5HR3A

Crystal structure of thioredoxin n106a mutant
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
107
structure length
107
Chain Sequence
DKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDAALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin
publication title Structural variability of E. coli thioredoxin captured in the crystal structures of single-point mutants.
pubmed doi rcsb
source organism Escherichia coli
total genus 30
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5hr3A00
3CSIA 3Q74A 3NZNA 2AHEA 2FHEA 4I6XA 3VPQA 1AUCA 2ZCTA 3NOFA 3OR5A 2IFQB 4POMA 2LV3A 1F2EA 5ELAA 3UBKA 4TVEA 1ABAA 1VF1A 1K0AA 4O7HA 1PGTA 5CP1A 3DVWA 3KP8A 2JADA 4JEDA 3WGXA 1XWKA 4ECIA 1HD2A 1TDIA 2MBSA 4ZBDA 4K6XA 2MMOA 3I6AA 3EVIA 2H8LA 1ERWA 4MZBA 3KD0A 4BWQA 2B1LA 3HHVA 3ZITA 3TOUA 5IOWA 4PQ1A 5DVBA 1GTAA 3HXSA 3P8WA 3GUSA 3IBHA 1ON4A 3BD2A 1I5GA 2DSAA 1OVNA 1SU9A 3A2XA 4K7IA 5DALA 3QDNA 1TP9A 2PBJA 3M9KA 4FYBA 2H0IA 4KUNA 5E59A 2GGTA 2KP2A 2IWTA 3GSTA 4IQAA 4NXIA 22GSA 4V2MA 1OC3A 4FH8A 4WETA 4JU5A 4WR4A 2AAWA 10GSA 4ML1A 1FOVA 4KCEA 1GSDA 4G19A 3GIXA 2GSSA 1ZYEA 1X9WB 6GSSA 1HYUA 2PVQA 2VLVA 2H19A 5ECQB 5F8BA 2HSYA 1JFUA 3FZ5A 1R5PA 5CRWA 2R5GA 3LXZA 5D8IA 1V9WA 3GYKA 1M9BA 2KLXA 4IP6A 3DKSA 2C3TA 1EOGA 4YQVA 4LLRA 1G7OA 2XC2A 4HU7A 3GX0A 2IMDA 2F8AA 5E4WA 1PD21 2HT9A 5FT3A 3KEBA 1ERVA 7GSSA 1EZKA 3IE3A 5ENUA 2HRFA 5D9WA 3KJYA 4KCAA 1J08A 1N8JA 2O85A 3HVSA 3KTLA 5L71A 2WB9A 1M99A 2QGVA 1VF2A 4JR4A 1AAZA 2HLSA 4L5LA 1UC7A 2MMNA 5EVOA 1WWJA 2GZPA 2PGTA 1ZZYA 4L0UA 1MDKA 4IQ1A 1GSUA 1F3BA 2L4QA 1QFNA 3QFBC 2E7PA 4Q5NA 4D73B 4EF0A 2IPAA 3TJFA 4EUYA 4L8EA 4MJEA 2LKUA 5CAXA 2YNXA 1A2MA 1GNEA 3RHCA 3A5WA 3RPNA 1YEXA 16GSA 5HFGA 2JZRA 1K0NA 1U3IA 4MABA 3K8NA 2YWOA 1XCCA 4YAVA 3LXTA 2PMTA 2IN3A 5IO2A 2DJJA 3FZ9A 1EGOA 2R4VA 5DQYA 4KE3A 4G10A 2H74A 2H71A 2MMZA 4ZIJA 2OE1A 4IN0A 3HDCA 3GL3A 1OC9A 1FB0A 3ZTLA 2LUSA 4HZ4A 2XBIA 3QAGA 1EV9A 1B9YC 4KA0A 4WEYA 3LWAA 3GH6A 5IIZA 1G6YA 3GTUA 1G0TA 2K8SA 1GSEA 3F63A 4DSRA 1TI3A 4BA7A 3UIWA 3E3EA 5F05A 3ERFA 2L5OA 3FZ4A 1XW5A 3D4MA 1F37A 3LORA 2MZCA 4HOJA 4TXOA 3WYWA 3F6FA 4MH2A 19GSA 2JZSA 1A2JA 2I4AA 3W6GA 3CBUA 3TJJA 1K0DA 4TR1B 3HCZA 2A4VA 4EC0A 4RI6A 2PPTA 5D93A 2LJRA 3EE2A 5CYYA 4IVFA 2C3QA 4CW9A 1URMA 3KCMA 1T00A 2IIYA 2WDUA 3WGEA 1JZDA 4MF6A 5AIVA 3VLNA 2XBQA 3H1NA 2KOKA 3M1GA 3ZYWA 3M0FA 4EO3A 3UAPA 5IM9A 1U3AA 2C0DA 4IBPA 4F0BA 3W8JA 2XPDA 1ZGNA 1SK0A 3IOSA 4K2DA 4GF0A 3FZAA 4MPGA 2CV4A 1ACVA 3P90A 1T8EB 2B5XA 5G30A 3G7IA 1OYJA 5HQPA 4FYCA 2PU9C 4I2UA 4YQMA 2I9HA 3U6VA 2P0GA 5C04A 3FK8A 1O7UA 1OC8A 1TRWA 4MJCA 1IYIA 3ZRDA 2DJ0A 1USBA 4BVYA 2PN8A 1AC1A 3P7XA 1PRXA 4MF5A 4QL7A 1M2BA 1S3CA 1XFLA 5DALB 2H1DA 1SL1B 1AQVA 1PMTA 4O5RA 2H1BA 4YQUA 4DVCA 1M2AA 5HFKA 4ILFA 13GSA 4G2EA 2CQ9A 2DBCA 1K0BA 2HZFA 1H4OA 3SBCA 4F9ZA 4GSNA 1PQNA 5JWQB 3ZIVA 1K0OA 4ZB6A 4JZQA 1R4WA 4KGIA 1OKTA 1XWGA 3KH9A 3VWXA 2BTOT 1PKZA 3RAZA 3GKMA 3EMPA 3IV4A 2H0HA 1RW1A 3UARA 1ILOA 2JZTA 3C1SA 5D96A 2EIQA 3ZL5A 4FO5A 4HU9A 3HYPA 4HDEA 4G9HA 1M0UA 5LNKe 4E8EA 4MF7A 2WRTA 2L5LA 1B8XA 1NHOA 4ZBAA 2YP6A 4K0NA 1TK0B 1OAZA 4NWYA 1GTIA 4MJBA 5KEJA 1W4VA 2PWJA 4AJ7A 3ISOA 4DEJA 4ML6A 1K3OA 3KXOA 4PNFA 2VL3A 2CAQA 1EOHA 2RM5A 4IJ3A 1SJ6A 3ZVJA 3ZFLA 2LNSA 3HA9A 3ERWA 3WT2A 2X99A 2C1YA 1M7TA 2VCTA 3D21A 3GKNA 2KUCA 5DBQA 2VCVA 3APSA 2CX4A 3F3RA 3J7Yb 4YAPA 1S3DA 1NM3A 1FG4A 4V1Ag 3LYKA 2CVBA 3R2QA 1T7PB 2YJHA 5ECPB 3TKQA 2VLTA 1JZOA 4MLYA 5J9CA 3ME8A 4V1Ap 3EYTA 5JCWA 5J41A 2NBSA 1M9AA 2QSIA 2H0GA 3JCML 2GDRA 9GSSA 5DJMA 5AGYA 3L0HA 2X8GA 2FY6A 3GN3A 3SWLA 4GCIA 3DYRA 3HKRA 2K8VA 2IJYA 4X43A 3FHKA 5COHA 1F3AA 3H79A 3F3QA 3FYGA 4N30A 2YV9A 1B48A 4QQ7A 3GH9A 2P31A 1SD8A 4GSTA 2YCDA 1OC9B 3EMXA 2PERA 2IMIA 1Y6EA 1CQHA 3EC3A 1VF4A 3E9JB 3KMOA 2OBIA 2LTKA 1WPIA 2HFDA 2GLRA 2XPEA 3KTBA 2H1AA 5ECSA 3W8SA 3GTUB 1PSQA 1VRSD 2JACA 4I8BA 1Z3EA 2R3XA 4KDUA 2GT5A 2YZUA 5H5RA 1SD9A 1EWXA 1B9XC 4I2TA 3TKSE 3I69A 1FVKA 2X8CA 1MDJA 2TIRA 3C71A 2GVPA 3KMNA 3F4TA 4TXOB 5KN1A 2IMEA 1A23A 2YWNA 2A2RA 2OBKA 4XIHA 1IYHA 3D22A 1O81A 2H75A 3UMAA 4MJAA 4PUAA 4N11A 5ECNB 4KSOA 2HXKA 4GSSA 1V40A 2VIMA 3VPTA 1A2LA 4RQRA 5G2ZA 4F82A 3ZFBA 4IS0A 1GSSA 2H01A 1GSYA 1XPVA 4KDXA 4DSSA 2VCZA 2OADA 3TRQA 3CSJA 3D4TA 1EV4A 2B1KA 3UOMA 2FCHA 2AUVA 1SYRA 1BAYA 3VWVA 1YKAA 2BJXA 5A4VA 3O76A 4MMMA 2C0GA 5KN2A 1J0FA 3LG6A 3DGQA 4HUAA 3RDWA 1LBKA 3N9JA 3KP9A 1THOA 2OA7A 4XTSA 3ZVJD 4TR0A 3HJPA 4O32A 2YANA 5IMVA 5C00A 1BQ7A 4BWSA 4HI7A 1GH2A 1EEJA 2X8HA 3O6TA 2IL3A 2VAFA 3O3TA 3KM6A 4P3YB 3MWHA 3CRTA 4AJ8A 4HZ2A 3C73A 2PUKC 2Z9SA 2C0FA 2GSRA 1T1VA 3HJOA 3QFAC 3FR9A 3H93A 1S3AA 2GQKA 5D9TA 1XOAA 4ECJA 5IQYA 1KNGA 5G5EA 5IMFA 1PA3A 2HE3A 2B7KA 3M9JA 1FB6A 2ES7A 2DMLA 3HZ4A 4ACSA 2VL9A 2CVDA 3APOA 1F6MC 2CX3A 2M80A 2VM2A 4IP1A 1JLWA 4ISDA 4MK3A 2NVLA 3CSHA 5DQSA 2F9SA 5CNWA 3VWWA 2CT6A 1GUMA 1K0MA 3WD6A 4XS4A 1NHYA 1ZOFA 5IPHA 4IKHA 2ALBA 4E8HA 3GV1A 3EU4A 2LJAA 2NTOA 2O8VB 2C80A 4ZL7A 2IMFA 3A3TA 4HEA2 5B8AA 4ECBA 3MSZA 2G2QA 1K0CA 2AV4A 3GSSA 4ZB9A 3H4KA 4I5QA 1FO5A 1SKWB 1J9BA 2FLSA 1GP1A 3QAVA 2VL2C 3US3A 11GSA 4NV5A 5DCHA 2BMXA 6GSWA 3I9V2 1ZL9A 2JSYA 2LRTA 4PURA 3TOTA 3GNJA 3PH9A 2K6VA 4J57E 3DXBA 1XWBA 2EC4A 1Z7PA 2B5EA 2VL2A 1PX6A 4N0ZA 3FEUA 3TDGA 2N5BA 2F8FA 1GSFA 2GQMA 5CO3A 4KSMA 3VFIA 2V2GA 2IFQA 3ZZXA 1G6WA 4ULXA 3IA1A 1AW9A 5ECKB 4N0VA 2L59A 4OWYA 1PL1A 5GZZB 1A24A 2V6KA 1MTCA 1SL2B 3BOAA 2ON5A 2GZZA 1YEPA 5JWOB 3FR6A 4JE1A 1VF3A 2E0QA 1V58A 1SYXA 3ERGA 1T4YA 5KN0A 1Q98A 3DVXA 3TKSC 1PX7A 3GKKA 1FW1A 3M8NA 2VOCA 4K9ZA 4OFMA 1V2AA 4MZCA 3TRPA 1K3LA 2H70A 3KH7A 4POLA 1XXUA 2V32A 3MAKA 3D6IA 5LCZA 5ABRA 1SKRB 1JZRA 3TCOA 3GX8A 2WCIA 2TRCP 4HQSA 2HYXA 3UVHA 4K8MA 2H66A 4EDYA 1CQGA 4K7NA 2B5YA 1BYEA 2HRNA 2VUPA 1NW2A 1JZWA 1ZYQB 2RUEA 1H75A 2WZ9A 3D0ZA 2VCWA 4L5OA 5GSTA 6GSUA 6GSXA 4ZBBA 1RQMA 1GLQA 5ECLB 3IAS2 1O85A 1X0RA 4J56E 2VCXA 2JSZA 5HR1A 3I43A 1GNWA 3FKFA 2GTUA 1XWCA 3VK9A 3Q6OA 2LQOA 4KAEA 3BCKA 4KX4A 5ID2A 3PGTA 1X9SB 3F4SA 4F0CA 3U5RE 2RLIA 1GUKA 3S9FA 2CAIA 2H76A 5DAKA 2NPBA 5H5QA 5G31A 2DJ1A 2H6ZA 1PL2A 2E2MA 2EIRA 2O89A 2RUFA 5G5FA 1WP0A 4XRDA 4PNGA 2B3SA 1UN2A 2ON7A 4Q5RA 4F2IA 3VURA 6GSTA 2F3MA 4ZL9A 4DSSB 5AIXA 1A0RP 4Q5FA 4H86A 2N5FA 1F9MA 1R5AA 2FGXA 2M46A 5IPGA 4IELA 4RQXA 2H6YA 1Y25A 4TXVA 3UBLA 5J4UA 5JCGA 4PGTA 4GRFA 1T3BA 2WS2A 2DJ3A 2LNTA 1BX9A 1XVQA 4D73A 2EIOA 3BCIA 1C72A 4LL4B 1SL0B 3RHBA 4L0WA 4TRXA 5GAND 4I97A 3TKRA 2WGRA 1FVJA 2LSTA 1UA5A 5ECOB 4NHWA 1U88A 2YZHA 4OCEA 1KTEA 2N5AA 4WKWA 1E2YA 3GHAA 1HNAA 3RBTA 5HR3A 4CDOA 3EWLA 4ID0A 3WT1A 1FAAA 4WBJA 1THXA 4TR4A 1X9MB 3CTGA 2GQLA 5ECHB 4BVXA 4IW9A 4JR6A 4GTUA 5CRGA 4KW6A 5IMCA 2R6KA 1ZCPA 4K0GA 2YN1A 1X5CA 2FA8A 5CREA 4HS1A 1GTBA 4HJ2A 3L78A 3DEXA 5B6NA 3RPPA 4K7OA 4EXJA 2ZNMA 4XS4B 4YH2A 3ZLPA 4K1FA 3M3MA 4XS6A 3NIVA 1AQXA 2I81A 2FD3A 1N2AA 1QXHA 5AISA 1QUWA 3KZQA 4BL7A 5ELGA 2CZ3A 5IOXA 1V57A 3VI7A 2CZ2A 3H8QA 3HZ8A 4IJIA 1QGVA 3TJKA 1TJDA 4MZWA 3VWUA 1WIKA 1OE7A 1EP7A 3IR4A 2MYGA 3J7Yk 4NPBA 2DIYA 1GUHA 4NV2A 3L4NA 1GWCA 1SK2A 3GKXA 2FWEA 1YJ6A 3L9SA 3PINA 3QD9A 2NDOA 4ZB8A 4OMVA 1BJXA 2HI7A 2K18A 3GFKA 1QQ2A 4Q5QA 4ZXGA 4QL9A 2C0EA 4ZL8A 3LSZA 1TRUA 5ECMB 5JWRB 4HQZA 1X5EA 1MEKA 1ERUA 2KP1A 2M72A 3E0UA 3IDVA 3QR6A 1ZMAA 3IPZA 2VD0A 3CYNA 4GLTA 1XW6A 1SKSB 2DC5A 3V1WA 4FYUA 2GS3A 1XBSA 3G9BA 4LMVA 2HZEA 4V2NA 1Z6NA 1RK4A 2OKAA 5HFIA 1R7HA 1XZOA 4ECCA 4NAXA 2OJLA 3HY2A 5DDLA 3EURA 1PN9A 4EVMA 1GULA 2XHFA 4J2FA 4JBBA 1SK1A 1TRSA 4EKZA 4NMUA 2V41A 4JRRA 1V98A 5GSSA 1DUGA 3BJ5A 3ED3A 3L9VA 3F6DA 1E6BA 4IGJA 2FA4A 3G7JA 2FNOA 1ML6A 3P2AA 3CXGA 3DRNA 2MMAA 5D9XA 4F03A 2VO4A 3FR3A 3TUEA 2VD1A 4AJ6A 2LRNA 1SENA 5KN3A 3MNGA 3CTFA 1TU8A 2OE0A 1A0FA 3UL3A 1XVWA 5HR0A 5DCGA 1YF1A 2D2ZA 2CVKA 4LMWA 2P5QA 1W89A 1U6TA 2FWGA 2JU5A 2KHPA 5ID2B 2RIIA 2FWFA 2TRXA 1DSBA 5D73A 2J23A 1GL8A 4GQCA 1XW9A 5FWGA 1MDIA 3GA4A 2F51A 1OKDA 5FHIA 2GZYA 1B4QA 1KBNA 5A4WA 1A8LA 5DAKB 1MD4A 2HSHA 3HD5A 2FWHA 5J5NA 5EL8A 4WBRD 3IRAA 1FHEA 2AJQB 1LJRA 2C4JA 2O87A 1VGLA 1TRVA 1TOFA 3TB2A 1JLVA 4MP4A 1O6JA 4WXTA 2YWIA 3TGZA 5A4UA 3QAWA 1QMVA 1YQ1A 5AN1A 1ST9A 1WMJA 3LEFA 1ERTA 2AYTA 2GSTA 5D9VA 4EL1A 1XIYA 3PR8A 2WJUA 2YPMA 3A2VA 4ZILA 4PQIA 2LJKA 4POBA 3AY8A 1QK8A 5G1KA 5GAPD 4TKYA 4WF5A 5IMAA 1WJKA 2L57A 4EE0A 4LL1B 4OD7A 1SJZA 2GSQA 2REMA 3A2WA 2V6OA 2H72A 1BG5A 2I1UA 1TXXA 3IXRA 3IAM2 3C7MA 3GL5A 2I3YA 4WF4A 4WR5A 3N5OA 4OCFA 3DIEA 4TN8A 4CHSA 3FY7A 4GWRA 2G0FA 2X64A 1TI1A 18GSA 4KH7A 2OE3A 4Z7XA 3HVXA 2A2SA 5IMDA 4PUFC 4X0XA 4GXZA 4PQHA 1XOBA 3F9UA 5INYA 1Q4JA 1HNBA 3LJRA 2L4CA 5ECRB 4DSQA 1YY7A 3FW2A 3IK7A 5G1LA 4HJMA 1TU7A 2RM6A 5A5KA 1EGRA 1PKWA 1TK5B 1GRXA 1T4ZA 5F0GA 3TJBA 2CA8A 8GSSA 4XCSA 5F06A 2C3NA 3MDKA 3HVVA 3GRXA 3TKSA 6GSVA 4IHUA 6GSYA 1KEBA 2IMKA 3TRXA 3F8UA 1Z9HA 3QOUA 2ZUPA 5JCUA 5CRDA 1XWAA 4LA1A 1WOUA 4XS1A 2YOIA 1YF0A 4FIWA 1JHBA 1DBYA 2H1GA 3KIJA 2AB6A 20GSA 3ZMLA 1BEDA 3BBYA 3LQ7A 2DIZA 2B6MA 1K3YA 1O8WA 1TTZA 4OFTA 4V2LA 4AGSA 4TW5A 5EY6A 2DJ2A 2LQQA 2WULA 3DMLA 2YV7A 4RUVA 1GLPA 2QC7A 1NSWA 1HQOA 2HZEB 3APQA 2WFCA 2DLXA 3LYPA 2R2JA 2MBTA 3F4RA 2J9HA 5J9BA 1R26A 2QKEA 3IK9A 3LGCA 3TJGA 2JL4A 1I9DA 3EU3A 1LU4A 2YJ7A 2L6DA 5B6MA 3UEMA 12GSA 4MDCA 4TR3A 4MA9A 1G7EA 2O7KA 1YZXA 4BPYA 3WGDA 1SJIA 3UJ1A 2VLUA 2FUG2 2B7JA 2H6XA 3G7YA 14GSA 4XHMA 1AIUA 1Z5YE 4KNDA 3F0IA 1X5DA 4PXOA 3KGKA 2YWMA 2C8UA 4MCUA 3QCPA 2E2GA 1O73A 4N10A 2GT6A 3C8EA 3FRCA 5HR2A 4O92A 1WRYA 3GMFA 5B8BA 1OE8A 3DD3A 1AXDA 1U87A 3D5JA 1Z6MA 4PX1A 1Z7RA 1WE0A 4TOPA 5J3RA 3Q19A 2R37A 2PVOC 3TKPA 4OFNA 3CMIA 3QPMA 4X1UA 5B7CA 2VM1A 2DMMA 3UVTA 1EEMA 3HJMA 3IHQA 3CRUA 2H73A 5ECIB 3QMXA 3ZREA 1O8XA 1MD3A 4XRAA 1GSQA 3GURA 4GQFA 2DJKA 4MPFA 17GSA 3VI5A 1YKCA 2H30A 3EINA 4MH3A 1YDKA 3L9UA 2OACA 1TK8B 4KB3A 2LRCA 1EP8A 1TW9A 1DE1A 2V1MA 5CRHA 2P5RA 4AF2A 2VCQA 5IMZA 4KDYA 1HNCA 3LFLA 5IO0A 1DE2A 1UVZA 4OO5A 3ZMKA 1TKDB 1GTUA 5DJLA 1A8YA 3DWVA 2LEGA 3Q18A 2K9FA 3C1RA 3IC4A 4TR1A 4RI7A 5F07A 2L6CA 5EPFA 1M2DA 4OO4A 4NHZA 3ME7A 4POKA 2LS5A 5LD0A 5H5SA 4EDZA 1B4PA 1AQWA 3ZIJA 2HNLA
