4MMMA 2H6ZA 4YQVA 3FHKA 3QFAC 5AIVA 5IMZA 1K3YA 1TJDA 3CRTA 3A2VA 4TR1A 4JE1A 1SD8A 1OE8A 1UN2A 3LSZA 4RQXA 4YKFA 3UBLA 3LW9A 2CVDA 1AQVA 3GRXA 1JZOA 4GQCA 3G7IA 1PQNA 3WT2A 1FOHA 2D2ZA 5H5RA 4G0IA 3TRQA 2DSAA 3IK7A 4HU9A 2R2JA 4EE0A 2H6YA 2CZ3A 5J9CA 3HDCA 4DSRA 2YNXA 4LMVA 2G2QA 4O92A 16GSA 2YCDA 1FO5A 5DDLA 2RM5A 3VURA 1F9MA 3GFKA 3BCIA 3FEUA 4HUAA 4ISDA 2F8AA 4K2XA 3DGQA 3KM6A 4EVMA 1F3BA 2N5BA 1OKDA 3H4KA 4TRXA 3TKPA 1JZDA 4KW6A 4KDYA 3APQA 5IIZA 1Z6MA 2IMKA 1YJ6A 3GTUB 5ECHB 2RLIA 2CVKA 2H1BA 2MMNA 4WF5A 1JLVA 3CRUA 4ZB8A 3VWUA 4N11A 3GNJA 4GLTA 2FWHA 3KMNA 4MZWA 4ZBAA 2P0GA 2FY6A 3DXBA 5DJLA 1A24A 4G0LA 5GAPD 4MZBA 1V2AA 2VL2A 3KGKA 3FY7A 4ECIA 1K0BA 3GKNA 3KEBA 13GSA 2YZUA 5CO3A 1SYRA 4Z7XA 3BJ5A 1PFOA 4PXOA 1Q98A 4Q5RA 2LKUA 5EVOA 3EMPA 1VF4A 3QDNA 3DYRA 2GS3A 2E2GA 2H19A 9GSSA 2X4AA 3HVSA 1CQGA 3TOTA 5J3RA 3WGEA 1EOHA 1EOGA 2ZCTA 5EL8A 4IP1A 1XVQA 3CYNA 1TRSA 2AUVA 2KLXA 4TR0A 2LJAA 3KMOA 3KCMA 2YV9A 3GSTA 5BRTA 3W8JA 3KJYA 2X64A 4MABA 3FZ5A 1A0FA 2O87A 1PL2A 5ECRB 4FO5A 4HQZA 4IKHA 1FB0A 2GGTA 3M9JA 3UARA 4TOPA 5ID2A 4K5RA 4XTSA 1SL1B 3P2AA 2ZUPA 5CREA 1PKWA 1URMA 2VCQA 3RHCA 1JZWA 1BQ7A 1J08A 1MTCA 4G10A 1K0MA 3FRCA 4MPGA 5DQSA 1GUHA 4CHSA 2E7PA 1EV4A 3MSZA 3L9VA 4IJIA 1NM3A 2HZFA 1TRVA 5ELGA 3H93A 1R5AA 4J2FA 1ZMAA 3TKSC 5AIXA 2OE3A 3Q18A 3TJFA 3JCML 1SJIA 4TW5A 2B1KA 4IHUA 1QK8A 1GSSA 3E9JB 5ECKB 2HE3A 5J41A 1EEMA 5GSSA 1U3IA 3GN3A 2VD1A 1FG4A 2PWJA 2DJJA 2UZ8A 4IS0A 1NHOA 1ZYEA 1K0AA 1QFNA 3WT1A 2GSTA 5HR0A 1WE0A 2YWIA 4NWYA 2KP2A 1XOBA 5JCUA 1GULA
chains in the Genus database with same CATH topology
2I3YA 1BG5A 4I2TA 2R3XA 4MP4A 3IC4A 1S3CA 3HXSA 4D73A 1VGLA 3GH6A 1YF1A 3O6TA 3ZIJA 2L6DA 2AV4A 4MLYA 5D9VA 2B6MA 3LFLA 1XPVA 3F6FA 5F0GA 2KHPA 3HZ4A 4ZL7A 5IOWA 4HOJA 5KEJA 2KUCA 1TDIA 4TVEA 2IFQB 5IMAA 1EP8A 4KDXA 3ERFA 2HZEB 3EMXA 1T3BA 1T4ZA 1ACVA 6GSWA 3FZ9A 2A2RA 4K9ZA 3H1NA 4K7OA 1SENA 2GQKA 1X5EA 2RUFA 1KNGA 3RBTA 4J57E 4XRDA 1B9XC 3O3TA 5IO2A 1PN9A 4LL1B 2FNOA 3GL5A 5G5EA 2L5LA 1G6WA 4CW9A 2LQOA 3ZVJD 4PX1A 4JRRA 2C0DA 1TXXA 2I81A 2MMZA 1ZYQB 4POMA 4QQ7A 3DKSA 4WETA 2A4VA 3MYDA 1GUKA 2L6CA 3ME8A 1T1VA 3CSIA 1GSYA 2VAFA 1WOUA 3CXGA 2PU9C 3BD2A 4JR6A 3IC8A 2H1AA 4KAEA 4PNGA 4YH2A 2C3QA 1FAAA 1G7OA 5GAND 3H8QA 3IAM2 2OE0A 4EUYA 2O85A 2DKIA 3QMXA 2DLXA 4BL7B 1MDKA 2OJLA 4POBA 1FVJA 1VF2A 1YY7A 4TN8A 2IFQA 4JEDA 3QAVA 4HS1A 2DIYA 1G0TA 2OBKA 2QC7A 2B1LA 4J56E 1HYUA 5KN0A 19GSA 3BCKA 3L0HA 3WGXA 2H75A 4N10A 1BAYA 4FYUA 5COHA 1ZYPA 1SL2B 4GQFA 1XWGA 1N8JA 4CY6A 3P90A 3I69A 5D9WA 1TP9A 4O5QA 5KN2A 1VRSD 4QL9A 3GHAA 2QKEA 5ABRA 1M9AA 3MNGA 3ME7A 2LRTA 3DVWA 4ZXGA 4EC0A 1GSUA 1QGVA 3ZRDA 1USBA 2FD3A 4XS6A 1ON4A 2CQ9A 3ZL5A 4F2IA 4IQAA 4EF0A 4ZB6A 4G9HA 3UL3A 1X5CA 3L9SA 4V2MA 1EGRA 2G0FA 4IVFA 2WDUA 3A5WA 1W89A 3CSJA 4BVXB 1IYIA 3UVHA 6GSVA 2LNTA 10GSA 2FGXA 4MF5A 20GSA 1GTAA 3TJGA 4XS1A 2GZZA 4MDCA 3EYTA 5G31A 2FUG2 5A4UA 3D0ZA 1PA3A 3PINA 3UBKA 3I43A 4EDZA 1M7TA 4F0CA 3KTBA 4GTUA 4IELA 2F9SA 2DMLA 5CRHA 4PUAA 4NAXA 1G7EA 2IPAA 3VI5A 1U88A 1GTIA 1XBSA 5H5SA 2F51A 2ALBA 2VL3A 1OC9A 1AW9A 2C0GA 3VWXA 3L4NA 3MIXA 1A23A 5HFKA 4ML6A 2AHEA 2LUSA 3LJRA 5DAKB 3HKRA 1F6MC 2CAIA 5GSTA 1YEXA 2PERA 3LXZA 2M46A 4DSSB 3ISOA 3HY2A 2LQQA 4FYBA 2AJQB 2HLSA 1MD4A 3I9V2 3VWVA 4GXZA 5KOWA 4O32A 2V32A 1MD3A 2IMDA 1YQ1A 2NDOA 2OADA 4MZCA 3M9KA 2OBIA 4ID0A 1G6YA 2YJHA 3TKSA 4BVXA 3ZIVA 5E4WA 1R26A 3TJJA 1XW5A 1XXUA 2VCXA 2XBQA 2PN8A 1C72A 2J23A 3IXRA 1KBNA 2TRCP 4XS4B 1M2BA 2DKHA 3KD0A 1SKRB 3APOA 2PPTA 4G19A 4OWYA 4WEYA 2YV7A 3DIEA 3EC3A 4IW9A 3DVXA 5IPHA 2PUKC 1HD2A 1ERUA 5B6MA 3CBUA 1F3AA 3G7JA 5H5QA 2IL3A 5A4WA 1XWKA 5CRDA 1HNAA 1YEPA 4MH3A 4HDEA 2FA4A 3P7XA 5ECOB 1PGTA 1LU4A 2DJKA 4K6XA 3F9UA 3G7YA 4TXOB 5HR3A 1O81A 2VL9A 3IPZA 2YWOA 2CAQA 3DMLA 2VO4A 2VIMA 1O85A 2CZ2A 2A2PA 1B8XA 5CAXA 5KN1A 3F4TA 1XZOA 2X99A 1GLQA 2VCVA 4NMUA 3WYWA 4LMWA 4BVYB 5IMDA 2P31A 2RUEA 2GVPA 4FYCA 3UIWA 2R6KA 4GWRA 4N30A 2K18A 1BX9A 1FHEA 3UEMA 1EWXA 2MMAA 2AAWA 1R5PA 1UC7A 4K2DA 2XHFA 3F0IA 4OCEA 5LNKe 2XC2A 5IO0A 1WJKA 1KTEA 1GH2A 1SK2A 4OCFA 1O8WA 2H30A 4BA7A 1A8LA 3R3EA 3GYKA 1NSWA 6GSUA 3GTUA 4F0BA 2V1MA 5B6NA 5G1KA 1TU7A 2QSIA 4KF9A 3MAKA 5HFIA 4PNFA 4HJMA 1H75A 1AXDA 3IHQA 2GSSA 4AJ7A 2YWNA 2YPMA 1YZXA 4MNNA 1EV9A 2V6KA 1F2EA 2VCWA 2B3SA 6GSTA 2C1YA 3DEXA 2CT6A 3TKRA 2DJ2A 3TJBA 4OFMA 2EC4A 1O73A 4ACSA 4LA1A 3QAWA 5JCGA 3KTLA 3HZ8A 4L0WA 1XVWA 1KEBA 1O6JA 3EPTA 5FT3A 5AISA 5DJMA 1SK1A 1BYEA 4PUFC 5FWGA 5CP1A 1S3DA 5F8BA 5EY6A 4K5SA 1Q4JA 2MMOA 1XFLA 1V98A 1K0DA 4DVCA 2L59A 5G30A 2H1GA 3HVXA 1QMVA 3IK9A 3SWLA 3D5JA 4BWQA 1SJZA 2M80A 2C3TA 1TTZA 2EIRA 3RAZA 1GSEA 4GRFA 1XWAA 2LNSA 3GV1A 3H79A 4PGTA 1TI3A 4L0UA 1GTBA 5L71A 1XIYA 4H86A 4V2NA 1A2JA 3UMAA 3TOUA 5JWQB 1ERWA 4ML1A 8GSSA 3ZTLA 1SK0A 3WD6A 4XIHA 1A8YA 2IMEA 2VCTA 1Z6NA 2VD0A 2WRTA 2MZCA 1WRYA 2HFDA 3LEFA 3GKXA 3Q74A 4PTSA 3UOMA 1T4YA 3PR8A 3ZZXA 5ECQB 3F3QA 3S9FA 1V9WA 2JZRA 4GSTA 5HFGA 3FYGA 5AN1A 2HXKA 2B5EA 2WB9A 4EXJA 2WGRA 4ZBBA 1TRUA 4OFTA 2M72A 1GUMA 3VFIA 2F8FA 1EP7A 3APSA 3ED3A 2CX3A 12GSA 4WBRD 1ZCPA 3KZQA 3VWWA 2R0PA 4EL1A 2V6OA 2H72A 2PBJA 3GKKA 5CYYA 22GSA 1QUWA 4NV5A 4EDYA 1DSBA 4WF4A 2HYXA 2EIOA 4L5OA 4GSNA 5F05A 1O8XA 2BJXA 2H66A 5LD0A 5DBQA 1UVZA 1HNCA 1FB6A 1Z7PA 5KN3A 3DWVA 4I2UA 4KE3A 4K0GA 1Z7RA 3J7Yk 5C00A 4IN0A 4X0XA 2C4JA 2V2GA 1M99A 2B5YA 3QPMA 5E59A 2DC5A 2XBIA 2R4VA 1BJXA 1Y6EA 3GMFA 4POLA 4KUNA 1X9WB 3WGDA 1RK4A 1SJ6A 3A2WA 1TKDB 2E2MA 4KGIA 4JR4A 1LJRA 2OE1A 2CVBA 3L9UA 4ZL8A 1AQWA 1GLPA 3GH9A 2HZEA 2X8GA 2TIRA 1X5DA 2K6VA 4ILFA 5D96A 4OFNA 1GNEA 1YF0A 4FQUA 3EVIA 4ZB9A 1XWBA 2TRXA 4TR3A 3F6DA 5DALB 5D9XA 1T8EB 3TDGA 5HR2A 2L4CA 3SBCA 2H70A 2GSRA 4YAPA 11GSA 4ECCA 2IWTA 4JBBA 4GF0A 4DEJA 2VUPA 4POKA 3M0FA 3RHBA 1O7UA 1AIUA 1W4VA 3D22A 2XPDA 3QR6A 3F8UA 3EE2A 5J5NA 2HRAA 1ZL9A 1WIKA 2L5OA 2CX4A 4TR1B 2X8CA 2A4HA 1YDKA 3NZNA 4P3YB 2REMA 1QQ2A 2NBSA 4F03A 3HJOA 4TKYA 4MCUA 4IGJA 4X43A 1CQHA 2MBTA 4BL7A 1SKWB 2FWEA 3TKSE 2WS2A 2VM1A 4FIWA 1M9BA 4OD7A 3PPUA 2PVOC 1I5GA 3NIVA 3DRNA 2ON7A 1XCCA 1TOFA 3C8EA 1WWJA 2R37A 14GSA 2OA7A 2KOKA 2GT6A 2I1UA 1THOA 3FZ4A 5G1LA 4KB3A 4RQRA 3N5OA 2WULA 2P5QA 4KA0A 1TI1A 4PURA 4G0KA 1GTUA 2WFCA 5IMCA 2HSMA 1YKAA 1X9SB 4IQ1A 3O76A 4WKWA 1PX7A 1X0RA 5J4UA 4LL4B 1XW9A 4KH7A 1H4OA 2BTOT 2K8SA 2N5FA 4IP6A 5G2ZA 2WZ9A 4ZBDA 2H8LA 2B7JA 3FR3A 4KDUA 4LLRA 1SD9A 2GZPA 2HRNA 5ECSA 3Q19A 2H6XA 3GX0A 1PX6A 2AYTA 3QD9A 5JCWA 1FW1A 4BPYA 3TRPA 1SL0B 4G2EA 3QAGA 1TW9A 1UA5A 3CTFA 2C0EA 2JSYA 3BOAA 1A2LA 2C80A 1MDIA 3LYKA 3ZFBA 1GRXA 2H1DA 1DBYA 4HZ4A 4HI7A 2DIZA 3L78A 4E8HA 1R7HA 5JWRB 1LBKA 3F63A 3HVVA 2FHEA 2JU5A 3NOFA 3D4MA 5DVBA 4Q5NA 4K7IA 3QOUA 4KSMA 4PQHA 2XPEA 4YQMA 2YJ7A 2K9FA 2FA8A 3BBYA 3HJMA 17GSA 3AY8A 4Z2TA 1Y25A 4I5QA 1WMJA 3KP8A 3DD3A 1SU9A 1PD21 2GTUA 3IA1A 1Z3EA 2JL4A 5ID2B 2B5XA 1K0OA 4Z2UA 2QA1A 5KOXA 4MJAA 4YAVA 5GZZB 4MA9A 5DAKA 4JZQA 1Z5YE 3C7MA 1OAZA 1PKZA 2RM6A 1ERTA 4HEA2 4DSSA 3EURA 2LRNA 1OVNA 4X4JA 3TCOA 