3ZVJA

Crystal structure of high molecular weight (hmw) form of peroxiredoxin i from schistosoma mansoni
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
165
structure length
165
Chain Sequence
b'MVLLPNRPAPEFKGQAVINGEFKEICLKDYRGKYVVLFFYPADFTFVCPTEIIAFSDQVEEFNSRNCQVIACSTDSQYSHLAWDNLDRKSGGLGHMKIPLLADRKQEISKAYGVFDEEDGNAFRGLFIIDPNGILRQITINDKPVGRSVDETLRLLDAFQFVEKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN PEROXIDASE
publication title Moonlighting by Different Stressors: Crystal Structure of the Chaperone Species of a 2-Cys Peroxiredoxin.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Oxidoreductase
total genus 33
structure length 165
sequence length 165
chains with identical sequence B, C, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3zvjA00
3UEMA 3MSZA 2OE3A 5J4UA 4ECIA 1ZL9A 3QAWA 4KGIA 2PMTA 2C3TA 1PKZA 1SJZA 4OMVA 4IKHA 5KN0A 1BEDA 3C73A 2H6YA 4TR3A 4HZ2A 5JWRB 3C1SA 4TR1A 4XRAA 1TRUA 2HZEB 5ECOB 4ZBBA 2GZZA 2C1YA 2GVPA 2YANA 1THXA 3APQA 1PA3A 3HA9A 5H5QA 1HYUA 3R2QA 2YJHA 2KUCA 3VLNA 2VIMA 1SK2A 3ZTLA 1XOBA 3GUSA 1ZYEA 5IPHA 3P2AA 3G7JA 3GSTA 4DEJA 6GSTA 5HR3A 2CAQA 1JFUA 4F0BA 3IE3A 4IQ1A 4PNGA 1TRWA 2FNOA 4EO3A 3HCZA 1GSDA 3ZFLA 3EVIA 1VGLA 2WZ9A 3CSHA 3QR6A 3ZL5A 4O5RA 1GULA 1VF3A 4HJ2A 5G31A 4ISDA 1XOAA 1XWAA 3HY2A 1WWJA 4V2LA 4Q5RA 4PQIA 1UC7A 1AUCA 1J08A 2B1KA 2H75A 4OFMA 5EVOA 4IP1A 5EPFA 1GSSA 5DBQA 2EIRA 1RK4A 4L5LA 2H1GA 4MK3A 4YAVA 3FZ9A 4PUAA 2IMEA 1TK8B 3GH9A 3A2XA 3L4NA 3ZREA 4RI6A 3W8JA 2FWHA 3OR5A 1OKDA 5HFKA 1EWXA 3F8UA 2I3YA 4PXOA 1TRSA 2OACA 2YP6A 2AV4A 2IWTA 4IHUA 3KZQA 1QK8A 2IFQB 2NBSA 5J3RA 1M99A 1V58A 3GIXA 1ILOA 4CDOA 2MMAA 1U3IA 3TJJA 5IMFA 3HYPA 4WBRD 3G7IA 3IPZA 2HZEA 2FUG2 3A2WA 1A8LA 5HFIA 5F07A 3O76A 1XBSA 5D73A 2RM5A 5ELAA 4ECJA 1GUMA 4HZ4A 1EGOA 1OC9B 2TIRA 1M2BA 1I9DA 3P8WA 2WCIA 5D9TA 1K3YA 1UVZA 3US3A 1R26A 2I1UA 5IOXA 1YEPA 2M46A 2RM6A 1TI3A 3GH6A 4I2UA 1O8XA 5IQYA 3GNJA 4KCEA 4OCEA 3D4TA 2PVOC 3CXGA 1DE1A 2VM1A 2LNTA 1ML6A 3F4SA 1DBYA 3HDCA 1BG5A 4O7HA 3HJOA 6GSXA 5JCGA 5ECKB 2LRTA 5IIZA 1AIUA 2L57A 1LU4A 5DDLA 2YV9A 3H4KA 5DJMA 3BD2A 2WB9A 1F6MC 1PX7A 4XIHA 4ZL9A 4HU7A 2Z9SA 4BWSA 4DSSB 1YJ6A 4X0XA 4EDZA 1SJIA 2AJQB 4MDCA 1XWCA 2IMFA 2H70A 3DRNA 1QFNA 1XVQA 2CZ3A 2KP2A 3GKMA 4MH3A 4AF2A 2V6OA 2H71A 3HZ4A 1V57A 2H6ZA 3WGDA 4BL7A 3PGTA 2GQKA 1T3BA 1Z7RA 4TKYA 2P0GA 4IN0A 1T4ZA 3C1RA 1Z5YE 1S3CA 5HFGA 2AAWA 1G0TA 2WJUA 1AQXA 7GSSA 2RUEA 4LMWA 1XW9A 3IXRA 5B7CA 4EKZA 4MH2A 4WXTA 2TRCP 3LG6A 12GSA 1WE0A 5AIVA 3TJGA 2H8LA 2VL3A 2LNSA 1B4QA 3P7XA 3I43A 3HVSA 2IMIA 2L4QA 1QMVA 1SENA 2ES7A 2AYTA 1GTIA 1U3AA 4KSOA 4EXJA 2GLRA 3I9V2 1DE2A 2WS2A 2HLSA 1FW1A 4ZL8A 5A4VA 2R2JA 1X0RA 2PVQA 3EU3A 3TRQA 4QL9A 4NAXA 2DIZA 3TKQA 1O8WA 2LV3A 2VO4A 4BVYA 3FZ4A 5B6NA 2J23A 3DVXA 3I6AA 3DMLA 1A0FA 2IMKA 4CW9A 1K0AA 1QXHA 1OC3A 3UJ1A 1KTEA 2H76A 4GSTA 2H6XA 4PQ1A 3BJ5A 3CSIA 4K8MA 2NPBA 5KN2A 1B9YC 4QQ7A 2DBCA 2E7PA 1M9BA 1PKWA 4F0CA 3RHCA 1R4WA 6GSUA 2PUKC 1GSYA 4FH8A 4EE0A 1V40A 4JR4A 2DJKA 2PGTA 5JCWA 2QC7A 1F2EA 3WD6A 4HJMA 1GRXA 5EL8A 3QMXA 4MJCA 4GRFA 3IC4A 3UMAA 6GSYA 3A3TA 3FR3A 3IK7A 3HXSA 4FYUA 4MCUA 1B4PA 3RHBA 3NOFA 1TTZA 3E9JB 3GL3A 3H79A 1SL2B 1LJRA 3O3TA 4YQVA 1YKAA 1HNAA 3QDNA 2LJAA 2B5YA 2GQMA 4AJ7A 3E0UA 5GZZB 17GSA 2H1DA 3HHVA 2O87A 5DQYA 3FHKA 3C71A 2ZCTA 3KD0A 10GSA 5F05A 2LRNA 4TR1B 3KP8A 3QAVA 2XBQA 4L0UA 3F63A 2L6DA 2RUFA 8GSSA 3A2VA 5IMAA 1EEMA 5AISA 2CVDA 2FCHA 2H73A 2VUPA 1X5CA 2HFDA 3D5JA 3NZNA 2R5GA 3IBHA 1Y6EA 5CNWA 1OKTA 1QQ2A 1YF0A 3FYGA 2R3XA 1TJDA 1HNCA 1E2YA 4MZCA 5G30A 1KEBA 3WT2A 5ECMB 2E2MA 3WGEA 3LQ7A 4XS6A 1YEXA 1U87A 2YJ7A 3D6IA 1BX9A 1JZOA 4KW6A 4LLRA 1PL2A 1RW1A 1UA5A 1F3AA 1K3OA 2V6KA 1JHBA 1XIYA 5H5RA 2C3NA 4IGJA 5IMVA 2N5FA 2CT6A 3F0IA 4BA7A 2VCXA 5D8IA 3EURA 1SKRB 2JSYA 3GFKA 3ERFA 4IQAA 3FK8A 2YCDA 3EINA 4X43A 4KNDA 4AGSA 5GSSA 2A2SA 4V2NA 2GT5A 5DVBA 2XHFA 4EL1A 2GTUA 4KB3A 4AJ6A 2EIQA 1V9WA 3TOTA 4V1Ap 2N5AA 3IOSA 2IN3A 2C4JA 5CRGA 1MEKA 2FWGA 3WYWA 3UOMA 2VCZA 1B8XA 1SYRA 1A0RP 5FHIA 5KN3A 4MF6A 1WPIA 4ZB9A 3WT1A 2FWEA 1XW5A 3Q74A 1EZKA 1GTUA 1PGTA 2MMOA 2H66A 3GA4A 4ZILA 2FLSA 4EC0A 5DCHA 3KGKA 4TOPA 2H0IA 3TJBA 1GWCA 1WRYA 3APOA 1XVWA 3DXBA 3F6FA 1HD2A 2DJ0A 4YAPA 1EOGA 3QFAC 4I2TA 4IP6A 3EU4A 3ZYWA 4N0ZA 4ZB6A 2FD3A 4JR6A 1SJ6A 4K0NA 4EF0A 1EV4A 1VRSD 3EMXA 3GURA 4JRRA 1MTCA 4TVEA 1Z7PA 4IJIA 1V98A 3EC3A 2CX3A 5ECNB 1BYEA 2E0QA 5J9BA 4WR4A 2OADA 22GSA 2GSQA 2YZHA 3ISOA 4N11A 2LTKA 2GSTA 4ZBDA 4RI7A 4ILFA 3TJKA 2CX4A 3QCPA 5COHA 5ECQB 4LL1B 2GZPA 4V2MA 2C3QA 2X8HA 4MLYA 5IMZA 1THOA 2O7KA 3GRXA 1EP8A 1GH2A 4XS4A 3KJYA 1PQNA 3LSZA 4NV5A 4NWYA 4TN8A 1NSWA 5LD0A 3CBUA 1K0NA 2LJRA 2QGVA 1PRXA 4KX4A 4K7OA 4POKA 4PUFC 3UARA 4GF0A 1XFLA 4XS1A 5ELGA 2JSZA 3ZFBA 1G7EA 3EE2A 2MMNA 3PH9A 2H0GA 2I4AA 2C0GA 2OBKA 1F37A 2E2GA 1A8YA 2VAFA 1H75A 1OE7A 1HQOA 5IM9A 1XWKA 1G6YA 1OC8A 4BPYA 2BJXA 1TRVA 1CQHA 2L59A 2FA8A 3Q6OA 1K0CA 4DSQA 4MZBA 2YN1A 1Z6MA 1W4VA 4J56E 2OA7A 4KA0A 4ZL7A 5GAND 4TXOB 2DJ1A 1EV9A 5IMCA 2YV7A 3TGZA 1K3LA 1GL8A 4ACSA 3BBYA 3HJMA 4F9ZA 3ME8A 2VOCA 1YZXA 4L0WA 1F9MA 3TKSA 5G5FA 3L0HA 4GWRA 4KSMA 3KMOA 1FVKA 5G2ZA 1S3DA 2G2QA 2R37A 1NW2A 2XPEA 3DEXA 4K9ZA 1BAYA 2WRTA 2H1BA 4G10A 1EGRA 3ED3A 3E3EA 1FB6A 2L6CA 5HR0A 5J9CA 1CQGA 1Q4JA 2AUVA 4RQRA 4D73B 4KAEA 3VWXA 1XCCA 2MMZA 3F4TA 3L9UA 1YY7A 4NMUA 3TDGA 2M72A 4MF5A 1JZDA 2HXKA 2PPTA 1EEJA 3TRXA 1K0MA 5J5NA 3D21A 3KH7A 5CYYA 1TK0B 1Q98A 1ZCPA 1SKWB 4J2FA 1PN9A 4GSNA 4WEYA 2H30A 3HZ8A 1GLPA 3C8EA 1K0BA 5F8BA 5ENUA 1J0FA 5CO3A 3NIVA 3EWLA 2X8CA 3CRTA 2H19A 4K1FA 3HJPA 3D22A 1B48A 2O89A 3AY8A 3SBCA 5IOWA 1ERVA 1SK1A 4TXOA 5DJLA 4DVCA 5F06A 4FO5A 5CAXA 4MJEA 1GSQA 4OCFA 3IR4A 4LL4B 2R6KA 4POLA 1ON4A 2ZNMA 2KHPA 2YOIA 3RPNA 3TKSC 2DMLA 2DJ3A 1M7TA 3GTUA 1FB0A 5L71A 2OBIA 1W89A 4OO4A 3UL3A 4I8BA 5HQPA 2OE0A 3DYRA 3BCIA 2HNLA 1O6JA 1GUHA 3JCML 5C00A 2I9HA 5CRHA 4KUNA 3CMIA 2VCTA 3P90A 4K6XA 1AC1A 5HR2A 2LKUA 4OWYA 3HD5A 1GUKA 2XC2A 4GQCA 5B6MA 4D73A 4GSSA 2GS3A 1T1VA 3ZZXA 2QSIA 2OJLA 1A24A 4CHSA 2G0FA 2F8FA 1N8JA 4KCAA 3HKRA 4K0GA 2WFCA 4E8HA 5CRDA 11GSA 2V32A 3A5WA 2JADA 1SK0A 5AIXA 1PSQA 4O32A 2GSRA 3GKNA 3O6TA 4ID0A 3UBLA 5DCGA 2HSHA 5ABRA 3FR6A 3GYKA 2YZUA 1T7PB 2VLVA 2H1AA 4G2EA 3HVXA 3KMNA 1MDJA 1TP9A 1SYXA 1R5AA 3KEBA 3IHQA 2VD1A 2JU5A 1I5GA 20GSA 2IIYA 1FHEA 4RUVA 2REMA 2KP1A 6GSSA 3DGQA 1ZGNA 4MPFA 3ME7A 3DKSA 4N0VA 1YKCA 4G9HA 1HNBA 1VF2A 4L5OA 4PQHA 3H93A 4MZWA 4ML1A 5A5KA 3F3QA 4EDYA 2O8VB 4EUYA 2YWOA 3LWAA 3W8SA 3QFBC 1F3BA 3DWVA 5DQSA 4PGTA 1AXDA 3KXOA 3PR8A 4FYBA 1O85A 1AQWA 3MAKA 4NHWA 4LA1A 2P5QA 2B7KA 4ZXGA 1DSBA 1FO5A 1X5EA 5DAKB 3QOUA 3EMPA 3CYNA 1EP7A 1Y25A 2YNXA 2HRNA 1TW9A 2V41A 3M8NA 2B5XA 2M80A 1ST9A 3QPMA 1T00A 4QL7A 2K8VA 1SD8A 2VM2A 2ALBA 4WBJA 1OAZA 1SL0B 2DJJA 1O7UA 4MA9A 5CP1A 4G19A 1Z3EA 4YQUA 4PNFA 19GSA 1JZRA 2GSSA 5H5SA 1O81A 2HI7A 16GSA 1VF4A 4XS4B 5J41A 2LS5A 1ZOFA 3KTBA 2IMDA 3G7YA 2FY6A 4ZBAA 5ECIB 4PURA 4Q5FA 2GGTA 3F9UA 1K0OA 3KM6A 2H01A 1M0UA 6GSVA 2DSAA 4JEDA 4P3YB 4GQFA 1KNGA 5GSTA 5G1LA 5ID2A 1FG4A 4JE1A 3GL5A 3CTFA 2XPDA 4XHMA 1O73A 4ML6A 3C7MA 1TI1A 3DD3A 3S9FA 2I81A 2JL4A 4OO5A 1T8EB 2VL9A 4TR4A 2FWFA 4F2IA 4WR5A 3FW2A 2DC5A 4JU5A 3SWLA 1YQ1A 4N10A 4IVFA 5B8AA 3KTLA 1U6TA 5B8BA 5FWGA 4JBBA 1AW9A 3FZ5A 5KN1A 1EOHA 4I97A 2KOKA 2L5OA 2K18A 4HEA2 2X64A 5AN1A 2F8AA 1Z9HA 4KDUA 4TW5A 3VWUA 2VCVA 4GXZA 4I5QA 4MF7A 2JZTA 3DIEA 1SU9A 2HT9A 2CZ2A 4X1UA 2PWJA 5DAKA 2ON7A 5FT3A 1JLWA 2B3SA 1FAAA 4IW9A 3GX8A 1SL1B 3GKXA 4IJ3A 4XRDA 3VI7A 3F3RA 1X9WB 4KDXA 4FYCA 4GLTA 2BTOT 1GNEA 1TOFA 3F6DA 3H1NA 3ZIVA 2OKAA 3ZMLA 3IV4A 1XWGA 2RIIA 3MDKA 1QUWA 4OD7A 1G6WA 2F51A 4E8EA 3IK9A 5JCUA 1X9SB 4TXVA 3FR9A 1ZZYA 2ZUPA 3VPQA 3H8QA 3ERWA 2C0EA 3UVHA 1GP1A 2LQOA 1U88A 3FZAA 3BOAA 5HR1A 5ECPB 4HQZA 9GSSA 2X8GA 3KH9A 3VFIA 2RLIA 3GX0A 4POMA 3TOUA 2H72A 2VCWA 1USBA 4NPBA 3RDWA 4ZIJA 5CRWA 1ACVA 2PBJA 3BCKA 1X9MB 2K8SA 4TR0A 2CV4A 2L4CA 5G1KA 2VD0A 2EIOA 2DMMA 3M0FA 2V1MA 4HDEA 2B6MA 1A23A 3FY7A 1MD3A 4XTSA 3RPPA 5IMDA 1ZMAA 3W6GA 4WKWA 2CQ9A 2CVKA 4YQMA 1T4YA 3CRUA 3N5OA 1TK5B 2YWMA 2YWIA 1Z6NA 2IJYA 1V2AA 4Q5QA 4WETA 3CSJA 5IO2A 1AAZA 5D93A 1YF1A 4OFTA 1PD21 3LEFA 3LGCA 4HS1A 4I6XA 3GTUB 3LJRA 4N30A 2R4VA 2L5LA 2FHEA 6GSWA 3QAGA 1WJKA 3KIJA 1TU7A 1FOVA 1GTAA 3TKRA 2JZRA 1A2MA 2FGXA 3LORA 3TKSE 3V1WA 3TJFA 1YDKA 4OFNA 4J57E 4MABA 2A4VA 3VWWA 3M3MA 3K8NA 2GQLA 3GMFA 3ZVJD 2VLTA 4NV2A 4AJ8A 1XPVA 3ERGA 4H86A 4JZQA 1NM3A 4V1Ag 3J7Yk 1PMTA 1A2JA 2H0HA 1GSEA 5DALB 3LFLA 2LJKA 4HUAA 1GLQA 2VL2A 1FVJA 4KDYA 2H74A 2JACA 1E6BA 2MBSA 5INYA 1M2AA 3IA1A 2C0DA 1G7OA 2QKEA 3RBTA 1IYIA 3VK9A 1M2DA 3UIWA 2GT6A 2ON5A 1SD9A 3MWHA 4GCIA 1MDIA 2WGRA 1BQ7A 4HU9A 3VURA 5ECHB 2DIYA 2HYXA 1AQVA 2DJ2A 2XBIA 2YPMA 3IDVA 2IFQA 4MJBA 5G5EA 1JLVA 2GDRA 2C80A 4ULXA 4L8EA 3J7Yb 1KBNA 4NXIA 3GHAA 1LBKA 3TRPA 3ZIJA 4F03A 2JZSA 4K7NA 1R5PA 4TRXA 3GKKA 2AB6A 1WIKA 2DLXA 2VCQA 2D2ZA 3LYKA 3GN3A 2WULA 5JWOB 1N2AA 1OYJA 1OC9A 2OE1A 1R7HA 4NHZA 3UVTA 4ZB8A 4LMVA 2MYGA 1TDIA 1H4OA 1B9XC 1K0DA 3U5RE 4RQXA 1XW6A 2AHEA 4GTUA 2NTOA 13GSA 4ECBA 1TU8A 3IRAA 4HI7A 14GSA 4KH7A 1MD4A 3QD9A 1PL1A 3GSSA 5DALA 5CREA 1GTBA 4XCSA 1OVNA 4DSSA 1ZYQB 1C72A 5ECSA 3TUEA 1A2LA 1WMJA 2VL2C 1JZWA 4IS0A 2LRCA 4Q5NA 2NVLA 1NHYA 4WF5A 2F3MA 1PX6A 3IAS2 5D9XA 4WF4A 3ZLPA 1MDKA 3RAZA 4MPGA 1NHOA 3I69A 4K2DA 2FA4A 4BVXA 4MJAA 18GSA 2IPAA 3UAPA 3WGXA 3M9JA 2GZYA 1IYHA 3F4RA 5LNKe 5IPGA 3N9JA 3TKPA 3DVWA 5A4WA 2MZCA 1DUGA 1ERUA 5ID2B 1S3AA 1URMA 2MBTA 3APSA 4KE3A 2C8UA 4Z7XA 2LQQA 3TB2A 4EVMA 4HOJA 5JWQB 1WOUA 3VPTA 1SKSB 2HRFA 5GAPD 3L9VA 1XZOA 2P31A 1OE8A 2C0FA 2NDOA 3ZRDA 5C04A 2B5EA 2F9SA 4YH2A 2J9HA 2P5RA 1ABAA 1J9BA 3PINA 2X99A 5E4WA 2YWNA 4IELA 3D4MA 3EYTA 4F82A 1QGVA 3LXTA 2WDUA 3ZMKA 2HE3A 2KLXA 3D0ZA 1UN2A 2LUSA 4POBA 1GNWA 5EY6A 2CAIA 1XWBA 4MMMA 1TKDB 3CTGA 4MP4A 4ECCA 1GSFA 5E59A 3L78A 5F0GA 3Q19A 3FKFA 3TCOA 2B7JA 2A2RA 3U6VA 3ZITA 3VWVA 3M9KA 4FIWA 4IBPA 3VI5A 4K7IA 2IL3A 5D9WA 5D96A 5KEJA 4HQSA 2LSTA 3L9SA 1RQMA 1ERWA 3GV1A 3HVVA 2PERA 1X5DA 3LYPA 1VF1A 4BWQA 4O92A 2EC4A 2O85A 2PU9C 2K9FA 1XXUA 3Q18A 1WP0A 2VLUA 5ECLB 2LEGA 1TXXA 3G9BA 5D9VA 1M9AA 5ECRB 4PX1A 4DSRA 3KCMA 3FEUA 3FRCA 3M1GA 1ERTA 5AGYA 3ZVJA 2B1LA 2HZFA 2HSYA 5IO0A 2N5BA 1BJXA 2PN8A 2V2GA 2K6VA 2CA8A 2TRXA 2CVBA 3KP9A 2BMXA 3MNGA 3LXZA 5A4UA 3UBKA 1GSUA 3IAM2 5LCZA
