3ZVJA

Crystal structure of high molecular weight (hmw) form of peroxiredoxin i from schistosoma mansoni
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
165
structure length
165
Chain Sequence
MVLLPNRPAPEFKGQAVINGEFKEICLKDYRGKYVVLFFYPADFTFVCPTEIIAFSDQVEEFNSRNCQVIACSTDSQYSHLAWDNLDRKSGGLGHMKIPLLADRKQEISKAYGVFDEEDGNAFRGLFIIDPNGILRQITINDKPVGRSVDETLRLLDAFQFVEKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN PEROXIDASE
publication title Moonlighting by Different Stressors: Crystal Structure of the Chaperone Species of a 2-Cys Peroxiredoxin.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Oxidoreductase
total genus 33
structure length 165
sequence length 165
chains with identical sequence B, C, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3zvjA00
2OJLA 3G7IA 1T3BA 2YANA 2WDUA 2HYXA 2EIRA 14GSA 4BPYA 5IM9A 1V98A 2YZUA 4LLRA 3HZ8A 1SL0B 1GTIA 5D73A 5ECLB 3RHBA 4N10A 3I9V2 2CX4A 5AIXA 1VF3A 4OO5A 1OE7A 2F3MA 1FHEA 1K3OA 3QMXA 4MZBA 1WE0A 4NWYA 3ERWA 4AJ7A 4IKHA 3O3TA 2WS2A 1SKSB 4HJMA 3I43A 3LSZA 3IXRA 1GP1A 1MDJA 2PVQA 2K8SA 1J08A 1T4YA 1PL1A 2LRTA 4GLTA 2LNTA 2JADA 1UVZA 1VF4A 3FR9A 2KP1A 2REMA 1XVQA 4PX1A 5FWGA 2L4CA 2H1GA 1F3BA 3F3QA 1GULA 2FY6A 3C1SA 2TRXA 3UBKA 4N11A 4TR1B 4LMWA 1ZOFA 4EF0A 2F8FA 1X5CA 3EINA 3BOAA 5H5QA 1PSQA 4K7NA 3IAS2 2GZZA 2GSQA 5C04A 2GTUA 1ERUA 4FIWA 2CVDA 3HHVA 3IC4A 2QC7A 2CVBA 2GVPA 2H70A 2GQKA 1X5EA 4HOJA 4XS4B 3Q18A 3DWVA 20GSA 1TI1A 1EV4A 4GF0A 3GTUA 2DC5A 3TKSE 1MTCA 1XFLA 2PU9C 1G0TA 3EURA 1TXXA 2HNLA 5DQYA 2PUKC 1WOUA 4MK3A 4ML6A 1GSSA 4NHWA 4IW9A 3W8JA 1RQMA 2C0FA 3QFBC 4ZBBA 5ECQB 1T4ZA 3C73A 3ZFLA 3LEFA 1OKTA 5CO3A 3TOUA 1S3DA 4EVMA 2I9HA 3VURA 4L0WA 3ME8A 1ZYQB 4ZL9A 3HZ4A 5AIVA 4EE0A 3RHCA 4GWRA 3G7JA 4ULXA 4Q5FA 2LRCA 3VLNA 3M8NA 2GZPA 2O87A 2FA4A 2GGTA 2KLXA 4IQ1A 3BCIA 16GSA 2H73A 2V1MA 3KTLA 5IPHA 4NPBA 4JEDA 1GTUA 2HRNA 1YZXA 5ECOB 2B6MA 4BVXA 2WRTA 1V57A 2VCXA 5EY6A 1SJ6A 5JCGA 2AJQB 1EEMA 5AN1A 3TRPA 2AHEA 1XOBA 1OC3A 1GRXA 1EGOA 5FT3A 3GX0A 1A0RP 2BTOT 1EWXA 6GSYA 2B3SA 4EDZA 4MF7A 4N0VA 4WR4A 1QFNA 5HFGA 6GSWA 3WT2A 1FG4A 1SJZA 1PMTA 1DSBA 5F05A 2E2MA 3LORA 2N5FA 3N9JA 3GN3A 3LFLA 1Z7PA 3LWAA 1TK0B 3A2VA 1OAZA 2X8CA 1NHYA 1T1VA 3IHQA 3EC3A 3GSTA 3LXZA 1A0FA 4ISDA 4MDCA 4HZ4A 1Q98A 2H1DA 3PH9A 1SL1B 1A2MA 4RQRA 5ELAA 3TB2A 4MJAA 3HD5A 3ZRDA 3V1WA 2C0GA 4PQIA 3H4KA 3HJPA 4FH8A 4PNGA 2B7KA 4XS1A 1K0CA 4MJEA 4ZB9A 4XIHA 3TRQA 5ID2B 1V40A 1G7EA 4QL7A 1TK5B 1T00A 2H6XA 3KEBA 4PURA 3VFIA 4O32A 1F37A 2AYTA 1ERVA 3H79A 3TKSC 4TXVA 2H1AA 4PXOA 3EU3A 1QQ2A 3UEMA 3L9VA 1ML6A 1OVNA 1BYEA 2YWOA 4LA1A 5DCHA 2D2ZA 2CQ9A 5ECHB 5IOWA 4G19A 3CBUA 1XOAA 4WBRD 5B6MA 4MABA 3KGKA 2DJJA 1GH2A 5F0GA 1X0RA 2H6YA 1HNBA 1H4OA 1GSEA 4V1Ap 3UIWA 2LJKA 1AAZA 2X64A 1XWGA 4DSRA 2H30A 3TRXA 4LL4B 3FZ9A 5CRGA 3M3MA 1LBKA 2HZEB 5A4VA 2FHEA 2HT9A 2FWEA 4YAPA 4JRRA 4Z7XA 4DVCA 3GH6A 4MPFA 5INYA 5LCZA 1WP0A 1TRVA 5LD0A 2MBTA 5ECIB 2OE3A 5IOXA 2JZTA 1WWJA 5KN1A 4ZL8A 3GKNA 3UBLA 3FK8A 2LQOA 3F9UA 1EP7A 3TGZA 3TJBA 5A5KA 5J5NA 3MAKA 2DJ2A 1M2BA 1UA5A 4HZ2A 2LNSA 3H8QA 3ISOA 4I5QA 1OC9A 2C3QA 5ENUA 2L5OA 1FW1A 3GURA 5HFKA 2C80A 4PQHA 5B8AA 3QFAC 1K0NA 3C71A 4D73B 1PGTA 1F3AA 3GA4A 4PNFA 3ZIVA 3ZITA 2N5AA 2FNOA 2K18A 3LXTA 4MZWA 4YH2A 2B5EA 1SYXA 3DXBA 3HA9A 4KGIA 2C3TA 5G2ZA 2VUPA 2MMZA 1R26A 4IELA 4V1Ag 5FHIA 4K9ZA 5DJLA 3MNGA 4BVYA 3U6VA 2C4JA 3I69A 4TN8A 1DUGA 3W6GA 2HLSA 2NDOA 3IRAA 3Q74A 2RM5A 1USBA 3ZZXA 2YNXA 11GSA 2B7JA 1ILOA 2FCHA 1AUCA 1YY7A 2JACA 3JCML 3UAPA 1FO5A 3VPQA 5CRWA 3F63A 4PUFC 1A2LA 1FVKA 1HNCA 1GUMA 2A2SA 2GQLA 1RK4A 4NAXA 4OCEA 4ACSA 4F03A 4KH7A 5J4UA 4ZBAA 1A8YA 1FOVA 1DBYA 4MA9A 4TVEA 3KTBA 2R6KA 3GX8A 1YDKA 5KEJA 7GSSA 2C8UA 2R37A 2C1YA 3NIVA 1JFUA 3TKSA 2FA8A 2ES7A 1JLWA 2JZRA 4OFMA 3O6TA 1MDIA 2HE3A 1WRYA 1VRSD 1KNGA 2V41A 4KE3A 4RI6A 3BCKA 19GSA 2I1UA 3WT1A 3L78A 1YKAA 4EXJA 3HY2A 4DSQA 2ZCTA 1HYUA 1R7HA 1TI3A 2VD0A 1YEXA 3UVHA 5LNKe 2G2QA 4DSSA 4F0CA 1TK8B 3P7XA 2GLRA 2L59A 4KAEA 3M0FA 4MPGA 5DALA 2L57A 2QGVA 3TJFA 2YCDA 1HNAA 1B4QA 5J41A 4J56E 2RUEA 2LUSA 4IHUA 2F9SA 5GSTA 5CRHA 4CDOA 1DE1A 2B5XA 4KNDA 5F07A 3G9BA 1S3CA 1ZYEA 1GTAA 3GKKA 1HD2A 3DRNA 4GTUA 4AJ6A 1FB6A 5J3RA 5CNWA 2B5YA 5D9XA 2Z9SA 4XTSA 1T8EB 2IWTA 3PGTA 4E8EA 3EYTA 4OFNA 5HR1A 4K0NA 3GYKA 2I3YA 3K8NA 4BL7A 1SYRA 2VAFA 1B9XC 4HEA2 2ZNMA 3A2WA 4KDUA 2CAQA 4K0GA 4MCUA 2LKUA 1YF0A 2V6OA 5G5EA 2RM6A 2CV4A 4AGSA 3RDWA 3VWXA 5G1KA 3FZ5A 3WGDA 2GDRA 2H75A 2QKEA 3HVXA 1R4WA 4KSOA 4POBA 4J2FA 3QCPA 2VCWA 2L6CA 2A4VA 2WB9A 1MD3A 2FWHA 2VLVA 3IK9A 4L0UA 1PA3A 5ECRB 4LMVA 5KN0A 5KN3A 4TR4A 3UOMA 2VM2A 2LQQA 1GLQA 2H1BA 3KMNA 2DMLA 3LYKA 3FY7A 4JU5A 4POMA 2KOKA 2LJRA 3KJYA 2DMMA 3IOSA 3TOTA 2X99A 4I6XA 1YQ1A 5CAXA 1SK1A 3FZ4A 1PKWA 3PINA 2IPAA 4NHZA 5CRDA 3LG6A 1QGVA 2OBKA 3KIJA 5HR2A 4RQXA 1N2AA 4ML1A 2XC2A 4EL1A 4F2IA 4IJ3A 4YQUA 5J9CA 5IPGA 4I8BA 4H86A 3C1RA 1TTZA 1EOGA 2IN3A 5G1LA 3QAWA 1B48A 3RBTA 4EO3A 22GSA 3A5WA 5F06A 1ZMAA 3ZL5A 3DEXA 1M0UA 1EZKA 1BQ7A 3IV4A 2NBSA 2OACA 4TR1A 4EKZA 1TKDB 2AV4A 2P31A 2J9HA 3VWUA 4J57E 2H0GA 4FYBA 3UJ1A 3QPMA 3GIXA 4L5LA 1KBNA 1C72A 2I4AA 3HDCA 3Q19A 3LYPA 1J9BA 3OR5A 5JWRB 1M9AA 4KCAA 4PGTA 1F9MA 3GFKA 3VWWA 1X9WB 3QD9A 2PWJA 3F6FA 3ZIJA 2KHPA 4IS0A 2GT5A 3VI5A 3CSHA 1BX9A 2VCVA 1TW9A 4F0BA 4AJ8A 2WULA 2M72A 1SK2A 5E4WA 4MF6A 4XRDA 1V2AA 4K1FA 1JZWA 4MJCA 2B1LA 2MMAA 3FEUA 2V2GA 2E0QA 2CX3A 3D4MA 4EUYA 1GWCA 2FWFA 1PQNA 1Z6NA 3LGCA 2AB6A 4BWQA 1LU4A 3L4NA 4HU9A 4I2TA 5B7CA 1XXUA 2DBCA 5B6NA 2WFCA 3P2AA 5HFIA 3ZVJD 3E3EA 3FW2A 4XCSA 1G7OA 1F2EA 3ERFA 3QAGA 2H8LA 4GSTA 2GSRA 3WGEA 3TCOA 2P5QA 2YJHA 4MH3A 1XWKA 2MMOA 2JZSA 1JZRA 1E2YA 1Z5YE 2GQMA 3UMAA 3ZMKA 3EMXA 4OD7A 3FZAA 5ECNB 1IYHA 1XW9A 2AAWA 1U88A 4ZB8A 3R2QA 1AXDA 2CVKA 2WCIA 2A2RA 2H0IA 1FB0A 3W8SA 3KZQA 1EGRA 3IBHA 5DAKA 12GSA 3CSJA 1BEDA 2YN1A 4NV5A 1F6MC 1ERTA 5AISA 1VF2A 2R4VA 2YPMA 2O8VB 1I9DA 1PD21 3HKRA 3TDGA 5G31A 4TR0A 4ZIJA 2EC4A 3GKMA 5GSSA 1NSWA 3QR6A 2JL4A 3CYNA 2DJ1A 3HVVA 4CHSA 3TJKA 3KCMA 3QDNA 2YP6A 4OWYA 3U5RE 3WGXA 2IJYA 4X0XA 4YQMA 4OMVA 1W89A 5ID2A 5GZZB 4FO5A 3QOUA 2JSZA 5ECPB 1HQOA 4NV2A 3CTGA 2WJUA 4ILFA 3P8WA 1AQXA 3H1NA 1VF1A 1GSFA 4I97A 2H01A 5CP1A 1G6YA 4RUVA 3ZVJA 5CREA 2YOIA 3LJRA 2DJ0A 4Q5RA 1G6WA 1NHOA 1SKWB 6GSXA 2IIYA 1GSDA 1V58A 4X1UA 5A4UA 5IIZA 3APQA 4ECCA 1ERWA 1B8XA 2KUCA 1BJXA 1K3LA 4TOPA 3L9SA 3MDKA 2HXKA 1QMVA 2OA7A 3F3RA 1S3AA 2H19A 4CW9A 1O81A 5GAPD 4K6XA 4I2UA 1GNEA 3ED3A 4POLA 2IL3A 3ZMLA 1SKRB 3KD0A 1AQWA 2DLXA 3KM6A 1THOA 6GSVA 4DSSB 1ON4A 5DBQA 1K3YA 1B4PA 4IBPA 2HZEA 3L0HA 5D9WA 3WYWA 2EIOA 2XHFA 5DCGA 3BBYA 1NW2A 2FUG2 1J0FA 1O8WA 2H74A 2F8AA 5EL8A 3M9KA 3BD2A 3CRTA 2H72A 4ZBDA 1XVWA 3IDVA 3EE2A 2E7PA 2DIYA 3GHAA 5JCWA 1TU8A 3C8EA 3FR3A 2HI7A 1TOFA 3G7YA 2OBIA 3ME7A 2YV9A 1I5GA 1TRWA 3CXGA 2BJXA 3RAZA 4IVFA 4KW6A 1K0BA 2CA8A 4LL1B 4TXOA 4F82A 1Y25A 2LS5A 1AIUA 3E9JB 2HRFA 3GNJA 4D73A 1U3AA 1XIYA 5HR0A 4E8HA 1GSQA 5GAND 2WGRA 4L8EA 1DE2A 4IN0A 2PPTA 2HFDA 3D5JA 4TKYA 3DD3A 4G9HA 6GSUA 1Z6MA 3KP8A 4OCFA 5DVBA 4YQVA 3IPZA 2ON7A 4JBBA 4ZXGA 3EWLA 4HI7A 3D21A 2HSHA 1ZL9A 2IFQA 3ZLPA 2V6KA 4P3YB 1ZCPA 3J7Yk 1XZOA 1X9MB 1BAYA 3GTUB 2YV7A 4IP1A 2DJKA 5H5RA 2GZYA 2R3XA 3DVWA 4ZILA 1XWCA 2YJ7A 3IK7A 3FKFA 2R2JA 5IMCA 3D22A 1WMJA 3GRXA 1BG5A 2O89A 9GSSA 5ABRA 1M2AA 3M9JA 3L9UA 4WF4A 2XBIA 2LRNA 2VCTA 6GSTA 4ID0A 4OFTA 1M2DA 2K8VA 1TP9A 2FGXA 5CYYA 2VCZA 2PBJA 2VM1A 4KA0A 1O8XA 3US3A 3GL5A 13GSA 2AUVA 2ALBA 3CRUA 2YZHA 4HDEA 3FRCA 1K0OA 4NMUA 2VD1A 2H66A 1THXA 4WR5A 1WIKA 3D6IA 1JHBA 5D93A 1WPIA 2GSSA 4Q5QA 1A23A 1EP8A 1TJDA 3SWLA 3A2XA 3F0IA 5G30A 1IYIA 5DJMA 3DGQA 4BA7A 17GSA 2LEGA 3HYPA 4ECBA 2NTOA 3J7Yb 3O76A 1M99A 1XWAA 2L6DA 2IMKA 5ECMB 3KH9A 3ZTLA 5JWOB 5A4WA 3TKQA 2RIIA 1PN9A 2IMDA 3LQ7A 5EVOA 2MBSA 2QSIA 5JWQB 4JZQA 4F9ZA 3CMIA 4TW5A 2CZ2A 1ABAA 1GLPA 1K0AA 1GNWA 4IGJA 3QAVA 2FLSA 4BWSA 3TUEA 2H0HA 2OE1A 1XPVA 2ZUPA 3TKRA 1QK8A 5IO2A 2BMXA 2LTKA 4GCIA 4MLYA 2IMIA 4O7HA 5COHA 4HQSA 1Y6EA 3DVXA 4GQCA 1FVJA 5D96A 1A2JA 2FWGA 3EU4A 2PVOC 2I81A 1XWBA 2PERA 4HUAA 4EC0A 3CSIA 2CAIA 3CTFA 1XBSA 3FHKA 1KEBA 1OKDA 4GSSA 1VGLA 4XRAA 1Q4JA 2TRCP 5HQPA 4K7OA 4G10A 1R5PA 1K0DA 4O92A 1U87A 4OO4A 4WETA 2N5BA 2OE0A 3GUSA 1QUWA 3APOA 2M46A 4HS1A 1SJIA 2VCQA 2LJAA 1Z7RA 1O85A 3MSZA 4XS4A 2MYGA 4MH2A 4AF2A 5B8BA 3AY8A 3HVSA 3I6AA 4L5OA 2YWMA 2C3NA 2VL2C 5DAKB 2P5RA 2OKAA 2VOCA 2PMTA 4JR4A 4KDYA 3IA1A 3FR6A 4ECJA 2B1KA 3F4TA 1EV9A 1TRUA 1V9WA 3Q6OA 4QQ7A 4FYUA 2NVLA 2C0EA 3FYGA 1AQVA 1KTEA 1EEJA 1SD8A 4MP4A 3C7MA 1PKZA 2H76A 2IMFA 3TJJA 1WJKA 4XHMA 3S9FA 1O73A 3EVIA 4KB3A 4G2EA 5IO0A 1ACVA 1H75A 3MWHA 2C0DA 3DYRA 5C00A 4PUAA 3IAM2 4GXZA 4V2NA 1TDIA 2O85A 1MEKA 3WD6A 3UARA 2E2GA 3GSSA 1GUKA 3N5OA 3TKPA 1OC9B 3KP9A 5L71A 2DSAA 1PRXA 6GSSA 3VK9A 3ZYWA 2J23A 4HJ2A 1RW1A 5IMZA 2F51A 4Q5NA 4GSNA 4TRXA 3F8UA 2GT6A 5F8BA 2YWNA 1SL2B 3GL3A 3ZREA 4MF5A 5KN2A 2DJ3A 1XW5A 8GSSA 1JZOA 4WXTA 4DEJA 3KMOA 4GQFA 3ZFBA 1PX7A 2P0GA 3GKXA 1O6JA 1LJRA 1T7PB 2YWIA 1GUHA 3DMLA 2XPEA 3F6DA 2WZ9A 4JR6A 1EOHA 1U6TA 1ZGNA 3P90A 4POKA 3SBCA 5JCUA 1A8LA 3APSA 2M80A 4K7IA 4WF5A 4K2DA 4MZCA 5IMVA 4GRFA 5ECSA 3PR8A 3F4RA 2ON5A 1AW9A 5HR3A 1O7UA 2GSTA 1YEPA 3KH7A 1E6BA 3DKSA 2PGTA 4WKWA 4O5RA 4ZB6A 1OYJA 4X43A 3ERGA 4KDXA 2JU5A 1M7TA 4EDYA 2LSTA 2H71A 4NXIA 3NZNA 2MZCA 5DDLA 5D9TA 3D0ZA 2VL9A 5IMAA 1Z9HA 5AGYA 2PN8A 10GSA 1XCCA 1K0MA 1YKCA 1JZDA 2HZFA 2KP2A 4V2LA 5D9VA 4TXOB 4TR3A 4HU7A 3HJOA 3DIEA 2OADA 3RPPA 3TJGA 3M1GA 5E59A 1ZZYA 1MDKA 1B9YC 2VO4A 2X8HA 5J9BA 2MMNA 4N30A 1YF1A 1M9BA 5IQYA 1Z3EA 4MMMA 1X5DA 3VPTA 1N8JA 1QXHA 2L4QA 4YAVA 4KX4A 5DALB 4V2MA 2CZ3A 2VL2A 3F4SA 3H93A 1URMA 4ECIA 4RI7A 1GL8A 2CT6A 1FAAA 2TIRA 3KXOA 2IFQB 1NM3A 2XPDA 2VLTA 2R5GA 2VIMA 4HQZA 1CQGA 5G5FA 1XW6A 5IMDA 3HCZA 1ST9A 2FD3A 3EMPA 3GH9A 4PQ1A 3GV1A 5DQSA 2H6ZA 4MJBA 2JSYA 18GSA 2GS3A 1GSUA 3RPNA 1X9SB 2K6VA 1MD4A 4JE1A 5IMFA 1SU9A 2IMEA 2RLIA 1TRSA 1JLVA 1YJ6A 4FYCA 1OC8A 5EPFA 3D4TA 1PL2A 1OE8A 2O7KA 2X8GA 4IJIA 4XS6A 4QL9A 1GTBA 3VI7A 2LV3A 2EIQA 5ECKB 3NOFA 4IP6A 1UN2A 1A24A 4IQAA 3BJ5A 1U3IA 2V32A 4WBJA 2NPBA 2XBQA 2VLUA 1UC7A 3A3TA 3UL3A 1PX6A 1SD9A 5H5SA 1SK0A 4KCEA 2K9FA 3UVTA 1R5AA 4ZL7A 1TU7A 1AC1A 4KSMA 1W4VA 3E0UA 4N0ZA 4K8MA 2DIZA 4KUNA 1GSYA 5ELGA 3HJMA 3VWVA 1SENA 3IR4A 4WEYA 3HXSA 3IE3A 5D8IA 3GMFA 1CQHA 2VL3A 2HSYA 2RUFA 2G0FA 2L5LA