4MJBA 1K3LA 2JADA 3C1SA 1PRXA 3LG6A 3R2QA 4V1Ap 3C71A 1ZYNA 3A5IA 2WJUA 4YKGA 4ECJA 4XCSA 4Z2RA 2DJ1A 4YQUA 4I6XA 1HNBA 2H0IA 3FZAA 5D9TA 1BEDA 3ZVJA 1ABAA 1VF1A 4EO3A 3LXTA 3HCZA 4K7NA 4MH2A 3W8SA 2IN3A 3ZITA 1R4WA 1E6BA 3V1WA 4XS4A 4O5RA 4WR4A 1IYHA 3E0UA 3MDKA 3TRXA 3LYPA 2YANA 1DE2A 1EGOA 4NXIA 1FOVA 1NW2A 1PN0A 3HHVA 2R5GA 2RIIA 4V1Ag 4F9ZA 5D93A 5INYA 2B7KA 4BWSA 2GDRA 4EKZA 3ZYWA 5FHIA 2GSQA 5J9BA 4D73B 2YWMA 5AGYA 2F3MA 4GCIA 5ECIB 2PGTA 1DE1A 4L8EA 2YZHA 2WCIA 3IDVA 2HSYA 6GSSA 4TXOA 1V40A 1OYJA 5D73A 1U3AA 2IJYA 5C04A 5A4VA 1OC3A 1NHYA 2I9HA 4ZL9A 5IMFA 4Q5FA 4X1UA 5B8AA 4CY8A 1SYXA 1WP0A 5ENUA 3GL3A 18GSA 1QXHA 3IOSA 2L4QA 2HI7A 3QFBC 6GSXA 1XOAA 4MPFA 2GZYA 1ERVA 2H76A 2LJRA 4TR4A 1PSQA 1EEJA 4E8EA 4CDOA 2DJ0A 1EZKA 3ZFLA 1TK8B 5B8BA 3KH9A 1M2DA 3VI7A 1PMTA 3TB2A 4BVYA 1GP1A 1GWCA 4MF6A 2NVLA 3UJ1A 2E0QA 3IR4A 2YP6A 1J9BA 2HNLA 3GIXA 3EWLA 3K8NA 2C0FA 1HQOA 2P5RA 3ERWA 2VLVA 2ES7A 2BMXA 2Z9SA 4NPBA 4KCEA 4RI7A 1THXA 2N5AA 1SKSB 1V57A 1AQXA 3D21A 4KSOA 2NPBA 1TRWA 2YOIA 1A2MA 2DMMA 5A5KA 3TGZA 4ZILA 5EPFA 2X8HA 2CA8A 4ECBA 3F4RA 2DJ3A 3GSSA 4V2LA 2IMIA 2OACA 1K0NA 4TXVA 4WXTA 1XWCA 1OKTA 2C3NA 3PH9A 4MF7A 1ML6A 2VL2C 4O7HA 2GQLA 6GSYA 3FKFA 1MEKA 1I9DA 2JSZA 4HJ2A 1JLWA 4NV2A 4KCAA 5BMUA 2H73A 1V58A 1A0RP 2VOCA 4RI6A 2FCHA 4PQ1A 1TK5B 2J9HA 3RPNA 3EINA 2NTOA 3MWHA 1TU8A 4OO4A 4AJ6A 4EIPA 3GURA 1AUCA 3A2XA 1T7PB 3E3EA 2HSHA 3F4SA 2IIYA 2O8VB 3M1GA 1GL8A 1J0FA 3KP9A 3FMWA 2PVQA 4WR5A 2LS5A 5ECLB 3VLNA 5F06A 3RDWA 4GSSA 4JU5A 4ICYA 4DSQA 2V41A 4N0ZA 1DUGA 3IBHA 2X49A 3LWAA 3FK8A 4XHMA 2LV3A 3FR6A 2MYGA 1OC8A 2LTKA 1F37A 1GSDA 1GSFA 3G9BA 5DCGA 5G5FA 1RW1A 1T00A 3HYPA 3GX8A 3IV4A 5DCHA 2KP1A 4KX4A 2YN1A 2IMFA 1GSQA 1JZRA 2VLTA 1AC1A 3EU4A 2QA2A 3HD5A 2VM2A 1MDJA 1JFUA 5IPGA 5ECMB 4AGSA 2MBSA 5D8IA 2I4AA 3LQ7A 2H71A 4FH8A 3U6VA 4AF2A 3ERGA 3N9JA 5ECPB 4USSA 3CTGA 2HRFA 1B4QA 1OE7A 3HJPA 4F82A 2DBCA 3U5RE 3OR5A 4A5PA 1ZGNA 1S3AA 1U87A 3ZMKA 1GNWA 4HQSA 5IOXA 2A2SA 2H0GA 2LSTA 4NHWA 4N0VA 3TUEA 2O7KA 4HU7A 2ON5A 5IQYA 2GT5A 5HR1A 2HT9A 3ZMLA 3TJKA 1FVKA 3EU3A 3HA9A 5IM9A 4ZIJA 2R0CA 3FW2A 2R0GA 3ZREA 4I97A 2JACA 2CV4A 2ZNMA 3ZLPA 1X9MB 3IAS2 2EIQA 5ELAA 5LCZA 1ILOA 2LJKA 4WBJA 3FR9A 3VK9A 3D4TA 2LRCA 3M3MA 4O5UA 3GKMA 3UAPA 4OO5A 1ST9A 3LGCA 4AJ8A 1PL1A 4L5LA 5HQPA 3P8WA 1AAZA 1OC9B 3CMIA 1N2AA 2O89A 2FLSA 3GA4A 3IRAA 1B48A 1ZZYA 2GLRA 4PQIA 5IMVA 2VLUA 3F3RA 3J7Yb 5F07A 1K0CA 3KH7A 4K0NA 2H01A 1JHBA 2LEGA 4MK3A 2PMTA 4EIQA 2FWFA 2K8VA 5DQYA 7GSSA 5B7CA 2H74A 3M8NA 2HRKA 1U6TA 3TKQA 1B9YC 2L57A 3LORA 1M2AA 4K8MA 4RUVA 5CRWA 3C73A 2QGVA 3W6GA 3PGTA 3D6IA 1K3OA 4HZ2A 3UVTA 4I8BA 2OKAA 5CNWA 1TK0B 4ULXA 4K1FA 4KNDA 4MJCA 4IBPA 1XW6A 4Q5QA 3US3A 2H0HA 2C8UA 4QL7A 5ECNB 3IE3A 5CRGA 1WPIA 1VF3A 1RQMA 2FWGA 3CSHA 3IHGA 5DALA 3GUSA 1YKCA 2VCZA 4MJEA 3Q6OA 3VPQA 1ZOFA 4NHZA 3C1RA 5JWOB 1B4PA 3A3TA 3KIJA 2GQMA 3KXOA 1Z9HA 3VPTA 3QCPA 1M0UA 1E2YA 4OMVA 3RPPA 4XRAA 2AB6A 2JZTA 3I6AA 2JZSA 4IJ3A 4MMMA 2H6ZA 4YQVA 3FHKA 3QFAC 5AIVA 5IMZA 1K3YA 1TJDA 3CRTA 3A2VA 4TR1A 4JE1A 1SD8A 1OE8A 1UN2A 3LSZA 4RQXA 4YKFA 3UBLA 3LW9A 2CVDA 1AQVA 3GRXA 1JZOA 4GQCA 3G7IA 1PQNA 3WT2A 1FOHA 2D2ZA 5H5RA 4G0IA 3TRQA 2DSAA 3IK7A 4HU9A 2R2JA 4EE0A 2H6YA 2CZ3A 5J9CA 3HDCA 4DSRA 2YNXA 4LMVA 2G2QA 4O92A 16GSA 2YCDA 1FO5A 5DDLA 2RM5A 3VURA 1F9MA 3GFKA 3BCIA 3FEUA 4HUAA 4ISDA 2F8AA 4K2XA 3DGQA 3KM6A 4EVMA 1F3BA 2N5BA 1OKDA 3H4KA 4TRXA 3TKPA 1JZDA 4KW6A 4KDYA 3APQA 5IIZA 1Z6MA 2IMKA 1YJ6A 3GTUB 5ECHB 2RLIA 2CVKA 2H1BA 2MMNA 4WF5A 1JLVA 3CRUA 4ZB8A 3VWUA 4N11A 3GNJA 4GLTA 2FWHA 3KMNA 4MZWA 4ZBAA 2P0GA 2FY6A 3DXBA 5DJLA 1A24A 4G0LA 5GAPD 4MZBA 1V2AA 2VL2A 3KGKA 3FY7A 4ECIA 1K0BA 3GKNA 3KEBA 13GSA 2YZUA 5CO3A 1SYRA 4Z7XA 3BJ5A 4PXOA 1Q98A 4Q5RA 2LKUA 5EVOA 3EMPA 1VF4A 3QDNA 3DYRA 2GS3A 2E2GA 2H19A 9GSSA 2X4AA 3HVSA 1CQGA 3TOTA 5J3RA 3WGEA 1EOHA 1EOGA 2ZCTA 5EL8A 4IP1A 1XVQA 3CYNA 1TRSA 2AUVA 2KLXA 4TR0A 2LJAA 3KMOA 3KCMA 2YV9A 3GSTA 5BRTA 3W8JA 3KJYA 2X64A 4MABA 3FZ5A 1A0FA 2O87A 1PL2A 5ECRB 4FO5A 4HQZA 4IKHA 1FB0A 2GGTA 3M9JA 3UARA 4TOPA 5ID2A 4K5RA 4XTSA 1SL1B 3P2AA 2ZUPA 5CREA 1PKWA 1URMA 2VCQA 3RHCA 1JZWA 1BQ7A 1J08A 1MTCA 4G10A 1K0MA 3FRCA 4MPGA 5DQSA 1GUHA 4CHSA 2E7PA 1EV4A 3MSZA 3L9VA 4IJIA 1NM3A 2HZFA 1TRVA 5ELGA 3H93A 1R5AA 4J2FA 1ZMAA 3TKSC 5AIXA 2OE3A 3Q18A 3TJFA 3JCML 1SJIA 4TW5A 2B1KA 4IHUA 1QK8A 1GSSA 3E9JB 5ECKB 2HE3A 5J41A 1EEMA 5GSSA 1U3IA 3GN3A 2VD1A 1FG4A 2PWJA 2DJJA 2UZ8A 4IS0A 1NHOA 1ZYEA 1K0AA 1QFNA 3WT1A 2GSTA 5HR0A 1WE0A 2YWIA 4NWYA 2KP2A 1XOBA 5JCUA 1GULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I3Y A;  1BG5 A;  4I2T A;  2R3X A;  4MP4 A;  3IC4 A;  1S3C A;  3HXS A;  4D73 A;  1VGL A;  3GH6 A;  1YF1 A;  3O6T A;  3ZIJ A;  2L6D A;  2AV4 A;  4MLY A;  5D9V A;  2B6M A;  3LFL A;  1XPV A;  3F6F A;  5F0G A;  2KHP A;  3HZ4 A;  4ZL7 A;  5IOW A;  4HOJ A;  5KEJ A;  2KUC A;  1TDI A;  4TVE A;  2IFQ B;  5IMA A;  1EP8 A;  4KDX A;  3ERF A;  2HZE B;  3EMX A;  1T3B A;  1T4Z A;  1ACV A;  6GSW A;  3FZ9 A;  2A2R A;  4K9Z A;  3H1N A;  4K7O A;  1SEN A;  2GQK A;  1X5E A;  2RUF A;  1KNG A;  3RBT A;  4J57 E;  4XRD A;  1B9X C;  3O3T A;  5IO2 A;  1PN9 A;  4LL1 B;  2FNO A;  3GL5 A;  5G5E A;  2L5L A;  1G6W A;  4CW9 A;  2LQO A;  3ZVJ D;  4PX1 A;  4JRR A;  2C0D A;  1TXX A;  2I81 A;  2MMZ A;  1ZYQ B;  4POM A;  4QQ7 A;  3DKS A;  4WET A;  2A4V A;  1GUK A;  2L6C A;  3ME8 A;  1T1V A;  3CSI A;  1GSY A;  2VAF A;  1WOU A;  3CXG A;  2PU9 C;  3BD2 A;  4JR6 A;  2H1A A;  4KAE A;  4PNG A;  4YH2 A;  2C3Q A;  1FAA A;  1G7O A;  5GAN D;  3H8Q A;  3IAM 2;  2OE0 A;  4EUY A;  2O85 A;  3QMX A;  2DLX A;  1MDK A;  2OJL A;  4POB A;  1FVJ A;  1VF2 A;  1YY7 A;  4TN8 A;  2IFQ A;  4JED A;  3QAV A;  4HS1 A;  2DIY A;  1G0T A;  2OBK A;  2QC7 A;  2B1L A;  4J56 E;  1HYU A;  5KN0 A;  19GS A;  3BCK A;  3L0H A;  3WGX A;  2H75 A;  4N10 A;  1BAY A;  4FYU A;  5COH A;  1SL2 B;  4GQF A;  1XWG A;  1N8J A;  3P90 A;  3I69 A;  5D9W A;  1TP9 A;  5KN2 A;  1VRS D;  4QL9 A;  3GHA A;  2QKE A;  5ABR A;  1M9A A;  3MNG A;  3ME7 A;  2LRT A;  3DVW A;  4ZXG A;  4EC0 A;  1GSU A;  1QGV A;  3ZRD A;  1USB A;  2FD3 A;  4XS6 A;  1ON4 A;  2CQ9 A;  3ZL5 A;  4F2I A;  4IQA A;  4EF0 A;  4ZB6 A;  4G9H A;  3UL3 A;  1X5C A;  3L9S A;  4V2M A;  1EGR A;  2G0F A;  4IVF A;  2WDU A;  3A5W A;  1W89 A;  3CSJ A;  1IYI A;  3UVH A;  6GSV A;  2LNT A;  10GS A;  2FGX A;  4MF5 A;  20GS A;  1GTA A;  3TJG A;  4XS1 A;  2GZZ A;  4MDC A;  3EYT A;  5G31 A;  2FUG 2;  5A4U A;  3D0Z A;  1PA3 A;  3PIN A;  3UBK A;  3I43 A;  4EDZ A;  1M7T A;  4F0C A;  3KTB A;  4GTU A;  4IEL A;  2F9S A;  2DML A;  5CRH A;  4PUA A;  4NAX A;  1G7E A;  2IPA A;  3VI5 A;  1U88 A;  1GTI A;  1XBS A;  5H5S A;  2F51 A;  2ALB A;  2VL3 A;  1OC9 A;  1AW9 A;  2C0G A;  3VWX A;  3L4N A;  1A23 A;  5HFK A;  4ML6 A;  2AHE A;  2LUS A;  3LJR A;  5DAK B;  3HKR A;  1F6M C;  2CAI A;  5GST A;  1YEX A;  2PER A;  3LXZ A;  2M46 A;  4DSS B;  3ISO A;  3HY2 A;  2LQQ A;  4FYB A;  2AJQ B;  