chains in the Genus database with same CATH superfamily
3UEMA 2QA1A 3MSZA 2OE3A 5J4UA 4ECIA 1ZL9A 3QAWA 4KGIA 2PMTA 2C3TA 1PKZA 1SJZA 4OMVA 4IKHA 5KN0A 1BEDA 3C73A 2H6YA 4TR3A 4HZ2A 5JWRB 3C1SA 4TR1A 4XRAA 1TRUA 2HZEB 5ECOB 4ZBBA 2GZZA 2C1YA 2GVPA 2YANA 4Z2UA 1THXA 3APQA 1PA3A 3HA9A 5H5QA 1HYUA 3R2QA 2YJHA 2KUCA 3VLNA 2VIMA 1SK2A 3ZTLA 1XOBA 3GUSA 1ZYEA 5IPHA 3P2AA 3G7JA 2DKIA 3GSTA 4DEJA 6GSTA 5HR3A 2CAQA 1JFUA 4F0BA 3IE3A 4IQ1A 4PNGA 1TRWA 2FNOA 4EO3A 3HCZA 1GSDA 3ZFLA 3EVIA 1VGLA 2WZ9A 3CSHA 3QR6A 3ZL5A 4O5RA 1GULA 1VF3A 4HJ2A 5G31A 1S3RA 4ISDA 1XOAA 1XWAA 3HY2A 1WWJA 4V2LA 4Q5RA 4PQIA 1UC7A 1AUCA 1J08A 2B1KA 2H75A 4OFMA 5EVOA 4IP1A 5EPFA 4PTSA 1GSSA 5DBQA 2EIRA 1RK4A 4L5LA 2H1GA 4MK3A 4YAVA 3FZ9A 4PUAA 2IMEA 1TK8B 3GH9A 3A2XA 3L4NA 3ZREA 4RI6A 3W8JA 2FWHA 3OR5A 1OKDA 5HFKA 1EWXA 3F8UA 2I3YA 4PXOA 1TRSA 2OACA 2YP6A 2AV4A 2IWTA 4IHUA 3KZQA 1QK8A 2IFQB 2NBSA 5J3RA 1M99A 1V58A 3GIXA 1ILOA 4CDOA 2MMAA 1U3IA 3TJJA 5IMFA 3HYPA 4WBRD 3G7IA 3IPZA 2HZEA 2FUG2 3A2WA 1A8LA 5HFIA 5F07A 3O76A 1XBSA 5D73A 2RM5A 5ELAA 4ECJA 1GUMA 4HZ4A 1EGOA 1OC9B 2TIRA 1M2BA 1I9DA 3P8WA 2WCIA 5D9TA 1K3YA 1UVZA 3US3A 1R26A 2I1UA 5IOXA 1YEPA 4Z2RA 2M46A 2RM6A 1TI3A 3GH6A 4I2UA 1O8XA 5IQYA 3GNJA 4KCEA 4OCEA 3D4TA 2PVOC 3CXGA 1DE1A 2VM1A 2LNTA 4EIQA 1ML6A 3F4SA 1DBYA 3HDCA 1BG5A 4O7HA 3HJOA 6GSXA 5JCGA 5ECKB 2LRTA 5IIZA 1AIUA 2L57A 1LU4A 5DDLA 2YV9A 3H4KA 5DJMA 3BD2A 2WB9A 1F6MC 1PX7A 3LW9A 4XIHA 4ZL9A 4HU7A 2Z9SA 4BWSA 4DSSB 4BVYB 1YJ6A 4X0XA 4EDZA 1SJIA 2AJQB 4MDCA 1XWCA 2IMFA 2H70A 3DRNA 1QFNA 1XVQA 2CZ3A 2KP2A 3GKMA 4MH3A 4AF2A 2V6OA 2H71A 3HZ4A 1V57A 2H6ZA 3WGDA 4BL7A 3PGTA 2GQKA 1T3BA 1Z7RA 4TKYA 2P0GA 4IN0A 1T4ZA 3C1RA 1Z5YE 1S3CA 5HFGA 2AAWA 1G0TA 2WJUA 1AQXA 7GSSA 2RUEA 4LMWA 1XW9A 3IXRA 5B7CA 4EKZA 4MH2A 4WXTA 2TRCP 3LG6A 12GSA 1WE0A 5AIVA 3TJGA 2H8LA 2VL3A 2LNSA 1B4QA 3P7XA 3I43A 3HVSA 2IMIA 2L4QA 1QMVA 1SENA 4O5UA 2ES7A 2AYTA 1GTIA 1U3AA 4KSOA 4EXJA 2GLRA 3I9V2 1DE2A 2WS2A 2HLSA 1FW1A 4ZL8A 5A4VA 2R2JA 2A2PA 1X0RA 2PVQA 3EU3A 3TRQA 4QL9A 4NAXA 2DIZA 3TKQA 1O8WA 2LV3A 2VO4A 4BVYA 3FZ4A 5B6NA 2J23A 3DVXA 3I6AA 3DMLA 1A0FA 2IMKA 4CW9A 1K0AA 1QXHA 1OC3A 3UJ1A 1KTEA 2H76A 4GSTA 2H6XA 4PQ1A 3BJ5A 3CSIA 4K8MA 2NPBA 5KN2A 1B9YC 4QQ7A 2DBCA 2E7PA 1M9BA 1PKWA 4F0CA 3RHCA 1R4WA 6GSUA 2PUKC 1GSYA 4FH8A 4EE0A 1V40A 4JR4A 2DJKA 2PGTA 4K5RA 5JCWA 2QC7A 1F2EA 3WD6A 4HJMA 1GRXA 3QMXA 4MJCA 4GRFA 5EL8A 3IC4A 3UMAA 6GSYA 1ZYNA 3A3TA 3FR3A 3IK7A 3HXSA 4FYUA 4MCUA 1B4PA 3RHBA 3NOFA 1TTZA 3E9JB 3GL3A 3H79A 1SL2B 4K2XA 1LJRA 3O3TA 4YQVA 1YKAA 1HNAA 3QDNA 2LJAA 2B5YA 2GQMA 4AJ7A 3E0UA 5GZZB 17GSA 2H1DA 3HHVA 2O87A 5DQYA 3FHKA 3C71A 2ZCTA 3KD0A 10GSA 5F05A 2LRNA 4TR1B 3KP8A 3QAVA 2XBQA 4L0UA 3F63A 2L6DA 2RUFA 8GSSA 3A2VA 5IMAA 1EEMA 5AISA 2CVDA 2FCHA 2H73A 2VUPA 1X5CA 2HFDA 3D5JA 3NZNA 2R5GA 3IBHA 1Y6EA 5CNWA 1OKTA 1QQ2A 1YF0A 3FYGA 2R3XA 1TJDA 1HNCA 1E2YA 4MZCA 5G30A 1KEBA 3WT2A 5ECMB 2E2MA 3WGEA 3LQ7A 4XS6A 1YEXA 1U87A 2YJ7A 3D6IA 1BX9A 1JZOA 4KW6A 4LLRA 1PL2A 1RW1A 1UA5A 1F3AA 1K3OA 2V6KA 1JHBA 1XIYA 5H5RA 2UZ8A 2C3NA 4IGJA 5IMVA 2N5FA 2CT6A 3F0IA 4BA7A 2VCXA 5D8IA 3EURA 1SKRB 2JSYA 3GFKA 3ERFA 4IQAA 3FK8A 2YCDA 3EINA 4X43A 4KNDA 4AGSA 5GSSA 2A2SA 4V2NA 2GT5A 5DVBA 2XHFA 4EL1A 2GTUA 4KB3A 4AJ6A 2EIQA 1V9WA 3TOTA 4V1Ap 2N5AA 3IOSA 2IN3A 2C4JA 5CRGA 1MEKA 2FWGA 3WYWA 3UOMA 2VCZA 1B8XA 1SYRA 1A0RP 5FHIA 5KN3A 4MF6A 1WPIA 4ZB9A 3WT1A 2FWEA 1XW5A 3Q74A 1EZKA 1GTUA 1PGTA 2MMOA 2H66A 3GA4A 4ZILA 2FLSA 4EC0A 5DCHA 3KGKA 4TOPA 2H0IA 3TJBA 1GWCA 1WRYA 3APOA 1XVWA 3DXBA 3F6FA 1HD2A 2DJ0A 4YAPA 1EOGA 3QFAC 4I2TA 4IP6A 3EU4A 3ZYWA 4N0ZA 2HRKA 4ZB6A 2FD3A 4JR6A 1SJ6A 4K0NA 4EF0A 1EV4A 1VRSD 3EMXA 3GURA 4JRRA 1MTCA 4TVEA 2A4HA 1Z7PA 4IJIA 1V98A 3EC3A 2CX3A 5ECNB 1BYEA 2E0QA 5J9BA 4WR4A 2OADA 22GSA 2GSQA 2YZHA 3ISOA 4N11A 2LTKA 2GSTA 4ZBDA 4RI7A 4ILFA 4USSA 3TJKA 2CX4A 3QCPA 5COHA 5ECQB 4LL1B 2GZPA 4V2MA 2C3QA 2X8HA 4MLYA 5IMZA 1THOA 2O7KA 3GRXA 1EP8A 1GH2A 4XS4A 3KJYA 1PQNA 3LSZA 4NV5A 4NWYA 4TN8A 1NSWA 5LD0A 3CBUA 1K0NA 2LJRA 2QGVA 1PRXA 4KX4A 4K7OA 4POKA 4PUFC 3UARA 4GF0A 4G0LA 1XFLA 4XS1A 5ELGA 2JSZA 3ZFBA 1G7EA 3EE2A 2MMNA 3PH9A 2H0GA 2I4AA 2C0GA 2OBKA 1F37A 5BMUA 4BL7B 2E2GA 1A8YA 2VAFA 1H75A 1OE7A 1HQOA 5IM9A 1XWKA 1G6YA 1OC8A 4BPYA 2BJXA 1TRVA 1CQHA 1FOHA 2L59A 2FA8A 3Q6OA 1K0CA 4DSQA 4MZBA 2YN1A 1Z6MA 1W4VA 4J56E 2OA7A 3R3EA 4KA0A 2R0GA 4ZL7A 1PFOA 5GAND 4TXOB 2DJ1A 1EV9A 5IMCA 2YV7A 3TGZA 1K3LA 1GL8A 4ACSA 3BBYA 3HJMA 4F9ZA 3ME8A 2VOCA 1YZXA 4L0WA 1F9MA 3TKSA 5G5FA 3L0HA 4GWRA 4KSMA 3KMOA 1FVKA 5G2ZA 4BIKA 1S3DA 2G2QA 2R37A 1NW2A 2XPEA 3DEXA 4K9ZA 1BAYA 2WRTA 2H1BA 4G10A 1EGRA 3ED3A 3E3EA 1FB6A 2L6CA 5HR0A 5J9CA 1CQGA 1Q4JA 2AUVA 4RQRA 4D73B 4KAEA 3VWXA 1XCCA 2MMZA 3F4TA 3L9UA 1YY7A 4NMUA 3TDGA 2M72A 4MF5A 1JZDA 2HXKA 2PPTA 1EEJA 3TRXA 1K0MA 5J5NA 3D21A 3KH7A 5CYYA 1TK0B 1Q98A 1ZCPA 1SKWB 4J2FA 1PN9A 4GSNA 4WEYA 2H30A 3HZ8A 1GLPA 3C8EA 1K0BA 5F8BA 5ENUA 1J0FA 2R0CA 5CO3A 3NIVA 3EWLA 2X8CA 3CRTA 2H19A 4K1FA 3HJPA 3D22A 1B48A 2O89A 3AY8A 3SBCA 5IOWA 1ERVA 1SK1A 4TXOA 5DJLA 4DVCA 5F06A 4FO5A 5CAXA 4MJEA 1GSQA 4OCFA 3IR4A 4LL4B 2R6KA 4POLA 1ON4A 2ZNMA 2KHPA 2YOIA 3RPNA 3TKSC 2DMLA 2DJ3A 1M7TA 3GTUA 1FB0A 5L71A 2OBIA 1W89A 4OO4A 3UL3A 4I8BA 5HQPA 2OE0A 3DYRA 3BCIA 2HNLA 1O6JA 1GUHA 3JCML 5C00A 2I9HA 5CRHA 4KUNA 3CMIA 2VCTA 3P90A 4K6XA 1AC1A 5HR2A 2LKUA 4OWYA 1M3IA 3HD5A 1GUKA 2XC2A 4GQCA 5B6MA 4D73A 4GSSA 2GS3A 1T1VA 3ZZXA 2QSIA 2OJLA 1A24A 4CHSA 2G0FA 2F8FA 5KOWA 1N8JA 4KCAA 3HKRA 4K0GA 2WFCA 4E8HA 3CQFA 5CRDA 11GSA 2V32A 3A5WA 2JADA 3PPUA 1SK0A 5AIXA 1PSQA 4O32A 2GSRA 3GKNA 3O6TA 4ID0A 3UBLA 5DCGA 2HSHA 5ABRA 3FR6A 3GYKA 2YZUA 1T7PB 2VLVA 2H1AA 4G2EA 3HVXA 3KMNA 1MDJA 1TP9A 1SYXA 1R5AA 3KEBA 3IHQA 2VD1A 2JU5A 1I5GA 20GSA 2IIYA 4A5PA 1FHEA 4RUVA 2REMA 2KP1A 6GSSA 3DGQA 1ZGNA 4MPFA 3ME7A 3DKSA 4CY6A 4N0VA 1YKCA 4G9HA 1HNBA 1VF2A 4L5OA 3A5IA 4PQHA 3H93A 4MZWA 4ML1A 5A5KA 3F3QA 4EDYA 2O8VB 4EUYA 2YWOA 3LWAA 3W8SA 3QFBC 1F3BA 3DWVA 5DQSA 4PGTA 1AXDA 3KXOA 3PR8A 4FYBA 1O85A 1AQWA 3MAKA 4NHWA 4LA1A 2P5QA 2B7KA 4ZXGA 1DSBA 3IHGA 1FO5A 1X5EA 4ICYA 5DAKB 3QOUA 3EMPA 3CYNA 1EP7A 1Y25A 2YNXA 2HRNA 1TW9A 2V41A 3M8NA 2B5XA 2M80A 1ST9A 3QPMA 1T00A 4QL7A 2K8VA 1SD8A 2VM2A 2ALBA 4WBJA 1OAZA 1SL0B 2DJJA 1O7UA 4MA9A 5CP1A 4G19A 1Z3EA 4YQUA 4PNFA 19GSA 1JZRA 2GSSA 5H5SA 1O81A 2HI7A 16GSA 4MNNA 1VF4A 4XS4B 5J41A 2LS5A 4X4JA 3MIXA 1ZOFA 3KTBA 2IMDA 3G7YA 2FY6A 4ZBAA 5ECIB 4PURA 4Q5FA 2GGTA 3F9UA 1K0OA 3KM6A 2H01A 1M0UA 6GSVA 2DSAA 4JEDA 4P3YB 4GQFA 1KNGA 5GSTA 5G1LA 5ID2A 1FG4A 4JE1A 3GL5A 3CTFA 2XPDA 4XHMA 1O73A 4ML6A 3C7MA 1TI1A 3DD3A 3S9FA 2I81A 2JL4A 4OO5A 1T8EB 2VL9A 4TR4A 2FWFA 4F2IA 4WR5A 3FW2A 2DC5A 4JU5A 3SWLA 1YQ1A 4N10A 4IVFA 5B8AA 3KTLA 1U6TA 5B8BA 5FWGA 4JBBA 2R0PA 1AW9A 3FZ5A 5KN1A 1EOHA 4I97A 2KOKA 2L5OA 2K18A 4HEA2 2X64A 5AN1A 2F8AA 1Z9HA 4KDUA 4TW5A 3VWUA 2VCVA 4GXZA 4I5QA 4MF7A 2JZTA 3DIEA 1SU9A 2HT9A 2CZ2A 4X1UA 2PWJA 5DAKA 5KOXA 2ON7A 5FT3A 1JLWA 2B3SA 1FAAA 4IW9A 3GX8A 1SL1B 3GKXA 4IJ3A 4XRDA 3VI7A 3F3RA 1X9WB 4KDXA 4FYCA 4GLTA 2BTOT 1GNEA 1TOFA 3F6DA 3H1NA 3ZIVA 2OKAA 3ZMLA 3IV4A 1XWGA 2RIIA 3MDKA 1QUWA 4OD7A 1G6WA 2F51A 4E8EA 3IK9A 5JCUA 1X9SB 4TXVA 3FR9A 1ZZYA 2ZUPA 3VPQA 3H8QA 3ERWA 2C0EA 1M3JA 3UVHA 1GP1A 2LQOA 1U88A 3FZAA 3BOAA 5HR1A 5ECPB 4HQZA 9GSSA 3IC8A 2X8GA 3KH9A 3VFIA 2RLIA 3GX0A 4POMA 3TOUA 2H72A 2VCWA 1USBA 4NPBA 3RDWA 4ZIJA 5CRWA 1ACVA 2PBJA 3BCKA 1X9MB 2K8SA 4TR0A 2CV4A 2L4CA 5G1KA 2VD0A 2EIOA 2DMMA 3M0FA 2V1MA 4HDEA 2B6MA 1A23A 3FY7A 1MD3A 4XTSA 3RPPA 5IMDA 1ZMAA 3W6GA 4WKWA 2CQ9A 2CVKA 4YQMA 1T4YA 3CRUA 3N5OA 3MYDA 1TK5B 2YWMA 2YWIA 1Z6NA 2IJYA 1V2AA 4Q5QA 4WETA 3CSJA 5IO2A 1AAZA 5D93A 1YF1A 4OFTA 4YKGA 1PD21 3LEFA 