chains in the Genus database with same CATH superfamily
3CSIA 3Q74A 3NZNA 2AHEA 2FHEA 4I6XA 3VPQA 1AUCA 2ZCTA 3NOFA 3OR5A 2IFQB 4POMA 2LV3A 1F2EA 5ELAA 3UBKA 4TVEA 4K5RA 1ABAA 1VF1A 1K0AA 4O7HA 1PGTA 5CP1A 3DVWA 3KP8A 2JADA 4JEDA 3WGXA 1XWKA 4ECIA 1HD2A 1TDIA 2MBSA 4ZBDA 4K6XA 2UZ8A 2MMOA 3I6AA 3EVIA 2H8LA 1ERWA 4MZBA 3KD0A 4BWQA 2B1LA 3HHVA 3ZITA 3TOUA 5IOWA 4PQ1A 5DVBA 1GTAA 3HXSA 3P8WA 3GUSA 3IBHA 1ON4A 3BD2A 1I5GA 2HRKA 2DSAA 1OVNA 1SU9A 3A2XA 4K7IA 5BMUA 4HSCX 5DALA 3QDNA 1TP9A 2PBJA 3M9KA 4FYBA 2H0IA 4KUNA 5E59A 2GGTA 2KP2A 2IWTA 3GSTA 4IQAA 4NXIA 22GSA 4V2MA 1OC3A 4FH8A 4WETA 4JU5A 4WR4A 1PFOA 2AAWA 10GSA 4ML1A 1FOVA 4KCEA 1GSDA 4G19A 3GIXA 2GSSA 1ZYEA 1X9WB 6GSSA 1HYUA 2PVQA 2VLVA 2H19A 5ECQB 5F8BA 2HSYA 1JFUA 3FZ5A 1R5PA 5CRWA 2R5GA 3LXZA 5D8IA 1V9WA 3GYKA 1M9BA 2KLXA 4IP6A 3DKSA 2C3TA 1EOGA 4YQVA 4LLRA 1G7OA 2XC2A 4HU7A 3GX0A 2IMDA 2F8AA 5E4WA 1PD21 2HT9A 5FT3A 3KEBA 1ERVA 7GSSA 1EZKA 3IE3A 5ENUA 2HRFA 5D9WA 3KJYA 4KCAA 1J08A 1N8JA 2O85A 3HVSA 3KTLA 5L71A 2WB9A 1M99A 4K5SA 3IC8A 2QGVA 1VF2A 4JR4A 1AAZA 2HLSA 4L5LA 1UC7A 2MMNA 2A4HA 5EVOA 1WWJA 2GZPA 2PGTA 1ZZYA 4L0UA 1MDKA 4IQ1A 1GSUA 2A2PA 1F3BA 2L4QA 1QFNA 3QFBC 2E7PA 4Q5NA 4D73B 4EF0A 2IPAA 3TJFA 4EUYA 4L8EA 4MJEA 2LKUA 5CAXA 2YNXA 1A2MA 1GNEA 3RHCA 3A5WA 3RPNA 1YEXA 16GSA 5HFGA 2JZRA 1K0NA 3IHGA 3PPUA 1U3IA 3A5IA 4MABA 3K8NA 2YWOA 1XCCA 4YAVA 3LXTA 2PMTA 2IN3A 5IO2A 2DJJA 3FZ9A 1EGOA 2R4VA 5DQYA 4YKFA 4KE3A 4G10A 2H74A 2H71A 2MMZA 3MYDA 4ZIJA 2OE1A 4IN0A 3HDCA 3GL3A 1OC9A 1FB0A 3ZTLA 2LUSA 4HZ4A 2XBIA 3QAGA 1EV9A 1B9YC 3LW9A 4KA0A 4WEYA 3LWAA 3GH6A 5IIZA 1G6YA 3GTUA 1G0TA 2K8SA 1GSEA 3F63A 4DSRA 1TI3A 4BA7A 3UIWA 3E3EA 5F05A 3ERFA 2L5OA 3FZ4A 1XW5A 3D4MA 1F37A 3LORA 2MZCA 4HOJA 4TXOA 3WYWA 3F6FA 4MH2A 19GSA 2JZSA 1A2JA 2I4AA 3W6GA 3CBUA 3TJJA 1K0DA 4TR1B 3HCZA 2A4VA 4EC0A 4RI6A 2PPTA 5D93A 2LJRA 3EE2A 5CYYA 4IVFA 2C3QA 4CW9A 1URMA 3KCMA 1T00A 2IIYA 2WDUA 3WGEA 1JZDA 4MF6A 5AIVA 3VLNA 2XBQA 3H1NA 2KOKA 3M1GA 3ZYWA 3M0FA 4EO3A 3UAPA 5IM9A 1U3AA 2C0DA 4IBPA 4F0BA 3W8JA 2XPDA 1ZGNA 1SK0A 3IOSA 4K2DA 4GF0A 3FZAA 4MPGA 2CV4A 1ACVA 3P90A 1T8EB 2B5XA 5G30A 3G7IA 1OYJA 5HQPA 4FYCA 2PU9C 4I2UA 4YQMA 2I9HA 3U6VA 2P0GA 5C04A 3FK8A 1O7UA 1OC8A 1TRWA 4MJCA 1IYIA 3ZRDA 2DJ0A 1USBA 4BVYA 2PN8A 1AC1A 3P7XA 1PRXA 4MF5A 4QL7A 1M2BA 1S3CA 1XFLA 5DALB 2H1DA 1SL1B 1AQVA 1PMTA 4O5RA 2H1BA 4YQUA 4DVCA 1M2AA 5HFKA 4ILFA 13GSA 4G2EA 2CQ9A 2DBCA 1K0BA 2HZFA 1H4OA 3SBCA 4F9ZA 4GSNA 1PQNA 5JWQB 3ZIVA 1K0OA 4ZB6A 4JZQA 1R4WA 4KGIA 1OKTA 1XWGA 3KH9A 3VWXA 2BTOT 1PKZA 3RAZA 3GKMA 3EMPA 3IV4A 2H0HA 1RW1A 3UARA 1ILOA 2JZTA 3C1SA 5D96A 2EIQA 3ZL5A 4FO5A 4HU9A 3HYPA 4HDEA 4G9HA 1M0UA 2HRAA 5LNKe 4E8EA 4MF7A 2WRTA 2L5LA 4Z2UA 1B8XA 1NHOA 3R3EA 4ZBAA 2YP6A 4K0NA 1TK0B 1OAZA 4NWYA 1GTIA 4MJBA 5KEJA 1W4VA 2PWJA 4AJ7A 3ISOA 4DEJA 4ML6A 1K3OA 3KXOA 4PNFA 2VL3A 2CAQA 1EOHA 2RM5A 4IJ3A 1SJ6A 3ZVJA 3ZFLA 2LNSA 3HA9A 3ERWA 3WT2A 2X99A 2C1YA 2QA2A 1M7TA 2VCTA 3D21A 3GKNA 2KUCA 5DBQA 4G0KA 2VCVA 3APSA 2CX4A 3F3RA 3J7Yb 4YAPA 1S3DA 1NM3A 4G0IA 1FG4A 4V1Ag 3LYKA 2CVBA 3R2QA 1T7PB 2YJHA 5ECPB 3TKQA 2VLTA 1JZOA 4MLYA 5J9CA 3ME8A 4V1Ap 3EYTA 5JCWA 5J41A 2NBSA 1M9AA 4EIPA 2QSIA 2H0GA 3JCML 2GDRA 9GSSA 5DJMA 5AGYA 3L0HA 2X8GA 2FY6A 3GN3A 3SWLA 1M3JA 4GCIA 3DYRA 3HKRA 2K8VA 2IJYA 4X43A 3FHKA 5COHA 1F3AA 3H79A 3F3QA 3FYGA 4N30A 4EIQA 2YV9A 1B48A 4QQ7A 3GH9A 2P31A 1SD8A 4GSTA 2YCDA 1OC9B 3EMXA 2PERA 2IMIA 1Y6EA 1CQHA 3EC3A 4K2XA 1VF4A 3E9JB 3KMOA 2OBIA 2LTKA 1WPIA 2HFDA 2GLRA 2XPEA 3KTBA 2H1AA 5ECSA 3W8SA 3GTUB 1PSQA 1VRSD 2JACA 4I8BA 1Z3EA 2R3XA 4KDUA 2GT5A 2YZUA 5H5RA 1SD9A 1EWXA 1B9XC 4I2TA 3TKSE 3I69A 1FVKA 2X8CA 4O5UA 1MDJA 2TIRA 3C71A 2GVPA 3KMNA 3F4TA 4TXOB 5KN1A 2IMEA 1A23A 2YWNA 2A2RA 2OBKA 4XIHA 1IYHA 3D22A 1O81A 2H75A 3UMAA 4MJAA 4PUAA 4N11A 5ECNB 4KSOA 2HXKA 4GSSA 1V40A 4Z2TA 2VIMA 3VPTA 1A2LA 4RQRA 5G2ZA 4F82A 3ZFBA 4IS0A 4G0LA 1GSSA 2H01A 5KOXA 1GSYA 1XPVA 4KDXA 4DSSA 2VCZA 2OADA 3TRQA 3CSJA 3D4TA 1EV4A 2B1KA 3UOMA 2FCHA 2AUVA 1SYRA 1BAYA 3VWVA 1YKAA 2BJXA 5A4VA 3O76A 4MMMA 2C0GA 5KN2A 1J0FA 3LG6A 3DGQA 4HUAA 3RDWA 1LBKA 3N9JA 3KP9A 1THOA 2OA7A 4XTSA 3ZVJD 4TR0A 3HJPA 4O32A 2YANA 5IMVA 5C00A 1BQ7A 4BWSA 4HI7A 1GH2A 1EEJA 2X8HA 3O6TA 2IL3A 2VAFA 3O3TA 3KM6A 4P3YB 3MWHA 3CRTA 4AJ8A 4HZ2A 3C73A 2PUKC 1ZYPA 2Z9SA 2C0FA 2GSRA 1T1VA 3HJOA 3QFAC 3FR9A 3H93A 1S3AA 2GQKA 5D9TA 1XOAA 4ECJA 5IQYA 1KNGA 5G5EA 5IMFA 1PA3A 2HE3A 2B7KA 3M9JA 1FB6A 2ES7A 2DMLA 3HZ4A 4ACSA 2VL9A 2CVDA 3APOA 1F6MC 2CX3A 2M80A 2VM2A 4IP1A 1JLWA 4ISDA 4MK3A 2NVLA 1XG8A 3CSHA 2F9SA 5CNWA 5DQSA 3VWWA 2CT6A 1GUMA 1K0MA 3WD6A 4XS4A 1NHYA 1ZOFA 5IPHA 4IKHA 2ALBA 4E8HA 3GV1A 3EU4A 2LJAA 2NTOA 2O8VB 2C80A 4ZL7A 2IMFA 3A3TA 4HEA2 5B8AA 4ECBA 3MSZA 2G2QA 1K0CA 2AV4A 3GSSA 4ZB9A 3H4KA 4I5QA 1FO5A 1SKWB 1J9BA 2FLSA 1GP1A 3QAVA 2VL2C 3US3A 11GSA 4NV5A 5DCHA 2BMXA 6GSWA 3I9V2 1ZL9A 2JSYA 2LRTA 4PURA 3TOTA 3GNJA 3PH9A 2K6VA 4J57E 3DXBA 1XWBA 2EC4A 1Z7PA 2B5EA 2VL2A 1PX6A 4N0ZA 3FEUA 3TDGA 2N5BA 2F8FA 1GSFA 2GQMA 5CO3A 4KSMA 3VFIA 2V2GA 2IFQA 3ZZXA 1G6WA 4ULXA 3IA1A 1AW9A 5ECKB 4N0VA 2L59A 4OWYA 1PL1A 5GZZB 1A24A 2V6KA 1MTCA 1SL2B 3BOAA 2ON5A 2GZZA 1YEPA 5JWOB 3FR6A 4JE1A 1VF3A 2E0QA 1V58A 1SYXA 3ERGA 1T4YA 5KN0A 1Q98A 3DVXA 3TKSC 1M3IA 1PX7A 3GKKA 1FW1A 3M8NA 2VOCA 4K9ZA 4OFMA 1V2AA 4MZCA 3TRPA 1K3LA 2H70A 3KH7A 4POLA 1XXUA 2R0CA 2V32A 3MAKA 3D6IA 5LCZA 5ABRA 1SKRB 1JZRA 3TCOA 3GX8A 2WCIA 2TRCP 4HQSA 2HYXA 3UVHA 4K8MA 3CQFA 3HVNA 2H66A 4EDYA 1CQGA 4K7NA 2B5YA 1BYEA 2HRNA 2VUPA 1NW2A 1JZWA 1ZYQB 2RUEA 1H75A 2WZ9A 1PN0A 3D0ZA 2VCWA 4L5OA 5GSTA 6GSUA 6GSXA 4ZBBA 1RQMA 1GLQA 5ECLB 3IAS2 4BIKA 1O85A 1X0RA 4J56E 2VCXA 2JSZA 5HR1A 3I43A 1GNWA 3FKFA 2GTUA 1XWCA 3VK9A 3Q6OA 2LQOA 4KAEA 3BCKA 4KX4A 5ID2A 3PGTA 1X9SB 3F4SA 4F0CA 3U5RE 2RLIA 1GUKA 3S9FA 2CAIA 2H76A 5DAKA 2NPBA 5H5QA 5G31A 2DJ1A 2H6ZA 1PL2A 2E2MA 2EIRA 2O89A 2RUFA 5G5FA 1WP0A 4XRDA 4PNGA 2B3SA 1UN2A 2ON7A 4Q5RA 4F2IA 3VURA 6GSTA 2F3MA 4ZL9A 4DSSB 5AIXA 1A0RP 4Q5FA 4H86A 2N5FA 1F9MA 1R5AA 2FGXA 2M46A 5IPGA 4IELA 4RQXA 2H6YA 1Y25A 4TXVA 3UBLA 5J4UA 5JCGA 4PGTA 4GRFA 1T3BA 2WS2A 4CY6A 2DJ3A 2LNTA 1BX9A 1XVQA 4D73A 2EIOA 3BCIA 1C72A 4LL4B 1SL0B 3RHBA 4L0WA 4TRXA 5GAND 4I97A 3TKRA 2WGRA 1FVJA 2LSTA 1UA5A 5ECOB 4NHWA 5BRTA 5KOWA 1U88A 2YZHA 4YKGA 4OCEA 1KTEA 2N5AA 4WKWA 1E2YA 3GHAA 1HNAA 3RBTA 5HR3A 4CDOA 3EWLA 4ICYA 4ID0A 3WT1A 1FAAA 4WBJA 3EPTA 1THXA 4TR4A 1X9MB 3CTGA 2GQLA 5ECHB 4BVXA 4IW9A 4JR6A 4GTUA 5CRGA 4KW6A 5IMCA 2R6KA 1ZCPA 4K0GA 2YN1A 1X5CA 2FA8A 5CREA 4HS1A 1GTBA 4HJ2A 3L78A 3DEXA 5B6NA 3RPPA 4K7OA 4EXJA 2ZNMA 4XS4B 4YH2A 3ZLPA 4K1FA 3M3MA 4XS6A 3NIVA 1AQXA 2I81A 2FD3A 1N2AA 1QXHA 5AISA 1QUWA 3KZQA 4BL7A 4PTSA 5ELGA 2CZ3A 5IOXA 1V57A 3VI7A 2CZ2A 3H8QA 3HZ8A 4IJIA 1QGVA 3TJKA 1TJDA 4MZWA 3VWUA 1WIKA 1OE7A 1EP7A 3IR4A 2MYGA 3J7Yk 4NPBA 2DIYA 1GUHA 4NV2A 3L4NA 1GWCA 1SK2A 3GKXA 2FWEA 1YJ6A 3L9SA 3PINA 3QD9A 2NDOA 4ZB8A 4OMVA 1BJXA 2HI7A 2K18A 3GFKA 1QQ2A 4Q5QA 4ZXGA 4QL9A 2C0EA 4ZL8A 3LSZA 1TRUA 5ECMB 5JWRB 4HQZA 1X5EA 1MEKA 1ERUA 2KP1A 2M72A 3E0UA 3IDVA 3QR6A 1ZMAA 3IPZA 2VD0A 3CYNA 4GLTA 1XW6A 1SKSB 2DC5A 3V1WA 4FYUA 2GS3A 1XBSA 3G9BA 4LMVA 2HZEA 4V2NA 4MNNA 1Z6NA 1RK4A 2OKAA 5HFIA 1R7HA 1XZOA 4ECCA 4NAXA 2OJLA 3HY2A 5DDLA 3EURA 1PN9A 4EVMA 1GULA 2XHFA 4J2FA 4JBBA 1SK1A 1TRSA 4EKZA 4NMUA 2V41A 4JRRA 1V98A 5GSSA 1DUGA 3BJ5A 3ED3A 3L9VA 3F6DA 1FOHA 1E6BA 4IGJA 2FA4A 3G7JA 1S3RA 2FNOA 1ML6A 2X4AA 3P2AA 3CXGA 3DRNA 2MMAA 5D9XA 4F03A 2VO4A 3FR3A 3TUEA 2VD1A 4AJ6A 2LRNA 1SENA 5KN3A 3MNGA 3CTFA 1TU8A 2OE0A 1A0FA 3UL3A 1XVWA 5HR0A 5DCGA 1YF1A 2D2ZA 4BVYB 2CVKA 4LMWA 2P5QA 1W89A 1U6TA 2FWGA 2JU5A 2KHPA 5ID2B 2RIIA 2FWFA 2TRXA 1DSBA 5D73A 2J23A 1GL8A 4GQCA 1XW9A 5FWGA 1MDIA 3GA4A 2F51A 1OKDA 5FHIA 2GZYA 1B4QA 1KBNA 5A4WA 1A8LA 5DAKB 1MD4A 2HSHA 3HD5A 2FWHA 5J5NA 5EL8A 4WBRD 3IRAA 1FHEA 2AJQB 1LJRA 2C4JA 2O87A 1VGLA 1TRVA 1TOFA 3TB2A 1JLVA 4MP4A 1O6JA 4WXTA 2YWIA 3TGZA 5A4UA 3QAWA 1QMVA 1YQ1A 2R0PA 5AN1A 1ST9A 2DKHA 1WMJA 3LEFA 1ERTA 2AYTA 2GSTA 5D9VA 4EL1A 1XIYA 3PR8A 2WJUA 2YPMA 3A2VA 4ZILA 4PQIA 2LJKA 4POBA 3AY8A 1QK8A 5G1KA 5GAPD 4TKYA 4WF5A 5IMAA 1WJKA 2L57A 4EE0A 4LL1B 4OD7A 2QA1A 1SJZA 2GSQA 2REMA 3A2WA 2V6OA 2H72A 1BG5A 2I1UA 1TXXA 3IXRA 3IAM2 3C7MA 3GL5A 2I3YA 4WF4A 4WR5A 3N5OA 4OCFA 1ZYNA 4KF9A 3DIEA 4TN8A 4CHSA 2DKIA 3FY7A 4GWRA 2G0FA 2X64A 1TI1A 18GSA 4KH7A 4BVXB 2OE3A 4Z7XA 4Z2RA 3HVXA 2A2SA 4FQUA 5IMDA 4PUFC 4X0XA 4GXZA 4A5PA 4PQHA 1XOBA 3F9UA 5INYA 1Q4JA 1HNBA 3LJRA 2L4CA 5ECRB 4DSQA 4USSA 1YY7A 3FW2A 3IK7A 5G1LA 