5HR3A

Crystal structure of thioredoxin n106a mutant
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
107
structure length
107
Chain Sequence
b'DKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDAALA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title Structural variability of E. coli thioredoxin captured in the crystal structures of single-point mutants.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 30
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5hr3A00
4BVXA 4WF5A 1YY7A 3FK8A 12GSA 4WETA 1ABAA 2L5LA 3CBUA 1XFLA 2OBKA 4FYUA 2WULA 5G2ZA 1A2MA 3J7Yk 4MH3A 1JZDA 2D2ZA 3KEBA 1OC3A 2TRCP 1PL2A 4ISDA 4AJ8A 2VIMA 2KOKA 4PQIA 5H5QA 1T8EB 1Y6EA 5ID2A 3UBLA 2YOIA 1DUGA 3EU4A 3APOA 3RPNA 3HVVA 1XWAA 5C04A 2YZUA 1V58A 2L4CA 3HVSA 2G2QA 1A2JA 2OADA 4ECJA 1UA5A 1Y25A 3WGXA 4JR4A 4KW6A 2RUFA 3IR4A 4GQCA 4KB3A 5INYA 4NPBA 1S3DA 1V98A 3A5WA 4HUAA 3U5RE 1FB0A 1PMTA 2OA7A 2DBCA 4MA9A 3E9JB 1EV9A 1XWCA 4GSNA 2H71A 3TRQA 4KDXA 4RUVA 3EMXA 2PVOC 3UEMA 2HYXA 5IPHA 3KJYA 4D73A 2YZHA 2GGTA 4OFMA 4H86A 2JU5A 3TJBA 3VWXA 4ZILA 1XVQA 1N8JA 2FWEA 5HR1A 2H66A 1NHYA 3ERGA 3LFLA 2N5BA 3UIWA 2B1LA 3TDGA 4BVYA 1J9BA 2NPBA 3GYKA 5D9VA 2H8LA 4TXOB 3BJ5A 4EDZA 2KUCA 3ZFLA 3J7Yb 1KBNA 4XRAA 3H93A 4WXTA 2LRCA 4XS4A 4RI6A 1MEKA 2IIYA 3F63A 16GSA 4K7OA 4EF0A 5CRGA 4V2MA 4KX4A 2MMZA 3HKRA 2LV3A 1ILOA 4OCEA 3FZAA 2C3QA 3VLNA 1J08A 2V6KA 4TR1B 1A23A 2H1DA 3F4TA 3LORA 5CRDA 4YAPA 3D4TA 2GZYA 4CHSA 4FH8A 2IL3A 3US3A 1OAZA 3DMLA 2H30A 4MJCA 3CTGA 5IM9A 2L6CA 4PURA 4J2FA 1XWGA 1PX7A 1M0UA 3LSZA 2CT6A 1AUCA 3VWWA 4NWYA 4PQHA 1K0OA 2GQLA 1GLQA 4HU7A 5AGYA 4PX1A 1U3IA 1OC9B 3PGTA 2DJJA 2IJYA 1FVKA 2XC2A 3ZVJD 3KGKA 3R2QA 3QPMA 1F3BA 3HY2A 3SWLA 4IQ1A 4ML1A 4IJ3A 1X0RA 1QMVA 1SKSB 4OD7A 3TKQA 5J5NA 4ZB8A 2H74A 2Z9SA 3WYWA 2H76A 3HHVA 2YWMA 3KIJA 3KMNA 5GAND 5JWQB 4FO5A 3LQ7A 1F9MA 1EWXA 1F2EA 5DALB 2GZZA 5DDLA 2H19A 2C0GA 18GSA 4LL4B 3IA1A 2AYTA 1Z3EA 2BJXA 5ENUA 2GSSA 1K3LA 4ACSA 1F6MC 1GSUA 1ZOFA 3DWVA 4MP4A 2H0GA 4EO3A 2CVBA 5G5FA 4KGIA 4GWRA 2EIQA 2R4VA 3D0ZA 4GLTA 1SYXA 1U88A 3IPZA 3ISOA 3O6TA 1ZL9A 3BBYA 2TIRA 2M46A 1Z6MA 3L9SA 2HSYA 5IIZA 4EVMA 1GTIA 2M80A 2ZNMA 3QOUA 1SKRB 3MDKA 3KCMA 2E2GA 2IMFA 1SD9A 1V2AA 1HD2A 2B7KA 3PR8A 4LLRA 1JLVA 4YQMA 5D96A 2LQOA 3ERFA 4N0VA 3D22A 4RQXA 2ZCTA 3GHAA 2CVDA 1GUMA 1O73A 4E8HA 4HU9A 4EDYA 2YPMA 5D9XA 1M2BA 3DIEA 2OBIA 1ML6A 1MDJA 4N10A 1TDIA 3UOMA 4KDYA 1GNWA 2F8AA 2I9HA 4JU5A 3QMXA 2P5RA 20GSA 3DEXA 2I81A 4ZB6A 1GUHA 4MPGA 3TCOA 3HJMA 3GFKA 3HDCA 1WMJA 5J9BA 3KTBA 3FY7A 1EEMA 3Q18A 1A8LA 2YWNA 2VL2C 2O7KA 1QXHA 4HOJA 3UBKA 1ZMAA 2ON5A 2DMLA 1I5GA 4ZL9A 5D9TA 3QAVA 3TRPA 2OE3A 2TRXA 1DE1A 2FWFA 4HQSA 17GSA 1M7TA 3M9JA 5DJLA 4HI7A 4TVEA 2L4QA 4NV5A 4IHUA 4GSSA 3BCIA 3HYPA 4KCEA 3BCKA 1S3AA 2ON7A 3IK9A 2GQKA 4TW5A 4O92A 5D93A 4L8EA 1R7HA 4O32A 3HJOA 2FCHA 2H1AA 1V40A 3VPQA 2I4AA 5CAXA 3TOUA 2VD1A 1EZKA 2AJQB 3EYTA 2LRTA 4IGJA 3EWLA 4O5RA 3BOAA 1AIUA 3GX0A 3E0UA 1H4OA 2MBSA 3VURA 1A0RP 4NHWA 5AIVA 3IC4A 1AQVA 1OVNA 2KLXA 3C1RA 4KNDA 1Q98A 4I8BA 4OFNA 1TRUA 1PL1A 1T1VA 5DAKA 2BTOT 2JACA 3GA4A 3HD5A 3UJ1A 3D21A 2AHEA 5F05A 1YEXA 4G10A 3U6VA 1VF2A 3NIVA 3ZLPA 4IQAA 4PGTA 3H4KA 3M8NA 3ZL5A 1LBKA 4X1UA 3VI5A 4Q5RA 1Z7RA 1MDIA 1FO5A 2K8VA 1U3AA 5IMCA 2LQQA 1O85A 1TRSA 2B5YA 2H01A 3ZMLA 3ZITA 2B6MA 3WGDA 2YWIA 2LNTA 4GSTA 1SYRA 2VCVA 5F06A 2VCWA 3WT2A 4QL9A 4WF4A 5G31A 1W89A 3P7XA 1K0NA 1FVJA 5F8BA 3IHQA 1ERTA 5GSSA 3ZREA 3M3MA 3ZIVA 4ULXA 5ABRA 1ZCPA 2GT6A 4AJ7A 2M72A 6GSXA 5CREA 1A8YA 2A2SA 4KCAA 4ML6A 4IP6A 2B3SA 4KE3A 2FNOA 5IMFA 4YQUA 3KH7A 5ECQB 3ZFBA 4MPFA 2MZCA 4IELA 3I43A 6GSTA 1EGOA 1JFUA 2YJHA 1K0CA 2DIZA 2RIIA 4E8EA 5G30A 1SJZA 4F0CA 3CYNA 1TK8B 3UAPA 1GSSA 1G6YA 2WCIA 4J56E 2F9SA 4JEDA 4KSOA 3KXOA 2LJKA 1ACVA 4OWYA 5GSTA 1RW1A 2YP6A 2LKUA 3DYRA 1MD3A 4BA7A 1XW6A 3WGEA 1K0BA 2WFCA 2V41A 2VD0A 3L0HA 4TN8A 1DE2A 2FGXA 3O3TA 1AW9A 2O89A 1QK8A 3LG6A 3TUEA 2GSRA 1JHBA 5J9CA 5AISA 2QGVA 3PH9A 3TKSC 2H1BA 3GKMA 3F6DA 4ID0A 1JZOA 2OKAA 4YAVA 4TR0A 2XBIA 5IMAA 3GKNA 3UVHA 1XOAA 1CQHA 4HQZA 5F0GA 5ECNB 4TXOA 1UN2A 1OKDA 3G7JA 1B4QA 4OMVA 5IOXA 3HCZA 3FEUA 2CZ3A 4F9ZA 5CP1A 3VPTA 3Q19A 4MJBA 3FKFA 4XTSA 2VO4A 1WIKA 3D4MA 5CO3A 1U87A 2YNXA 3GTUB 3HJPA 2QKEA 2X8GA 3E3EA 4TR1A 1O7UA 2DIYA 4MDCA 1FOVA 2IFQA 3KM6A 1PRXA 4GTUA 5H5SA 5A5KA 5IMDA 2EIRA 1YKAA 1AXDA 5JCUA 2FD3A 3CSHA 4ZL7A 1SKWB 2O85A 2V6OA 5CRHA 2FA8A 3VI7A 6GSWA 2B5XA 2HZEB 2WGRA 1PGTA 4TR3A 2CAQA 3DD3A 2JSYA 3FW2A 3N9JA 5GAPD 3QCPA 1FG4A 3APQA 4MJEA 4KSMA 1OC9A 2VCZA 1J0FA 4IBPA 2AB6A 5EL8A 1XZOA 2FWHA 3ZYWA 2VL3A 2LS5A 3VK9A 3FZ9A 5ECHB 4ECIA 3K8NA 1U6TA 3F9UA 3MAKA 4HJMA 3TB2A 4TOPA 2NDOA 4DEJA 2C1YA 2YCDA 1PD21 1FHEA 1YJ6A 5JCGA 1ZYEA 1GSQA 2K6VA 4BWQA 3N5OA 4L0UA 3EC3A 3DKSA 3O76A 5ELAA 1EOGA 4MZBA 1T7PB 3RPPA 2HNLA 5JCWA 2NBSA 3P8WA 2R5GA 1XWBA 2FA4A 1G6WA 4IVFA 4YH2A 4NHZA 1Z9HA 1OKTA 5KN2A 2FUG2 1KNGA 1SJ6A 5H5RA 2EC4A 5J3RA 3FR9A 3P90A 2C80A 1ST9A 2NTOA 3EURA 1AQXA 4KA0A 4OCFA 1R26A 2RM6A 4GXZA 2IN3A 3G7IA 2K18A 1E6BA 2GLRA 3HA9A 4MK3A 2JZSA 5DCHA 4DSSB 3GX8A 4EL1A 5ECSA 3S9FA 3QAGA 2GSTA 3TJKA 4N0ZA 1X9WB 4JBBA 2OJLA 2PBJA 2B7JA 1GL8A 4ILFA 1F37A 3L4NA 2LSTA 3GL5A 3UL3A 1PX6A 4XIHA 4F0BA 1TU7A 3A2WA 3LYPA 2H6ZA 3Q6OA 4N11A 1BAYA 1QGVA 2HFDA 1WOUA 2G0FA 2VCQA 5DCGA 2NVLA 1JZWA 2I3YA 2JZRA 3MWHA 2OACA 5EPFA 2REMA 2VM2A 1Q4JA 3IBHA 3I69A 5DVBA 3RHBA 3LEFA 2DJ0A 4IN0A 2PVQA 4L0WA 5FHIA 2GQMA 4GCIA 1T3BA 2CAIA 1R5PA 5ECPB 4I97A 3ED3A 4G9HA 1G7EA 4XS6A 5GZZB 1PSQA 3C71A 5L71A 4IJIA 1WRYA 5DQSA 4O7HA 1BJXA 5IO0A 4MF6A 1THXA 3I9V2 1ERUA 4Q5NA 2CQ9A 3F3RA 1BYEA 2E0QA 3KTLA 4OO5A 3V1WA 2B1KA 3DRNA 4I2UA 1PQNA 4PXOA 4FIWA 1XCCA 2FY6A 1JLWA 4HEA2 3G7YA 1RQMA 1TTZA 2HT9A 4NMUA 1W4VA 3IAS2 4MF5A 1NM3A 2P5QA 1YF1A 3CSIA 4FYCA 1DSBA 4MZWA 1ZZYA 3F4RA 2H6YA 1X9MB 5IMVA 3GKKA 5IOWA 4XS1A 4V1Ap 4CDOA 2B5EA 2ZUPA 2ES7A 4RI7A 3UARA 2YN1A 1XBSA 5E59A 3LJRA 4ZL8A 1O8WA 5B7CA 5HR2A 4K7IA 19GSA 1NW2A 4EXJA 1EGRA 1K3OA 3M1GA 3QFAC 1WE0A 2X8CA 2IMIA 1TW9A 2I1UA 3F6FA 1EEJA 2R6KA 2O8VB 3LXZA 1B8XA 3IOSA 3KH9A 4HJ2A 4G19A 4V2LA 2CVKA 4DSRA 5FWGA 3IRAA 3KZQA 1SL2B 4DVCA 1ZYQB 2N5AA 3NOFA 4K9ZA 3HXSA 4HZ2A 4EUYA 2QC7A 1OYJA 1SD8A 2LUSA 2WJUA 2RUEA 1TI1A 2KP2A 2GDRA 3ZMKA 5EY6A 7GSSA 2PWJA 5A4UA 3RBTA 1B9XC 1N2AA 4K7NA 3G9BA 13GSA 1SL1B 4WR5A 4F82A 1QUWA 4P3YB 3EU3A 1SL0B 3IAM2 3TKRA 3GIXA 1Z7PA 3C1SA 4Z7XA 4HDEA 2V2GA 2E2MA 1AQWA 2VL9A 3I6AA 3LYKA 4K8MA 5JWRB 4I6XA 4K6XA 3DGQA 4J57E 3A2XA 3CRUA 2H72A 2WS2A 2C3TA 2GTUA 1R5AA 1PKWA 1G0TA 3GSTA 1GSYA 4X43A 3C73A 5HR3A 1GTBA 3M0FA 3TJGA 3KP9A 5HFIA 2P31A 5DAKB 5A4WA 1VGLA 3H79A 2PERA 2V1MA 1XIYA 2H6XA 1TI3A 2O87A 1SU9A 1OE7A 4PUFC 2RM5A 2C0FA 2GZPA 1M2AA 4PNGA 4OO4A 3GN3A 3P2AA 3FR3A 3W6GA 1XWKA 2QSIA 1T4YA 2CA8A 2H0IA 1X5CA 4GQFA 1USBA 3CSJA 4GF0A 4NV2A 3TKPA 1TP9A 5D9WA 4POKA 3FHKA 1TRVA 2DC5A 2HRFA 1EP7A 2PGTA 3CTFA 4BPYA 1BG5A 5CRWA 4CW9A 3LXTA 2XPEA 5CYYA 3GUSA 3D5JA 3IK7A 1IYHA 1SENA 3C8EA 3KP8A 4K0GA 2P0GA 3KD0A 3ZRDA 2F3MA 2GT5A 6GSUA 5B8AA 3L78A 3GH9A 4PQ1A 5ECMB 1QQ2A 2AUVA 5LCZA 3GTUA 1FAAA 1GNEA 1Z6NA 1O6JA 5B6NA 3FYGA 1K0MA 1S3CA 1M9AA 1WJKA 3Q74A 4F03A 1TKDB 2WRTA 4LA1A 3QAWA 2H1GA 5KN1A 4ECCA 1PKZA 2YWOA 5G1LA 4ZIJA 4DSQA 3CMIA 1FW1A 1EOHA 5ID2B 1SK0A 1UVZA 5KEJA 1V9WA 4JR6A 2DJKA 1V57A 3TJJA 1NHOA 2HZFA 1PA3A 3UVTA 2HZEA 1GSEA 4ZBBA 3QD9A 4MLYA 5ELGA 1XPVA 2IWTA 4XCSA 1XW9A 2H75A 4XHMA 1B9YC 2JADA 1UC7A 1TRWA 3M9KA 3VFIA 1SK2A 1EP8A 5FT3A 2XHFA 1ZGNA 2FWGA 4QL7A 1CQGA 3H1NA 2PN8A 1KTEA 2IPAA 1H75A 3F4SA 3F3QA 4KUNA 1X5DA 2YV9A 2HE3A 2X8HA 1C72A 1WPIA 4IS0A 3FZ5A 1GULA 4F2IA 3LGCA 3ZVJA 1GSDA 5HFGA 4GRFA 4G2EA 4D73B 1YF0A 5ECRB 3MNGA 1GTAA 3ME7A 5LNKe 3VWUA 4V1Ag 2LEGA 3CXGA 4RQRA 4MCUA 2IMDA 3GSSA 2LJRA 2DJ3A 1OE8A 5J41A 5J4UA 1HNBA 4POLA 2IFQB 4TKYA 3F8UA 2DMMA 2GSQA 3RDWA 1TOFA 3DVXA 1BEDA 1NSWA 1WP0A 5IMZA 2VL2A 2C3NA 2CV4A 4L5OA 3HZ8A 2J23A 5DALA 4XS4B 1B4PA 1O81A 2GS3A 3F0IA 5EVOA 3GL3A 2K8SA 1VF1A 3RAZA 4DSSA 2VCTA 5DBQA 3IXRA 2HRNA 4NAXA 3DXBA 1M2DA 1ERVA 3QDNA 4MMMA 4I5QA 1AAZA 1HYUA 3TJFA 2WB9A 4TXVA 1SJIA 1GSFA 3MSZA 1A0FA 1MD4A 4IP1A 3WT1A 4JRRA 4ZBDA 1GUKA 5A4VA 3GNJA 2VLTA 4K0NA 11GSA 1XXUA 1F3AA 5HFKA 1TXXA 1GWCA 2EIOA 4K1FA 4N30A 4TRXA 4IKHA 1LU4A 3ERWA 1E2YA 2H70A 3FRCA 3DVWA 4YQVA 3A2VA 1HNCA 1KEBA 1R4WA 2DSAA 3CRTA 5ECKB 2CX3A 1OC8A 2CZ2A 4V2NA 2R3XA 3GURA 2VAFA 3VWVA 1XW5A 2BMXA 4WBJA 4JZQA 1VF4A 2E7PA 3ZZXA 5G1KA 4WKWA 3IV4A 4AF2A 1YQ1A 5AN1A 1RK4A 3BD2A 5KN0A 1GP1A 1WWJA 1XVWA 2IMKA 4LMWA 2VCXA 2N5FA 1X5EA 3RHCA 2L5OA 3APSA 1GLPA 3ME8A 2HI7A 3OR5A 5KN3A 1Z5YE 5HQPA 1GTUA 2OE1A 1ERWA 1HQOA 1BX9A 4MABA 2MBTA 2L6DA 2HSHA 2JSZA 2X64A 4BL7A 2DLXA 22GSA 1O8XA 3L9UA 5CNWA 4EC0A 4LL1B 3QR6A 2KP1A 1T00A 2C0DA 1M99A 5ECLB 4PUAA 2MMOA 4WR4A 2J9HA 1M9BA 3W8JA 2DJ1A 6GSSA 1PN9A 1B48A 3FZ4A 4WEYA 5DQYA 4L5LA 3TOTA 5COHA 2JZTA 4JE1A 2VM1A 1DBYA 2YANA 1VF3A 1MDKA 9GSSA 1YEPA 1TK0B 1QFNA 4MJAA 4TR4A 4ZBAA 3JCML 4K2DA 4Q5QA 4OFTA 2DJ2A 1YDKA 14GSA 1VRSD 2RLIA 1THOA 4EKZA 4Q5FA 3GKXA 4ZB9A 1ON4A 1I9DA 2OE0A 6GSYA 1YKCA 4MZCA 2L57A 3EMPA 1FB6A 1K3YA 3FR6A 3EVIA 4I2TA 5G5EA 2ALBA 4KAEA 5IQYA 2VLVA 2YV7A 3GH6A 3TGZA 2CX4A 2K9FA 2MMAA 2HLSA 5ECIB 2FHEA 3IE3A 4POBA 1BQ7A 2PU9C 3TRXA 1JZRA 3H8QA 1XOBA 2F51A 5LD0A 2VLUA 1HNAA 2FLSA 2VUPA 2XBQA 3EINA 4QQ7A 2R2JA 4MF7A 2MYGA 2X99A 2C0EA 3TKSA 4HZ4A 4PNFA 1GRXA 4IW9A 4XRDA 2A2RA 4EE0A 1X9SB 5JWOB 3ZIJA 2GVPA 4HS1A 1YZXA 2YJ7A 2C4JA 2F8FA 3GV1A 3UMAA 1GH2A 3GMFA 5IPGA 5IO2A 2PPTA 1AC1A 3EE2A 1IYIA 4KH7A 3SBCA 3W8SA 1A2LA 4ZXGA 5D8IA 1EV4A 4LMVA 3KMOA 1URMA 3D6IA 2AV4A 5HR0A 6GSVA 2HXKA 2R37A 3HZ4A 5B8BA 3L9VA 2PUKC 1T4ZA 2A4VA 2MMNA 5ECOB 1LJRA 4WBRD 3TKSE 4MH2A 1K0DA 1MTCA 2KHPA 2LNSA 4NXIA 1K0AA 2AAWA 3NZNA 2L59A 5E4WA 4ECBA 5B6MA 5AIXA 3PINA 2IMEA 3HVXA 3GRXA 2LTKA 1TJDA 2XPDA 4KDUA 3LWAA 4POMA 1A24A 3C7MA 2PMTA 1TK5B 2JL4A 1TU8A 2V32A 3IDVA 3A3TA 2WZ9A 2LRNA 8GSSA 2C8UA 3AY8A 4AJ6A 3WD6A 2VOCA 5F07A 2WDUA 4BWSA 3ZTLA 1G7OA 10GSA 5D73A 2H0HA 4FYBA 4X0XA 5C00A 2H73A 3QFBC 2LJAA 5DJMA 1SK1A 4AGSA