4EIPA 3LGCA 4HS1A 4I6XA 3GTUB 3LJRA 4N30A 2R4VA 2L5LA 2FHEA 6GSWA 3QAGA 1WJKA 3KIJA 1TU7A 1FOVA 1GTAA 1XG8A 3TKRA 2JZRA 1A2MA 2FGXA 3LORA 3TKSE 3V1WA 4CY8A 3TJFA 1YDKA 4FQUA 4J57E 4OFNA 4MABA 2A4VA 3VWWA 3M3MA 3K8NA 2GQLA 3GMFA 3ZVJD 2VLTA 4NV2A 4AJ8A 1XPVA 3ERGA 4H86A 4JZQA 1NM3A 4V1Ag 3J7Yk 1PMTA 1A2JA 1ZYPA 4Z2TA 2H0HA 1GSEA 5DALB 3LFLA 2LJKA 4HUAA 1GLQA 2VL2A 1FVJA 4KDYA 2H74A 2JACA 1E6BA 2MBSA 5INYA 1M2AA 3IA1A 2C0DA 1G7OA 2QKEA 3RBTA 4G0KA 1IYIA 3FMWA 3VK9A 1M2DA 3UIWA 2GT6A 2ON5A 1SD9A 3MWHA 4BVXB 4HSCX 4GCIA 1MDIA 2WGRA 1BQ7A 4HU9A 3VURA 5ECHB 2DIYA 2HYXA 1AQVA 2DJ2A 2XBIA 2YPMA 4O5QA 3IDVA 2IFQA 4MJBA 5G5EA 1JLVA 2GDRA 2C80A 4ULXA 4L8EA 3J7Yb 1KBNA 4NXIA 3GHAA 1LBKA 3TRPA 3ZIJA 4F03A 2JZSA 4K7NA 1R5PA 4TRXA 3GKKA 2AB6A 1WIKA 2DKHA 2DLXA 2VCQA 2D2ZA 3LYKA 3GN3A 2WULA 3EPTA 5JWOB 1N2AA 1OYJA 1OC9A 2OE1A 1R7HA 4NHZA 3UVTA 4ZB8A 4LMVA 2MYGA 1TDIA 1H4OA 1B9XC 1K0DA 4KF9A 3U5RE 4RQXA 5BRTA 1XW6A 2AHEA 4GTUA 2NTOA 13GSA 4ECBA 1TU8A 1PN0A 3IRAA 4HI7A 14GSA 4KH7A 1MD4A 4G0IA 3QD9A 1PL1A 3GSSA 5DALA 5CREA 1GTBA 4XCSA 1OVNA 4DSSA 1ZYQB 1C72A 5ECSA 3TUEA 1A2LA 1WMJA 2VL2C 1JZWA 4IS0A 2LRCA 4Q5NA 2NVLA 1NHYA 4WF5A 2F3MA 1PX6A 3IAS2 5D9XA 4WF4A 3ZLPA 1MDKA 3RAZA 4MPGA 1NHOA 3I69A 4K2DA 2FA4A 4BVXA 4MJAA 18GSA 2IPAA 3UAPA 3WGXA 4K5SA 3M9JA 2GZYA 1IYHA 3F4RA 5LNKe 5IPGA 3N9JA 3TKPA 3DVWA 5A4WA 3HVNA 2MZCA 1DUGA 1ERUA 4YKFA 5ID2B 1S3AA 1URMA 2MBTA 3APSA 4KE3A 2C8UA 4Z7XA 2LQQA 3TB2A 4EVMA 4HOJA 5JWQB 1WOUA 3VPTA 1SKSB 2HRFA 5GAPD 3L9VA 1XZOA 2P31A 1OE8A 2C0FA 2NDOA 3ZRDA 5C04A 2B5EA 2F9SA 4YH2A 2J9HA 2P5RA 1ABAA 1J9BA 3PINA 2X99A 5E4WA 2YWNA 4IELA 3D4MA 3EYTA 2HRAA 4F82A 1QGVA 3LXTA 2WDUA 3ZMKA 2HE3A 2KLXA 3D0ZA 1UN2A 2LUSA 4POBA 1GNWA 5EY6A 2CAIA 1XWBA 4MMMA 1TKDB 3CTGA 4MP4A 4ECCA 1GSFA 5E59A 3L78A 5F0GA 3Q19A 3FKFA 3TCOA 2B7JA 2A2RA 3U6VA 3ZITA 2X49A 3VWVA 3M9KA 4FIWA 4IBPA 3VI5A 4K7IA 2IL3A 5D9WA 5D96A 2HSMA 4HQSA 5KEJA 2LSTA 3L9SA 2X4AA 1RQMA 1ERWA 3GV1A 3HVVA 2PERA 1X5DA 3LYPA 1VF1A 4BWQA 4O92A 2QA2A 2EC4A 2O85A 2PU9C 2K9FA 1XXUA 3Q18A 1WP0A 2VLUA 5ECLB 2LEGA 1TXXA 3G9BA 5D9VA 1M9AA 5ECRB 4PX1A 4DSRA 3KCMA 3FEUA 3FRCA 3M1GA 1ERTA 5AGYA 3ZVJA 2B1LA 2HZFA 2HSYA 5IO0A 2N5BA 1BJXA 2PN8A 2V2GA 2K6VA 2CA8A 2TRXA 2CVBA 3KP9A 2BMXA 3MNGA 3LXZA 5A4UA 3UBKA 1GSUA 3IAM2 5LCZA
chains in the Genus database with same CATH topology
3UEMA 2QA1A 3MSZA 2OE3A 5J4UA 4ECIA 1ZL9A 3QAWA 4KGIA 2PMTA 2C3TA 1PKZA 1SJZA 4OMVA 4IKHA 5KN0A 1BEDA 3C73A 2H6YA 4TR3A 4HZ2A 5JWRB 3C1SA 4TR1A 4XRAA 1TRUA 2HZEB 5ECOB 4ZBBA 2GZZA 2C1YA 2GVPA 2YANA 4Z2UA 1THXA 3APQA 1PA3A 3HA9A 5H5QA 1HYUA 3R2QA 2YJHA 2KUCA 3VLNA 2VIMA 1SK2A 3ZTLA 1XOBA 3GUSA 1ZYEA 5IPHA 3P2AA 3G7JA 2DKIA 3GSTA 4DEJA 6GSTA 5HR3A 2CAQA 1JFUA 4F0BA 3IE3A 4IQ1A 4PNGA 1TRWA 2FNOA 4EO3A 3HCZA 1GSDA 3ZFLA 3EVIA 1VGLA 2WZ9A 3CSHA 3QR6A 3ZL5A 4O5RA 1GULA 1VF3A 4HJ2A 5G31A 4ISDA 1XOAA 1XWAA 3HY2A 1WWJA 4V2LA 4Q5RA 4PQIA 1UC7A 1AUCA 1J08A 2B1KA 2H75A 4OFMA 5EVOA 4IP1A 5EPFA 4PTSA 1GSSA 5DBQA 2EIRA 1RK4A 4L5LA 2H1GA 4MK3A 4YAVA 3FZ9A 4PUAA 2IMEA 1TK8B 3GH9A 3A2XA 3L4NA 3ZREA 4RI6A 3W8JA 2FWHA 3OR5A 1OKDA 5HFKA 1EWXA 3F8UA 2I3YA 4PXOA 1TRSA 2OACA 2YP6A 2AV4A 2IWTA 4IHUA 3KZQA 1QK8A 2IFQB 2NBSA 5J3RA 1M99A 1V58A 3GIXA 1ILOA 4CDOA 2MMAA 1U3IA 3TJJA 5IMFA 3HYPA 4WBRD 3G7IA 3IPZA 2HZEA 2FUG2 3A2WA 1A8LA 5HFIA 5F07A 3O76A 1XBSA 5D73A 2RM5A 5ELAA 4ECJA 1GUMA 4HZ4A 1EGOA 1OC9B 2TIRA 1M2BA 1I9DA 3P8WA 2WCIA 5D9TA 1K3YA 1UVZA 3US3A 1R26A 2I1UA 5IOXA 1YEPA 4Z2RA 2M46A 2RM6A 1TI3A 3GH6A 4I2UA 1O8XA 5IQYA 3GNJA 4KCEA 4OCEA 3D4TA 2PVOC 3CXGA 1DE1A 2VM1A 2LNTA 4EIQA 1ML6A 3F4SA 1DBYA 3HDCA 1BG5A 4O7HA 3HJOA 6GSXA 5JCGA 5ECKB 2LRTA 5IIZA 1AIUA 2L57A 1LU4A 5DDLA 2YV9A 3H4KA 5DJMA 3BD2A 2WB9A 1F6MC 1PX7A 3LW9A 4XIHA 4ZL9A 4HU7A 2Z9SA 4BWSA 4DSSB 4BVYB 1YJ6A 4X0XA 4EDZA 1SJIA 2AJQB 4MDCA 1XWCA 2IMFA 2H70A 3DRNA 1QFNA 1XVQA 2CZ3A 2KP2A 3GKMA 4MH3A 4AF2A 2V6OA 2H71A 3HZ4A 1V57A 2H6ZA 3WGDA 4BL7A 3PGTA 2GQKA 1T3BA 1Z7RA 4TKYA 2P0GA 4IN0A 1T4ZA 3C1RA 1Z5YE 1S3CA 5HFGA 2AAWA 1G0TA 2WJUA 1AQXA 7GSSA 2RUEA 4LMWA 1XW9A 3IXRA 5B7CA 4EKZA 4MH2A 4WXTA 2TRCP 3LG6A 12GSA 1WE0A 5AIVA 3TJGA 2H8LA 2VL3A 2LNSA 1B4QA 3P7XA 3I43A 3HVSA 2IMIA 2L4QA 1QMVA 1SENA 4O5UA 2ES7A 2AYTA 1GTIA 1U3AA 4KSOA 4EXJA 2GLRA 3I9V2 1DE2A 2WS2A 2HLSA 1FW1A 4ZL8A 5A4VA 2R2JA 2A2PA 1X0RA 2PVQA 3EU3A 3TRQA 4QL9A 4NAXA 2DIZA 3TKQA 1O8WA 2LV3A 2VO4A 4BVYA 3FZ4A 5B6NA 2J23A 3DVXA 3I6AA 3DMLA 1A0FA 2IMKA 4CW9A 1K0AA 1QXHA 1OC3A 3UJ1A 1KTEA 2H76A 4GSTA 2H6XA 4PQ1A 3BJ5A 3CSIA 4K8MA 2NPBA 5KN2A 1B9YC 4QQ7A 2DBCA 2E7PA 1M9BA 1PKWA 4F0CA 3RHCA 1R4WA 6GSUA 2PUKC 1GSYA 4FH8A 4EE0A 1V40A 4JR4A 2DJKA 2PGTA 4K5RA 5JCWA 2QC7A 1F2EA 3WD6A 4HJMA 1GRXA 3QMXA 4MJCA 4GRFA 5EL8A 3IC4A 3UMAA 6GSYA 1ZYNA 3A3TA 3FR3A 3IK7A 3HXSA 4FYUA 4MCUA 1B4PA 3RHBA 3NOFA 1TTZA 3E9JB 3GL3A 3H79A 1SL2B 4K2XA 1LJRA 3O3TA 4YQVA 1YKAA 1HNAA 3QDNA 2LJAA 2B5YA 2GQMA 4AJ7A 3E0UA 5GZZB 17GSA 2H1DA 3HHVA 2O87A 5DQYA 3FHKA 3C71A 2ZCTA 3KD0A 10GSA 5F05A 2LRNA 4TR1B 3KP8A 3QAVA 2XBQA 4L0UA 3F63A 2L6DA 2RUFA 8GSSA 3A2VA 5IMAA 1EEMA 5AISA 2CVDA 2FCHA 2H73A 2VUPA 1X5CA 2HFDA 3D5JA 3NZNA 2R5GA 3IBHA 1Y6EA 5CNWA 1OKTA 1QQ2A 1YF0A 3FYGA 2R3XA 1TJDA 1HNCA 1E2YA 4MZCA 5G30A 1KEBA 3WT2A 5ECMB 2E2MA 3WGEA 3LQ7A 4XS6A 1YEXA 1U87A 2YJ7A 3D6IA 1BX9A 1JZOA 4KW6A 4LLRA 1PL2A 1RW1A 1UA5A 1F3AA 1K3OA 2V6KA 1JHBA 1XIYA 5H5RA 2UZ8A 2C3NA 4IGJA 5IMVA 2N5FA 2CT6A 3F0IA 4BA7A 2VCXA 5D8IA 3EURA 1SKRB 2JSYA 3GFKA 3ERFA 4IQAA 3FK8A 2YCDA 3EINA 4X43A 4KNDA 4AGSA 5GSSA 2A2SA 4V2NA 2GT5A 5DVBA 2XHFA 4EL1A 2GTUA 4KB3A 4AJ6A 2EIQA 1V9WA 3TOTA 4V1Ap 2N5AA 3IOSA 2IN3A 2C4JA 5CRGA 1MEKA 2FWGA 3WYWA 3UOMA 2VCZA 1B8XA 1SYRA 1A0RP 5FHIA 5KN3A 4MF6A 1WPIA 4ZB9A 3WT1A 2FWEA 1XW5A 3Q74A 1EZKA 1GTUA 1PGTA 2MMOA 2H66A 3GA4A 4ZILA 2FLSA 4EC0A 5DCHA 3KGKA 4TOPA 2H0IA 3TJBA 1GWCA 1WRYA 3APOA 1XVWA 3DXBA 3F6FA 1HD2A 2DJ0A 4YAPA 1EOGA 3QFAC 4I2TA 4IP6A 3EU4A 3ZYWA 4N0ZA 2HRKA 4ZB6A 2FD3A 4JR6A 1SJ6A 4K0NA 4EF0A 1EV4A 1VRSD 3EMXA 3GURA 4JRRA 1MTCA 4TVEA 2A4HA 1Z7PA 4IJIA 1V98A 3EC3A 2CX3A 5ECNB 1BYEA 2E0QA 5J9BA 4WR4A 2OADA 22GSA 2GSQA 2YZHA 3ISOA 4N11A 2LTKA 2GSTA 4ZBDA 4RI7A 4ILFA 4USSA 3TJKA 2CX4A 3QCPA 5COHA 5ECQB 4LL1B 2GZPA 4V2MA 2C3QA 2X8HA 4MLYA 5IMZA 1THOA 2O7KA 3GRXA 1EP8A 1GH2A 4XS4A 3KJYA 1PQNA 3LSZA 4NV5A 4NWYA 4TN8A 1NSWA 5LD0A 3CBUA 1K0NA 2LJRA 2QGVA 1PRXA 4KX4A 4K7OA 4POKA 4PUFC 3UARA 4GF0A 4G0LA 1XFLA 4XS1A 5ELGA 2JSZA 3ZFBA 1G7EA 3EE2A 2MMNA 3PH9A 2H0GA 2I4AA 2C0GA 2OBKA 1F37A 5BMUA 4BL7B 2E2GA 1A8YA 2VAFA 1H75A 1OE7A 1HQOA 5IM9A 1XWKA 1G6YA 1OC8A 4BPYA 2BJXA 1TRVA 1CQHA 1FOHA 2L59A 2FA8A 3Q6OA 1K0CA 4DSQA 4MZBA 2YN1A 1Z6MA 1W4VA 4J56E 2OA7A 3R3EA 4KA0A 2R0GA 4ZL7A 5GAND 4TXOB 2DJ1A 1EV9A 5IMCA 2YV7A 3TGZA 1K3LA 1GL8A 4ACSA 3BBYA 3HJMA 4F9ZA 3ME8A 2VOCA 1YZXA 4L0WA 1F9MA 3TKSA 5G5FA 3L0HA 4GWRA 4KSMA 3KMOA 1FVKA 5G2ZA 1S3DA 2G2QA 2R37A 1NW2A 2XPEA 3DEXA 4K9ZA 1BAYA 2WRTA 2H1BA 4G10A 1EGRA 3ED3A 3E3EA 1FB6A 2L6CA 5HR0A 5J9CA 1CQGA 1Q4JA 2AUVA 4RQRA 4D73B 4KAEA 3VWXA 1XCCA 2MMZA 3F4TA 3L9UA 1YY7A 4NMUA 3TDGA 2M72A 4MF5A 1JZDA 2HXKA 2PPTA 1EEJA 3TRXA 1K0MA 5J5NA 3D21A 3KH7A 5CYYA 1TK0B 1Q98A 1ZCPA 1SKWB 4J2FA 1PN9A 4GSNA 4WEYA 2H30A 3HZ8A 1GLPA 3C8EA 1K0BA 5F8BA 5ENUA 1J0FA 2R0CA 5CO3A 3NIVA 3EWLA 2X8CA 3CRTA 2H19A 4K1FA 3HJPA 3D22A 1B48A 2O89A 3AY8A 3SBCA 5IOWA 1ERVA 1SK1A 4TXOA 5DJLA 4DVCA 5F06A 4FO5A 5CAXA 4MJEA 1GSQA 4OCFA 3IR4A 4LL4B 2R6KA 4POLA 1ON4A 2ZNMA 2KHPA 2YOIA 3RPNA 3TKSC 2DMLA 2DJ3A 1M7TA 3GTUA 1FB0A 5L71A 2OBIA 1W89A 4OO4A 3UL3A 4I8BA 5HQPA 2OE0A 3DYRA 3BCIA 2HNLA 1O6JA 1GUHA 3JCML 5C00A 2I9HA 5CRHA 4KUNA 3CMIA 2VCTA 3P90A 4K6XA 1AC1A 5HR2A 2LKUA 4OWYA 3HD5A 1GUKA 2XC2A 4GQCA 5B6MA 4D73A 4GSSA 2GS3A 1T1VA 3ZZXA 2QSIA 2OJLA 1A24A 4CHSA 2G0FA 2F8FA 5KOWA 1N8JA 4KCAA 3HKRA 4K0GA 2WFCA 4E8HA 5CRDA 11GSA 2V32A 3A5WA 2JADA 3PPUA 1SK0A 5AIXA 1PSQA 4O32A 2GSRA 3GKNA 3O6TA 4ID0A 3UBLA 5DCGA 2HSHA 5ABRA 3FR6A 3GYKA 2YZUA 1T7PB 2VLVA 2H1AA 4G2EA 3HVXA 3KMNA 1MDJA 1TP9A 1SYXA 1R5AA 3KEBA 3IHQA 2VD1A 2JU5A 1I5GA 20GSA 2IIYA 4A5PA 1FHEA 4RUVA 2REMA 2KP1A 6GSSA 3DGQA 1ZGNA 4MPFA 3ME7A 3DKSA 4CY6A 4N0VA 1YKCA 4G9HA 1HNBA 1VF2A 4L5OA 3A5IA 4PQHA 3H93A 4MZWA 4ML1A 5A5KA 3F3QA 4EDYA 2O8VB 4EUYA 2YWOA 3LWAA 3W8SA 3QFBC 1F3BA 3DWVA 5DQSA 4PGTA 1AXDA 3KXOA 3PR8A 4FYBA 1O85A 1AQWA 3MAKA 4NHWA 4LA1A 2P5QA 2B7KA 4ZXGA 1DSBA 3IHGA 1FO5A 1X5EA 4ICYA 5DAKB 3QOUA 3EMPA 3CYNA 1EP7A 1Y25A 2YNXA 2HRNA 1TW9A 2V41A 3M8NA 2B5XA 2M80A 1ST9A 3QPMA 1T00A 4QL7A 2K8VA 1SD8A 2VM2A 2ALBA 4WBJA 1OAZA 1SL0B 2DJJA 1O7UA 4MA9A 5CP1A 4G19A 1Z3EA 4YQUA 4PNFA 19GSA 1JZRA 2GSSA 5H5SA 1O81A 2HI7A 16GSA 4MNNA 1VF4A 4XS4B 5J41A 2LS5A 4X4JA 3MIXA 1ZOFA 3KTBA 2IMDA 3G7YA 2FY6A 4ZBAA 5ECIB 4PURA 4Q5FA 2GGTA 3F9UA 1K0OA 3KM6A 2H01A 1M0UA 6GSVA 2DSAA 4JEDA 4P3YB 4GQFA 1KNGA 5GSTA 5G1LA 5ID2A 1FG4A 4JE1A 3GL5A 3CTFA 2XPDA 4XHMA 1O73A 4ML6A 3C7MA 1TI1A 3DD3A 3S9FA 2I81A 2JL4A 4OO5A 1T8EB 2VL9A 4TR4A 2FWFA 4F2IA 4WR5A 3FW2A 2DC5A 4JU5A 3SWLA 1YQ1A 4N10A 4IVFA 5B8AA 3KTLA 1U6TA 