4HJMA 1TU7A 2RM6A 5A5KA 1EGRA 1PKWA 1TK5B 2R0GA 4X4JA 1GRXA 1T4ZA 5F0GA 3TJBA 4BL7B 2CA8A 2HSMA 8GSSA 4XCSA 5F06A 2C3NA 3MDKA 3HVVA 3GRXA 3TKSA 6GSVA 4IHUA 6GSYA 1KEBA 2IMKA 3TRXA 3F8UA 1Z9HA 3QOUA 2ZUPA 5JCUA 5CRDA 1XWAA 4LA1A 1WOUA 4XS1A 2YOIA 1YF0A 4FIWA 1JHBA 1DBYA 2H1GA 3KIJA 2AB6A 20GSA 4CY8A 3ZMLA 1BEDA 3BBYA 3LQ7A 2DIZA 2B6MA 1K3YA 1O8WA 1TTZA 4OFTA 4V2LA 4AGSA 4TW5A 5EY6A 2DJ2A 2LQQA 4O5QA 2WULA 3DMLA 2YV7A 4RUVA 1GLPA 2QC7A 1NSWA 1HQOA 2HZEB 3APQA 2WFCA 2DLXA 3LYPA 2R2JA 2MBTA 3F4RA 2J9HA 5J9BA 1R26A 2QKEA 3IK9A 3LGCA 3TJGA 2JL4A 1I9DA 3EU3A 1LU4A 2YJ7A 2L6DA 5B6MA 3UEMA 12GSA 2X49A 4MDCA 4TR3A 4MA9A 1G7EA 2O7KA 1YZXA 4BPYA 3WGDA 1SJIA 3UJ1A 2VLUA 2FUG2 2B7JA 2H6XA 3G7YA 14GSA 4XHMA 1AIUA 1Z5YE 4KNDA 3F0IA 1X5DA 4PXOA 3KGKA 2YWMA 2C8UA 4MCUA 3QCPA 2E2GA 1O73A 4N10A 2GT6A 3C8EA 3FRCA 5HR2A 4O92A 1WRYA 3GMFA 5B8BA 3MIXA 1OE8A 3DD3A 1AXDA 1U87A 3FMWA 3D5JA 1Z6MA 4PX1A 1Z7RA 1WE0A 4TOPA 5J3RA 3Q19A 2R37A 2PVOC 3TKPA 4OFNA 3CMIA 3QPMA 4X1UA 5B7CA 2VM1A 2DMMA 3UVTA 1EEMA 3HJMA 3IHQA 3CRUA 2H73A 5ECIB 3QMXA 3ZREA 1O8XA 1MD3A 4XRAA 1GSQA 3GURA 4GQFA 2DJKA 4MPFA 17GSA 3VI5A 1YKCA 2H30A 3EINA 4MH3A 1YDKA 3L9UA 2OACA 1TK8B 4KB3A 2LRCA 1EP8A 1TW9A 1DE1A 2V1MA 5CRHA 2P5RA 4AF2A 2VCQA 5IMZA 4KDYA 1HNCA 3LFLA 5IO0A 1DE2A 1UVZA 4OO5A 3ZMKA 1TKDB 1GTUA 5DJLA 1A8YA 3DWVA 2LEGA 3Q18A 2K9FA 3C1RA 3IC4A 4TR1A 4RI7A 5F07A 2L6CA 5EPFA 1M2DA 4OO4A 4NHZA 3ME7A 4POKA 2LS5A 5LD0A 5H5SA 4EDZA 1B4PA 1AQWA 3ZIJA 2HNLA
chains in the Genus database with same CATH topology
3CSIA 3Q74A 3NZNA 2AHEA 2FHEA 4I6XA 3VPQA 1AUCA 2ZCTA 3NOFA 3OR5A 2IFQB 4POMA 2LV3A 1F2EA 5ELAA 3UBKA 4TVEA 4K5RA 1ABAA 1VF1A 1K0AA 4O7HA 1PGTA 5CP1A 3DVWA 3KP8A 2JADA 4JEDA 3WGXA 1XWKA 4ECIA 1HD2A 1TDIA 2MBSA 4ZBDA 4K6XA 2UZ8A 2MMOA 3I6AA 3EVIA 2H8LA 1ERWA 4MZBA 3KD0A 4BWQA 2B1LA 3HHVA 3ZITA 3TOUA 5IOWA 4PQ1A 5DVBA 1GTAA 3HXSA 3P8WA 3GUSA 3IBHA 1ON4A 3BD2A 1I5GA 2HRKA 2DSAA 1OVNA 1SU9A 3A2XA 4K7IA 5BMUA 5DALA 3QDNA 1TP9A 2PBJA 3M9KA 4FYBA 2H0IA 4KUNA 5E59A 2GGTA 2KP2A 2IWTA 3GSTA 4IQAA 4NXIA 22GSA 4V2MA 1OC3A 4FH8A 4WETA 4JU5A 4WR4A 2AAWA 10GSA 4ML1A 1FOVA 4KCEA 1GSDA 4G19A 3GIXA 2GSSA 1ZYEA 1X9WB 6GSSA 1HYUA 2PVQA 2VLVA 2H19A 5ECQB 5F8BA 2HSYA 1JFUA 3FZ5A 1R5PA 5CRWA 2R5GA 3LXZA 5D8IA 1V9WA 3GYKA 1M9BA 2KLXA 4IP6A 3DKSA 2C3TA 1EOGA 4YQVA 4LLRA 1G7OA 2XC2A 4HU7A 3GX0A 2IMDA 2F8AA 5E4WA 1PD21 2HT9A 5FT3A 3KEBA 1ERVA 7GSSA 1EZKA 3IE3A 5ENUA 2HRFA 5D9WA 3KJYA 4KCAA 1J08A 1N8JA 2O85A 3HVSA 3KTLA 5L71A 2WB9A 1M99A 4K5SA 3IC8A 2QGVA 1VF2A 4JR4A 1AAZA 2HLSA 4L5LA 1UC7A 2MMNA 2A4HA 5EVOA 1WWJA 2GZPA 2PGTA 1ZZYA 4L0UA 1MDKA 4IQ1A 1GSUA 2A2PA 1F3BA 2L4QA 1QFNA 3QFBC 2E7PA 4Q5NA 4D73B 4EF0A 2IPAA 3TJFA 4EUYA 4L8EA 4MJEA 2LKUA 5CAXA 2YNXA 1A2MA 1GNEA 3RHCA 3A5WA 3RPNA 1YEXA 16GSA 5HFGA 2JZRA 1K0NA 3IHGA 3PPUA 1U3IA 3A5IA 4MABA 3K8NA 2YWOA 1XCCA 4YAVA 3LXTA 2PMTA 2IN3A 5IO2A 2DJJA 3FZ9A 1EGOA 2R4VA 5DQYA 4YKFA 4KE3A 4G10A 2H74A 2H71A 2MMZA 3MYDA 4ZIJA 2OE1A 4IN0A 3HDCA 3GL3A 1OC9A 1FB0A 3ZTLA 2LUSA 4HZ4A 2XBIA 3QAGA 1EV9A 1B9YC 3LW9A 4KA0A 4WEYA 3LWAA 3GH6A 5IIZA 1G6YA 3GTUA 1G0TA 2K8SA 1GSEA 3F63A 4DSRA 1TI3A 4BA7A 3UIWA 3E3EA 5F05A 3ERFA 2L5OA 3FZ4A 1XW5A 3D4MA 1F37A 3LORA 2MZCA 4HOJA 4TXOA 3WYWA 3F6FA 4MH2A 19GSA 2JZSA 1A2JA 2I4AA 3W6GA 3CBUA 3TJJA 1K0DA 4TR1B 3HCZA 2A4VA 4EC0A 4RI6A 2PPTA 5D93A 2LJRA 3EE2A 5CYYA 4IVFA 2C3QA 4CW9A 1URMA 3KCMA 1T00A 2IIYA 2WDUA 3WGEA 1JZDA 4MF6A 5AIVA 3VLNA 2XBQA 3H1NA 2KOKA 3M1GA 3ZYWA 3M0FA 4EO3A 3UAPA 5IM9A 1U3AA 2C0DA 4IBPA 4F0BA 3W8JA 2XPDA 1ZGNA 1SK0A 3IOSA 4K2DA 4GF0A 3FZAA 4MPGA 2CV4A 1ACVA 3P90A 1T8EB 2B5XA 5G30A 3G7IA 1OYJA 5HQPA 4FYCA 2PU9C 4I2UA 4YQMA 2I9HA 3U6VA 2P0GA 5C04A 3FK8A 1O7UA 1OC8A 1TRWA 4MJCA 1IYIA 3ZRDA 2DJ0A 1USBA 4BVYA 2PN8A 1AC1A 3P7XA 1PRXA 4MF5A 4QL7A 1M2BA 1S3CA 1XFLA 5DALB 2H1DA 1SL1B 1AQVA 1PMTA 4O5RA 2H1BA 4YQUA 4DVCA 1M2AA 5HFKA 4ILFA 13GSA 4G2EA 2CQ9A 2DBCA 1K0BA 2HZFA 1H4OA 3SBCA 4F9ZA 4GSNA 1PQNA 5JWQB 3ZIVA 1K0OA 4ZB6A 4JZQA 1R4WA 4KGIA 1OKTA 1XWGA 3KH9A 3VWXA 2BTOT 1PKZA 3RAZA 3GKMA 3EMPA 3IV4A 2H0HA 1RW1A 3UARA 1ILOA 2JZTA 3C1SA 5D96A 2EIQA 3ZL5A 4FO5A 4HU9A 3HYPA 4HDEA 4G9HA 1M0UA 2HRAA 5LNKe 4E8EA 4MF7A 2WRTA 2L5LA 4Z2UA 1B8XA 1NHOA 3R3EA 4ZBAA 2YP6A 4K0NA 1TK0B 1OAZA 4NWYA 1GTIA 4MJBA 5KEJA 1W4VA 2PWJA 4AJ7A 3ISOA 4DEJA 4ML6A 1K3OA 3KXOA 4PNFA 2VL3A 2CAQA 1EOHA 2RM5A 4IJ3A 1SJ6A 3ZVJA 3ZFLA 2LNSA 3HA9A 3ERWA 3WT2A 2X99A 2C1YA 2QA2A 1M7TA 2VCTA 3D21A 3GKNA 2KUCA 5DBQA 4G0KA 2VCVA 3APSA 2CX4A 3F3RA 3J7Yb 4YAPA 1S3DA 1NM3A 4G0IA 1FG4A 4V1Ag 3LYKA 2CVBA 3R2QA 1T7PB 2YJHA 5ECPB 3TKQA 2VLTA 1JZOA 4MLYA 5J9CA 3ME8A 4V1Ap 3EYTA 5JCWA 5J41A 2NBSA 1M9AA 4EIPA 2QSIA 2H0GA 3JCML 2GDRA 9GSSA 5DJMA 5AGYA 3L0HA 2X8GA 2FY6A 3GN3A 3SWLA 4GCIA 3DYRA 3HKRA 2K8VA 2IJYA 4X43A 3FHKA 5COHA 1F3AA 3H79A 3F3QA 3FYGA 4N30A 4EIQA 2YV9A 1B48A 4QQ7A 3GH9A 2P31A 1SD8A 4GSTA 2YCDA 1OC9B 3EMXA 2PERA 2IMIA 1Y6EA 1CQHA 3EC3A 4K2XA 1VF4A 3E9JB 3KMOA 2OBIA 2LTKA 1WPIA 2HFDA 2GLRA 2XPEA 3KTBA 2H1AA 5ECSA 3W8SA 3GTUB 1PSQA 1VRSD 2JACA 4I8BA 1Z3EA 2R3XA 4KDUA 2GT5A 2YZUA 5H5RA 1SD9A 1EWXA 1B9XC 4I2TA 3TKSE 3I69A 1FVKA 2X8CA 4O5UA 1MDJA 2TIRA 3C71A 2GVPA 3KMNA 3F4TA 4TXOB 5KN1A 2IMEA 1A23A 2YWNA 2A2RA 2OBKA 4XIHA 1IYHA 3D22A 1O81A 2H75A 3UMAA 4MJAA 4PUAA 4N11A 5ECNB 4KSOA 2HXKA 4GSSA 1V40A 4Z2TA 2VIMA 3VPTA 1A2LA 4RQRA 5G2ZA 4F82A 3ZFBA 4IS0A 4G0LA 1GSSA 2H01A 5KOXA 1GSYA 1XPVA 4KDXA 4DSSA 2VCZA 2OADA 3TRQA 3CSJA 3D4TA 1EV4A 2B1KA 3UOMA 2FCHA 2AUVA 1SYRA 1BAYA 3VWVA 1YKAA 2BJXA 5A4VA 3O76A 4MMMA 2C0GA 5KN2A 1J0FA 3LG6A 3DGQA 4HUAA 3RDWA 1LBKA 3N9JA 3KP9A 1THOA 2OA7A 4XTSA 3ZVJD 4TR0A 3HJPA 4O32A 2YANA 5IMVA 5C00A 1BQ7A 4BWSA 4HI7A 1GH2A 1EEJA 2X8HA 3O6TA 2IL3A 2VAFA 3O3TA 3KM6A 4P3YB 3MWHA 3CRTA 4AJ8A 4HZ2A 3C73A 2PUKC 1ZYPA 2Z9SA 2C0FA 2GSRA 1T1VA 3HJOA 3QFAC 3FR9A 3H93A 1S3AA 2GQKA 5D9TA 1XOAA 4ECJA 5IQYA 1KNGA 5G5EA 5IMFA 1PA3A 2HE3A 2B7KA 3M9JA 1FB6A 2ES7A 2DMLA 3HZ4A 4ACSA 2VL9A 2CVDA 3APOA 1F6MC 2CX3A 2M80A 2VM2A 4IP1A 1JLWA 4ISDA 4MK3A 2NVLA 3CSHA 5DQSA 2F9SA 5CNWA 3VWWA 2CT6A 1GUMA 1K0MA 3WD6A 4XS4A 1NHYA 1ZOFA 5IPHA 4IKHA 2ALBA 4E8HA 3GV1A 3EU4A 2LJAA 2NTOA 2O8VB 2C80A 4ZL7A 2IMFA 3A3TA 4HEA2 5B8AA 4ECBA 3MSZA 2G2QA 1K0CA 2AV4A 3GSSA 4ZB9A 3H4KA 4I5QA 1FO5A 1SKWB 1J9BA 2FLSA 1GP1A 3QAVA 2VL2C 3US3A 11GSA 4NV5A 5DCHA 2BMXA 6GSWA 3I9V2 1ZL9A 2JSYA 2LRTA 4PURA 3TOTA 3GNJA 3PH9A 2K6VA 4J57E 3DXBA 1XWBA 2EC4A 1Z7PA 2B5EA 2VL2A 1PX6A 4N0ZA 3FEUA 3TDGA 2N5BA 2F8FA 1GSFA 2GQMA 5CO3A 4KSMA 3VFIA 2V2GA 2IFQA 3ZZXA 1G6WA 4ULXA 3IA1A 1AW9A 5ECKB 4N0VA 2L59A 4OWYA 1PL1A 5GZZB 1A24A 2V6KA 1MTCA 1SL2B 3BOAA 2ON5A 2GZZA 1YEPA 5JWOB 3FR6A 4JE1A 1VF3A 2E0QA 1V58A 1SYXA 3ERGA 1T4YA 5KN0A 1Q98A 3DVXA 3TKSC 1PX7A 3GKKA 1FW1A 3M8NA 2VOCA 4K9ZA 4OFMA 1V2AA 4MZCA 3TRPA 1K3LA 2H70A 3KH7A 4POLA 1XXUA 2R0CA 2V32A 3MAKA 3D6IA 5LCZA 5ABRA 1SKRB 1JZRA 3TCOA 3GX8A 2WCIA 2TRCP 4HQSA 2HYXA 3UVHA 4K8MA 2H66A 4EDYA 1CQGA 4K7NA 2B5YA 1BYEA 2HRNA 2VUPA 1NW2A 1JZWA 1ZYQB 2RUEA 1H75A 2WZ9A 1PN0A 3D0ZA 2VCWA 4L5OA 5GSTA 6GSUA 6GSXA 4ZBBA 1RQMA 1GLQA 5ECLB 3IAS2 1O85A 1X0RA 4J56E 2VCXA 2JSZA 5HR1A 3I43A 1GNWA 3FKFA 2GTUA 1XWCA 3VK9A 3Q6OA 2LQOA 4KAEA 3BCKA 4KX4A 5ID2A 3PGTA 1X9SB 3F4SA 4F0CA 3U5RE 2RLIA 1GUKA 3S9FA 2CAIA 2H76A 5DAKA 2NPBA 5H5QA 5G31A 2DJ1A 2H6ZA 1PL2A 2E2MA 2EIRA 2O89A 2RUFA 5G5FA 1WP0A 4XRDA 4PNGA 2B3SA 1UN2A 2ON7A 4Q5RA 4F2IA 3VURA 6GSTA 2F3MA 4ZL9A 4DSSB 5AIXA 1A0RP 4Q5FA 4H86A 2N5FA 1F9MA 1R5AA 2FGXA 2M46A 5IPGA 4IELA 4RQXA 2H6YA 1Y25A 4TXVA 3UBLA 5J4UA 5JCGA 4PGTA 4GRFA 1T3BA 2WS2A 4CY6A 2DJ3A 2LNTA 1BX9A 1XVQA 4D73A 2EIOA 3BCIA 1C72A 4LL4B 1SL0B 3RHBA 4L0WA 4TRXA 5GAND 4I97A 3TKRA 2WGRA 1FVJA 2LSTA 1UA5A 5ECOB 4NHWA 5BRTA 5KOWA 1U88A 2YZHA 4YKGA 4OCEA 1KTEA 2N5AA 4WKWA 1E2YA 3GHAA 1HNAA 3RBTA 5HR3A 4CDOA 3EWLA 4ICYA 4ID0A 3WT1A 1FAAA 4WBJA 3EPTA 1THXA 4TR4A 1X9MB 3CTGA 2GQLA 5ECHB 4BVXA 4IW9A 4JR6A 4GTUA 5CRGA 4KW6A 5IMCA 2R6KA 1ZCPA 4K0GA 2YN1A 1X5CA 2FA8A 5CREA 4HS1A 1GTBA 4HJ2A 3L78A 3DEXA 5B6NA 3RPPA 4K7OA 4EXJA 2ZNMA 4XS4B 4YH2A 3ZLPA 4K1FA 3M3MA 4XS6A 3NIVA 1AQXA 2I81A 2FD3A 1N2AA 1QXHA 5AISA 1QUWA 3KZQA 4BL7A 4PTSA 5ELGA 2CZ3A 5IOXA 1V57A 3VI7A 2CZ2A 3H8QA 3HZ8A 4IJIA 1QGVA 3TJKA 1TJDA 4MZWA 3VWUA 1WIKA 1OE7A 1EP7A 3IR4A 2MYGA 3J7Yk 4NPBA 2DIYA 1GUHA 4NV2A 3L4NA 1GWCA 1SK2A 3GKXA 2FWEA 1YJ6A 3L9SA 3PINA 3QD9A 2NDOA 4ZB8A 4OMVA 1BJXA 2HI7A 2K18A 3GFKA 1QQ2A 4Q5QA 4ZXGA 4QL9A 2C0EA 4ZL8A 3LSZA 1TRUA 5ECMB 5JWRB 4HQZA 1X5EA 1MEKA 1ERUA 2KP1A 2M72A 3E0UA 3IDVA 3QR6A 1ZMAA 3IPZA 2VD0A 3CYNA 4GLTA 1XW6A 1SKSB 2DC5A 3V1WA 4FYUA 2GS3A 1XBSA 3G9BA 4LMVA 2HZEA 4V2NA 4MNNA 1Z6NA 1RK4A 2OKAA 5HFIA 1R7HA 1XZOA 4ECCA 4NAXA 2OJLA 3HY2A 5DDLA 3EURA 1PN9A 4EVMA 1GULA 2XHFA 4J2FA 4JBBA 1SK1A 1TRSA 4EKZA 4NMUA 2V41A 4JRRA 1V98A 5GSSA 1DUGA 3BJ5A 3ED3A 3L9VA 3F6DA 1FOHA 1E6BA 4IGJA 2FA4A 3G7JA 2FNOA 1ML6A 2X4AA 3P2AA 3CXGA 3DRNA 2MMAA 5D9XA 4F03A 2VO4A 3FR3A 3TUEA 2VD1A 4AJ6A 2LRNA 1SENA 5KN3A 3MNGA 3CTFA 1TU8A 2OE0A 1A0FA 3UL3A 1XVWA 5HR0A 5DCGA 1YF1A 2D2ZA 4BVYB 2CVKA 4LMWA 2P5QA 1W89A 1U6TA 2FWGA 2JU5A 2KHPA 5ID2B 2RIIA 2FWFA 2TRXA 1DSBA 5D73A 2J23A 1GL8A 4GQCA 1XW9A 5FWGA 1MDIA 3GA4A 2F51A 1OKDA 5FHIA 2GZYA 1B4QA 1KBNA 5A4WA 1A8LA 5DAKB 1MD4A 2HSHA 3HD5A 2FWHA 5J5NA 5EL8A 4WBRD 3IRAA 1FHEA 2AJQB 1LJRA 2C4JA 2O87A 