chains in the Genus database with same CATH superfamily
4BVXA 4FQUA 4WF5A 1YY7A 3FK8A 12GSA 4WETA 1ABAA 2L5LA 3CBUA 1XFLA 2OBKA 4FYUA 2WULA 5G2ZA 1A2MA 3J7Yk 4EIPA 4MH3A 1JZDA 2D2ZA 3KEBA 1OC3A 2TRCP 1PL2A 4ISDA 4AJ8A 2VIMA 2KOKA 4PQIA 5H5QA 1T8EB 1Y6EA 5ID2A 3UBLA 2YOIA 1DUGA 3EU4A 3APOA 3RPNA 3HVVA 1XWAA 5C04A 2YZUA 1V58A 2L4CA 3HVSA 2G2QA 1A2JA 4K5RA 2OADA 4ECJA 1UA5A 1Y25A 3WGXA 4JR4A 4KW6A 2RUFA 3IR4A 4GQCA 4KB3A 5INYA 4NPBA 1S3DA 1V98A 3A5WA 4HUAA 3U5RE 1FB0A 1PMTA 2OA7A 2DBCA 4MA9A 3E9JB 1EV9A 1XWCA 4GSNA 2H71A 3TRQA 4KDXA 4RUVA 3EMXA 2PVOC 3UEMA 2HYXA 5IPHA 3KJYA 4D73A 2YZHA 2GGTA 4OFMA 4H86A 2QA2A 3CQFA 2JU5A 3TJBA 3VWXA 1M3JA 4ZILA 1XVQA 1N8JA 2FWEA 5HR1A 2H66A 1NHYA 3ERGA 3LFLA 2N5BA 3UIWA 2B1LA 3TDGA 4BVYA 1J9BA 2NPBA 3GYKA 5D9VA 2H8LA 4TXOB 3BJ5A 4EDZA 2KUCA 3ZFLA 3J7Yb 1KBNA 4XRAA 3H93A 4WXTA 2LRCA 4XS4A 4RI6A 1MEKA 2IIYA 3F63A 16GSA 5KOXA 4K7OA 4EF0A 5CRGA 4V2MA 4KX4A 2MMZA 3HKRA 2LV3A 1ILOA 4OCEA 3FZAA 2C3QA 3VLNA 1J08A 2V6KA 4TR1B 1A23A 2H1DA 3F4TA 3LORA 5CRDA 4YAPA 3D4TA 2GZYA 4CHSA 4FH8A 2IL3A 3US3A 1OAZA 3DMLA 2H30A 4MJCA 3CTGA 5IM9A 2L6CA 4PURA 4J2FA 1XWGA 1PX7A 1M0UA 3LSZA 2CT6A 1AUCA 3VWWA 4NWYA 4PQHA 1K0OA 2GQLA 1GLQA 4HU7A 2R0CA 5AGYA 4PX1A 1U3IA 1OC9B 3PGTA 2DJJA 2IJYA 1FVKA 2XC2A 3ZVJD 3KGKA 3R2QA 3QPMA 1F3BA 2R0PA 3HY2A 5KOWA 3SWLA 3LW9A 4IQ1A 4ML1A 4IJ3A 1X0RA 1QMVA 1SKSB 4OD7A 3TKQA 5J5NA 4ZB8A 2H74A 2Z9SA 3WYWA 2H76A 3HHVA 2YWMA 3KIJA 3KMNA 5GAND 5JWQB 4FO5A 3LQ7A 1F9MA 1EWXA 1F2EA 5DALB 2GZZA 5DDLA 2H19A 2C0GA 18GSA 4LL4B 3IA1A 2AYTA 3HVNA 1Z3EA 2BJXA 5ENUA 2GSSA 1K3LA 4ACSA 1F6MC 1GSUA 1ZOFA 3DWVA 4MP4A 2H0GA 4EO3A 2CVBA 5G5FA 4KGIA 4GWRA 2EIQA 2R4VA 3D0ZA 4GLTA 1SYXA 1U88A 3IPZA 3ISOA 3O6TA 1ZL9A 3BBYA 2TIRA 2M46A 1Z6MA 3L9SA 2HSYA 5IIZA 4EVMA 1GTIA 2M80A 2ZNMA 3QOUA 1SKRB 3MDKA 3KCMA 2E2GA 2IMFA 1SD9A 1V2AA 1HD2A 2B7KA 3PR8A 4LLRA 1JLVA 4YQMA 5D96A 2LQOA 3ERFA 4N0VA 3D22A 4RQXA 2ZCTA 3GHAA 2CVDA 1GUMA 1O73A 4E8HA 4HU9A 4EDYA 2YPMA 4YKGA 1M2BA 5D9XA 3DIEA 2OBIA 1ML6A 1MDJA 4N10A 1TDIA 3UOMA 4KDYA 1GNWA 2F8AA 2I9HA 4JU5A 3QMXA 2P5RA 20GSA 3DEXA 2I81A 4ZB6A 4BL7B 1GUHA 4MPGA 3TCOA 3HJMA 3GFKA 3HDCA 1WMJA 5J9BA 3KTBA 3FY7A 1EEMA 3Q18A 1A8LA 2YWNA 2VL2C 2O7KA 1QXHA 4HOJA 3UBKA 1ZMAA 2ON5A 2DMLA 1I5GA 4ZL9A 5D9TA 3QAVA 3TRPA 2OE3A 2TRXA 1DE1A 2FWFA 4HQSA 17GSA 1M7TA 3M9JA 5DJLA 4HI7A 4TVEA 2L4QA 4NV5A 4IHUA 4GSSA 3BCIA 3HYPA 4KCEA 3BCKA 4HSCX 1S3AA 2ON7A 3IK9A 2GQKA 4TW5A 4O92A 5D93A 4L8EA 1R7HA 4O32A 3HJOA 2FCHA 2H1AA 1V40A 3VPQA 2I4AA 5CAXA 3TOUA 2VD1A 1EZKA 2AJQB 3EYTA 2LRTA 4IGJA 3EWLA 4O5RA 3BOAA 1AIUA 3GX0A 3E0UA 1H4OA 2MBSA 3VURA 1A0RP 3PPUA 4NHWA 5AIVA 3IC4A 1AQVA 1OVNA 2KLXA 3C1RA 4KNDA 1Q98A 4I8BA 4OFNA 1TRUA 1PL1A 1T1VA 5DAKA 2BTOT 2JACA 3GA4A 3HD5A 3UJ1A 3D21A 2AHEA 5F05A 1YEXA 4G10A 3U6VA 1VF2A 3NIVA 3ZLPA 4IQAA 4PGTA 3H4KA 3M8NA 3ZL5A 1LBKA 4X1UA 3VI5A 4Q5RA 1Z7RA 1MDIA 1ZYNA 1FO5A 2K8VA 1U3AA 5BMUA 5IMCA 2LQQA 1O85A 1TRSA 2B5YA 2H01A 3ZMLA 3ZITA 2B6MA 4CY8A 3WGDA 2YWIA 2LNTA 4GSTA 1SYRA 2VCVA 5F06A 2VCWA 3WT2A 4QL9A 4WF4A 5G31A 1W89A 3P7XA 1K0NA 1FVJA 5F8BA 3IHQA 1ERTA 5GSSA 3ZREA 3M3MA 3ZIVA 4ULXA 5ABRA 1ZCPA 2GT6A 4AJ7A 2M72A 6GSXA 5CREA 1A8YA 2A2SA 4KCAA 4ML6A 4IP6A 2B3SA 4KE3A 2FNOA 5IMFA 4YQUA 3KH7A 5ECQB 3ZFBA 4MPFA 2MZCA 4IELA 3I43A 6GSTA 1EGOA 1JFUA 2YJHA 1K0CA 2DIZA 2RIIA 4E8EA 3A5IA 5G30A 1SJZA 4F0CA 3CYNA 1TK8B 3UAPA 1GSSA 1G6YA 2WCIA 4J56E 2F9SA 4JEDA 4KSOA 3KXOA 2LJKA 1ACVA 4OWYA 5GSTA 1RW1A 2YP6A 2LKUA 3DYRA 1MD3A 4BA7A 1XW6A 3WGEA 1K0BA 2WFCA 2V41A 2VD0A 3L0HA 4TN8A 1DE2A 2FGXA 3O3TA 1AW9A 2O89A 1QK8A 3LG6A 3TUEA 2GSRA 1JHBA 5J9CA 5AISA 2QGVA 3PH9A 3TKSC 2H1BA 3GKMA 3F6DA 4ID0A 1JZOA 2OKAA 4YAVA 4TR0A 2XBIA 5IMAA 3GKNA 3UVHA 1XOAA 1CQHA 4HQZA 5F0GA 5ECNB 4TXOA 1UN2A 1OKDA 3G7JA 1B4QA 4OMVA 2QA1A 5IOXA 3HCZA 3FEUA 2CZ3A 4F9ZA 5CP1A 3VPTA 3Q19A 4MJBA 3FKFA 4XTSA 2VO4A 1WIKA 3D4MA 5CO3A 1U87A 2YNXA 3GTUB 3HJPA 2QKEA 2X8GA 3E3EA 4TR1A 1O7UA 2DIYA 4MDCA 1FOVA 2IFQA 3KM6A 1PRXA 4GTUA 5H5SA 5A5KA 5IMDA 2EIRA 1YKAA 1AXDA 5JCUA 2FD3A 3CSHA 4ZL7A 1SKWB 2O85A 2V6OA 5CRHA 2FA8A 3VI7A 6GSWA 2B5XA 2HZEB 2WGRA 1PGTA 4TR3A 2CAQA 3DD3A 2JSYA 3FW2A 3N9JA 5GAPD 3QCPA 1FG4A 3APQA 4MJEA 4KSMA 1OC9A 2VCZA 1J0FA 4IBPA 2AB6A 5EL8A 1XZOA 2FWHA 4X4JA 3ZYWA 2VL3A 2R0GA 2LS5A 3VK9A 3FZ9A 5ECHB 4ECIA 3K8NA 1U6TA 3F9UA 3MAKA 4HJMA 3TB2A 4BVYB 4TOPA 2NDOA 4DEJA 2C1YA 2YCDA 1PD21 1FHEA 1YJ6A 5JCGA 1ZYEA 1GSQA 2K6VA 4BWQA 3N5OA 4L0UA 3EC3A 3DKSA 3O76A 1EOGA 5ELAA 4MZBA 1T7PB 3RPPA 2HNLA 5JCWA 2NBSA 3P8WA 2R5GA 1XWBA 2FA4A 1G6WA 4IVFA 1M3IA 4YH2A 4NHZA 1Z9HA 1OKTA 5KN2A 2FUG2 1KNGA 1SJ6A 5H5RA 2EC4A 5J3RA 3FR9A 3P90A 2C80A 1ST9A 2NTOA 3EURA 1AQXA 4KA0A 4OCFA 1R26A 2RM6A 4GXZA 2IN3A 3G7IA 2K18A 1E6BA 2GLRA 3HA9A 4MK3A 2JZSA 5DCHA 4DSSB 4MNNA 3GX8A 4EL1A 5ECSA 3S9FA 3QAGA 2GSTA 1FOHA 2X4AA 3TJKA 4N0ZA 1X9WB 4JBBA 4KF9A 2OJLA 2PBJA 2B7JA 1GL8A 4ILFA 1F37A 3L4NA 2LSTA 3GL5A 3UL3A 1PX6A 4XIHA 4F0BA 3MYDA 1TU7A 3A2WA 3LYPA 2H6ZA 3Q6OA 2HRKA 4N11A 1BAYA 1QGVA 2HFDA 1WOUA 3EPTA 2G0FA 2VCQA 5DCGA 2NVLA 4G0LA 1JZWA 2I3YA 2JZRA 3MWHA 2OACA 5EPFA 2REMA 3FMWA 2VM2A 1Q4JA 3IBHA 3I69A 5DVBA 3RHBA 3LEFA 2DJ0A 4IN0A 4Z2UA 2PVQA 5BRTA 4L0WA 5FHIA 2GQMA 4GCIA 1T3BA 2CAIA 1R5PA 5ECPB 4I97A 3ED3A 4G9HA 1G7EA 4XS6A 5GZZB 1PSQA 2DKIA 3C71A 5L71A 4IJIA 1WRYA 5DQSA 4O7HA 1BJXA 4G0KA 5IO0A 4MF6A 1THXA 3I9V2 1ERUA 4Q5NA 2CQ9A 3F3RA 1BYEA 2E0QA 3KTLA 4OO5A 3V1WA 2B1KA 3DRNA 4I2UA 1PQNA 2X49A 4PXOA 4FIWA 1XCCA 2FY6A 1JLWA 4HEA2 3G7YA 1RQMA 1TTZA 2HT9A 4NMUA 1W4VA 3IAS2 4MF5A 1NM3A 2P5QA 1YF1A 3CSIA 4FYCA 1DSBA 4O5QA 4MZWA 1ZZYA 3F4RA 4G0IA 2H6YA 1X9MB 5IMVA 3GKKA 5IOWA 4XS1A 4V1Ap 4CDOA 2B5EA 2ZUPA 2ES7A 4RI7A 3UARA 2YN1A 1XBSA 5E59A 3LJRA 4ZL8A 1O8WA 1PN0A 5B7CA 5HR2A 4K7IA 19GSA 1NW2A 4EXJA 1EGRA 1K3OA 3M1GA 3QFAC 1WE0A 2X8CA 2IMIA 1TW9A 2I1UA 3F6FA 1EEJA 2R6KA 2O8VB 3LXZA 4YKFA 1B8XA 3IOSA 3KH9A 4HJ2A 4G19A 4V2LA 2CVKA 4DSRA 5FWGA 3IRAA 3KZQA 1SL2B 4DVCA 1ZYQB 2N5AA 3NOFA 4K9ZA 3HXSA 4HZ2A 4EUYA 2QC7A 1OYJA 1SD8A 2LUSA 2WJUA 2RUEA 4CY6A 1TI1A 2KP2A 4K5SA 2GDRA 3ZMKA 5EY6A 7GSSA 2PWJA 5A4UA 3RBTA 1B9XC 1N2AA 4K7NA 3G9BA 2A2PA 4EIQA 13GSA 1SL1B 4WR5A 4F82A 1QUWA 4P3YB 3EU3A 1SL0B 4Z2RA 3IAM2 3TKRA 3GIXA 1Z7PA 2HRAA 3C1SA 4Z7XA 4HDEA 2V2GA 2E2MA 1AQWA 2VL9A 3I6AA 3LYKA 4K8MA 5JWRB 4I6XA 4K6XA 3DGQA 4J57E 3A2XA 3CRUA 2H72A 2WS2A 2C3TA 3IC8A 2GTUA 1R5AA 1PKWA 1G0TA 3GSTA 1GSYA 4X43A 3C73A 5HR3A 1GTBA 3M0FA 3TJGA 3KP9A 5HFIA 2P31A 5DAKB 5A4WA 1VGLA 3H79A 2PERA 2V1MA 1XIYA 2H6XA 1TI3A 2O87A 1SU9A 1OE7A 4PUFC 2RM5A 2C0FA 2GZPA 1M2AA 4PNGA 4OO4A 3GN3A 3P2AA 3FR3A 3W6GA 1XWKA 2QSIA 1T4YA 4Z2TA 2CA8A 2H0IA 1X5CA 4GQFA 1USBA 3CSJA 4GF0A 4NV2A 3TKPA 3MIXA 1TP9A 5D9WA 4POKA 3FHKA 1TRVA 2DC5A 2HRFA 1EP7A 2PGTA 3CTFA 4BPYA 1BG5A 5CRWA 3R3EA 4CW9A 3LXTA 3IHGA 2XPEA 5CYYA 3GUSA 3D5JA 3IK7A 4BVXB 1IYHA 1SENA 3C8EA 3KP8A 4K0GA 1S3RA 2P0GA 3KD0A 3ZRDA 2F3MA 4ICYA 2GT5A 6GSUA 5B8AA 3L78A 3GH9A 4PQ1A 5ECMB 1QQ2A 2AUVA 5LCZA 3GTUA 1FAAA 1GNEA 1Z6NA 1O6JA 5B6NA 3FYGA 1K0MA 1S3CA 1M9AA 1WJKA 3Q74A 4F03A 1TKDB 2WRTA 4LA1A 3QAWA 2H1GA 5KN1A 4ECCA 1PKZA 2YWOA 5G1LA 4ZIJA 4DSQA 3CMIA 1FW1A 1EOHA 5ID2B 1SK0A 1UVZA 5KEJA 1V9WA 4JR6A 2DJKA 1V57A 3TJJA 1NHOA 2HZFA 1PA3A 3UVTA 2HZEA 1GSEA 4ZBBA 3QD9A 4MLYA 5ELGA 1XPVA 2IWTA 4XCSA 1XW9A 2H75A 4XHMA 1B9YC 2JADA 1UC7A 1TRWA 2HSMA 3M9KA 3VFIA 1SK2A 1EP8A 4USSA 5FT3A 2XHFA 1ZGNA 2FWGA 4QL7A 1CQGA 3H1NA 2PN8A 1KTEA 2IPAA 1H75A 3F4SA 4K2XA 3F3QA 4KUNA 1X5DA 2YV9A 2HE3A 2X8HA 1C72A 1WPIA 4IS0A 3FZ5A 1GULA 4F2IA 3LGCA 3ZVJA 1GSDA 5HFGA 4GRFA 4G2EA 4D73B 1YF0A 4O5UA 5ECRB 3MNGA 1GTAA 3ME7A 5LNKe 3VWUA 4V1Ag 2LEGA 3CXGA 4RQRA 4MCUA 2IMDA 3GSSA 2LJRA 2DJ3A 1OE8A 5J41A 5J4UA 1HNBA 4POLA 2IFQB 4TKYA 3F8UA 2DMMA 2GSQA 3RDWA 1TOFA 3DVXA 1BEDA 1NSWA 1WP0A 5IMZA 2VL2A 2C3NA 2CV4A 4L5OA 3HZ8A 2J23A 5DALA 4XS4B 1B4PA 1O81A 2GS3A 3F0IA 5EVOA 3GL3A 2K8SA 1VF1A 4A5PA 3RAZA 4DSSA 2VCTA 5DBQA 3IXRA 2HRNA 4NAXA 3DXBA 1M2DA 1ERVA 3QDNA 4MMMA 4I5QA 1AAZA 1HYUA 3TJFA 2WB9A 4TXVA 1SJIA 1GSFA 3MSZA 1A0FA 1MD4A 4IP1A 3WT1A 4JRRA 4ZBDA 1GUKA 5A4VA 3GNJA 2VLTA 4K0NA 11GSA 1XXUA 1F3AA 5HFKA 1TXXA 1GWCA 2EIOA 4K1FA 4N30A 4TRXA 4IKHA 1LU4A 3ERWA 1E2YA 2H70A 3FRCA 3DVWA 4YQVA 3A2VA 1HNCA 1KEBA 1R4WA 2UZ8A 2DSAA 2DKHA 3CRTA 5ECKB 2CX3A 1OC8A 2CZ2A 4V2NA 2R3XA 3GURA 4BIKA 2VAFA 3VWVA 1XW5A 2BMXA 4WBJA 4JZQA 1VF4A 2E7PA 3ZZXA 5G1KA 4WKWA 3IV4A 4AF2A 1YQ1A 5AN1A 1RK4A 3BD2A 5KN0A 1GP1A 1WWJA 1XVWA 2IMKA 4LMWA 2VCXA 2N5FA 1X5EA 3RHCA 2L5OA 3APSA 1GLPA 3ME8A 2HI7A 3OR5A 5KN3A 1Z5YE 5HQPA 1GTUA 