chains in the Genus database with same CATH superfamily
2OJLA 3G7IA 1T3BA 2YANA 2WDUA 2HYXA 2EIRA 14GSA 4BPYA 5IM9A 1V98A 2YZUA 4LLRA 3HZ8A 1SL0B 1GTIA 5D73A 5ECLB 3RHBA 4N10A 3I9V2 2CX4A 5AIXA 1VF3A 4OO5A 1OE7A 2F3MA 1FHEA 1K3OA 3QMXA 4MZBA 1PFOA 1WE0A 4NWYA 1XG8A 3ERWA 4AJ7A 4IKHA 3O3TA 2WS2A 1SKSB 4HJMA 3I43A 3LSZA 3IXRA 1GP1A 4G0LA 1MDJA 2PVQA 2K8SA 4USSA 1J08A 1T4YA 1PL1A 2LRTA 2QA1A 4GLTA 2LNTA 2JADA 1UVZA 1VF4A 3FR9A 4YKGA 2KP1A 2REMA 1XVQA 4PX1A 5FWGA 2L4CA 2H1GA 1F3BA 3F3QA 1GULA 2FY6A 3C1SA 2TRXA 3UBKA 4N11A 4TR1B 4LMWA 1ZOFA 4EF0A 2F8FA 1X5CA 3EINA 3BOAA 5H5QA 1PSQA 4K7NA 3IAS2 2GZZA 2GSQA 5C04A 2GTUA 1ERUA 4FIWA 2CVDA 3HHVA 3IC4A 2QC7A 2CVBA 2GVPA 2H70A 2GQKA 1X5EA 4HOJA 4XS4B 3Q18A 3DWVA 20GSA 1TI1A 1EV4A 4GF0A 3GTUA 2DC5A 3TKSE 1MTCA 1XFLA 2PU9C 1G0TA 4CY8A 3EURA 1TXXA 2HNLA 5DQYA 2PUKC 1WOUA 4MK3A 4ML6A 1GSSA 4NHWA 4IW9A 3W8JA 1RQMA 2C0FA 3QFBC 4ZBBA 5ECQB 1T4ZA 3C73A 3ZFLA 3LEFA 1OKTA 5CO3A 3TOUA 1S3DA 4EVMA 2I9HA 3VURA 4A5PA 4L0WA 3ME8A 2R0PA 1ZYQB 4ZL9A 3HZ4A 5AIVA 4EE0A 3RHCA 4GWRA 3G7JA 4ULXA 4Q5FA 2LRCA 3VLNA 3M8NA 2GZPA 2O87A 2FA4A 2GGTA 2KLXA 4IQ1A 3BCIA 16GSA 2H73A 2V1MA 3KTLA 5IPHA 4NPBA 4JEDA 1GTUA 2HRNA 1YZXA 5ECOB 2B6MA 4BVXA 2WRTA 1V57A 2VCXA 5EY6A 1SJ6A 5JCGA 2AJQB 1EEMA 5AN1A 3TRPA 2AHEA 1XOBA 1OC3A 1GRXA 1EGOA 5FT3A 3GX0A 1A0RP 2BTOT 1EWXA 6GSYA 2B3SA 4EDZA 4MF7A 4N0VA 4WR4A 1QFNA 5HFGA 6GSWA 3WT2A 1FG4A 1SJZA 1PMTA 1DSBA 5F05A 2E2MA 3LORA 2N5FA 5KOWA 3N9JA 3GN3A 3LFLA 1Z7PA 3LWAA 1TK0B 3A2VA 1OAZA 1S3RA 2X8CA 1NHYA 1T1VA 3IHQA 3EC3A 3GSTA 3LXZA 1A0FA 4ISDA 4MDCA 4HZ4A 1Q98A 2H1DA 3PH9A 1SL1B 1A2MA 4RQRA 5ELAA 4FQUA 3TB2A 4MJAA 3FMWA 3HD5A 3ZRDA 3V1WA 2C0GA 4PQIA 3H4KA 3HJPA 4FH8A 4PNGA 2B7KA 4XS1A 1K0CA 4MJEA 4ZB9A 4XIHA 3TRQA 5ID2B 1V40A 1G7EA 4QL7A 1TK5B 1T00A 2H6XA 3KEBA 4PURA 3VFIA 4O32A 4HSCX 1F37A 2AYTA 1ERVA 3H79A 3TKSC 4TXVA 2H1AA 4PXOA 3EU3A 1QQ2A 3UEMA 3L9VA 1ML6A 1OVNA 1BYEA 2YWOA 4LA1A 5DCHA 2D2ZA 2CQ9A 5ECHB 5IOWA 4G19A 3CBUA 1XOAA 4WBRD 5B6MA 4MABA 3KGKA 2DJJA 1GH2A 5F0GA 1X0RA 2H6YA 1HNBA 1H4OA 1GSEA 4V1Ap 3UIWA 2LJKA 1AAZA 2X64A 1XWGA 4DSRA 2H30A 1M3JA 3TRXA 4LL4B 3FZ9A 5CRGA 3M3MA 1LBKA 2HZEB 5A4VA 2FHEA 2HT9A 2FWEA 4YAPA 4JRRA 4Z7XA 4DVCA 3GH6A 4MPFA 5INYA 5LCZA 1WP0A 1TRVA 5LD0A 2MBTA 5ECIB 2OE3A 2DKIA 5IOXA 2JZTA 1WWJA 5KN1A 4ZL8A 3GKNA 3UBLA 3FK8A 2LQOA 3F9UA 1EP7A 3TGZA 3TJBA 5A5KA 5J5NA 3MAKA 2DJ2A 1M2BA 1UA5A 4HZ2A 2LNSA 2HSMA 3H8QA 3ISOA 4I5QA 1OC9A 2C3QA 5ENUA 2L5OA 1FW1A 3GURA 5HFKA 2C80A 4PQHA 5B8AA 4K5RA 3QFAC 1K0NA 3C71A 4D73B 1PGTA 1F3AA 3GA4A 4PNFA 2HRAA 3ZIVA 3ZITA 2N5AA 2FNOA 2K18A 3LXTA 4MZWA 4O5QA 4YH2A 2B5EA 1SYXA 3DXBA 3HA9A 4KGIA 2C3TA 5G2ZA 2VUPA 2MMZA 1R26A 4IELA 4V1Ag 5FHIA 4K9ZA 5DJLA 3MNGA 4BVYA 3U6VA 2C4JA 3I69A 4TN8A 1DUGA 3W6GA 2HLSA 2NDOA 3IRAA 3Q74A 2RM5A 1USBA 3ZZXA 2YNXA 11GSA 2B7JA 1ILOA 2FCHA 1AUCA 1YY7A 2JACA 3JCML 3UAPA 1FO5A 3VPQA 5CRWA 3F63A 2R0GA 4PUFC 1A2LA 1FVKA 1HNCA 1GUMA 2A2SA 2GQLA 1RK4A 4NAXA 4OCEA 4ACSA 4F03A 4KH7A 5J4UA 4ZBAA 1A8YA 1FOVA 1DBYA 4MA9A 4X4JA 4TVEA 3KTBA 2R6KA 3GX8A 1YDKA 5KEJA 7GSSA 2C8UA 2R37A 2C1YA 3NIVA 1JFUA 3TKSA 2FA8A 2ES7A 1JLWA 2JZRA 4OFMA 3O6TA 1MDIA 2HE3A 1WRYA 3R3EA 1VRSD 1KNGA 2V41A 4KE3A 4RI6A 3BCKA 19GSA 2I1UA 3WT1A 3L78A 1YKAA 4EXJA 3HY2A 4DSQA 2ZCTA 1HYUA 1R7HA 1TI3A 2VD0A 1YEXA 3UVHA 5LNKe 2G2QA 4DSSA 4F0CA 1TK8B 3P7XA 2GLRA 2L59A 4KAEA 3M0FA 4MPGA 5DALA 2L57A 2QGVA 3TJFA 2YCDA 1HNAA 1B4QA 5J41A 4J56E 2RUEA 2LUSA 4IHUA 2F9SA 5GSTA 5CRHA 4CDOA 1DE1A 2B5XA 4KNDA 5F07A 3G9BA 1S3CA 1ZYEA 1GTAA 3GKKA 1HD2A 3DRNA 4GTUA 4AJ6A 1FB6A 5J3RA 5CNWA 2B5YA 4G0KA 5D9XA 2Z9SA 4XTSA 1T8EB 2IWTA 3PGTA 4E8EA 3EYTA 4OFNA 5HR1A 4K0NA 3GYKA 2I3YA 3K8NA 4BL7A 1SYRA 2VAFA 1B9XC 4HEA2 2ZNMA 3A2WA 4KDUA 4BVXB 2CAQA 4K0GA 4MCUA 2LKUA 1YF0A 2V6OA 5G5EA 2RM6A 2CV4A 4AGSA 5BRTA 3RDWA 3VWXA 5G1KA 3FZ5A 3WGDA 2GDRA 2H75A 2QKEA 3HVXA 1R4WA 4KSOA 4POBA 4J2FA 3QCPA 2VCWA 2UZ8A 2L6CA 3IHGA 2A4VA 2WB9A 4L0UA 1MD3A 2FWHA 2VLVA 3IK9A 1PA3A 5ECRB 4CY6A 4LMVA 5KN0A 5KN3A 4TR4A 3UOMA 2VM2A 2LQQA 1GLQA 2H1BA 3KMNA 2DMLA 3LYKA 3FY7A 4JU5A 4POMA 2KOKA 2LJRA 3KJYA 2DMMA 3IOSA 3TOTA 2X99A 4I6XA 1YQ1A 5CAXA 1SK1A 3FZ4A 1PKWA 3PINA 2IPAA 4NHZA 5CRDA 3LG6A 1QGVA 2OBKA 3KIJA 5HR2A 4RQXA 1N2AA 4ML1A 2XC2A 4EL1A 4F2IA 4IJ3A 4YQUA 5J9CA 5IPGA 4I8BA 4H86A 3C1RA 1TTZA 1EOGA 2IN3A 5G1LA 3QAWA 1B48A 3RBTA 4EO3A 22GSA 3A5WA 4Z2UA 5F06A 1ZMAA 3ZL5A 3DEXA 1M0UA 1EZKA 1BQ7A 3IV4A 2NBSA 2OACA 4TR1A 4EKZA 1TKDB 2AV4A 2P31A 2J9HA 3VWUA 4J57E 2H0GA 4FYBA 3UJ1A 3QPMA 3GIXA 4L5LA 1KBNA 1C72A 2I4AA 3HDCA 3Q19A 3LYPA 1J9BA 3OR5A 5JWRB 1M9AA 4KCAA 4PGTA 1F9MA 3GFKA 3CQFA 3VWWA 1X9WB 3QD9A 2PWJA 3F6FA 3ZIJA 2KHPA 4IS0A 3IC8A 2GT5A 3PPUA 3VI5A 3CSHA 1BX9A 2VCVA 1TW9A 4F0BA 4AJ8A 2WULA 2M72A 1SK2A 5E4WA 4MF6A 4XRDA 1V2AA 4K1FA 1JZWA 4MJCA 2B1LA 2MMAA 3FEUA 2V2GA 2E0QA 2CX3A 3D4MA 4EUYA 1GWCA 2FWFA 1PQNA 1Z6NA 3LGCA 2AB6A 4BWQA 1LU4A 3L4NA 4HU9A 4I2TA 5B7CA 1XXUA 2DBCA 5B6NA 2WFCA 3P2AA 4K2XA 5HFIA 3ZVJD 3E3EA 3FW2A 4XCSA 1G7OA 1F2EA 3ERFA 3QAGA 2H8LA 4GSTA 2GSRA 3WGEA 3TCOA 2P5QA 2YJHA 4MH3A 1XWKA 2MMOA 2JZSA 1JZRA 1E2YA 1Z5YE 2GQMA 3UMAA 3ZMKA 3EMXA 4OD7A 3FZAA 5ECNB 1IYHA 1XW9A 2AAWA 1U88A 4ZB8A 3R2QA 1AXDA 2CVKA 2WCIA 2A2RA 1FOHA 2H0IA 1FB0A 3W8SA 3KZQA 1EGRA 3IBHA 5DAKA 12GSA 3CSJA 1BEDA 2YN1A 4NV5A 1F6MC 1ERTA 5AISA 1VF2A 2R4VA 2YPMA 2O8VB 1I9DA 1PD21 3HKRA 3MIXA 3TDGA 4BVYB 5G31A 4TR0A 4ZIJA 2EC4A 3GKMA 5GSSA 1NSWA 3QR6A 2JL4A 3CYNA 2DJ1A 3HVVA 4CHSA 3TJKA 3KCMA 3QDNA 2YP6A 4OWYA 3U5RE 3WGXA 2IJYA 4X0XA 4YQMA 4OMVA 1W89A 5ID2A 5GZZB 4FO5A 3QOUA 2JSZA 5ECPB 1HQOA 4NV2A 3CTGA 2WJUA 4ILFA 3P8WA 1AQXA 3H1NA 1VF1A 1GSFA 3LW9A 4I97A 2H01A 5CP1A 1G6YA 4RUVA 3ZVJA 5CREA 2YOIA 3LJRA 2DJ0A 4Q5RA 1G6WA 1NHOA 1SKWB 6GSXA 2IIYA 1GSDA 1V58A 4X1UA 5A4UA 5IIZA 3APQA 4ECCA 1ERWA 1B8XA 2KUCA 1BJXA 1K3LA 4TOPA 3L9SA 3MDKA 2HXKA 1QMVA 2OA7A 3F3RA 1S3AA 2H19A 4CW9A 1O81A 5GAPD 4K6XA 4I2UA 1GNEA 3ED3A 4POLA 2IL3A 3ZMLA 1SKRB 3KD0A 1AQWA 2DLXA 3KM6A 1THOA 6GSVA 4DSSB 1ON4A 5DBQA 1K3YA 1B4PA 2A2PA 4IBPA 2HZEA 3L0HA 5D9WA 4ICYA 3WYWA 2EIOA 2XHFA 5DCGA 3BBYA 1NW2A 2FUG2 1J0FA 1O8WA 2H74A 2F8AA 5EL8A 3M9KA 2R0CA 3BD2A 3CRTA 2H72A 4ZBDA 1XVWA 3IDVA 3EE2A 2E7PA 2DIYA 3GHAA 5JCWA 1TU8A 3C8EA 3FR3A 2HI7A 1TOFA 3G7YA 2OBIA 3ME7A 2YV9A 1I5GA 1TRWA 3CXGA 2BJXA 3RAZA 4IVFA 4KW6A 1K0BA 2CA8A 4LL1B 4TXOA 4F82A 1Y25A 2LS5A 1AIUA 3E9JB 2HRFA 3GNJA 4BIKA 4D73A 1U3AA 1XIYA 5HR0A 4E8HA 1GSQA 5GAND 2WGRA 4L8EA 1M3IA 1DE2A 4IN0A 4G0IA 2PPTA 1PN0A 2HFDA 3D5JA 4TKYA 3DD3A 4G9HA 6GSUA 1Z6MA 3KP8A 4OCFA 5DVBA 4YQVA 3IPZA 2ON7A 4JBBA 4ZXGA 3EWLA 4HI7A 3D21A 2HSHA 1ZL9A 2IFQA 3ZLPA 2V6KA 4P3YB 1ZCPA 3J7Yk 1XZOA 1X9MB 1BAYA 3GTUB 2YV7A 4IP1A 2DJKA 5H5RA 2GZYA 2R3XA 3DVWA 4ZILA 1XWCA 2YJ7A 3IK7A 3FKFA 2R2JA 5IMCA 4KF9A 3D22A 1WMJA 3GRXA 1BG5A 2O89A 9GSSA 5ABRA 1M2AA 3M9JA 3L9UA 4WF4A 2XBIA 2LRNA 2VCTA 6GSTA 4ID0A 4OFTA 1M2DA 2K8VA 1TP9A 2FGXA 5CYYA 2VCZA 2PBJA 2VM1A 4KA0A 1O8XA 3US3A 3GL5A 3HVNA 13GSA 3EPTA 2AUVA 2ALBA 3CRUA 2YZHA 4HDEA 3FRCA 1K0OA 4NMUA 2VD1A 2H66A 1THXA 4WR5A 1WIKA 3D6IA 1JHBA 5D93A 1WPIA 2GSSA 4Q5QA 1A23A 1EP8A 1TJDA 3SWLA 3A2XA 3F0IA 5G30A 1IYIA 5DJMA 2DKHA 3DGQA 4BA7A 17GSA 2LEGA 3HYPA 4ECBA 2NTOA 3J7Yb 3O76A 1M99A 1XWAA 2L6DA 2IMKA 5ECMB 3KH9A 3ZTLA 5JWOB 5A4WA 3TKQA 2RIIA 1PN9A 2IMDA 3LQ7A 5EVOA 2MBSA 2QSIA 5JWQB 4JZQA 4Z2RA 4F9ZA 3CMIA 4TW5A 2CZ2A 1ABAA 1GLPA 1K0AA 1GNWA 4IGJA 3QAVA 2FLSA 4BWSA 3TUEA 2H0HA 2OE1A 1XPVA 2ZUPA 3TKRA 1QK8A 5IO2A 2BMXA 2LTKA 2A4HA 4GCIA 4MLYA 2IMIA 4O7HA 5COHA 4HQSA 1Y6EA 3DVXA 4GQCA 1FVJA 5D96A 1A2JA 2FWGA 3EU4A 2PVOC 2I81A 1XWBA 2PERA 4HUAA 4EC0A 3CSIA 2CAIA 3CTFA 1XBSA 3FHKA 1KEBA 1OKDA 4GSSA 1VGLA 4XRAA 1Q4JA 2TRCP 5HQPA 4K7OA 4G10A 1R5PA 1K0DA 4O92A 1U87A 4OO4A 4WETA 2N5BA 2OE0A 4MNNA 3GUSA 1QUWA 3APOA 4EIQA 2M46A 4HS1A 1SJIA 2VCQA 2LJAA 1Z7RA 1O85A 3MSZA 3A5IA 4XS4A 2MYGA 4MH2A 4AF2A 5B8BA 3AY8A 2QA2A 3HVSA 3I6AA 4L5OA 2YWMA 2C3NA 2VL2C 5DAKB 2P5RA 2OKAA 2VOCA 2PMTA 4JR4A 4KDYA 4PTSA 3IA1A 3FR6A 4ECJA 2B1KA 3F4TA 1EV9A 1TRUA 1V9WA 3Q6OA 4QQ7A 4FYUA 2NVLA 2C0EA 3FYGA 1AQVA 1KTEA 1EEJA 1SD8A 4MP4A 2X4AA 3C7MA 1PKZA 2H76A 2IMFA 3TJJA 1WJKA 4XHMA 5KOXA 3S9FA 1O73A 3EVIA 4KB3A 4G2EA 5IO0A 1ACVA 1H75A 3MWHA 2C0DA 3DYRA 5C00A 4PUAA 3IAM2 4GXZA 4V2NA 1TDIA 2O85A 1MEKA 3WD6A 3UARA 2E2GA 3GSSA 1GUKA 