1VGLA 1TRVA 1TOFA 3TB2A 1JLVA 4MP4A 1O6JA 4WXTA 2YWIA 3TGZA 5A4UA 3QAWA 1QMVA 1YQ1A 2R0PA 5AN1A 1ST9A 2DKHA 1WMJA 3LEFA 1ERTA 2AYTA 2GSTA 5D9VA 4EL1A 1XIYA 3PR8A 2WJUA 2YPMA 3A2VA 4ZILA 4PQIA 2LJKA 4POBA 3AY8A 1QK8A 5G1KA 5GAPD 4TKYA 4WF5A 5IMAA 1WJKA 2L57A 4EE0A 4LL1B 4OD7A 2QA1A 1SJZA 2GSQA 2REMA 3A2WA 2V6OA 2H72A 1BG5A 2I1UA 1TXXA 3IXRA 3IAM2 3C7MA 3GL5A 2I3YA 4WF4A 4WR5A 3N5OA 4OCFA 1ZYNA 4KF9A 3DIEA 4TN8A 4CHSA 2DKIA 3FY7A 4GWRA 2G0FA 2X64A 1TI1A 18GSA 4KH7A 4BVXB 2OE3A 4Z7XA 4Z2RA 3HVXA 2A2SA 4FQUA 5IMDA 4PUFC 4X0XA 4GXZA 4A5PA 4PQHA 1XOBA 3F9UA 5INYA 1Q4JA 1HNBA 3LJRA 2L4CA 5ECRB 4DSQA 4USSA 1YY7A 3FW2A 3IK7A 5G1LA 4HJMA 1TU7A 2RM6A 5A5KA 1EGRA 1PKWA 1TK5B 2R0GA 4X4JA 1GRXA 1T4ZA 5F0GA 3TJBA 4BL7B 2CA8A 2HSMA 8GSSA 4XCSA 5F06A 2C3NA 3MDKA 3HVVA 3GRXA 3TKSA 6GSVA 4IHUA 6GSYA 1KEBA 2IMKA 3TRXA 3F8UA 1Z9HA 3QOUA 2ZUPA 5JCUA 5CRDA 1XWAA 4LA1A 1WOUA 4XS1A 2YOIA 1YF0A 4FIWA 1JHBA 1DBYA 2H1GA 3KIJA 2AB6A 20GSA 4CY8A 3ZMLA 1BEDA 3BBYA 3LQ7A 2DIZA 2B6MA 1K3YA 1O8WA 1TTZA 4OFTA 4V2LA 4AGSA 4TW5A 5EY6A 2DJ2A 2LQQA 4O5QA 2WULA 3DMLA 2YV7A 4RUVA 1GLPA 2QC7A 1NSWA 1HQOA 2HZEB 3APQA 2WFCA 2DLXA 3LYPA 2R2JA 2MBTA 3F4RA 2J9HA 5J9BA 1R26A 2QKEA 3IK9A 3LGCA 3TJGA 2JL4A 1I9DA 3EU3A 1LU4A 2YJ7A 2L6DA 5B6MA 3UEMA 12GSA 2X49A 4MDCA 4TR3A 4MA9A 1G7EA 2O7KA 1YZXA 4BPYA 3WGDA 1SJIA 3UJ1A 2VLUA 2FUG2 2B7JA 2H6XA 3G7YA 14GSA 4XHMA 1AIUA 1Z5YE 4KNDA 3F0IA 1X5DA 4PXOA 3KGKA 2YWMA 2C8UA 4MCUA 3QCPA 2E2GA 1O73A 4N10A 2GT6A 3C8EA 3FRCA 5HR2A 4O92A 1WRYA 3GMFA 5B8BA 3MIXA 1OE8A 3DD3A 1AXDA 1U87A 3FMWA 3D5JA 1Z6MA 4PX1A 1Z7RA 1WE0A 4TOPA 5J3RA 3Q19A 2R37A 2PVOC 3TKPA 4OFNA 3CMIA 3QPMA 4X1UA 5B7CA 2VM1A 2DMMA 3UVTA 1EEMA 3HJMA 3IHQA 3CRUA 2H73A 5ECIB 3QMXA 3ZREA 1O8XA 1MD3A 4XRAA 1GSQA 3GURA 4GQFA 2DJKA 4MPFA 17GSA 3VI5A 1YKCA 2H30A 3EINA 4MH3A 1YDKA 3L9UA 2OACA 1TK8B 4KB3A 2LRCA 1EP8A 1TW9A 1DE1A 2V1MA 5CRHA 2P5RA 4AF2A 2VCQA 5IMZA 4KDYA 1HNCA 3LFLA 5IO0A 1DE2A 1UVZA 4OO5A 3ZMKA 1TKDB 1GTUA 5DJLA 1A8YA 3DWVA 2LEGA 3Q18A 2K9FA 3C1RA 3IC4A 4TR1A 4RI7A 5F07A 2L6CA 5EPFA 1M2DA 4OO4A 4NHZA 3ME7A 4POKA 2LS5A 5LD0A 5H5SA 4EDZA 1B4PA 1AQWA 3ZIJA 2HNLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CSI A;  3Q74 A;  3NZN A;  2AHE A;  2FHE A;  4I6X A;  3VPQ A;  1AUC A;  2ZCT A;  3NOF A;  3OR5 A;  2IFQ B;  4POM A;  2LV3 A;  1F2E A;  5ELA A;  3UBK A;  4TVE A;  1ABA A;  1VF1 A;  1K0A A;  4O7H A;  1PGT A;  5CP1 A;  3DVW A;  3KP8 A;  2JAD A;  4JED A;  3WGX A;  1XWK A;  4ECI A;  1HD2 A;  1TDI A;  2MBS A;  4ZBD A;  4K6X A;  2MMO A;  3I6A A;  3EVI A;  2H8L A;  1ERW A;  4MZB A;  3KD0 A;  4BWQ A;  2B1L A;  3HHV A;  3ZIT A;  3TOU A;  5IOW A;  4PQ1 A;  5DVB A;  1GTA A;  3HXS A;  3P8W A;  3GUS A;  3IBH A;  1ON4 A;  3BD2 A;  1I5G A;  2DSA A;  1OVN A;  1SU9 A;  3A2X A;  4K7I A;  5DAL A;  3QDN A;  1TP9 A;  2PBJ A;  3M9K A;  4FYB A;  2H0I A;  4KUN A;  5E59 A;  2GGT A;  2KP2 A;  2IWT A;  3GST A;  4IQA A;  4NXI A;  22GS A;  4V2M A;  1OC3 A;  4FH8 A;  4WET A;  4JU5 A;  4WR4 A;  2AAW A;  10GS A;  4ML1 A;  1FOV A;  4KCE A;  1GSD A;  4G19 A;  3GIX A;  2GSS A;  1ZYE A;  1X9W B;  6GSS A;  1HYU A;  2PVQ A;  2VLV A;  2H19 A;  5ECQ B;  5F8B A;  2HSY A;  1JFU A;  3FZ5 A;  1R5P A;  5CRW A;  2R5G A;  3LXZ A;  5D8I A;  1V9W A;  3GYK A;  1M9B A;  2KLX A;  4IP6 A;  3DKS A;  2C3T A;  1EOG A;  4YQV A;  4LLR A;  1G7O A;  2XC2 A;  4HU7 A;  3GX0 A;  2IMD A;  2F8A A;  5E4W A;  1PD2 1;  2HT9 A;  5FT3 A;  3KEB A;  1ERV A;  7GSS A;  1EZK A;  3IE3 A;  5ENU A;  2HRF A;  5D9W A;  3KJY A;  4KCA A;  1J08 A;  1N8J A;  2O85 A;  3HVS A;  3KTL A;  5L71 A;  2WB9 A;  1M99 A;  2QGV A;  1VF2 A;  4JR4 A;  1AAZ A;  2HLS A;  4L5L A;  1UC7 A;  2MMN A;  5EVO A;  1WWJ A;  2GZP A;  2PGT A;  1ZZY A;  4L0U A;  1MDK A;  4IQ1 A;  1GSU A;  1F3B A;  2L4Q A;  1QFN A;  3QFB C;  2E7P A;  4Q5N A;  4D73 B;  4EF0 A;  2IPA A;  3TJF A;  4EUY A;  4L8E A;  4MJE A;  2LKU A;  5CAX A;  2YNX A;  1A2M A;  1GNE A;  3RHC A;  3A5W A;  3RPN A;  1YEX A;  16GS A;  5HFG A;  2JZR A;  1K0N A;  1U3I A;  4MAB A;  3K8N A;  2YWO A;  1XCC A;  4YAV A;  3LXT A;  2PMT A;  2IN3 A;  5IO2 A;  2DJJ A;  3FZ9 A;  1EGO A;  2R4V A;  5DQY A;  4KE3 A;  4G10 A;  2H74 A;  2H71 A;  2MMZ A;  4ZIJ A;  2OE1 A;  4IN0 A;  3HDC A;  3GL3 A;  1OC9 A;  1FB0 A;  3ZTL A;  2LUS A;  4HZ4 A;  2XBI A;  3QAG A;  1EV9 A;  1B9Y C;  4KA0 A;  4WEY A;  3LWA A;  3GH6 A;  5IIZ A;  1G6Y A;  3GTU A;  1G0T A;  2K8S A;  1GSE A;  3F63 A;  4DSR A;  1TI3 A;  4BA7 A;  3UIW A;  3E3E A;  5F05 A;  3ERF A;  2L5O A;  3FZ4 A;  1XW5 A;  3D4M A;  1F37 A;  3LOR A;  2MZC A;  4HOJ A;  4TXO A;  3WYW A;  3F6F A;  4MH2 A;  19GS A;  2JZS A;  1A2J A;  2I4A A;  3W6G A;  3CBU A;  3TJJ A;  1K0D A;  4TR1 B;  3HCZ A;  2A4V A;  4EC0 A;  4RI6 A;  2PPT A;  5D93 A;  2LJR A;  3EE2 A;  5CYY A;  4IVF A;  2C3Q A;  4CW9 A;  1URM A;  3KCM A;  1T00 A;  2IIY A;  2WDU A;  3WGE A;  1JZD A;  4MF6 A;  5AIV A;  3VLN A;  2XBQ A;  3H1N A;  2KOK A;  3M1G A;  3ZYW A;  3M0F A;  4EO3 A;  3UAP A;  5IM9 A;  1U3A A;  2C0D A;  4IBP A;  4F0B A;  3W8J A;  2XPD A;  1ZGN A;  1SK0 A;  3IOS A;  4K2D A;  4GF0 A;  3FZA A;  4MPG A;  2CV4 A;  1ACV A;  3P90 A;  1T8E B;  2B5X A;  5G30 A;  3G7I A;  1OYJ A;  5HQP A;  4FYC A;  2PU9 C;  4I2U A;  4YQM A;  2I9H A;  3U6V A;  2P0G A;  5C04 A;  3FK8 A;  1O7U A;  1OC8 A;  1TRW A;  4MJC A;  1IYI A;  3ZRD A;  2DJ0 A;  1USB A;  4BVY A;  2PN8 A;  1AC1 A;  3P7X A;  1PRX A;  4MF5 A;  4QL7 A;  1M2B A;  1S3C A;  1XFL A;  5DAL B;  2H1D A;  1SL1 B;  1AQV A;  1PMT A;  4O5R A;  2H1B A;  4YQU A;  4DVC A;  1M2A A;  5HFK A;  4ILF A;  13GS A;  4G2E A;  2CQ9 A;  2DBC A;  1K0B A;  2HZF A;  1H4O A;  3SBC A;  4F9Z A;  4GSN A;  1PQN A;  5JWQ B;  3ZIV A;  1K0O A;  4ZB6 A;  4JZQ A;  1R4W A;  4KGI A;  1OKT A;  1XWG A;  3KH9 A;  3VWX A;  2BTO T;  1PKZ A;  3RAZ A;  3GKM A;  3EMP A;  3IV4 A;  2H0H A;  1RW1 A;  3UAR A;  1ILO A;  2JZT A;  3C1S A;  5D96 A;  2EIQ A;  3ZL5 A;  4FO5 A;  4HU9 A;  3HYP A;  4HDE A;  4G9H A;  1M0U A;  5LNK e;  4E8E A;  4MF7 A;  2WRT A;  2L5L A;  1B8X A;  1NHO A;  4ZBA A;  2YP6 A;  4K0N A;  1TK0 B;  1OAZ A;  4NWY A;  1GTI A;  4MJB A;  5KEJ A;  1W4V A;  2PWJ A;  4AJ7 A;  3ISO A;  4DEJ A;  4ML6 A;  1K3O A;  3KXO A;  4PNF A;  2VL3 A;  2CAQ A;  1EOH A;  2RM5 A;  4IJ3 A;  1SJ6 A;  3ZVJ A;  3ZFL A;  2LNS A;  3HA9 A;  3ERW A;  3WT2 A;  2X99 A;  2C1Y A;  1M7T A;  2VCT A;  3D21 A;  3GKN A;  2KUC A;  5DBQ A;  2VCV A;  3APS A;  2CX4 A;  3F3R A;  3J7Y b;  4YAP A;  1S3D A;  1NM3 A;  1FG4 A;  4V1A g;  3LYK A;  2CVB A;  3R2Q A;  1T7P B;  2YJH A;  5ECP B;  3TKQ A;  2VLT A;  1JZO A;  4MLY A;  5J9C A;  3ME8 A;  4V1A p;  3EYT A;  5JCW A;  5J41 A;  2NBS A;  1M9A A;  2QSI A;  2H0G A;  3JCM L;  2GDR A;  9GSS A;  5DJM A;  5AGY A;  3L0H A;  2X8G A;  2FY6 A;  3GN3 A;  3SWL A;  4GCI A;  3DYR A;  3HKR A;  2K8V A;  2IJY A;  4X43 A;  3FHK A;  5COH A;  1F3A A;  3H79 A;  3F3Q A;  3FYG A;  4N30 A;  2YV9 A;  1B48 A;  4QQ7 A;  3GH9 A;  2P31 A;  1SD8 A;  4GST A;  2YCD A;  1OC9 B;  3EMX A;  2PER A;  2IMI A;  1Y6E A;  1CQH A;  3EC3 A;  1VF4 A;  3E9J B;  3KMO A;  2OBI A;  2LTK A;  1WPI A;  2HFD A;  2GLR A;  2XPE A;  3KTB A;  2H1A A;  5ECS A;  3W8S A;  3GTU B;  1PSQ A;  1VRS D;  2JAC A;  4I8B A;  1Z3E A;  2R3X A;  4KDU A;  2GT5 A;  2YZU A;  5H5R A;  1SD9 A;  1EWX A;  1B9X C;  4I2T A;  3TKS E;  3I69 A;  1FVK A;  2X8C A;  1MDJ A;  2TIR A;  3C71 A;  2GVP A;  3KMN A;  3F4T A;  4TXO B;  5KN1 A;  2IME A;  1A23 A;  2YWN A;  2A2R A;  2OBK A;  4XIH A;  1IYH A;  3D22 A;  1O81 A;  2H75 A;  3UMA A;  4MJA A;  4PUA A;  4N11 A;  5ECN B;  4KSO A;  2HXK A;  4GSS A;  1V40 A;  2VIM A;  3VPT A;  1A2L A;  4RQR A;  5G2Z A;  4F82 A;  3ZFB A;  4IS0 A;  1GSS A;  2H01 A;  1GSY A;  1XPV A;  4KDX A;  4DSS A;  2VCZ A;  2OAD A;  3TRQ A;  3CSJ A;  3D4T A;  1EV4 A;  2B1K A;  3UOM A;  2FCH A;  2AUV A;  1SYR A;  1BAY A;  3VWV A;  1YKA A;  2BJX A;  5A4V A;  3O76 A;  4MMM A;  2C0G A;  5KN2 A;  1J0F A;  3LG6 A;  3DGQ A;  4HUA A;  3RDW A;  1LBK A;  3N9J A;  3KP9 A;  1THO A;  2OA7 A;  4XTS A;  3ZVJ D;  4TR0 A;  3HJP A;  4O32 A;  2YAN A;  5IMV A;  5C00 A;  1BQ7 A;  4BWS A;  4HI7 A;  1GH2 A;  1EEJ A;  2X8H A;  3O6T A;  2IL3 A;  2VAF A;  3O3T A;  3KM6 A;  4P3Y B;  3MWH A;  3CRT A;  4AJ8 A;  4HZ2 A;  3C73 A;  2PUK C;  2Z9S A;  2C0F A;  2GSR A;  1T1V A;  3HJO A;  3QFA C;  3FR9 A;  3H93 A;  1S3A A;  2GQK A;  5D9T A;  1XOA A;  4ECJ A;  5IQY A;  1KNG A;  5G5E A;  5IMF A;  1PA3 A;  2HE3 A;  2B7K A;  3M9J A;  1FB6 A;  2ES7 A;  2DML A;  3HZ4 A;  4ACS A;  2VL9 A;  2CVD A;  3APO A;  1F6M C;  2CX3 A;  2M80 A;  2VM2 A;  4IP1 A;  1JLW A;  4ISD A;  4MK3 A;  2NVL A;  3CSH A;  5DQS A;  2F9S A;  5CNW A;  3VWW A;  2CT6 A;  1GUM A;  1K0M A;  3WD6 A;  4XS4 A;  1NHY A;  1ZOF A;  5IPH A;  4IKH A;  2ALB A;  4E8H A;  3GV1 A;  3EU4 A;  2LJA A;  2NTO A;  2O8V B;  2C80 A;  4ZL7 A;  2IMF A;  3A3T A;  4HEA 2;  5B8A A;  4ECB A;  3MSZ A;  2G2Q A;  1K0C A;  2AV4 A;  3GSS A;  4ZB9 A;  3H4K A;  4I5Q A;  1FO5 A;  1SKW B;  1J9B A;  2FLS A;  1GP1 A;  3QAV A;  2VL2 C;  3US3 A;  11GS A;  4NV5 A;  5DCH A;  2BMX A;  6GSW A;  3I9V 2;  1ZL9 A;  2JSY A;  2LRT A;  4PUR A;  3TOT A;  3GNJ A;  3PH9 A;  2K6V A;  4J57 E;  3DXB A;  1XWB A;  2EC4 A;  1Z7P A;  2B5E A;  2VL2 A;  1PX6 A;  4N0Z