2OE1A 1ERWA 1HQOA 1BX9A 4MABA 2MBTA 2L6DA 2HSHA 2JSZA 2X64A 4BL7A 2DLXA 22GSA 1O8XA 3L9UA 5CNWA 4EC0A 4LL1B 3QR6A 2KP1A 1T00A 2C0DA 1M99A 5ECLB 4PUAA 2MMOA 4WR4A 2J9HA 1M9BA 3W8JA 2DJ1A 6GSSA 1XG8A 1PN9A 1B48A 3FZ4A 4WEYA 5DQYA 4L5LA 3TOTA 1PFOA 5COHA 2JZTA 4JE1A 2VM1A 1DBYA 2YANA 1VF3A 1MDKA 9GSSA 1YEPA 1TK0B 1QFNA 4MJAA 4TR4A 4ZBAA 3JCML 4K2DA 4Q5QA 4OFTA 2DJ2A 1YDKA 14GSA 1VRSD 2RLIA 1THOA 4EKZA 4Q5FA 3GKXA 4ZB9A 1ON4A 1I9DA 2OE0A 6GSYA 1YKCA 4MZCA 2L57A 3EMPA 1FB6A 1K3YA 3FR6A 3EVIA 4I2TA 5G5EA 2ALBA 4KAEA 5IQYA 2VLVA 2YV7A 3GH6A 3TGZA 2CX4A 2K9FA 2MMAA 2HLSA 5ECIB 2FHEA 3IE3A 4POBA 1BQ7A 2PU9C 3TRXA 1JZRA 3H8QA 1XOBA 2F51A 5LD0A 2VLUA 1HNAA 2FLSA 2VUPA 2XBQA 3EINA 4QQ7A 2R2JA 4MF7A 2MYGA 2X99A 2C0EA 3TKSA 4HZ4A 4PNFA 1GRXA 4IW9A 4XRDA 2A2RA 4EE0A 1X9SB 5JWOB 3ZIJA 2GVPA 4HS1A 1YZXA 2YJ7A 2C4JA 2F8FA 3GV1A 3UMAA 1GH2A 3GMFA 5IPGA 5IO2A 2PPTA 1AC1A 3EE2A 1IYIA 4KH7A 3SBCA 3W8SA 1A2LA 4ZXGA 1EV4A 4LMVA 5D8IA 3KMOA 1URMA 3D6IA 2AV4A 5HR0A 6GSVA 2HXKA 2R37A 3HZ4A 5B8BA 3L9VA 2PUKC 1T4ZA 2A4VA 2MMNA 5ECOB 1LJRA 1ZYPA 4WBRD 3TKSE 4MH2A 1K0DA 4PTSA 1MTCA 2KHPA 2LNSA 4NXIA 1K0AA 2AAWA 3NZNA 2L59A 5E4WA 4ECBA 2A4HA 5B6MA 5AIXA 3PINA 2IMEA 3HVXA 3GRXA 2LTKA 1TJDA 2XPDA 4KDUA 3LWAA 4POMA 1A24A 3C7MA 2PMTA 1TK5B 2JL4A 1TU8A 2V32A 3IDVA 3A3TA 2WZ9A 2LRNA 8GSSA 2C8UA 3AY8A 4AJ6A 3WD6A 2VOCA 5F07A 2WDUA 4BWSA 3ZTLA 1G7OA 10GSA 5D73A 2H0HA 4FYBA 4X0XA 5C00A 2H73A 3QFBC 2LJAA 5DJMA 1SK1A 4AGSA
chains in the Genus database with same CATH topology
4BVXA 4FQUA 4WF5A 1YY7A 3FK8A 12GSA 4WETA 1ABAA 2L5LA 3CBUA 1XFLA 2OBKA 4FYUA 2WULA 5G2ZA 1A2MA 3J7Yk 4EIPA 4MH3A 1JZDA 2D2ZA 3KEBA 1OC3A 2TRCP 1PL2A 4ISDA 4AJ8A 2VIMA 2KOKA 4PQIA 5H5QA 1T8EB 1Y6EA 5ID2A 3UBLA 2YOIA 1DUGA 3EU4A 3APOA 3RPNA 3HVVA 1XWAA 5C04A 2YZUA 1V58A 2L4CA 3HVSA 2G2QA 1A2JA 4K5RA 2OADA 4ECJA 1UA5A 1Y25A 3WGXA 4JR4A 4KW6A 2RUFA 3IR4A 4GQCA 4KB3A 5INYA 4NPBA 1S3DA 1V98A 3A5WA 4HUAA 3U5RE 1FB0A 1PMTA 2OA7A 2DBCA 4MA9A 3E9JB 1EV9A 1XWCA 4GSNA 2H71A 3TRQA 4KDXA 4RUVA 3EMXA 2PVOC 3UEMA 2HYXA 5IPHA 3KJYA 4D73A 2YZHA 2GGTA 4OFMA 4H86A 2QA2A 2JU5A 3TJBA 3VWXA 4ZILA 1XVQA 1N8JA 2FWEA 5HR1A 2H66A 1NHYA 3ERGA 3LFLA 2N5BA 3UIWA 2B1LA 3TDGA 4BVYA 1J9BA 2NPBA 3GYKA 5D9VA 2H8LA 4TXOB 3BJ5A 4EDZA 2KUCA 3ZFLA 3J7Yb 1KBNA 4XRAA 3H93A 4WXTA 2LRCA 4XS4A 4RI6A 1MEKA 2IIYA 3F63A 16GSA 5KOXA 4K7OA 4EF0A 5CRGA 4V2MA 4KX4A 2MMZA 3HKRA 2LV3A 1ILOA 4OCEA 3FZAA 2C3QA 3VLNA 1J08A 2V6KA 4TR1B 1A23A 2H1DA 3F4TA 3LORA 5CRDA 4YAPA 3D4TA 2GZYA 4CHSA 4FH8A 2IL3A 3US3A 1OAZA 3DMLA 2H30A 4MJCA 3CTGA 5IM9A 2L6CA 4PURA 4J2FA 1XWGA 1PX7A 1M0UA 3LSZA 2CT6A 1AUCA 3VWWA 4NWYA 4PQHA 1K0OA 2GQLA 1GLQA 4HU7A 2R0CA 5AGYA 4PX1A 1U3IA 1OC9B 3PGTA 2DJJA 2IJYA 1FVKA 2XC2A 3ZVJD 3KGKA 3R2QA 3QPMA 1F3BA 2R0PA 3HY2A 5KOWA 3SWLA 3LW9A 4IQ1A 4ML1A 4IJ3A 1X0RA 1QMVA 1SKSB 4OD7A 3TKQA 5J5NA 4ZB8A 2H74A 2Z9SA 3WYWA 2H76A 3HHVA 2YWMA 3KIJA 3KMNA 5GAND 5JWQB 4FO5A 3LQ7A 1F9MA 1EWXA 1F2EA 5DALB 2GZZA 5DDLA 2H19A 2C0GA 18GSA 4LL4B 3IA1A 2AYTA 1Z3EA 2BJXA 5ENUA 2GSSA 1K3LA 4ACSA 1F6MC 1GSUA 1ZOFA 3DWVA 4MP4A 2H0GA 4EO3A 2CVBA 5G5FA 4KGIA 4GWRA 2EIQA 2R4VA 3D0ZA 4GLTA 1SYXA 1U88A 3IPZA 3ISOA 3O6TA 1ZL9A 3BBYA 2TIRA 2M46A 1Z6MA 3L9SA 2HSYA 5IIZA 4EVMA 1GTIA 2M80A 2ZNMA 3QOUA 1SKRB 3MDKA 3KCMA 2E2GA 2IMFA 1SD9A 1V2AA 1HD2A 2B7KA 3PR8A 4LLRA 1JLVA 4YQMA 5D96A 2LQOA 3ERFA 4N0VA 3D22A 4RQXA 2ZCTA 3GHAA 2CVDA 1GUMA 1O73A 4E8HA 4HU9A 4EDYA 2YPMA 4YKGA 1M2BA 5D9XA 3DIEA 2OBIA 1ML6A 1MDJA 4N10A 1TDIA 3UOMA 4KDYA 1GNWA 2F8AA 2I9HA 4JU5A 3QMXA 2P5RA 20GSA 3DEXA 2I81A 4ZB6A 4BL7B 1GUHA 4MPGA 3TCOA 3HJMA 3GFKA 3HDCA 1WMJA 5J9BA 3KTBA 3FY7A 1EEMA 3Q18A 1A8LA 2YWNA 2VL2C 2O7KA 1QXHA 4HOJA 3UBKA 1ZMAA 2ON5A 2DMLA 1I5GA 4ZL9A 5D9TA 3QAVA 3TRPA 2OE3A 2TRXA 1DE1A 2FWFA 4HQSA 17GSA 1M7TA 3M9JA 5DJLA 4HI7A 4TVEA 2L4QA 4NV5A 4IHUA 4GSSA 3BCIA 3HYPA 4KCEA 3BCKA 1S3AA 2ON7A 3IK9A 2GQKA 4TW5A 4O92A 5D93A 4L8EA 1R7HA 4O32A 3HJOA 2FCHA 2H1AA 1V40A 3VPQA 2I4AA 5CAXA 3TOUA 2VD1A 1EZKA 2AJQB 3EYTA 2LRTA 4IGJA 3EWLA 4O5RA 3BOAA 1AIUA 3GX0A 3E0UA 1H4OA 2MBSA 3VURA 1A0RP 3PPUA 4NHWA 5AIVA 3IC4A 1AQVA 1OVNA 2KLXA 3C1RA 4KNDA 1Q98A 4I8BA 4OFNA 1TRUA 1PL1A 1T1VA 5DAKA 2BTOT 2JACA 3GA4A 3HD5A 3UJ1A 3D21A 2AHEA 5F05A 1YEXA 4G10A 3U6VA 1VF2A 3NIVA 3ZLPA 4IQAA 4PGTA 3H4KA 3M8NA 3ZL5A 1LBKA 4X1UA 3VI5A 4Q5RA 1Z7RA 1MDIA 1ZYNA 1FO5A 2K8VA 1U3AA 5BMUA 5IMCA 2LQQA 1O85A 1TRSA 2B5YA 2H01A 3ZMLA 3ZITA 2B6MA 4CY8A 3WGDA 2YWIA 2LNTA 4GSTA 1SYRA 2VCVA 5F06A 2VCWA 3WT2A 4QL9A 4WF4A 5G31A 1W89A 3P7XA 1K0NA 1FVJA 5F8BA 3IHQA 1ERTA 5GSSA 3ZREA 3M3MA 3ZIVA 4ULXA 5ABRA 1ZCPA 2GT6A 4AJ7A 2M72A 6GSXA 5CREA 1A8YA 2A2SA 4KCAA 4ML6A 4IP6A 2B3SA 4KE3A 2FNOA 5IMFA 4YQUA 3KH7A 5ECQB 3ZFBA 4MPFA 2MZCA 4IELA 3I43A 6GSTA 1EGOA 1JFUA 2YJHA 1K0CA 2DIZA 2RIIA 4E8EA 3A5IA 5G30A 1SJZA 4F0CA 3CYNA 1TK8B 3UAPA 1GSSA 1G6YA 2WCIA 4J56E 2F9SA 4JEDA 4KSOA 3KXOA 2LJKA 1ACVA 4OWYA 5GSTA 1RW1A 2YP6A 2LKUA 3DYRA 1MD3A 4BA7A 1XW6A 3WGEA 1K0BA 2WFCA 2V41A 2VD0A 3L0HA 4TN8A 1DE2A 2FGXA 3O3TA 1AW9A 2O89A 1QK8A 3LG6A 3TUEA 2GSRA 1JHBA 5J9CA 5AISA 2QGVA 3PH9A 3TKSC 2H1BA 3GKMA 3F6DA 4ID0A 1JZOA 2OKAA 4YAVA 4TR0A 2XBIA 5IMAA 3GKNA 3UVHA 1XOAA 1CQHA 4HQZA 5F0GA 5ECNB 4TXOA 1UN2A 1OKDA 3G7JA 1B4QA 4OMVA 2QA1A 5IOXA 3HCZA 3FEUA 2CZ3A 4F9ZA 5CP1A 3VPTA 3Q19A 4MJBA 3FKFA 4XTSA 2VO4A 1WIKA 3D4MA 5CO3A 1U87A 2YNXA 3GTUB 3HJPA 2QKEA 2X8GA 3E3EA 4TR1A 1O7UA 2DIYA 4MDCA 1FOVA 2IFQA 3KM6A 1PRXA 4GTUA 5H5SA 5A5KA 5IMDA 2EIRA 1YKAA 1AXDA 5JCUA 2FD3A 3CSHA 4ZL7A 1SKWB 2O85A 2V6OA 5CRHA 2FA8A 3VI7A 6GSWA 2B5XA 2HZEB 2WGRA 1PGTA 4TR3A 2CAQA 3DD3A 2JSYA 3FW2A 3N9JA 5GAPD 3QCPA 1FG4A 3APQA 4MJEA 4KSMA 1OC9A 2VCZA 1J0FA 4IBPA 2AB6A 5EL8A 1XZOA 2FWHA 4X4JA 3ZYWA 2VL3A 2R0GA 2LS5A 3VK9A 3FZ9A 5ECHB 4ECIA 3K8NA 1U6TA 3F9UA 3MAKA 4HJMA 3TB2A 4BVYB 4TOPA 2NDOA 4DEJA 2C1YA 2YCDA 1PD21 1FHEA 1YJ6A 5JCGA 1ZYEA 1GSQA 2K6VA 4BWQA 3N5OA 4L0UA 3EC3A 3DKSA 3O76A 1EOGA 5ELAA 4MZBA 1T7PB 3RPPA 2HNLA 5JCWA 2NBSA 3P8WA 2R5GA 1XWBA 2FA4A 1G6WA 4IVFA 4YH2A 4NHZA 1Z9HA 1OKTA 5KN2A 2FUG2 1KNGA 1SJ6A 5H5RA 2EC4A 5J3RA 3FR9A 3P90A 2C80A 1ST9A 2NTOA 3EURA 1AQXA 4KA0A 4OCFA 1R26A 2RM6A 4GXZA 2IN3A 3G7IA 2K18A 1E6BA 2GLRA 3HA9A 4MK3A 2JZSA 5DCHA 4DSSB 4MNNA 3GX8A 4EL1A 5ECSA 3S9FA 3QAGA 2GSTA 1FOHA 2X4AA 3TJKA 4N0ZA 1X9WB 4JBBA 4KF9A 2OJLA 2PBJA 2B7JA 1GL8A 4ILFA 1F37A 3L4NA 2LSTA 3GL5A 3UL3A 1PX6A 4XIHA 4F0BA 3MYDA 1TU7A 3A2WA 3LYPA 2H6ZA 3Q6OA 2HRKA 4N11A 1BAYA 1QGVA 2HFDA 1WOUA 3EPTA 2G0FA 2VCQA 5DCGA 2NVLA 4G0LA 1JZWA 2I3YA 2JZRA 3MWHA 2OACA 5EPFA 2REMA 3FMWA 2VM2A 1Q4JA 3IBHA 3I69A 5DVBA 3RHBA 3LEFA 2DJ0A 4IN0A 4Z2UA 2PVQA 5BRTA 4L0WA 5FHIA 2GQMA 4GCIA 1T3BA 2CAIA 1R5PA 5ECPB 4I97A 3ED3A 4G9HA 1G7EA 4XS6A 5GZZB 1PSQA 2DKIA 3C71A 5L71A 4IJIA 1WRYA 5DQSA 4O7HA 1BJXA 4G0KA 5IO0A 4MF6A 1THXA 3I9V2 1ERUA 4Q5NA 2CQ9A 3F3RA 1BYEA 2E0QA 3KTLA 4OO5A 3V1WA 2B1KA 3DRNA 4I2UA 1PQNA 2X49A 4PXOA 4FIWA 1XCCA 2FY6A 1JLWA 4HEA2 3G7YA 1RQMA 1TTZA 2HT9A 4NMUA 1W4VA 3IAS2 4MF5A 1NM3A 2P5QA 1YF1A 3CSIA 4FYCA 1DSBA 4O5QA 4MZWA 1ZZYA 3F4RA 4G0IA 2H6YA 1X9MB 5IMVA 3GKKA 5IOWA 4XS1A 4V1Ap 4CDOA 2B5EA 2ZUPA 2ES7A 4RI7A 3UARA 2YN1A 1XBSA 5E59A 3LJRA 4ZL8A 1O8WA 1PN0A 5B7CA 5HR2A 4K7IA 19GSA 1NW2A 4EXJA 1EGRA 1K3OA 3M1GA 3QFAC 1WE0A 2X8CA 2IMIA 1TW9A 2I1UA 3F6FA 1EEJA 2R6KA 2O8VB 3LXZA 4YKFA 1B8XA 3IOSA 3KH9A 4HJ2A 4G19A 4V2LA 2CVKA 4DSRA 5FWGA 3IRAA 3KZQA 1SL2B 4DVCA 1ZYQB 2N5AA 3NOFA 4K9ZA 3HXSA 4HZ2A 4EUYA 2QC7A 1OYJA 1SD8A 2LUSA 2WJUA 2RUEA 4CY6A 1TI1A 2KP2A 4K5SA 2GDRA 3ZMKA 5EY6A 7GSSA 2PWJA 5A4UA 3RBTA 1B9XC 1N2AA 4K7NA 3G9BA 2A2PA 4EIQA 13GSA 1SL1B 4WR5A 4F82A 1QUWA 4P3YB 3EU3A 1SL0B 4Z2RA 3IAM2 3TKRA 3GIXA 1Z7PA 2HRAA 3C1SA 4Z7XA 4HDEA 2V2GA 2E2MA 1AQWA 2VL9A 3I6AA 3LYKA 4K8MA 5JWRB 4I6XA 4K6XA 3DGQA 4J57E 3A2XA 3CRUA 2H72A 2WS2A 2C3TA 3IC8A 2GTUA 1R5AA 1PKWA 1G0TA 3GSTA 1GSYA 4X43A 3C73A 5HR3A 1GTBA 3M0FA 3TJGA 3KP9A 5HFIA 2P31A 5DAKB 5A4WA 1VGLA 3H79A 2PERA 2V1MA 1XIYA 2H6XA 1TI3A 2O87A 1SU9A 1OE7A 4PUFC 2RM5A 2C0FA 2GZPA 1M2AA 4PNGA 4OO4A 3GN3A 3P2AA 3FR3A 3W6GA 1XWKA 2QSIA 1T4YA 4Z2TA 2CA8A 2H0IA 1X5CA 4GQFA 1USBA 3CSJA 4GF0A 4NV2A 3TKPA 3MIXA 1TP9A 5D9WA 4POKA 3FHKA 1TRVA 2DC5A 2HRFA 1EP7A 2PGTA 3CTFA 4BPYA 1BG5A 5CRWA 3R3EA 4CW9A 3LXTA 3IHGA 2XPEA 5CYYA 3GUSA 3D5JA 3IK7A 4BVXB 1IYHA 1SENA 3C8EA 3KP8A 4K0GA 2P0GA 3KD0A 3ZRDA 2F3MA 4ICYA 2GT5A 6GSUA 5B8AA 3L78A 3GH9A 4PQ1A 5ECMB 1QQ2A 2AUVA 5LCZA 3GTUA 1FAAA 1GNEA 1Z6NA 1O6JA 5B6NA 3FYGA 1K0MA 1S3CA 1M9AA 1WJKA 3Q74A 4F03A 1TKDB 2WRTA 4LA1A 3QAWA 2H1GA 5KN1A 4ECCA 1PKZA 2YWOA 5G1LA 4ZIJA 4DSQA 3CMIA 1FW1A 1EOHA 5ID2B 1SK0A 1UVZA 5KEJA 1V9WA 4JR6A 2DJKA 1V57A 3TJJA 1NHOA 2HZFA 1PA3A 3UVTA 2HZEA 1GSEA 4ZBBA 3QD9A 4MLYA 5ELGA 1XPVA 2IWTA 4XCSA 1XW9A 2H75A 4XHMA 1B9YC 2JADA 1UC7A 1TRWA 2HSMA 3M9KA 3VFIA 1SK2A 1EP8A 4USSA 5FT3A 2XHFA 1ZGNA 2FWGA 4QL7A 1CQGA 3H1NA 2PN8A 1KTEA 2IPAA 1H75A 3F4SA 4K2XA 3F3QA 4KUNA 1X5DA 2YV9A 2HE3A 2X8HA 1C72A 1WPIA 4IS0A 3FZ5A 1GULA 4F2IA 3LGCA 3ZVJA 1GSDA 5HFGA 4GRFA 4G2EA 4D73B 1YF0A 4O5UA 5ECRB 3MNGA 1GTAA 3ME7A 5LNKe 3VWUA 4V1Ag 2LEGA 3CXGA 4RQRA 4MCUA 2IMDA 3GSSA 2LJRA 2DJ3A 1OE8A 5J41A 5J4UA 1HNBA 4POLA 2IFQB 4TKYA 3F8UA 2DMMA 2GSQA 3RDWA 1TOFA 3DVXA 1BEDA 1NSWA 1WP0A 5IMZA 2VL2A 2C3NA 2CV4A 4L5OA 3HZ8A 2J23A 5DALA 4XS4B 1B4PA 1O81A 2GS3A 