3N5OA 3TKPA 1OC9B 3KP9A 5L71A 2DSAA 1PRXA 6GSSA 3VK9A 3ZYWA 2J23A 4HJ2A 1RW1A 5IMZA 2F51A 3MYDA 4Q5NA 4GSNA 4TRXA 3F8UA 2GT6A 5F8BA 2YWNA 1SL2B 3GL3A 3ZREA 4MF5A 5KN2A 2DJ3A 1XW5A 8GSSA 1JZOA 4WXTA 4DEJA 3KMOA 4GQFA 3ZFBA 1PX7A 2P0GA 3GKXA 1O6JA 1LJRA 1T7PB 2YWIA 1GUHA 3DMLA 2XPEA 3F6DA 2WZ9A 4JR6A 1EOHA 1U6TA 1ZGNA 3P90A 4POKA 3SBCA 5JCUA 1A8LA 3APSA 2M80A 4K7IA 4WF5A 4K2DA 4MZCA 5IMVA 4GRFA 5ECSA 3PR8A 3F4RA 4O5UA 2ON5A 1AW9A 5HR3A 1O7UA 2GSTA 1YEPA 3KH7A 1E6BA 3DKSA 2PGTA 4WKWA 4O5RA 4ZB6A 1OYJA 4X43A 2X49A 4EIPA 3ERGA 4KDXA 2JU5A 1M7TA 4EDYA 2LSTA 2H71A 4NXIA 3NZNA 2MZCA 5DDLA 5D9TA 3D0ZA 2VL9A 5IMAA 1Z9HA 5AGYA 2PN8A 10GSA 1XCCA 1K0MA 1YKCA 1JZDA 2HZFA 2KP2A 4V2LA 5D9VA 4TXOB 4TR3A 4HU7A 3HJOA 3DIEA 2OADA 3RPPA 3TJGA 3M1GA 5E59A 1ZZYA 1MDKA 1B9YC 2VO4A 2X8HA 5J9BA 2MMNA 4N30A 1YF1A 1M9BA 5IQYA 1Z3EA 4MMMA 1ZYPA 4YKFA 1X5DA 3VPTA 1N8JA 1QXHA 2L4QA 5BMUA 4YAVA 2HRKA 4KX4A 5DALB 4V2MA 2CZ3A 2VL2A 3F4SA 3H93A 1URMA 4ECIA 4RI7A 1GL8A 2CT6A 1FAAA 2TIRA 3KXOA 2IFQB 1NM3A 2XPDA 2VLTA 2R5GA 2VIMA 4HQZA 1CQGA 5G5FA 1XW6A 5IMDA 3HCZA 1ST9A 2FD3A 3EMPA 3GH9A 4PQ1A 3GV1A 5DQSA 2H6ZA 4MJBA 2JSYA 18GSA 2GS3A 1GSUA 3RPNA 1X9SB 2K6VA 1MD4A 4JE1A 5IMFA 1SU9A 2IMEA 2RLIA 1TRSA 1JLVA 1YJ6A 4Z2TA 4FYCA 1OC8A 5EPFA 3D4TA 1PL2A 1OE8A 2O7KA 2X8GA 4IJIA 4XS6A 4QL9A 1GTBA 4BL7B 3VI7A 2LV3A 2EIQA 5ECKB 3NOFA 4IP6A 1UN2A 1A24A 4IQAA 3BJ5A 1U3IA 2V32A 4K5SA 4WBJA 2NPBA 2XBQA 2VLUA 1UC7A 3A3TA 3UL3A 1PX6A 1SD9A 5H5SA 1SK0A 4KCEA 2K9FA 3UVTA 1R5AA 4ZL7A 1TU7A 1AC1A 4KSMA 1ZYNA 1W4VA 3E0UA 4N0ZA 4K8MA 2DIZA 4KUNA 1GSYA 5ELGA 3HJMA 3VWVA 1SENA 3IR4A 4WEYA 3HXSA 3IE3A 5D8IA 3GMFA 1CQHA 2VL3A 2HSYA 2RUFA 2G0FA 2L5LA
chains in the Genus database with same CATH topology
2OJLA 3G7IA 1T3BA 2YANA 2WDUA 2HYXA 2EIRA 14GSA 4BPYA 5IM9A 1V98A 2YZUA 4LLRA 3HZ8A 1SL0B 1GTIA 5D73A 5ECLB 3RHBA 4N10A 3I9V2 2CX4A 5AIXA 1VF3A 4OO5A 1OE7A 2F3MA 1FHEA 1K3OA 3QMXA 4MZBA 1WE0A 4NWYA 3ERWA 4AJ7A 4IKHA 3O3TA 2WS2A 1SKSB 4HJMA 3I43A 3LSZA 3IXRA 1GP1A 4G0LA 1MDJA 2PVQA 2K8SA 4USSA 1J08A 1T4YA 1PL1A 2LRTA 2QA1A 4GLTA 2LNTA 2JADA 1UVZA 1VF4A 3FR9A 4YKGA 2KP1A 2REMA 1XVQA 4PX1A 5FWGA 2L4CA 2H1GA 1F3BA 3F3QA 1GULA 2FY6A 3C1SA 2TRXA 3UBKA 4N11A 4TR1B 4LMWA 1ZOFA 4EF0A 2F8FA 1X5CA 3EINA 3BOAA 5H5QA 1PSQA 4K7NA 3IAS2 2GZZA 2GSQA 5C04A 2GTUA 1ERUA 4FIWA 2CVDA 3HHVA 3IC4A 2QC7A 2CVBA 2GVPA 2H70A 2GQKA 1X5EA 4HOJA 4XS4B 3Q18A 3DWVA 20GSA 1TI1A 1EV4A 4GF0A 3GTUA 2DC5A 3TKSE 1MTCA 1XFLA 2PU9C 1G0TA 4CY8A 3EURA 1TXXA 2HNLA 5DQYA 2PUKC 1WOUA 4MK3A 4ML6A 1GSSA 4NHWA 4IW9A 3W8JA 1RQMA 2C0FA 3QFBC 4ZBBA 5ECQB 1T4ZA 3C73A 3ZFLA 3LEFA 1OKTA 5CO3A 3TOUA 1S3DA 4EVMA 2I9HA 3VURA 4A5PA 4L0WA 3ME8A 2R0PA 1ZYQB 4ZL9A 3HZ4A 5AIVA 4EE0A 3RHCA 4GWRA 3G7JA 4ULXA 4Q5FA 2LRCA 3VLNA 3M8NA 2GZPA 2O87A 2FA4A 2GGTA 2KLXA 4IQ1A 3BCIA 16GSA 2H73A 2V1MA 3KTLA 5IPHA 4NPBA 4JEDA 1GTUA 2HRNA 1YZXA 5ECOB 2B6MA 4BVXA 2WRTA 1V57A 2VCXA 5EY6A 1SJ6A 5JCGA 2AJQB 1EEMA 5AN1A 3TRPA 2AHEA 1XOBA 1OC3A 1GRXA 1EGOA 5FT3A 3GX0A 1A0RP 2BTOT 1EWXA 6GSYA 2B3SA 4EDZA 4MF7A 4N0VA 4WR4A 1QFNA 5HFGA 6GSWA 3WT2A 1FG4A 1SJZA 1PMTA 1DSBA 5F05A 2E2MA 3LORA 2N5FA 5KOWA 3N9JA 3GN3A 3LFLA 1Z7PA 3LWAA 1TK0B 3A2VA 1OAZA 2X8CA 1NHYA 1T1VA 3IHQA 3EC3A 3GSTA 3LXZA 1A0FA 4ISDA 4MDCA 4HZ4A 1Q98A 2H1DA 3PH9A 1SL1B 1A2MA 4RQRA 5ELAA 4FQUA 3TB2A 4MJAA 3FMWA 3HD5A 3ZRDA 3V1WA 2C0GA 4PQIA 3H4KA 3HJPA 4FH8A 4PNGA 2B7KA 4XS1A 1K0CA 4MJEA 4ZB9A 4XIHA 3TRQA 5ID2B 1V40A 1G7EA 4QL7A 1TK5B 1T00A 2H6XA 3KEBA 4PURA 3VFIA 4O32A 1F37A 2AYTA 1ERVA 3H79A 3TKSC 4TXVA 2H1AA 4PXOA 3EU3A 1QQ2A 3UEMA 3L9VA 1ML6A 1OVNA 1BYEA 2YWOA 4LA1A 5DCHA 2D2ZA 2CQ9A 5ECHB 5IOWA 4G19A 3CBUA 1XOAA 4WBRD 5B6MA 4MABA 3KGKA 2DJJA 1GH2A 5F0GA 1X0RA 2H6YA 1HNBA 1H4OA 1GSEA 4V1Ap 3UIWA 2LJKA 1AAZA 2X64A 1XWGA 4DSRA 2H30A 3TRXA 4LL4B 3FZ9A 5CRGA 3M3MA 1LBKA 2HZEB 5A4VA 2FHEA 2HT9A 2FWEA 4YAPA 4JRRA 4Z7XA 4DVCA 3GH6A 4MPFA 5INYA 5LCZA 1WP0A 1TRVA 5LD0A 2MBTA 5ECIB 2OE3A 2DKIA 5IOXA 2JZTA 1WWJA 5KN1A 4ZL8A 3GKNA 3UBLA 3FK8A 2LQOA 3F9UA 1EP7A 3TGZA 3TJBA 5A5KA 5J5NA 3MAKA 2DJ2A 1M2BA 1UA5A 4HZ2A 2LNSA 2HSMA 3H8QA 3ISOA 4I5QA 1OC9A 2C3QA 5ENUA 2L5OA 1FW1A 3GURA 5HFKA 2C80A 4PQHA 5B8AA 4K5RA 3QFAC 1K0NA 3C71A 4D73B 1PGTA 1F3AA 3GA4A 4PNFA 2HRAA 3ZIVA 3ZITA 2N5AA 2FNOA 2K18A 3LXTA 4MZWA 4O5QA 4YH2A 2B5EA 1SYXA 3DXBA 3HA9A 4KGIA 2C3TA 5G2ZA 2VUPA 2MMZA 1R26A 4IELA 4V1Ag 5FHIA 4K9ZA 5DJLA 3MNGA 4BVYA 3U6VA 2C4JA 3I69A 4TN8A 1DUGA 3W6GA 2HLSA 2NDOA 3IRAA 3Q74A 2RM5A 1USBA 3ZZXA 2YNXA 11GSA 2B7JA 1ILOA 2FCHA 1AUCA 1YY7A 2JACA 3JCML 3UAPA 1FO5A 3VPQA 5CRWA 3F63A 2R0GA 4PUFC 1A2LA 1FVKA 1HNCA 1GUMA 2A2SA 2GQLA 1RK4A 4NAXA 4OCEA 4ACSA 4F03A 4KH7A 5J4UA 4ZBAA 1A8YA 1FOVA 1DBYA 4MA9A 4X4JA 4TVEA 3KTBA 2R6KA 3GX8A 1YDKA 5KEJA 7GSSA 2C8UA 2R37A 2C1YA 3NIVA 1JFUA 3TKSA 2FA8A 2ES7A 1JLWA 2JZRA 4OFMA 3O6TA 1MDIA 2HE3A 1WRYA 3R3EA 1VRSD 1KNGA 2V41A 4KE3A 4RI6A 3BCKA 19GSA 2I1UA 3WT1A 3L78A 1YKAA 4EXJA 3HY2A 4DSQA 2ZCTA 1HYUA 1R7HA 1TI3A 2VD0A 1YEXA 3UVHA 5LNKe 2G2QA 4DSSA 4F0CA 1TK8B 3P7XA 2GLRA 2L59A 4KAEA 3M0FA 4MPGA 5DALA 2L57A 2QGVA 3TJFA 2YCDA 1HNAA 1B4QA 5J41A 4J56E 2RUEA 2LUSA 4IHUA 2F9SA 5GSTA 5CRHA 4CDOA 1DE1A 2B5XA 4KNDA 5F07A 3G9BA 1S3CA 1ZYEA 1GTAA 3GKKA 1HD2A 3DRNA 4GTUA 4AJ6A 1FB6A 5J3RA 5CNWA 2B5YA 4G0KA 5D9XA 2Z9SA 4XTSA 1T8EB 2IWTA 3PGTA 4E8EA 3EYTA 4OFNA 5HR1A 4K0NA 3GYKA 2I3YA 3K8NA 4BL7A 1SYRA 2VAFA 1B9XC 4HEA2 2ZNMA 3A2WA 4KDUA 4BVXB 2CAQA 4K0GA 4MCUA 2LKUA 1YF0A 2V6OA 5G5EA 2RM6A 2CV4A 4AGSA 5BRTA 3RDWA 3VWXA 5G1KA 3FZ5A 3WGDA 2GDRA 2H75A 2QKEA 3HVXA 1R4WA 4KSOA 4POBA 4J2FA 3QCPA 2VCWA 2UZ8A 2L6CA 3IHGA 2A4VA 2WB9A 4L0UA 1MD3A 2FWHA 2VLVA 3IK9A 1PA3A 5ECRB 4CY6A 4LMVA 5KN0A 5KN3A 4TR4A 3UOMA 2VM2A 2LQQA 1GLQA 2H1BA 3KMNA 2DMLA 3LYKA 3FY7A 4JU5A 4POMA 2KOKA 2LJRA 3KJYA 2DMMA 3IOSA 3TOTA 2X99A 4I6XA 1YQ1A 5CAXA 1SK1A 3FZ4A 1PKWA 3PINA 2IPAA 4NHZA 5CRDA 3LG6A 1QGVA 2OBKA 3KIJA 5HR2A 4RQXA 1N2AA 4ML1A 2XC2A 4EL1A 4F2IA 4IJ3A 4YQUA 5J9CA 5IPGA 4I8BA 4H86A 3C1RA 1TTZA 1EOGA 2IN3A 5G1LA 3QAWA 1B48A 3RBTA 4EO3A 22GSA 3A5WA 4Z2UA 5F06A 1ZMAA 3ZL5A 3DEXA 1M0UA 1EZKA 1BQ7A 3IV4A 2NBSA 2OACA 4TR1A 4EKZA 1TKDB 2AV4A 2P31A 2J9HA 3VWUA 4J57E 2H0GA 4FYBA 3UJ1A 3QPMA 3GIXA 4L5LA 1KBNA 1C72A 2I4AA 3HDCA 3Q19A 3LYPA 1J9BA 3OR5A 5JWRB 1M9AA 4KCAA 4PGTA 1F9MA 3GFKA 3VWWA 1X9WB 3QD9A 2PWJA 3F6FA 3ZIJA 2KHPA 4IS0A 3IC8A 2GT5A 3PPUA 3VI5A 3CSHA 1BX9A 2VCVA 1TW9A 4F0BA 4AJ8A 2WULA 2M72A 1SK2A 5E4WA 4MF6A 4XRDA 1V2AA 4K1FA 1JZWA 4MJCA 2B1LA 2MMAA 3FEUA 2V2GA 2E0QA 2CX3A 3D4MA 4EUYA 1GWCA 2FWFA 1PQNA 1Z6NA 3LGCA 2AB6A 4BWQA 1LU4A 3L4NA 4HU9A 4I2TA 5B7CA 1XXUA 2DBCA 5B6NA 2WFCA 3P2AA 4K2XA 5HFIA 3ZVJD 3E3EA 3FW2A 4XCSA 1G7OA 1F2EA 3ERFA 3QAGA 2H8LA 4GSTA 2GSRA 3WGEA 3TCOA 2P5QA 2YJHA 4MH3A 1XWKA 2MMOA 2JZSA 1JZRA 1E2YA 1Z5YE 2GQMA 3UMAA 3ZMKA 3EMXA 4OD7A 3FZAA 5ECNB 1IYHA 1XW9A 2AAWA 1U88A 4ZB8A 3R2QA 1AXDA 2CVKA 2WCIA 2A2RA 1FOHA 2H0IA 1FB0A 3W8SA 3KZQA 1EGRA 3IBHA 5DAKA 12GSA 3CSJA 1BEDA 2YN1A 4NV5A 1F6MC 1ERTA 5AISA 1VF2A 2R4VA 2YPMA 2O8VB 1I9DA 1PD21 3HKRA 3MIXA 3TDGA 4BVYB 5G31A 4TR0A 4ZIJA 2EC4A 3GKMA 5GSSA 1NSWA 3QR6A 2JL4A 3CYNA 2DJ1A 3HVVA 4CHSA 3TJKA 3KCMA 3QDNA 2YP6A 4OWYA 3U5RE 3WGXA 2IJYA 4X0XA 4YQMA 4OMVA 1W89A 5ID2A 5GZZB 4FO5A 3QOUA 2JSZA 5ECPB 1HQOA 4NV2A 3CTGA 2WJUA 4ILFA 3P8WA 1AQXA 3H1NA 1VF1A 1GSFA 3LW9A 4I97A 2H01A 5CP1A 1G6YA 4RUVA 3ZVJA 5CREA 2YOIA 3LJRA 2DJ0A 4Q5RA 1G6WA 1NHOA 1SKWB 6GSXA 2IIYA 1GSDA 1V58A 4X1UA 5A4UA 5IIZA 3APQA 4ECCA 1ERWA 1B8XA 2KUCA 1BJXA 1K3LA 4TOPA 3L9SA 3MDKA 2HXKA 1QMVA 2OA7A 3F3RA 1S3AA 2H19A 4CW9A 1O81A 5GAPD 4K6XA 4I2UA 1GNEA 3ED3A 4POLA 2IL3A 3ZMLA 1SKRB 3KD0A 1AQWA 2DLXA 3KM6A 1THOA 6GSVA 4DSSB 1ON4A 5DBQA 1K3YA 1B4PA 2A2PA 4IBPA 2HZEA 3L0HA 5D9WA 4ICYA 3WYWA 2EIOA 2XHFA 5DCGA 3BBYA 1NW2A 2FUG2 1J0FA 1O8WA 2H74A 2F8AA 5EL8A 3M9KA 2R0CA 3BD2A 3CRTA 2H72A 4ZBDA 1XVWA 3IDVA 3EE2A 2E7PA 2DIYA 3GHAA 5JCWA 1TU8A 3C8EA 3FR3A 2HI7A 1TOFA 3G7YA 2OBIA 3ME7A 2YV9A 1I5GA 1TRWA 3CXGA 2BJXA 3RAZA 4IVFA 4KW6A 1K0BA 2CA8A 4LL1B 4TXOA 4F82A 1Y25A 2LS5A 1AIUA 3E9JB 2HRFA 3GNJA 4D73A 1U3AA 1XIYA 5HR0A 4E8HA 1GSQA 5GAND 2WGRA 4L8EA 1DE2A 4IN0A 4G0IA 2PPTA 1PN0A 2HFDA 3D5JA 4TKYA 3DD3A 4G9HA 6GSUA 1Z6MA 3KP8A 4OCFA 5DVBA 4YQVA 3IPZA 2ON7A 4JBBA 4ZXGA 3EWLA 4HI7A 3D21A 2HSHA 1ZL9A 2IFQA 3ZLPA 2V6KA 4P3YB 1ZCPA 3J7Yk 1XZOA 1X9MB 1BAYA 3GTUB 2YV7A 4IP1A 2DJKA 5H5RA 2GZYA 2R3XA 3DVWA 4ZILA 1XWCA 2YJ7A 3IK7A 3FKFA 2R2JA 5IMCA 4KF9A 3D22A 1WMJA 3GRXA 1BG5A 2O89A 9GSSA 5ABRA 1M2AA 3M9JA 3L9UA 4WF4A 2XBIA 2LRNA 2VCTA 6GSTA 4ID0A 4OFTA 1M2DA 2K8VA 1TP9A 2FGXA 5CYYA 2VCZA 2PBJA 2VM1A 4KA0A 1O8XA 3US3A 3GL5A 13GSA 3EPTA 2AUVA 2ALBA 3CRUA 2YZHA 4HDEA 3FRCA 1K0OA 4NMUA 2VD1A 2H66A 1THXA 4WR5A 1WIKA 3D6IA 1JHBA 5D93A 1WPIA 2GSSA 4Q5QA 1A23A 1EP8A 1TJDA 3SWLA 3A2XA 3F0IA 5G30A 1IYIA 5DJMA 2DKHA 3DGQA 4BA7A 17GSA 2LEGA 3HYPA 4ECBA 2NTOA 3J7Yb 3O76A 1M99A 1XWAA 2L6DA 2IMKA 5ECMB 3KH9A 3ZTLA 5JWOB 5A4WA 3TKQA 2RIIA 1PN9A 2IMDA 3LQ7A 5EVOA 2MBSA 2QSIA 5JWQB 4JZQA 4Z2RA 4F9ZA 3CMIA 4TW5A 2CZ2A 1ABAA 1GLPA 1K0AA 1GNWA 4IGJA 3QAVA 2FLSA 4BWSA 3TUEA 2H0HA 2OE1A 1XPVA 2ZUPA 3TKRA 1QK8A 5IO2A 2BMXA 2LTKA 2A4HA 4GCIA 4MLYA 2IMIA 4O7HA 5COHA 4HQSA 1Y6EA 3DVXA 4GQCA 1FVJA 5D96A 1A2JA 2FWGA 3EU4A 2PVOC 2I81A 1XWBA 2PERA 4HUAA 4EC0A 3CSIA 2CAIA 3CTFA 1XBSA 3FHKA 1KEBA 1OKDA 4GSSA 1VGLA 