A;  3FEU A;  3TDG A;  2N5B A;  2F8F A;  1GSF A;  2GQM A;  5CO3 A;  4KSM A;  3VFI A;  2V2G A;  2IFQ A;  3ZZX A;  1G6W A;  4ULX A;  3IA1 A;  1AW9 A;  5ECK B;  4N0V A;  2L59 A;  4OWY A;  1PL1 A;  5GZZ B;  1A24 A;  2V6K A;  1MTC A;  1SL2 B;  3BOA A;  2ON5 A;  2GZZ A;  1YEP A;  5JWO B;  3FR6 A;  4JE1 A;  1VF3 A;  2E0Q A;  1V58 A;  1SYX A;  3ERG A;  1T4Y A;  5KN0 A;  1Q98 A;  3DVX A;  3TKS C;  1PX7 A;  3GKK A;  1FW1 A;  3M8N A;  2VOC A;  4K9Z A;  4OFM A;  1V2A A;  4MZC A;  3TRP A;  1K3L A;  2H70 A;  3KH7 A;  4POL A;  1XXU A;  2V32 A;  3MAK A;  3D6I A;  5LCZ A;  5ABR A;  1SKR B;  1JZR A;  3TCO A;  3GX8 A;  2WCI A;  2TRC P;  4HQS A;  2HYX A;  3UVH A;  4K8M A;  2H66 A;  4EDY A;  1CQG A;  4K7N A;  2B5Y A;  1BYE A;  2HRN A;  2VUP A;  1NW2 A;  1JZW A;  1ZYQ B;  2RUE A;  1H75 A;  2WZ9 A;  3D0Z A;  2VCW A;  4L5O A;  5GST A;  6GSU A;  6GSX A;  4ZBB A;  1RQM A;  1GLQ A;  5ECL B;  3IAS 2;  1O85 A;  1X0R A;  4J56 E;  2VCX A;  2JSZ A;  5HR1 A;  3I43 A;  1GNW A;  3FKF A;  2GTU A;  1XWC A;  3VK9 A;  3Q6O A;  2LQO A;  4KAE A;  3BCK A;  4KX4 A;  5ID2 A;  3PGT A;  1X9S B;  3F4S A;  4F0C A;  3U5R E;  2RLI A;  1GUK A;  3S9F A;  2CAI A;  2H76 A;  5DAK A;  2NPB A;  5H5Q A;  5G31 A;  2DJ1 A;  2H6Z A;  1PL2 A;  2E2M A;  2EIR A;  2O89 A;  2RUF A;  5G5F A;  1WP0 A;  4XRD A;  4PNG A;  2B3S A;  1UN2 A;  2ON7 A;  4Q5R A;  4F2I A;  3VUR A;  6GST A;  2F3M A;  4ZL9 A;  4DSS B;  5AIX A;  1A0R P;  4Q5F A;  4H86 A;  2N5F A;  1F9M A;  1R5A A;  2FGX A;  2M46 A;  5IPG A;  4IEL A;  4RQX A;  2H6Y A;  1Y25 A;  4TXV A;  3UBL A;  5J4U A;  5JCG A;  4PGT A;  4GRF A;  1T3B A;  2WS2 A;  2DJ3 A;  2LNT A;  1BX9 A;  1XVQ A;  4D73 A;  2EIO A;  3BCI A;  1C72 A;  4LL4 B;  1SL0 B;  3RHB A;  4L0W A;  4TRX A;  5GAN D;  4I97 A;  3TKR A;  2WGR A;  1FVJ A;  2LST A;  1UA5 A;  5ECO B;  4NHW A;  1U88 A;  2YZH A;  4OCE A;  1KTE A;  2N5A A;  4WKW A;  1E2Y A;  3GHA A;  1HNA A;  3RBT A;  5HR3 A;  4CDO A;  3EWL A;  4ID0 A;  3WT1 A;  1FAA A;  4WBJ A;  1THX A;  4TR4 A;  1X9M B;  3CTG A;  2GQL A;  5ECH B;  4BVX A;  4IW9 A;  4JR6 A;  4GTU A;  5CRG A;  4KW6 A;  5IMC A;  2R6K A;  1ZCP A;  4K0G A;  2YN1 A;  1X5C A;  2FA8 A;  5CRE A;  4HS1 A;  1GTB A;  4HJ2 A;  3L78 A;  3DEX A;  5B6N A;  3RPP A;  4K7O A;  4EXJ A;  2ZNM A;  4XS4 B;  4YH2 A;  3ZLP A;  4K1F A;  3M3M A;  4XS6 A;  3NIV A;  1AQX A;  2I81 A;  2FD3 A;  1N2A A;  1QXH A;  5AIS A;  1QUW A;  3KZQ A;  4BL7 A;  5ELG A;  2CZ3 A;  5IOX A;  1V57 A;  3VI7 A;  2CZ2 A;  3H8Q A;  3HZ8 A;  4IJI A;  1QGV A;  3TJK A;  1TJD A;  4MZW A;  3VWU A;  1WIK A;  1OE7 A;  1EP7 A;  3IR4 A;  2MYG A;  3J7Y k;  4NPB A;  2DIY A;  1GUH A;  4NV2 A;  3L4N A;  1GWC A;  1SK2 A;  3GKX A;  2FWE A;  1YJ6 A;  3L9S A;  3PIN A;  3QD9 A;  2NDO A;  4ZB8 A;  4OMV A;  1BJX A;  2HI7 A;  2K18 A;  3GFK A;  1QQ2 A;  4Q5Q A;  4ZXG A;  4QL9 A;  2C0E A;  4ZL8 A;  3LSZ A;  1TRU A;  5ECM B;  5JWR B;  4HQZ A;  1X5E A;  1MEK A;  1ERU A;  2KP1 A;  2M72 A;  3E0U A;  3IDV A;  3QR6 A;  1ZMA A;  3IPZ A;  2VD0 A;  3CYN A;  4GLT A;  1XW6 A;  1SKS B;  2DC5 A;  3V1W A;  4FYU A;  2GS3 A;  1XBS A;  3G9B A;  4LMV A;  2HZE A;  4V2N A;  1Z6N A;  1RK4 A;  2OKA A;  5HFI A;  1R7H A;  1XZO A;  4ECC A;  4NAX A;  2OJL A;  3HY2 A;  5DDL A;  3EUR A;  1PN9 A;  4EVM A;  1GUL A;  2XHF A;  4J2F A;  4JBB A;  1SK1 A;  1TRS A;  4EKZ A;  4NMU A;  2V41 A;  4JRR A;  1V98 A;  5GSS A;  1DUG A;  3BJ5 A;  3ED3 A;  3L9V A;  3F6D A;  1E6B A;  4IGJ A;  2FA4 A;  3G7J A;  2FNO A;  1ML6 A;  3P2A A;  3CXG A;  3DRN A;  2MMA A;  5D9X A;  4F03 A;  2VO4 A;  3FR3 A;  3TUE A;  2VD1 A;  4AJ6 A;  2LRN A;  1SEN A;  5KN3 A;  3MNG A;  3CTF A;  1TU8 A;  2OE0 A;  1A0F A;  3UL3 A;  1XVW A;  5HR0 A;  5DCG A;  1YF1 A;  2D2Z A;  2CVK A;  4LMW A;  2P5Q A;  1W89 A;  1U6T A;  2FWG A;  2JU5 A;  2KHP A;  5ID2 B;  2RII A;  2FWF A;  2TRX A;  1DSB A;  5D73 A;  2J23 A;  1GL8 A;  4GQC A;  1XW9 A;  5FWG A;  1MDI A;  3GA4 A;  2F51 A;  1OKD A;  5FHI A;  2GZY A;  1B4Q A;  1KBN A;  5A4W A;  1A8L A;  5DAK B;  1MD4 A;  2HSH A;  3HD5 A;  2FWH A;  5J5N A;  5EL8 A;  4WBR D;  3IRA A;  1FHE A;  2AJQ B;  1LJR A;  2C4J A;  2O87 A;  1VGL A;  1TRV A;  1TOF A;  3TB2 A;  1JLV A;  4MP4 A;  1O6J A;  4WXT A;  2YWI A;  3TGZ A;  5A4U A;  3QAW A;  1QMV A;  1YQ1 A;  5AN1 A;  1ST9 A;  1WMJ A;  3LEF A;  1ERT A;  2AYT A;  2GST A;  5D9V A;  4EL1 A;  1XIY A;  3PR8 A;  2WJU A;  2YPM A;  3A2V A;  4ZIL A;  4PQI A;  2LJK A;  4POB A;  3AY8 A;  1QK8 A;  5G1K A;  5GAP D;  4TKY A;  4WF5 A;  5IMA A;  1WJK A;  2L57 A;  4EE0 A;  4LL1 B;  4OD7 A;  1SJZ A;  2GSQ A;  2REM A;  3A2W A;  2V6O A;  2H72 A;  1BG5 A;  2I1U A;  1TXX A;  3IXR A;  3IAM 2;  3C7M A;  3GL5 A;  2I3Y A;  4WF4 A;  4WR5 A;  3N5O A;  4OCF A;  3DIE A;  4TN8 A;  4CHS A;  3FY7 A;  4GWR A;  2G0F A;  2X64 A;  1TI1 A;  18GS A;  4KH7 A;  2OE3 A;  4Z7X A;  3HVX A;  2A2S A;  5IMD A;  4PUF C;  4X0X A;  4GXZ A;  4PQH A;  1XOB A;  3F9U A;  5INY A;  1Q4J A;  1HNB A;  3LJR A;  2L4C A;  5ECR B;  4DSQ A;  1YY7 A;  3FW2 A;  3IK7 A;  5G1L A;  4HJM A;  1TU7 A;  2RM6 A;  5A5K A;  1EGR A;  1PKW A;  1TK5 B;  1GRX A;  1T4Z A;  5F0G A;  3TJB A;  2CA8 A;  8GSS A;  4XCS A;  5F06 A;  2C3N A;  3MDK A;  3HVV A;  3GRX A;  3TKS A;  6GSV A;  4IHU A;  6GSY A;  1KEB A;  2IMK A;  3TRX A;  3F8U A;  1Z9H A;  3QOU A;  2ZUP A;  5JCU A;  5CRD A;  1XWA A;  4LA1 A;  1WOU A;  4XS1 A;  2YOI A;  1YF0 A;  4FIW A;  1JHB A;  1DBY A;  2H1G A;  3KIJ A;  2AB6 A;  20GS A;  3ZML A;  1BED A;  3BBY A;  3LQ7 A;  2DIZ A;  2B6M A;  1K3Y A;  1O8W A;  1TTZ A;  4OFT A;  4V2L A;  4AGS A;  4TW5 A;  5EY6 A;  2DJ2 A;  2LQQ A;  2WUL A;  3DML A;  2YV7 A;  4RUV A;  1GLP A;  2QC7 A;  1NSW A;  1HQO A;  2HZE B;  3APQ A;  2WFC A;  2DLX A;  3LYP A;  2R2J A;  2MBT A;  3F4R A;  2J9H A;  5J9B A;  1R26 A;  2QKE A;  3IK9 A;  3LGC A;  3TJG A;  2JL4 A;  1I9D A;  3EU3 A;  1LU4 A;  2YJ7 A;  2L6D A;  5B6M A;  3UEM A;  12GS A;  4MDC A;  4TR3 A;  4MA9 A;  1G7E A;  2O7K A;  1YZX A;  4BPY A;  3WGD A;  1SJI A;  3UJ1 A;  2VLU A;  2FUG 2;  2B7J A;  2H6X A;  3G7Y A;  14GS A;  4XHM A;  1AIU A;  1Z5Y E;  4KND A;  3F0I A;  1X5D A;  4PXO A;  3KGK A;  2YWM A;  2C8U A;  4MCU A;  3QCP A;  2E2G A;  1O73 A;  4N10 A;  2GT6 A;  3C8E A;  3FRC A;  5HR2 A;  4O92 A;  1WRY A;  3GMF A;  5B8B A;  1OE8 A;  3DD3 A;  1AXD A;  1U87 A;  3D5J A;  1Z6M A;  4PX1 A;  1Z7R A;  1WE0 A;  4TOP A;  5J3R A;  3Q19 A;  2R37 A;  2PVO C;  3TKP A;  4OFN A;  3CMI A;  3QPM A;  4X1U A;  5B7C A;  2VM1 A;  2DMM A;  3UVT A;  1EEM A;  3HJM A;  3IHQ A;  3CRU A;  2H73 A;  5ECI B;  3QMX A;  3ZRE A;  1O8X A;  1MD3 A;  4XRA A;  1GSQ A;  3GUR A;  4GQF A;  2DJK A;  4MPF A;  17GS A;  3VI5 A;  1YKC A;  2H30 A;  3EIN A;  4MH3 A;  1YDK A;  3L9U A;  2OAC A;  1TK8 B;  4KB3 A;  2LRC A;  1EP8 A;  1TW9 A;  1DE1 A;  2V1M A;  5CRH A;  2P5R A;  4AF2 A;  2VCQ A;  5IMZ A;  4KDY A;  1HNC A;  3LFL A;  5IO0 A;  1DE2 A;  1UVZ A;  4OO5 A;  3ZMK A;  1TKD B;  1GTU A;  5DJL A;  1A8Y A;  3DWV A;  2LEG A;  3Q18 A;  2K9F A;  3C1R A;  3IC4 A;  4TR1 A;  4RI7 A;  5F07 A;  2L6C A;  5EPF A;  1M2D A;  4OO4 A;  4NHZ A;  3ME7 A;  4POK A;  2LS5 A;  5LD0 A;  5H5S A;  4EDZ A;  1B4P A;  1AQW A;  3ZIJ A;  2HNL A; 
#chains in the Genus database with same CATH topology
 3CSI A;  3Q74 A;  3NZN A;  2AHE A;  2FHE A;  4I6X A;  3VPQ A;  1AUC A;  2ZCT A;  3NOF A;  3OR5 A;  2IFQ B;  4POM A;  2LV3 A;  1F2E A;  5ELA A;  3UBK A;  4TVE A;  4K5R A;  1ABA A;  1VF1 A;  1K0A A;  4O7H A;  1PGT A;  5CP1 A;  3DVW A;  3KP8 A;  2JAD A;  4JED A;  3WGX A;  1XWK A;  4ECI A;  1HD2 A;  1TDI A;  2MBS A;  4ZBD A;  4K6X A;  2UZ8 A;  2MMO A;  3I6A A;  3EVI A;  2H8L A;  1ERW A;  4MZB A;  3KD0 A;  4BWQ A;  2B1L A;  3HHV A;  3ZIT A;  3TOU A;  5IOW A;  4PQ1 A;  5DVB A;  1GTA A;  3HXS A;  3P8W A;  3GUS A;  3IBH A;  1ON4 A;  3BD2 A;  1I5G A;  2HRK A;  2DSA A;  1OVN A;  1SU9 A;  3A2X A;  4K7I A;  5BMU A;  4HSC X;  5DAL A;  3QDN A;  1TP9 A;  2PBJ A;  3M9K A;  4FYB A;  2H0I A;  4KUN A;  5E59 A;  2GGT A;  2KP2 A;  2IWT A;  3GST A;  4IQA A;  4NXI A;  22GS A;  4V2M A;  1OC3 A;  4FH8 A;  4WET A;  4JU5 A;  4WR4 A;  1PFO A;  2AAW A;  10GS A;  4ML1 A;  1FOV A;  4KCE A;  1GSD A;  4G19 A;  3GIX A;  2GSS A;  1ZYE A;  1X9W B;  6GSS A;  1HYU A;  2PVQ A;  2VLV A;  2H19 A;  5ECQ B;  5F8B A;  2HSY A;  1JFU A;  3FZ5 A;  1R5P A;  5CRW A;  2R5G A;  3LXZ A;  5D8I A;  1V9W A;  3GYK A;  1M9B A;  2KLX A;  4IP6 A;  3DKS A;  2C3T A;  1EOG A;  4YQV A;  4LLR A;  1G7O A;  2XC2 A;  4HU7 A;  3GX0 A;  2IMD A;  2F8A A;  5E4W A;  1PD2 1;  2HT9 A;  5FT3 A;  3KEB A;  1ERV A;  7GSS A;  1EZK A;  3IE3 A;  5ENU A;  2HRF A;  5D9W A;  3KJY A;  4KCA A;  1J08 A;  1N8J A;  2O85 A;  3HVS A;  3KTL A;  5L71 A;  2WB9 A;  1M99 A;  4K5S A;  3IC8 A;  2QGV A;  1VF2 A;  4JR4 A;  1AAZ A;  2HLS A;  4L5L A;  1UC7 A;  2MMN A;  2A4H A;  5EVO A;  1WWJ A;  2GZP A;  2PGT A;  1ZZY A;  4L0U A;  1MDK A;  4IQ1 A;  1GSU A;  2A2P A;  1F3B A;  2L4Q A;  1QFN A;  3QFB C;  2E7P A;  4Q5N A;  4D73 B;  4EF0 A;  2IPA A;  3TJF A;  4EUY A;  4L8E A;  4MJE A;  2LKU A;  5CAX A;  2YNX A;  1A2M A;  1GNE A;  3RHC A;  3A5W A;  3RPN A;  1YEX A;  16GS A;  5HFG A;  2JZR A;  1K0N A;  3IHG A;  3PPU A;  1U3I A;  3A5I A;  4MAB A;  3K8N A;  2YWO A;  1XCC A;  4YAV A;  3LXT A;  2PMT A;  2IN3 