3F0IA 5EVOA 3GL3A 2K8SA 1VF1A 4A5PA 3RAZA 4DSSA 2VCTA 5DBQA 3IXRA 2HRNA 4NAXA 3DXBA 1M2DA 1ERVA 3QDNA 4MMMA 4I5QA 1AAZA 1HYUA 3TJFA 2WB9A 4TXVA 1SJIA 1GSFA 3MSZA 1A0FA 1MD4A 4IP1A 3WT1A 4JRRA 4ZBDA 1GUKA 5A4VA 3GNJA 2VLTA 4K0NA 11GSA 1XXUA 1F3AA 5HFKA 1TXXA 1GWCA 2EIOA 4K1FA 4N30A 4TRXA 4IKHA 1LU4A 3ERWA 1E2YA 2H70A 3FRCA 3DVWA 4YQVA 3A2VA 1HNCA 1KEBA 1R4WA 2UZ8A 2DSAA 2DKHA 3CRTA 5ECKB 2CX3A 1OC8A 2CZ2A 4V2NA 2R3XA 3GURA 2VAFA 3VWVA 1XW5A 2BMXA 4WBJA 4JZQA 1VF4A 2E7PA 3ZZXA 5G1KA 4WKWA 3IV4A 4AF2A 1YQ1A 5AN1A 1RK4A 3BD2A 5KN0A 1GP1A 1WWJA 1XVWA 2IMKA 4LMWA 2VCXA 2N5FA 1X5EA 3RHCA 2L5OA 3APSA 1GLPA 3ME8A 2HI7A 3OR5A 5KN3A 1Z5YE 5HQPA 1GTUA 2OE1A 1ERWA 1HQOA 1BX9A 4MABA 2MBTA 2L6DA 2HSHA 2JSZA 2X64A 4BL7A 2DLXA 22GSA 1O8XA 3L9UA 5CNWA 4EC0A 4LL1B 3QR6A 2KP1A 1T00A 2C0DA 1M99A 5ECLB 4PUAA 2MMOA 4WR4A 2J9HA 1M9BA 3W8JA 2DJ1A 6GSSA 1PN9A 1B48A 3FZ4A 4WEYA 5DQYA 4L5LA 3TOTA 5COHA 2JZTA 4JE1A 2VM1A 1DBYA 2YANA 1VF3A 1MDKA 9GSSA 1YEPA 1TK0B 1QFNA 4MJAA 4TR4A 4ZBAA 3JCML 4K2DA 4Q5QA 4OFTA 2DJ2A 1YDKA 14GSA 1VRSD 2RLIA 1THOA 4EKZA 4Q5FA 3GKXA 4ZB9A 1ON4A 1I9DA 2OE0A 6GSYA 1YKCA 4MZCA 2L57A 3EMPA 1FB6A 1K3YA 3FR6A 3EVIA 4I2TA 5G5EA 2ALBA 4KAEA 5IQYA 2VLVA 2YV7A 3GH6A 3TGZA 2CX4A 2K9FA 2MMAA 2HLSA 5ECIB 2FHEA 3IE3A 4POBA 1BQ7A 2PU9C 3TRXA 1JZRA 3H8QA 1XOBA 2F51A 5LD0A 2VLUA 1HNAA 2FLSA 2VUPA 2XBQA 3EINA 4QQ7A 2R2JA 4MF7A 2MYGA 2X99A 2C0EA 3TKSA 4HZ4A 4PNFA 1GRXA 4IW9A 4XRDA 2A2RA 4EE0A 1X9SB 5JWOB 3ZIJA 2GVPA 4HS1A 1YZXA 2YJ7A 2C4JA 2F8FA 3GV1A 3UMAA 1GH2A 3GMFA 5IPGA 5IO2A 2PPTA 1AC1A 3EE2A 1IYIA 4KH7A 3SBCA 3W8SA 1A2LA 4ZXGA 1EV4A 4LMVA 5D8IA 3KMOA 1URMA 3D6IA 2AV4A 5HR0A 6GSVA 2HXKA 2R37A 3HZ4A 5B8BA 3L9VA 2PUKC 1T4ZA 2A4VA 2MMNA 5ECOB 1LJRA 1ZYPA 4WBRD 3TKSE 4MH2A 1K0DA 4PTSA 1MTCA 2KHPA 2LNSA 4NXIA 1K0AA 2AAWA 3NZNA 2L59A 5E4WA 4ECBA 2A4HA 5B6MA 5AIXA 3PINA 2IMEA 3HVXA 3GRXA 2LTKA 1TJDA 2XPDA 4KDUA 3LWAA 4POMA 1A24A 3C7MA 2PMTA 1TK5B 2JL4A 1TU8A 2V32A 3IDVA 3A3TA 2WZ9A 2LRNA 8GSSA 2C8UA 3AY8A 4AJ6A 3WD6A 2VOCA 5F07A 2WDUA 4BWSA 3ZTLA 1G7OA 10GSA 5D73A 2H0HA 4FYBA 4X0XA 5C00A 2H73A 3QFBC 2LJAA 5DJMA 1SK1A 4AGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BVX A;  4WF5 A;  1YY7 A;  3FK8 A;  12GS A;  4WET A;  1ABA A;  2L5L A;  3CBU A;  1XFL A;  2OBK A;  4FYU A;  2WUL A;  5G2Z A;  1A2M A;  3J7Y k;  4MH3 A;  1JZD A;  2D2Z A;  3KEB A;  1OC3 A;  2TRC P;  1PL2 A;  4ISD A;  4AJ8 A;  2VIM A;  2KOK A;  4PQI A;  5H5Q A;  1T8E B;  1Y6E A;  5ID2 A;  3UBL A;  2YOI A;  1DUG A;  3EU4 A;  3APO A;  3RPN A;  3HVV A;  1XWA A;  5C04 A;  2YZU A;  1V58 A;  2L4C A;  3HVS A;  2G2Q A;  1A2J A;  2OAD A;  4ECJ A;  1UA5 A;  1Y25 A;  3WGX A;  4JR4 A;  4KW6 A;  2RUF A;  3IR4 A;  4GQC A;  4KB3 A;  5INY A;  4NPB A;  1S3D A;  1V98 A;  3A5W A;  4HUA A;  3U5R E;  1FB0 A;  1PMT A;  2OA7 A;  2DBC A;  4MA9 A;  3E9J B;  1EV9 A;  1XWC A;  4GSN A;  2H71 A;  3TRQ A;  4KDX A;  4RUV A;  3EMX A;  2PVO C;  3UEM A;  2HYX A;  5IPH A;  3KJY A;  4D73 A;  2YZH A;  2GGT A;  4OFM A;  4H86 A;  2JU5 A;  3TJB A;  3VWX A;  4ZIL A;  1XVQ A;  1N8J A;  2FWE A;  5HR1 A;  2H66 A;  1NHY A;  3ERG A;  3LFL A;  2N5B A;  3UIW A;  2B1L A;  3TDG A;  4BVY A;  1J9B A;  2NPB A;  3GYK A;  5D9V A;  2H8L A;  4TXO B;  3BJ5 A;  4EDZ A;  2KUC A;  3ZFL A;  3J7Y b;  1KBN A;  4XRA A;  3H93 A;  4WXT A;  2LRC A;  4XS4 A;  4RI6 A;  1MEK A;  2IIY A;  3F63 A;  16GS A;  4K7O A;  4EF0 A;  5CRG A;  4V2M A;  4KX4 A;  2MMZ A;  3HKR A;  2LV3 A;  1ILO A;  4OCE A;  3FZA A;  2C3Q A;  3VLN A;  1J08 A;  2V6K A;  4TR1 B;  1A23 A;  2H1D A;  3F4T A;  3LOR A;  5CRD A;  4YAP A;  3D4T A;  2GZY A;  4CHS A;  4FH8 A;  2IL3 A;  3US3 A;  1OAZ A;  3DML A;  2H30 A;  4MJC A;  3CTG A;  5IM9 A;  2L6C A;  4PUR A;  4J2F A;  1XWG A;  1PX7 A;  1M0U A;  3LSZ A;  2CT6 A;  1AUC A;  3VWW A;  4NWY A;  4PQH A;  1K0O A;  2GQL A;  1GLQ A;  4HU7 A;  5AGY A;  4PX1 A;  1U3I A;  1OC9 B;  3PGT A;  2DJJ A;  2IJY A;  1FVK A;  2XC2 A;  3ZVJ D;  3KGK A;  3R2Q A;  3QPM A;  1F3B A;  3HY2 A;  3SWL A;  4IQ1 A;  4ML1 A;  4IJ3 A;  1X0R A;  1QMV A;  1SKS B;  4OD7 A;  3TKQ A;  5J5N A;  4ZB8 A;  2H74 A;  2Z9S A;  3WYW A;  2H76 A;  3HHV A;  2YWM A;  3KIJ A;  3KMN A;  5GAN D;  5JWQ B;  4FO5 A;  3LQ7 A;  1F9M A;  1EWX A;  1F2E A;  5DAL B;  2GZZ A;  5DDL A;  2H19 A;  2C0G A;  18GS A;  4LL4 B;  3IA1 A;  2AYT A;  1Z3E A;  2BJX A;  5ENU A;  2GSS A;  1K3L A;  4ACS A;  1F6M C;  1GSU A;  1ZOF A;  3DWV A;  4MP4 A;  2H0G A;  4EO3 A;  2CVB A;  5G5F A;  4KGI A;  4GWR A;  2EIQ A;  2R4V A;  3D0Z A;  4GLT A;  1SYX A;  1U88 A;  3IPZ A;  3ISO A;  3O6T A;  1ZL9 A;  3BBY A;  2TIR A;  2M46 A;  1Z6M A;  3L9S A;  2HSY A;  5IIZ A;  4EVM A;  1GTI A;  2M80 A;  2ZNM A;  3QOU A;  1SKR B;  3MDK A;  3KCM A;  2E2G A;  2IMF A;  1SD9 A;  1V2A A;  1HD2 A;  2B7K A;  3PR8 A;  4LLR A;  1JLV A;  4YQM A;  5D96 A;  2LQO A;  3ERF A;  4N0V A;  3D22 A;  4RQX A;  2ZCT A;  3GHA A;  2CVD A;  1GUM A;  1O73 A;  4E8H A;  4HU9 A;  4EDY A;  2YPM A;  5D9X A;  1M2B A;  3DIE A;  2OBI A;  1ML6 A;  1MDJ A;  4N10 A;  1TDI A;  3UOM A;  4KDY A;  1GNW A;  2F8A A;  2I9H A;  4JU5 A;  3QMX A;  2P5R A;  20GS A;  3DEX A;  2I81 A;  4ZB6 A;  1GUH A;  4MPG A;  3TCO A;  3HJM A;  3GFK A;  3HDC A;  1WMJ A;  5J9B A;  3KTB A;  3FY7 A;  1EEM A;  3Q18 A;  1A8L A;  2YWN A;  2VL2 C;  2O7K A;  1QXH A;  4HOJ A;  3UBK A;  1ZMA A;  2ON5 A;  2DML A;  1I5G A;  4ZL9 A;  5D9T A;  3QAV A;  3TRP A;  2OE3 A;  2TRX A;  1DE1 A;  2FWF A;  4HQS A;  17GS A;  1M7T A;  3M9J A;  5DJL A;  4HI7 A;  4TVE A;  2L4Q A;  4NV5 A;  4IHU A;  4GSS A;  3BCI A;  3HYP A;  4KCE A;  3BCK A;  1S3A A;  2ON7 A;  3IK9 A;  2GQK A;  4TW5 A;  4O92 A;  5D93 A;  4L8E A;  1R7H A;  4O32 A;  3HJO A;  2FCH A;  2H1A A;  1V40 A;  3VPQ A;  2I4A A;  5CAX A;  3TOU A;  2VD1 A;  1EZK A;  2AJQ B;  3EYT A;  2LRT A;  4IGJ A;  3EWL A;  4O5R A;  3BOA A;  1AIU A;  3GX0 A;  3E0U A;  1H4O A;  2MBS A;  3VUR A;  1A0R P;  4NHW A;  5AIV A;  3IC4 A;  1AQV A;  1OVN A;  2KLX A;  3C1R A;  4KND A;  1Q98 A;  4I8B A;  4OFN A;  1TRU A;  1PL1 A;  1T1V A;  5DAK A;  2BTO T;  2JAC A;  3GA4 A;  3HD5 A;  3UJ1 A;  3D21 A;  2AHE A;  5F05 A;  1YEX A;  4G10 A;  3U6V A;  1VF2 A;  3NIV A;  3ZLP A;  4IQA A;  4PGT A;  3H4K A;  3M8N A;  3ZL5 A;  1LBK A;  4X1U A;  3VI5 A;  4Q5R A;  1Z7R A;  1MDI A;  1FO5 A;  2K8V A;  1U3A A;  5IMC A;  2LQQ A;  1O85 A;  1TRS A;  2B5Y A;  2H01 A;  3ZML A;  3ZIT A;  2B6M A;  3WGD A;  2YWI A;  2LNT A;  4GST A;  1SYR A;  2VCV A;  5F06 A;  2VCW A;  3WT2 A;  4QL9 A;  4WF4 A;  5G31 A;  1W89 A;  3P7X A;  1K0N A;  1FVJ A;  5F8B A;  3IHQ A;  1ERT A;  5GSS A;  3ZRE A;  3M3M A;  3ZIV A;  4ULX A;  5ABR A;  1ZCP A;  2GT6 A;  4AJ7 A;  2M72 A;  6GSX A;  5CRE A;  1A8Y A;  2A2S A;  4KCA A;  4ML6 A;  4IP6 A;  2B3S A;  4KE3 A;  2FNO A;  5IMF A;  4YQU A;  3KH7 A;  5ECQ B;  3ZFB A;  4MPF A;  2MZC A;  4IEL A;  3I43 A;  6GST A;  1EGO A;  1JFU A;  2YJH A;  1K0C A;  2DIZ A;  2RII A;  4E8E A;  5G30 A;  1SJZ A;  4F0C A;  3CYN A;  1TK8 B;  3UAP A;  1GSS A;  1G6Y A;  2WCI A;  4J56 E;  2F9S A;  4JED A;  4KSO A;  3KXO A;  2LJK A;  1ACV A;  4OWY A;  5GST A;  1RW1 A;  2YP6 A;  2LKU A;  3DYR A;  1MD3 A;  4BA7 A;  1XW6 A;  3WGE A;  1K0B A;  2WFC A;  2V41 A;  2VD0 A;  3L0H A;  4TN8 A;  1DE2 A;  2FGX A;  3O3T A;  1AW9 A;  2O89 A;  1QK8 A;  3LG6 A;  3TUE A;  2GSR A;  1JHB A;  5J9C A;  5AIS A;  2QGV A;  3PH9 A;  3TKS C;  2H1B A;  3GKM A;  3F6D A;  4ID0 A;  1JZO A;  2OKA A;  4YAV A;  4TR0 A;  2XBI A;  5IMA A;  3GKN A;  3UVH A;  1XOA A;  1CQH A;  4HQZ A;  5F0G A;  5ECN B;  4TXO A;  1UN2 A;  1OKD A;  3G7J A;  1B4Q A;  4OMV A;  5IOX A;  3HCZ A;  3FEU A;  2CZ3 A;  4F9Z A;  5CP1 A;  3VPT A;  3Q19 A;  4MJB A;  3FKF A;  4XTS A;  2VO4 A;  1WIK A;  3D4M A;  5CO3 A;  1U87 A;  2YNX A;  3GTU B;  3HJP A;  2QKE A;  2X8G A;  3E3E A;  4TR1 A;  1O7U A;  2DIY A;  4MDC A;  1FOV A;  2IFQ A;  3KM6 A;  1PRX A;  4GTU A;  5H5S A;  5A5K A;  5IMD A;  2EIR A;  1YKA A;  1AXD A;  5JCU A;  2FD3 A;  3CSH A;  4ZL7 A;  1SKW B;  2O85 A;  2V6O A;  5CRH A;  2FA8 A;  3VI7 A;  6GSW A;  2B5X A;  2HZE B;  2WGR A;  1PGT A;  4TR3 A;  2CAQ A;  3DD3 A;  2JSY A;  3FW2 A;  3N9J A;  5GAP D;  3QCP A;  1FG4 A;  3APQ A;  4MJE A;  4KSM A;  1OC9 A;  2VCZ A;  1J0F A;  4IBP A;  2AB6 A;  5EL8 A;  1XZO A;  2FWH A;  3ZYW A;  2VL3 A;  2LS5 A;  3VK9 A;  3FZ9 A;  5ECH B;  4ECI A;  3K8N A;  1U6T A;  3F9U A;  3MAK A;  4HJM A;  3TB2 A;  4TOP A;  2NDO A;  4DEJ A;  2C1Y A;  2YCD A;  1PD2 1;  1FHE A;  1YJ6 A;  5JCG A;  1ZYE A;  1GSQ A;  2K6V A;  4BWQ A;  3N5O A;  4L0U A;  3EC3 A;  3DKS A;  3O76 A;  5ELA A;  1EOG A;  4MZB A;  1T7P B;  3RPP A;  2HNL A;  5JCW A;  2NBS A;  3P8W A;  2R5G A;  1XWB A;  2FA4 A;  1G6W A;  4IVF A;  4YH2 A;  4NHZ A;  1Z9H A;  1OKT A;  5KN2 A;  2FUG 2;  1KNG A;  1SJ6 A;  5H5R A;  2EC4 A;  5J3R A;  3FR9 A;  3P90 A;  2C80 A;  1ST9 A;  2NTO A;  3EUR A;  1AQX A;  4KA0 A;  4OCF A;  1R26 A;  2RM6 A;  4GXZ A;  2IN3 A;  3G7I A;  2K18 A;  1E6B A;  2GLR A;  3HA9 A;  4MK3 A;  2JZS A;  5DCH A;  4DSS B;  3GX8 A;  4EL1 A;  5ECS A;  3S9F A;  3QAG A;  2GST A;  3TJK A;  4N0Z A;  1X9W B;  4JBB A;  2OJL A;  2PBJ A;  2B7J A;  1GL8 A;  4ILF A;  1F37 A;  3L4N A;  2LST A;  3GL5 A;  3UL3 A;  1PX6 A;  4XIH A;  4F0B A;  1TU7 A;  3A2W A;  3LYP