2HLS A;  1MD4 A;  3I9V 2;  3VWV A;  4GXZ A;  4O32 A;  2V32 A;  1MD3 A;  2IMD A;  1YQ1 A;  2NDO A;  2OAD A;  4MZC A;  3M9K A;  2OBI A;  4ID0 A;  1G6Y A;  2YJH A;  3TKS A;  4BVX A;  3ZIV A;  5E4W A;  1R26 A;  3TJJ A;  1XW5 A;  1XXU A;  2VCX A;  2XBQ A;  2PN8 A;  1C72 A;  2J23 A;  3IXR A;  1KBN A;  2TRC P;  4XS4 B;  1M2B A;  3KD0 A;  1SKR B;  3APO A;  2PPT A;  4G19 A;  4OWY A;  4WEY A;  2YV7 A;  3DIE A;  3EC3 A;  4IW9 A;  3DVX A;  5IPH A;  2PUK C;  1HD2 A;  1ERU A;  5B6M A;  3CBU A;  1F3A A;  3G7J A;  5H5Q A;  2IL3 A;  5A4W A;  1XWK A;  5CRD A;  1HNA A;  1YEP A;  4MH3 A;  4HDE A;  2FA4 A;  3P7X A;  5ECO B;  1PGT A;  1LU4 A;  2DJK A;  4K6X A;  3F9U A;  3G7Y A;  4TXO B;  5HR3 A;  1O81 A;  2VL9 A;  3IPZ A;  2YWO A;  2CAQ A;  3DML A;  2VO4 A;  2VIM A;  1O85 A;  2CZ2 A;  1B8X A;  5CAX A;  5KN1 A;  3F4T A;  1XZO A;  2X99 A;  1GLQ A;  2VCV A;  4NMU A;  3WYW A;  4LMW A;  5IMD A;  2P31 A;  2RUE A;  2GVP A;  4FYC A;  3UIW A;  2R6K A;  4GWR A;  4N30 A;  2K18 A;  1BX9 A;  1FHE A;  3UEM A;  1EWX A;  2MMA A;  2AAW A;  1R5P A;  1UC7 A;  4K2D A;  2XHF A;  3F0I A;  4OCE A;  5LNK e;  2XC2 A;  5IO0 A;  1WJK A;  1KTE A;  1GH2 A;  1SK2 A;  4OCF A;  1O8W A;  2H30 A;  4BA7 A;  1A8L A;  3GYK A;  1NSW A;  6GSU A;  3GTU A;  4F0B A;  2V1M A;  5B6N A;  5G1K A;  1TU7 A;  2QSI A;  3MAK A;  5HFI A;  4PNF A;  4HJM A;  1H75 A;  1AXD A;  3IHQ A;  2GSS A;  4AJ7 A;  2YWN A;  2YPM A;  1YZX A;  1EV9 A;  2V6K A;  1F2E A;  2VCW A;  2B3S A;  6GST A;  2C1Y A;  3DEX A;  2CT6 A;  3TKR A;  2DJ2 A;  3TJB A;  4OFM A;  2EC4 A;  1O73 A;  4ACS A;  4LA1 A;  3QAW A;  5JCG A;  3KTL A;  3HZ8 A;  4L0W A;  1XVW A;  1KEB A;  1O6J A;  5FT3 A;  5AIS A;  5DJM A;  1SK1 A;  1BYE A;  4PUF C;  5FWG A;  5CP1 A;  1S3D A;  5F8B A;  5EY6 A;  1Q4J A;  2MMO A;  1XFL A;  1V98 A;  1K0D A;  4DVC A;  2L59 A;  5G30 A;  2H1G A;  3HVX A;  1QMV A;  3IK9 A;  3SWL A;  3D5J A;  4BWQ A;  1SJZ A;  2M80 A;  2C3T A;  1TTZ A;  2EIR A;  3RAZ A;  1GSE A;  4GRF A;  1XWA A;  2LNS A;  3GV1 A;  3H79 A;  4PGT A;  1TI3 A;  4L0U A;  1GTB A;  5L71 A;  1XIY A;  4H86 A;  4V2N A;  1A2J A;  3UMA A;  3TOU A;  5JWQ B;  1ERW A;  4ML1 A;  8GSS A;  3ZTL A;  1SK0 A;  3WD6 A;  4XIH A;  1A8Y A;  2IME A;  2VCT A;  1Z6N A;  2VD0 A;  2WRT A;  2MZC A;  1WRY A;  2HFD A;  3LEF A;  3GKX A;  3Q74 A;  3UOM A;  1T4Y A;  3PR8 A;  3ZZX A;  5ECQ B;  3F3Q A;  3S9F A;  1V9W A;  2JZR A;  4GST A;  5HFG A;  3FYG A;  5AN1 A;  2HXK A;  2B5E A;  2WB9 A;  4EXJ A;  2WGR A;  4ZBB A;  1TRU A;  4OFT A;  2M72 A;  1GUM A;  3VFI A;  2F8F A;  1EP7 A;  3APS A;  3ED3 A;  2CX3 A;  12GS A;  4WBR D;  1ZCP A;  3KZQ A;  3VWW A;  4EL1 A;  2V6O A;  2H72 A;  2PBJ A;  3GKK A;  5CYY A;  22GS A;  1QUW A;  4NV5 A;  4EDY A;  1DSB A;  4WF4 A;  2HYX A;  2EIO A;  4L5O A;  4GSN A;  5F05 A;  1O8X A;  2BJX A;  2H66 A;  5LD0 A;  5DBQ A;  1UVZ A;  1HNC A;  1FB6 A;  1Z7P A;  5KN3 A;  3DWV A;  4I2U A;  4KE3 A;  4K0G A;  1Z7R A;  3J7Y k;  5C00 A;  4IN0 A;  4X0X A;  2C4J A;  2V2G A;  1M99 A;  2B5Y A;  3QPM A;  5E59 A;  2DC5 A;  2XBI A;  2R4V A;  1BJX A;  1Y6E A;  3GMF A;  4POL A;  4KUN A;  1X9W B;  3WGD A;  1RK4 A;  1SJ6 A;  3A2W A;  1TKD B;  2E2M A;  4KGI A;  4JR4 A;  1LJR A;  2OE1 A;  2CVB A;  3L9U A;  4ZL8 A;  1AQW A;  1GLP A;  3GH9 A;  2HZE A;  2X8G A;  2TIR A;  1X5D A;  2K6V A;  4ILF A;  5D96 A;  4OFN A;  1GNE A;  1YF0 A;  3EVI A;  4ZB9 A;  1XWB A;  2TRX A;  4TR3 A;  3F6D A;  5DAL B;  5D9X A;  1T8E B;  3TDG A;  5HR2 A;  2L4C A;  3SBC A;  2H70 A;  2GSR A;  4YAP A;  11GS A;  4ECC A;  2IWT A;  4JBB A;  4GF0 A;  4DEJ A;  2VUP A;  4POK A;  3M0F A;  3RHB A;  1O7U A;  1AIU A;  1W4V A;  3D22 A;  2XPD A;  3QR6 A;  3F8U A;  3EE2 A;  5J5N A;  1ZL9 A;  1WIK A;  2L5O A;  2CX4 A;  4TR1 B;  2X8C A;  1YDK A;  3NZN A;  4P3Y B;  2REM A;  1QQ2 A;  2NBS A;  4F03 A;  3HJO A;  4TKY A;  4MCU A;  4IGJ A;  4X43 A;  1CQH A;  2MBT A;  4BL7 A;  1SKW B;  2FWE A;  3TKS E;  2WS2 A;  2VM1 A;  4FIW A;  1M9B A;  4OD7 A;  2PVO C;  1I5G A;  3NIV A;  3DRN A;  2ON7 A;  1XCC A;  1TOF A;  3C8E A;  1WWJ A;  2R37 A;  14GS A;  2OA7 A;  2KOK A;  2GT6 A;  2I1U A;  1THO A;  3FZ4 A;  5G1L A;  4KB3 A;  4RQR A;  3N5O A;  2WUL A;  2P5Q A;  4KA0 A;  1TI1 A;  4PUR A;  1GTU A;  2WFC A;  5IMC A;  1YKA A;  1X9S B;  4IQ1 A;  3O76 A;  4WKW A;  1PX7 A;  1X0R A;  5J4U A;  4LL4 B;  1XW9 A;  4KH7 A;  1H4O A;  2BTO T;  2K8S A;  2N5F A;  4IP6 A;  5G2Z A;  2WZ9 A;  4ZBD A;  2H8L A;  2B7J A;  3FR3 A;  4KDU A;  4LLR A;  1SD9 A;  2GZP A;  2HRN A;  5ECS A;  3Q19 A;  2H6X A;  3GX0 A;  1PX6 A;  2AYT A;  3QD9 A;  5JCW A;  1FW1 A;  4BPY A;  3TRP A;  1SL0 B;  4G2E A;  3QAG A;  1TW9 A;  1UA5 A;  3CTF A;  2C0E A;  2JSY A;  3BOA A;  1A2L A;  2C80 A;  1MDI A;  3LYK A;  3ZFB A;  1GRX A;  2H1D A;  1DBY A;  4HZ4 A;  4HI7 A;  2DIZ A;  3L78 A;  4E8H A;  1R7H A;  5JWR B;  1LBK A;  3F63 A;  3HVV A;  2FHE A;  2JU5 A;  3NOF A;  3D4M A;  5DVB A;  4Q5N A;  4K7I A;  3QOU A;  4KSM A;  4PQH A;  2XPE A;  4YQM A;  2YJ7 A;  2K9F A;  2FA8 A;  3BBY A;  3HJM A;  17GS A;  3AY8 A;  1Y25 A;  4I5Q A;  1WMJ A;  3KP8 A;  3DD3 A;  1SU9 A;  1PD2 1;  2GTU A;  3IA1 A;  1Z3E A;  2JL4 A;  5ID2 B;  2B5X A;  1K0O A;  4MJA A;  4YAV A;  5GZZ B;  4MA9 A;  5DAK A;  4JZQ A;  1Z5Y E;  3C7M A;  1OAZ A;  1PKZ A;  2RM6 A;  1ERT A;  4HEA 2;  4DSS A;  3EUR A;  2LRN A;  1OVN A;  3TCO A;  4MJB A;  1K3L A;  2JAD A;  3C1S A;  1PRX A;  3LG6 A;  3R2Q A;  4V1A p;  3C71 A;  2WJU A;  4ECJ A;  4XCS A;  2DJ1 A;  4YQU A;  4I6X A;  1HNB A;  2H0I A;  3FZA A;  5D9T A;  1BED A;  3ZVJ A;  1ABA A;  1VF1 A;  4EO3 A;  3LXT A;  3HCZ A;  4K7N A;  4MH2 A;  3W8S A;  2IN3 A;  3ZIT A;  1R4W A;  1E6B A;  3V1W A;  4XS4 A;  4O5R A;  4WR4 A;  1IYH A;  3E0U A;  3MDK A;  3TRX A;  3LYP A;  2YAN A;  1DE2 A;  1EGO A;  4NXI A;  1FOV A;  1NW2 A;  3HHV A;  2R5G A;  2RII A;  4V1A g;  4F9Z A;  5D93 A;  5INY A;  2B7K A;  4BWS A;  2GDR A;  4EKZ A;  3ZYW A;  5FHI A;  2GSQ A;  5J9B A;  4D73 B;  2YWM A;  5AGY A;  2F3M A;  4GCI A;  5ECI B;  2PGT A;  1DE1 A;  4L8E A;  2YZH A;  2WCI A;  3IDV A;  2HSY A;  6GSS A;  4TXO A;  1V40 A;  1OYJ A;  5D73 A;  1U3A A;  2IJY A;  5C04 A;  5A4V A;  1OC3 A;  1NHY A;  2I9H A;  4ZL9 A;  5IMF A;  4Q5F A;  4X1U A;  5B8A A;  1SYX A;  1WP0 A;  5ENU A;  3GL3 A;  18GS A;  1QXH A;  3IOS A;  2L4Q A;  2HI7 A;  3QFB C;  6GSX A;  1XOA A;  4MPF A;  2GZY A;  1ERV A;  2H76 A;  2LJR A;  4TR4 A;  1PSQ A;  1EEJ A;  4E8E A;  4CDO A;  2DJ0 A;  1EZK A;  3ZFL A;  1TK8 B;  5B8B A;  3KH9 A;  1M2D A;  3VI7 A;  1PMT A;  3TB2 A;  4BVY A;  1GP1 A;  1GWC A;  4MF6 A;  2NVL A;  3UJ1 A;  2E0Q A;  3IR4 A;  2YP6 A;  1J9B A;  2HNL A;  3GIX A;  3EWL A;  3K8N A;  2C0F A;  1HQO A;  2P5R A;  3ERW A;  2VLV A;  2ES7 A;  2BMX A;  2Z9S A;  4NPB A;  4KCE A;  4RI7 A;  1THX A;  2N5A A;  1SKS B;  1V57 A;  1AQX A;  3D21 A;  4KSO A;  2NPB A;  1TRW A;  2YOI A;  1A2M A;  2DMM A;  5A5K A;  3TGZ A;  4ZIL A;  5EPF A;  2X8H A;  2CA8 A;  4ECB A;  3F4R A;  