A;  5IO2 A;  2DJJ A;  3FZ9 A;  1EGO A;  2R4V A;  5DQY A;  4YKF A;  4KE3 A;  4G10 A;  2H74 A;  2H71 A;  2MMZ A;  3MYD A;  4ZIJ A;  2OE1 A;  4IN0 A;  3HDC A;  3GL3 A;  1OC9 A;  1FB0 A;  3ZTL A;  2LUS A;  4HZ4 A;  2XBI A;  3QAG A;  1EV9 A;  1B9Y C;  3LW9 A;  4KA0 A;  4WEY A;  3LWA A;  3GH6 A;  5IIZ A;  1G6Y A;  3GTU A;  1G0T A;  2K8S A;  1GSE A;  3F63 A;  4DSR A;  1TI3 A;  4BA7 A;  3UIW A;  3E3E A;  5F05 A;  3ERF A;  2L5O A;  3FZ4 A;  1XW5 A;  3D4M A;  1F37 A;  3LOR A;  2MZC A;  4HOJ A;  4TXO A;  3WYW A;  3F6F A;  4MH2 A;  19GS A;  2JZS A;  1A2J A;  2I4A A;  3W6G A;  3CBU A;  3TJJ A;  1K0D A;  4TR1 B;  3HCZ A;  2A4V A;  4EC0 A;  4RI6 A;  2PPT A;  5D93 A;  2LJR A;  3EE2 A;  5CYY A;  4IVF A;  2C3Q A;  4CW9 A;  1URM A;  3KCM A;  1T00 A;  2IIY A;  2WDU A;  3WGE A;  1JZD A;  4MF6 A;  5AIV A;  3VLN A;  2XBQ A;  3H1N A;  2KOK A;  3M1G A;  3ZYW A;  3M0F A;  4EO3 A;  3UAP A;  5IM9 A;  1U3A A;  2C0D A;  4IBP A;  4F0B A;  3W8J A;  2XPD A;  1ZGN A;  1SK0 A;  3IOS A;  4K2D A;  4GF0 A;  3FZA A;  4MPG A;  2CV4 A;  1ACV A;  3P90 A;  1T8E B;  2B5X A;  5G30 A;  3G7I A;  1OYJ A;  5HQP A;  4FYC A;  2PU9 C;  4I2U A;  4YQM A;  2I9H A;  3U6V A;  2P0G A;  5C04 A;  3FK8 A;  1O7U A;  1OC8 A;  1TRW A;  4MJC A;  1IYI A;  3ZRD A;  2DJ0 A;  1USB A;  4BVY A;  2PN8 A;  1AC1 A;  3P7X A;  1PRX A;  4MF5 A;  4QL7 A;  1M2B A;  1S3C A;  1XFL A;  5DAL B;  2H1D A;  1SL1 B;  1AQV A;  1PMT A;  4O5R A;  2H1B A;  4YQU A;  4DVC A;  1M2A A;  5HFK A;  4ILF A;  13GS A;  4G2E A;  2CQ9 A;  2DBC A;  1K0B A;  2HZF A;  1H4O A;  3SBC A;  4F9Z A;  4GSN A;  1PQN A;  5JWQ B;  3ZIV A;  1K0O A;  4ZB6 A;  4JZQ A;  1R4W A;  4KGI A;  1OKT A;  1XWG A;  3KH9 A;  3VWX A;  2BTO T;  1PKZ A;  3RAZ A;  3GKM A;  3EMP A;  3IV4 A;  2H0H A;  1RW1 A;  3UAR A;  1ILO A;  2JZT A;  3C1S A;  5D96 A;  2EIQ A;  3ZL5 A;  4FO5 A;  4HU9 A;  3HYP A;  4HDE A;  4G9H A;  1M0U A;  2HRA A;  5LNK e;  4E8E A;  4MF7 A;  2WRT A;  2L5L A;  4Z2U A;  1B8X A;  1NHO A;  3R3E A;  4ZBA A;  2YP6 A;  4K0N A;  1TK0 B;  1OAZ A;  4NWY A;  1GTI A;  4MJB A;  5KEJ A;  1W4V A;  2PWJ A;  4AJ7 A;  3ISO A;  4DEJ A;  4ML6 A;  1K3O A;  3KXO A;  4PNF A;  2VL3 A;  2CAQ A;  1EOH A;  2RM5 A;  4IJ3 A;  1SJ6 A;  3ZVJ A;  3ZFL A;  2LNS A;  3HA9 A;  3ERW A;  3WT2 A;  2X99 A;  2C1Y A;  2QA2 A;  1M7T A;  2VCT A;  3D21 A;  3GKN A;  2KUC A;  5DBQ A;  4G0K A;  2VCV A;  3APS A;  2CX4 A;  3F3R A;  3J7Y b;  4YAP A;  1S3D A;  1NM3 A;  4G0I A;  1FG4 A;  4V1A g;  3LYK A;  2CVB A;  3R2Q A;  1T7P B;  2YJH A;  5ECP B;  3TKQ A;  2VLT A;  1JZO A;  4MLY A;  5J9C A;  3ME8 A;  4V1A p;  3EYT A;  5JCW A;  5J41 A;  2NBS A;  1M9A A;  4EIP A;  2QSI A;  2H0G A;  3JCM L;  2GDR A;  9GSS A;  5DJM A;  5AGY A;  3L0H A;  2X8G A;  2FY6 A;  3GN3 A;  3SWL A;  1M3J A;  4GCI A;  3DYR A;  3HKR A;  2K8V A;  2IJY A;  4X43 A;  3FHK A;  5COH A;  1F3A A;  3H79 A;  3F3Q A;  3FYG A;  4N30 A;  4EIQ A;  2YV9 A;  1B48 A;  4QQ7 A;  3GH9 A;  2P31 A;  1SD8 A;  4GST A;  2YCD A;  1OC9 B;  3EMX A;  2PER A;  2IMI A;  1Y6E A;  1CQH A;  3EC3 A;  4K2X A;  1VF4 A;  3E9J B;  3KMO A;  2OBI A;  2LTK A;  1WPI A;  2HFD A;  2GLR A;  2XPE A;  3KTB A;  2H1A A;  5ECS A;  3W8S A;  3GTU B;  1PSQ A;  1VRS D;  2JAC A;  4I8B A;  1Z3E A;  2R3X A;  4KDU A;  2GT5 A;  2YZU A;  5H5R A;  1SD9 A;  1EWX A;  1B9X C;  4I2T A;  3TKS E;  3I69 A;  1FVK A;  2X8C A;  4O5U A;  1MDJ A;  2TIR A;  3C71 A;  2GVP A;  3KMN A;  3F4T A;  4TXO B;  5KN1 A;  2IME A;  1A23 A;  2YWN A;  2A2R A;  2OBK A;  4XIH A;  1IYH A;  3D22 A;  1O81 A;  2H75 A;  3UMA A;  4MJA A;  4PUA A;  4N11 A;  5ECN B;  4KSO A;  2HXK A;  4GSS A;  1V40 A;  4Z2T A;  2VIM A;  3VPT A;  1A2L A;  4RQR A;  5G2Z A;  4F82 A;  3ZFB A;  4IS0 A;  4G0L A;  1GSS A;  2H01 A;  5KOX A;  1GSY A;  1XPV A;  4KDX A;  4DSS A;  2VCZ A;  2OAD A;  3TRQ A;  3CSJ A;  3D4T A;  1EV4 A;  2B1K A;  3UOM A;  2FCH A;  2AUV A;  1SYR A;  1BAY A;  3VWV A;  1YKA A;  2BJX A;  5A4V A;  3O76 A;  4MMM A;  2C0G A;  5KN2 A;  1J0F A;  3LG6 A;  3DGQ A;  4HUA A;  3RDW A;  1LBK A;  3N9J A;  3KP9 A;  1THO A;  2OA7 A;  4XTS A;  3ZVJ D;  4TR0 A;  3HJP A;  4O32 A;  2YAN A;  5IMV A;  5C00 A;  1BQ7 A;  4BWS A;  4HI7 A;  1GH2 A;  1EEJ A;  2X8H A;  3O6T A;  2IL3 A;  2VAF A;  3O3T A;  3KM6 A;  4P3Y B;  3MWH A;  3CRT A;  4AJ8 A;  4HZ2 A;  3C73 A;  2PUK C;  1ZYP A;  2Z9S A;  2C0F A;  2GSR A;  1T1V A;  3HJO A;  3QFA C;  3FR9 A;  3H93 A;  1S3A A;  2GQK A;  5D9T A;  1XOA A;  4ECJ A;  5IQY A;  1KNG A;  5G5E A;  5IMF A;  1PA3 A;  2HE3 A;  2B7K A;  3M9J A;  1FB6 A;  2ES7 A;  2DML A;  3HZ4 A;  4ACS A;  2VL9 A;  2CVD A;  3APO A;  1F6M C;  2CX3 A;  2M80 A;  2VM2 A;  4IP1 A;  1JLW A;  4ISD A;  4MK3 A;  2NVL A;  1XG8 A;  3CSH A;  2F9S A;  5CNW A;  5DQS A;  3VWW A;  2CT6 A;  1GUM A;  1K0M A;  3WD6 A;  4XS4 A;  1NHY A;  1ZOF A;  5IPH A;  4IKH A;  2ALB A;  4E8H A;  3GV1 A;  3EU4 A;  2LJA A;  2NTO A;  2O8V B;  2C80 A;  4ZL7 A;  2IMF A;  3A3T A;  4HEA 2;  5B8A A;  4ECB A;  3MSZ A;  2G2Q A;  1K0C A;  2AV4 A;  3GSS A;  4ZB9 A;  3H4K A;  4I5Q A;  1FO5 A;  1SKW B;  1J9B A;  2FLS A;  1GP1 A;  3QAV A;  2VL2 C;  3US3 A;  11GS A;  4NV5 A;  5DCH A;  2BMX A;  6GSW A;  3I9V 2;  1ZL9 A;  2JSY A;  2LRT A;  4PUR A;  3TOT A;  3GNJ A;  3PH9 A;  2K6V A;  4J57 E;  3DXB A;  1XWB A;  2EC4 A;  1Z7P A;  2B5E A;  2VL2 A;  1PX6 A;  4N0Z A;  3FEU A;  3TDG A;  2N5B A;  2F8F A;  1GSF A;  2GQM A;  5CO3 A;  4KSM A;  3VFI A;  2V2G A;  2IFQ A;  3ZZX A;  1G6W A;  4ULX A;  3IA1 A;  1AW9 A;  5ECK B;  4N0V A;  2L59 A;  4OWY A;  1PL1 A;  5GZZ B;  1A24 A;  2V6K A;  1MTC A;  1SL2 B;  3BOA A;  2ON5 A;  2GZZ A;  1YEP A;  5JWO B;  3FR6 A;  4JE1 A;  1VF3 A;  2E0Q A;  1V58 A;  1SYX A;  3ERG A;  1T4Y A;  5KN0 A;  1Q98 A;  3DVX A;  3TKS C;  1M3I A;  1PX7 A;  3GKK A;  1FW1 A;  3M8N A;  2VOC A;  4K9Z A;  4OFM A;  1V2A A;  4MZC A;  3TRP A;  1K3L A;  2H70 A;  3KH7 A;  4POL A;  1XXU A;  2R0C A;  2V32 A;  3MAK A;  3D6I A;  5LCZ A;  5ABR A;  1SKR B;  1JZR A;  3TCO A;  3GX8 A;  2WCI A;  2TRC P;  4HQS A;  2HYX A;  3UVH A;  4K8M A;  3CQF A;  3HVN A;  2H66 A;  4EDY A;  1CQG A;  4K7N A;  2B5Y A;  1BYE A;  2HRN A;  2VUP A;  1NW2 A;  1JZW A;  1ZYQ B;  2RUE A;  1H75 A;  2WZ9 A;  1PN0 A;  3D0Z A;  2VCW A;  4L5O A;  5GST A;  6GSU A;  6GSX A;  4ZBB A;  1RQM A;  1GLQ A;  5ECL B;  3IAS 2;  4BIK A;  1O85 A;  1X0R A;  4J56 E;  2VCX A;  2JSZ A;  5HR1 A;  3I43 A;  1GNW A;  3FKF A;  2GTU A;  1XWC A;  3VK9 A;  3Q6O A;  2LQO A;  4KAE A;  3BCK A;  4KX4 A;  5ID2 A;  3PGT A;  1X9S B;  3F4S A;  4F0C A;  3U5R E;  2RLI A;  1GUK A;  3S9F A;  2CAI A;  2H76 A;  5DAK A;  2NPB A;  5H5Q A;  5G31 A;  2DJ1 A;  2H6Z A;  1PL2 A;  2E2M A;  2EIR A;  2O89 A;  2RUF A;  5G5F A;  1WP0 A;  4XRD A;  4PNG A;  2B3S A;  1UN2 A;  2ON7 A;  4Q5R A;  4F2I A;  3VUR A;  6GST A;  2F3M A;  4ZL9 A;  4DSS B;  5AIX A;  1A0R P;  4Q5F A;  4H86 A;  2N5F A;  1F9M A;  1R5A A;  2FGX A;  2M46 A;  5IPG A;  4IEL A;  4RQX A;  2H6Y A;  1Y25 A;  4TXV A;  3UBL A;  5J4U A;  5JCG A;  4PGT A;  4GRF A;  1T3B A;  2WS2 A;  4CY6 A;  2DJ3 A;  2LNT A;  1BX9 A;  1XVQ A;  4D73 A;  2EIO A;  3BCI A;  1C72 A;  4LL4 B;  1SL0 B;  3RHB A;  4L0W A;  4TRX A;  5GAN D;  4I97 A;  3TKR A;  2WGR A;  1FVJ A;  2LST A;  1UA5 A;  5ECO B;  4NHW A;  5BRT A;  5KOW A;  1U88 A;  2YZH A;  4YKG A;  4OCE A;  1KTE A;  2N5A A;  4WKW A;  1E2Y A;  3GHA A;  1HNA A;  3RBT A;  5HR3 A;  4CDO A;  3EWL A;  4ICY A;  4ID0 A;  3WT1 A;  1FAA A;  4WBJ A;  3EPT A;  1THX A;  4TR4 A;  1X9M B;  3CTG A;  2GQL A;  5ECH B;  4BVX A;  4IW9 A;  4JR6 A;  4GTU A;  5CRG A;  4KW6 A;  5IMC A;  2R6K A;  1ZCP A;  4K0G A;  2YN1 A;  1X5C A;  2FA8 A;  5CRE A;  4HS1 A;  1GTB A;  4HJ2 A;  3L78 A;  3DEX A;  5B6N A;  3RPP A;  4K7O A;  4EXJ A;  2ZNM A;  4XS4 B;  4YH2 A;  3ZLP A;  4K1F A;  3M3M A;  4XS6 A;  3NIV A;  1AQX A;  2I81 A;  2FD3 A;  1N2A A;  1QXH A;  5AIS A;  1QUW A;  3KZQ A;  4BL7 A;  4PTS A;  5ELG A;  2CZ3 A;  5IOX A;  1V57 A;  3VI7 A;  2CZ2 A;  3H8Q A;  3HZ8 A;  4IJI A;  1QGV A;  3TJK A;  1TJD A;  4MZW A;  3VWU A;  1WIK A;  1OE7 A;  1EP7 A;  3IR4 A;  2MYG A;  3J7Y k;  4NPB A;  2DIY A;  1GUH A;  4NV2 A;  3L4N A;  1GWC A;  1SK2 A;  3GKX A;  2FWE A;  1YJ6 A;  3L9S A;  3PIN A;  3QD9 A;  2NDO A;  4ZB8 A;  4OMV A;  1BJX A;  2HI7 A;  2K18 A;  3GFK A;  1QQ2 A;  4Q5Q A;  4ZXG A;  4QL9 A;  2C0E A;  4ZL8 A;  3LSZ A;  1TRU A;  5ECM B;  5JWR B;  4HQZ A;  1X5E A;  1MEK A;  1ERU A;  2KP1 A;  2M72 A;  3E0U A;  3IDV A;  3QR6 A;  1ZMA A;  3IPZ A;  2VD0 A;  3CYN A;  4GLT A;  1XW6 A;  1SKS B;  2DC5 A;  3V1W A;  4FYU A;  2GS3 A;  1XBS A;  3G9B A;  4LMV A;  2HZE A;  4V2N A;  4MNN A;  1Z6N A;  1RK4 A;  2OKA A;  5HFI A;  1R7H A;  1XZO A;  4ECC A;  4NAX A;  2OJL A;  3HY2 A;  5DDL A;  3EUR A;  1PN9 A;  4EVM A;  1GUL A;  2XHF A;  4J2F A;  4JBB A;  1SK1 A;  1TRS A;  4EKZ A;  4NMU A;  2V41 A;  4JRR A;  1V98 A;  5GSS A;  1DUG A;  3BJ5 A;  3ED3 A;  3L9V A;  3F6D A;  1FOH A;  1E6B A;  4IGJ A;  2FA4 A;  3G7J A;  1S3R A;  2FNO A;  1ML6 A;  2X4A A;  3P2A A;  3CXG A;  3DRN A;  2MMA A;  5D9X A;  4F03 A;  2VO4 A;  3FR3 A;  3TUE A;  2VD1 A;  4AJ6 A;  2LRN A;  1SEN A;  5KN3 A;  3MNG A;  3CTF A;  1TU8 A;  2OE0 A;  1A0F A;  3UL3 A;  1XVW A;  5HR0 A;  5DCG A;  1YF1 A;  2D2Z A;  4BVY B;  2CVK A;  4LMW A;  2P5Q A;  