4XRAA 1Q4JA 2TRCP 5HQPA 4K7OA 4G10A 1R5PA 1K0DA 4O92A 1U87A 4OO4A 4WETA 2N5BA 2OE0A 4MNNA 3GUSA 1QUWA 3APOA 4EIQA 2M46A 4HS1A 1SJIA 2VCQA 2LJAA 1Z7RA 1O85A 3MSZA 3A5IA 4XS4A 2MYGA 4MH2A 4AF2A 5B8BA 3AY8A 2QA2A 3HVSA 3I6AA 4L5OA 2YWMA 2C3NA 2VL2C 5DAKB 2P5RA 2OKAA 2VOCA 2PMTA 4JR4A 4KDYA 4PTSA 3IA1A 3FR6A 4ECJA 2B1KA 3F4TA 1EV9A 1TRUA 1V9WA 3Q6OA 4QQ7A 4FYUA 2NVLA 2C0EA 3FYGA 1AQVA 1KTEA 1EEJA 1SD8A 4MP4A 2X4AA 3C7MA 1PKZA 2H76A 2IMFA 3TJJA 1WJKA 4XHMA 5KOXA 3S9FA 1O73A 3EVIA 4KB3A 4G2EA 5IO0A 1ACVA 1H75A 3MWHA 2C0DA 3DYRA 5C00A 4PUAA 3IAM2 4GXZA 4V2NA 1TDIA 2O85A 1MEKA 3WD6A 3UARA 2E2GA 3GSSA 1GUKA 3N5OA 3TKPA 1OC9B 3KP9A 5L71A 2DSAA 1PRXA 6GSSA 3VK9A 3ZYWA 2J23A 4HJ2A 1RW1A 5IMZA 2F51A 3MYDA 4Q5NA 4GSNA 4TRXA 3F8UA 2GT6A 5F8BA 2YWNA 1SL2B 3GL3A 3ZREA 4MF5A 5KN2A 2DJ3A 1XW5A 8GSSA 1JZOA 4WXTA 4DEJA 3KMOA 4GQFA 3ZFBA 1PX7A 2P0GA 3GKXA 1O6JA 1LJRA 1T7PB 2YWIA 1GUHA 3DMLA 2XPEA 3F6DA 2WZ9A 4JR6A 1EOHA 1U6TA 1ZGNA 3P90A 4POKA 3SBCA 5JCUA 1A8LA 3APSA 2M80A 4K7IA 4WF5A 4K2DA 4MZCA 5IMVA 4GRFA 5ECSA 3PR8A 3F4RA 4O5UA 2ON5A 1AW9A 5HR3A 1O7UA 2GSTA 1YEPA 3KH7A 1E6BA 3DKSA 2PGTA 4WKWA 4O5RA 4ZB6A 1OYJA 4X43A 2X49A 4EIPA 3ERGA 4KDXA 2JU5A 1M7TA 4EDYA 2LSTA 2H71A 4NXIA 3NZNA 2MZCA 5DDLA 5D9TA 3D0ZA 2VL9A 5IMAA 1Z9HA 5AGYA 2PN8A 10GSA 1XCCA 1K0MA 1YKCA 1JZDA 2HZFA 2KP2A 4V2LA 5D9VA 4TXOB 4TR3A 4HU7A 3HJOA 3DIEA 2OADA 3RPPA 3TJGA 3M1GA 5E59A 1ZZYA 1MDKA 1B9YC 2VO4A 2X8HA 5J9BA 2MMNA 4N30A 1YF1A 1M9BA 5IQYA 1Z3EA 4MMMA 1ZYPA 4YKFA 1X5DA 3VPTA 1N8JA 1QXHA 2L4QA 5BMUA 4YAVA 2HRKA 4KX4A 5DALB 4V2MA 2CZ3A 2VL2A 3F4SA 3H93A 1URMA 4ECIA 4RI7A 1GL8A 2CT6A 1FAAA 2TIRA 3KXOA 2IFQB 1NM3A 2XPDA 2VLTA 2R5GA 2VIMA 4HQZA 1CQGA 5G5FA 1XW6A 5IMDA 3HCZA 1ST9A 2FD3A 3EMPA 3GH9A 4PQ1A 3GV1A 5DQSA 2H6ZA 4MJBA 2JSYA 18GSA 2GS3A 1GSUA 3RPNA 1X9SB 2K6VA 1MD4A 4JE1A 5IMFA 1SU9A 2IMEA 2RLIA 1TRSA 1JLVA 1YJ6A 4Z2TA 4FYCA 1OC8A 5EPFA 3D4TA 1PL2A 1OE8A 2O7KA 2X8GA 4IJIA 4XS6A 4QL9A 1GTBA 4BL7B 3VI7A 2LV3A 2EIQA 5ECKB 3NOFA 4IP6A 1UN2A 1A24A 4IQAA 3BJ5A 1U3IA 2V32A 4K5SA 4WBJA 2NPBA 2XBQA 2VLUA 1UC7A 3A3TA 3UL3A 1PX6A 1SD9A 5H5SA 1SK0A 4KCEA 2K9FA 3UVTA 1R5AA 4ZL7A 1TU7A 1AC1A 4KSMA 1ZYNA 1W4VA 3E0UA 4N0ZA 4K8MA 2DIZA 4KUNA 1GSYA 5ELGA 3HJMA 3VWVA 1SENA 3IR4A 4WEYA 3HXSA 3IE3A 5D8IA 3GMFA 1CQHA 2VL3A 2HSYA 2RUFA 2G0FA 2L5LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OJL A;  3G7I A;  1T3B A;  2YAN A;  2WDU A;  2HYX A;  2EIR A;  14GS A;  4BPY A;  5IM9 A;  1V98 A;  2YZU A;  4LLR A;  3HZ8 A;  1SL0 B;  1GTI A;  5D73 A;  5ECL B;  3RHB A;  4N10 A;  3I9V 2;  2CX4 A;  5AIX A;  1VF3 A;  4OO5 A;  1OE7 A;  2F3M A;  1FHE A;  1K3O A;  3QMX A;  4MZB A;  1WE0 A;  4NWY A;  3ERW A;  4AJ7 A;  4IKH A;  3O3T A;  2WS2 A;  1SKS B;  4HJM A;  3I43 A;  3LSZ A;  3IXR A;  1GP1 A;  1MDJ A;  2PVQ A;  2K8S A;  1J08 A;  1T4Y A;  1PL1 A;  2LRT A;  4GLT A;  2LNT A;  2JAD A;  1UVZ A;  1VF4 A;  3FR9 A;  2KP1 A;  2REM A;  1XVQ A;  4PX1 A;  5FWG A;  2L4C A;  2H1G A;  1F3B A;  3F3Q A;  1GUL A;  2FY6 A;  3C1S A;  2TRX A;  3UBK A;  4N11 A;  4TR1 B;  4LMW A;  1ZOF A;  4EF0 A;  2F8F A;  1X5C A;  3EIN A;  3BOA A;  5H5Q A;  1PSQ A;  4K7N A;  3IAS 2;  2GZZ A;  2GSQ A;  5C04 A;  2GTU A;  1ERU A;  4FIW A;  2CVD A;  3HHV A;  3IC4 A;  2QC7 A;  2CVB A;  2GVP A;  2H70 A;  2GQK A;  1X5E A;  4HOJ A;  4XS4 B;  3Q18 A;  3DWV A;  20GS A;  1TI1 A;  1EV4 A;  4GF0 A;  3GTU A;  2DC5 A;  3TKS E;  1MTC A;  1XFL A;  2PU9 C;  1G0T A;  3EUR A;  1TXX A;  2HNL A;  5DQY A;  2PUK C;  1WOU A;  4MK3 A;  4ML6 A;  1GSS A;  4NHW A;  4IW9 A;  3W8J A;  1RQM A;  2C0F A;  3QFB C;  4ZBB A;  5ECQ B;  1T4Z A;  3C73 A;  3ZFL A;  3LEF A;  1OKT A;  5CO3 A;  3TOU A;  1S3D A;  4EVM A;  2I9H A;  3VUR A;  4L0W A;  3ME8 A;  1ZYQ B;  4ZL9 A;  3HZ4 A;  5AIV A;  4EE0 A;  3RHC A;  4GWR A;  3G7J A;  4ULX A;  4Q5F A;  2LRC A;  3VLN A;  3M8N A;  2GZP A;  2O87 A;  2FA4 A;  2GGT A;  2KLX A;  4IQ1 A;  3BCI A;  16GS A;  2H73 A;  2V1M A;  3KTL A;  5IPH A;  4NPB A;  4JED A;  1GTU A;  2HRN A;  1YZX A;  5ECO B;  2B6M A;  4BVX A;  2WRT A;  1V57 A;  2VCX A;  5EY6 A;  1SJ6 A;  5JCG A;  2AJQ B;  1EEM A;  5AN1 A;  3TRP A;  2AHE A;  1XOB A;  1OC3 A;  1GRX A;  1EGO A;  5FT3 A;  3GX0 A;  1A0R P;  2BTO T;  1EWX A;  6GSY A;  2B3S A;  4EDZ A;  4MF7 A;  4N0V A;  4WR4 A;  1QFN A;  5HFG A;  6GSW A;  3WT2 A;  1FG4 A;  1SJZ A;  1PMT A;  1DSB A;  5F05 A;  2E2M A;  3LOR A;  2N5F A;  3N9J A;  3GN3 A;  3LFL A;  1Z7P A;  3LWA A;  1TK0 B;  3A2V A;  1OAZ A;  2X8C A;  1NHY A;  1T1V A;  3IHQ A;  3EC3 A;  3GST A;  3LXZ A;  1A0F A;  4ISD A;  4MDC A;  4HZ4 A;  1Q98 A;  2H1D A;  3PH9 A;  1SL1 B;  1A2M A;  4RQR A;  5ELA A;  3TB2 A;  4MJA A;  3HD5 A;  3ZRD A;  3V1W A;  2C0G A;  4PQI A;  3H4K A;  3HJP A;  4FH8 A;  4PNG A;  2B7K A;  4XS1 A;  1K0C A;  4MJE A;  4ZB9 A;  4XIH A;  3TRQ A;  5ID2 B;  1V40 A;  1G7E A;  4QL7 A;  1TK5 B;  1T00 A;  2H6X A;  3KEB A;  4PUR A;  3VFI A;  4O32 A;  1F37 A;  2AYT A;  1ERV A;  3H79 A;  3TKS C;  4TXV A;  2H1A A;  4PXO A;  3EU3 A;  1QQ2 A;  3UEM A;  3L9V A;  1ML6 A;  1OVN A;  1BYE A;  2YWO A;  4LA1 A;  5DCH A;  2D2Z A;  2CQ9 A;  5ECH B;  5IOW A;  4G19 A;  3CBU A;  1XOA A;  4WBR D;  5B6M A;  4MAB A;  3KGK A;  2DJJ A;  1GH2 A;  5F0G A;  1X0R A;  2H6Y A;  1HNB A;  1H4O A;  1GSE A;  4V1A p;  3UIW A;  2LJK A;  1AAZ A;  2X64 A;  1XWG A;  4DSR A;  2H30 A;  3TRX A;  4LL4 B;  3FZ9 A;  5CRG A;  3M3M A;  1LBK A;  2HZE B;  5A4V A;  2FHE A;  2HT9 A;  2FWE A;  4YAP A;  4JRR A;  4Z7X A;  4DVC A;  3GH6 A;  4MPF A;  5INY A;  5LCZ A;  1WP0 A;  1TRV A;  5LD0 A;  2MBT A;  5ECI B;  2OE3 A;  5IOX A;  2JZT A;  1WWJ A;  5KN1 A;  4ZL8 A;  3GKN A;  3UBL A;  3FK8 A;  2LQO A;  3F9U A;  1EP7 A;  3TGZ A;  3TJB A;  5A5K A;  5J5N A;  3MAK A;  2DJ2 A;  1M2B A;  1UA5 A;  4HZ2 A;  2LNS A;  3H8Q A;  3ISO A;  4I5Q A;  1OC9 A;  2C3Q A;  5ENU A;  2L5O A;  1FW1 A;  3GUR A;  5HFK A;  2C80 A;  4PQH A;  5B8A A;  3QFA C;  1K0N A;  3C71 A;  4D73 B;  1PGT A;  1F3A A;  3GA4 A;  4PNF A;  3ZIV A;  3ZIT A;  2N5A A;  2FNO A;  2K18 A;  3LXT A;  4MZW A;  4YH2 A;  2B5E A;  1SYX A;  3DXB A;  3HA9 A;  4KGI A;  2C3T A;  5G2Z A;  2VUP A;  2MMZ A;  1R26 A;  4IEL A;  4V1A g;  5FHI A;  4K9Z A;  5DJL A;  3MNG A;  4BVY A;  3U6V A;  2C4J A;  3I69 A;  4TN8 A;  1DUG A;  3W6G A;  2HLS A;  2NDO A;  3IRA A;  3Q74 A;  2RM5 A;  1USB A;  3ZZX A;  2YNX A;  11GS A;  2B7J A;  1ILO A;  2FCH A;  1AUC A;  1YY7 A;  2JAC A;  3JCM L;  3UAP A;  1FO5 A;  3VPQ A;  5CRW A;  3F63 A;  4PUF C;  1A2L A;  1FVK A;  1HNC A;  1GUM A;  2A2S A;  2GQL A;  1RK4 A;  4NAX A;  4OCE A;  4ACS A;  4F03 A;  4KH7 A;  5J4U A;  4ZBA A;  1A8Y A;  1FOV A;  1DBY A;  4MA9 A;  4TVE A;  3KTB A;  2R6K A;  3GX8 A;  1YDK A;  5KEJ A;  7GSS A;  2C8U A;  2R37 A;  2C1Y A;  3NIV A;  1JFU A;  3TKS A;  2FA8 A;  2ES7 A;  1JLW A;  2JZR A;  4OFM A;  3O6T A;  1MDI A;  2HE3 A;  1WRY A;  1VRS D;  1KNG A;  2V41 A;  4KE3 A;  4RI6 A;  3BCK A;  19GS A;  2I1U A;  3WT1 A;  3L78 A;  1YKA A;  4EXJ A;  3HY2 A;  4DSQ A;  2ZCT A;  1HYU A;  1R7H A;  1TI3 A;  2VD0 A;  1YEX A;  3UVH A;  5LNK e;  2G2Q A;  4DSS A;  4F0C A;  1TK8 B;  3P7X A;  2GLR A;  2L59 A;  4KAE A;  3M0F A;  4MPG A;  5DAL A;  2L57 A;  2QGV A;  3TJF A;  2YCD A;  1HNA A;  1B4Q A;  5J41 A;  4J56 E;  2RUE A;  2LUS A;  4IHU A;  2F9S A;  5GST A;  5CRH A;  4CDO A;  1DE1 A;  2B5X A;  4KND A;  5F07 A;  3G9B A;  1S3C A;  1ZYE A;  1GTA A;  3GKK A;  1HD2 A;  3DRN A;  4GTU A;  4AJ6 A;  1FB6 A;  5J3R A;  5CNW A;  2B5Y A;  5D9X A;  2Z9S A;  4XTS A;  1T8E B;  2IWT A;  3PGT A;  4E8E A;  3EYT A;  4OFN A;  5HR1 A;  4K0N A;  3GYK A;  2I3Y A;  3K8N A;  4BL7 A;  1SYR A;  2VAF A;  1B9X C;  4HEA 2;  2ZNM A;  3A2W A;  4KDU A;  2CAQ A;  4K0G A;  4MCU A;  2LKU A;  1YF0 A;  2V6O A;  5G5E A;  2RM6 A;  2CV4 A;  4AGS A;  3RDW A;  3VWX A;  5G1K A;  3FZ5 A;  3WGD A;  2GDR A;  2H75 A;  2QKE A;  3HVX A;  1R4W A;  4KSO A;  4POB A;  4J2F A;  3QCP A;  2VCW A;  2L6C A;  2A4V A;  2WB9 A;  1MD3 A;  2FWH A;  2VLV A;  3IK9 A;  4L0U A;  1PA3 A;  5ECR B;  4LMV A;  5KN0 A;  5KN3 A;  4TR4 A;  3UOM A;  2VM2 A;  2LQQ A;  1GLQ A;  2H1B A;  3KMN A;  2DML A;  3LYK A;  3FY7 A;  4JU5 A;  4POM A;  2KOK A;  2LJR A;  3KJY A;  2DMM A;  3IOS A;  3TOT A;  2X99 A;  4I6X A;  1YQ1 A;  5CAX A;  1SK1 A;  3FZ4 A;  1PKW A;  3PIN A;  2IPA A;  4NHZ A;  5CRD A;  3LG6 A;  1QGV A;  2OBK A;  3KIJ A;  5HR2 A;  4RQX A;  1N2A A;  4ML1 A;  2XC2 A;  4EL1 A;  4F2I A;  4IJ3 A;  4YQU A;  5J9C A;  5IPG A;  4I8B A;  4H86 A;  3C1R A;  1TTZ A;  1EOG A;  2IN3 A;  5G1L A;  3QAW A;  1B48 A;  3RBT A;  4EO3 A;  22GS A;  3A5W A;  5F06 A;  1ZMA A;  3ZL5 A;  3DEX A;  1M0U A;  1EZK A;  1BQ7 A;  3IV4 A;  2NBS A;  2OAC A;  4TR1 A;  4EKZ A;  1TKD B;  2AV4 A;  2P31 A;  2J9H A;  3VWU A;  4J57 E;  2H0G A;  4FYB A;  3UJ1 A;  3QPM A;  3GIX A;  4L5L A;  1KBN A;  1C72 A;  2I4A A;  3HDC A;  3Q19 A;  3LYP A;  1J9B A;  3OR5 A;  5JWR B;  1M9A A;  4KCA A;  4PGT A;  1F9M A;  3GFK A;  3VWW A;  1X9W B;  3QD9 A;  2PWJ A;  3F6F A;  3ZIJ A;  2KHP A;  4IS0 A;  2GT5 A;  3VI5 A;  3CSH A;  1BX9 A;  2VCV A;  1TW9 A;  4F0B A;  4AJ8 A;  2WUL A;  2M72 A;  1SK2 A;  5E4W A;  4MF6 A;  4XRD A;  1V2A A;  4K1F A;  1JZW A;  4MJC A;  2B1L A;  2MMA A;  3FEU A;  2V2G A;  2E0Q A;  2CX3 A;  3D4M A;  4EUY A;  1GWC A;  2FWF A;  1PQN A;  1Z6N A;  