2DJ3 A;  3GSS A;  4V2L A;  2IMI A;  2OAC A;  1K0N A;  4TXV A;  4WXT A;  1XWC A;  1OKT A;  2C3N A;  3PH9 A;  4MF7 A;  1ML6 A;  2VL2 C;  4O7H A;  2GQL A;  6GSY A;  3FKF A;  1MEK A;  1I9D A;  2JSZ A;  4HJ2 A;  1JLW A;  4NV2 A;  4KCA A;  2H73 A;  1V58 A;  1A0R P;  2VOC A;  4RI6 A;  2FCH A;  4PQ1 A;  1TK5 B;  2J9H A;  3RPN A;  3EIN A;  2NTO A;  3MWH A;  1TU8 A;  4OO4 A;  4AJ6 A;  3GUR A;  1AUC A;  3A2X A;  1T7P B;  3E3E A;  2HSH A;  3F4S A;  2IIY A;  2O8V B;  3M1G A;  1GL8 A;  1J0F A;  3KP9 A;  2PVQ A;  4WR5 A;  2LS5 A;  5ECL B;  3VLN A;  5F06 A;  3RDW A;  4GSS A;  4JU5 A;  4DSQ A;  2V41 A;  4N0Z A;  1DUG A;  3IBH A;  3LWA A;  3FK8 A;  4XHM A;  2LV3 A;  3FR6 A;  2MYG A;  1OC8 A;  2LTK A;  1F37 A;  1GSD A;  1GSF A;  3G9B A;  5DCG A;  5G5F A;  1RW1 A;  1T00 A;  3HYP A;  3GX8 A;  3IV4 A;  5DCH A;  2KP1 A;  4KX4 A;  2YN1 A;  2IMF A;  1GSQ A;  1JZR A;  2VLT A;  1AC1 A;  3EU4 A;  3HD5 A;  2VM2 A;  1MDJ A;  1JFU A;  5IPG A;  5ECM B;  4AGS A;  2MBS A;  5D8I A;  2I4A A;  3LQ7 A;  2H71 A;  4FH8 A;  3U6V A;  4AF2 A;  3ERG A;  3N9J A;  5ECP B;  3CTG A;  2HRF A;  1B4Q A;  1OE7 A;  3HJP A;  4F82 A;  2DBC A;  3U5R E;  3OR5 A;  1ZGN A;  1S3A A;  1U87 A;  3ZMK A;  1GNW A;  4HQS A;  5IOX A;  2A2S A;  2H0G A;  2LST A;  4NHW A;  4N0V A;  3TUE A;  2O7K A;  4HU7 A;  2ON5 A;  5IQY A;  2GT5 A;  5HR1 A;  2HT9 A;  3ZML A;  3TJK A;  1FVK A;  3EU3 A;  3HA9 A;  5IM9 A;  4ZIJ A;  3FW2 A;  3ZRE A;  4I97 A;  2JAC A;  2CV4 A;  2ZNM A;  3ZLP A;  1X9M B;  3IAS 2;  2EIQ A;  5ELA A;  5LCZ A;  1ILO A;  2LJK A;  4WBJ A;  3FR9 A;  3VK9 A;  3D4T A;  2LRC A;  3M3M A;  3GKM A;  3UAP A;  4OO5 A;  1ST9 A;  3LGC A;  4AJ8 A;  1PL1 A;  4L5L A;  5HQP A;  3P8W A;  1AAZ A;  1OC9 B;  3CMI A;  1N2A A;  2O89 A;  2FLS A;  3GA4 A;  3IRA A;  1B48 A;  1ZZY A;  2GLR A;  4PQI A;  5IMV A;  2VLU A;  3F3R A;  3J7Y b;  5F07 A;  1K0C A;  3KH7 A;  4K0N A;  2H01 A;  1JHB A;  2LEG A;  4MK3 A;  2PMT A;  2FWF A;  2K8V A;  5DQY A;  7GSS A;  5B7C A;  2H74 A;  3M8N A;  1U6T A;  3TKQ A;  1B9Y C;  2L57 A;  3LOR A;  1M2A A;  4K8M A;  4RUV A;  5CRW A;  3C73 A;  2QGV A;  3W6G A;  3PGT A;  3D6I A;  1K3O A;  4HZ2 A;  3UVT A;  4I8B A;  2OKA A;  5CNW A;  1TK0 B;  4ULX A;  4K1F A;  4KND A;  4MJC A;  4IBP A;  1XW6 A;  4Q5Q A;  3US3 A;  2H0H A;  2C8U A;  4QL7 A;  5ECN B;  3IE3 A;  5CRG A;  1WPI A;  1VF3 A;  1RQM A;  2FWG A;  3CSH A;  5DAL A;  3GUS A;  1YKC A;  2VCZ A;  4MJE A;  3Q6O A;  3VPQ A;  1ZOF A;  4NHZ A;  3C1R A;  5JWO B;  1B4P A;  3A3T A;  3KIJ A;  2GQM A;  3KXO A;  1Z9H A;  3VPT A;  3QCP A;  1M0U A;  1E2Y A;  4OMV A;  3RPP A;  4XRA A;  2AB6 A;  2JZT A;  3I6A A;  2JZS A;  4IJ3 A;  4MMM A;  2H6Z A;  4YQV A;  3FHK A;  3QFA C;  5AIV A;  5IMZ A;  1K3Y A;  1TJD A;  3CRT A;  3A2V A;  4TR1 A;  4JE1 A;  1SD8 A;  1OE8 A;  1UN2 A;  3LSZ A;  4RQX A;  3UBL A;  2CVD A;  1AQV A;  3GRX A;  1JZO A;  4GQC A;  3G7I A;  1PQN A;  3WT2 A;  2D2Z A;  5H5R A;  3TRQ A;  2DSA A;  3IK7 A;  4HU9 A;  2R2J A;  4EE0 A;  2H6Y A;  2CZ3 A;  5J9C A;  3HDC A;  4DSR A;  2YNX A;  4LMV A;  2G2Q A;  4O92 A;  16GS A;  2YCD A;  1FO5 A;  5DDL A;  2RM5 A;  3VUR A;  1F9M A;  3GFK A;  3BCI A;  3FEU A;  4HUA A;  4ISD A;  2F8A A;  3DGQ A;  3KM6 A;  4EVM A;  1F3B A;  2N5B A;  1OKD A;  3H4K A;  4TRX A;  3TKP A;  1JZD A;  4KW6 A;  4KDY A;  3APQ A;  5IIZ A;  1Z6M A;  2IMK A;  1YJ6 A;  3GTU B;  5ECH B;  2RLI A;  2CVK A;  2H1B A;  2MMN A;  4WF5 A;  1JLV A;  3CRU A;  4ZB8 A;  3VWU A;  4N11 A;  3GNJ A;  4GLT A;  2FWH A;  3KMN A;  4MZW A;  4ZBA A;  2P0G A;  2FY6 A;  3DXB A;  5DJL A;  1A24 A;  5GAP D;  4MZB A;  1V2A A;  2VL2 A;  3KGK A;  3FY7 A;  4ECI A;  1K0B A;  3GKN A;  3KEB A;  13GS A;  2YZU A;  5CO3 A;  1SYR A;  4Z7X A;  3BJ5 A;  4PXO A;  1Q98 A;  4Q5R A;  2LKU A;  5EVO A;  3EMP A;  1VF4 A;  3QDN A;  3DYR A;  2GS3 A;  2E2G A;  2H19 A;  9GSS A;  3HVS A;  1CQG A;  3TOT A;  5J3R A;  3WGE A;  1EOH A;  1EOG A;  2ZCT A;  5EL8 A;  4IP1 A;  1XVQ A;  3CYN A;  1TRS A;  2AUV A;  2KLX A;  4TR0 A;  2LJA A;  3KMO A;  3KCM A;  2YV9 A;  3GST A;  3W8J A;  3KJY A;  2X64 A;  4MAB A;  3FZ5 A;  1A0F A;  2O87 A;  1PL2 A;  5ECR B;  4FO5 A;  4HQZ A;  4IKH A;  1FB0 A;  2GGT A;  3M9J A;  3UAR A;  4TOP A;  5ID2 A;  4XTS A;  1SL1 B;  3P2A A;  2ZUP A;  5CRE A;  1PKW A;  1URM A;  2VCQ A;  3RHC A;  1JZW A;  1BQ7 A;  1J08 A;  1MTC A;  4G10 A;  1K0M A;  3FRC A;  4MPG A;  5DQS A;  1GUH A;  4CHS A;  2E7P A;  1EV4 A;  3MSZ A;  3L9V A;  4IJI A;  1NM3 A;  2HZF A;  1TRV A;  5ELG A;  3H93 A;  1R5A A;  4J2F A;  1ZMA A;  3TKS C;  5AIX A;  2OE3 A;  3Q18 A;  3TJF A;  3JCM L;  1SJI A;  4TW5 A;  2B1K A;  4IHU A;  1QK8 A;  1GSS A;  3E9J B;  5ECK B;  2HE3 A;  5J41 A;  1EEM A;  5GSS A;  1U3I A;  3GN3 A;  2VD1 A;  1FG4 A;  2PWJ A;  2DJJ A;  4IS0 A;  1NHO A;  1ZYE A;  1K0A A;  1QFN A;  3WT1 A;  2GST A;  5HR0 A;  1WE0 A;  2YWI A;  4NWY A;  2KP2 A;  1XOB A;  5JCU A;  1GUL A; 
#chains in the Genus database with same CATH topology
 2I3Y A;  1BG5 A;  4I2T A;  2R3X A;  4MP4 A;  3IC4 A;  1S3C A;  3HXS A;  4D73 A;  1VGL A;  3GH6 A;  1YF1 A;  3O6T A;  3ZIJ A;  2L6D A;  2AV4 A;  4MLY A;  5D9V A;  2B6M A;  3LFL A;  1XPV A;  3F6F A;  5F0G A;  2KHP A;  3HZ4 A;  4ZL7 A;  5IOW A;  4HOJ A;  5KEJ A;  2KUC A;  1TDI A;  4TVE A;  2IFQ B;  5IMA A;  1EP8 A;  4KDX A;  3ERF A;  2HZE B;  3EMX A;  1T3B A;  1T4Z A;  1ACV A;  6GSW A;  3FZ9 A;  2A2R A;  4K9Z A;  3H1N A;  4K7O A;  1SEN A;  2GQK A;  1X5E A;  2RUF A;  1KNG A;  3RBT A;  4J57 E;  4XRD A;  1B9X C;  3O3T A;  5IO2 A;  1PN9 A;  4LL1 B;  2FNO A;  3GL5 A;  5G5E A;  2L5L A;  1G6W A;  4CW9 A;  2LQO A;  3ZVJ D;  4PX1 A;  4JRR A;  2C0D A;  1TXX A;  2I81 A;  2MMZ A;  1ZYQ B;  4POM A;  4QQ7 A;  3DKS A;  4WET A;  2A4V A;  3MYD A;  1GUK A;  2L6C A;  3ME8 A;  1T1V A;  3CSI A;  1GSY A;  2VAF A;  1WOU A;  3CXG A;  2PU9 C;  3BD2 A;  4JR6 A;  3IC8 A;  2H1A A;  4KAE A;  4PNG A;  4YH2 A;  2C3Q A;  1FAA A;  1G7O A;  5GAN D;  3H8Q A;  3IAM 2;  2OE0 A;  4EUY A;  2O85 A;  2DKI A;  3QMX A;  2DLX A;  4BL7 B;  1MDK A;  2OJL A;  4POB A;  1FVJ A;  1VF2 A;  1YY7 A;  4TN8 A;  2IFQ A;  4JED A;  3QAV A;  4HS1 A;  2DIY A;  1G0T A;  2OBK A;  2QC7 A;  2B1L A;  4J56 E;  1HYU A;  5KN0 A;  19GS A;  3BCK A;  3L0H A;  3WGX A;  2H75 A;  4N10 A;  1BAY A;  4FYU A;  5COH A;  1ZYP A;  1SL2 B;  4GQF A;  1XWG A;  1N8J A;  4CY6 A;  3P90 A;  3I69 A;  5D9W A;  1TP9 A;  4O5Q A;  5KN2 A;  1VRS D;  4QL9 A;  3GHA A;  2QKE A;  5ABR A;  1M9A A;  3MNG A;  3ME7 A;  2LRT A;  3DVW A;  4ZXG A;  4EC0 A;  1GSU A;  1QGV A;  3ZRD A;  1USB A;  2FD3 A;  4XS6 A;  1ON4 A;  2CQ9 A;  3ZL5 A;  4F2I A;  4IQA A;  4EF0 A;  4ZB6 A;  4G9H A;  3UL3 A;  1X5C A;  3L9S A;  4V2M A;  1EGR A;  2G0F A;  4IVF A;  2WDU A;  3A5W A;  1W89 A;  3CSJ A;  4BVX B;  1IYI A;  3UVH A;  6GSV A;  2LNT A;  10GS A;  2FGX A;  4MF5 A;  20GS A;  1GTA A;  3TJG A;  4XS1 A;  2GZZ A;  4MDC A;  3EYT A;  5G31 A;  2FUG 2;  5A4U A;  3D0Z A;  1PA3 A;  3PIN A;  3UBK A;  