A;  2H6Z A;  3Q6O A;  4N11 A;  1BAY A;  1QGV A;  2HFD A;  1WOU A;  2G0F A;  2VCQ A;  5DCG A;  2NVL A;  1JZW A;  2I3Y A;  2JZR A;  3MWH A;  2OAC A;  5EPF A;  2REM A;  2VM2 A;  1Q4J A;  3IBH A;  3I69 A;  5DVB A;  3RHB A;  3LEF A;  2DJ0 A;  4IN0 A;  2PVQ A;  4L0W A;  5FHI A;  2GQM A;  4GCI A;  1T3B A;  2CAI A;  1R5P A;  5ECP B;  4I97 A;  3ED3 A;  4G9H A;  1G7E A;  4XS6 A;  5GZZ B;  1PSQ A;  3C71 A;  5L71 A;  4IJI A;  1WRY A;  5DQS A;  4O7H A;  1BJX A;  5IO0 A;  4MF6 A;  1THX A;  3I9V 2;  1ERU A;  4Q5N A;  2CQ9 A;  3F3R A;  1BYE A;  2E0Q A;  3KTL A;  4OO5 A;  3V1W A;  2B1K A;  3DRN A;  4I2U A;  1PQN A;  4PXO A;  4FIW A;  1XCC A;  2FY6 A;  1JLW A;  4HEA 2;  3G7Y A;  1RQM A;  1TTZ A;  2HT9 A;  4NMU A;  1W4V A;  3IAS 2;  4MF5 A;  1NM3 A;  2P5Q A;  1YF1 A;  3CSI A;  4FYC A;  1DSB A;  4MZW A;  1ZZY A;  3F4R A;  2H6Y A;  1X9M B;  5IMV A;  3GKK A;  5IOW A;  4XS1 A;  4V1A p;  4CDO A;  2B5E A;  2ZUP A;  2ES7 A;  4RI7 A;  3UAR A;  2YN1 A;  1XBS A;  5E59 A;  3LJR A;  4ZL8 A;  1O8W A;  5B7C A;  5HR2 A;  4K7I A;  19GS A;  1NW2 A;  4EXJ A;  1EGR A;  1K3O A;  3M1G A;  3QFA C;  1WE0 A;  2X8C A;  2IMI A;  1TW9 A;  2I1U A;  3F6F A;  1EEJ A;  2R6K A;  2O8V B;  3LXZ A;  1B8X A;  3IOS A;  3KH9 A;  4HJ2 A;  4G19 A;  4V2L A;  2CVK A;  4DSR A;  5FWG A;  3IRA A;  3KZQ A;  1SL2 B;  4DVC A;  1ZYQ B;  2N5A A;  3NOF A;  4K9Z A;  3HXS A;  4HZ2 A;  4EUY A;  2QC7 A;  1OYJ A;  1SD8 A;  2LUS A;  2WJU A;  2RUE A;  1TI1 A;  2KP2 A;  2GDR A;  3ZMK A;  5EY6 A;  7GSS A;  2PWJ A;  5A4U A;  3RBT A;  1B9X C;  1N2A A;  4K7N A;  3G9B A;  13GS A;  1SL1 B;  4WR5 A;  4F82 A;  1QUW A;  4P3Y B;  3EU3 A;  1SL0 B;  3IAM 2;  3TKR A;  3GIX A;  1Z7P A;  3C1S A;  4Z7X A;  4HDE A;  2V2G A;  2E2M A;  1AQW A;  2VL9 A;  3I6A A;  3LYK A;  4K8M A;  5JWR B;  4I6X A;  4K6X A;  3DGQ A;  4J57 E;  3A2X A;  3CRU A;  2H72 A;  2WS2 A;  2C3T A;  2GTU A;  1R5A A;  1PKW A;  1G0T A;  3GST A;  1GSY A;  4X43 A;  3C73 A;  5HR3 A;  1GTB A;  3M0F A;  3TJG A;  3KP9 A;  5HFI A;  2P31 A;  5DAK B;  5A4W A;  1VGL A;  3H79 A;  2PER A;  2V1M A;  1XIY A;  2H6X A;  1TI3 A;  2O87 A;  1SU9 A;  1OE7 A;  4PUF C;  2RM5 A;  2C0F A;  2GZP A;  1M2A A;  4PNG A;  4OO4 A;  3GN3 A;  3P2A A;  3FR3 A;  3W6G A;  1XWK A;  2QSI A;  1T4Y A;  2CA8 A;  2H0I A;  1X5C A;  4GQF A;  1USB A;  3CSJ A;  4GF0 A;  4NV2 A;  3TKP A;  1TP9 A;  5D9W A;  4POK A;  3FHK A;  1TRV A;  2DC5 A;  2HRF A;  1EP7 A;  2PGT A;  3CTF A;  4BPY A;  1BG5 A;  5CRW A;  4CW9 A;  3LXT A;  2XPE A;  5CYY A;  3GUS A;  3D5J A;  3IK7 A;  1IYH A;  1SEN A;  3C8E A;  3KP8 A;  4K0G A;  2P0G A;  3KD0 A;  3ZRD A;  2F3M A;  2GT5 A;  6GSU A;  5B8A A;  3L78 A;  3GH9 A;  4PQ1 A;  5ECM B;  1QQ2 A;  2AUV A;  5LCZ A;  3GTU A;  1FAA A;  1GNE A;  1Z6N A;  1O6J A;  5B6N A;  3FYG A;  1K0M A;  1S3C A;  1M9A A;  1WJK A;  3Q74 A;  4F03 A;  1TKD B;  2WRT A;  4LA1 A;  3QAW A;  2H1G A;  5KN1 A;  4ECC A;  1PKZ A;  2YWO A;  5G1L A;  4ZIJ A;  4DSQ A;  3CMI A;  1FW1 A;  1EOH A;  5ID2 B;  1SK0 A;  1UVZ A;  5KEJ A;  1V9W A;  4JR6 A;  2DJK A;  1V57 A;  3TJJ A;  1NHO A;  2HZF A;  1PA3 A;  3UVT A;  2HZE A;  1GSE A;  4ZBB A;  3QD9 A;  4MLY A;  5ELG A;  1XPV A;  2IWT A;  4XCS A;  1XW9 A;  2H75 A;  4XHM A;  1B9Y C;  2JAD A;  1UC7 A;  1TRW A;  3M9K A;  3VFI A;  1SK2 A;  1EP8 A;  5FT3 A;  2XHF A;  1ZGN A;  2FWG A;  4QL7 A;  1CQG A;  3H1N A;  2PN8 A;  1KTE A;  2IPA A;  1H75 A;  3F4S A;  3F3Q A;  4KUN A;  1X5D A;  2YV9 A;  2HE3 A;  2X8H A;  1C72 A;  1WPI A;  4IS0 A;  3FZ5 A;  1GUL A;  4F2I A;  3LGC A;  3ZVJ A;  1GSD A;  5HFG A;  4GRF A;  4G2E A;  4D73 B;  1YF0 A;  5ECR B;  3MNG A;  1GTA A;  3ME7 A;  5LNK e;  3VWU A;  4V1A g;  2LEG A;  3CXG A;  4RQR A;  4MCU A;  2IMD A;  3GSS A;  2LJR A;  2DJ3 A;  1OE8 A;  5J41 A;  5J4U A;  1HNB A;  4POL A;  2IFQ B;  4TKY A;  3F8U A;  2DMM A;  2GSQ A;  3RDW A;  1TOF A;  3DVX A;  1BED A;  1NSW A;  1WP0 A;  5IMZ A;  2VL2 A;  2C3N A;  2CV4 A;  4L5O A;  3HZ8 A;  2J23 A;  5DAL A;  4XS4 B;  1B4P A;  1O81 A;  2GS3 A;  3F0I A;  5EVO A;  3GL3 A;  2K8S A;  1VF1 A;  3RAZ A;  4DSS A;  2VCT A;  5DBQ A;  3IXR A;  2HRN A;  4NAX A;  3DXB A;  1M2D A;  1ERV A;  3QDN A;  4MMM A;  4I5Q A;  1AAZ A;  1HYU A;  3TJF A;  2WB9 A;  4TXV A;  1SJI A;  1GSF A;  3MSZ A;  1A0F A;  1MD4 A;  4IP1 A;  3WT1 A;  4JRR A;  4ZBD A;  1GUK A;  5A4V A;  3GNJ A;  2VLT A;  4K0N A;  11GS A;  1XXU A;  1F3A A;  5HFK A;  1TXX A;  1GWC A;  2EIO A;  4K1F A;  4N30 A;  4TRX A;  4IKH A;  1LU4 A;  3ERW A;  1E2Y A;  2H70 A;  3FRC A;  3DVW A;  4YQV A;  3A2V A;  1HNC A;  1KEB A;  1R4W A;  2DSA A;  3CRT A;  5ECK B;  2CX3 A;  1OC8 A;  2CZ2 A;  4V2N A;  2R3X A;  3GUR A;  2VAF A;  3VWV A;  1XW5 A;  2BMX A;  4WBJ A;  4JZQ A;  1VF4 A;  2E7P A;  3ZZX A;  5G1K A;  4WKW A;  3IV4 A;  4AF2 A;  1YQ1 A;  5AN1 A;  1RK4 A;  3BD2 A;  5KN0 A;  1GP1 A;  1WWJ A;  1XVW A;  2IMK A;  4LMW A;  2VCX A;  2N5F A;  1X5E A;  3RHC A;  2L5O A;  3APS A;  1GLP A;  3ME8 A;  2HI7 A;  3OR5 A;  5KN3 A;  1Z5Y E;  5HQP A;  1GTU A;  2OE1 A;  1ERW A;  1HQO A;  1BX9 A;  4MAB A;  2MBT A;  2L6D A;  2HSH A;  2JSZ A;  2X64 A;  4BL7 A;  2DLX A;  22GS A;  1O8X A;  3L9U A;  5CNW A;  4EC0 A;  4LL1 B;  3QR6 A;  2KP1 A;  1T00 A;  2C0D A;  1M99 A;  5ECL B;  4PUA A;  2MMO A;  4WR4 A;  2J9H A;  1M9B A;  3W8J A;  2DJ1 A;  6GSS A;  1PN9 A;  1B48 A;  3FZ4 A;  4WEY A;  5DQY A;  4L5L A;  3TOT A;  5COH A;  2JZT A;  4JE1 A;  2VM1 A;  1DBY A;  2YAN A;  1VF3 A;  1MDK A;  9GSS A;  1YEP A;  1TK0 B;  1QFN A;  4MJA A;  4TR4 A;  4ZBA A;  3JCM L;  4K2D A;  4Q5Q A;  4OFT A;  2DJ2 A;  1YDK A;  14GS A;  1VRS D;  2RLI A;  1THO A;  4EKZ A;  4Q5F A;  3GKX A;  4ZB9 A;  1ON4 A;  1I9D A;  2OE0 A;  6GSY A;  1YKC A;  4MZC A;  2L57 A;  3EMP A;  1FB6 A;  1K3Y A;  3FR6 A;  3EVI A;  4I2T A;  5G5E A;  2ALB A;  4KAE A;  5IQY A;  2VLV A;  2YV7 A;  3GH6 A;  3TGZ A;  2CX4 A;  2K9F A;  2MMA A;  2HLS A;  5ECI B;  2FHE A;  3IE3 A;  4POB A;  1BQ7 A;  2PU9 C;  3TRX A;  1JZR A;  3H8Q A;  1XOB A;  2F51 A;  5LD0 A;  2VLU A;  1HNA A;  2FLS A;  2VUP A;  2XBQ A;  3EIN A;  4QQ7 A;  2R2J A;  4MF7 A;  2MYG A;  2X99 A;  2C0E A;  3TKS A;  4HZ4 A;  4PNF A;  1GRX A;  4IW9 A;  4XRD A;  2A2R A;  4EE0 A;  1X9S B;  5JWO B;  3ZIJ A;  2GVP A;  4HS1 A;  1YZX A;  2YJ7 A;  2C4J A;  2F8F A;  3GV1 A;  3UMA A;  1GH2 A;  3GMF A;  5IPG A;  5IO2 A;  2PPT A;  1AC1 A;  3EE2 A;  1IYI A;  4KH7 A;  3SBC A;  3W8S A;  1A2L A;  4ZXG A;  5D8I A;  1EV4 A;  4LMV A;  3KMO A;  1URM A;  3D6I A;  2AV4 A;  5HR0 A;  6GSV A;  2HXK A;  2R37 A;  3HZ4 A;  5B8B A;  3L9V A;  2PUK C;  1T4Z A;  2A4V A;  2MMN A;  5ECO B;  1LJR A;  4WBR D;  3TKS E;  4MH2 A;  1K0D A;  1MTC A;  2KHP A;  2LNS A;  4NXI A;  1K0A A;  2AAW A;  3NZN A;  2L59 A;  5E4W A;  4ECB A;  5B6M A;  5AIX A;  3PIN A;  2IME A;  3HVX A;  3GRX A;  2LTK A;  1TJD A;  2XPD A;  4KDU A;  3LWA A;  4POM A;  1A24 A;  3C7M A;  2PMT A;  1TK5 B;  2JL4 A;  1TU8 A;  2V32 A;  3IDV A;  3A3T A;  2WZ9 A;  2LRN A;  8GSS A;  2C8U A;  3AY8 A;  4AJ6 A;  3WD6 A;  2VOC A;  5F07 A;  2WDU A;  4BWS A;  3ZTL A;  1G7O A;  10GS A;  5D73 A;  2H0H A;  4FYB A;  4X0X A;  5C00 A;  2H73 A;  3QFB C;  2LJA A;  5DJM A;  1SK1 A;  4AGS A; 
#chains in the Genus database with same CATH topology
 4BVX A;  4FQU A;  4WF5 A;  1YY7 A;  3FK8 A;  12GS A;  4WET A;  1ABA A;  2L5L A;  3CBU A;  1XFL A;  2OBK A;  4FYU A;  2WUL A;  5G2Z A;  1A2M A;  3J7Y k;  4EIP A;  4MH3 A;  1JZD A;  2D2Z A;  3KEB A;  1OC3 A;  2TRC P;  1PL2 A;  4ISD A;  4AJ8 A;  2VIM A;  2KOK A;  4PQI A;  5H5Q A;  1T8E B;  1Y6E A;  5ID2 A;  3UBL A;  2YOI A;  1DUG A;  3EU4 A;  3APO A;  3RPN A;  3HVV A;  1XWA A;  5C04 A;  2YZU A;  1V58 A;  2L4C A;  3HVS A;  2G2Q A;  1A2J A;  4K5R A;  2OAD A;  4ECJ A;  1UA5 A;  1Y25 A;  3WGX A;  4JR4 A;  4KW6 A;  2RUF A;  3IR4 A;  4GQC A;  4KB3 A;  5INY A;  4NPB A;  1S3D A;  1V98 A;  3A5W A;  4HUA A;  3U5R E;  1FB0 A;  1PMT A;  2OA7 A;  2DBC A;  4MA9 A;  3E9J B;  1EV9 A;  1XWC A;  4GSN A;  2H71 A;  3TRQ A;  4KDX A;  4RUV A;  3EMX A;  2PVO C;  3UEM A;  2HYX A;  5IPH A;  3KJY A;  4D73 A;  2YZH A;  2GGT A;  4OFM A;  4H86 A;  2QA2 A;  3CQF A;  2JU5 A;  3TJB A;  3VWX A;  1M3J A;  4ZIL A;  1XVQ A;  1N8J A;  2FWE A;  5HR1 A;  2H66 A;  1NHY A;  3ERG A;  3LFL A;  2N5B A;  3UIW A;  2B1L A;  3TDG A;  4BVY A;  1J9B A;  2NPB A;  3GYK A;  5D9V A;  2H8L A;  4TXO B;  3BJ5 A;  4EDZ A;  2KUC A;  3ZFL A;  3J7Y b;  1KBN A;  4XRA A;  3H93 A;  4WXT A;  2LRC A;  4XS4 A;  4RI6 A;  1MEK A;  2IIY A;  3F63 A;  16GS A;  5KOX A;  4K7O A;  4EF0 A;  5CRG A;  4V2M A;  4KX4 A;  2MMZ A;  3HKR A;  2LV3 A;  1ILO A;  4OCE A;  3FZA A;  2C3Q A;  3VLN A;  1J08 A;  2V6K A;  4TR1 B;  1A23 A;  2H1D A;  3F4T A;  3LOR A;  5CRD A;  4YAP A;  3D4T A;  2GZY A;  4CHS A;  4FH8 A;  2IL3 A;  3US3 A;  1OAZ A;  3DML A;  2H30 A;  4MJC A;  3CTG A;  5IM9 A;  2L6C A;  4PUR A;  4J2F A;  1XWG A;  1PX7 A;  1M0U A;  3LSZ A;  2CT6 A;  1AUC A;  3VWW A;  4NWY A;  4PQH A;  1K0O A;  2GQL A;  1GLQ A;  4HU7 A;  2R0C A;  5AGY A;  4PX1 A;  1U3I A;  1OC9 B;  3PGT A;  2DJJ A;  2IJY A;  1FVK A;  2XC2 A;  3ZVJ D;  3KGK A;  3R2Q A;  3QPM A;  1F3B A;  2R0P A;  3HY2 A;  5KOW A;  3SWL A;  3LW9 A;  4IQ1 A;  4ML1 A;  4IJ3 A;  1X0R A;  1QMV A;  1SKS B;  4OD7 A;  3TKQ A;  5J5N A;  4ZB8 A;  2H74 