3LGC A;  2AB6 A;  4BWQ A;  1LU4 A;  3L4N A;  4HU9 A;  4I2T A;  5B7C A;  1XXU A;  2DBC A;  5B6N A;  2WFC A;  3P2A A;  5HFI A;  3ZVJ D;  3E3E A;  3FW2 A;  4XCS A;  1G7O A;  1F2E A;  3ERF A;  3QAG A;  2H8L A;  4GST A;  2GSR A;  3WGE A;  3TCO A;  2P5Q A;  2YJH A;  4MH3 A;  1XWK A;  2MMO A;  2JZS A;  1JZR A;  1E2Y A;  1Z5Y E;  2GQM A;  3UMA A;  3ZMK A;  3EMX A;  4OD7 A;  3FZA A;  5ECN B;  1IYH A;  1XW9 A;  2AAW A;  1U88 A;  4ZB8 A;  3R2Q A;  1AXD A;  2CVK A;  2WCI A;  2A2R A;  2H0I A;  1FB0 A;  3W8S A;  3KZQ A;  1EGR A;  3IBH A;  5DAK A;  12GS A;  3CSJ A;  1BED A;  2YN1 A;  4NV5 A;  1F6M C;  1ERT A;  5AIS A;  1VF2 A;  2R4V A;  2YPM A;  2O8V B;  1I9D A;  1PD2 1;  3HKR A;  3TDG A;  5G31 A;  4TR0 A;  4ZIJ A;  2EC4 A;  3GKM A;  5GSS A;  1NSW A;  3QR6 A;  2JL4 A;  3CYN A;  2DJ1 A;  3HVV A;  4CHS A;  3TJK A;  3KCM A;  3QDN A;  2YP6 A;  4OWY A;  3U5R E;  3WGX A;  2IJY A;  4X0X A;  4YQM A;  4OMV A;  1W89 A;  5ID2 A;  5GZZ B;  4FO5 A;  3QOU A;  2JSZ A;  5ECP B;  1HQO A;  4NV2 A;  3CTG A;  2WJU A;  4ILF A;  3P8W A;  1AQX A;  3H1N A;  1VF1 A;  1GSF A;  4I97 A;  2H01 A;  5CP1 A;  1G6Y A;  4RUV A;  3ZVJ A;  5CRE A;  2YOI A;  3LJR A;  2DJ0 A;  4Q5R A;  1G6W A;  1NHO A;  1SKW B;  6GSX A;  2IIY A;  1GSD A;  1V58 A;  4X1U A;  5A4U A;  5IIZ A;  3APQ A;  4ECC A;  1ERW A;  1B8X A;  2KUC A;  1BJX A;  1K3L A;  4TOP A;  3L9S A;  3MDK A;  2HXK A;  1QMV A;  2OA7 A;  3F3R A;  1S3A A;  2H19 A;  4CW9 A;  1O81 A;  5GAP D;  4K6X A;  4I2U A;  1GNE A;  3ED3 A;  4POL A;  2IL3 A;  3ZML A;  1SKR B;  3KD0 A;  1AQW A;  2DLX A;  3KM6 A;  1THO A;  6GSV A;  4DSS B;  1ON4 A;  5DBQ A;  1K3Y A;  1B4P A;  4IBP A;  2HZE A;  3L0H A;  5D9W A;  3WYW A;  2EIO A;  2XHF A;  5DCG A;  3BBY A;  1NW2 A;  2FUG 2;  1J0F A;  1O8W A;  2H74 A;  2F8A A;  5EL8 A;  3M9K A;  3BD2 A;  3CRT A;  2H72 A;  4ZBD A;  1XVW A;  3IDV A;  3EE2 A;  2E7P A;  2DIY A;  3GHA A;  5JCW A;  1TU8 A;  3C8E A;  3FR3 A;  2HI7 A;  1TOF A;  3G7Y A;  2OBI A;  3ME7 A;  2YV9 A;  1I5G A;  1TRW A;  3CXG A;  2BJX A;  3RAZ A;  4IVF A;  4KW6 A;  1K0B A;  2CA8 A;  4LL1 B;  4TXO A;  4F82 A;  1Y25 A;  2LS5 A;  1AIU A;  3E9J B;  2HRF A;  3GNJ A;  4D73 A;  1U3A A;  1XIY A;  5HR0 A;  4E8H A;  1GSQ A;  5GAN D;  2WGR A;  4L8E A;  1DE2 A;  4IN0 A;  2PPT A;  2HFD A;  3D5J A;  4TKY A;  3DD3 A;  4G9H A;  6GSU A;  1Z6M A;  3KP8 A;  4OCF A;  5DVB A;  4YQV A;  3IPZ A;  2ON7 A;  4JBB A;  4ZXG A;  3EWL A;  4HI7 A;  3D21 A;  2HSH A;  1ZL9 A;  2IFQ A;  3ZLP A;  2V6K A;  4P3Y B;  1ZCP A;  3J7Y k;  1XZO A;  1X9M B;  1BAY A;  3GTU B;  2YV7 A;  4IP1 A;  2DJK A;  5H5R A;  2GZY A;  2R3X A;  3DVW A;  4ZIL A;  1XWC A;  2YJ7 A;  3IK7 A;  3FKF A;  2R2J A;  5IMC A;  3D22 A;  1WMJ A;  3GRX A;  1BG5 A;  2O89 A;  9GSS A;  5ABR A;  1M2A A;  3M9J A;  3L9U A;  4WF4 A;  2XBI A;  2LRN A;  2VCT A;  6GST A;  4ID0 A;  4OFT A;  1M2D A;  2K8V A;  1TP9 A;  2FGX A;  5CYY A;  2VCZ A;  2PBJ A;  2VM1 A;  4KA0 A;  1O8X A;  3US3 A;  3GL5 A;  13GS A;  2AUV A;  2ALB A;  3CRU A;  2YZH A;  4HDE A;  3FRC A;  1K0O A;  4NMU A;  2VD1 A;  2H66 A;  1THX A;  4WR5 A;  1WIK A;  3D6I A;  1JHB A;  5D93 A;  1WPI A;  2GSS A;  4Q5Q A;  1A23 A;  1EP8 A;  1TJD A;  3SWL A;  3A2X A;  3F0I A;  5G30 A;  1IYI A;  5DJM A;  3DGQ A;  4BA7 A;  17GS A;  2LEG A;  3HYP A;  4ECB A;  2NTO A;  3J7Y b;  3O76 A;  1M99 A;  1XWA A;  2L6D A;  2IMK A;  5ECM B;  3KH9 A;  3ZTL A;  5JWO B;  5A4W A;  3TKQ A;  2RII A;  1PN9 A;  2IMD A;  3LQ7 A;  5EVO A;  2MBS A;  2QSI A;  5JWQ B;  4JZQ A;  4F9Z A;  3CMI A;  4TW5 A;  2CZ2 A;  1ABA A;  1GLP A;  1K0A A;  1GNW A;  4IGJ A;  3QAV A;  2FLS A;  4BWS A;  3TUE A;  2H0H A;  2OE1 A;  1XPV A;  2ZUP A;  3TKR A;  1QK8 A;  5IO2 A;  2BMX A;  2LTK A;  4GCI A;  4MLY A;  2IMI A;  4O7H A;  5COH A;  4HQS A;  1Y6E A;  3DVX A;  4GQC A;  1FVJ A;  5D96 A;  1A2J A;  2FWG A;  3EU4 A;  2PVO C;  2I81 A;  1XWB A;  2PER A;  4HUA A;  4EC0 A;  3CSI A;  2CAI A;  3CTF A;  1XBS A;  3FHK A;  1KEB A;  1OKD A;  4GSS A;  1VGL A;  4XRA A;  1Q4J A;  2TRC P;  5HQP A;  4K7O A;  4G10 A;  1R5P A;  1K0D A;  4O92 A;  1U87 A;  4OO4 A;  4WET A;  2N5B A;  2OE0 A;  3GUS A;  1QUW A;  3APO A;  2M46 A;  4HS1 A;  1SJI A;  2VCQ A;  2LJA A;  1Z7R A;  1O85 A;  3MSZ A;  4XS4 A;  2MYG A;  4MH2 A;  4AF2 A;  5B8B A;  3AY8 A;  3HVS A;  3I6A A;  4L5O A;  2YWM A;  2C3N A;  2VL2 C;  5DAK B;  2P5R A;  2OKA A;  2VOC A;  2PMT A;  4JR4 A;  4KDY A;  3IA1 A;  3FR6 A;  4ECJ A;  2B1K A;  3F4T A;  1EV9 A;  1TRU A;  1V9W A;  3Q6O A;  4QQ7 A;  4FYU A;  2NVL A;  2C0E A;  3FYG A;  1AQV A;  1KTE A;  1EEJ A;  1SD8 A;  4MP4 A;  3C7M A;  1PKZ A;  2H76 A;  2IMF A;  3TJJ A;  1WJK A;  4XHM A;  3S9F A;  1O73 A;  3EVI A;  4KB3 A;  4G2E A;  5IO0 A;  1ACV A;  1H75 A;  3MWH A;  2C0D A;  3DYR A;  5C00 A;  4PUA A;  3IAM 2;  4GXZ A;  4V2N A;  1TDI A;  2O85 A;  1MEK A;  3WD6 A;  3UAR A;  2E2G A;  3GSS A;  1GUK A;  3N5O A;  3TKP A;  1OC9 B;  3KP9 A;  5L71 A;  2DSA A;  1PRX A;  6GSS A;  3VK9 A;  3ZYW A;  2J23 A;  4HJ2 A;  1RW1 A;  5IMZ A;  2F51 A;  4Q5N A;  4GSN A;  4TRX A;  3F8U A;  2GT6 A;  5F8B A;  2YWN A;  1SL2 B;  3GL3 A;  3ZRE A;  4MF5 A;  5KN2 A;  2DJ3 A;  1XW5 A;  8GSS A;  1JZO A;  4WXT A;  4DEJ A;  3KMO A;  4GQF A;  3ZFB A;  1PX7 A;  2P0G A;  3GKX A;  1O6J A;  1LJR A;  1T7P B;  2YWI A;  1GUH A;  3DML A;  2XPE A;  3F6D A;  2WZ9 A;  4JR6 A;  1EOH A;  1U6T A;  1ZGN A;  3P90 A;  4POK A;  3SBC A;  5JCU A;  1A8L A;  3APS A;  2M80 A;  4K7I A;  4WF5 A;  4K2D A;  4MZC A;  5IMV A;  4GRF A;  5ECS A;  3PR8 A;  3F4R A;  2ON5 A;  1AW9 A;  5HR3 A;  1O7U A;  2GST A;  1YEP A;  3KH7 A;  1E6B A;  3DKS A;  2PGT A;  4WKW A;  4O5R A;  4ZB6 A;  1OYJ A;  4X43 A;  3ERG A;  4KDX A;  2JU5 A;  1M7T A;  4EDY A;  2LST A;  2H71 A;  4NXI A;  3NZN A;  2MZC A;  5DDL A;  5D9T A;  3D0Z A;  2VL9 A;  5IMA A;  1Z9H A;  5AGY A;  2PN8 A;  10GS A;  1XCC A;  1K0M A;  1YKC A;  1JZD A;  2HZF A;  2KP2 A;  4V2L A;  5D9V A;  4TXO B;  4TR3 A;  4HU7 A;  3HJO A;  3DIE A;  2OAD A;  3RPP A;  3TJG A;  3M1G A;  5E59 A;  1ZZY A;  1MDK A;  1B9Y C;  2VO4 A;  2X8H A;  5J9B A;  2MMN A;  4N30 A;  1YF1 A;  1M9B A;  5IQY A;  1Z3E A;  4MMM A;  1X5D A;  3VPT A;  1N8J A;  1QXH A;  2L4Q A;  4YAV A;  4KX4 A;  5DAL B;  4V2M A;  2CZ3 A;  2VL2 A;  3F4S A;  3H93 A;  1URM A;  4ECI A;  4RI7 A;  1GL8 A;  2CT6 A;  1FAA A;  2TIR A;  3KXO A;  2IFQ B;  1NM3 A;  2XPD A;  2VLT A;  2R5G A;  2VIM A;  4HQZ A;  1CQG A;  5G5F A;  1XW6 A;  5IMD A;  3HCZ A;  1ST9 A;  2FD3 A;  3EMP A;  3GH9 A;  4PQ1 A;  3GV1 A;  5DQS A;  2H6Z A;  4MJB A;  2JSY A;  18GS A;  2GS3 A;  1GSU A;  3RPN A;  1X9S B;  2K6V A;  1MD4 A;  4JE1 A;  5IMF A;  1SU9 A;  2IME A;  2RLI A;  1TRS A;  1JLV A;  1YJ6 A;  4FYC A;  1OC8 A;  5EPF A;  3D4T A;  1PL2 A;  1OE8 A;  2O7K A;  2X8G A;  4IJI A;  4XS6 A;  4QL9 A;  1GTB A;  3VI7 A;  2LV3 A;  2EIQ A;  5ECK B;  3NOF A;  4IP6 A;  1UN2 A;  1A24 A;  4IQA A;  3BJ5 A;  1U3I A;  2V32 A;  4WBJ A;  2NPB A;  2XBQ A;  2VLU A;  1UC7 A;  3A3T A;  3UL3 A;  1PX6 A;  1SD9 A;  5H5S A;  1SK0 A;  4KCE A;  2K9F A;  3UVT A;  1R5A A;  4ZL7 A;  1TU7 A;  1AC1 A;  4KSM A;  1W4V A;  3E0U A;  4N0Z A;  4K8M A;  2DIZ A;  4KUN A;  1GSY A;  5ELG A;  3HJM A;  3VWV A;  1SEN A;  3IR4 A;  4WEY A;  3HXS A;  3IE3 A;  5D8I A;  3GMF A;  1CQH A;  2VL3 A;  2HSY A;  2RUF A;  2G0F A;  2L5L A; 
#chains in the Genus database with same CATH topology
 2OJL A;  3G7I A;  1T3B A;  2YAN A;  2WDU A;  2HYX A;  2EIR A;  14GS A;  4BPY A;  5IM9 A;  1V98 A;  2YZU A;  4LLR A;  3HZ8 A;  1SL0 B;  1GTI A;  5D73 A;  5ECL B;  3RHB A;  4N10 A;  3I9V 2;  2CX4 A;  5AIX A;  1VF3 A;  4OO5 A;  1OE7 A;  2F3M A;  1FHE A;  1K3O A;  3QMX A;  4MZB A;  1PFO A;  1WE0 A;  4NWY A;  1XG8 A;  3ERW A;  4AJ7 A;  4IKH A;  3O3T A;  2WS2 A;  1SKS B;  4HJM A;  3I43 A;  3LSZ A;  3IXR A;  1GP1 A;  4G0L A;  1MDJ A;  2PVQ A;  2K8S A;  4USS A;  1J08 A;  1T4Y A;  1PL1 A;  2LRT A;  2QA1 A;  4GLT A;  2LNT A;  2JAD A;  1UVZ A;  1VF4 A;  3FR9 A;  4YKG A;  2KP1 A;  2REM A;  1XVQ A;  4PX1 A;  5FWG A;  2L4C A;  2H1G A;  1F3B A;  3F3Q A;  1GUL A;  2FY6 A;  3C1S A;  2TRX A;  3UBK A;  4N11 A;  4TR1 B;  4LMW A;  1ZOF A;  4EF0 A;  2F8F A;  1X5C A;  3EIN A;  3BOA A;  5H5Q A;  1PSQ A;  4K7N A;  3IAS 2;  2GZZ A;  2GSQ A;  5C04 A;  2GTU A;  1ERU A;  4FIW A;  2CVD A;  3HHV A;  3IC4 A;  2QC7 A;  2CVB A;  2GVP A;  2H70 A;  2GQK A;  1X5E A;  4HOJ A;  4XS4 B;  3Q18 A;  3DWV A;  20GS A;  1TI1 A;  1EV4 A;  4GF0 A;  3GTU A;  2DC5 A;  3TKS E;  1MTC A;  1XFL A;  2PU9 C;  1G0T A;  4CY8 A;  3EUR A;  1TXX A;  2HNL A;  5DQY A;  2PUK C;  1WOU A;  4MK3 A;  4ML6 A;  1GSS A;  4NHW A;  4IW9 A;  3W8J A;  1RQM A;  2C0F A;  3QFB C;  4ZBB A;  5ECQ B;  1T4Z A;  3C73 A;  3ZFL A;  3LEF A;  1OKT A;  5CO3 A;  3TOU A;  1S3D A;  4EVM A;  2I9H A;  3VUR A;  4A5P A;  4L0W A;  3ME8 A;  2R0P A;  1ZYQ B;  4ZL9 A;  3HZ4 A;  5AIV A;  4EE0 A;  3RHC A;  4GWR A;  3G7J A;  4ULX A;  4Q5F A;  2LRC A;  3VLN A;  3M8N A;  2GZP A;  2O87 A;  2FA4 A;  2GGT A;  2KLX A;  4IQ1 A;  3BCI A;  16GS A;  2H73 A;  2V1M A;  3KTL A;  5IPH A;  4NPB A;  4JED A;  1GTU A;  2HRN A;  1YZX A;  5ECO B;  2B6M A;  4BVX A;  2WRT A;  1V57 A;  2VCX A;  5EY6 A;  1SJ6 A;  5JCG A;  2AJQ B;  1EEM A;  5AN1 A;  3TRP A;  2AHE A;  1XOB A;  1OC3 A;  1GRX A;  1EGO A;  5FT3 A;  3GX0 A;  1A0R P;  