3I43 A;  4EDZ A;  1M7T A;  4F0C A;  3KTB A;  4GTU A;  4IEL A;  2F9S A;  2DML A;  5CRH A;  4PUA A;  4NAX A;  1G7E A;  2IPA A;  3VI5 A;  1U88 A;  1GTI A;  1XBS A;  5H5S A;  2F51 A;  2ALB A;  2VL3 A;  1OC9 A;  1AW9 A;  2C0G A;  3VWX A;  3L4N A;  3MIX A;  1A23 A;  5HFK A;  4ML6 A;  2AHE A;  2LUS A;  3LJR A;  5DAK B;  3HKR A;  1F6M C;  2CAI A;  5GST A;  1YEX A;  2PER A;  3LXZ A;  2M46 A;  4DSS B;  3ISO A;  3HY2 A;  2LQQ A;  4FYB A;  2AJQ B;  2HLS A;  1MD4 A;  3I9V 2;  3VWV A;  4GXZ A;  5KOW A;  4O32 A;  2V32 A;  1MD3 A;  2IMD A;  1YQ1 A;  2NDO A;  2OAD A;  4MZC A;  3M9K A;  2OBI A;  4ID0 A;  1G6Y A;  2YJH A;  3TKS A;  4BVX A;  3ZIV A;  5E4W A;  1R26 A;  3TJJ A;  1XW5 A;  1XXU A;  2VCX A;  2XBQ A;  2PN8 A;  1C72 A;  2J23 A;  3IXR A;  1KBN A;  2TRC P;  4XS4 B;  1M2B A;  2DKH A;  3KD0 A;  1SKR B;  3APO A;  2PPT A;  4G19 A;  4OWY A;  4WEY A;  2YV7 A;  3DIE A;  3EC3 A;  4IW9 A;  3DVX A;  5IPH A;  2PUK C;  1HD2 A;  1ERU A;  5B6M A;  3CBU A;  1F3A A;  3G7J A;  5H5Q A;  2IL3 A;  5A4W A;  1XWK A;  5CRD A;  1HNA A;  1YEP A;  4MH3 A;  4HDE A;  2FA4 A;  3P7X A;  5ECO B;  1PGT A;  1LU4 A;  2DJK A;  4K6X A;  3F9U A;  3G7Y A;  4TXO B;  5HR3 A;  1O81 A;  2VL9 A;  3IPZ A;  2YWO A;  2CAQ A;  3DML A;  2VO4 A;  2VIM A;  1O85 A;  2CZ2 A;  2A2P A;  1B8X A;  5CAX A;  5KN1 A;  3F4T A;  1XZO A;  2X99 A;  1GLQ A;  2VCV A;  4NMU A;  3WYW A;  4LMW A;  4BVY B;  5IMD A;  2P31 A;  2RUE A;  2GVP A;  4FYC A;  3UIW A;  2R6K A;  4GWR A;  4N30 A;  2K18 A;  1BX9 A;  1FHE A;  3UEM A;  1EWX A;  2MMA A;  2AAW A;  1R5P A;  1UC7 A;  4K2D A;  2XHF A;  3F0I A;  4OCE A;  5LNK e;  2XC2 A;  1XG8 A;  5IO0 A;  1WJK A;  1KTE A;  1GH2 A;  1SK2 A;  4OCF A;  1O8W A;  2H30 A;  4BA7 A;  1A8L A;  3R3E A;  3GYK A;  1NSW A;  6GSU A;  3GTU A;  4F0B A;  2V1M A;  5B6N A;  5G1K A;  1TU7 A;  2QSI A;  4KF9 A;  3MAK A;  5HFI A;  4PNF A;  4HJM A;  1H75 A;  1AXD A;  3IHQ A;  2GSS A;  4AJ7 A;  2YWN A;  2YPM A;  1YZX A;  4MNN A;  1EV9 A;  2V6K A;  1F2E A;  2VCW A;  2B3S A;  6GST A;  2C1Y A;  3DEX A;  2CT6 A;  3TKR A;  2DJ2 A;  3TJB A;  4OFM A;  2EC4 A;  1O73 A;  4ACS A;  4LA1 A;  3QAW A;  5JCG A;  3KTL A;  3HZ8 A;  4L0W A;  1XVW A;  1KEB A;  1O6J A;  3EPT A;  5FT3 A;  5AIS A;  1M3J A;  5DJM A;  1SK1 A;  1BYE A;  4PUF C;  5FWG A;  5CP1 A;  1S3D A;  5F8B A;  5EY6 A;  4K5S A;  1Q4J A;  2MMO A;  1XFL A;  1V98 A;  1K0D A;  4DVC A;  2L59 A;  5G30 A;  2H1G A;  3HVX A;  1QMV A;  3IK9 A;  3SWL A;  3D5J A;  4BWQ A;  1SJZ A;  2M80 A;  2C3T A;  1TTZ A;  2EIR A;  3RAZ A;  1GSE A;  4GRF A;  1XWA A;  2LNS A;  3GV1 A;  3H79 A;  4PGT A;  1TI3 A;  4L0U A;  1GTB A;  5L71 A;  1XIY A;  4H86 A;  4V2N A;  1A2J A;  3UMA A;  3TOU A;  5JWQ B;  1ERW A;  4ML1 A;  8GSS A;  3ZTL A;  1SK0 A;  3WD6 A;  4XIH A;  1A8Y A;  2IME A;  2VCT A;  1Z6N A;  2VD0 A;  2WRT A;  2MZC A;  1WRY A;  2HFD A;  3LEF A;  3GKX A;  3Q74 A;  4PTS A;  3UOM A;  1T4Y A;  3PR8 A;  3ZZX A;  5ECQ B;  3F3Q A;  3S9F A;  1V9W A;  2JZR A;  4GST A;  5HFG A;  3FYG A;  5AN1 A;  2HXK A;  2B5E A;  2WB9 A;  4EXJ A;  2WGR A;  4ZBB A;  1TRU A;  4OFT A;  2M72 A;  1GUM A;  3VFI A;  2F8F A;  1EP7 A;  3APS A;  3ED3 A;  2CX3 A;  12GS A;  4WBR D;  1ZCP A;  3KZQ A;  3VWW A;  2R0P A;  4EL1 A;  2V6O A;  2H72 A;  2PBJ A;  3GKK A;  5CYY A;  22GS A;  1QUW A;  4NV5 A;  4EDY A;  1DSB A;  4WF4 A;  2HYX A;  2EIO A;  4L5O A;  4GSN A;  5F05 A;  1O8X A;  2BJX A;  2H66 A;  5LD0 A;  5DBQ A;  1UVZ A;  1HNC A;  1FB6 A;  1Z7P A;  5KN3 A;  3DWV A;  4I2U A;  4KE3 A;  4K0G A;  1Z7R A;  3J7Y k;  5C00 A;  4IN0 A;  4X0X A;  2C4J A;  2V2G A;  1M99 A;  2B5Y A;  3QPM A;  5E59 A;  2DC5 A;  2XBI A;  2R4V A;  1BJX A;  1Y6E A;  3GMF A;  4POL A;  4KUN A;  1X9W B;  3WGD A;  1RK4 A;  1SJ6 A;  3A2W A;  1TKD B;  2E2M A;  4HSC X;  4KGI A;  4JR4 A;  1LJR A;  2OE1 A;  2CVB A;  3L9U A;  4ZL8 A;  1AQW A;  1GLP A;  3GH9 A;  2HZE A;  2X8G A;  2TIR A;  1X5D A;  2K6V A;  4ILF A;  5D96 A;  4OFN A;  1GNE A;  1YF0 A;  4FQU A;  3EVI A;  4ZB9 A;  1XWB A;  2TRX A;  4TR3 A;  3F6D A;  5DAL B;  5D9X A;  1T8E B;  3TDG A;  5HR2 A;  2L4C A;  3SBC A;  2H70 A;  2GSR A;  4YAP A;  11GS A;  4ECC A;  2IWT A;  4JBB A;  4GF0 A;  4DEJ A;  2VUP A;  4POK A;  3M0F A;  3RHB A;  1O7U A;  1AIU A;  1W4V A;  3D22 A;  2XPD A;  3QR6 A;  3F8U A;  3EE2 A;  5J5N A;  2HRA A;  1ZL9 A;  1WIK A;  2L5O A;  2CX4 A;  4BIK A;  4TR1 B;  2X8C A;  2A4H A;  1YDK A;  3NZN A;  4P3Y B;  2REM A;  1QQ2 A;  2NBS A;  4F03 A;  3HJO A;  4TKY A;  4MCU A;  4IGJ A;  4X43 A;  1CQH A;  2MBT A;  4BL7 A;  1SKW B;  2FWE A;  3TKS E;  2WS2 A;  2VM1 A;  4FIW A;  1M9B A;  4OD7 A;  3PPU A;  2PVO C;  1I5G A;  3NIV A;  3DRN A;  2ON7 A;  1XCC A;  1TOF A;  3C8E A;  1WWJ A;  2R37 A;  14GS A;  2OA7 A;  2KOK A;  2GT6 A;  2I1U A;  1THO A;  3FZ4 A;  5G1L A;  4KB3 A;  4RQR A;  3N5O A;  2WUL A;  2P5Q A;  4KA0 A;  1TI1 A;  4PUR A;  4G0K A;  1GTU A;  2WFC A;  5IMC A;  2HSM A;  1YKA A;  1X9S B;  4IQ1 A;  3O76 A;  4WKW A;  1PX7 A;  1X0R A;  5J4U A;  4LL4 B;  1XW9 A;  4KH7 A;  1H4O A;  2BTO T;  2K8S A;  2N5F A;  4IP6 A;  5G2Z A;  2WZ9 A;  4ZBD A;  2H8L A;  2B7J A;  3FR3 A;  4KDU A;  4LLR A;  1SD9 A;  2GZP A;  2HRN A;  5ECS A;  3Q19 A;  2H6X A;  3GX0 A;  1PX6 A;  2AYT A;  3QD9 A;  5JCW A;  1FW1 A;  4BPY A;  3TRP A;  1SL0 B;  4G2E A;  3QAG A;  1TW9 A;  1UA5 A;  3CTF A;  2C0E A;  2JSY A;  3BOA A;  1A2L A;  2C80 A;  1MDI A;  1S3R A;  3LYK A;  3ZFB A;  1GRX A;  2H1D A;  1DBY A;  4HZ4 A;  4HI7 A;  2DIZ A;  3L78 A;  4E8H A;  1R7H A;  5JWR B;  1LBK A;  3F63 A;  3HVV A;  2FHE A;  2JU5 A;  3NOF A;  3D4M A;  5DVB A;  4Q5N A;  4K7I A;  3QOU A;  4KSM A;  4PQH A;  2XPE A;  4YQM A;  2YJ7 A;  2K9F A;  2FA8 A;  3BBY A;  3HJM A;  17GS A;  3AY8 A;  4Z2T A;  1Y25 A;  4I5Q A;  1WMJ A;  3KP8 A;  3DD3 A;  1SU9 A;  1PD2 1;  2GTU A;  3IA1 A;  1Z3E A;  2JL4 A;  5ID2 B;  2B5X A;  1K0O A;  4Z2U A;  2QA1 A;  5KOX A;  4MJA A;  4YAV A;  5GZZ B;  4MA9 A;  5DAK A;  4JZQ A;  1Z5Y E;  3C7M A;  1OAZ A;  1PKZ A;  2RM6 A;  1ERT A;  4HEA 2;  4DSS A;  3EUR A;  2LRN A;  1OVN A;  4X4J A;  3TCO A;  4MJB A;  1K3L A;  2JAD A;  3C1S A;  1PRX A;  3LG6 A;  3R2Q A;  4V1A p;  3C71 A;  1ZYN A;  3A5I A;  1M3I A;  2WJU A;  4YKG A;  4ECJ A;  4XCS A;  4Z2R A;  2DJ1 A;  4YQU A;  4I6X A;  1HNB A;  2H0I A;  3FZA A;  5D9T A;  1BED A;  3ZVJ A;  1ABA A;  1VF1 A;  4EO3 A;  3LXT A;  3HCZ A;  4K7N A;  4MH2 A;  3W8S A;  2IN3 A;  3ZIT A;  1R4W A;  1E6B A;  3V1W A;  4XS4 A;  4O5R A;  4WR4 A;  1IYH A;  3E0U A;  3MDK A;  3TRX A;  3LYP A;  2YAN A;  1DE2 A;  1EGO A;  4NXI A;  1FOV A;  1NW2 A;  1PN0 A;  3HHV A;  2R5G A;  2RII A;  4V1A g;  4F9Z A;  5D93 A;  5INY A;  2B7K A;  4BWS A;  2GDR A;  4EKZ A;  3ZYW A;  5FHI A;  2GSQ A;  5J9B A;  4D73 B;  2YWM A;  5AGY A;  2F3M A;  4GCI A;  5ECI B;  2PGT A;  1DE1 A;  4L8E A;  2YZH A;  2WCI A;  3IDV A;  2HSY A;  6GSS A;  4TXO A;  1V40 A;  1OYJ A;  5D73 A;  1U3A A;  2IJY A;  5C04 A;  5A4V A;  1OC3 A;  1NHY A;  2I9H A;  