A;  2Z9S A;  3WYW A;  2H76 A;  3HHV A;  2YWM A;  3KIJ A;  3KMN A;  5GAN D;  5JWQ B;  4FO5 A;  3LQ7 A;  1F9M A;  1EWX A;  1F2E A;  5DAL B;  2GZZ A;  5DDL A;  2H19 A;  2C0G A;  18GS A;  4LL4 B;  3IA1 A;  2AYT A;  3HVN A;  1Z3E A;  2BJX A;  5ENU A;  2GSS A;  1K3L A;  4ACS A;  1F6M C;  1GSU A;  1ZOF A;  3DWV A;  4MP4 A;  2H0G A;  4EO3 A;  2CVB A;  5G5F A;  4KGI A;  4GWR A;  2EIQ A;  2R4V A;  3D0Z A;  4GLT A;  1SYX A;  1U88 A;  3IPZ A;  3ISO A;  3O6T A;  1ZL9 A;  3BBY A;  2TIR A;  2M46 A;  1Z6M A;  3L9S A;  2HSY A;  5IIZ A;  4EVM A;  1GTI A;  2M80 A;  2ZNM A;  3QOU A;  1SKR B;  3MDK A;  3KCM A;  2E2G A;  2IMF A;  1SD9 A;  1V2A A;  1HD2 A;  2B7K A;  3PR8 A;  4LLR A;  1JLV A;  4YQM A;  5D96 A;  2LQO A;  3ERF A;  4N0V A;  3D22 A;  4RQX A;  2ZCT A;  3GHA A;  2CVD A;  1GUM A;  1O73 A;  4E8H A;  4HU9 A;  4EDY A;  2YPM A;  4YKG A;  1M2B A;  5D9X A;  3DIE A;  2OBI A;  1ML6 A;  1MDJ A;  4N10 A;  1TDI A;  3UOM A;  4KDY A;  1GNW A;  2F8A A;  2I9H A;  4JU5 A;  3QMX A;  2P5R A;  20GS A;  3DEX A;  2I81 A;  4ZB6 A;  4BL7 B;  1GUH A;  4MPG A;  3TCO A;  3HJM A;  3GFK A;  3HDC A;  1WMJ A;  5J9B A;  3KTB A;  3FY7 A;  1EEM A;  3Q18 A;  1A8L A;  2YWN A;  2VL2 C;  2O7K A;  1QXH A;  4HOJ A;  3UBK A;  1ZMA A;  2ON5 A;  2DML A;  1I5G A;  4ZL9 A;  5D9T A;  3QAV A;  3TRP A;  2OE3 A;  2TRX A;  1DE1 A;  2FWF A;  4HQS A;  17GS A;  1M7T A;  3M9J A;  5DJL A;  4HI7 A;  4TVE A;  2L4Q A;  4NV5 A;  4IHU A;  4GSS A;  3BCI A;  3HYP A;  4KCE A;  3BCK A;  4HSC X;  1S3A A;  2ON7 A;  3IK9 A;  2GQK A;  4TW5 A;  4O92 A;  5D93 A;  4L8E A;  1R7H A;  4O32 A;  3HJO A;  2FCH A;  2H1A A;  1V40 A;  3VPQ A;  2I4A A;  5CAX A;  3TOU A;  2VD1 A;  1EZK A;  2AJQ B;  3EYT A;  2LRT A;  4IGJ A;  3EWL A;  4O5R A;  3BOA A;  1AIU A;  3GX0 A;  3E0U A;  1H4O A;  2MBS A;  3VUR A;  1A0R P;  3PPU A;  4NHW A;  5AIV A;  3IC4 A;  1AQV A;  1OVN A;  2KLX A;  3C1R A;  4KND A;  1Q98 A;  4I8B A;  4OFN A;  1TRU A;  1PL1 A;  1T1V A;  5DAK A;  2BTO T;  2JAC A;  3GA4 A;  3HD5 A;  3UJ1 A;  3D21 A;  2AHE A;  5F05 A;  1YEX A;  4G10 A;  3U6V A;  1VF2 A;  3NIV A;  3ZLP A;  4IQA A;  4PGT A;  3H4K A;  3M8N A;  3ZL5 A;  1LBK A;  4X1U A;  3VI5 A;  4Q5R A;  1Z7R A;  1MDI A;  1ZYN A;  1FO5 A;  2K8V A;  1U3A A;  5BMU A;  5IMC A;  2LQQ A;  1O85 A;  1TRS A;  2B5Y A;  2H01 A;  3ZML A;  3ZIT A;  2B6M A;  4CY8 A;  3WGD A;  2YWI A;  2LNT A;  4GST A;  1SYR A;  2VCV A;  5F06 A;  2VCW A;  3WT2 A;  4QL9 A;  4WF4 A;  5G31 A;  1W89 A;  3P7X A;  1K0N A;  1FVJ A;  5F8B A;  3IHQ A;  1ERT A;  5GSS A;  3ZRE A;  3M3M A;  3ZIV A;  4ULX A;  5ABR A;  1ZCP A;  2GT6 A;  4AJ7 A;  2M72 A;  6GSX A;  5CRE A;  1A8Y A;  2A2S A;  4KCA A;  4ML6 A;  4IP6 A;  2B3S A;  4KE3 A;  2FNO A;  5IMF A;  4YQU A;  3KH7 A;  5ECQ B;  3ZFB A;  4MPF A;  2MZC A;  4IEL A;  3I43 A;  6GST A;  1EGO A;  1JFU A;  2YJH A;  1K0C A;  2DIZ A;  2RII A;  4E8E A;  3A5I A;  5G30 A;  1SJZ A;  4F0C A;  3CYN A;  1TK8 B;  3UAP A;  1GSS A;  1G6Y A;  2WCI A;  4J56 E;  2F9S A;  4JED A;  4KSO A;  3KXO A;  2LJK A;  1ACV A;  4OWY A;  5GST A;  1RW1 A;  2YP6 A;  2LKU A;  3DYR A;  1MD3 A;  4BA7 A;  1XW6 A;  3WGE A;  1K0B A;  2WFC A;  2V41 A;  2VD0 A;  3L0H A;  4TN8 A;  1DE2 A;  2FGX A;  3O3T A;  1AW9 A;  2O89 A;  1QK8 A;  3LG6 A;  3TUE A;  2GSR A;  1JHB A;  5J9C A;  5AIS A;  2QGV A;  3PH9 A;  3TKS C;  2H1B A;  3GKM A;  3F6D A;  4ID0 A;  1JZO A;  2OKA A;  4YAV A;  4TR0 A;  2XBI A;  5IMA A;  3GKN A;  3UVH A;  1XOA A;  1CQH A;  4HQZ A;  5F0G A;  5ECN B;  4TXO A;  1UN2 A;  1OKD A;  3G7J A;  1B4Q A;  4OMV A;  2QA1 A;  5IOX A;  3HCZ A;  3FEU A;  2CZ3 A;  4F9Z A;  5CP1 A;  3VPT A;  3Q19 A;  4MJB A;  3FKF A;  4XTS A;  2VO4 A;  1WIK A;  3D4M A;  5CO3 A;  1U87 A;  2YNX A;  3GTU B;  3HJP A;  2QKE A;  2X8G A;  3E3E A;  4TR1 A;  1O7U A;  2DIY A;  4MDC A;  1FOV A;  2IFQ A;  3KM6 A;  1PRX A;  4GTU A;  5H5S A;  5A5K A;  5IMD A;  2EIR A;  1YKA A;  1AXD A;  5JCU A;  2FD3 A;  3CSH A;  4ZL7 A;  1SKW B;  2O85 A;  2V6O A;  5CRH A;  2FA8 A;  3VI7 A;  6GSW A;  2B5X A;  2HZE B;  2WGR A;  1PGT A;  4TR3 A;  2CAQ A;  3DD3 A;  2JSY A;  3FW2 A;  3N9J A;  5GAP D;  3QCP A;  1FG4 A;  3APQ A;  4MJE A;  4KSM A;  1OC9 A;  2VCZ A;  1J0F A;  4IBP A;  2AB6 A;  5EL8 A;  1XZO A;  2FWH A;  4X4J A;  3ZYW A;  2VL3 A;  2R0G A;  2LS5 A;  3VK9 A;  3FZ9 A;  5ECH B;  4ECI A;  3K8N A;  1U6T A;  3F9U A;  3MAK A;  4HJM A;  3TB2 A;  4BVY B;  4TOP A;  2NDO A;  4DEJ A;  2C1Y A;  2YCD A;  1PD2 1;  1FHE A;  1YJ6 A;  5JCG A;  1ZYE A;  1GSQ A;  2K6V A;  4BWQ A;  3N5O A;  4L0U A;  3EC3 A;  3DKS A;  3O76 A;  1EOG A;  5ELA A;  4MZB A;  1T7P B;  3RPP A;  2HNL A;  5JCW A;  2NBS A;  3P8W A;  2R5G A;  1XWB A;  2FA4 A;  1G6W A;  4IVF A;  1M3I A;  4YH2 A;  4NHZ A;  1Z9H A;  1OKT A;  5KN2 A;  2FUG 2;  1KNG A;  1SJ6 A;  5H5R A;  2EC4 A;  5J3R A;  3FR9 A;  3P90 A;  2C80 A;  1ST9 A;  2NTO A;  3EUR A;  1AQX A;  4KA0 A;  4OCF A;  1R26 A;  2RM6 A;  4GXZ A;  2IN3 A;  3G7I A;  2K18 A;  1E6B A;  2GLR A;  3HA9 A;  4MK3 A;  2JZS A;  5DCH A;  4DSS B;  4MNN A;  3GX8 A;  4EL1 A;  5ECS A;  3S9F A;  3QAG A;  2GST A;  1FOH A;  2X4A A;  3TJK A;  4N0Z A;  1X9W B;  4JBB A;  4KF9 A;  2OJL A;  2PBJ A;  2B7J A;  1GL8 A;  4ILF A;  1F37 A;  3L4N A;  2LST A;  3GL5 A;  3UL3 A;  1PX6 A;  4XIH A;  4F0B A;  3MYD A;  1TU7 A;  3A2W A;  3LYP A;  2H6Z A;  3Q6O A;  2HRK A;  4N11 A;  1BAY A;  1QGV A;  2HFD A;  1WOU A;  3EPT A;  2G0F A;  2VCQ A;  5DCG A;  2NVL A;  4G0L A;  1JZW A;  2I3Y A;  2JZR A;  3MWH A;  2OAC A;  5EPF A;  2REM A;  3FMW A;  2VM2 A;  1Q4J A;  3IBH A;  3I69 A;  5DVB A;  3RHB A;  3LEF A;  2DJ0 A;  4IN0 A;  4Z2U A;  2PVQ A;  5BRT A;  4L0W A;  5FHI A;  2GQM A;  4GCI A;  1T3B A;  2CAI A;  1R5P A;  5ECP B;  4I97 A;  3ED3 A;  4G9H A;  1G7E A;  4XS6 A;  5GZZ B;  1PSQ A;  2DKI A;  3C71 A;  5L71 A;  4IJI A;  1WRY A;  5DQS A;  4O7H A;  1BJX A;  4G0K A;  5IO0 A;  4MF6 A;  1THX A;  3I9V 2;  1ERU A;  4Q5N A;  2CQ9 A;  3F3R A;  1BYE A;  2E0Q A;  3KTL A;  4OO5 A;  3V1W A;  2B1K A;  3DRN A;  4I2U A;  1PQN A;  2X49 A;  4PXO A;  4FIW A;  1XCC A;  2FY6 A;  1JLW A;  4HEA 2;  3G7Y A;  1RQM A;  1TTZ A;  2HT9 A;  4NMU A;  1W4V A;  3IAS 2;  4MF5 A;  1NM3 A;  2P5Q A;  1YF1 A;  3CSI A;  4FYC A;  1DSB A;  4O5Q A;  4MZW A;  1ZZY A;  3F4R A;  4G0I A;  2H6Y A;  1X9M B;  5IMV A;  3GKK A;  5IOW A;  4XS1 A;  4V1A p;  4CDO A;  2B5E A;  2ZUP A;  2ES7 A;  4RI7 A;  3UAR A;  2YN1 A;  1XBS A;  5E59 A;  3LJR A;  4ZL8 A;  1O8W A;  1PN0 A;  5B7C A;  5HR2 A;  4K7I A;  19GS A;  1NW2 A;  4EXJ A;  1EGR A;  1K3O A;  3M1G A;  3QFA C;  1WE0 A;  2X8C A;  2IMI A;  1TW9 A;  2I1U A;  3F6F A;  1EEJ A;  2R6K A;  2O8V B;  3LXZ A;  4YKF A;  1B8X A;  3IOS A;  3KH9 A;  4HJ2 A;  4G19 A;  4V2L A;  2CVK A;  4DSR A;  5FWG A;  3IRA A;  3KZQ A;  1SL2 B;  4DVC A;  1ZYQ B;  2N5A A;  3NOF A;  4K9Z A;  3HXS A;  4HZ2 A;  4EUY A;  2QC7 A;  1OYJ A;  1SD8 A;  2LUS A;  2WJU A;  2RUE A;  4CY6 A;  1TI1 A;  2KP2 A;  4K5S A;  2GDR A;  3ZMK A;  5EY6 A;  7GSS A;  2PWJ A;  5A4U A;  3RBT A;  1B9X C;  1N2A A;  4K7N A;  3G9B A;  2A2P A;  4EIQ A;  13GS A;  1SL1 B;  4WR5 A;  4F82 A;  1QUW A;  4P3Y B;  3EU3 A;  1SL0 B;  4Z2R A;  3IAM 2;  3TKR A;  3GIX A;  1Z7P A;  2HRA A;  3C1S A;  4Z7X A;  4HDE A;  2V2G A;  2E2M A;  1AQW A;  2VL9 A;  3I6A A;  3LYK A;  4K8M A;  5JWR B;  4I6X A;  4K6X A;  3DGQ A;  4J57 E;  3A2X A;  3CRU A;  2H72 A;  2WS2 A;  2C3T A;  3IC8 A;  2GTU A;  1R5A A;  1PKW A;  1G0T A;  3GST A;  1GSY A;  4X43 A;  3C73 A;  5HR3 A;  1GTB A;  3M0F A;  3TJG A;  3KP9 A;  5HFI A;  2P31 A;  5DAK B;  5A4W A;  1VGL A;  3H79 A;  2PER A;  2V1M A;  1XIY A;  2H6X A;  1TI3 A;  2O87 A;  1SU9 A;  1OE7 A;  4PUF C;  2RM5 A;  2C0F A;  2GZP A;  1M2A A;  4PNG A;  4OO4 A;  3GN3 A;  3P2A A;  3FR3 A;  3W6G A;  1XWK A;  2QSI A;  1T4Y A;  4Z2T A;  2CA8 A;  2H0I A;  1X5C A;  4GQF A;  1USB A;  3CSJ A;  4GF0 A;  4NV2 A;  3TKP A;  3MIX A;  1TP9 A;  5D9W A;  4POK A;  3FHK A;  1TRV A;  2DC5 A;  2HRF A;  1EP7 A;  2PGT A;  3CTF A;  4BPY A;  1BG5 A;  5CRW A;  3R3E A;  4CW9 A;  3LXT A;  3IHG A;  2XPE A;  5CYY A;  3GUS A;  3D5J A;  3IK7 A;  4BVX B;  1IYH A;  1SEN A;  3C8E A;  3KP8 A;  4K0G A;  1S3R A;  2P0G A;  3KD0 A;  3ZRD A;  2F3M A;  4ICY A;  2GT5 A;  6GSU A;  5B8A A;  3L78 A;  3GH9 A;  4PQ1 A;  5ECM B;  1QQ2 A;  2AUV A;  5LCZ A;  3GTU A;  1FAA A;  1GNE A;  1Z6N A;  1O6J A;  5B6N A;  3FYG A;  1K0M A;  1S3C A;  1M9A A;  1WJK A;  3Q74 A;  4F03 A;  1TKD B;  2WRT A;  4LA1 A;  3QAW A;  2H1G A;  5KN1 A;  4ECC A;  1PKZ A;  2YWO A;  5G1L A;  4ZIJ A;  4DSQ A;  3CMI A;  1FW1 A;  1EOH A;  5ID2 B;  1SK0 A;  1UVZ A;  5KEJ A;  1V9W A;  4JR6 A;  2DJK A;  1V57 A;  3TJJ A;  1NHO A;  2HZF A;  1PA3 A;  3UVT A;  2HZE A;  1GSE A;  4ZBB A;  3QD9 A;  4MLY A;  5ELG A;  1XPV A;  2IWT A;  4XCS A;  1XW9 A;  2H75 A;  4XHM A;  1B9Y C;  2JAD A;  1UC7 A;  1TRW A;  2HSM A;  3M9K A;  3VFI A;  1SK2 A;  1EP8 A;  4USS A;  5FT3 A;  2XHF A;  1ZGN A;  2FWG A;  4QL7 A;  1CQG A;  3H1N A;  2PN8 A;  1KTE A;  2IPA A;  1H75 A;  3F4S A;  4K2X A;  3F3Q A;  4KUN A;  1X5D A;  2YV9 A;  2HE3 A;  2X8H A;  1C72 A;  1WPI A;  4IS0 A;  3FZ5 A;  1GUL A;  4F2I A;  3LGC A;  3ZVJ A;  1GSD A;  5HFG A;  4GRF A;  4G2E A;  4D73 B;  1YF0 A;  4O5U A;  5ECR B;  3MNG A;  1GTA A;  3ME7 A;  5LNK