5B8BA 5FWGA 4JBBA 2R0PA 1AW9A 3FZ5A 5KN1A 1EOHA 4I97A 2KOKA 2L5OA 2K18A 4HEA2 2X64A 5AN1A 2F8AA 1Z9HA 4KDUA 4TW5A 3VWUA 2VCVA 4GXZA 4I5QA 4MF7A 2JZTA 3DIEA 1SU9A 2HT9A 2CZ2A 4X1UA 2PWJA 5DAKA 5KOXA 2ON7A 5FT3A 1JLWA 2B3SA 1FAAA 4IW9A 3GX8A 1SL1B 3GKXA 4IJ3A 4XRDA 3VI7A 3F3RA 1X9WB 4KDXA 4FYCA 4GLTA 2BTOT 1GNEA 1TOFA 3F6DA 3H1NA 3ZIVA 2OKAA 3ZMLA 3IV4A 1XWGA 2RIIA 3MDKA 1QUWA 4OD7A 1G6WA 2F51A 4E8EA 3IK9A 5JCUA 1X9SB 4TXVA 3FR9A 1ZZYA 2ZUPA 3VPQA 3H8QA 3ERWA 2C0EA 3UVHA 1GP1A 2LQOA 1U88A 3FZAA 3BOAA 5HR1A 5ECPB 4HQZA 9GSSA 3IC8A 2X8GA 3KH9A 3VFIA 2RLIA 3GX0A 4POMA 3TOUA 2H72A 2VCWA 1USBA 4NPBA 3RDWA 4ZIJA 5CRWA 1ACVA 2PBJA 3BCKA 1X9MB 2K8SA 4TR0A 2CV4A 2L4CA 5G1KA 2VD0A 2EIOA 2DMMA 3M0FA 2V1MA 4HDEA 2B6MA 1A23A 3FY7A 1MD3A 4XTSA 3RPPA 5IMDA 1ZMAA 3W6GA 4WKWA 2CQ9A 2CVKA 4YQMA 1T4YA 3CRUA 3N5OA 3MYDA 1TK5B 2YWMA 2YWIA 1Z6NA 2IJYA 1V2AA 4Q5QA 4WETA 3CSJA 5IO2A 1AAZA 5D93A 1YF1A 4OFTA 4YKGA 1PD21 3LEFA 4EIPA 3LGCA 4HS1A 4I6XA 3GTUB 3LJRA 4N30A 2R4VA 2L5LA 2FHEA 6GSWA 3QAGA 1WJKA 3KIJA 1TU7A 1FOVA 1GTAA 3TKRA 2JZRA 1A2MA 2FGXA 3LORA 3TKSE 3V1WA 4CY8A 3TJFA 1YDKA 4FQUA 4J57E 4OFNA 4MABA 2A4VA 3VWWA 3M3MA 3K8NA 2GQLA 3GMFA 3ZVJD 2VLTA 4NV2A 4AJ8A 1XPVA 3ERGA 4H86A 4JZQA 1NM3A 4V1Ag 3J7Yk 1PMTA 1A2JA 1ZYPA 4Z2TA 2H0HA 1GSEA 5DALB 3LFLA 2LJKA 4HUAA 1GLQA 2VL2A 1FVJA 4KDYA 2H74A 2JACA 1E6BA 2MBSA 5INYA 1M2AA 3IA1A 2C0DA 1G7OA 2QKEA 3RBTA 4G0KA 1IYIA 3FMWA 3VK9A 1M2DA 3UIWA 2GT6A 2ON5A 1SD9A 3MWHA 4BVXB 4GCIA 1MDIA 2WGRA 1BQ7A 4HU9A 3VURA 5ECHB 2DIYA 2HYXA 1AQVA 2DJ2A 2XBIA 2YPMA 4O5QA 3IDVA 2IFQA 4MJBA 5G5EA 1JLVA 2GDRA 2C80A 4ULXA 4L8EA 3J7Yb 1KBNA 4NXIA 3GHAA 1LBKA 3TRPA 3ZIJA 4F03A 2JZSA 4K7NA 1R5PA 4TRXA 3GKKA 2AB6A 1WIKA 2DKHA 2DLXA 2VCQA 2D2ZA 3LYKA 3GN3A 2WULA 3EPTA 5JWOB 1N2AA 1OYJA 1OC9A 2OE1A 1R7HA 4NHZA 3UVTA 4ZB8A 4LMVA 2MYGA 1TDIA 1H4OA 1B9XC 1K0DA 4KF9A 3U5RE 4RQXA 5BRTA 1XW6A 2AHEA 4GTUA 2NTOA 13GSA 4ECBA 1TU8A 1PN0A 3IRAA 4HI7A 14GSA 4KH7A 1MD4A 4G0IA 3QD9A 1PL1A 3GSSA 5DALA 5CREA 1GTBA 4XCSA 1OVNA 4DSSA 1ZYQB 1C72A 5ECSA 3TUEA 1A2LA 1WMJA 2VL2C 1JZWA 4IS0A 2LRCA 4Q5NA 2NVLA 1NHYA 4WF5A 2F3MA 1PX6A 3IAS2 5D9XA 4WF4A 3ZLPA 1MDKA 3RAZA 4MPGA 1NHOA 3I69A 4K2DA 2FA4A 4BVXA 4MJAA 18GSA 2IPAA 3UAPA 3WGXA 4K5SA 3M9JA 2GZYA 1IYHA 3F4RA 5LNKe 5IPGA 3N9JA 3TKPA 3DVWA 5A4WA 2MZCA 1DUGA 1ERUA 4YKFA 5ID2B 1S3AA 1URMA 2MBTA 3APSA 4KE3A 2C8UA 4Z7XA 2LQQA 3TB2A 4EVMA 4HOJA 5JWQB 1WOUA 3VPTA 1SKSB 2HRFA 5GAPD 3L9VA 1XZOA 2P31A 1OE8A 2C0FA 2NDOA 3ZRDA 5C04A 2B5EA 2F9SA 4YH2A 2J9HA 2P5RA 1ABAA 1J9BA 3PINA 2X99A 5E4WA 2YWNA 4IELA 3D4MA 3EYTA 2HRAA 4F82A 1QGVA 3LXTA 2WDUA 3ZMKA 2HE3A 2KLXA 3D0ZA 1UN2A 2LUSA 4POBA 1GNWA 5EY6A 2CAIA 1XWBA 4MMMA 1TKDB 3CTGA 4MP4A 4ECCA 1GSFA 5E59A 3L78A 5F0GA 3Q19A 3FKFA 3TCOA 2B7JA 2A2RA 3U6VA 3ZITA 2X49A 3VWVA 3M9KA 4FIWA 4IBPA 3VI5A 4K7IA 2IL3A 5D9WA 5D96A 2HSMA 4HQSA 5KEJA 2LSTA 3L9SA 2X4AA 1RQMA 1ERWA 3GV1A 3HVVA 2PERA 1X5DA 3LYPA 1VF1A 4BWQA 4O92A 2QA2A 2EC4A 2O85A 2PU9C 2K9FA 1XXUA 3Q18A 1WP0A 2VLUA 5ECLB 2LEGA 1TXXA 3G9BA 5D9VA 1M9AA 5ECRB 4PX1A 4DSRA 3KCMA 3FEUA 3FRCA 3M1GA 1ERTA 5AGYA 3ZVJA 2B1LA 2HZFA 2HSYA 5IO0A 2N5BA 1BJXA 2PN8A 2V2GA 2K6VA 2CA8A 2TRXA 2CVBA 3KP9A 2BMXA 3MNGA 3LXZA 5A4UA 3UBKA 1GSUA 3IAM2 5LCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UEM A;  3MSZ A;  2OE3 A;  5J4U A;  4ECI A;  1ZL9 A;  3QAW A;  4KGI A;  2PMT A;  2C3T A;  1PKZ A;  1SJZ A;  4OMV A;  4IKH A;  5KN0 A;  1BED A;  3C73 A;  2H6Y A;  4TR3 A;  4HZ2 A;  5JWR B;  3C1S A;  4TR1 A;  4XRA A;  1TRU A;  2HZE B;  5ECO B;  4ZBB A;  2GZZ A;  2C1Y A;  2GVP A;  2YAN A;  1THX A;  3APQ A;  1PA3 A;  3HA9 A;  5H5Q A;  1HYU A;  3R2Q A;  2YJH A;  2KUC A;  3VLN A;  2VIM A;  1SK2 A;  3ZTL A;  1XOB A;  3GUS A;  1ZYE A;  5IPH A;  3P2A A;  3G7J A;  3GST A;  4DEJ A;  6GST A;  5HR3 A;  2CAQ A;  1JFU A;  4F0B A;  3IE3 A;  4IQ1 A;  4PNG A;  1TRW A;  2FNO A;  4EO3 A;  3HCZ A;  1GSD A;  3ZFL A;  3EVI A;  1VGL A;  2WZ9 A;  3CSH A;  3QR6 A;  3ZL5 A;  4O5R A;  1GUL A;  1VF3 A;  4HJ2 A;  5G31 A;  4ISD A;  1XOA A;  1XWA A;  3HY2 A;  1WWJ A;  4V2L A;  4Q5R A;  4PQI A;  1UC7 A;  1AUC A;  1J08 A;  2B1K A;  2H75 A;  4OFM A;  5EVO A;  4IP1 A;  5EPF A;  1GSS A;  5DBQ A;  2EIR A;  1RK4 A;  4L5L A;  2H1G A;  4MK3 A;  4YAV A;  3FZ9 A;  4PUA A;  2IME A;  1TK8 B;  3GH9 A;  3A2X A;  3L4N A;  3ZRE A;  4RI6 A;  3W8J A;  2FWH A;  3OR5 A;  1OKD A;  5HFK A;  1EWX A;  3F8U A;  2I3Y A;  4PXO A;  1TRS A;  2OAC A;  2YP6 A;  2AV4 A;  2IWT A;  4IHU A;  3KZQ A;  1QK8 A;  2IFQ B;  2NBS A;  5J3R A;  1M99 A;  1V58 A;  3GIX A;  1ILO A;  4CDO A;  2MMA A;  1U3I A;  3TJJ A;  5IMF A;  3HYP A;  4WBR D;  3G7I A;  3IPZ A;  2HZE A;  2FUG 2;  3A2W A;  1A8L A;  5HFI A;  5F07 A;  3O76 A;  1XBS A;  5D73 A;  2RM5 A;  5ELA A;  4ECJ A;  1GUM A;  4HZ4 A;  1EGO A;  1OC9 B;  2TIR A;  1M2B A;  1I9D A;  3P8W A;  2WCI A;  5D9T A;  1K3Y A;  1UVZ A;  3US3 A;  1R26 A;  2I1U A;  5IOX A;  1YEP A;  2M46 A;  2RM6 A;  1TI3 A;  3GH6 A;  4I2U A;  1O8X A;  5IQY A;  3GNJ A;  4KCE A;  4OCE A;  3D4T A;  2PVO C;  3CXG A;  1DE1 A;  2VM1 A;  2LNT A;  1ML6 A;  3F4S A;  1DBY A;  3HDC A;  1BG5 A;  4O7H A;  3HJO A;  6GSX A;  5JCG A;  5ECK B;  2LRT A;  5IIZ A;  1AIU A;  2L57 A;  1LU4 A;  5DDL A;  2YV9 A;  3H4K A;  5DJM A;  3BD2 A;  2WB9 A;  1F6M C;  1PX7 A;  4XIH A;  4ZL9 A;  4HU7 A;  2Z9S A;  4BWS A;  4DSS B;  1YJ6 A;  4X0X A;  4EDZ A;  1SJI A;  2AJQ B;  4MDC A;  1XWC A;  2IMF A;  2H70 A;  3DRN A;  1QFN A;  1XVQ A;  2CZ3 A;  2KP2 A;  3GKM A;  4MH3 A;  4AF2 A;  2V6O A;  2H71 A;  3HZ4 A;  1V57 A;  2H6Z A;  3WGD A;  4BL7 A;  3PGT A;  2GQK A;  1T3B A;  1Z7R A;  4TKY A;  2P0G A;  4IN0 A;  1T4Z A;  3C1R A;  1Z5Y E;  1S3C A;  5HFG A;  2AAW A;  1G0T A;  2WJU A;  1AQX A;  7GSS A;  2RUE A;  4LMW A;  1XW9 A;  3IXR A;  5B7C A;  4EKZ A;  4MH2 A;  4WXT A;  2TRC P;  3LG6 A;  12GS A;  1WE0 A;  5AIV A;  3TJG A;  2H8L A;  2VL3 A;  2LNS A;  1B4Q A;  3P7X A;  3I43 A;  3HVS A;  2IMI A;  2L4Q A;  1QMV A;  1SEN A;  2ES7 A;  2AYT A;  1GTI A;  1U3A A;  4KSO A;  4EXJ A;  2GLR A;  3I9V 2;  1DE2 A;  2WS2 A;  2HLS A;  1FW1 A;  4ZL8 A;  5A4V A;  2R2J A;  1X0R A;  2PVQ A;  3EU3 A;  3TRQ A;  4QL9 A;  4NAX A;  2DIZ A;  3TKQ A;  1O8W A;  2LV3 A;  2VO4 A;  4BVY A;  3FZ4 A;  5B6N A;  2J23 A;  3DVX A;  3I6A A;  3DML A;  1A0F A;  2IMK A;  4CW9 A;  1K0A A;  1QXH A;  1OC3 A;  3UJ1 A;  1KTE A;  2H76 A;  4GST A;  2H6X A;  4PQ1 A;  3BJ5 A;  3CSI A;  4K8M A;  2NPB A;  5KN2 A;  1B9Y C;  4QQ7 A;  2DBC A;  2E7P A;  1M9B A;  1PKW A;  4F0C A;  3RHC A;  1R4W A;  6GSU A;  2PUK C;  1GSY A;  4FH8 A;  4EE0 A;  1V40 A;  4JR4 A;  2DJK A;  2PGT A;  5JCW A;  2QC7 A;  1F2E A;  3WD6 A;  4HJM A;  1GRX A;  5EL8 A;  3QMX A;  4MJC A;  4GRF A;  3IC4 A;  3UMA A;  6GSY A;  3A3T A;  3FR3 A;  3IK7 A;  3HXS A;  4FYU A;  4MCU A;  1B4P A;  3RHB A;  3NOF A;  1TTZ A;  3E9J B;  3GL3 A;  3H79 A;  1SL2 B;  1LJR A;  3O3T A;  4YQV A;  1YKA A;  1HNA A;  3QDN A;  2LJA A;  2B5Y A;  2GQM A;  4AJ7 A;  3E0U A;  5GZZ B;  17GS A;  2H1D A;  3HHV A;  2O87 A;  5DQY A;  3FHK A;  3C71 A;  2ZCT A;  3KD0 A;  10GS A;  5F05 A;  2LRN A;  4TR1 B;  3KP8 A;  3QAV A;  2XBQ A;  4L0U A;  3F63 A;  2L6D A;  2RUF A;  8GSS A;  3A2V A;  5IMA A;  1EEM A;  5AIS A;  2CVD A;  2FCH A;  2H73 A;  2VUP A;  1X5C A;  2HFD A;  3D5J A;  3NZN A;  2R5G A;  3IBH A;  1Y6E A;  5CNW A;  1OKT A;  1QQ2 A;  1YF0 A;  3FYG A;  2R3X A;  1TJD A;  1HNC A;  1E2Y A;  4MZC A;  5G30 A;  1KEB A;  3WT2 A;  5ECM B;  2E2M A;  3WGE A;  3LQ7 A;  4XS6 A;  1YEX A;  1U87 A;  2YJ7 A;  3D6I A;  1BX9 A;  1JZO A;  4KW6 A;  4LLR A;  1PL2 A;  1RW1 A;  1UA5 A;  1F3A A;  1K3O A;  2V6K A;  1JHB A;  1XIY A;  5H5R A;  2C3N A;  4IGJ A;  5IMV A;  2N5F A;  2CT6 A;  3F0I A;  4BA7 A;  2VCX A;  5D8I A;  3EUR A;  1SKR B;  2JSY A;  3GFK A;  3ERF A;  4IQA A;  3FK8 A;  2YCD A;  3EIN A;  4X43 A;  4KND A;  4AGS A;  5GSS A;  2A2S A;  4V2N A;  2GT5 A;  5DVB A;  2XHF A;  4EL1 A;  2GTU A;  4KB3 A;  4AJ6 A;  2EIQ A;  1V9W A;  3TOT A;  4V1A p;  2N5A A;  3IOS A;  2IN3 A;  2C4J A;  5CRG A;  1MEK A;  2FWG A;  3WYW A;  3UOM A;  2VCZ A;  1B8X A;  1SYR A;  1A0R P;  5FHI A;  5KN3 A;  4MF6 A;  1WPI A;  4ZB9 A;  3WT1 A;  2FWE A;  1XW5 A;  3Q74 A;  1EZK A;  1GTU A;  1PGT A;  2MMO A;  2H66 A;  3GA4 A;  4ZIL A;  2FLS A;  4EC0 A;  5DCH A;  3KGK A;  4TOP A;  2H0I A;  3TJB A;  1GWC A;  1WRY A;  3APO A;  1XVW A;  3DXB A;  3F6F A;  1HD2 A;  2DJ0 A;  4YAP A;  1EOG A;  3QFA C;  4I2T A;  4IP6 A;  3EU4 A;  3ZYW A;  4N0Z A;  4ZB6 A;  2FD3 A;  4JR6 A;  1SJ6 A;  4K0N A;  4EF0 A;  1EV4 A;  1VRS D;  3EMX A;  3GUR A;  4JRR A;  1MTC A;  4TVE A;  1Z7P A;  4IJI A;  1V98 A;  3EC3 A;  2CX3 A;  5ECN B;  1BYE A;  2E0Q A;  5J9B A;  4WR4 A;  2OAD A;  22GS A;  2GSQ A;  2YZH A;  3ISO A;  4N11 A;  2LTK A;  2GST A;  4ZBD A;  4RI7 A;  4ILF A;  3TJK A;  2CX4 A;  3QCP A;  5COH A;  5ECQ B;  4LL1 B;  2GZP A;  4V2M A;  2C3Q A;  2X8H A;  4MLY A;  5IMZ A;  1THO A;  2O7K A;  3GRX A;  1EP8 A;  1GH2 A;  4XS4 A;  3KJY A;  