2BTO T;  1EWX A;  6GSY A;  2B3S A;  4EDZ A;  4MF7 A;  4N0V A;  4WR4 A;  1QFN A;  5HFG A;  6GSW A;  3WT2 A;  1FG4 A;  1SJZ A;  1PMT A;  1DSB A;  5F05 A;  2E2M A;  3LOR A;  2N5F A;  5KOW A;  3N9J A;  3GN3 A;  3LFL A;  1Z7P A;  3LWA A;  1TK0 B;  3A2V A;  1OAZ A;  1S3R A;  2X8C A;  1NHY A;  1T1V A;  3IHQ A;  3EC3 A;  3GST A;  3LXZ A;  1A0F A;  4ISD A;  4MDC A;  4HZ4 A;  1Q98 A;  2H1D A;  3PH9 A;  1SL1 B;  1A2M A;  4RQR A;  5ELA A;  4FQU A;  3TB2 A;  4MJA A;  3FMW A;  3HD5 A;  3ZRD A;  3V1W A;  2C0G A;  4PQI A;  3H4K A;  3HJP A;  4FH8 A;  4PNG A;  2B7K A;  4XS1 A;  1K0C A;  4MJE A;  4ZB9 A;  4XIH A;  3TRQ A;  5ID2 B;  1V40 A;  1G7E A;  4QL7 A;  1TK5 B;  1T00 A;  2H6X A;  3KEB A;  4PUR A;  3VFI A;  4O32 A;  4HSC X;  1F37 A;  2AYT A;  1ERV A;  3H79 A;  3TKS C;  4TXV A;  2H1A A;  4PXO A;  3EU3 A;  1QQ2 A;  3UEM A;  3L9V A;  1ML6 A;  1OVN A;  1BYE A;  2YWO A;  4LA1 A;  5DCH A;  2D2Z A;  2CQ9 A;  5ECH B;  5IOW A;  4G19 A;  3CBU A;  1XOA A;  4WBR D;  5B6M A;  4MAB A;  3KGK A;  2DJJ A;  1GH2 A;  5F0G A;  1X0R A;  2H6Y A;  1HNB A;  1H4O A;  1GSE A;  4V1A p;  3UIW A;  2LJK A;  1AAZ A;  2X64 A;  1XWG A;  4DSR A;  2H30 A;  1M3J A;  3TRX A;  4LL4 B;  3FZ9 A;  5CRG A;  3M3M A;  1LBK A;  2HZE B;  5A4V A;  2FHE A;  2HT9 A;  2FWE A;  4YAP A;  4JRR A;  4Z7X A;  4DVC A;  3GH6 A;  4MPF A;  5INY A;  5LCZ A;  1WP0 A;  1TRV A;  5LD0 A;  2MBT A;  5ECI B;  2OE3 A;  2DKI A;  5IOX A;  2JZT A;  1WWJ A;  5KN1 A;  4ZL8 A;  3GKN A;  3UBL A;  3FK8 A;  2LQO A;  3F9U A;  1EP7 A;  3TGZ A;  3TJB A;  5A5K A;  5J5N A;  3MAK A;  2DJ2 A;  1M2B A;  1UA5 A;  4HZ2 A;  2LNS A;  2HSM A;  3H8Q A;  3ISO A;  4I5Q A;  1OC9 A;  2C3Q A;  5ENU A;  2L5O A;  1FW1 A;  3GUR A;  5HFK A;  2C80 A;  4PQH A;  5B8A A;  4K5R A;  3QFA C;  1K0N A;  3C71 A;  4D73 B;  1PGT A;  1F3A A;  3GA4 A;  4PNF A;  2HRA A;  3ZIV A;  3ZIT A;  2N5A A;  2FNO A;  2K18 A;  3LXT A;  4MZW A;  4O5Q A;  4YH2 A;  2B5E A;  1SYX A;  3DXB A;  3HA9 A;  4KGI A;  2C3T A;  5G2Z A;  2VUP A;  2MMZ A;  1R26 A;  4IEL A;  4V1A g;  5FHI A;  4K9Z A;  5DJL A;  3MNG A;  4BVY A;  3U6V A;  2C4J A;  3I69 A;  4TN8 A;  1DUG A;  3W6G A;  2HLS A;  2NDO A;  3IRA A;  3Q74 A;  2RM5 A;  1USB A;  3ZZX A;  2YNX A;  11GS A;  2B7J A;  1ILO A;  2FCH A;  1AUC A;  1YY7 A;  2JAC A;  3JCM L;  3UAP A;  1FO5 A;  3VPQ A;  5CRW A;  3F63 A;  2R0G A;  4PUF C;  1A2L A;  1FVK A;  1HNC A;  1GUM A;  2A2S A;  2GQL A;  1RK4 A;  4NAX A;  4OCE A;  4ACS A;  4F03 A;  4KH7 A;  5J4U A;  4ZBA A;  1A8Y A;  1FOV A;  1DBY A;  4MA9 A;  4X4J A;  4TVE A;  3KTB A;  2R6K A;  3GX8 A;  1YDK A;  5KEJ A;  7GSS A;  2C8U A;  2R37 A;  2C1Y A;  3NIV A;  1JFU A;  3TKS A;  2FA8 A;  2ES7 A;  1JLW A;  2JZR A;  4OFM A;  3O6T A;  1MDI A;  2HE3 A;  1WRY A;  3R3E A;  1VRS D;  1KNG A;  2V41 A;  4KE3 A;  4RI6 A;  3BCK A;  19GS A;  2I1U A;  3WT1 A;  3L78 A;  1YKA A;  4EXJ A;  3HY2 A;  4DSQ A;  2ZCT A;  1HYU A;  1R7H A;  1TI3 A;  2VD0 A;  1YEX A;  3UVH A;  5LNK e;  2G2Q A;  4DSS A;  4F0C A;  1TK8 B;  3P7X A;  2GLR A;  2L59 A;  4KAE A;  3M0F A;  4MPG A;  5DAL A;  2L57 A;  2QGV A;  3TJF A;  2YCD A;  1HNA A;  1B4Q A;  5J41 A;  4J56 E;  2RUE A;  2LUS A;  4IHU A;  2F9S A;  5GST A;  5CRH A;  4CDO A;  1DE1 A;  2B5X A;  4KND A;  5F07 A;  3G9B A;  1S3C A;  1ZYE A;  1GTA A;  3GKK A;  1HD2 A;  3DRN A;  4GTU A;  4AJ6 A;  1FB6 A;  5J3R A;  5CNW A;  2B5Y A;  4G0K A;  5D9X A;  2Z9S A;  4XTS A;  1T8E B;  2IWT A;  3PGT A;  4E8E A;  3EYT A;  4OFN A;  5HR1 A;  4K0N A;  3GYK A;  2I3Y A;  3K8N A;  4BL7 A;  1SYR A;  2VAF A;  1B9X C;  4HEA 2;  2ZNM A;  3A2W A;  4KDU A;  4BVX B;  2CAQ A;  4K0G A;  4MCU A;  2LKU A;  1YF0 A;  2V6O A;  5G5E A;  2RM6 A;  2CV4 A;  4AGS A;  5BRT A;  3RDW A;  3VWX A;  5G1K A;  3FZ5 A;  3WGD A;  2GDR A;  2H75 A;  2QKE A;  3HVX A;  1R4W A;  4KSO A;  4POB A;  4J2F A;  3QCP A;  2VCW A;  2UZ8 A;  2L6C A;  3IHG A;  2A4V A;  2WB9 A;  4L0U A;  1MD3 A;  2FWH A;  2VLV A;  3IK9 A;  1PA3 A;  5ECR B;  4CY6 A;  4LMV A;  5KN0 A;  5KN3 A;  4TR4 A;  3UOM A;  2VM2 A;  2LQQ A;  1GLQ A;  2H1B A;  3KMN A;  2DML A;  3LYK A;  3FY7 A;  4JU5 A;  4POM A;  2KOK A;  2LJR A;  3KJY A;  2DMM A;  3IOS A;  3TOT A;  2X99 A;  4I6X A;  1YQ1 A;  5CAX A;  1SK1 A;  3FZ4 A;  1PKW A;  3PIN A;  2IPA A;  4NHZ A;  5CRD A;  3LG6 A;  1QGV A;  2OBK A;  3KIJ A;  5HR2 A;  4RQX A;  1N2A A;  4ML1 A;  2XC2 A;  4EL1 A;  4F2I A;  4IJ3 A;  4YQU A;  5J9C A;  5IPG A;  4I8B A;  4H86 A;  3C1R A;  1TTZ A;  1EOG A;  2IN3 A;  5G1L A;  3QAW A;  1B48 A;  3RBT A;  4EO3 A;  22GS A;  3A5W A;  4Z2U A;  5F06 A;  1ZMA A;  3ZL5 A;  3DEX A;  1M0U A;  1EZK A;  1BQ7 A;  3IV4 A;  2NBS A;  2OAC A;  4TR1 A;  4EKZ A;  1TKD B;  2AV4 A;  2P31 A;  2J9H A;  3VWU A;  4J57 E;  2H0G A;  4FYB A;  3UJ1 A;  3QPM A;  3GIX A;  4L5L A;  1KBN A;  1C72 A;  2I4A A;  3HDC A;  3Q19 A;  3LYP A;  1J9B A;  3OR5 A;  5JWR B;  1M9A A;  4KCA A;  4PGT A;  1F9M A;  3GFK A;  3CQF A;  3VWW A;  1X9W B;  3QD9 A;  2PWJ A;  3F6F A;  3ZIJ A;  2KHP A;  4IS0 A;  3IC8 A;  2GT5 A;  3PPU A;  3VI5 A;  3CSH A;  1BX9 A;  2VCV A;  1TW9 A;  4F0B A;  4AJ8 A;  2WUL A;  2M72 A;  1SK2 A;  5E4W A;  4MF6 A;  4XRD A;  1V2A A;  4K1F A;  1JZW A;  4MJC A;  2B1L A;  2MMA A;  3FEU A;  2V2G A;  2E0Q A;  2CX3 A;  3D4M A;  4EUY A;  1GWC A;  2FWF A;  1PQN A;  1Z6N A;  3LGC A;  2AB6 A;  4BWQ A;  1LU4 A;  3L4N A;  4HU9 A;  4I2T A;  5B7C A;  1XXU A;  2DBC A;  5B6N A;  2WFC A;  3P2A A;  4K2X A;  5HFI A;  3ZVJ D;  3E3E A;  3FW2 A;  4XCS A;  1G7O A;  1F2E A;  3ERF A;  3QAG A;  2H8L A;  4GST A;  2GSR A;  3WGE A;  3TCO A;  2P5Q A;  2YJH A;  4MH3 A;  1XWK A;  2MMO A;  2JZS A;  1JZR A;  1E2Y A;  1Z5Y E;  2GQM A;  3UMA A;  3ZMK A;  3EMX A;  4OD7 A;  3FZA A;  5ECN B;  1IYH A;  1XW9 A;  2AAW A;  1U88 A;  4ZB8 A;  3R2Q A;  1AXD A;  2CVK A;  2WCI A;  2A2R A;  1FOH A;  2H0I A;  1FB0 A;  3W8S A;  3KZQ A;  1EGR A;  3IBH A;  5DAK A;  12GS A;  3CSJ A;  1BED A;  2YN1 A;  4NV5 A;  1F6M C;  1ERT A;  5AIS A;  1VF2 A;  2R4V A;  2YPM A;  2O8V B;  1I9D A;  1PD2 1;  3HKR A;  3MIX A;  3TDG A;  4BVY B;  5G31 A;  4TR0 A;  4ZIJ A;  2EC4 A;  3GKM A;  5GSS A;  1NSW A;  3QR6 A;  2JL4 A;  3CYN A;  2DJ1 A;  3HVV A;  4CHS A;  3TJK A;  3KCM A;  3QDN A;  2YP6 A;  4OWY A;  3U5R E;  3WGX A;  2IJY A;  4X0X A;  4YQM A;  4OMV A;  1W89 A;  5ID2 A;  5GZZ B;  4FO5 A;  3QOU A;  2JSZ A;  5ECP B;  1HQO A;  4NV2 A;  3CTG A;  2WJU A;  4ILF A;  3P8W A;  1AQX A;  3H1N A;  1VF1 A;  1GSF A;  3LW9 A;  4I97 A;  2H01 A;  5CP1 A;  1G6Y A;  4RUV A;  3ZVJ A;  5CRE A;  2YOI A;  3LJR A;  2DJ0 A;  4Q5R A;  1G6W A;  1NHO A;  1SKW B;  6GSX A;  2IIY A;  1GSD A;  1V58 A;  4X1U A;  5A4U A;  5IIZ A;  3APQ A;  4ECC A;  1ERW A;  1B8X A;  2KUC A;  1BJX A;  1K3L A;  4TOP A;  3L9S A;  3MDK A;  2HXK A;  1QMV A;  2OA7 A;  3F3R A;  1S3A A;  2H19 A;  4CW9 A;  1O81 A;  5GAP D;  4K6X A;  4I2U A;  1GNE A;  3ED3 A;  4POL A;  2IL3 A;  3ZML A;  1SKR B;  3KD0 A;  1AQW A;  2DLX A;  3KM6 A;  1THO A;  6GSV A;  4DSS B;  1ON4 A;  5DBQ A;  1K3Y A;  1B4P A;  2A2P A;  4IBP A;  2HZE A;  3L0H A;  5D9W A;  4ICY A;  3WYW A;  2EIO A;  2XHF A;  5DCG A;  3BBY A;  1NW2 A;  2FUG 2;  1J0F A;  1O8W A;  2H74 A;  2F8A A;  5EL8 A;  3M9K A;  2R0C A;  3BD2 A;  3CRT A;  2H72 A;  4ZBD A;  1XVW A;  3IDV A;  3EE2 A;  2E7P A;  2DIY A;  3GHA A;  5JCW A;  1TU8 A;  3C8E A;  3FR3 A;  2HI7 A;  1TOF A;  3G7Y A;  2OBI A;  3ME7 A;  2YV9 A;  1I5G A;  1TRW A;  3CXG A;  2BJX A;  3RAZ A;  4IVF A;  4KW6 A;  1K0B A;  2CA8 A;  4LL1 B;  4TXO A;  4F82 A;  1Y25 A;  2LS5 A;  1AIU A;  3E9J B;  2HRF A;  3GNJ A;  4BIK A;  4D73 A;  1U3A A;  1XIY A;  5HR0 A;  4E8H A;  1GSQ A;  5GAN D;  2WGR A;  4L8E A;  1M3I A;  1DE2 A;  4IN0 A;  4G0I A;  2PPT A;  1PN0 A;  2HFD A;  3D5J A;  4TKY A;  3DD3 A;  4G9H A;  6GSU A;  1Z6M A;  3KP8 A;  4OCF A;  5DVB A;  4YQV A;  3IPZ A;  2ON7 A;  4JBB A;  4ZXG A;  3EWL A;  4HI7 A;  3D21 A;  2HSH A;  1ZL9 A;  2IFQ A;  3ZLP A;  2V6K A;  4P3Y B;  1ZCP A;  3J7Y k;  1XZO A;  1X9M B;  1BAY A;  3GTU B;  2YV7 A;  4IP1 A;  2DJK A;  5H5R A;  2GZY A;  2R3X A;  3DVW A;  4ZIL A;  1XWC A;  2YJ7 A;  3IK7 A;  3FKF A;  2R2J A;  5IMC A;  4KF9 A;  3D22 A;  1WMJ A;  3GRX A;  1BG5 A;  2O89 A;  9GSS A;  5ABR A;  1M2A A;  3M9J A;  3L9U A;  4WF4 A;  2XBI A;  2LRN A;  2VCT A;  6GST A;  4ID0 A;  4OFT A;  1M2D A;  2K8V A;  1TP9 A;  2FGX A;  5CYY A;  2VCZ A;  2PBJ A;  2VM1 A;  4KA0 A;  1O8X A;  3US3 A;  3GL5 A;  3HVN A;  13GS A;  3EPT A;  2AUV A;  2ALB A;  3CRU A;  2YZH A;  4HDE A;  3FRC A;  1K0O A;  4NMU A;  2VD1 A;  2H66 A;  1THX A;  4WR5 A;  1WIK A;  3D6I A;  1JHB A;  5D93 A;  1WPI A;  2GSS A;  4Q5Q A;  1A23 A;  1EP8 A;  1TJD A;  3SWL A;  3A2X A;  3F0I A;  5G30 A;  1IYI A;  5DJM A;  2DKH A;  3DGQ A;  4BA7 A;  17GS A;  2LEG A;  3HYP A;  4ECB A;  2NTO A;  3J7Y b;  3O76 A;  1M99 A;  1XWA A;  2L6D A;  2IMK A;  5ECM B;  3KH9 A;  3ZTL A;  5JWO B;  5A4W A;  3TKQ A;  2RII A;  1PN9 A;  2IMD A;  3LQ7 A;  5EVO A;  2MBS A;  2QSI A;  5JWQ B;  4JZQ A;  4Z2R A;  4F9Z A;  3CMI A;  4TW5 A;  2CZ2 A;  1ABA A;  1GLP A;  1K0A A;  1GNW A;  4IGJ A;  3QAV A;  2FLS A;  4BWS A;  3TUE A;  2H0H A;  2OE1 A;  1XPV A;  2ZUP A;  3TKR A;  1QK8 A;  5IO2 A;  2BMX A;  2LTK A;  2A4H A;  4GCI A;  4MLY A;  2IMI A;  4O7H A;  5COH A;  4HQS A;  1Y6E A;  3DVX A;  4GQC A;  1FVJ A;  