e;  3VWU A;  4V1A g;  2LEG A;  3CXG A;  4RQR A;  4MCU A;  2IMD A;  3GSS A;  2LJR A;  2DJ3 A;  1OE8 A;  5J41 A;  5J4U A;  1HNB A;  4POL A;  2IFQ B;  4TKY A;  3F8U A;  2DMM A;  2GSQ A;  3RDW A;  1TOF A;  3DVX A;  1BED A;  1NSW A;  1WP0 A;  5IMZ A;  2VL2 A;  2C3N A;  2CV4 A;  4L5O A;  3HZ8 A;  2J23 A;  5DAL A;  4XS4 B;  1B4P A;  1O81 A;  2GS3 A;  3F0I A;  5EVO A;  3GL3 A;  2K8S A;  1VF1 A;  4A5P A;  3RAZ A;  4DSS A;  2VCT A;  5DBQ A;  3IXR A;  2HRN A;  4NAX A;  3DXB A;  1M2D A;  1ERV A;  3QDN A;  4MMM A;  4I5Q A;  1AAZ A;  1HYU A;  3TJF A;  2WB9 A;  4TXV A;  1SJI A;  1GSF A;  3MSZ A;  1A0F A;  1MD4 A;  4IP1 A;  3WT1 A;  4JRR A;  4ZBD A;  1GUK A;  5A4V A;  3GNJ A;  2VLT A;  4K0N A;  11GS A;  1XXU A;  1F3A A;  5HFK A;  1TXX A;  1GWC A;  2EIO A;  4K1F A;  4N30 A;  4TRX A;  4IKH A;  1LU4 A;  3ERW A;  1E2Y A;  2H70 A;  3FRC A;  3DVW A;  4YQV A;  3A2V A;  1HNC A;  1KEB A;  1R4W A;  2UZ8 A;  2DSA A;  2DKH A;  3CRT A;  5ECK B;  2CX3 A;  1OC8 A;  2CZ2 A;  4V2N A;  2R3X A;  3GUR A;  4BIK A;  2VAF A;  3VWV A;  1XW5 A;  2BMX A;  4WBJ A;  4JZQ A;  1VF4 A;  2E7P A;  3ZZX A;  5G1K A;  4WKW A;  3IV4 A;  4AF2 A;  1YQ1 A;  5AN1 A;  1RK4 A;  3BD2 A;  5KN0 A;  1GP1 A;  1WWJ A;  1XVW A;  2IMK A;  4LMW A;  2VCX A;  2N5F A;  1X5E A;  3RHC A;  2L5O A;  3APS A;  1GLP A;  3ME8 A;  2HI7 A;  3OR5 A;  5KN3 A;  1Z5Y E;  5HQP A;  1GTU A;  2OE1 A;  1ERW A;  1HQO A;  1BX9 A;  4MAB A;  2MBT A;  2L6D A;  2HSH A;  2JSZ A;  2X64 A;  4BL7 A;  2DLX A;  22GS A;  1O8X A;  3L9U A;  5CNW A;  4EC0 A;  4LL1 B;  3QR6 A;  2KP1 A;  1T00 A;  2C0D A;  1M99 A;  5ECL B;  4PUA A;  2MMO A;  4WR4 A;  2J9H A;  1M9B A;  3W8J A;  2DJ1 A;  6GSS A;  1XG8 A;  1PN9 A;  1B48 A;  3FZ4 A;  4WEY A;  5DQY A;  4L5L A;  3TOT A;  1PFO A;  5COH A;  2JZT A;  4JE1 A;  2VM1 A;  1DBY A;  2YAN A;  1VF3 A;  1MDK A;  9GSS A;  1YEP A;  1TK0 B;  1QFN A;  4MJA A;  4TR4 A;  4ZBA A;  3JCM L;  4K2D A;  4Q5Q A;  4OFT A;  2DJ2 A;  1YDK A;  14GS A;  1VRS D;  2RLI A;  1THO A;  4EKZ A;  4Q5F A;  3GKX A;  4ZB9 A;  1ON4 A;  1I9D A;  2OE0 A;  6GSY A;  1YKC A;  4MZC A;  2L57 A;  3EMP A;  1FB6 A;  1K3Y A;  3FR6 A;  3EVI A;  4I2T A;  5G5E A;  2ALB A;  4KAE A;  5IQY A;  2VLV A;  2YV7 A;  3GH6 A;  3TGZ A;  2CX4 A;  2K9F A;  2MMA A;  2HLS A;  5ECI B;  2FHE A;  3IE3 A;  4POB A;  1BQ7 A;  2PU9 C;  3TRX A;  1JZR A;  3H8Q A;  1XOB A;  2F51 A;  5LD0 A;  2VLU A;  1HNA A;  2FLS A;  2VUP A;  2XBQ A;  3EIN A;  4QQ7 A;  2R2J A;  4MF7 A;  2MYG A;  2X99 A;  2C0E A;  3TKS A;  4HZ4 A;  4PNF A;  1GRX A;  4IW9 A;  4XRD A;  2A2R A;  4EE0 A;  1X9S B;  5JWO B;  3ZIJ A;  2GVP A;  4HS1 A;  1YZX A;  2YJ7 A;  2C4J A;  2F8F A;  3GV1 A;  3UMA A;  1GH2 A;  3GMF A;  5IPG A;  5IO2 A;  2PPT A;  1AC1 A;  3EE2 A;  1IYI A;  4KH7 A;  3SBC A;  3W8S A;  1A2L A;  4ZXG A;  1EV4 A;  4LMV A;  5D8I A;  3KMO A;  1URM A;  3D6I A;  2AV4 A;  5HR0 A;  6GSV A;  2HXK A;  2R37 A;  3HZ4 A;  5B8B A;  3L9V A;  2PUK C;  1T4Z A;  2A4V A;  2MMN A;  5ECO B;  1LJR A;  1ZYP A;  4WBR D;  3TKS E;  4MH2 A;  1K0D A;  4PTS A;  1MTC A;  2KHP A;  2LNS A;  4NXI A;  1K0A A;  2AAW A;  3NZN A;  2L59 A;  5E4W A;  4ECB A;  2A4H A;  5B6M A;  5AIX A;  3PIN A;  2IME A;  3HVX A;  3GRX A;  2LTK A;  1TJD A;  2XPD A;  4KDU A;  3LWA A;  4POM A;  1A24 A;  3C7M A;  2PMT A;  1TK5 B;  2JL4 A;  1TU8 A;  2V32 A;  3IDV A;  3A3T A;  2WZ9 A;  2LRN A;  8GSS A;  2C8U A;  3AY8 A;  4AJ6 A;  3WD6 A;  2VOC A;  5F07 A;  2WDU A;  4BWS A;  3ZTL A;  1G7O A;  10GS A;  5D73 A;  2H0H A;  4FYB A;  4X0X A;  5C00 A;  2H73 A;  3QFB C;  2LJA A;  5DJM A;  1SK1 A;  4AGS A; 
#chains in the Genus database with same CATH homology
 4BVX A;  4FQU A;  4WF5 A;  1YY7 A;  3FK8 A;  12GS A;  4WET A;  1ABA A;  2L5L A;  3CBU A;  1XFL A;  2OBK A;  4FYU A;  2WUL A;  5G2Z A;  1A2M A;  3J7Y k;  4EIP A;  4MH3 A;  1JZD A;  2D2Z A;  3KEB A;  1OC3 A;  2TRC P;  1PL2 A;  4ISD A;  4AJ8 A;  2VIM A;  2KOK A;  4PQI A;  5H5Q A;  1T8E B;  1Y6E A;  5ID2 A;  3UBL A;  2YOI A;  1DUG A;  3EU4 A;  3APO A;  3RPN A;  3HVV A;  1XWA A;  5C04 A;  2YZU A;  1V58 A;  2L4C A;  3HVS A;  2G2Q A;  1A2J A;  4K5R A;  2OAD A;  4ECJ A;  1UA5 A;  1Y25 A;  3WGX A;  4JR4 A;  4KW6 A;  2RUF A;  3IR4 A;  4GQC A;  4KB3 A;  5INY A;  4NPB A;  1S3D A;  1V98 A;  3A5W A;  4HUA A;  3U5R E;  1FB0 A;  1PMT A;  2OA7 A;  2DBC A;  4MA9 A;  3E9J B;  1EV9 A;  1XWC A;  4GSN A;  2H71 A;  3TRQ A;  4KDX A;  4RUV A;  3EMX A;  2PVO C;  3UEM A;  2HYX A;  5IPH A;  3KJY A;  4D73 A;  2YZH A;  2GGT A;  4OFM A;  4H86 A;  2QA2 A;  2JU5 A;  3TJB A;  3VWX A;  4ZIL A;  1XVQ A;  1N8J A;  2FWE A;  5HR1 A;  2H66 A;  1NHY A;  3ERG A;  3LFL A;  2N5B A;  3UIW A;  2B1L A;  3TDG A;  4BVY A;  1J9B A;  2NPB A;  3GYK A;  5D9V A;  2H8L A;  4TXO B;  3BJ5 A;  4EDZ A;  2KUC A;  3ZFL A;  3J7Y b;  1KBN A;  4XRA A;  3H93 A;  4WXT A;  2LRC A;  4XS4 A;  4RI6 A;  1MEK A;  2IIY A;  3F63 A;  16GS A;  5KOX A;  4K7O A;  4EF0 A;  5CRG A;  4V2M A;  4KX4 A;  2MMZ A;  3HKR A;  2LV3 A;  1ILO A;  4OCE A;  3FZA A;  2C3Q A;  3VLN A;  1J08 A;  2V6K A;  4TR1 B;  1A23 A;  2H1D A;  3F4T A;  3LOR A;  5CRD A;  4YAP A;  3D4T A;  2GZY A;  4CHS A;  4FH8 A;  2IL3 A;  3US3 A;  1OAZ A;  3DML A;  2H30 A;  4MJC A;  3CTG A;  5IM9 A;  2L6C A;  4PUR A;  4J2F A;  1XWG A;  1PX7 A;  1M0U A;  3LSZ A;  2CT6 A;  1AUC A;  3VWW A;  4NWY A;  4PQH A;  1K0O A;  2GQL A;  1GLQ A;  4HU7 A;  2R0C A;  5AGY A;  4PX1 A;  1U3I A;  1OC9 B;  3PGT A;  2DJJ A;  2IJY A;  1FVK A;  2XC2 A;  3ZVJ D;  3KGK A;  3R2Q A;  3QPM A;  1F3B A;  2R0P A;  3HY2 A;  5KOW A;  3SWL A;  3LW9 A;  4IQ1 A;  4ML1 A;  4IJ3 A;  1X0R A;  1QMV A;  1SKS B;  4OD7 A;  3TKQ A;  5J5N A;  4ZB8 A;  2H74 A;  2Z9S A;  3WYW A;  2H76 A;  3HHV A;  2YWM A;  3KIJ A;  3KMN A;  5GAN D;  5JWQ B;  4FO5 A;  3LQ7 A;  1F9M A;  1EWX A;  1F2E A;  5DAL B;  2GZZ A;  5DDL A;  2H19 A;  2C0G A;  18GS A;  4LL4 B;  3IA1 A;  2AYT A;  1Z3E A;  2BJX A;  5ENU A;  2GSS A;  1K3L A;  4ACS A;  1F6M C;  1GSU A;  1ZOF A;  3DWV A;  4MP4 A;  2H0G A;  4EO3 A;  2CVB A;  5G5F A;  4KGI A;  4GWR A;  2EIQ A;  2R4V A;  3D0Z A;  4GLT A;  1SYX A;  1U88 A;  3IPZ A;  3ISO A;  3O6T A;  1ZL9 A;  3BBY A;  2TIR A;  2M46 A;  1Z6M A;  3L9S A;  2HSY A;  5IIZ A;  4EVM A;  1GTI A;  2M80 A;  2ZNM A;  3QOU A;  1SKR B;  3MDK A;  3KCM A;  2E2G A;  2IMF A;  1SD9 A;  1V2A A;  1HD2 A;  2B7K A;  3PR8 A;  4LLR A;  1JLV A;  4YQM A;  5D96 A;  2LQO A;  3ERF A;  4N0V A;  3D22 A;  4RQX A;  2ZCT A;  3GHA A;  2CVD A;  1GUM A;  1O73 A;  4E8H A;  4HU9 A;  4EDY A;  2YPM A;  4YKG A;  1M2B A;  5D9X A;  3DIE A;  2OBI A;  1ML6 A;  1MDJ A;  4N10 A;  1TDI A;  3UOM A;  4KDY A;  1GNW A;  2F8A A;  2I9H A;  4JU5 A;  3QMX A;  2P5R A;  20GS A;  3DEX A;  2I81 A;  4ZB6 A;  4BL7 B;  1GUH A;  4MPG A;  3TCO A;  3HJM A;  3GFK A;  3HDC A;  1WMJ A;  5J9B A;  3KTB A;  3FY7 A;  1EEM A;  3Q18 A;  1A8L A;  2YWN A;  2VL2 C;  2O7K A;  1QXH A;  4HOJ A;  3UBK A;  1ZMA A;  2ON5 A;  2DML A;  1I5G A;  4ZL9 A;  5D9T A;  3QAV A;  3TRP A;  2OE3 A;  2TRX A;  1DE1 A;  2FWF A;  4HQS A;  17GS A;  1M7T A;  3M9J A;  5DJL A;  4HI7 A;  4TVE A;  2L4Q A;  4NV5 A;  4IHU A;  4GSS A;  3BCI A;  3HYP A;  4KCE A;  3BCK A;  1S3A A;  2ON7 A;  3IK9 A;  2GQK A;  4TW5 A;  4O92 A;  5D93 A;  4L8E A;  1R7H A;  4O32 A;  3HJO A;  2FCH A;  2H1A A;  1V40 A;  3VPQ A;  2I4A A;  5CAX A;  3TOU A;  2VD1 A;  1EZK A;  2AJQ B;  3EYT A;  2LRT A;  4IGJ A;  3EWL A;  4O5R A;  3BOA A;  1AIU A;  3GX0 A;  3E0U A;  1H4O A;  2MBS A;  3VUR A;  1A0R P;  3PPU A;  4NHW A;  5AIV A;  3IC4 A;  1AQV A;  1OVN A;  2KLX A;  3C1R A;  4KND A;  1Q98 A;  4I8B A;  4OFN A;  1TRU A;  1PL1 A;  1T1V A;  5DAK A;  2BTO T;  2JAC A;  3GA4 A;  3HD5 A;  3UJ1 A;  3D21 A;  2AHE A;  5F05 A;  1YEX A;  4G10 A;  3U6V A;  1VF2 A;  3NIV A;  3ZLP A;  4IQA A;  4PGT A;  3H4K A;  3M8N A;  3ZL5 A;  1LBK A;  4X1U A;  3VI5 A;  4Q5R A;  1Z7R A;  1MDI A;  1ZYN A;  1FO5 A;  2K8V A;  1U3A A;  5BMU A;  5IMC A;  2LQQ A;  1O85 A;  1TRS A;  2B5Y A;  2H01 A;  3ZML A;  3ZIT A;  2B6M A;  4CY8 A;  3WGD A;  2YWI A;  2LNT A;  4GST A;  1SYR A;  2VCV A;  5F06 A;  2VCW A;  3WT2 A;  4QL9 A;  4WF4 A;  5G31 A;  1W89 A;  3P7X A;  1K0N A;  1FVJ A;  5F8B A;  3IHQ A;  1ERT A;  5GSS A;  3ZRE A;  3M3M A;  3ZIV A;  4ULX A;  5ABR A;  1ZCP A;  2GT6 A;  4AJ7 A;  2M72 A;  6GSX A;  5CRE A;  1A8Y A;  2A2S A;  4KCA A;  4ML6 A;  4IP6 A;  2B3S A;  4KE3 A;  2FNO A;  5IMF A;  4YQU A;  3KH7 A;  5ECQ B;  3ZFB A;  4MPF A;  2MZC A;  4IEL A;  3I43 A;  6GST A;  1EGO A;  1JFU A;  2YJH A;  1K0C A;  2DIZ A;  2RII A;  4E8E A;  3A5I A;  5G30 A;  1SJZ A;  4F0C A;  3CYN A;  1TK8 B;  3UAP A;  1GSS A;  1G6Y A;  2WCI A;  4J56 E;  2F9S A;  4JED A;  4KSO A;  3KXO A;  2LJK A;  1ACV A;  4OWY A;  5GST A;  1RW1 A;  2YP6 A;  2LKU A;  3DYR A;  1MD3 A;  4BA7 A;  1XW6 A;  3WGE A;  1K0B A;  2WFC A;  2V41 A;  2VD0 A;  3L0H A;  4TN8 A;  1DE2 A;  2FGX A;  3O3T A;  1AW9 A;  2O89 A;  1QK8 A;  3LG6 A;  3TUE A;  2GSR A;  1JHB A;  5J9C A;  5AIS A;  2QGV A;  3PH9 A;  3TKS C;  2H1B A;  3GKM A;  3F6D A;  4ID0 A;  1JZO A;  2OKA A;  4YAV A;  4TR0 A;  2XBI A;  5IMA A;  3GKN A;  3UVH A;  1XOA A;  1CQH A;  4HQZ A;  5F0G A;  5ECN B;  4TXO A;  1UN2 A;  1OKD A;  3G7J A;  1B4Q A;  4OMV A;  2QA1 A;  5IOX A;  3HCZ A;  3FEU A;  2CZ3 