1W89 A;  1U6T A;  2FWG A;  2JU5 A;  2KHP A;  5ID2 B;  2RII A;  2FWF A;  2TRX A;  1DSB A;  5D73 A;  2J23 A;  1GL8 A;  4GQC A;  1XW9 A;  5FWG A;  1MDI A;  3GA4 A;  2F51 A;  1OKD A;  5FHI A;  2GZY A;  1B4Q A;  1KBN A;  5A4W A;  1A8L A;  5DAK B;  1MD4 A;  2HSH A;  3HD5 A;  2FWH A;  5J5N A;  5EL8 A;  4WBR D;  3IRA A;  1FHE A;  2AJQ B;  1LJR A;  2C4J A;  2O87 A;  1VGL A;  1TRV A;  1TOF A;  3TB2 A;  1JLV A;  4MP4 A;  1O6J A;  4WXT A;  2YWI A;  3TGZ A;  5A4U A;  3QAW A;  1QMV A;  1YQ1 A;  2R0P A;  5AN1 A;  1ST9 A;  2DKH A;  1WMJ A;  3LEF A;  1ERT A;  2AYT A;  2GST A;  5D9V A;  4EL1 A;  1XIY A;  3PR8 A;  2WJU A;  2YPM A;  3A2V A;  4ZIL A;  4PQI A;  2LJK A;  4POB A;  3AY8 A;  1QK8 A;  5G1K A;  5GAP D;  4TKY A;  4WF5 A;  5IMA A;  1WJK A;  2L57 A;  4EE0 A;  4LL1 B;  4OD7 A;  2QA1 A;  1SJZ A;  2GSQ A;  2REM A;  3A2W A;  2V6O A;  2H72 A;  1BG5 A;  2I1U A;  1TXX A;  3IXR A;  3IAM 2;  3C7M A;  3GL5 A;  2I3Y A;  4WF4 A;  4WR5 A;  3N5O A;  4OCF A;  1ZYN A;  4KF9 A;  3DIE A;  4TN8 A;  4CHS A;  2DKI A;  3FY7 A;  4GWR A;  2G0F A;  2X64 A;  1TI1 A;  18GS A;  4KH7 A;  4BVX B;  2OE3 A;  4Z7X A;  4Z2R A;  3HVX A;  2A2S A;  4FQU A;  5IMD A;  4PUF C;  4X0X A;  4GXZ A;  4A5P A;  4PQH A;  1XOB A;  3F9U A;  5INY A;  1Q4J A;  1HNB A;  3LJR A;  2L4C A;  5ECR B;  4DSQ A;  4USS A;  1YY7 A;  3FW2 A;  3IK7 A;  5G1L A;  4HJM A;  1TU7 A;  2RM6 A;  5A5K A;  1EGR A;  1PKW A;  1TK5 B;  2R0G A;  4X4J A;  1GRX A;  1T4Z A;  5F0G A;  3TJB A;  4BL7 B;  2CA8 A;  2HSM A;  8GSS A;  4XCS A;  5F06 A;  2C3N A;  3MDK A;  3HVV A;  3GRX A;  3TKS A;  6GSV A;  4IHU A;  6GSY A;  1KEB A;  2IMK A;  3TRX A;  3F8U A;  1Z9H A;  3QOU A;  2ZUP A;  5JCU A;  5CRD A;  1XWA A;  4LA1 A;  1WOU A;  4XS1 A;  2YOI A;  1YF0 A;  4FIW A;  1JHB A;  1DBY A;  2H1G A;  3KIJ A;  2AB6 A;  20GS A;  4CY8 A;  3ZML A;  1BED A;  3BBY A;  3LQ7 A;  2DIZ A;  2B6M A;  1K3Y A;  1O8W A;  1TTZ A;  4OFT A;  4V2L A;  4AGS A;  4TW5 A;  5EY6 A;  2DJ2 A;  2LQQ A;  4O5Q A;  2WUL A;  3DML A;  2YV7 A;  4RUV A;  1GLP A;  2QC7 A;  1NSW A;  1HQO A;  2HZE B;  3APQ A;  2WFC A;  2DLX A;  3LYP A;  2R2J A;  2MBT A;  3F4R A;  2J9H A;  5J9B A;  1R26 A;  2QKE A;  3IK9 A;  3LGC A;  3TJG A;  2JL4 A;  1I9D A;  3EU3 A;  1LU4 A;  2YJ7 A;  2L6D A;  5B6M A;  3UEM A;  12GS A;  2X49 A;  4MDC A;  4TR3 A;  4MA9 A;  1G7E A;  2O7K A;  1YZX A;  4BPY A;  3WGD A;  1SJI A;  3UJ1 A;  2VLU A;  2FUG 2;  2B7J A;  2H6X A;  3G7Y A;  14GS A;  4XHM A;  1AIU A;  1Z5Y E;  4KND A;  3F0I A;  1X5D A;  4PXO A;  3KGK A;  2YWM A;  2C8U A;  4MCU A;  3QCP A;  2E2G A;  1O73 A;  4N10 A;  2GT6 A;  3C8E A;  3FRC A;  5HR2 A;  4O92 A;  1WRY A;  3GMF A;  5B8B A;  3MIX A;  1OE8 A;  3DD3 A;  1AXD A;  1U87 A;  3FMW A;  3D5J A;  1Z6M A;  4PX1 A;  1Z7R A;  1WE0 A;  4TOP A;  5J3R A;  3Q19 A;  2R37 A;  2PVO C;  3TKP A;  4OFN A;  3CMI A;  3QPM A;  4X1U A;  5B7C A;  2VM1 A;  2DMM A;  3UVT A;  1EEM A;  3HJM A;  3IHQ A;  3CRU A;  2H73 A;  5ECI B;  3QMX A;  3ZRE A;  1O8X A;  1MD3 A;  4XRA A;  1GSQ A;  3GUR A;  4GQF A;  2DJK A;  4MPF A;  17GS A;  3VI5 A;  1YKC A;  2H30 A;  3EIN A;  4MH3 A;  1YDK A;  3L9U A;  2OAC A;  1TK8 B;  4KB3 A;  2LRC A;  1EP8 A;  1TW9 A;  1DE1 A;  2V1M A;  5CRH A;  2P5R A;  4AF2 A;  2VCQ A;  5IMZ A;  4KDY A;  1HNC A;  3LFL A;  5IO0 A;  1DE2 A;  1UVZ A;  4OO5 A;  3ZMK A;  1TKD B;  1GTU A;  5DJL A;  1A8Y A;  3DWV A;  2LEG A;  3Q18 A;  2K9F A;  3C1R A;  3IC4 A;  4TR1 A;  4RI7 A;  5F07 A;  2L6C A;  5EPF A;  1M2D A;  4OO4 A;  4NHZ A;  3ME7 A;  4POK A;  2LS5 A;  5LD0 A;  5H5S A;  4EDZ A;  1B4P A;  1AQW A;  3ZIJ A;  2HNL A; 
#chains in the Genus database with same CATH homology
 3CSI A;  3Q74 A;  3NZN A;  2AHE A;  2FHE A;  4I6X A;  3VPQ A;  1AUC A;  2ZCT A;  3NOF A;  3OR5 A;  2IFQ B;  4POM A;  2LV3 A;  1F2E A;  5ELA A;  3UBK A;  4TVE A;  4K5R A;  1ABA A;  1VF1 A;  1K0A A;  4O7H A;  1PGT A;  5CP1 A;  3DVW A;  3KP8 A;  2JAD A;  4JED A;  3WGX A;  1XWK A;  4ECI A;  1HD2 A;  1TDI A;  2MBS A;  4ZBD A;  4K6X A;  2UZ8 A;  2MMO A;  3I6A A;  3EVI A;  2H8L A;  1ERW A;  4MZB A;  3KD0 A;  4BWQ A;  2B1L A;  3HHV A;  3ZIT A;  3TOU A;  5IOW A;  4PQ1 A;  5DVB A;  1GTA A;  3HXS A;  3P8W A;  3GUS A;  3IBH A;  1ON4 A;  3BD2 A;  1I5G A;  2HRK A;  2DSA A;  1OVN A;  1SU9 A;  3A2X A;  4K7I A;  5BMU A;  5DAL A;  3QDN A;  1TP9 A;  2PBJ A;  3M9K A;  4FYB A;  2H0I A;  4KUN A;  5E59 A;  2GGT A;  2KP2 A;  2IWT A;  3GST A;  4IQA A;  4NXI A;  22GS A;  4V2M A;  1OC3 A;  4FH8 A;  4WET A;  4JU5 A;  4WR4 A;  2AAW A;  10GS A;  4ML1 A;  1FOV A;  4KCE A;  1GSD A;  4G19 A;  3GIX A;  2GSS A;  1ZYE A;  1X9W B;  6GSS A;  1HYU A;  2PVQ A;  2VLV A;  2H19 A;  5ECQ B;  5F8B A;  2HSY A;  1JFU A;  3FZ5 A;  1R5P A;  5CRW A;  2R5G A;  3LXZ A;  5D8I A;  1V9W A;  3GYK A;  1M9B A;  2KLX A;  4IP6 A;  3DKS A;  2C3T A;  1EOG A;  4YQV A;  4LLR A;  1G7O A;  2XC2 A;  4HU7 A;  3GX0 A;  2IMD A;  2F8A A;  5E4W A;  1PD2 1;  2HT9 A;  5FT3 A;  3KEB A;  1ERV A;  7GSS A;  1EZK A;  3IE3 A;  5ENU A;  2HRF A;  5D9W A;  3KJY A;  4KCA A;  1J08 A;  1N8J A;  2O85 A;  3HVS A;  3KTL A;  5L71 A;  2WB9 A;  1M99 A;  4K5S A;  3IC8 A;  2QGV A;  1VF2 A;  4JR4 A;  1AAZ A;  2HLS A;  4L5L A;  1UC7 A;  2MMN A;  2A4H A;  5EVO A;  1WWJ A;  2GZP A;  2PGT A;  1ZZY A;  4L0U A;  1MDK A;  4IQ1 A;  1GSU A;  2A2P A;  1F3B A;  2L4Q A;  1QFN A;  3QFB C;  2E7P A;  4Q5N A;  4D73 B;  4EF0 A;  2IPA A;  3TJF A;  4EUY A;  4L8E A;  4MJE A;  2LKU A;  5CAX A;  2YNX A;  1A2M A;  1GNE A;  3RHC A;  3A5W A;  3RPN A;  1YEX A;  16GS A;  5HFG A;  2JZR A;  1K0N A;  3IHG A;  3PPU A;  1U3I A;  3A5I A;  4MAB A;  3K8N A;  2YWO A;  1XCC A;  4YAV A;  3LXT A;  2PMT A;  2IN3 A;  5IO2 A;  2DJJ A;  3FZ9 A;  1EGO A;  2R4V A;  5DQY A;  4YKF A;  4KE3 A;  4G10 A;  2H74 A;  2H71 A;  2MMZ A;  3MYD A;  4ZIJ A;  2OE1 A;  4IN0 A;  3HDC A;  3GL3 A;  1OC9 A;  1FB0 A;  3ZTL A;  2LUS A;  4HZ4 A;  2XBI A;  3QAG A;  1EV9 A;  1B9Y C;  3LW9 A;  4KA0 A;  4WEY A;  3LWA A;  3GH6 A;  5IIZ A;  1G6Y A;  3GTU A;  1G0T A;  2K8S A;  1GSE A;  3F63 A;  4DSR A;  1TI3 A;  4BA7 A;  3UIW A;  3E3E A;  5F05 A;  3ERF A;  2L5O A;  3FZ4 A;  1XW5 A;  3D4M A;  1F37 A;  3LOR A;  2MZC A;  4HOJ A;  4TXO A;  3WYW A;  3F6F A;  4MH2 A;  19GS A;  2JZS A;  1A2J A;  2I4A A;  3W6G A;  3CBU A;  3TJJ A;  1K0D A;  4TR1 B;  3HCZ A;  2A4V A;  4EC0 A;  4RI6 A;  2PPT A;  5D93 A;  2LJR A;  3EE2 A;  5CYY A;  4IVF A;  2C3Q A;  4CW9 A;  1URM A;  3KCM A;  1T00 A;  2IIY A;  2WDU A;  3WGE A;  1JZD A;  4MF6 A;  5AIV A;  3VLN A;  2XBQ A;  3H1N A;  2KOK A;  3M1G A;  3ZYW A;  3M0F A;  4EO3 A;  3UAP A;  5IM9 A;  1U3A A;  2C0D A;  4IBP A;  4F0B A;  3W8J A;  2XPD A;  1ZGN A;  1SK0 A;  3IOS A;  4K2D A;  4GF0 A;  3FZA A;  4MPG A;  2CV4 A;  1ACV A;  3P90 A;  1T8E B;  2B5X A;  5G30 A;  3G7I A;  1OYJ A;  5HQP A;  4FYC A;  2PU9 C;  4I2U A;  4YQM A;  2I9H A;  3U6V A;  2P0G A;  5C04 A;  3FK8 A;  1O7U A;  1OC8 A;  1TRW A;  4MJC A;  1IYI A;  3ZRD A;  2DJ0 A;  1USB A;  4BVY A;  2PN8 A;  1AC1 A;  3P7X A;  1PRX A;  4MF5 A;  4QL7 A;  1M2B A;  1S3C A;  1XFL A;  5DAL B;  2H1D A;  1SL1 B;  1AQV A;  1PMT A;  4O5R A;  2H1B A;  4YQU A;  4DVC A;  1M2A A;  5HFK A;  4ILF A;  13GS A;  4G2E A;  2CQ9 A;  2DBC A;  1K0B A;  2HZF A;  1H4O A;  3SBC A;  4F9Z A;  4GSN A;  1PQN A;  5JWQ B;  3ZIV A;  1K0O A;  4ZB6 A;  4JZQ A;  1R4W A;  4KGI A;  1OKT A;  1XWG A;  3KH9 A;  3VWX A;  2BTO T;  1PKZ A;  3RAZ A;  3GKM A;  3EMP A;  3IV4 A;  2H0H A;  1RW1 A;  3UAR A;  1ILO A;  2JZT A;  3C1S A;  5D96 A;  2EIQ A;  3ZL5 A;  4FO5 A;  4HU9 A;  3HYP A;  4HDE A;  4G9H A;  1M0U A;  2HRA A;  5LNK e;  4E8E A;  4MF7 A;  2WRT A;  2L5L A;  4Z2U A;  1B8X A;  1NHO A;  3R3E A;  4ZBA A;  2YP6 A;  4K0N A;  1TK0 B;  1OAZ A;  4NWY A;  1GTI A;  4MJB A;  5KEJ A;  1W4V A;  2PWJ A;  4AJ7 A;  3ISO A;  4DEJ A;  4ML6 A;  1K3O A;  3KXO A;  4PNF A;  2VL3 A;  2CAQ A;  1EOH A;  2RM5 A;  4IJ3 A;  1SJ6 A;  3ZVJ A;  3ZFL A;  2LNS A;  3HA9 A;  3ERW A;  3WT2 A;  2X99 A;  2C1Y A;  2QA2 A;  1M7T A;  2VCT A;  3D21 A;  3GKN A;  2KUC A;  5DBQ A;  4G0K A;  2VCV A;  3APS A;  2CX4 A;  3F3R A;  3J7Y b;  4YAP A;  1S3D A;  1NM3 A;  4G0I A;  1FG4 A;  4V1A g;  3LYK A;  2CVB A;  3R2Q A;  1T7P B;  2YJH A;  5ECP B;  3TKQ A;  2VLT A;  1JZO A;  4MLY A;  5J9C A;  3ME8 A;  4V1A p;  3EYT A;  5JCW A;  5J41 A;  2NBS A;  1M9A A;  4EIP A;  2QSI A;  2H0G A;  3JCM L;  2GDR A;  9GSS A;  5DJM A;  5AGY A;  3L0H A;  2X8G A;  2FY6 A;  3GN3 A;  3SWL A;  4GCI A;  3DYR A;  3HKR A;  2K8V A;  2IJY A;  4X43 A;  3FHK A;  5COH A;  1F3A A;  3H79 A;  3F3Q A;  3FYG A;  4N30 A;  4EIQ A;  2YV9 A;  1B48 A;  4QQ7 A;  3GH9 A;  2P31 A;  1SD8 A;  4GST A;  2YCD A;  1OC9 B;  3EMX A;  2PER A;  2IMI A;  1Y6E A;  1CQH A;  3EC3 A;  4K2X A;  1VF4 A;  3E9J B;  3KMO A;  2OBI A;  2LTK A;  1WPI A;  2HFD A;  2GLR A;  2XPE A;  3KTB A;  2H1A A;  5ECS A;  3W8S A;  3GTU B;  1PSQ A;  1VRS D;  2JAC A;  4I8B A;  1Z3E A;  2R3X A;  4KDU A;  2GT5 A;  2YZU A;  5H5R A;  1SD9 A;  1EWX A;  1B9X C;  4I2T A;  3TKS E;  3I69 A;  1FVK A;  2X8C A;  4O5U A;  1MDJ A;  2TIR A;  3C71 A;  2GVP A;  3KMN A;  3F4T A;  4TXO B;  5KN1 A;  2IME A;  1A23 A;  2YWN A;  2A2R A;  2OBK A;  4XIH A;  1IYH A;  3D22 A;  1O81 A;  2H75 A;  3UMA A;  4MJA A;  4PUA A;  4N11 A;  5ECN B;  4KSO