1PQN A;  3LSZ A;  4NV5 A;  4NWY A;  4TN8 A;  1NSW A;  5LD0 A;  3CBU A;  1K0N A;  2LJR A;  2QGV A;  1PRX A;  4KX4 A;  4K7O A;  4POK A;  4PUF C;  3UAR A;  4GF0 A;  1XFL A;  4XS1 A;  5ELG A;  2JSZ A;  3ZFB A;  1G7E A;  3EE2 A;  2MMN A;  3PH9 A;  2H0G A;  2I4A A;  2C0G A;  2OBK A;  1F37 A;  2E2G A;  1A8Y A;  2VAF A;  1H75 A;  1OE7 A;  1HQO A;  5IM9 A;  1XWK A;  1G6Y A;  1OC8 A;  4BPY A;  2BJX A;  1TRV A;  1CQH A;  2L59 A;  2FA8 A;  3Q6O A;  1K0C A;  4DSQ A;  4MZB A;  2YN1 A;  1Z6M A;  1W4V A;  4J56 E;  2OA7 A;  4KA0 A;  4ZL7 A;  5GAN D;  4TXO B;  2DJ1 A;  1EV9 A;  5IMC A;  2YV7 A;  3TGZ A;  1K3L A;  1GL8 A;  4ACS A;  3BBY A;  3HJM A;  4F9Z A;  3ME8 A;  2VOC A;  1YZX A;  4L0W A;  1F9M A;  3TKS A;  5G5F A;  3L0H A;  4GWR A;  4KSM A;  3KMO A;  1FVK A;  5G2Z A;  1S3D A;  2G2Q A;  2R37 A;  1NW2 A;  2XPE A;  3DEX A;  4K9Z A;  1BAY A;  2WRT A;  2H1B A;  4G10 A;  1EGR A;  3ED3 A;  3E3E A;  1FB6 A;  2L6C A;  5HR0 A;  5J9C A;  1CQG A;  1Q4J A;  2AUV A;  4RQR A;  4D73 B;  4KAE A;  3VWX A;  1XCC A;  2MMZ A;  3F4T A;  3L9U A;  1YY7 A;  4NMU A;  3TDG A;  2M72 A;  4MF5 A;  1JZD A;  2HXK A;  2PPT A;  1EEJ A;  3TRX A;  1K0M A;  5J5N A;  3D21 A;  3KH7 A;  5CYY A;  1TK0 B;  1Q98 A;  1ZCP A;  1SKW B;  4J2F A;  1PN9 A;  4GSN A;  4WEY A;  2H30 A;  3HZ8 A;  1GLP A;  3C8E A;  1K0B A;  5F8B A;  5ENU A;  1J0F A;  5CO3 A;  3NIV A;  3EWL A;  2X8C A;  3CRT A;  2H19 A;  4K1F A;  3HJP A;  3D22 A;  1B48 A;  2O89 A;  3AY8 A;  3SBC A;  5IOW A;  1ERV A;  1SK1 A;  4TXO A;  5DJL A;  4DVC A;  5F06 A;  4FO5 A;  5CAX A;  4MJE A;  1GSQ A;  4OCF A;  3IR4 A;  4LL4 B;  2R6K A;  4POL A;  1ON4 A;  2ZNM A;  2KHP A;  2YOI A;  3RPN A;  3TKS C;  2DML A;  2DJ3 A;  1M7T A;  3GTU A;  1FB0 A;  5L71 A;  2OBI A;  1W89 A;  4OO4 A;  3UL3 A;  4I8B A;  5HQP A;  2OE0 A;  3DYR A;  3BCI A;  2HNL A;  1O6J A;  1GUH A;  3JCM L;  5C00 A;  2I9H A;  5CRH A;  4KUN A;  3CMI A;  2VCT A;  3P90 A;  4K6X A;  1AC1 A;  5HR2 A;  2LKU A;  4OWY A;  3HD5 A;  1GUK A;  2XC2 A;  4GQC A;  5B6M A;  4D73 A;  4GSS A;  2GS3 A;  1T1V A;  3ZZX A;  2QSI A;  2OJL A;  1A24 A;  4CHS A;  2G0F A;  2F8F A;  1N8J A;  4KCA A;  3HKR A;  4K0G A;  2WFC A;  4E8H A;  5CRD A;  11GS A;  2V32 A;  3A5W A;  2JAD A;  1SK0 A;  5AIX A;  1PSQ A;  4O32 A;  2GSR A;  3GKN A;  3O6T A;  4ID0 A;  3UBL A;  5DCG A;  2HSH A;  5ABR A;  3FR6 A;  3GYK A;  2YZU A;  1T7P B;  2VLV A;  2H1A A;  4G2E A;  3HVX A;  3KMN A;  1MDJ A;  1TP9 A;  1SYX A;  1R5A A;  3KEB A;  3IHQ A;  2VD1 A;  2JU5 A;  1I5G A;  20GS A;  2IIY A;  1FHE A;  4RUV A;  2REM A;  2KP1 A;  6GSS A;  3DGQ A;  1ZGN A;  4MPF A;  3ME7 A;  3DKS A;  4N0V A;  1YKC A;  4G9H A;  1HNB A;  1VF2 A;  4L5O A;  4PQH A;  3H93 A;  4MZW A;  4ML1 A;  5A5K A;  3F3Q A;  4EDY A;  2O8V B;  4EUY A;  2YWO A;  3LWA A;  3W8S A;  3QFB C;  1F3B A;  3DWV A;  5DQS A;  4PGT A;  1AXD A;  3KXO A;  3PR8 A;  4FYB A;  1O85 A;  1AQW A;  3MAK A;  4NHW A;  4LA1 A;  2P5Q A;  2B7K A;  4ZXG A;  1DSB A;  1FO5 A;  1X5E A;  5DAK B;  3QOU A;  3EMP A;  3CYN A;  1EP7 A;  1Y25 A;  2YNX A;  2HRN A;  1TW9 A;  2V41 A;  3M8N A;  2B5X A;  2M80 A;  1ST9 A;  3QPM A;  1T00 A;  4QL7 A;  2K8V A;  1SD8 A;  2VM2 A;  2ALB A;  4WBJ A;  1OAZ A;  1SL0 B;  2DJJ A;  1O7U A;  4MA9 A;  5CP1 A;  4G19 A;  1Z3E A;  4YQU A;  4PNF A;  19GS A;  1JZR A;  2GSS A;  5H5S A;  1O81 A;  2HI7 A;  16GS A;  1VF4 A;  4XS4 B;  5J41 A;  2LS5 A;  1ZOF A;  3KTB A;  2IMD A;  3G7Y A;  2FY6 A;  4ZBA A;  5ECI B;  4PUR A;  4Q5F A;  2GGT A;  3F9U A;  1K0O A;  3KM6 A;  2H01 A;  1M0U A;  6GSV A;  2DSA A;  4JED A;  4P3Y B;  4GQF A;  1KNG A;  5GST A;  5G1L A;  5ID2 A;  1FG4 A;  4JE1 A;  3GL5 A;  3CTF A;  2XPD A;  4XHM A;  1O73 A;  4ML6 A;  3C7M A;  1TI1 A;  3DD3 A;  3S9F A;  2I81 A;  2JL4 A;  4OO5 A;  1T8E B;  2VL9 A;  4TR4 A;  2FWF A;  4F2I A;  4WR5 A;  3FW2 A;  2DC5 A;  4JU5 A;  3SWL A;  1YQ1 A;  4N10 A;  4IVF A;  5B8A A;  3KTL A;  1U6T A;  5B8B A;  5FWG A;  4JBB A;  1AW9 A;  3FZ5 A;  5KN1 A;  1EOH A;  4I97 A;  2KOK A;  2L5O A;  2K18 A;  4HEA 2;  2X64 A;  5AN1 A;  2F8A A;  1Z9H A;  4KDU A;  4TW5 A;  3VWU A;  2VCV A;  4GXZ A;  4I5Q A;  4MF7 A;  2JZT A;  3DIE A;  1SU9 A;  2HT9 A;  2CZ2 A;  4X1U A;  2PWJ A;  5DAK A;  2ON7 A;  5FT3 A;  1JLW A;  2B3S A;  1FAA A;  4IW9 A;  3GX8 A;  1SL1 B;  3GKX A;  4IJ3 A;  4XRD A;  3VI7 A;  3F3R A;  1X9W B;  4KDX A;  4FYC A;  4GLT A;  2BTO T;  1GNE A;  1TOF A;  3F6D A;  3H1N A;  3ZIV A;  2OKA A;  3ZML A;  3IV4 A;  1XWG A;  2RII A;  3MDK A;  1QUW A;  4OD7 A;  1G6W A;  2F51 A;  4E8E A;  3IK9 A;  5JCU A;  1X9S B;  4TXV A;  3FR9 A;  1ZZY A;  2ZUP A;  3VPQ A;  3H8Q A;  3ERW A;  2C0E A;  3UVH A;  1GP1 A;  2LQO A;  1U88 A;  3FZA A;  3BOA A;  5HR1 A;  5ECP B;  4HQZ A;  9GSS A;  2X8G A;  3KH9 A;  3VFI A;  2RLI A;  3GX0 A;  4POM A;  3TOU A;  2H72 A;  2VCW A;  1USB A;  4NPB A;  3RDW A;  4ZIJ A;  5CRW A;  1ACV A;  2PBJ A;  3BCK A;  1X9M B;  2K8S A;  4TR0 A;  2CV4 A;  2L4C A;  5G1K A;  2VD0 A;  2EIO A;  2DMM A;  3M0F A;  2V1M A;  4HDE A;  2B6M A;  1A23 A;  3FY7 A;  1MD3 A;  4XTS A;  3RPP A;  5IMD A;  1ZMA A;  3W6G A;  4WKW A;  2CQ9 A;  2CVK A;  4YQM A;  1T4Y A;  3CRU A;  3N5O A;  1TK5 B;  2YWM A;  2YWI A;  1Z6N A;  2IJY A;  1V2A A;  4Q5Q A;  4WET A;  3CSJ A;  5IO2 A;  1AAZ A;  5D93 A;  1YF1 A;  4OFT A;  1PD2 1;  3LEF A;  3LGC A;  4HS1 A;  4I6X A;  3GTU B;  3LJR A;  4N30 A;  2R4V A;  2L5L A;  2FHE A;  6GSW A;  3QAG A;  1WJK A;  3KIJ A;  1TU7 A;  1FOV A;  1GTA A;  3TKR A;  2JZR A;  1A2M A;  2FGX A;  3LOR A;  3TKS E;  3V1W A;  3TJF A;  1YDK A;  4OFN A;  4J57 E;  4MAB A;  2A4V A;  3VWW A;  3M3M A;  3K8N A;  2GQL A;  3GMF A;  3ZVJ D;  2VLT A;  4NV2 A;  4AJ8 A;  1XPV A;  3ERG A;  4H86 A;  4JZQ A;  1NM3 A;  4V1A g;  3J7Y k;  1PMT A;  1A2J A;  2H0H A;  1GSE A;  5DAL B;  3LFL A;  2LJK A;  4HUA A;  1GLQ A;  2VL2 A;  1FVJ A;  4KDY A;  2H74 A;  2JAC A;  1E6B A;  2MBS A;  5INY A;  1M2A A;  3IA1 A;  2C0D A;  1G7O A;  2QKE A;  3RBT A;  1IYI A;  3VK9 A;  1M2D A;  3UIW A;  2GT6 A;  2ON5 A;  1SD9 A;  3MWH A;  4GCI A;  1MDI A;  2WGR A;  1BQ7 A;  4HU9 A;  3VUR A;  5ECH B;  2DIY A;  2HYX A;  1AQV A;  2DJ2 A;  2XBI A;  2YPM A;  3IDV A;  2IFQ A;  4MJB A;  5G5E A;  1JLV A;  2GDR A;  2C80 A;  4ULX A;  4L8E A;  3J7Y b;  1KBN A;  4NXI A;  3GHA A;  1LBK A;  3TRP A;  3ZIJ A;  4F03 A;  2JZS A;  4K7N A;  1R5P A;  4TRX A;  3GKK A;  2AB6 A;  1WIK A;  2DLX A;  2VCQ A;  2D2Z A;  3LYK A;  3GN3 A;  2WUL A;  5JWO B;  1N2A A;  1OYJ A;  1OC9 A;  2OE1 A;  1R7H A;  4NHZ A;  3UVT A;  4ZB8 A;  4LMV A;  2MYG A;  1TDI A;  1H4O A;  1B9X C;  1K0D A;  3U5R E;  4RQX A;  1XW6 A;  2AHE A;  4GTU A;  2NTO A;  13GS A;  4ECB A;  1TU8 A;  3IRA A;  4HI7 A;  14GS A;  4KH7 A;  1MD4 A;  3QD9 A;  1PL1 A;  3GSS A;  5DAL A;  5CRE A;  1GTB A;  4XCS A;  1OVN A;  4DSS A;  1ZYQ B;  1C72 A;  5ECS A;  3TUE A;  1A2L A;  1WMJ A;  2VL2 C;  1JZW A;  4IS0 A;  2LRC A;  4Q5N A;  2NVL A;  1NHY A;  4WF5 A;  2F3M A;  1PX6 A;  3IAS 2;  5D9X A;  4WF4 A;  3ZLP A;  1MDK A;  3RAZ A;  4MPG A;  1NHO A;  3I69 A;  4K2D A;  2FA4 A;  4BVX A;  4MJA A;  18GS A;  2IPA A;  3UAP A;  3WGX A;  3M9J A;  2GZY A;  1IYH A;  3F4R A;  5LNK e;  5IPG A;  3N9J A;  3TKP A;  3DVW A;  5A4W A;  2MZC A;  1DUG A;  1ERU A;  5ID2 B;  1S3A A;  1URM A;  2MBT A;  3APS A;  4KE3 A;  2C8U A;  4Z7X A;  2LQQ A;  3TB2 A;  4EVM A;  4HOJ A;  5JWQ B;  1WOU A;  3VPT A;  1SKS B;  2HRF A;  5GAP D;  3L9V A;  1XZO A;  2P31 A;  1OE8 A;  2C0F A;  2NDO A;  3ZRD A;  5C04 A;  2B5E A;  2F9S A;  4YH2 A;  2J9H A;  2P5R A;  1ABA A;  1J9B A;  3PIN A;  2X99 A;  5E4W A;  2YWN A;  4IEL A;  3D4M A;  3EYT A;  4F82 A;  1QGV A;  3LXT A;  2WDU A;  3ZMK A;  2HE3 A;  2KLX A;  3D0Z A;  1UN2 A;  2LUS A;  4POB A;  1GNW A;  5EY6 A;  2CAI A;  1XWB A;  4MMM A;  1TKD B;  3CTG A;  4MP4 A;  4ECC A;  1GSF A;  5E59 A;  3L78 A;  5F0G A;  3Q19 A;  3FKF A;  3TCO A;  2B7J A;  2A2R A;  3U6V A;  3ZIT A;  3VWV A;  3M9K A;  4FIW A;  4IBP A;  3VI5 A;  4K7I A;  2IL3 A;  5D9W A;  5D96 A;  5KEJ A;  4HQS A;  2LST A;  3L9S A;  1RQM A;  1ERW A;  3GV1 A;  3HVV A;  2PER A;  1X5D A;  3LYP A;  1VF1 A;  4BWQ A;  4O92 A;  2EC4 A;  2O85 A;  2PU9 C;  2K9F A;  1XXU A;  3Q18 A;  1WP0 A;  2VLU A;  5ECL B;  2LEG A;  1TXX A;  3G9B A;  5D9V A;  1M9A A;  5ECR B;  4PX1 A;  4DSR A;  3KCM A;  3FEU A;  3FRC A;  3M1G A;  1ERT A;  5AGY A;  3ZVJ A;  2B1L A;  2HZF A;  2HSY A;  5IO0 A;  2N5B A;  1BJX A;  2PN8 A;  2V2G A;  2K6V A;  2CA8 A;  2TRX A;  2CVB A;  3KP9 A;  2BMX A;  3MNG A;  3LXZ A;  5A4U A;  3UBK A;  1GSU A;  3IAM 2;  5LCZ A; 
#chains in the Genus database with same CATH topology