A;  4F9Z A;  5CP1 A;  3VPT A;  3Q19 A;  4MJB A;  3FKF A;  4XTS A;  2VO4 A;  1WIK A;  3D4M A;  5CO3 A;  1U87 A;  2YNX A;  3GTU B;  3HJP A;  2QKE A;  2X8G A;  3E3E A;  4TR1 A;  1O7U A;  2DIY A;  4MDC A;  1FOV A;  2IFQ A;  3KM6 A;  1PRX A;  4GTU A;  5H5S A;  5A5K A;  5IMD A;  2EIR A;  1YKA A;  1AXD A;  5JCU A;  2FD3 A;  3CSH A;  4ZL7 A;  1SKW B;  2O85 A;  2V6O A;  5CRH A;  2FA8 A;  3VI7 A;  6GSW A;  2B5X A;  2HZE B;  2WGR A;  1PGT A;  4TR3 A;  2CAQ A;  3DD3 A;  2JSY A;  3FW2 A;  3N9J A;  5GAP D;  3QCP A;  1FG4 A;  3APQ A;  4MJE A;  4KSM A;  1OC9 A;  2VCZ A;  1J0F A;  4IBP A;  2AB6 A;  5EL8 A;  1XZO A;  2FWH A;  4X4J A;  3ZYW A;  2VL3 A;  2R0G A;  2LS5 A;  3VK9 A;  3FZ9 A;  5ECH B;  4ECI A;  3K8N A;  1U6T A;  3F9U A;  3MAK A;  4HJM A;  3TB2 A;  4BVY B;  4TOP A;  2NDO A;  4DEJ A;  2C1Y A;  2YCD A;  1PD2 1;  1FHE A;  1YJ6 A;  5JCG A;  1ZYE A;  1GSQ A;  2K6V A;  4BWQ A;  3N5O A;  4L0U A;  3EC3 A;  3DKS A;  3O76 A;  1EOG A;  5ELA A;  4MZB A;  1T7P B;  3RPP A;  2HNL A;  5JCW A;  2NBS A;  3P8W A;  2R5G A;  1XWB A;  2FA4 A;  1G6W A;  4IVF A;  4YH2 A;  4NHZ A;  1Z9H A;  1OKT A;  5KN2 A;  2FUG 2;  1KNG A;  1SJ6 A;  5H5R A;  2EC4 A;  5J3R A;  3FR9 A;  3P90 A;  2C80 A;  1ST9 A;  2NTO A;  3EUR A;  1AQX A;  4KA0 A;  4OCF A;  1R26 A;  2RM6 A;  4GXZ A;  2IN3 A;  3G7I A;  2K18 A;  1E6B A;  2GLR A;  3HA9 A;  4MK3 A;  2JZS A;  5DCH A;  4DSS B;  4MNN A;  3GX8 A;  4EL1 A;  5ECS A;  3S9F A;  3QAG A;  2GST A;  1FOH A;  2X4A A;  3TJK A;  4N0Z A;  1X9W B;  4JBB A;  4KF9 A;  2OJL A;  2PBJ A;  2B7J A;  1GL8 A;  4ILF A;  1F37 A;  3L4N A;  2LST A;  3GL5 A;  3UL3 A;  1PX6 A;  4XIH A;  4F0B A;  3MYD A;  1TU7 A;  3A2W A;  3LYP A;  2H6Z A;  3Q6O A;  2HRK A;  4N11 A;  1BAY A;  1QGV A;  2HFD A;  1WOU A;  3EPT A;  2G0F A;  2VCQ A;  5DCG A;  2NVL A;  4G0L A;  1JZW A;  2I3Y A;  2JZR A;  3MWH A;  2OAC A;  5EPF A;  2REM A;  3FMW A;  2VM2 A;  1Q4J A;  3IBH A;  3I69 A;  5DVB A;  3RHB A;  3LEF A;  2DJ0 A;  4IN0 A;  4Z2U A;  2PVQ A;  5BRT A;  4L0W A;  5FHI A;  2GQM A;  4GCI A;  1T3B A;  2CAI A;  1R5P A;  5ECP B;  4I97 A;  3ED3 A;  4G9H A;  1G7E A;  4XS6 A;  5GZZ B;  1PSQ A;  2DKI A;  3C71 A;  5L71 A;  4IJI A;  1WRY A;  5DQS A;  4O7H A;  1BJX A;  4G0K A;  5IO0 A;  4MF6 A;  1THX A;  3I9V 2;  1ERU A;  4Q5N A;  2CQ9 A;  3F3R A;  1BYE A;  2E0Q A;  3KTL A;  4OO5 A;  3V1W A;  2B1K A;  3DRN A;  4I2U A;  1PQN A;  2X49 A;  4PXO A;  4FIW A;  1XCC A;  2FY6 A;  1JLW A;  4HEA 2;  3G7Y A;  1RQM A;  1TTZ A;  2HT9 A;  4NMU A;  1W4V A;  3IAS 2;  4MF5 A;  1NM3 A;  2P5Q A;  1YF1 A;  3CSI A;  4FYC A;  1DSB A;  4O5Q A;  4MZW A;  1ZZY A;  3F4R A;  4G0I A;  2H6Y A;  1X9M B;  5IMV A;  3GKK A;  5IOW A;  4XS1 A;  4V1A p;  4CDO A;  2B5E A;  2ZUP A;  2ES7 A;  4RI7 A;  3UAR A;  2YN1 A;  1XBS A;  5E59 A;  3LJR A;  4ZL8 A;  1O8W A;  1PN0 A;  5B7C A;  5HR2 A;  4K7I A;  19GS A;  1NW2 A;  4EXJ A;  1EGR A;  1K3O A;  3M1G A;  3QFA C;  1WE0 A;  2X8C A;  2IMI A;  1TW9 A;  2I1U A;  3F6F A;  1EEJ A;  2R6K A;  2O8V B;  3LXZ A;  4YKF A;  1B8X A;  3IOS A;  3KH9 A;  4HJ2 A;  4G19 A;  4V2L A;  2CVK A;  4DSR A;  5FWG A;  3IRA A;  3KZQ A;  1SL2 B;  4DVC A;  1ZYQ B;  2N5A A;  3NOF A;  4K9Z A;  3HXS A;  4HZ2 A;  4EUY A;  2QC7 A;  1OYJ A;  1SD8 A;  2LUS A;  2WJU A;  2RUE A;  4CY6 A;  1TI1 A;  2KP2 A;  4K5S A;  2GDR A;  3ZMK A;  5EY6 A;  7GSS A;  2PWJ A;  5A4U A;  3RBT A;  1B9X C;  1N2A A;  4K7N A;  3G9B A;  2A2P A;  4EIQ A;  13GS A;  1SL1 B;  4WR5 A;  4F82 A;  1QUW A;  4P3Y B;  3EU3 A;  1SL0 B;  4Z2R A;  3IAM 2;  3TKR A;  3GIX A;  1Z7P A;  2HRA A;  3C1S A;  4Z7X A;  4HDE A;  2V2G A;  2E2M A;  1AQW A;  2VL9 A;  3I6A A;  3LYK A;  4K8M A;  5JWR B;  4I6X A;  4K6X A;  3DGQ A;  4J57 E;  3A2X A;  3CRU A;  2H72 A;  2WS2 A;  2C3T A;  3IC8 A;  2GTU A;  1R5A A;  1PKW A;  1G0T A;  3GST A;  1GSY A;  4X43 A;  3C73 A;  5HR3 A;  1GTB A;  3M0F A;  3TJG A;  3KP9 A;  5HFI A;  2P31 A;  5DAK B;  5A4W A;  1VGL A;  3H79 A;  2PER A;  2V1M A;  1XIY A;  2H6X A;  1TI3 A;  2O87 A;  1SU9 A;  1OE7 A;  4PUF C;  2RM5 A;  2C0F A;  2GZP A;  1M2A A;  4PNG A;  4OO4 A;  3GN3 A;  3P2A A;  3FR3 A;  3W6G A;  1XWK A;  2QSI A;  1T4Y A;  4Z2T A;  2CA8 A;  2H0I A;  1X5C A;  4GQF A;  1USB A;  3CSJ A;  4GF0 A;  4NV2 A;  3TKP A;  3MIX A;  1TP9 A;  5D9W A;  4POK A;  3FHK A;  1TRV A;  2DC5 A;  2HRF A;  1EP7 A;  2PGT A;  3CTF A;  4BPY A;  1BG5 A;  5CRW A;  3R3E A;  4CW9 A;  3LXT A;  3IHG A;  2XPE A;  5CYY A;  3GUS A;  3D5J A;  3IK7 A;  4BVX B;  1IYH A;  1SEN A;  3C8E A;  3KP8 A;  4K0G A;  2P0G A;  3KD0 A;  3ZRD A;  2F3M A;  4ICY A;  2GT5 A;  6GSU A;  5B8A A;  3L78 A;  3GH9 A;  4PQ1 A;  5ECM B;  1QQ2 A;  2AUV A;  5LCZ A;  3GTU A;  1FAA A;  1GNE A;  1Z6N A;  1O6J A;  5B6N A;  3FYG A;  1K0M A;  1S3C A;  1M9A A;  1WJK A;  3Q74 A;  4F03 A;  1TKD B;  2WRT A;  4LA1 A;  3QAW A;  2H1G A;  5KN1 A;  4ECC A;  1PKZ A;  2YWO A;  5G1L A;  4ZIJ A;  4DSQ A;  3CMI A;  1FW1 A;  1EOH A;  5ID2 B;  1SK0 A;  1UVZ A;  5KEJ A;  1V9W A;  4JR6 A;  2DJK A;  1V57 A;  3TJJ A;  1NHO A;  2HZF A;  1PA3 A;  3UVT A;  2HZE A;  1GSE A;  4ZBB A;  3QD9 A;  4MLY A;  5ELG A;  1XPV A;  2IWT A;  4XCS A;  1XW9 A;  2H75 A;  4XHM A;  1B9Y C;  2JAD A;  1UC7 A;  1TRW A;  2HSM A;  3M9K A;  3VFI A;  1SK2 A;  1EP8 A;  4USS A;  5FT3 A;  2XHF A;  1ZGN A;  2FWG A;  4QL7 A;  1CQG A;  3H1N A;  2PN8 A;  1KTE A;  2IPA A;  1H75 A;  3F4S A;  4K2X A;  3F3Q A;  4KUN A;  1X5D A;  2YV9 A;  2HE3 A;  2X8H A;  1C72 A;  1WPI A;  4IS0 A;  3FZ5 A;  1GUL A;  4F2I A;  3LGC A;  3ZVJ A;  1GSD A;  5HFG A;  4GRF A;  4G2E A;  4D73 B;  1YF0 A;  4O5U A;  5ECR B;  3MNG A;  1GTA A;  3ME7 A;  5LNK e;  3VWU A;  4V1A g;  2LEG A;  3CXG A;  4RQR A;  4MCU A;  2IMD A;  3GSS A;  2LJR A;  2DJ3 A;  1OE8 A;  5J41 A;  5J4U A;  1HNB A;  4POL A;  2IFQ B;  4TKY A;  3F8U A;  2DMM A;  2GSQ A;  3RDW A;  1TOF A;  3DVX A;  1BED A;  1NSW A;  1WP0 A;  5IMZ A;  2VL2 A;  2C3N A;  2CV4 A;  4L5O A;  3HZ8 A;  2J23 A;  5DAL A;  4XS4 B;  1B4P A;  1O81 A;  2GS3 A;  3F0I A;  5EVO A;  3GL3 A;  2K8S A;  1VF1 A;  4A5P A;  3RAZ A;  4DSS A;  2VCT A;  5DBQ A;  3IXR A;  2HRN A;  4NAX A;  3DXB A;  1M2D A;  1ERV A;  3QDN A;  4MMM A;  4I5Q A;  1AAZ A;  1HYU A;  3TJF A;  2WB9 A;  4TXV A;  1SJI A;  1GSF A;  3MSZ A;  1A0F A;  1MD4 A;  4IP1 A;  3WT1 A;  4JRR A;  4ZBD A;  1GUK A;  5A4V A;  3GNJ A;  2VLT A;  4K0N A;  11GS A;  1XXU A;  1F3A A;  5HFK A;  1TXX A;  1GWC A;  2EIO A;  4K1F A;  4N30 A;  4TRX A;  4IKH A;  1LU4 A;  3ERW A;  1E2Y A;  2H70 A;  3FRC A;  3DVW A;  4YQV A;  3A2V A;  1HNC A;  1KEB A;  1R4W A;  2UZ8 A;  2DSA A;  2DKH A;  3CRT A;  5ECK B;  2CX3 A;  1OC8 A;  2CZ2 A;  4V2N A;  2R3X A;  3GUR A;  2VAF A;  3VWV A;  1XW5 A;  2BMX A;  4WBJ A;  4JZQ A;  1VF4 A;  2E7P A;  3ZZX A;  5G1K A;  4WKW A;  3IV4 A;  4AF2 A;  1YQ1 A;  5AN1 A;  1RK4 A;  3BD2 A;  5KN0 A;  1GP1 A;  1WWJ A;  1XVW A;  2IMK A;  4LMW A;  2VCX A;  2N5F A;  1X5E A;  3RHC A;  2L5O A;  3APS A;  1GLP A;  3ME8 A;  2HI7 A;  3OR5 A;  5KN3 A;  1Z5Y E;  5HQP A;  1GTU A;  2OE1 A;  1ERW A;  1HQO A;  1BX9 A;  4MAB A;  2MBT A;  2L6D A;  2HSH A;  2JSZ A;  2X64 A;  4BL7 A;  2DLX A;  22GS A;  1O8X A;  3L9U A;  5CNW A;  4EC0 A;  4LL1 B;  3QR6 A;  2KP1 A;  1T00 A;  2C0D A;  1M99 A;  5ECL B;  4PUA A;  2MMO A;  4WR4 A;  2J9H A;  1M9B A;  3W8J A;  2DJ1 A;  6GSS A;  1PN9 A;  1B48 A;  3FZ4 A;  4WEY A;  5DQY A;  4L5L A;  3TOT A;  5COH A;  2JZT A;  4JE1 A;  2VM1 A;  1DBY A;  2YAN A;  1VF3 A;  1MDK A;  9GSS A;  1YEP A;  1TK0 B;  1QFN A;  4MJA A;  4TR4 A;  4ZBA A;  3JCM L;  4K2D A;  4Q5Q A;  4OFT A;  2DJ2 A;  1YDK A;  14GS A;  1VRS D;  2RLI A;  1THO A;  4EKZ A;  4Q5F A;  3GKX A;  4ZB9 A;  1ON4 A;  1I9D A;  2OE0 A;  6GSY A;  1YKC A;  4MZC A;  2L57 A;  3EMP A;  1FB6 A;  1K3Y A;  3FR6 A;  3EVI A;  4I2T A;  5G5E A;  2ALB A;  4KAE A;  5IQY A;  2VLV A;  2YV7 A;  3GH6 A;  3TGZ A;  2CX4 A;  2K9F A;  2MMA A;  2HLS A;  5ECI B;  2FHE A;  3IE3 A;  4POB A;  1BQ7 A;  2PU9 C;  3TRX A;  1JZR A;  3H8Q A;  1XOB A;  2F51 A;  5LD0 A;  2VLU A;  1HNA A;  2FLS A;  2VUP A;  2XBQ A;  3EIN A;  4QQ7 A;  2R2J A;  4MF7 A;  2MYG A;  2X99 A;  2C0E A;  3TKS A;  4HZ4 A;  4PNF A;  1GRX A;  4IW9 A;  4XRD A;  2A2R A;  4EE0 A;  1X9S B;  5JWO B;  3ZIJ A;  2GVP A;  4HS1 A;  1YZX A;  2YJ7 A;  2C4J A;  2F8F A;  3GV1 A;  3UMA A;  1GH2 A;  3GMF A;  5IPG A;  5IO2 A;  2PPT A;  1AC1 A;  3EE2 A;  1IYI A;  4KH7 A;  3SBC A;  3W8S A;  1A2L A;  4ZXG A;  1EV4 A;  4LMV A;  5D8I A;  3KMO A;  1URM A;  3D6I A;  2AV4 A;  5HR0 A;  6GSV A;  2HXK A;  2R37 A;  3HZ4 A;  5B8B A;  3L9V A;  2PUK C;  1T4Z A;  2A4V A;  2MMN A;  5ECO B;  1LJR A;  1ZYP A;  4WBR D;  3TKS E;  4MH2 A;  1K0D A;  4PTS A;  1MTC A;  2KHP A;  2LNS A;  4NXI A;  1K0A A;  2AAW A;  3NZN A;  2L59 A;  5E4W A;  4ECB A;  2A4H A;  5B6M A;  5AIX A;  3PIN A;  2IME A;  3HVX A;  3GRX A;  2LTK A;  1TJD A;  2XPD A;  4KDU A;  3LWA A;  4POM A;  1A24 A;  3C7M A;  2PMT A;  1TK5 B;  2JL4 A;  1TU8 A;  2V32 A;  3IDV A;  3A3T A;  2WZ9 A;  2LRN A;  8GSS A;  2C8U A;  3AY8 A;  4AJ6 A;  3WD6 A;  2VOC A;  5F07 A;  2WDU A;  4BWS A;  3ZTL A;  1G7O A;  10GS A;  5D73 A;  2H0H A;  4FYB A;  4X0X A;  5C00 A;  2H73 A;  3QFB C;  2LJA A;  5DJM A;  1SK1 A;  4AGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...