4ZL9 A;  5IMF A;  4Q5F A;  4X1U A;  5B8A A;  4CY8 A;  1SYX A;  1WP0 A;  5ENU A;  3GL3 A;  18GS A;  1QXH A;  3IOS A;  2L4Q A;  2HI7 A;  3QFB C;  6GSX A;  1XOA A;  4MPF A;  2GZY A;  1ERV A;  2H76 A;  2LJR A;  4TR4 A;  1PSQ A;  1EEJ A;  4E8E A;  4CDO A;  2DJ0 A;  1EZK A;  3ZFL A;  1TK8 B;  5B8B A;  3KH9 A;  1M2D A;  3VI7 A;  1PMT A;  3TB2 A;  4BVY A;  1GP1 A;  1GWC A;  4MF6 A;  2NVL A;  3UJ1 A;  2E0Q A;  3IR4 A;  2YP6 A;  1J9B A;  2HNL A;  3GIX A;  3EWL A;  3K8N A;  2C0F A;  1HQO A;  2P5R A;  3ERW A;  2VLV A;  2ES7 A;  2BMX A;  2Z9S A;  4NPB A;  4KCE A;  4RI7 A;  1THX A;  2N5A A;  1SKS B;  1V57 A;  1AQX A;  3D21 A;  4KSO A;  2NPB A;  1TRW A;  2YOI A;  1A2M A;  2DMM A;  5A5K A;  3TGZ A;  4ZIL A;  5EPF A;  2X8H A;  2CA8 A;  4ECB A;  3F4R A;  2DJ3 A;  3GSS A;  4V2L A;  2IMI A;  2OAC A;  1K0N A;  4TXV A;  4WXT A;  1XWC A;  1OKT A;  2C3N A;  3PH9 A;  4MF7 A;  1ML6 A;  2VL2 C;  4O7H A;  2GQL A;  6GSY A;  3FKF A;  1MEK A;  1I9D A;  2JSZ A;  4HJ2 A;  1JLW A;  4NV2 A;  4KCA A;  5BMU A;  2H73 A;  1V58 A;  1A0R P;  2VOC A;  4RI6 A;  2FCH A;  4PQ1 A;  1TK5 B;  2J9H A;  3RPN A;  3EIN A;  2NTO A;  3MWH A;  1TU8 A;  4OO4 A;  4AJ6 A;  4EIP A;  3GUR A;  1AUC A;  3A2X A;  1T7P B;  3E3E A;  2HSH A;  3F4S A;  2IIY A;  2O8V B;  3M1G A;  1GL8 A;  1J0F A;  3KP9 A;  3FMW A;  2PVQ A;  4WR5 A;  2LS5 A;  5ECL B;  3VLN A;  5F06 A;  3RDW A;  4GSS A;  4JU5 A;  4ICY A;  4DSQ A;  2V41 A;  4N0Z A;  1DUG A;  3IBH A;  2X49 A;  3LWA A;  3FK8 A;  4XHM A;  3CQF A;  2LV3 A;  3FR6 A;  3HVN A;  2MYG A;  1OC8 A;  2LTK A;  1F37 A;  1GSD A;  1GSF A;  3G9B A;  5DCG A;  5G5F A;  1RW1 A;  1T00 A;  3HYP A;  3GX8 A;  3IV4 A;  5DCH A;  2KP1 A;  4KX4 A;  2YN1 A;  2IMF A;  1GSQ A;  1JZR A;  2VLT A;  1AC1 A;  3EU4 A;  2QA2 A;  3HD5 A;  2VM2 A;  1MDJ A;  1JFU A;  5IPG A;  5ECM B;  4AGS A;  2MBS A;  5D8I A;  2I4A A;  3LQ7 A;  2H71 A;  4FH8 A;  3U6V A;  4AF2 A;  3ERG A;  3N9J A;  5ECP B;  4USS A;  3CTG A;  2HRF A;  1B4Q A;  1OE7 A;  3HJP A;  4F82 A;  2DBC A;  3U5R E;  3OR5 A;  4A5P A;  1ZGN A;  1S3A A;  1U87 A;  3ZMK A;  1GNW A;  4HQS A;  5IOX A;  2A2S A;  2H0G A;  2LST A;  4NHW A;  4N0V A;  3TUE A;  2O7K A;  4HU7 A;  2ON5 A;  5IQY A;  2GT5 A;  5HR1 A;  2HT9 A;  3ZML A;  3TJK A;  1FVK A;  3EU3 A;  3HA9 A;  5IM9 A;  4ZIJ A;  2R0C A;  3FW2 A;  2R0G A;  3ZRE A;  4I97 A;  2JAC A;  2CV4 A;  2ZNM A;  3ZLP A;  1X9M B;  3IAS 2;  2EIQ A;  5ELA A;  5LCZ A;  1ILO A;  2LJK A;  4WBJ A;  3FR9 A;  3VK9 A;  3D4T A;  2LRC A;  3M3M A;  4O5U A;  3GKM A;  3UAP A;  4OO5 A;  1ST9 A;  3LGC A;  4AJ8 A;  1PL1 A;  4L5L A;  5HQP A;  3P8W A;  1AAZ A;  1OC9 B;  3CMI A;  1N2A A;  2O89 A;  2FLS A;  3GA4 A;  3IRA A;  1B48 A;  1ZZY A;  2GLR A;  4PQI A;  5IMV A;  2VLU A;  3F3R A;  3J7Y b;  5F07 A;  1K0C A;  3KH7 A;  4K0N A;  2H01 A;  1JHB A;  2LEG A;  4MK3 A;  2PMT A;  4EIQ A;  2FWF A;  2K8V A;  5DQY A;  7GSS A;  5B7C A;  2H74 A;  3M8N A;  2HRK A;  1U6T A;  3TKQ A;  1B9Y C;  2L57 A;  3LOR A;  1M2A A;  4K8M A;  4RUV A;  5CRW A;  3C73 A;  2QGV A;  3W6G A;  3PGT A;  3D6I A;  1K3O A;  4HZ2 A;  3UVT A;  4I8B A;  2OKA A;  5CNW A;  1TK0 B;  4ULX A;  4K1F A;  4KND A;  4MJC A;  4IBP A;  1XW6 A;  4Q5Q A;  3US3 A;  2H0H A;  2C8U A;  4QL7 A;  5ECN B;  3IE3 A;  5CRG A;  1WPI A;  1VF3 A;  1RQM A;  2FWG A;  3CSH A;  3IHG A;  5DAL A;  3GUS A;  1YKC A;  2VCZ A;  4MJE A;  3Q6O A;  3VPQ A;  1ZOF A;  4NHZ A;  3C1R A;  5JWO B;  1B4P A;  3A3T A;  3KIJ A;  2GQM A;  3KXO A;  1Z9H A;  3VPT A;  3QCP A;  1M0U A;  1E2Y A;  4OMV A;  3RPP A;  4XRA A;  2AB6 A;  2JZT A;  3I6A A;  2JZS A;  4IJ3 A;  4MMM A;  2H6Z A;  4YQV A;  3FHK A;  3QFA C;  5AIV A;  5IMZ A;  1K3Y A;  1TJD A;  3CRT A;  3A2V A;  4TR1 A;  4JE1 A;  1SD8 A;  1OE8 A;  1UN2 A;  3LSZ A;  4RQX A;  4YKF A;  3UBL A;  3LW9 A;  2CVD A;  1AQV A;  3GRX A;  1JZO A;  4GQC A;  3G7I A;  1PQN A;  3WT2 A;  1FOH A;  2D2Z A;  5H5R A;  4G0I A;  3TRQ A;  2DSA A;  3IK7 A;  4HU9 A;  2R2J A;  4EE0 A;  2H6Y A;  2CZ3 A;  5J9C A;  3HDC A;  4DSR A;  2YNX A;  4LMV A;  2G2Q A;  4O92 A;  16GS A;  2YCD A;  1FO5 A;  5DDL A;  2RM5 A;  3VUR A;  1F9M A;  3GFK A;  3BCI A;  3FEU A;  4HUA A;  4ISD A;  2F8A A;  4K2X A;  3DGQ A;  3KM6 A;  4EVM A;  1F3B A;  2N5B A;  1OKD A;  3H4K A;  4TRX A;  3TKP A;  1JZD A;  4KW6 A;  4KDY A;  3APQ A;  5IIZ A;  1Z6M A;  2IMK A;  1YJ6 A;  3GTU B;  5ECH B;  2RLI A;  2CVK A;  2H1B A;  2MMN A;  4WF5 A;  1JLV A;  3CRU A;  4ZB8 A;  3VWU A;  4N11 A;  3GNJ A;  4GLT A;  2FWH A;  3KMN A;  4MZW A;  4ZBA A;  2P0G A;  2FY6 A;  3DXB A;  5DJL A;  1A24 A;  4G0L A;  5GAP D;  4MZB A;  1V2A A;  2VL2 A;  3KGK A;  3FY7 A;  4ECI A;  1K0B A;  3GKN A;  3KEB A;  13GS A;  2YZU A;  5CO3 A;  1SYR A;  4Z7X A;  3BJ5 A;  1PFO A;  4PXO A;  1Q98 A;  4Q5R A;  2LKU A;  5EVO A;  3EMP A;  1VF4 A;  3QDN A;  3DYR A;  2GS3 A;  2E2G A;  2H19 A;  9GSS A;  2X4A A;  3HVS A;  1CQG A;  3TOT A;  5J3R A;  3WGE A;  1EOH A;  1EOG A;  2ZCT A;  5EL8 A;  4IP1 A;  1XVQ A;  3CYN A;  1TRS A;  2AUV A;  2KLX A;  4TR0 A;  2LJA A;  3KMO A;  3KCM A;  2YV9 A;  3GST A;  5BRT A;  3W8J A;  3KJY A;  2X64 A;  4MAB A;  3FZ5 A;  1A0F A;  2O87 A;  1PL2 A;  5ECR B;  4FO5 A;  4HQZ A;  4IKH A;  1FB0 A;  2GGT A;  3M9J A;  3UAR A;  4TOP A;  5ID2 A;  4K5R A;  4XTS A;  1SL1 B;  3P2A A;  2ZUP A;  5CRE A;  1PKW A;  1URM A;  2VCQ A;  3RHC A;  1JZW A;  1BQ7 A;  1J08 A;  1MTC A;  4G10 A;  1K0M A;  3FRC A;  4MPG A;  5DQS A;  1GUH A;  4CHS A;  2E7P A;  1EV4 A;  3MSZ A;  3L9V A;  4IJI A;  1NM3 A;  2HZF A;  1TRV A;  5ELG A;  3H93 A;  1R5A A;  4J2F A;  1ZMA A;  3TKS C;  5AIX A;  2OE3 A;  3Q18 A;  3TJF A;  3JCM L;  1SJI A;  4TW5 A;  2B1K A;  4IHU A;  1QK8 A;  1GSS A;  3E9J B;  5ECK B;  2HE3 A;  5J41 A;  1EEM A;  5GSS A;  1U3I A;  3GN3 A;  2VD1 A;  1FG4 A;  2PWJ A;  2DJJ A;  2UZ8 A;  4IS0 A;  1NHO A;  1ZYE A;  1K0A A;  1QFN A;  3WT1 A;  2GST A;  5HR0 A;  1WE0 A;  2YWI A;  4NWY A;  2KP2 A;  1XOB A;  5JCU A;  1GUL A; 
#chains in the Genus database with same CATH homology