 3UEM A;  2QA1 A;  3MSZ A;  2OE3 A;  5J4U A;  4ECI A;  1ZL9 A;  3QAW A;  4KGI A;  2PMT A;  2C3T A;  1PKZ A;  1SJZ A;  4OMV A;  4IKH A;  5KN0 A;  1BED A;  3C73 A;  2H6Y A;  4TR3 A;  4HZ2 A;  5JWR B;  3C1S A;  4TR1 A;  4XRA A;  1TRU A;  2HZE B;  5ECO B;  4ZBB A;  2GZZ A;  2C1Y A;  2GVP A;  2YAN A;  4Z2U A;  1THX A;  3APQ A;  1PA3 A;  3HA9 A;  5H5Q A;  1HYU A;  3R2Q A;  2YJH A;  2KUC A;  3VLN A;  2VIM A;  1SK2 A;  3ZTL A;  1XOB A;  3GUS A;  1ZYE A;  5IPH A;  3P2A A;  3G7J A;  2DKI A;  3GST A;  4DEJ A;  6GST A;  5HR3 A;  2CAQ A;  1JFU A;  4F0B A;  3IE3 A;  4IQ1 A;  4PNG A;  1TRW A;  2FNO A;  4EO3 A;  3HCZ A;  1GSD A;  3ZFL A;  3EVI A;  1VGL A;  2WZ9 A;  3CSH A;  3QR6 A;  3ZL5 A;  4O5R A;  1GUL A;  1VF3 A;  4HJ2 A;  5G31 A;  1S3R A;  4ISD A;  1XOA A;  1XWA A;  3HY2 A;  1WWJ A;  4V2L A;  4Q5R A;  4PQI A;  1UC7 A;  1AUC A;  1J08 A;  2B1K A;  2H75 A;  4OFM A;  5EVO A;  4IP1 A;  5EPF A;  4PTS A;  1GSS A;  5DBQ A;  2EIR A;  1RK4 A;  4L5L A;  2H1G A;  4MK3 A;  4YAV A;  3FZ9 A;  4PUA A;  2IME A;  1TK8 B;  3GH9 A;  3A2X A;  3L4N A;  3ZRE A;  4RI6 A;  3W8J A;  2FWH A;  3OR5 A;  1OKD A;  5HFK A;  1EWX A;  3F8U A;  2I3Y A;  4PXO A;  1TRS A;  2OAC A;  2YP6 A;  2AV4 A;  2IWT A;  4IHU A;  3KZQ A;  1QK8 A;  2IFQ B;  2NBS A;  5J3R A;  1M99 A;  1V58 A;  3GIX A;  1ILO A;  4CDO A;  2MMA A;  1U3I A;  3TJJ A;  5IMF A;  3HYP A;  4WBR D;  3G7I A;  3IPZ A;  2HZE A;  2FUG 2;  3A2W A;  1A8L A;  5HFI A;  5F07 A;  3O76 A;  1XBS A;  5D73 A;  2RM5 A;  5ELA A;  4ECJ A;  1GUM A;  4HZ4 A;  1EGO A;  1OC9 B;  2TIR A;  1M2B A;  1I9D A;  3P8W A;  2WCI A;  5D9T A;  1K3Y A;  1UVZ A;  3US3 A;  1R26 A;  2I1U A;  5IOX A;  1YEP A;  4Z2R A;  2M46 A;  2RM6 A;  1TI3 A;  3GH6 A;  4I2U A;  1O8X A;  5IQY A;  3GNJ A;  4KCE A;  4OCE A;  3D4T A;  2PVO C;  3CXG A;  1DE1 A;  2VM1 A;  2LNT A;  4EIQ A;  1ML6 A;  3F4S A;  1DBY A;  3HDC A;  1BG5 A;  4O7H A;  3HJO A;  6GSX A;  5JCG A;  5ECK B;  2LRT A;  5IIZ A;  1AIU A;  2L57 A;  1LU4 A;  5DDL A;  2YV9 A;  3H4K A;  5DJM A;  3BD2 A;  2WB9 A;  1F6M C;  1PX7 A;  3LW9 A;  4XIH A;  4ZL9 A;  4HU7 A;  2Z9S A;  4BWS A;  4DSS B;  4BVY B;  1YJ6 A;  4X0X A;  4EDZ A;  1SJI A;  2AJQ B;  4MDC A;  1XWC A;  2IMF A;  2H70 A;  3DRN A;  1QFN A;  1XVQ A;  2CZ3 A;  2KP2 A;  3GKM A;  4MH3 A;  4AF2 A;  2V6O A;  2H71 A;  3HZ4 A;  1V57 A;  2H6Z A;  3WGD A;  4BL7 A;  3PGT A;  2GQK A;  1T3B A;  1Z7R A;  4TKY A;  2P0G A;  4IN0 A;  1T4Z A;  3C1R A;  1Z5Y E;  1S3C A;  5HFG A;  2AAW A;  1G0T A;  2WJU A;  1AQX A;  7GSS A;  2RUE A;  4LMW A;  1XW9 A;  3IXR A;  5B7C A;  4EKZ A;  4MH2 A;  4WXT A;  2TRC P;  3LG6 A;  12GS A;  1WE0 A;  5AIV A;  3TJG A;  2H8L A;  2VL3 A;  2LNS A;  1B4Q A;  3P7X A;  3I43 A;  3HVS A;  2IMI A;  2L4Q A;  1QMV A;  1SEN A;  4O5U A;  2ES7 A;  2AYT A;  1GTI A;  1U3A A;  4KSO A;  4EXJ A;  2GLR A;  3I9V 2;  1DE2 A;  2WS2 A;  2HLS A;  1FW1 A;  4ZL8 A;  5A4V A;  2R2J A;  2A2P A;  1X0R A;  2PVQ A;  3EU3 A;  3TRQ A;  4QL9 A;  4NAX A;  2DIZ A;  3TKQ A;  1O8W A;  2LV3 A;  2VO4 A;  4BVY A;  3FZ4 A;  5B6N A;  2J23 A;  3DVX A;  3I6A A;  3DML A;  1A0F A;  2IMK A;  4CW9 A;  1K0A A;  1QXH A;  1OC3 A;  3UJ1 A;  1KTE A;  2H76 A;  4GST A;  2H6X A;  4PQ1 A;  3BJ5 A;  3CSI A;  4K8M A;  2NPB A;  5KN2 A;  1B9Y C;  4QQ7 A;  2DBC A;  2E7P A;  1M9B A;  1PKW A;  4F0C A;  3RHC A;  1R4W A;  6GSU A;  2PUK C;  1GSY A;  4FH8 A;  4EE0 A;  1V40 A;  4JR4 A;  2DJK A;  2PGT A;  4K5R A;  5JCW A;  2QC7 A;  1F2E A;  3WD6 A;  4HJM A;  1GRX A;  3QMX A;  4MJC A;  4GRF A;  5EL8 A;  3IC4 A;  3UMA A;  6GSY A;  1ZYN A;  3A3T A;  3FR3 A;  3IK7 A;  3HXS A;  4FYU A;  4MCU A;  1B4P A;  3RHB A;  3NOF A;  1TTZ A;  3E9J B;  3GL3 A;  3H79 A;  1SL2 B;  4K2X A;  1LJR A;  3O3T A;  4YQV A;  1YKA A;  1HNA A;  3QDN A;  2LJA A;  2B5Y A;  2GQM A;  4AJ7 A;  3E0U A;  5GZZ B;  17GS A;  2H1D A;  3HHV A;  2O87 A;  5DQY A;  3FHK A;  3C71 A;  2ZCT A;  3KD0 A;  10GS A;  5F05 A;  2LRN A;  4TR1 B;  3KP8 A;  3QAV A;  2XBQ A;  4L0U A;  3F63 A;  2L6D A;  2RUF A;  8GSS A;  3A2V A;  5IMA A;  1EEM A;  5AIS A;  2CVD A;  2FCH A;  2H73 A;  2VUP A;  1X5C A;  2HFD A;  3D5J A;  3NZN A;  2R5G A;  3IBH A;  1Y6E A;  5CNW A;  1OKT A;  1QQ2 A;  1YF0 A;  3FYG A;  2R3X A;  1TJD A;  1HNC A;  1E2Y A;  4MZC A;  5G30 A;  1KEB A;  3WT2 A;  5ECM B;  2E2M A;  3WGE A;  3LQ7 A;  4XS6 A;  1YEX A;  1U87 A;  2YJ7 A;  3D6I A;  1BX9 A;  1JZO A;  4KW6 A;  4LLR A;  1PL2 A;  1RW1 A;  1UA5 A;  1F3A A;  1K3O A;  2V6K A;  1JHB A;  1XIY A;  5H5R A;  2UZ8 A;  2C3N A;  4IGJ A;  5IMV A;  2N5F A;  2CT6 A;  3F0I A;  4BA7 A;  2VCX A;  5D8I A;  3EUR A;  1SKR B;  2JSY A;  3GFK A;  3ERF A;  4IQA A;  3FK8 A;  2YCD A;  3EIN A;  4X43 A;  4KND A;  4AGS A;  5GSS A;  2A2S A;  4V2N A;  2GT5 A;  5DVB A;  2XHF A;  4EL1 A;  2GTU A;  4KB3 A;  4AJ6 A;  2EIQ A;  1V9W A;  3TOT A;  4V1A p;  2N5A A;  3IOS A;  2IN3 A;  2C4J A;  5CRG A;  1MEK A;  2FWG A;  3WYW A;  3UOM A;  2VCZ A;  1B8X A;  1SYR A;  1A0R P;  5FHI A;  5KN3 A;  4MF6 A;  1WPI A;  4ZB9 A;  3WT1 A;  2FWE A;  1XW5 A;  3Q74 A;  1EZK A;  1GTU A;  1PGT A;  2MMO A;  2H66 A;  3GA4 A;  4ZIL A;  2FLS A;  4EC0 A;  5DCH A;  3KGK A;  4TOP A;  2H0I A;  3TJB A;  1GWC A;  1WRY A;  3APO A;  1XVW A;  3DXB A;  3F6F A;  1HD2 A;  2DJ0 A;  4YAP A;  1EOG A;  3QFA C;  4I2T A;  4IP6 A;  3EU4 A;  3ZYW A;  4N0Z A;  2HRK A;  4ZB6 A;  2FD3 A;  4JR6 A;  1SJ6 A;  4K0N A;  4EF0 A;  1EV4 A;  1VRS D;  3EMX A;  3GUR A;  4JRR A;  1MTC A;  4TVE A;  2A4H A;  1Z7P A;  4IJI A;  1V98 A;  3EC3 A;  2CX3 A;  5ECN B;  1BYE A;  2E0Q A;  5J9B A;  4WR4 A;  2OAD A;  22GS A;  2GSQ A;  2YZH A;  3ISO A;  4N11 A;  2LTK A;  2GST A;  4ZBD A;  4RI7 A;  4ILF A;  4USS A;  3TJK A;  2CX4 A;  3QCP A;  5COH A;  5ECQ B;  4LL1 B;  2GZP A;  4V2M A;  2C3Q A;  2X8H A;  4MLY A;  5IMZ A;  1THO A;  2O7K A;  3GRX A;  1EP8 A;  1GH2 A;  4XS4 A;  3KJY A;  1PQN A;  3LSZ A;  4NV5 A;  4NWY A;  4TN8 A;  1NSW A;  5LD0 A;  3CBU A;  1K0N A;  2LJR A;  2QGV A;  1PRX A;  4KX4 A;  4K7O A;  4POK A;  4PUF C;  3UAR A;  4GF0 A;  4G0L A;  1XFL A;  4XS1 A;  5ELG A;  2JSZ A;  3ZFB A;  1G7E A;  3EE2 A;  2MMN A;  3PH9 A;  2H0G A;  2I4A A;  2C0G A;  2OBK A;  1F37 A;  5BMU A;  4BL7 B;  2E2G A;  1A8Y A;  2VAF A;  1H75 A;  1OE7 A;  1HQO A;  5IM9 A;  1XWK A;  1G6Y A;  1OC8 A;  4BPY A;  2BJX A;  1TRV A;  1CQH A;  1FOH A;  2L59 A;  2FA8 A;  3Q6O A;  1K0C A;  4DSQ A;  4MZB A;  2YN1 A;  1Z6M A;  1W4V A;  4J56 E;  2OA7 A;  3R3E A;  4KA0 A;  2R0G A;  4ZL7 A;  1PFO A;  5GAN D;  4TXO B;  2DJ1 A;  1EV9 A;  5IMC A;  2YV7 A;  3TGZ A;  1K3L A;  1GL8 A;  4ACS A;  3BBY A;  3HJM A;  4F9Z A;  3ME8 A;  2VOC A;  1YZX A;  4L0W A;  1F9M A;  3TKS A;  5G5F A;  3L0H A;  4GWR A;  4KSM A;  3KMO A;  1FVK A;  5G2Z A;  4BIK A;  1S3D A;  2G2Q A;  2R37 A;  1NW2 A;  2XPE A;  3DEX A;  4K9Z A;  1BAY A;  2WRT A;  2H1B A;  4G10 A;  1EGR A;  3ED3 A;  3E3E A;  1FB6 A;  2L6C A;  5HR0 A;  5J9C A;  1CQG A;  1Q4J A;  2AUV A;  4RQR A;  4D73 B;  4KAE A;  3VWX A;  1XCC A;  2MMZ A;  3F4T A;  3L9U A;  1YY7 A;  4NMU A;  3TDG A;  2M72 A;  4MF5 A;  1JZD A;  2HXK A;  2PPT A;  1EEJ A;  3TRX A;  1K0M A;  5J5N A;  3D21 A;  3KH7 A;  5CYY A;  1TK0 B;  1Q98 A;  1ZCP A;  1SKW B;  4J2F A;  1PN9 A;  4GSN A;  4WEY A;  2H30 A;  3HZ8 A;  1GLP A;  3C8E A;  1K0B A;  5F8B A;  5ENU A;  1J0F A;  2R0C A;  5CO3 A;  3NIV A;  3EWL A;  2X8C A;  3CRT A;  2H19 A;  4K1F A;  3HJP A;  3D22 A;  1B48 A;  2O89 A;  3AY8 A;  3SBC A;  5IOW A;  1ERV A;  1SK1 A;  4TXO A;  5DJL A;  4DVC A;  5F06 A;  4FO5 A;  5CAX A;  4MJE A;  1GSQ A;  4OCF A;  3IR4 A;  4LL4 B;  2R6K A;  4POL A;  1ON4 A;  2ZNM A;  2KHP A;  2YOI A;  3RPN A;  3TKS C;  2DML A;  2DJ3 A;  1M7T A;  3GTU A;  1FB0 A;  5L71 A;  2OBI A;  1W89 A;  4OO4 A;  3UL3 A;  4I8B A;  5HQP A;  2OE0 A;  3DYR A;  3BCI A;  2HNL A;  1O6J A;  1GUH A;  3JCM L;  5C00 A;  2I9H A;  5CRH A;  4KUN A;  3CMI A;  2VCT A;  3P90 A;  4K6X A;  1AC1 A;  5HR2 A;  2LKU A;  4OWY A;  1M3I A;  3HD5 A;  1GUK A;  2XC2 A;  4GQC A;  5B6M A;  4D73 A;  4GSS A;  2GS3 A;  1T1V A;  3ZZX A;  2QSI A;  2OJL A;  1A24 A;  4CHS A;  2G0F A;  2F8F A;  5KOW A;  1N8J A;  4KCA A;  3HKR A;  4K0G A;  2WFC A;  4E8H A;  3CQF A;  5CRD A;  11GS A;  2V32 A;  3A5W A;  2JAD A;  3PPU A;  1SK0 A;  5AIX A;  1PSQ A;  4O32 A;  2GSR A;  3GKN A;  3O6T A;  4ID0 A;  3UBL A;  5DCG A;  2HSH A;  5ABR A;  3FR6 A;  3GYK A;  2YZU A;  1T7P B;  2VLV A;  2H1A A;  4G2E A;  3HVX A;  3KMN A;  1MDJ A;  1TP9 A;  1SYX A;  1R5A A;  3KEB A;  3IHQ A;  2VD1 A;  2JU5 A;  1I5G A;  20GS A;  2IIY A;  4A5P A;  1FHE A;  4RUV A;  2REM A;  2KP1 A;  6GSS A;  3DGQ A;  1ZGN A;  4MPF A;  3ME7 A;  3DKS A;  4CY6 A;  4N0V A;  1YKC A;  4G9H A;  1HNB A;  1VF2 A;  4L5O A;  3A5I A;  4PQH A;  3H93 A;  4MZW A;  4ML1 A;  5A5K A;  3F3Q A;  4EDY A;  2O8V B;  4EUY A;  2YWO A;  3LWA A;  3W8S A;  3QFB C;  1F3B A;  3DWV A;  5DQS A;  4PGT A;  1AXD A;  3KXO A;  3PR8 A;  4FYB A;  1O85 A;  1AQW A;  3MAK A;  4NHW A;  4LA1 A;  2P5Q A;  2B7K A;  4ZXG A;  1DSB A;  3IHG A;  1FO5 A;  1X5E A;  4ICY A;  5DAK B;  3QOU A;  3EMP A;  3CYN A;  1EP7 A;  1Y25 A;  2YNX A;  2HRN A;  1TW9 A;  2V41 A;  3M8N A;  2B5X A;  2M80 A;  1ST9 A;  3QPM A;  1T00 A;  4QL7 A;  2K8V A;  1SD8 A;  2VM2 A;  2ALB A;  4WBJ A;  1OAZ A;  1SL0 B;  2DJJ A;  1O7U A;  4MA9 A;  5CP1 A;  4G19 A;  1Z3E A;  4YQU A;  4PNF A;  19GS A;  1JZR A;  2GSS A;  5H5S A;  1O81 A;  