5D96 A;  1A2J A;  2FWG A;  3EU4 A;  2PVO C;  2I81 A;  1XWB A;  2PER A;  4HUA A;  4EC0 A;  3CSI A;  2CAI A;  3CTF A;  1XBS A;  3FHK A;  1KEB A;  1OKD A;  4GSS A;  1VGL A;  4XRA A;  1Q4J A;  2TRC P;  5HQP A;  4K7O A;  4G10 A;  1R5P A;  1K0D A;  4O92 A;  1U87 A;  4OO4 A;  4WET A;  2N5B A;  2OE0 A;  4MNN A;  3GUS A;  1QUW A;  3APO A;  4EIQ A;  2M46 A;  4HS1 A;  1SJI A;  2VCQ A;  2LJA A;  1Z7R A;  1O85 A;  3MSZ A;  3A5I A;  4XS4 A;  2MYG A;  4MH2 A;  4AF2 A;  5B8B A;  3AY8 A;  2QA2 A;  3HVS A;  3I6A A;  4L5O A;  2YWM A;  2C3N A;  2VL2 C;  5DAK B;  2P5R A;  2OKA A;  2VOC A;  2PMT A;  4JR4 A;  4KDY A;  4PTS A;  3IA1 A;  3FR6 A;  4ECJ A;  2B1K A;  3F4T A;  1EV9 A;  1TRU A;  1V9W A;  3Q6O A;  4QQ7 A;  4FYU A;  2NVL A;  2C0E A;  3FYG A;  1AQV A;  1KTE A;  1EEJ A;  1SD8 A;  4MP4 A;  2X4A A;  3C7M A;  1PKZ A;  2H76 A;  2IMF A;  3TJJ A;  1WJK A;  4XHM A;  5KOX A;  3S9F A;  1O73 A;  3EVI A;  4KB3 A;  4G2E A;  5IO0 A;  1ACV A;  1H75 A;  3MWH A;  2C0D A;  3DYR A;  5C00 A;  4PUA A;  3IAM 2;  4GXZ A;  4V2N A;  1TDI A;  2O85 A;  1MEK A;  3WD6 A;  3UAR A;  2E2G A;  3GSS A;  1GUK A;  3N5O A;  3TKP A;  1OC9 B;  3KP9 A;  5L71 A;  2DSA A;  1PRX A;  6GSS A;  3VK9 A;  3ZYW A;  2J23 A;  4HJ2 A;  1RW1 A;  5IMZ A;  2F51 A;  3MYD A;  4Q5N A;  4GSN A;  4TRX A;  3F8U A;  2GT6 A;  5F8B A;  2YWN A;  1SL2 B;  3GL3 A;  3ZRE A;  4MF5 A;  5KN2 A;  2DJ3 A;  1XW5 A;  8GSS A;  1JZO A;  4WXT A;  4DEJ A;  3KMO A;  4GQF A;  3ZFB A;  1PX7 A;  2P0G A;  3GKX A;  1O6J A;  1LJR A;  1T7P B;  2YWI A;  1GUH A;  3DML A;  2XPE A;  3F6D A;  2WZ9 A;  4JR6 A;  1EOH A;  1U6T A;  1ZGN A;  3P90 A;  4POK A;  3SBC A;  5JCU A;  1A8L A;  3APS A;  2M80 A;  4K7I A;  4WF5 A;  4K2D A;  4MZC A;  5IMV A;  4GRF A;  5ECS A;  3PR8 A;  3F4R A;  4O5U A;  2ON5 A;  1AW9 A;  5HR3 A;  1O7U A;  2GST A;  1YEP A;  3KH7 A;  1E6B A;  3DKS A;  2PGT A;  4WKW A;  4O5R A;  4ZB6 A;  1OYJ A;  4X43 A;  2X49 A;  4EIP A;  3ERG A;  4KDX A;  2JU5 A;  1M7T A;  4EDY A;  2LST A;  2H71 A;  4NXI A;  3NZN A;  2MZC A;  5DDL A;  5D9T A;  3D0Z A;  2VL9 A;  5IMA A;  1Z9H A;  5AGY A;  2PN8 A;  10GS A;  1XCC A;  1K0M A;  1YKC A;  1JZD A;  2HZF A;  2KP2 A;  4V2L A;  5D9V A;  4TXO B;  4TR3 A;  4HU7 A;  3HJO A;  3DIE A;  2OAD A;  3RPP A;  3TJG A;  3M1G A;  5E59 A;  1ZZY A;  1MDK A;  1B9Y C;  2VO4 A;  2X8H A;  5J9B A;  2MMN A;  4N30 A;  1YF1 A;  1M9B A;  5IQY A;  1Z3E A;  4MMM A;  1ZYP A;  4YKF A;  1X5D A;  3VPT A;  1N8J A;  1QXH A;  2L4Q A;  5BMU A;  4YAV A;  2HRK A;  4KX4 A;  5DAL B;  4V2M A;  2CZ3 A;  2VL2 A;  3F4S A;  3H93 A;  1URM A;  4ECI A;  4RI7 A;  1GL8 A;  2CT6 A;  1FAA A;  2TIR A;  3KXO A;  2IFQ B;  1NM3 A;  2XPD A;  2VLT A;  2R5G A;  2VIM A;  4HQZ A;  1CQG A;  5G5F A;  1XW6 A;  5IMD A;  3HCZ A;  1ST9 A;  2FD3 A;  3EMP A;  3GH9 A;  4PQ1 A;  3GV1 A;  5DQS A;  2H6Z A;  4MJB A;  2JSY A;  18GS A;  2GS3 A;  1GSU A;  3RPN A;  1X9S B;  2K6V A;  1MD4 A;  4JE1 A;  5IMF A;  1SU9 A;  2IME A;  2RLI A;  1TRS A;  1JLV A;  1YJ6 A;  4Z2T A;  4FYC A;  1OC8 A;  5EPF A;  3D4T A;  1PL2 A;  1OE8 A;  2O7K A;  2X8G A;  4IJI A;  4XS6 A;  4QL9 A;  1GTB A;  4BL7 B;  3VI7 A;  2LV3 A;  2EIQ A;  5ECK B;  3NOF A;  4IP6 A;  1UN2 A;  1A24 A;  4IQA A;  3BJ5 A;  1U3I A;  2V32 A;  4K5S A;  4WBJ A;  2NPB A;  2XBQ A;  2VLU A;  1UC7 A;  3A3T A;  3UL3 A;  1PX6 A;  1SD9 A;  5H5S A;  1SK0 A;  4KCE A;  2K9F A;  3UVT A;  1R5A A;  4ZL7 A;  1TU7 A;  1AC1 A;  4KSM A;  1ZYN A;  1W4V A;  3E0U A;  4N0Z A;  4K8M A;  2DIZ A;  4KUN A;  1GSY A;  5ELG A;  3HJM A;  3VWV A;  1SEN A;  3IR4 A;  4WEY A;  3HXS A;  3IE3 A;  5D8I A;  3GMF A;  1CQH A;  2VL3 A;  2HSY A;  2RUF A;  2G0F A;  2L5L A; 
#chains in the Genus database with same CATH homology
 2OJL A;  3G7I A;  1T3B A;  2YAN A;  2WDU A;  2HYX A;  2EIR A;  14GS A;  4BPY A;  5IM9 A;  1V98 A;  2YZU A;  4LLR A;  3HZ8 A;  1SL0 B;  1GTI A;  5D73 A;  5ECL B;  3RHB A;  4N10 A;  3I9V 2;  2CX4 A;  5AIX A;  1VF3 A;  4OO5 A;  1OE7 A;  2F3M A;  1FHE A;  1K3O A;  3QMX A;  4MZB A;  1WE0 A;  4NWY A;  3ERW A;  4AJ7 A;  4IKH A;  3O3T A;  2WS2 A;  1SKS B;  4HJM A;  3I43 A;  3LSZ A;  3IXR A;  1GP1 A;  4G0L A;  1MDJ A;  2PVQ A;  2K8S A;  4USS A;  1J08 A;  1T4Y A;  1PL1 A;  2LRT A;  2QA1 A;  4GLT A;  2LNT A;  2JAD A;  1UVZ A;  1VF4 A;  3FR9 A;  4YKG A;  2KP1 A;  2REM A;  1XVQ A;  4PX1 A;  5FWG A;  2L4C A;  2H1G A;  1F3B A;  3F3Q A;  1GUL A;  2FY6 A;  3C1S A;  2TRX A;  3UBK A;  4N11 A;  4TR1 B;  4LMW A;  1ZOF A;  4EF0 A;  2F8F A;  1X5C A;  3EIN A;  3BOA A;  5H5Q A;  1PSQ A;  4K7N A;  3IAS 2;  2GZZ A;  2GSQ A;  5C04 A;  2GTU A;  1ERU A;  4FIW A;  2CVD A;  3HHV A;  3IC4 A;  2QC7 A;  2CVB A;  2GVP A;  2H70 A;  2GQK A;  1X5E A;  4HOJ A;  4XS4 B;  3Q18 A;  3DWV A;  20GS A;  1TI1 A;  1EV4 A;  4GF0 A;  3GTU A;  2DC5 A;  3TKS E;  1MTC A;  1XFL A;  2PU9 C;  1G0T A;  4CY8 A;  3EUR A;  1TXX A;  2HNL A;  5DQY A;  2PUK C;  1WOU A;  4MK3 A;  4ML6 A;  1GSS A;  4NHW A;  4IW9 A;  3W8J A;  1RQM A;  2C0F A;  3QFB C;  4ZBB A;  5ECQ B;  1T4Z A;  3C73 A;  3ZFL A;  3LEF A;  1OKT A;  5CO3 A;  3TOU A;  1S3D A;  4EVM A;  2I9H A;  3VUR A;  4A5P A;  4L0W A;  3ME8 A;  2R0P A;  1ZYQ B;  4ZL9 A;  3HZ4 A;  5AIV A;  4EE0 A;  3RHC A;  4GWR A;  3G7J A;  4ULX A;  4Q5F A;  2LRC A;  3VLN A;  3M8N A;  2GZP A;  2O87 A;  2FA4 A;  2GGT A;  2KLX A;  4IQ1 A;  3BCI A;  16GS A;  2H73 A;  2V1M A;  3KTL A;  5IPH A;  4NPB A;  4JED A;  1GTU A;  2HRN A;  1YZX A;  5ECO B;  2B6M A;  4BVX A;  2WRT A;  1V57 A;  2VCX A;  5EY6 A;  1SJ6 A;  5JCG A;  2AJQ B;  1EEM A;  5AN1 A;  3TRP A;  2AHE A;  1XOB A;  1OC3 A;  1GRX A;  1EGO A;  5FT3 A;  3GX0 A;  1A0R P;  2BTO T;  1EWX A;  6GSY A;  2B3S A;  4EDZ A;  4MF7 A;  4N0V A;  4WR4 A;  1QFN A;  5HFG A;  6GSW A;  3WT2 A;  1FG4 A;  1SJZ A;  1PMT A;  1DSB A;  5F05 A;  2E2M A;  3LOR A;  2N5F A;  5KOW A;  3N9J A;  3GN3 A;  3LFL A;  1Z7P A;  3LWA A;  1TK0 B;  3A2V A;  1OAZ A;  2X8C A;  1NHY A;  1T1V A;  3IHQ A;  3EC3 A;  3GST A;  3LXZ A;  1A0F A;  4ISD A;  4MDC A;  4HZ4 A;  1Q98 A;  2H1D A;  3PH9 A;  1SL1 B;  1A2M A;  4RQR A;  5ELA A;  4FQU A;  3TB2 A;  4MJA A;  3FMW A;  3HD5 A;  3ZRD A;  3V1W A;  2C0G A;  4PQI A;  3H4K A;  3HJP A;  4FH8 A;  4PNG A;  2B7K A;  4XS1 A;  1K0C A;  4MJE A;  4ZB9 A;  4XIH A;  3TRQ A;  5ID2 B;  1V40 A;  1G7E A;  4QL7 A;  1TK5 B;  1T00 A;  2H6X A;  3KEB A;  4PUR A;  3VFI A;  4O32 A;  1F37 A;  2AYT A;  1ERV A;  3H79 A;  3TKS C;  4TXV A;  2H1A A;  4PXO A;  3EU3 A;  1QQ2 A;  3UEM A;  3L9V A;  1ML6 A;  1OVN A;  1BYE A;  2YWO A;  4LA1 A;  5DCH A;  2D2Z A;  2CQ9 A;  5ECH B;  5IOW A;  4G19 A;  3CBU A;  1XOA A;  4WBR D;  5B6M A;  4MAB A;  3KGK A;  2DJJ A;  1GH2 A;  5F0G A;  1X0R A;  2H6Y A;  1HNB A;  1H4O A;  1GSE A;  4V1A p;  3UIW A;  2LJK A;  1AAZ A;  2X64 A;  1XWG A;  4DSR A;  2H30 A;  3TRX A;  4LL4 B;  3FZ9 A;  5CRG A;  3M3M A;  1LBK A;  2HZE B;  5A4V A;  2FHE A;  2HT9 A;  2FWE A;  4YAP A;  4JRR A;  4Z7X A;  4DVC A;  3GH6 A;  4MPF A;  5INY A;  5LCZ A;  1WP0 A;  1TRV A;  5LD0 A;  2MBT A;  5ECI B;  2OE3 A;  2DKI A;  5IOX A;  2JZT A;  1WWJ A;  5KN1 A;  4ZL8 A;  3GKN A;  3UBL A;  3FK8 A;  2LQO A;  3F9U A;  1EP7 A;  3TGZ A;  3TJB A;  5A5K A;  5J5N A;  3MAK A;  2DJ2 A;  1M2B A;  1UA5 A;  4HZ2 A;  2LNS A;  2HSM A;  3H8Q A;  3ISO A;  4I5Q A;  1OC9 A;  2C3Q A;  5ENU A;  2L5O A;  1FW1 A;  3GUR A;  5HFK A;  2C80 A;  4PQH A;  5B8A A;  4K5R A;  3QFA C;  1K0N A;  3C71 A;  4D73 B;  1PGT A;  1F3A A;  3GA4 A;  4PNF A;  2HRA A;  3ZIV A;  3ZIT A;  2N5A A;  2FNO A;  2K18 A;  3LXT A;  4MZW A;  4O5Q A;  4YH2 A;  2B5E A;  1SYX A;  3DXB A;  3HA9 A;  4KGI A;  2C3T A;  5G2Z A;  2VUP A;  2MMZ A;  1R26 A;  4IEL A;  4V1A g;  5FHI A;  4K9Z A;  5DJL A;  3MNG A;  4BVY A;  3U6V A;  2C4J A;  3I69 A;  4TN8 A;  1DUG A;  3W6G A;  2HLS A;  2NDO A;  3IRA A;  3Q74 A;  2RM5 A;  1USB A;  3ZZX A;  2YNX A;  11GS A;  2B7J A;  1ILO A;  2FCH A;  1AUC A;  1YY7 A;  2JAC A;  3JCM L;  3UAP A;  1FO5 A;  3VPQ A;  5CRW A;  3F63 A;  2R0G A;  4PUF C;  1A2L A;  1FVK A;  1HNC A;  1GUM A;  2A2S A;  2GQL A;  1RK4 A;  4NAX A;  4OCE A;  4ACS A;  4F03 A;  4KH7 A;  5J4U A;  4ZBA A;  1A8Y A;  1FOV A;  1DBY A;  4MA9 A;  4X4J A;  4TVE A;  3KTB A;  2R6K A;  3GX8 A;  1YDK A;  5KEJ A;  7GSS A;  2C8U A;  2R37 A;  2C1Y A;  3NIV A;  1JFU A;  3TKS A;  2FA8 A;  2ES7 A;  1JLW A;  2JZR A;  4OFM A;  3O6T A;  1MDI A;  2HE3 A;  1WRY A;  3R3E A;  1VRS D;  1KNG A;  2V41 A;  4KE3 A;  4RI6 A;  3BCK A;  19GS A;  2I1U A;  3WT1 A;  3L78 A;  1YKA A;  4EXJ A;  3HY2 A;  4DSQ A;  2ZCT A;  1HYU A;  1R7H A;  1TI3 A;  2VD0 A;  1YEX A;  3UVH A;  5LNK e;  2G2Q A;  4DSS A;  4F0C A;  1TK8 B;  3P7X A;  2GLR A;  2L59 A;  4KAE A;  3M0F A;  4MPG A;  5DAL A;  2L57 A;  2QGV A;  3TJF A;  2YCD A;  1HNA A;  1B4Q A;  5J41 A;  4J56 E;  2RUE A;  2LUS A;  4IHU A;  2F9S A;  5GST A;  5CRH A;  4CDO A;  1DE1 A;  2B5X A;  4KND A;  5F07 A;  3G9B A;  1S3C A;  1ZYE A;  1GTA A;  3GKK A;  1HD2 A;  3DRN A;  4GTU A;  4AJ6 A;  1FB6 A;  5J3R A;  5CNW A;  2B5Y A;  4G0K A;  5D9X A;  2Z9S A;  4XTS A;  1T8E B;  2IWT A;  3PGT A;  4E8E A;  3EYT A;  4OFN A;  5HR1 A;  4K0N A;  3GYK A;  2I3Y A;  3K8N A;  4BL7 A;  1SYR A;  2VAF A;  1B9X C;  4HEA 2;  2ZNM A;  3A2W A;  4KDU A;  4BVX B;  2CAQ A;  4K0G A;  4MCU A;  2LKU A;  1YF0 A;  2V6O A;  5G5E A;  2RM6 