 2I3Y A;  1BG5 A;  4I2T A;  2R3X A;  4MP4 A;  3IC4 A;  1S3C A;  3HXS A;  4D73 A;  1VGL A;  3GH6 A;  1YF1 A;  3O6T A;  3ZIJ A;  2L6D A;  2AV4 A;  4MLY A;  5D9V A;  2B6M A;  3LFL A;  1XPV A;  3F6F A;  5F0G A;  2KHP A;  3HZ4 A;  4ZL7 A;  5IOW A;  4HOJ A;  5KEJ A;  2KUC A;  1TDI A;  4TVE A;  2IFQ B;  5IMA A;  1EP8 A;  4KDX A;  3ERF A;  2HZE B;  3EMX A;  1T3B A;  1T4Z A;  1ACV A;  6GSW A;  3FZ9 A;  2A2R A;  4K9Z A;  3H1N A;  4K7O A;  1SEN A;  2GQK A;  1X5E A;  2RUF A;  1KNG A;  3RBT A;  4J57 E;  4XRD A;  1B9X C;  3O3T A;  5IO2 A;  1PN9 A;  4LL1 B;  2FNO A;  3GL5 A;  5G5E A;  2L5L A;  1G6W A;  4CW9 A;  2LQO A;  3ZVJ D;  4PX1 A;  4JRR A;  2C0D A;  1TXX A;  2I81 A;  2MMZ A;  1ZYQ B;  4POM A;  4QQ7 A;  3DKS A;  4WET A;  2A4V A;  3MYD A;  1GUK A;  2L6C A;  3ME8 A;  1T1V A;  3CSI A;  1GSY A;  2VAF A;  1WOU A;  3CXG A;  2PU9 C;  3BD2 A;  4JR6 A;  3IC8 A;  2H1A A;  4KAE A;  4PNG A;  4YH2 A;  2C3Q A;  1FAA A;  1G7O A;  5GAN D;  3H8Q A;  3IAM 2;  2OE0 A;  4EUY A;  2O85 A;  2DKI A;  3QMX A;  2DLX A;  4BL7 B;  1MDK A;  2OJL A;  4POB A;  1FVJ A;  1VF2 A;  1YY7 A;  4TN8 A;  2IFQ A;  4JED A;  3QAV A;  4HS1 A;  2DIY A;  1G0T A;  2OBK A;  2QC7 A;  2B1L A;  4J56 E;  1HYU A;  5KN0 A;  19GS A;  3BCK A;  3L0H A;  3WGX A;  2H75 A;  4N10 A;  1BAY A;  4FYU A;  5COH A;  1ZYP A;  1SL2 B;  4GQF A;  1XWG A;  1N8J A;  4CY6 A;  3P90 A;  3I69 A;  5D9W A;  1TP9 A;  4O5Q A;  5KN2 A;  1VRS D;  4QL9 A;  3GHA A;  2QKE A;  5ABR A;  1M9A A;  3MNG A;  3ME7 A;  2LRT A;  3DVW A;  4ZXG A;  4EC0 A;  1GSU A;  1QGV A;  3ZRD A;  1USB A;  2FD3 A;  4XS6 A;  1ON4 A;  2CQ9 A;  3ZL5 A;  4F2I A;  4IQA A;  4EF0 A;  4ZB6 A;  4G9H A;  3UL3 A;  1X5C A;  3L9S A;  4V2M A;  1EGR A;  2G0F A;  4IVF A;  2WDU A;  3A5W A;  1W89 A;  3CSJ A;  4BVX B;  1IYI A;  3UVH A;  6GSV A;  2LNT A;  10GS A;  2FGX A;  4MF5 A;  20GS A;  1GTA A;  3TJG A;  4XS1 A;  2GZZ A;  4MDC A;  3EYT A;  5G31 A;  2FUG 2;  5A4U A;  3D0Z A;  1PA3 A;  3PIN A;  3UBK A;  3I43 A;  4EDZ A;  1M7T A;  4F0C A;  3KTB A;  4GTU A;  4IEL A;  2F9S A;  2DML A;  5CRH A;  4PUA A;  4NAX A;  1G7E A;  2IPA A;  3VI5 A;  1U88 A;  1GTI A;  1XBS A;  5H5S A;  2F51 A;  2ALB A;  2VL3 A;  1OC9 A;  1AW9 A;  2C0G A;  3VWX A;  3L4N A;  3MIX A;  1A23 A;  5HFK A;  4ML6 A;  2AHE A;  2LUS A;  3LJR A;  5DAK B;  3HKR A;  1F6M C;  2CAI A;  5GST A;  1YEX A;  2PER A;  3LXZ A;  2M46 A;  4DSS B;  3ISO A;  3HY2 A;  2LQQ A;  4FYB A;  2AJQ B;  2HLS A;  1MD4 A;  3I9V 2;  3VWV A;  4GXZ A;  5KOW A;  4O32 A;  2V32 A;  1MD3 A;  2IMD A;  1YQ1 A;  2NDO A;  2OAD A;  4MZC A;  3M9K A;  2OBI A;  4ID0 A;  1G6Y A;  2YJH A;  3TKS A;  4BVX A;  3ZIV A;  5E4W A;  1R26 A;  3TJJ A;  1XW5 A;  1XXU A;  2VCX A;  2XBQ A;  2PN8 A;  1C72 A;  2J23 A;  3IXR A;  1KBN A;  2TRC P;  4XS4 B;  1M2B A;  2DKH A;  3KD0 A;  1SKR B;  3APO A;  2PPT A;  4G19 A;  4OWY A;  4WEY A;  2YV7 A;  3DIE A;  3EC3 A;  4IW9 A;  3DVX A;  5IPH A;  2PUK C;  1HD2 A;  1ERU A;  5B6M A;  3CBU A;  1F3A A;  3G7J A;  5H5Q A;  2IL3 A;  5A4W A;  1XWK A;  5CRD A;  1HNA A;  1YEP A;  4MH3 A;  4HDE A;  2FA4 A;  3P7X A;  5ECO B;  1PGT A;  1LU4 A;  2DJK A;  4K6X A;  3F9U A;  3G7Y A;  4TXO B;  5HR3 A;  1O81 A;  2VL9 A;  3IPZ A;  2YWO A;  2CAQ A;  3DML A;  2VO4 A;  2VIM A;  1O85 A;  2CZ2 A;  2A2P A;  1B8X A;  5CAX A;  5KN1 A;  3F4T A;  1XZO A;  2X99 A;  1GLQ A;  2VCV A;  4NMU A;  3WYW A;  4LMW A;  4BVY B;  5IMD A;  2P31 A;  2RUE A;  2GVP A;  4FYC A;  3UIW A;  2R6K A;  4GWR A;  4N30 A;  2K18 A;  1BX9 A;  1FHE A;  3UEM A;  1EWX A;  2MMA A;  2AAW A;  1R5P A;  1UC7 A;  4K2D A;  2XHF A;  3F0I A;  4OCE A;  5LNK e;  2XC2 A;  5IO0 A;  1WJK A;  1KTE A;  1GH2 A;  1SK2 A;  4OCF A;  1O8W A;  2H30 A;  4BA7 A;  1A8L A;  3R3E A;  3GYK A;  1NSW A;  6GSU A;  3GTU A;  4F0B A;  2V1M A;  5B6N A;  5G1K A;  1TU7 A;  2QSI A;  4KF9 A;  3MAK A;  5HFI A;  4PNF A;  4HJM A;  1H75 A;  1AXD A;  3IHQ A;  2GSS A;  4AJ7 A;  2YWN A;  2YPM A;  1YZX A;  4MNN A;  1EV9 A;  2V6K A;  1F2E A;  2VCW A;  2B3S A;  6GST A;  2C1Y A;  3DEX A;  2CT6 A;  3TKR A;  2DJ2 A;  3TJB A;  4OFM A;  2EC4 A;  1O73 A;  4ACS A;  4LA1 A;  3QAW A;  5JCG A;  3KTL A;  3HZ8 A;  4L0W A;  1XVW A;  1KEB A;  1O6J A;  3EPT A;  5FT3 A;  5AIS A;  5DJM A;  1SK1 A;  1BYE A;  4PUF C;  5FWG A;  5CP1 A;  1S3D A;  5F8B A;  5EY6 A;  4K5S A;  1Q4J A;  2MMO A;  1XFL A;  1V98 A;  1K0D A;  4DVC A;  2L59 A;  5G30 A;  2H1G A;  3HVX A;  1QMV A;  3IK9 A;  3SWL A;  3D5J A;  4BWQ A;  1SJZ A;  2M80 A;  2C3T A;  1TTZ A;  2EIR A;  3RAZ A;  1GSE A;  4GRF A;  1XWA A;  2LNS A;  3GV1 A;  3H79 A;  4PGT A;  1TI3 A;  4L0U A;  1GTB A;  5L71 A;  1XIY A;  4H86 A;  4V2N A;  1A2J A;  3UMA A;  3TOU A;  5JWQ B;  1ERW A;  4ML1 A;  8GSS A;  3ZTL A;  1SK0 A;  3WD6 A;  4XIH A;  1A8Y A;  2IME A;  2VCT A;  1Z6N A;  2VD0 A;  2WRT A;  2MZC A;  1WRY A;  2HFD A;  3LEF A;  3GKX A;  3Q74 A;  4PTS A;  3UOM A;  1T4Y A;  3PR8 A;  3ZZX A;  5ECQ B;  3F3Q A;  3S9F A;  1V9W A;  2JZR A;  4GST A;  5HFG A;  3FYG A;  5AN1 A;  2HXK A;  2B5E A;  2WB9 A;  4EXJ A;  2WGR A;  4ZBB A;  1TRU A;  4OFT A;  2M72 A;  1GUM A;  3VFI A;  2F8F A;  1EP7 A;  3APS A;  3ED3 A;  2CX3 A;  12GS A;  4WBR D;  1ZCP A;  3KZQ A;  3VWW A;  2R0P A;  4EL1 A;  2V6O A;  2H72 A;  2PBJ A;  3GKK A;  5CYY A;  22GS A;  1QUW A;  4NV5 A;  4EDY A;  1DSB A;  4WF4 A;  2HYX A;  2EIO A;  4L5O A;  4GSN A;  5F05 A;  1O8X A;  2BJX A;  2H66 A;  5LD0 A;  5DBQ A;  1UVZ A;  1HNC A;  1FB6 A;  1Z7P A;  5KN3 A;  3DWV A;  4I2U A;  4KE3 A;  4K0G A;  1Z7R A;  3J7Y k;  5C00 A;  4IN0 A;  4X0X A;  2C4J A;  2V2G A;  1M99 A;  2B5Y A;  3QPM A;  5E59 A;  2DC5 A;  2XBI A;  2R4V A;  1BJX A;  1Y6E A;  3GMF A;  4POL A;  4KUN A;  1X9W B;  3WGD A;  1RK4 A;  1SJ6 A;  3A2W A;  1TKD B;  2E2M A;  4KGI A;  4JR4 A;  1LJR A;  2OE1 A;  2CVB A;  3L9U A;  4ZL8 A;  1AQW A;  1GLP A;  3GH9 A;  2HZE A;  2X8G A;  2TIR A;  1X5D A;  2K6V A;  4ILF A;  5D96 A;  4OFN A;  1GNE A;  1YF0 A;  4FQU A;  3EVI A;  4ZB9 A;  1XWB A;  2TRX A;  4TR3 A;  3F6D A;  5DAL B;  5D9X A;  1T8E B;  3TDG A;  5HR2 A;  2L4C A;  3SBC A;  2H70 A;  2GSR A;  4YAP A;  11GS A;  4ECC A;  2IWT A;  4JBB A;  4GF0 A;  4DEJ A;  2VUP A;  4POK A;  3M0F A;  3RHB A;  1O7U A;  1AIU A;  1W4V A;  3D22 A;  2XPD A;  3QR6 A;  3F8U A;  3EE2 A;  5J5N A;  2HRA A;  1ZL9 A;  1WIK A;  2L5O A;  2CX4 A;  4TR1 B;  2X8C A;  2A4H A;  1YDK A;  3NZN A;  4P3Y B;  2REM A;  1QQ2 A;  2NBS A;  4F03 A;  3HJO A;  4TKY A;  4MCU A;  4IGJ A;  4X43 A;  1CQH A;  2MBT A;  4BL7 A;  1SKW B;  2FWE A;  3TKS E;  2WS2 A;  2VM1 A;  4FIW A;  1M9B A;  4OD7 A;  3PPU A;  2PVO C;  1I5G A;  3NIV A;  3DRN A;  2ON7 A;  1XCC A;  1TOF A;  3C8E A;  1WWJ A;  2R37 A;  14GS A;  2OA7 A;  2KOK A;  2GT6 A;  2I1U A;  1THO A;  3FZ4 A;  5G1L A;  4KB3 A;  4RQR A;  3N5O A;  2WUL A;  2P5Q A;  4KA0 A;  1TI1 A;  4PUR A;  4G0K A;  1GTU A;  2WFC A;  5IMC A;  2HSM A;  1YKA A;  1X9S B;  4IQ1 A;  3O76 A;  4WKW A;  1PX7 A;  1X0R A;  5J4U A;  4LL4 B;  1XW9 A;  4KH7 A;  1H4O A;  2BTO T;  2K8S A;  2N5F A;  4IP6 A;  5G2Z A;  2WZ9 A;  4ZBD A;  2H8L A;  2B7J A;  3FR3 A;  4KDU A;  4LLR A;  1SD9 A;  2GZP A;  2HRN A;  5ECS A;  3Q19 A;  2H6X A;  3GX0 A;  1PX6 A;  2AYT A;  3QD9 A;  5JCW A;  1FW1 A;  4BPY A;  3TRP A;  1SL0 B;  4G2E A;  3QAG A;  1TW9 A;  1UA5 A;  3CTF A;  2C0E A;  2JSY A;  3BOA A;  1A2L A;  2C80 A;  1MDI A;  3LYK A;  3ZFB A;  1GRX A;  2H1D A;  1DBY A;  4HZ4 A;  4HI7 A;  2DIZ A;  3L78 A;  4E8H A;  1R7H A;  5JWR B;  1LBK A;  3F63 A;  3HVV A;  2FHE A;  2JU5 A;  3NOF A;  3D4M A;  5DVB A;  4Q5N A;  4K7I A;  3QOU A;  4KSM A;  4PQH A;  2XPE A;  4YQM A;  2YJ7 A;  2K9F A;  2FA8 A;  3BBY A;  3HJM A;  17GS A;  3AY8 A;  4Z2T A;  1Y25 A;  4I5Q A;  1WMJ A;  3KP8 A;  3DD3 A;  1SU9 A;  1PD2 1;  2GTU A;  3IA1 A;  1Z3E A;  2JL4 A;  5ID2 B;  2B5X A;  1K0O A;  4Z2U A;  2QA1 A;  5KOX A;  4MJA A;  4YAV A;  5GZZ B;  4MA9 A;  5DAK A;  4JZQ A;  1Z5Y E;  3C7M