2HI7 A;  16GS A;  4MNN A;  1VF4 A;  4XS4 B;  5J41 A;  2LS5 A;  4X4J A;  3MIX A;  1ZOF A;  3KTB A;  2IMD A;  3G7Y A;  2FY6 A;  4ZBA A;  5ECI B;  4PUR A;  4Q5F A;  2GGT A;  3F9U A;  1K0O A;  3KM6 A;  2H01 A;  1M0U A;  6GSV A;  2DSA A;  4JED A;  4P3Y B;  4GQF A;  1KNG A;  5GST A;  5G1L A;  5ID2 A;  1FG4 A;  4JE1 A;  3GL5 A;  3CTF A;  2XPD A;  4XHM A;  1O73 A;  4ML6 A;  3C7M A;  1TI1 A;  3DD3 A;  3S9F A;  2I81 A;  2JL4 A;  4OO5 A;  1T8E B;  2VL9 A;  4TR4 A;  2FWF A;  4F2I A;  4WR5 A;  3FW2 A;  2DC5 A;  4JU5 A;  3SWL A;  1YQ1 A;  4N10 A;  4IVF A;  5B8A A;  3KTL A;  1U6T A;  5B8B A;  5FWG A;  4JBB A;  2R0P A;  1AW9 A;  3FZ5 A;  5KN1 A;  1EOH A;  4I97 A;  2KOK A;  2L5O A;  2K18 A;  4HEA 2;  2X64 A;  5AN1 A;  2F8A A;  1Z9H A;  4KDU A;  4TW5 A;  3VWU A;  2VCV A;  4GXZ A;  4I5Q A;  4MF7 A;  2JZT A;  3DIE A;  1SU9 A;  2HT9 A;  2CZ2 A;  4X1U A;  2PWJ A;  5DAK A;  5KOX A;  2ON7 A;  5FT3 A;  1JLW A;  2B3S A;  1FAA A;  4IW9 A;  3GX8 A;  1SL1 B;  3GKX A;  4IJ3 A;  4XRD A;  3VI7 A;  3F3R A;  1X9W B;  4KDX A;  4FYC A;  4GLT A;  2BTO T;  1GNE A;  1TOF A;  3F6D A;  3H1N A;  3ZIV A;  2OKA A;  3ZML A;  3IV4 A;  1XWG A;  2RII A;  3MDK A;  1QUW A;  4OD7 A;  1G6W A;  2F51 A;  4E8E A;  3IK9 A;  5JCU A;  1X9S B;  4TXV A;  3FR9 A;  1ZZY A;  2ZUP A;  3VPQ A;  3H8Q A;  3ERW A;  2C0E A;  1M3J A;  3UVH A;  1GP1 A;  2LQO A;  1U88 A;  3FZA A;  3BOA A;  5HR1 A;  5ECP B;  4HQZ A;  9GSS A;  3IC8 A;  2X8G A;  3KH9 A;  3VFI A;  2RLI A;  3GX0 A;  4POM A;  3TOU A;  2H72 A;  2VCW A;  1USB A;  4NPB A;  3RDW A;  4ZIJ A;  5CRW A;  1ACV A;  2PBJ A;  3BCK A;  1X9M B;  2K8S A;  4TR0 A;  2CV4 A;  2L4C A;  5G1K A;  2VD0 A;  2EIO A;  2DMM A;  3M0F A;  2V1M A;  4HDE A;  2B6M A;  1A23 A;  3FY7 A;  1MD3 A;  4XTS A;  3RPP A;  5IMD A;  1ZMA A;  3W6G A;  4WKW A;  2CQ9 A;  2CVK A;  4YQM A;  1T4Y A;  3CRU A;  3N5O A;  3MYD A;  1TK5 B;  2YWM A;  2YWI A;  1Z6N A;  2IJY A;  1V2A A;  4Q5Q A;  4WET A;  3CSJ A;  5IO2 A;  1AAZ A;  5D93 A;  1YF1 A;  4OFT A;  4YKG A;  1PD2 1;  3LEF A;  4EIP A;  3LGC A;  4HS1 A;  4I6X A;  3GTU B;  3LJR A;  4N30 A;  2R4V A;  2L5L A;  2FHE A;  6GSW A;  3QAG A;  1WJK A;  3KIJ A;  1TU7 A;  1FOV A;  1GTA A;  1XG8 A;  3TKR A;  2JZR A;  1A2M A;  2FGX A;  3LOR A;  3TKS E;  3V1W A;  4CY8 A;  3TJF A;  1YDK A;  4FQU A;  4J57 E;  4OFN A;  4MAB A;  2A4V A;  3VWW A;  3M3M A;  3K8N A;  2GQL A;  3GMF A;  3ZVJ D;  2VLT A;  4NV2 A;  4AJ8 A;  1XPV A;  3ERG A;  4H86 A;  4JZQ A;  1NM3 A;  4V1A g;  3J7Y k;  1PMT A;  1A2J A;  1ZYP A;  4Z2T A;  2H0H A;  1GSE A;  5DAL B;  3LFL A;  2LJK A;  4HUA A;  1GLQ A;  2VL2 A;  1FVJ A;  4KDY A;  2H74 A;  2JAC A;  1E6B A;  2MBS A;  5INY A;  1M2A A;  3IA1 A;  2C0D A;  1G7O A;  2QKE A;  3RBT A;  4G0K A;  1IYI A;  3FMW A;  3VK9 A;  1M2D A;  3UIW A;  2GT6 A;  2ON5 A;  1SD9 A;  3MWH A;  4BVX B;  4HSC X;  4GCI A;  1MDI A;  2WGR A;  1BQ7 A;  4HU9 A;  3VUR A;  5ECH B;  2DIY A;  2HYX A;  1AQV A;  2DJ2 A;  2XBI A;  2YPM A;  4O5Q A;  3IDV A;  2IFQ A;  4MJB A;  5G5E A;  1JLV A;  2GDR A;  2C80 A;  4ULX A;  4L8E A;  3J7Y b;  1KBN A;  4NXI A;  3GHA A;  1LBK A;  3TRP A;  3ZIJ A;  4F03 A;  2JZS A;  4K7N A;  1R5P A;  4TRX A;  3GKK A;  2AB6 A;  1WIK A;  2DKH A;  2DLX A;  2VCQ A;  2D2Z A;  3LYK A;  3GN3 A;  2WUL A;  3EPT A;  5JWO B;  1N2A A;  1OYJ A;  1OC9 A;  2OE1 A;  1R7H A;  4NHZ A;  3UVT A;  4ZB8 A;  4LMV A;  2MYG A;  1TDI A;  1H4O A;  1B9X C;  1K0D A;  4KF9 A;  3U5R E;  4RQX A;  5BRT A;  1XW6 A;  2AHE A;  4GTU A;  2NTO A;  13GS A;  4ECB A;  1TU8 A;  1PN0 A;  3IRA A;  4HI7 A;  14GS A;  4KH7 A;  1MD4 A;  4G0I A;  3QD9 A;  1PL1 A;  3GSS A;  5DAL A;  5CRE A;  1GTB A;  4XCS A;  1OVN A;  4DSS A;  1ZYQ B;  1C72 A;  5ECS A;  3TUE A;  1A2L A;  1WMJ A;  2VL2 C;  1JZW A;  4IS0 A;  2LRC A;  4Q5N A;  2NVL A;  1NHY A;  4WF5 A;  2F3M A;  1PX6 A;  3IAS 2;  5D9X A;  4WF4 A;  3ZLP A;  1MDK A;  3RAZ A;  4MPG A;  1NHO A;  3I69 A;  4K2D A;  2FA4 A;  4BVX A;  4MJA A;  18GS A;  2IPA A;  3UAP A;  3WGX A;  4K5S A;  3M9J A;  2GZY A;  1IYH A;  3F4R A;  5LNK e;  5IPG A;  3N9J A;  3TKP A;  3DVW A;  5A4W A;  3HVN A;  2MZC A;  1DUG A;  1ERU A;  4YKF A;  5ID2 B;  1S3A A;  1URM A;  2MBT A;  3APS A;  4KE3 A;  2C8U A;  4Z7X A;  2LQQ A;  3TB2 A;  4EVM A;  4HOJ A;  5JWQ B;  1WOU A;  3VPT A;  1SKS B;  2HRF A;  5GAP D;  3L9V A;  1XZO A;  2P31 A;  1OE8 A;  2C0F A;  2NDO A;  3ZRD A;  5C04 A;  2B5E A;  2F9S A;  4YH2 A;  2J9H A;  2P5R A;  1ABA A;  1J9B A;  3PIN A;  2X99 A;  5E4W A;  2YWN A;  4IEL A;  3D4M A;  3EYT A;  2HRA A;  4F82 A;  1QGV A;  3LXT A;  2WDU A;  3ZMK A;  2HE3 A;  2KLX A;  3D0Z A;  1UN2 A;  2LUS A;  4POB A;  1GNW A;  5EY6 A;  2CAI A;  1XWB A;  4MMM A;  1TKD B;  3CTG A;  4MP4 A;  4ECC A;  1GSF A;  5E59 A;  3L78 A;  5F0G A;  3Q19 A;  3FKF A;  3TCO A;  2B7J A;  2A2R A;  3U6V A;  3ZIT A;  2X49 A;  3VWV A;  3M9K A;  4FIW A;  4IBP A;  3VI5 A;  4K7I A;  2IL3 A;  5D9W A;  5D96 A;  2HSM A;  4HQS A;  5KEJ A;  2LST A;  3L9S A;  2X4A A;  1RQM A;  1ERW A;  3GV1 A;  3HVV A;  2PER A;  1X5D A;  3LYP A;  1VF1 A;  4BWQ A;  4O92 A;  2QA2 A;  2EC4 A;  2O85 A;  2PU9 C;  2K9F A;  1XXU A;  3Q18 A;  1WP0 A;  2VLU A;  5ECL B;  2LEG A;  1TXX A;  3G9B A;  5D9V A;  1M9A A;  5ECR B;  4PX1 A;  4DSR A;  3KCM A;  3FEU A;  3FRC A;  3M1G A;  1ERT A;  5AGY A;  3ZVJ A;  2B1L A;  2HZF A;  2HSY A;  5IO0 A;  2N5B A;  1BJX A;  2PN8 A;  2V2G A;  2K6V A;  2CA8 A;  2TRX A;  2CVB A;  3KP9 A;  2BMX A;  3MNG A;  3LXZ A;  5A4U A;  3UBK A;  1GSU A;  3IAM 2;  5LCZ A; 
#chains in the Genus database with same CATH homology
 3UEM A;  2QA1 A;  3MSZ A;  2OE3 A;  5J4U A;  4ECI A;  1ZL9 A;  3QAW A;  4KGI A;  2PMT A;  2C3T A;  1PKZ A;  1SJZ A;  4OMV A;  4IKH A;  5KN0 A;  1BED A;  3C73 A;  2H6Y A;  4TR3 A;  4HZ2 A;  5JWR B;  3C1S A;  4TR1 A;  4XRA A;  1TRU A;  2HZE B;  5ECO B;  4ZBB A;  2GZZ A;  2C1Y A;  2GVP A;  2YAN A;  4Z2U A;  1THX A;  3APQ A;  1PA3 A;  3HA9 A;  5H5Q A;  1HYU A;  3R2Q A;  2YJH A;  2KUC A;  3VLN A;  2VIM A;  1SK2 A;  3ZTL A;  1XOB A;  3GUS A;  1ZYE A;  5IPH A;  3P2A A;  3G7J A;  2DKI A;  3GST A;  4DEJ A;  6GST A;  5HR3 A;  2CAQ A;  1JFU A;  4F0B A;  3IE3 A;  4IQ1 A;  4PNG A;  1TRW A;  2FNO A;  4EO3 A;  3HCZ A;  1GSD A;  3ZFL A;  3EVI A;  1VGL A;  2WZ9 A;  3CSH A;  3QR6 A;  3ZL5 A;  4O5R A;  1GUL A;  1VF3 A;  4HJ2 A;  5G31 A;  4ISD A;  1XOA A;  1XWA A;  3HY2 A;  1WWJ A;  4V2L A;  4Q5R A;  4PQI A;  1UC7 A;  1AUC A;  1J08 A;  2B1K A;  2H75 A;  4OFM A;  5EVO A;  4IP1 A;  5EPF A;  4PTS A;  1GSS A;  5DBQ A;  2EIR A;  1RK4 A;  4L5L A;  2H1G A;  4MK3 A;  4YAV A;  3FZ9 A;  4PUA A;  2IME A;  1TK8 B;  3GH9 A;  3A2X A;  3L4N A;  3ZRE A;  4RI6 A;  3W8J A;  2FWH A;  3OR5 A;  1OKD A;  5HFK A;  1EWX A;  3F8U A;  2I3Y A;  4PXO A;  1TRS A;  2OAC A;  2YP6 A;  2AV4 A;  2IWT A;  4IHU A;  3KZQ A;  1QK8 A;  2IFQ B;  2NBS A;  5J3R A;  1M99 A;  1V58 A;  3GIX A;  1ILO A;  4CDO A;  2MMA A;  1U3I A;  3TJJ A;  5IMF A;  3HYP A;  4WBR D;  3G7I A;  3IPZ A;  2HZE A;  2FUG 2;  3A2W A;  1A8L A;  5HFI A;  5F07 A;  3O76 A;  1XBS A;  5D73 A;  2RM5 A;  5ELA A;  4ECJ A;  1GUM A;  4HZ4 A;  1EGO A;  1OC9 B;  2TIR A;  1M2B A;  1I9D A;  3P8W A;  2WCI A;  5D9T A;  1K3Y A;  1UVZ A;  3US3 A;  1R26 A;  2I1U A;  5IOX A;  1YEP A;  4Z2R A;  2M46 A;  2RM6 A;  1TI3 A;  3GH6 A;  4I2U A;  1O8X A;  5IQY A;  3GNJ A;  4KCE A;  4OCE A;  3D4T A;  2PVO C;  3CXG A;  1DE1 A;  2VM1 A;  2LNT A;  4EIQ A;  1ML6 A;  3F4S A;  1DBY A;  3HDC A;  1BG5 A;  4O7H A;  3HJO A;  6GSX A;  5JCG A;  5ECK B;  2LRT A;  5IIZ A;  1AIU A;  2L57 A;  1LU4 A;  5DDL A;  2YV9 A;  3H4K A;  5DJM A;  3BD2 A;  2WB9 A;  1F6M C;  1PX7 A;  3LW9 A;  4XIH A;  4ZL9 A;  4HU7 A;  2Z9S A;  4BWS A;  4DSS B;  4BVY B;  1YJ6 A;  4X0X A;  4EDZ A;  1SJI A;  2AJQ B;  4MDC A;  1XWC A;  2IMF A;  2H70 A;  3DRN A;  1QFN A;  1XVQ A;  2CZ3 A;  2KP2 A;  3GKM A;  4MH3 A;  4AF2 A;  2V6O A;  2H71 A;  3HZ4 A;  1V57 A;  2H6Z A;  3WGD A;  4BL7 A;  3PGT A;  2GQK A;  1T3B A;  1Z7R A;  4TKY A;  2P0G A;  4IN0 A;  1T4Z A;  3C1R A;  1Z5Y E;  1S3C A;  5HFG A;  2AAW A;  1G0T A;  2WJU A;  1AQX A;  7GSS A;  2RUE A;  4LMW A;  1XW9 A;  3IXR A;  5B7C A;  4EKZ A;  4MH2 A;  4WXT A;  2TRC P;  3LG6 A;  12GS A;  1WE0 A;  5AIV A;  3TJG A;  2H8L A;  2VL3 A;  2LNS A;  1B4Q A;  3P7X A;  3I43 A;  3HVS A;  2IMI A;  2L4Q A;  1QMV A;  1SEN A;  4O5U A;  2ES7 A;  2AYT A;  1GTI A;  1U3A A;  4KSO A;  4EXJ A;  2GLR A;  3I9V 2;  1DE2 A;  2WS2 A;  2HLS A;  1FW1 A;  4ZL8 A;  5A4V A;  2R2J A;  2A2P A;  1X0R A;  2PVQ A;  3EU3 A;  3TRQ A;  4QL9 A;  4NAX A;  2DIZ A;  3TKQ A;  1O8W A;  2LV3 A;  2VO4 A;  4BVY A;  3FZ4 A;  5B6N A;  2J23 A;  3DVX A;  3I6A A;  3DML A;  1A0F A;  2IMK A;  4CW9 A;  1K0A A;  1QXH A;  1OC3 A;  3UJ1 A;  1KTE A;  2H76 A;  4GST A;  2H6X A;  4PQ1 A;  3BJ5 A;  3CSI A;  4K8M A;  2NPB A;  5KN2 A;  1B9Y C;  4QQ7 A;  2DBC A;  2E7P A;  1M9B A;  1PKW A;  4F0C A;  3RHC A;  1R4W A;  6GSU A;  2PUK C;  1GSY A;  4FH8 A;  4EE0 A;  1V40 A;  4JR4 A;  2DJK A;  