A;  2CV4 A;  4AGS A;  5BRT A;  3RDW A;  3VWX A;  5G1K A;  3FZ5 A;  3WGD A;  2GDR A;  2H75 A;  2QKE A;  3HVX A;  1R4W A;  4KSO A;  4POB A;  4J2F A;  3QCP A;  2VCW A;  2UZ8 A;  2L6C A;  3IHG A;  2A4V A;  2WB9 A;  4L0U A;  1MD3 A;  2FWH A;  2VLV A;  3IK9 A;  1PA3 A;  5ECR B;  4CY6 A;  4LMV A;  5KN0 A;  5KN3 A;  4TR4 A;  3UOM A;  2VM2 A;  2LQQ A;  1GLQ A;  2H1B A;  3KMN A;  2DML A;  3LYK A;  3FY7 A;  4JU5 A;  4POM A;  2KOK A;  2LJR A;  3KJY A;  2DMM A;  3IOS A;  3TOT A;  2X99 A;  4I6X A;  1YQ1 A;  5CAX A;  1SK1 A;  3FZ4 A;  1PKW A;  3PIN A;  2IPA A;  4NHZ A;  5CRD A;  3LG6 A;  1QGV A;  2OBK A;  3KIJ A;  5HR2 A;  4RQX A;  1N2A A;  4ML1 A;  2XC2 A;  4EL1 A;  4F2I A;  4IJ3 A;  4YQU A;  5J9C A;  5IPG A;  4I8B A;  4H86 A;  3C1R A;  1TTZ A;  1EOG A;  2IN3 A;  5G1L A;  3QAW A;  1B48 A;  3RBT A;  4EO3 A;  22GS A;  3A5W A;  4Z2U A;  5F06 A;  1ZMA A;  3ZL5 A;  3DEX A;  1M0U A;  1EZK A;  1BQ7 A;  3IV4 A;  2NBS A;  2OAC A;  4TR1 A;  4EKZ A;  1TKD B;  2AV4 A;  2P31 A;  2J9H A;  3VWU A;  4J57 E;  2H0G A;  4FYB A;  3UJ1 A;  3QPM A;  3GIX A;  4L5L A;  1KBN A;  1C72 A;  2I4A A;  3HDC A;  3Q19 A;  3LYP A;  1J9B A;  3OR5 A;  5JWR B;  1M9A A;  4KCA A;  4PGT A;  1F9M A;  3GFK A;  3VWW A;  1X9W B;  3QD9 A;  2PWJ A;  3F6F A;  3ZIJ A;  2KHP A;  4IS0 A;  3IC8 A;  2GT5 A;  3PPU A;  3VI5 A;  3CSH A;  1BX9 A;  2VCV A;  1TW9 A;  4F0B A;  4AJ8 A;  2WUL A;  2M72 A;  1SK2 A;  5E4W A;  4MF6 A;  4XRD A;  1V2A A;  4K1F A;  1JZW A;  4MJC A;  2B1L A;  2MMA A;  3FEU A;  2V2G A;  2E0Q A;  2CX3 A;  3D4M A;  4EUY A;  1GWC A;  2FWF A;  1PQN A;  1Z6N A;  3LGC A;  2AB6 A;  4BWQ A;  1LU4 A;  3L4N A;  4HU9 A;  4I2T A;  5B7C A;  1XXU A;  2DBC A;  5B6N A;  2WFC A;  3P2A A;  4K2X A;  5HFI A;  3ZVJ D;  3E3E A;  3FW2 A;  4XCS A;  1G7O A;  1F2E A;  3ERF A;  3QAG A;  2H8L A;  4GST A;  2GSR A;  3WGE A;  3TCO A;  2P5Q A;  2YJH A;  4MH3 A;  1XWK A;  2MMO A;  2JZS A;  1JZR A;  1E2Y A;  1Z5Y E;  2GQM A;  3UMA A;  3ZMK A;  3EMX A;  4OD7 A;  3FZA A;  5ECN B;  1IYH A;  1XW9 A;  2AAW A;  1U88 A;  4ZB8 A;  3R2Q A;  1AXD A;  2CVK A;  2WCI A;  2A2R A;  1FOH A;  2H0I A;  1FB0 A;  3W8S A;  3KZQ A;  1EGR A;  3IBH A;  5DAK A;  12GS A;  3CSJ A;  1BED A;  2YN1 A;  4NV5 A;  1F6M C;  1ERT A;  5AIS A;  1VF2 A;  2R4V A;  2YPM A;  2O8V B;  1I9D A;  1PD2 1;  3HKR A;  3MIX A;  3TDG A;  4BVY B;  5G31 A;  4TR0 A;  4ZIJ A;  2EC4 A;  3GKM A;  5GSS A;  1NSW A;  3QR6 A;  2JL4 A;  3CYN A;  2DJ1 A;  3HVV A;  4CHS A;  3TJK A;  3KCM A;  3QDN A;  2YP6 A;  4OWY A;  3U5R E;  3WGX A;  2IJY A;  4X0X A;  4YQM A;  4OMV A;  1W89 A;  5ID2 A;  5GZZ B;  4FO5 A;  3QOU A;  2JSZ A;  5ECP B;  1HQO A;  4NV2 A;  3CTG A;  2WJU A;  4ILF A;  3P8W A;  1AQX A;  3H1N A;  1VF1 A;  1GSF A;  3LW9 A;  4I97 A;  2H01 A;  5CP1 A;  1G6Y A;  4RUV A;  3ZVJ A;  5CRE A;  2YOI A;  3LJR A;  2DJ0 A;  4Q5R A;  1G6W A;  1NHO A;  1SKW B;  6GSX A;  2IIY A;  1GSD A;  1V58 A;  4X1U A;  5A4U A;  5IIZ A;  3APQ A;  4ECC A;  1ERW A;  1B8X A;  2KUC A;  1BJX A;  1K3L A;  4TOP A;  3L9S A;  3MDK A;  2HXK A;  1QMV A;  2OA7 A;  3F3R A;  1S3A A;  2H19 A;  4CW9 A;  1O81 A;  5GAP D;  4K6X A;  4I2U A;  1GNE A;  3ED3 A;  4POL A;  2IL3 A;  3ZML A;  1SKR B;  3KD0 A;  1AQW A;  2DLX A;  3KM6 A;  1THO A;  6GSV A;  4DSS B;  1ON4 A;  5DBQ A;  1K3Y A;  1B4P A;  2A2P A;  4IBP A;  2HZE A;  3L0H A;  5D9W A;  4ICY A;  3WYW A;  2EIO A;  2XHF A;  5DCG A;  3BBY A;  1NW2 A;  2FUG 2;  1J0F A;  1O8W A;  2H74 A;  2F8A A;  5EL8 A;  3M9K A;  2R0C A;  3BD2 A;  3CRT A;  2H72 A;  4ZBD A;  1XVW A;  3IDV A;  3EE2 A;  2E7P A;  2DIY A;  3GHA A;  5JCW A;  1TU8 A;  3C8E A;  3FR3 A;  2HI7 A;  1TOF A;  3G7Y A;  2OBI A;  3ME7 A;  2YV9 A;  1I5G A;  1TRW A;  3CXG A;  2BJX A;  3RAZ A;  4IVF A;  4KW6 A;  1K0B A;  2CA8 A;  4LL1 B;  4TXO A;  4F82 A;  1Y25 A;  2LS5 A;  1AIU A;  3E9J B;  2HRF A;  3GNJ A;  4D73 A;  1U3A A;  1XIY A;  5HR0 A;  4E8H A;  1GSQ A;  5GAN D;  2WGR A;  4L8E A;  1DE2 A;  4IN0 A;  4G0I A;  2PPT A;  1PN0 A;  2HFD A;  3D5J A;  4TKY A;  3DD3 A;  4G9H A;  6GSU A;  1Z6M A;  3KP8 A;  4OCF A;  5DVB A;  4YQV A;  3IPZ A;  2ON7 A;  4JBB A;  4ZXG A;  3EWL A;  4HI7 A;  3D21 A;  2HSH A;  1ZL9 A;  2IFQ A;  3ZLP A;  2V6K A;  4P3Y B;  1ZCP A;  3J7Y k;  1XZO A;  1X9M B;  1BAY A;  3GTU B;  2YV7 A;  4IP1 A;  2DJK A;  5H5R A;  2GZY A;  2R3X A;  3DVW A;  4ZIL A;  1XWC A;  2YJ7 A;  3IK7 A;  3FKF A;  2R2J A;  5IMC A;  4KF9 A;  3D22 A;  1WMJ A;  3GRX A;  1BG5 A;  2O89 A;  9GSS A;  5ABR A;  1M2A A;  3M9J A;  3L9U A;  4WF4 A;  2XBI A;  2LRN A;  2VCT A;  6GST A;  4ID0 A;  4OFT A;  1M2D A;  2K8V A;  1TP9 A;  2FGX A;  5CYY A;  2VCZ A;  2PBJ A;  2VM1 A;  4KA0 A;  1O8X A;  3US3 A;  3GL5 A;  13GS A;  3EPT A;  2AUV A;  2ALB A;  3CRU A;  2YZH A;  4HDE A;  3FRC A;  1K0O A;  4NMU A;  2VD1 A;  2H66 A;  1THX A;  4WR5 A;  1WIK A;  3D6I A;  1JHB A;  5D93 A;  1WPI A;  2GSS A;  4Q5Q A;  1A23 A;  1EP8 A;  1TJD A;  3SWL A;  3A2X A;  3F0I A;  5G30 A;  1IYI A;  5DJM A;  2DKH A;  3DGQ A;  4BA7 A;  17GS A;  2LEG A;  3HYP A;  4ECB A;  2NTO A;  3J7Y b;  3O76 A;  1M99 A;  1XWA A;  2L6D A;  2IMK A;  5ECM B;  3KH9 A;  3ZTL A;  5JWO B;  5A4W A;  3TKQ A;  2RII A;  1PN9 A;  2IMD A;  3LQ7 A;  5EVO A;  2MBS A;  2QSI A;  5JWQ B;  4JZQ A;  4Z2R A;  4F9Z A;  3CMI A;  4TW5 A;  2CZ2 A;  1ABA A;  1GLP A;  1K0A A;  1GNW A;  4IGJ A;  3QAV A;  2FLS A;  4BWS A;  3TUE A;  2H0H A;  2OE1 A;  1XPV A;  2ZUP A;  3TKR A;  1QK8 A;  5IO2 A;  2BMX A;  2LTK A;  2A4H A;  4GCI A;  4MLY A;  2IMI A;  4O7H A;  5COH A;  4HQS A;  1Y6E A;  3DVX A;  4GQC A;  1FVJ A;  5D96 A;  1A2J A;  2FWG A;  3EU4 A;  2PVO C;  2I81 A;  1XWB A;  2PER A;  4HUA A;  4EC0 A;  3CSI A;  2CAI A;  3CTF A;  1XBS A;  3FHK A;  1KEB A;  1OKD A;  4GSS A;  1VGL A;  4XRA A;  1Q4J A;  2TRC P;  5HQP A;  4K7O A;  4G10 A;  1R5P A;  1K0D A;  4O92 A;  1U87 A;  4OO4 A;  4WET A;  2N5B A;  2OE0 A;  4MNN A;  3GUS A;  1QUW A;  3APO A;  4EIQ A;  2M46 A;  4HS1 A;  1SJI A;  2VCQ A;  2LJA A;  1Z7R A;  1O85 A;  3MSZ A;  3A5I A;  4XS4 A;  2MYG A;  4MH2 A;  4AF2 A;  5B8B A;  3AY8 A;  2QA2 A;  3HVS A;  3I6A A;  4L5O A;  2YWM A;  2C3N A;  2VL2 C;  5DAK B;  2P5R A;  2OKA A;  2VOC A;  2PMT A;  4JR4 A;  4KDY A;  4PTS A;  3IA1 A;  3FR6 A;  4ECJ A;  2B1K A;  3F4T A;  1EV9 A;  1TRU A;  1V9W A;  3Q6O A;  4QQ7 A;  4FYU A;  2NVL A;  2C0E A;  3FYG A;  1AQV A;  1KTE A;  1EEJ A;  1SD8 A;  4MP4 A;  2X4A A;  3C7M A;  1PKZ A;  2H76 A;  2IMF A;  3TJJ A;  1WJK A;  4XHM A;  5KOX A;  3S9F A;  1O73 A;  3EVI A;  4KB3 A;  4G2E A;  5IO0 A;  1ACV A;  1H75 A;  3MWH A;  2C0D A;  3DYR A;  5C00 A;  4PUA A;  3IAM 2;  4GXZ A;  4V2N A;  1TDI A;  2O85 A;  1MEK A;  3WD6 A;  3UAR A;  2E2G A;  3GSS A;  1GUK A;  3N5O A;  3TKP A;  1OC9 B;  3KP9 A;  5L71 A;  2DSA A;  1PRX A;  6GSS A;  3VK9 A;  3ZYW A;  2J23 A;  4HJ2 A;  1RW1 A;  5IMZ A;  2F51 A;  3MYD A;  4Q5N A;  4GSN A;  4TRX A;  3F8U A;  2GT6 A;  5F8B A;  2YWN A;  1SL2 B;  3GL3 A;  3ZRE A;  4MF5 A;  5KN2 A;  2DJ3 A;  1XW5 A;  8GSS A;  1JZO A;  4WXT A;  4DEJ A;  3KMO A;  4GQF A;  3ZFB A;  1PX7 A;  2P0G A;  3GKX A;  1O6J A;  1LJR A;  1T7P B;  2YWI A;  1GUH A;  3DML A;  2XPE A;  3F6D A;  2WZ9 A;  4JR6 A;  1EOH A;  1U6T A;  1ZGN A;  3P90 A;  4POK A;  3SBC A;  5JCU A;  1A8L A;  3APS A;  2M80 A;  4K7I A;  4WF5 A;  4K2D A;  4MZC A;  5IMV A;  4GRF A;  5ECS A;  3PR8 A;  3F4R A;  4O5U A;  2ON5 A;  1AW9 A;  5HR3 A;  1O7U A;  2GST A;  1YEP A;  3KH7 A;  1E6B A;  3DKS A;  2PGT A;  4WKW A;  4O5R A;  4ZB6 A;  1OYJ A;  4X43 A;  2X49 A;  4EIP A;  3ERG A;  4KDX A;  2JU5 A;  1M7T A;  4EDY A;  2LST A;  2H71 A;  4NXI A;  3NZN A;  2MZC A;  5DDL A;  5D9T A;  3D0Z A;  2VL9 A;  5IMA A;  1Z9H A;  5AGY A;  2PN8 A;  10GS A;  1XCC A;  1K0M A;  1YKC A;  1JZD A;  2HZF A;  2KP2 A;  4V2L A;  5D9V A;  4TXO B;  4TR3 A;  4HU7 A;  3HJO A;  3DIE A;  2OAD A;  3RPP A;  3TJG A;  3M1G A;  5E59 A;  1ZZY A;  1MDK A;  1B9Y C;  2VO4 A;  2X8H A;  5J9B A;  2MMN A;  4N30 A;  1YF1 A;  1M9B A;  5IQY A;  1Z3E A;  4MMM A;  1ZYP A;  4YKF A;  1X5D A;  3VPT A;  1N8J A;  1QXH A;  2L4Q A;  5BMU A;  4YAV A;  2HRK A;  4KX4 A;  5DAL B;  4V2M A;  2CZ3 A;  2VL2 A;  3F4S A;  3H93 A;  1URM A;  4ECI A;  4RI7 A;  1GL8 A;  2CT6 A;  1FAA A;  2TIR A;  3KXO A;  2IFQ B;  1NM3 A;  2XPD A;  2VLT A;  2R5G A;  2VIM A;  4HQZ A;  1CQG A;  5G5F A;  1XW6 A;  5IMD A;  3HCZ A;  1ST9 A;  2FD3 A;  3EMP A;  3GH9 A;  4PQ1 A;  3GV1 A;  5DQS A;  2H6Z A;  4MJB A;  2JSY A;  18GS A;  2GS3 A;  1GSU A;  3RPN A;  1X9S B;  2K6V A;  1MD4 A;  4JE1 A;  5IMF A;  1SU9 A;  2IME A;  2RLI A;  1TRS A;  1JLV A;  1YJ6 A;  4Z2T A;  4FYC A;  1OC8 A;  5EPF A;  3D4T A;  1PL2 A;  1OE8 A;  2O7K A;  2X8G A;  4IJI A;  4XS6 A;  4QL9 A;  1GTB A;  4BL7 B;  3VI7 A;  2LV3 A;  2EIQ A;  5ECK B;  3NOF A;  4IP6 A;  1UN2 A;  1A24 A;  4IQA A;  3BJ5 A;  1U3I A;  2V32 A;  4K5S A;  4WBJ A;  2NPB A;  2XBQ A;  2VLU A;  1UC7 A;  3A3T A;  3UL3 A;  1PX6 A;  1SD9 A;  5H5S A;  1SK0 A;  4KCE A;  2K9F A;  3UVT A;  1R5A A;  4ZL7 A;  1TU7 A;  1AC1 A;  4KSM A;  1ZYN A;  1W4V A;  3E0U A;  4N0Z A;  4K8M A;  2DIZ A;  4KUN A;  1GSY A;  5ELG A;  3HJM A;  3VWV A;  1SEN A;  3IR4 A;  4WEY A;  3HXS A;  3IE3 A;  5D8I A;  3GMF A;  1CQH A;  2VL3 A;  2HSY A;  2RUF A;  2G0F A;  2L5L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...