A;  1OAZ A;  1PKZ A;  2RM6 A;  1ERT A;  4HEA 2;  4DSS A;  3EUR A;  2LRN A;  1OVN A;  4X4J A;  3TCO A;  4MJB A;  1K3L A;  2JAD A;  3C1S A;  1PRX A;  3LG6 A;  3R2Q A;  4V1A p;  3C71 A;  1ZYN A;  3A5I A;  2WJU A;  4YKG A;  4ECJ A;  4XCS A;  4Z2R A;  2DJ1 A;  4YQU A;  4I6X A;  1HNB A;  2H0I A;  3FZA A;  5D9T A;  1BED A;  3ZVJ A;  1ABA A;  1VF1 A;  4EO3 A;  3LXT A;  3HCZ A;  4K7N A;  4MH2 A;  3W8S A;  2IN3 A;  3ZIT A;  1R4W A;  1E6B A;  3V1W A;  4XS4 A;  4O5R A;  4WR4 A;  1IYH A;  3E0U A;  3MDK A;  3TRX A;  3LYP A;  2YAN A;  1DE2 A;  1EGO A;  4NXI A;  1FOV A;  1NW2 A;  1PN0 A;  3HHV A;  2R5G A;  2RII A;  4V1A g;  4F9Z A;  5D93 A;  5INY A;  2B7K A;  4BWS A;  2GDR A;  4EKZ A;  3ZYW A;  5FHI A;  2GSQ A;  5J9B A;  4D73 B;  2YWM A;  5AGY A;  2F3M A;  4GCI A;  5ECI B;  2PGT A;  1DE1 A;  4L8E A;  2YZH A;  2WCI A;  3IDV A;  2HSY A;  6GSS A;  4TXO A;  1V40 A;  1OYJ A;  5D73 A;  1U3A A;  2IJY A;  5C04 A;  5A4V A;  1OC3 A;  1NHY A;  2I9H A;  4ZL9 A;  5IMF A;  4Q5F A;  4X1U A;  5B8A A;  4CY8 A;  1SYX A;  1WP0 A;  5ENU A;  3GL3 A;  18GS A;  1QXH A;  3IOS A;  2L4Q A;  2HI7 A;  3QFB C;  6GSX A;  1XOA A;  4MPF A;  2GZY A;  1ERV A;  2H76 A;  2LJR A;  4TR4 A;  1PSQ A;  1EEJ A;  4E8E A;  4CDO A;  2DJ0 A;  1EZK A;  3ZFL A;  1TK8 B;  5B8B A;  3KH9 A;  1M2D A;  3VI7 A;  1PMT A;  3TB2 A;  4BVY A;  1GP1 A;  1GWC A;  4MF6 A;  2NVL A;  3UJ1 A;  2E0Q A;  3IR4 A;  2YP6 A;  1J9B A;  2HNL A;  3GIX A;  3EWL A;  3K8N A;  2C0F A;  1HQO A;  2P5R A;  3ERW A;  2VLV A;  2ES7 A;  2BMX A;  2Z9S A;  4NPB A;  4KCE A;  4RI7 A;  1THX A;  2N5A A;  1SKS B;  1V57 A;  1AQX A;  3D21 A;  4KSO A;  2NPB A;  1TRW A;  2YOI A;  1A2M A;  2DMM A;  5A5K A;  3TGZ A;  4ZIL A;  5EPF A;  2X8H A;  2CA8 A;  4ECB A;  3F4R A;  2DJ3 A;  3GSS A;  4V2L A;  2IMI A;  2OAC A;  1K0N A;  4TXV A;  4WXT A;  1XWC A;  1OKT A;  2C3N A;  3PH9 A;  4MF7 A;  1ML6 A;  2VL2 C;  4O7H A;  2GQL A;  6GSY A;  3FKF A;  1MEK A;  1I9D A;  2JSZ A;  4HJ2 A;  1JLW A;  4NV2 A;  4KCA A;  5BMU A;  2H73 A;  1V58 A;  1A0R P;  2VOC A;  4RI6 A;  2FCH A;  4PQ1 A;  1TK5 B;  2J9H A;  3RPN A;  3EIN A;  2NTO A;  3MWH A;  1TU8 A;  4OO4 A;  4AJ6 A;  4EIP A;  3GUR A;  1AUC A;  3A2X A;  1T7P B;  3E3E A;  2HSH A;  3F4S A;  2IIY A;  2O8V B;  3M1G A;  1GL8 A;  1J0F A;  3KP9 A;  3FMW A;  2PVQ A;  4WR5 A;  2LS5 A;  5ECL B;  3VLN A;  5F06 A;  3RDW A;  4GSS A;  4JU5 A;  4ICY A;  4DSQ A;  2V41 A;  4N0Z A;  1DUG A;  3IBH A;  2X49 A;  3LWA A;  3FK8 A;  4XHM A;  2LV3 A;  3FR6 A;  2MYG A;  1OC8 A;  2LTK A;  1F37 A;  1GSD A;  1GSF A;  3G9B A;  5DCG A;  5G5F A;  1RW1 A;  1T00 A;  3HYP A;  3GX8 A;  3IV4 A;  5DCH A;  2KP1 A;  4KX4 A;  2YN1 A;  2IMF A;  1GSQ A;  1JZR A;  2VLT A;  1AC1 A;  3EU4 A;  2QA2 A;  3HD5 A;  2VM2 A;  1MDJ A;  1JFU A;  5IPG A;  5ECM B;  4AGS A;  2MBS A;  5D8I A;  2I4A A;  3LQ7 A;  2H71 A;  4FH8 A;  3U6V A;  4AF2 A;  3ERG A;  3N9J A;  5ECP B;  4USS A;  3CTG A;  2HRF A;  1B4Q A;  1OE7 A;  3HJP A;  4F82 A;  2DBC A;  3U5R E;  3OR5 A;  4A5P A;  1ZGN A;  1S3A A;  1U87 A;  3ZMK A;  1GNW A;  4HQS A;  5IOX A;  2A2S A;  2H0G A;  2LST A;  4NHW A;  4N0V A;  3TUE A;  2O7K A;  4HU7 A;  2ON5 A;  5IQY A;  2GT5 A;  5HR1 A;  2HT9 A;  3ZML A;  3TJK A;  1FVK A;  3EU3 A;  3HA9 A;  5IM9 A;  4ZIJ A;  2R0C A;  3FW2 A;  2R0G A;  3ZRE A;  4I97 A;  2JAC A;  2CV4 A;  2ZNM A;  3ZLP A;  1X9M B;  3IAS 2;  2EIQ A;  5ELA A;  5LCZ A;  1ILO A;  2LJK A;  4WBJ A;  3FR9 A;  3VK9 A;  3D4T A;  2LRC A;  3M3M A;  4O5U A;  3GKM A;  3UAP A;  4OO5 A;  1ST9 A;  3LGC A;  4AJ8 A;  1PL1 A;  4L5L A;  5HQP A;  3P8W A;  1AAZ A;  1OC9 B;  3CMI A;  1N2A A;  2O89 A;  2FLS A;  3GA4 A;  3IRA A;  1B48 A;  1ZZY A;  2GLR A;  4PQI A;  5IMV A;  2VLU A;  3F3R A;  3J7Y b;  5F07 A;  1K0C A;  3KH7 A;  4K0N A;  2H01 A;  1JHB A;  2LEG A;  4MK3 A;  2PMT A;  4EIQ A;  2FWF A;  2K8V A;  5DQY A;  7GSS A;  5B7C A;  2H74 A;  3M8N A;  2HRK A;  1U6T A;  3TKQ A;  1B9Y C;  2L57 A;  3LOR A;  1M2A A;  4K8M A;  4RUV A;  5CRW A;  3C73 A;  2QGV A;  3W6G A;  3PGT A;  3D6I A;  1K3O A;  4HZ2 A;  3UVT A;  4I8B A;  2OKA A;  5CNW A;  1TK0 B;  4ULX A;  4K1F A;  4KND A;  4MJC A;  4IBP A;  1XW6 A;  4Q5Q A;  3US3 A;  2H0H A;  2C8U A;  4QL7 A;  5ECN B;  3IE3 A;  5CRG A;  1WPI A;  1VF3 A;  1RQM A;  2FWG A;  3CSH A;  3IHG A;  5DAL A;  3GUS A;  1YKC A;  2VCZ A;  4MJE A;  3Q6O A;  3VPQ A;  1ZOF A;  4NHZ A;  3C1R A;  5JWO B;  1B4P A;  3A3T A;  3KIJ A;  2GQM A;  3KXO A;  1Z9H A;  3VPT A;  3QCP A;  1M0U A;  1E2Y A;  4OMV A;  3RPP A;  4XRA A;  2AB6 A;  2JZT A;  3I6A A;  2JZS A;  4IJ3 A;  4MMM A;  2H6Z A;  4YQV A;  3FHK A;  3QFA C;  5AIV A;  5IMZ A;  1K3Y A;  1TJD A;  3CRT A;  3A2V A;  4TR1 A;  4JE1 A;  1SD8 A;  1OE8 A;  1UN2 A;  3LSZ A;  4RQX A;  4YKF A;  3UBL A;  3LW9 A;  2CVD A;  1AQV A;  3GRX A;  1JZO A;  4GQC A;  3G7I A;  1PQN A;  3WT2 A;  1FOH A;  2D2Z A;  5H5R A;  4G0I A;  3TRQ A;  2DSA A;  3IK7 A;  4HU9 A;  2R2J A;  4EE0 A;  2H6Y A;  2CZ3 A;  5J9C A;  3HDC A;  4DSR A;  2YNX A;  4LMV A;  2G2Q A;  4O92 A;  16GS A;  2YCD A;  1FO5 A;  5DDL A;  2RM5 A;  3VUR A;  1F9M A;  3GFK A;  3BCI A;  3FEU A;  4HUA A;  4ISD A;  2F8A A;  4K2X A;  3DGQ A;  3KM6 A;  4EVM A;  1F3B A;  2N5B A;  1OKD A;  3H4K A;  4TRX A;  3TKP A;  1JZD A;  4KW6 A;  4KDY A;  3APQ A;  5IIZ A;  1Z6M A;  2IMK A;  1YJ6 A;  3GTU B;  5ECH B;  2RLI A;  2CVK A;  2H1B A;  2MMN A;  4WF5 A;  1JLV A;  3CRU A;  4ZB8 A;  3VWU A;  4N11 A;  3GNJ A;  4GLT A;  2FWH A;  3KMN A;  4MZW A;  4ZBA A;  2P0G A;  2FY6 A;  3DXB A;  5DJL A;  1A24 A;  4G0L A;  5GAP D;  4MZB A;  1V2A A;  2VL2 A;  3KGK A;  3FY7 A;  4ECI A;  1K0B A;  3GKN A;  3KEB A;  13GS A;  2YZU A;  5CO3 A;  1SYR A;  4Z7X A;  3BJ5 A;  4PXO A;  1Q98 A;  4Q5R A;  2LKU A;  5EVO A;  3EMP A;  1VF4 A;  3QDN A;  3DYR A;  2GS3 A;  2E2G A;  2H19 A;  9GSS A;  2X4A A;  3HVS A;  1CQG A;  3TOT A;  5J3R A;  3WGE A;  1EOH A;  1EOG A;  2ZCT A;  5EL8 A;  4IP1 A;  1XVQ A;  3CYN A;  1TRS A;  2AUV A;  2KLX A;  4TR0 A;  2LJA A;  3KMO A;  3KCM A;  2YV9 A;  3GST A;  5BRT A;  3W8J A;  3KJY A;  2X64 A;  4MAB A;  3FZ5 A;  1A0F A;  2O87 A;  1PL2 A;  5ECR B;  4FO5 A;  4HQZ A;  4IKH A;  1FB0 A;  2GGT A;  3M9J A;  3UAR A;  4TOP A;  5ID2 A;  4K5R A;  4XTS A;  1SL1 B;  3P2A A;  2ZUP A;  5CRE A;  1PKW A;  1URM A;  2VCQ A;  3RHC A;  1JZW A;  1BQ7 A;  1J08 A;  1MTC A;  4G10 A;  1K0M A;  3FRC A;  4MPG A;  5DQS A;  1GUH A;  4CHS A;  2E7P A;  1EV4 A;  3MSZ A;  3L9V A;  4IJI A;  1NM3 A;  2HZF A;  1TRV A;  5ELG A;  3H93 A;  1R5A A;  4J2F A;  1ZMA A;  3TKS C;  5AIX A;  2OE3 A;  3Q18 A;  3TJF A;  3JCM L;  1SJI A;  4TW5 A;  2B1K A;  4IHU A;  1QK8 A;  1GSS A;  3E9J B;  5ECK B;  2HE3 A;  5J41 A;  1EEM A;  5GSS A;  1U3I A;  3GN3 A;  2VD1 A;  1FG4 A;  2PWJ A;  2DJJ A;  2UZ8 A;  4IS0 A;  1NHO A;  1ZYE A;  1K0A A;  1QFN A;  3WT1 A;  2GST A;  5HR0 A;  1WE0 A;  2YWI A;  4NWY A;  2KP2 A;  1XOB A;  5JCU A;  1GUL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...