A;  2HXK A;  4GSS A;  1V40 A;  4Z2T A;  2VIM A;  3VPT A;  1A2L A;  4RQR A;  5G2Z A;  4F82 A;  3ZFB A;  4IS0 A;  4G0L A;  1GSS A;  2H01 A;  5KOX A;  1GSY A;  1XPV A;  4KDX A;  4DSS A;  2VCZ A;  2OAD A;  3TRQ A;  3CSJ A;  3D4T A;  1EV4 A;  2B1K A;  3UOM A;  2FCH A;  2AUV A;  1SYR A;  1BAY A;  3VWV A;  1YKA A;  2BJX A;  5A4V A;  3O76 A;  4MMM A;  2C0G A;  5KN2 A;  1J0F A;  3LG6 A;  3DGQ A;  4HUA A;  3RDW A;  1LBK A;  3N9J A;  3KP9 A;  1THO A;  2OA7 A;  4XTS A;  3ZVJ D;  4TR0 A;  3HJP A;  4O32 A;  2YAN A;  5IMV A;  5C00 A;  1BQ7 A;  4BWS A;  4HI7 A;  1GH2 A;  1EEJ A;  2X8H A;  3O6T A;  2IL3 A;  2VAF A;  3O3T A;  3KM6 A;  4P3Y B;  3MWH A;  3CRT A;  4AJ8 A;  4HZ2 A;  3C73 A;  2PUK C;  1ZYP A;  2Z9S A;  2C0F A;  2GSR A;  1T1V A;  3HJO A;  3QFA C;  3FR9 A;  3H93 A;  1S3A A;  2GQK A;  5D9T A;  1XOA A;  4ECJ A;  5IQY A;  1KNG A;  5G5E A;  5IMF A;  1PA3 A;  2HE3 A;  2B7K A;  3M9J A;  1FB6 A;  2ES7 A;  2DML A;  3HZ4 A;  4ACS A;  2VL9 A;  2CVD A;  3APO A;  1F6M C;  2CX3 A;  2M80 A;  2VM2 A;  4IP1 A;  1JLW A;  4ISD A;  4MK3 A;  2NVL A;  3CSH A;  5DQS A;  2F9S A;  5CNW A;  3VWW A;  2CT6 A;  1GUM A;  1K0M A;  3WD6 A;  4XS4 A;  1NHY A;  1ZOF A;  5IPH A;  4IKH A;  2ALB A;  4E8H A;  3GV1 A;  3EU4 A;  2LJA A;  2NTO A;  2O8V B;  2C80 A;  4ZL7 A;  2IMF A;  3A3T A;  4HEA 2;  5B8A A;  4ECB A;  3MSZ A;  2G2Q A;  1K0C A;  2AV4 A;  3GSS A;  4ZB9 A;  3H4K A;  4I5Q A;  1FO5 A;  1SKW B;  1J9B A;  2FLS A;  1GP1 A;  3QAV A;  2VL2 C;  3US3 A;  11GS A;  4NV5 A;  5DCH A;  2BMX A;  6GSW A;  3I9V 2;  1ZL9 A;  2JSY A;  2LRT A;  4PUR A;  3TOT A;  3GNJ A;  3PH9 A;  2K6V A;  4J57 E;  3DXB A;  1XWB A;  2EC4 A;  1Z7P A;  2B5E A;  2VL2 A;  1PX6 A;  4N0Z A;  3FEU A;  3TDG A;  2N5B A;  2F8F A;  1GSF A;  2GQM A;  5CO3 A;  4KSM A;  3VFI A;  2V2G A;  2IFQ A;  3ZZX A;  1G6W A;  4ULX A;  3IA1 A;  1AW9 A;  5ECK B;  4N0V A;  2L59 A;  4OWY A;  1PL1 A;  5GZZ B;  1A24 A;  2V6K A;  1MTC A;  1SL2 B;  3BOA A;  2ON5 A;  2GZZ A;  1YEP A;  5JWO B;  3FR6 A;  4JE1 A;  1VF3 A;  2E0Q A;  1V58 A;  1SYX A;  3ERG A;  1T4Y A;  5KN0 A;  1Q98 A;  3DVX A;  3TKS C;  1PX7 A;  3GKK A;  1FW1 A;  3M8N A;  2VOC A;  4K9Z A;  4OFM A;  1V2A A;  4MZC A;  3TRP A;  1K3L A;  2H70 A;  3KH7 A;  4POL A;  1XXU A;  2R0C A;  2V32 A;  3MAK A;  3D6I A;  5LCZ A;  5ABR A;  1SKR B;  1JZR A;  3TCO A;  3GX8 A;  2WCI A;  2TRC P;  4HQS A;  2HYX A;  3UVH A;  4K8M A;  2H66 A;  4EDY A;  1CQG A;  4K7N A;  2B5Y A;  1BYE A;  2HRN A;  2VUP A;  1NW2 A;  1JZW A;  1ZYQ B;  2RUE A;  1H75 A;  2WZ9 A;  1PN0 A;  3D0Z A;  2VCW A;  4L5O A;  5GST A;  6GSU A;  6GSX A;  4ZBB A;  1RQM A;  1GLQ A;  5ECL B;  3IAS 2;  1O85 A;  1X0R A;  4J56 E;  2VCX A;  2JSZ A;  5HR1 A;  3I43 A;  1GNW A;  3FKF A;  2GTU A;  1XWC A;  3VK9 A;  3Q6O A;  2LQO A;  4KAE A;  3BCK A;  4KX4 A;  5ID2 A;  3PGT A;  1X9S B;  3F4S A;  4F0C A;  3U5R E;  2RLI A;  1GUK A;  3S9F A;  2CAI A;  2H76 A;  5DAK A;  2NPB A;  5H5Q A;  5G31 A;  2DJ1 A;  2H6Z A;  1PL2 A;  2E2M A;  2EIR A;  2O89 A;  2RUF A;  5G5F A;  1WP0 A;  4XRD A;  4PNG A;  2B3S A;  1UN2 A;  2ON7 A;  4Q5R A;  4F2I A;  3VUR A;  6GST A;  2F3M A;  4ZL9 A;  4DSS B;  5AIX A;  1A0R P;  4Q5F A;  4H86 A;  2N5F A;  1F9M A;  1R5A A;  2FGX A;  2M46 A;  5IPG A;  4IEL A;  4RQX A;  2H6Y A;  1Y25 A;  4TXV A;  3UBL A;  5J4U A;  5JCG A;  4PGT A;  4GRF A;  1T3B A;  2WS2 A;  4CY6 A;  2DJ3 A;  2LNT A;  1BX9 A;  1XVQ A;  4D73 A;  2EIO A;  3BCI A;  1C72 A;  4LL4 B;  1SL0 B;  3RHB A;  4L0W A;  4TRX A;  5GAN D;  4I97 A;  3TKR A;  2WGR A;  1FVJ A;  2LST A;  1UA5 A;  5ECO B;  4NHW A;  5BRT A;  5KOW A;  1U88 A;  2YZH A;  4YKG A;  4OCE A;  1KTE A;  2N5A A;  4WKW A;  1E2Y A;  3GHA A;  1HNA A;  3RBT A;  5HR3 A;  4CDO A;  3EWL A;  4ICY A;  4ID0 A;  3WT1 A;  1FAA A;  4WBJ A;  3EPT A;  1THX A;  4TR4 A;  1X9M B;  3CTG A;  2GQL A;  5ECH B;  4BVX A;  4IW9 A;  4JR6 A;  4GTU A;  5CRG A;  4KW6 A;  5IMC A;  2R6K A;  1ZCP A;  4K0G A;  2YN1 A;  1X5C A;  2FA8 A;  5CRE A;  4HS1 A;  1GTB A;  4HJ2 A;  3L78 A;  3DEX A;  5B6N A;  3RPP A;  4K7O A;  4EXJ A;  2ZNM A;  4XS4 B;  4YH2 A;  3ZLP A;  4K1F A;  3M3M A;  4XS6 A;  3NIV A;  1AQX A;  2I81 A;  2FD3 A;  1N2A A;  1QXH A;  5AIS A;  1QUW A;  3KZQ A;  4BL7 A;  4PTS A;  5ELG A;  2CZ3 A;  5IOX A;  1V57 A;  3VI7 A;  2CZ2 A;  3H8Q A;  3HZ8 A;  4IJI A;  1QGV A;  3TJK A;  1TJD A;  4MZW A;  3VWU A;  1WIK A;  1OE7 A;  1EP7 A;  3IR4 A;  2MYG A;  3J7Y k;  4NPB A;  2DIY A;  1GUH A;  4NV2 A;  3L4N A;  1GWC A;  1SK2 A;  3GKX A;  2FWE A;  1YJ6 A;  3L9S A;  3PIN A;  3QD9 A;  2NDO A;  4ZB8 A;  4OMV A;  1BJX A;  2HI7 A;  2K18 A;  3GFK A;  1QQ2 A;  4Q5Q A;  4ZXG A;  4QL9 A;  2C0E A;  4ZL8 A;  3LSZ A;  1TRU A;  5ECM B;  5JWR B;  4HQZ A;  1X5E A;  1MEK A;  1ERU A;  2KP1 A;  2M72 A;  3E0U A;  3IDV A;  3QR6 A;  1ZMA A;  3IPZ A;  2VD0 A;  3CYN A;  4GLT A;  1XW6 A;  1SKS B;  2DC5 A;  3V1W A;  4FYU A;  2GS3 A;  1XBS A;  3G9B A;  4LMV A;  2HZE A;  4V2N A;  4MNN A;  1Z6N A;  1RK4 A;  2OKA A;  5HFI A;  1R7H A;  1XZO A;  4ECC A;  4NAX A;  2OJL A;  3HY2 A;  5DDL A;  3EUR A;  1PN9 A;  4EVM A;  1GUL A;  2XHF A;  4J2F A;  4JBB A;  1SK1 A;  1TRS A;  4EKZ A;  4NMU A;  2V41 A;  4JRR A;  1V98 A;  5GSS A;  1DUG A;  3BJ5 A;  3ED3 A;  3L9V A;  3F6D A;  1FOH A;  1E6B A;  4IGJ A;  2FA4 A;  3G7J A;  2FNO A;  1ML6 A;  2X4A A;  3P2A A;  3CXG A;  3DRN A;  2MMA A;  5D9X A;  4F03 A;  2VO4 A;  3FR3 A;  3TUE A;  2VD1 A;  4AJ6 A;  2LRN A;  1SEN A;  5KN3 A;  3MNG A;  3CTF A;  1TU8 A;  2OE0 A;  1A0F A;  3UL3 A;  1XVW A;  5HR0 A;  5DCG A;  1YF1 A;  2D2Z A;  4BVY B;  2CVK A;  4LMW A;  2P5Q A;  1W89 A;  1U6T A;  2FWG A;  2JU5 A;  2KHP A;  5ID2 B;  2RII A;  2FWF A;  2TRX A;  1DSB A;  5D73 A;  2J23 A;  1GL8 A;  4GQC A;  1XW9 A;  5FWG A;  1MDI A;  3GA4 A;  2F51 A;  1OKD A;  5FHI A;  2GZY A;  1B4Q A;  1KBN A;  5A4W A;  1A8L A;  5DAK B;  1MD4 A;  2HSH A;  3HD5 A;  2FWH A;  5J5N A;  5EL8 A;  4WBR D;  3IRA A;  1FHE A;  2AJQ B;  1LJR A;  2C4J A;  2O87 A;  1VGL A;  1TRV A;  1TOF A;  3TB2 A;  1JLV A;  4MP4 A;  1O6J A;  4WXT A;  2YWI A;  3TGZ A;  5A4U A;  3QAW A;  1QMV A;  1YQ1 A;  2R0P A;  5AN1 A;  1ST9 A;  2DKH A;  1WMJ A;  3LEF A;  1ERT A;  2AYT A;  2GST A;  5D9V A;  4EL1 A;  1XIY A;  3PR8 A;  2WJU A;  2YPM A;  3A2V A;  4ZIL A;  4PQI A;  2LJK A;  4POB A;  3AY8 A;  1QK8 A;  5G1K A;  5GAP D;  4TKY A;  4WF5 A;  5IMA A;  1WJK A;  2L57 A;  4EE0 A;  4LL1 B;  4OD7 A;  2QA1 A;  1SJZ A;  2GSQ A;  2REM A;  3A2W A;  2V6O A;  2H72 A;  1BG5 A;  2I1U A;  1TXX A;  3IXR A;  3IAM 2;  3C7M A;  3GL5 A;  2I3Y A;  4WF4 A;  4WR5 A;  3N5O A;  4OCF A;  1ZYN A;  4KF9 A;  3DIE A;  4TN8 A;  4CHS A;  2DKI A;  3FY7 A;  4GWR A;  2G0F A;  2X64 A;  1TI1 A;  18GS A;  4KH7 A;  4BVX B;  2OE3 A;  4Z7X A;  4Z2R A;  3HVX A;  2A2S A;  4FQU A;  5IMD A;  4PUF C;  4X0X A;  4GXZ A;  4A5P A;  4PQH A;  1XOB A;  3F9U A;  5INY A;  1Q4J A;  1HNB A;  3LJR A;  2L4C A;  5ECR B;  4DSQ A;  4USS A;  1YY7 A;  3FW2 A;  3IK7 A;  5G1L A;  4HJM A;  1TU7 A;  2RM6 A;  5A5K A;  1EGR A;  1PKW A;  1TK5 B;  2R0G A;  4X4J A;  1GRX A;  1T4Z A;  5F0G A;  3TJB A;  4BL7 B;  2CA8 A;  2HSM A;  8GSS A;  4XCS A;  5F06 A;  2C3N A;  3MDK A;  3HVV A;  3GRX A;  3TKS A;  6GSV A;  4IHU A;  6GSY A;  1KEB A;  2IMK A;  3TRX A;  3F8U A;  1Z9H A;  3QOU A;  2ZUP A;  5JCU A;  5CRD A;  1XWA A;  4LA1 A;  1WOU A;  4XS1 A;  2YOI A;  1YF0 A;  4FIW A;  1JHB A;  1DBY A;  2H1G A;  3KIJ A;  2AB6 A;  20GS A;  4CY8 A;  3ZML A;  1BED A;  3BBY A;  3LQ7 A;  2DIZ A;  2B6M A;  1K3Y A;  1O8W A;  1TTZ A;  4OFT A;  4V2L A;  4AGS A;  4TW5 A;  5EY6 A;  2DJ2 A;  2LQQ A;  4O5Q A;  2WUL A;  3DML A;  2YV7 A;  4RUV A;  1GLP A;  2QC7 A;  1NSW A;  1HQO A;  2HZE B;  3APQ A;  2WFC A;  2DLX A;  3LYP A;  2R2J A;  2MBT A;  3F4R A;  2J9H A;  5J9B A;  1R26 A;  2QKE A;  3IK9 A;  3LGC A;  3TJG A;  2JL4 A;  1I9D A;  3EU3 A;  1LU4 A;  2YJ7 A;  2L6D A;  5B6M A;  3UEM A;  12GS A;  2X49 A;  4MDC A;  4TR3 A;  4MA9 A;  1G7E A;  2O7K A;  1YZX A;  4BPY A;  3WGD A;  1SJI A;  3UJ1 A;  2VLU A;  2FUG 2;  2B7J A;  2H6X A;  3G7Y A;  14GS A;  4XHM A;  1AIU A;  1Z5Y E;  4KND A;  3F0I A;  1X5D A;  4PXO A;  3KGK A;  2YWM A;  2C8U A;  4MCU A;  3QCP A;  2E2G A;  1O73 A;  4N10 A;  2GT6 A;  3C8E A;  3FRC A;  5HR2 A;  4O92 A;  1WRY A;  3GMF A;  5B8B A;  3MIX A;  1OE8 A;  3DD3 A;  1AXD A;  1U87 A;  3FMW A;  3D5J A;  1Z6M A;  4PX1 A;  1Z7R A;  1WE0 A;  4TOP A;  5J3R A;  3Q19 A;  2R37 A;  2PVO C;  3TKP A;  4OFN A;  3CMI A;  3QPM A;  4X1U A;  5B7C A;  2VM1 A;  2DMM A;  3UVT A;  1EEM A;  3HJM A;  3IHQ A;  3CRU A;  2H73 A;  5ECI B;  3QMX A;  3ZRE A;  1O8X A;  1MD3 A;  4XRA A;  1GSQ A;  3GUR A;  4GQF A;  2DJK A;  4MPF A;  17GS A;  3VI5 A;  1YKC A;  2H30 A;  3EIN A;  4MH3 A;  1YDK A;  3L9U A;  2OAC A;  1TK8 B;  4KB3 A;  2LRC A;  1EP8 A;  1TW9 A;  1DE1 A;  2V1M A;  5CRH A;  2P5R A;  4AF2 A;  2VCQ A;  5IMZ A;  4KDY A;  1HNC A;  3LFL A;  5IO0 A;  1DE2 A;  1UVZ A;  4OO5 A;  3ZMK A;  1TKD B;  1GTU A;  5DJL A;  1A8Y A;  3DWV A;  2LEG A;  3Q18 A;  2K9F A;  3C1R A;  3IC4 A;  4TR1 A;  4RI7 A;  5F07 A;  2L6C A;  5EPF A;  1M2D A;  4OO4 A;  4NHZ A;  3ME7 A;  4POK A;  2LS5 A;  5LD0 A;  5H5S A;  4EDZ A;  1B4P A;  1AQW A;  3ZIJ A;  2HNL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...