2PGT A;  4K5R A;  5JCW A;  2QC7 A;  1F2E A;  3WD6 A;  4HJM A;  1GRX A;  3QMX A;  4MJC A;  4GRF A;  5EL8 A;  3IC4 A;  3UMA A;  6GSY A;  1ZYN A;  3A3T A;  3FR3 A;  3IK7 A;  3HXS A;  4FYU A;  4MCU A;  1B4P A;  3RHB A;  3NOF A;  1TTZ A;  3E9J B;  3GL3 A;  3H79 A;  1SL2 B;  4K2X A;  1LJR A;  3O3T A;  4YQV A;  1YKA A;  1HNA A;  3QDN A;  2LJA A;  2B5Y A;  2GQM A;  4AJ7 A;  3E0U A;  5GZZ B;  17GS A;  2H1D A;  3HHV A;  2O87 A;  5DQY A;  3FHK A;  3C71 A;  2ZCT A;  3KD0 A;  10GS A;  5F05 A;  2LRN A;  4TR1 B;  3KP8 A;  3QAV A;  2XBQ A;  4L0U A;  3F63 A;  2L6D A;  2RUF A;  8GSS A;  3A2V A;  5IMA A;  1EEM A;  5AIS A;  2CVD A;  2FCH A;  2H73 A;  2VUP A;  1X5C A;  2HFD A;  3D5J A;  3NZN A;  2R5G A;  3IBH A;  1Y6E A;  5CNW A;  1OKT A;  1QQ2 A;  1YF0 A;  3FYG A;  2R3X A;  1TJD A;  1HNC A;  1E2Y A;  4MZC A;  5G30 A;  1KEB A;  3WT2 A;  5ECM B;  2E2M A;  3WGE A;  3LQ7 A;  4XS6 A;  1YEX A;  1U87 A;  2YJ7 A;  3D6I A;  1BX9 A;  1JZO A;  4KW6 A;  4LLR A;  1PL2 A;  1RW1 A;  1UA5 A;  1F3A A;  1K3O A;  2V6K A;  1JHB A;  1XIY A;  5H5R A;  2UZ8 A;  2C3N A;  4IGJ A;  5IMV A;  2N5F A;  2CT6 A;  3F0I A;  4BA7 A;  2VCX A;  5D8I A;  3EUR A;  1SKR B;  2JSY A;  3GFK A;  3ERF A;  4IQA A;  3FK8 A;  2YCD A;  3EIN A;  4X43 A;  4KND A;  4AGS A;  5GSS A;  2A2S A;  4V2N A;  2GT5 A;  5DVB A;  2XHF A;  4EL1 A;  2GTU A;  4KB3 A;  4AJ6 A;  2EIQ A;  1V9W A;  3TOT A;  4V1A p;  2N5A A;  3IOS A;  2IN3 A;  2C4J A;  5CRG A;  1MEK A;  2FWG A;  3WYW A;  3UOM A;  2VCZ A;  1B8X A;  1SYR A;  1A0R P;  5FHI A;  5KN3 A;  4MF6 A;  1WPI A;  4ZB9 A;  3WT1 A;  2FWE A;  1XW5 A;  3Q74 A;  1EZK A;  1GTU A;  1PGT A;  2MMO A;  2H66 A;  3GA4 A;  4ZIL A;  2FLS A;  4EC0 A;  5DCH A;  3KGK A;  4TOP A;  2H0I A;  3TJB A;  1GWC A;  1WRY A;  3APO A;  1XVW A;  3DXB A;  3F6F A;  1HD2 A;  2DJ0 A;  4YAP A;  1EOG A;  3QFA C;  4I2T A;  4IP6 A;  3EU4 A;  3ZYW A;  4N0Z A;  2HRK A;  4ZB6 A;  2FD3 A;  4JR6 A;  1SJ6 A;  4K0N A;  4EF0 A;  1EV4 A;  1VRS D;  3EMX A;  3GUR A;  4JRR A;  1MTC A;  4TVE A;  2A4H A;  1Z7P A;  4IJI A;  1V98 A;  3EC3 A;  2CX3 A;  5ECN B;  1BYE A;  2E0Q A;  5J9B A;  4WR4 A;  2OAD A;  22GS A;  2GSQ A;  2YZH A;  3ISO A;  4N11 A;  2LTK A;  2GST A;  4ZBD A;  4RI7 A;  4ILF A;  4USS A;  3TJK A;  2CX4 A;  3QCP A;  5COH A;  5ECQ B;  4LL1 B;  2GZP A;  4V2M A;  2C3Q A;  2X8H A;  4MLY A;  5IMZ A;  1THO A;  2O7K A;  3GRX A;  1EP8 A;  1GH2 A;  4XS4 A;  3KJY A;  1PQN A;  3LSZ A;  4NV5 A;  4NWY A;  4TN8 A;  1NSW A;  5LD0 A;  3CBU A;  1K0N A;  2LJR A;  2QGV A;  1PRX A;  4KX4 A;  4K7O A;  4POK A;  4PUF C;  3UAR A;  4GF0 A;  4G0L A;  1XFL A;  4XS1 A;  5ELG A;  2JSZ A;  3ZFB A;  1G7E A;  3EE2 A;  2MMN A;  3PH9 A;  2H0G A;  2I4A A;  2C0G A;  2OBK A;  1F37 A;  5BMU A;  4BL7 B;  2E2G A;  1A8Y A;  2VAF A;  1H75 A;  1OE7 A;  1HQO A;  5IM9 A;  1XWK A;  1G6Y A;  1OC8 A;  4BPY A;  2BJX A;  1TRV A;  1CQH A;  1FOH A;  2L59 A;  2FA8 A;  3Q6O A;  1K0C A;  4DSQ A;  4MZB A;  2YN1 A;  1Z6M A;  1W4V A;  4J56 E;  2OA7 A;  3R3E A;  4KA0 A;  2R0G A;  4ZL7 A;  5GAN D;  4TXO B;  2DJ1 A;  1EV9 A;  5IMC A;  2YV7 A;  3TGZ A;  1K3L A;  1GL8 A;  4ACS A;  3BBY A;  3HJM A;  4F9Z A;  3ME8 A;  2VOC A;  1YZX A;  4L0W A;  1F9M A;  3TKS A;  5G5F A;  3L0H A;  4GWR A;  4KSM A;  3KMO A;  1FVK A;  5G2Z A;  1S3D A;  2G2Q A;  2R37 A;  1NW2 A;  2XPE A;  3DEX A;  4K9Z A;  1BAY A;  2WRT A;  2H1B A;  4G10 A;  1EGR A;  3ED3 A;  3E3E A;  1FB6 A;  2L6C A;  5HR0 A;  5J9C A;  1CQG A;  1Q4J A;  2AUV A;  4RQR A;  4D73 B;  4KAE A;  3VWX A;  1XCC A;  2MMZ A;  3F4T A;  3L9U A;  1YY7 A;  4NMU A;  3TDG A;  2M72 A;  4MF5 A;  1JZD A;  2HXK A;  2PPT A;  1EEJ A;  3TRX A;  1K0M A;  5J5N A;  3D21 A;  3KH7 A;  5CYY A;  1TK0 B;  1Q98 A;  1ZCP A;  1SKW B;  4J2F A;  1PN9 A;  4GSN A;  4WEY A;  2H30 A;  3HZ8 A;  1GLP A;  3C8E A;  1K0B A;  5F8B A;  5ENU A;  1J0F A;  2R0C A;  5CO3 A;  3NIV A;  3EWL A;  2X8C A;  3CRT A;  2H19 A;  4K1F A;  3HJP A;  3D22 A;  1B48 A;  2O89 A;  3AY8 A;  3SBC A;  5IOW A;  1ERV A;  1SK1 A;  4TXO A;  5DJL A;  4DVC A;  5F06 A;  4FO5 A;  5CAX A;  4MJE A;  1GSQ A;  4OCF A;  3IR4 A;  4LL4 B;  2R6K A;  4POL A;  1ON4 A;  2ZNM A;  2KHP A;  2YOI A;  3RPN A;  3TKS C;  2DML A;  2DJ3 A;  1M7T A;  3GTU A;  1FB0 A;  5L71 A;  2OBI A;  1W89 A;  4OO4 A;  3UL3 A;  4I8B A;  5HQP A;  2OE0 A;  3DYR A;  3BCI A;  2HNL A;  1O6J A;  1GUH A;  3JCM L;  5C00 A;  2I9H A;  5CRH A;  4KUN A;  3CMI A;  2VCT A;  3P90 A;  4K6X A;  1AC1 A;  5HR2 A;  2LKU A;  4OWY A;  3HD5 A;  1GUK A;  2XC2 A;  4GQC A;  5B6M A;  4D73 A;  4GSS A;  2GS3 A;  1T1V A;  3ZZX A;  2QSI A;  2OJL A;  1A24 A;  4CHS A;  2G0F A;  2F8F A;  5KOW A;  1N8J A;  4KCA A;  3HKR A;  4K0G A;  2WFC A;  4E8H A;  5CRD A;  11GS A;  2V32 A;  3A5W A;  2JAD A;  3PPU A;  1SK0 A;  5AIX A;  1PSQ A;  4O32 A;  2GSR A;  3GKN A;  3O6T A;  4ID0 A;  3UBL A;  5DCG A;  2HSH A;  5ABR A;  3FR6 A;  3GYK A;  2YZU A;  1T7P B;  2VLV A;  2H1A A;  4G2E A;  3HVX A;  3KMN A;  1MDJ A;  1TP9 A;  1SYX A;  1R5A A;  3KEB A;  3IHQ A;  2VD1 A;  2JU5 A;  1I5G A;  20GS A;  2IIY A;  4A5P A;  1FHE A;  4RUV A;  2REM A;  2KP1 A;  6GSS A;  3DGQ A;  1ZGN A;  4MPF A;  3ME7 A;  3DKS A;  4CY6 A;  4N0V A;  1YKC A;  4G9H A;  1HNB A;  1VF2 A;  4L5O A;  3A5I A;  4PQH A;  3H93 A;  4MZW A;  4ML1 A;  5A5K A;  3F3Q A;  4EDY A;  2O8V B;  4EUY A;  2YWO A;  3LWA A;  3W8S A;  3QFB C;  1F3B A;  3DWV A;  5DQS A;  4PGT A;  1AXD A;  3KXO A;  3PR8 A;  4FYB A;  1O85 A;  1AQW A;  3MAK A;  4NHW A;  4LA1 A;  2P5Q A;  2B7K A;  4ZXG A;  1DSB A;  3IHG A;  1FO5 A;  1X5E A;  4ICY A;  5DAK B;  3QOU A;  3EMP A;  3CYN A;  1EP7 A;  1Y25 A;  2YNX A;  2HRN A;  1TW9 A;  2V41 A;  3M8N A;  2B5X A;  2M80 A;  1ST9 A;  3QPM A;  1T00 A;  4QL7 A;  2K8V A;  1SD8 A;  2VM2 A;  2ALB A;  4WBJ A;  1OAZ A;  1SL0 B;  2DJJ A;  1O7U A;  4MA9 A;  5CP1 A;  4G19 A;  1Z3E A;  4YQU A;  4PNF A;  19GS A;  1JZR A;  2GSS A;  5H5S A;  1O81 A;  2HI7 A;  16GS A;  4MNN A;  1VF4 A;  4XS4 B;  5J41 A;  2LS5 A;  4X4J A;  3MIX A;  1ZOF A;  3KTB A;  2IMD A;  3G7Y A;  2FY6 A;  4ZBA A;  5ECI B;  4PUR A;  4Q5F A;  2GGT A;  3F9U A;  1K0O A;  3KM6 A;  2H01 A;  1M0U A;  6GSV A;  2DSA A;  4JED A;  4P3Y B;  4GQF A;  1KNG A;  5GST A;  5G1L A;  5ID2 A;  1FG4 A;  4JE1 A;  3GL5 A;  3CTF A;  2XPD A;  4XHM A;  1O73 A;  4ML6 A;  3C7M A;  1TI1 A;  3DD3 A;  3S9F A;  2I81 A;  2JL4 A;  4OO5 A;  1T8E B;  2VL9 A;  4TR4 A;  2FWF A;  4F2I A;  4WR5 A;  3FW2 A;  2DC5 A;  4JU5 A;  3SWL A;  1YQ1 A;  4N10 A;  4IVF A;  5B8A A;  3KTL A;  1U6T A;  5B8B A;  5FWG A;  4JBB A;  2R0P A;  1AW9 A;  3FZ5 A;  5KN1 A;  1EOH A;  4I97 A;  2KOK A;  2L5O A;  2K18 A;  4HEA 2;  2X64 A;  5AN1 A;  2F8A A;  1Z9H A;  4KDU A;  4TW5 A;  3VWU A;  2VCV A;  4GXZ A;  4I5Q A;  4MF7 A;  2JZT A;  3DIE A;  1SU9 A;  2HT9 A;  2CZ2 A;  4X1U A;  2PWJ A;  5DAK A;  5KOX A;  2ON7 A;  5FT3 A;  1JLW A;  2B3S A;  1FAA A;  4IW9 A;  3GX8 A;  1SL1 B;  3GKX A;  4IJ3 A;  4XRD A;  3VI7 A;  3F3R A;  1X9W B;  4KDX A;  4FYC A;  4GLT A;  2BTO T;  1GNE A;  1TOF A;  3F6D A;  3H1N A;  3ZIV A;  2OKA A;  3ZML A;  3IV4 A;  1XWG A;  2RII A;  3MDK A;  1QUW A;  4OD7 A;  1G6W A;  2F51 A;  4E8E A;  3IK9 A;  5JCU A;  1X9S B;  4TXV A;  3FR9 A;  1ZZY A;  2ZUP A;  3VPQ A;  3H8Q A;  3ERW A;  2C0E A;  3UVH A;  1GP1 A;  2LQO A;  1U88 A;  3FZA A;  3BOA A;  5HR1 A;  5ECP B;  4HQZ A;  9GSS A;  3IC8 A;  2X8G A;  3KH9 A;  3VFI A;  2RLI A;  3GX0 A;  4POM A;  3TOU A;  2H72 A;  2VCW A;  1USB A;  4NPB A;  3RDW A;  4ZIJ A;  5CRW A;  1ACV A;  2PBJ A;  3BCK A;  1X9M B;  2K8S A;  4TR0 A;  2CV4 A;  2L4C A;  5G1K A;  2VD0 A;  2EIO A;  2DMM A;  3M0F A;  2V1M A;  4HDE A;  2B6M A;  1A23 A;  3FY7 A;  1MD3 A;  4XTS A;  3RPP A;  5IMD A;  1ZMA A;  3W6G A;  4WKW A;  2CQ9 A;  2CVK A;  4YQM A;  1T4Y A;  3CRU A;  3N5O A;  3MYD A;  1TK5 B;  2YWM A;  2YWI A;  1Z6N A;  2IJY A;  1V2A A;  4Q5Q A;  4WET A;  3CSJ A;  5IO2 A;  1AAZ A;  5D93 A;  1YF1 A;  4OFT A;  4YKG A;  1PD2 1;  3LEF A;  4EIP A;  3LGC A;  4HS1 A;  4I6X A;  3GTU B;  3LJR A;  4N30 A;  2R4V A;  2L5L A;  2FHE A;  6GSW A;  3QAG A;  1WJK A;  3KIJ A;  1TU7 A;  1FOV A;  1GTA A;  3TKR A;  2JZR A;  1A2M A;  2FGX A;  3LOR A;  3TKS E;  3V1W A;  4CY8 A;  3TJF A;  1YDK A;  4FQU A;  4J57 E;  4OFN A;  4MAB A;  2A4V A;  3VWW A;  3M3M A;  3K8N A;  2GQL A;  3GMF A;  3ZVJ D;  2VLT A;  4NV2 A;  4AJ8 A;  1XPV A;  3ERG A;  4H86 A;  4JZQ A;  1NM3 A;  4V1A g;  3J7Y k;  1PMT A;  1A2J A;  1ZYP A;  4Z2T A;  2H0H A;  1GSE A;  5DAL B;  3LFL A;  2LJK A;  4HUA A;  1GLQ A;  2VL2 A;  1FVJ A;  4KDY A;  2H74 A;  2JAC A;  1E6B A;  2MBS A;  5INY A;  1M2A A;  3IA1 A;  2C0D A;  1G7O A;  2QKE A;  3RBT A;  4G0K A;  1IYI A;  3FMW A;  3VK9 A;  1M2D A;  3UIW A;  2GT6 A;  2ON5 A;  1SD9 A;  3MWH A;  4BVX B;  4GCI A;  1MDI A;  2WGR A;  1BQ7 A;  4HU9 A;  3VUR A;  5ECH B;  2DIY A;  2HYX A;  1AQV A;  2DJ2 A;  2XBI A;  2YPM A;  4O5Q A;  3IDV A;  2IFQ A;  4MJB A;  5G5E A;  1JLV A;  2GDR A;  2C80 A;  4ULX A;  4L8E A;  3J7Y b;  1KBN A;  4NXI A;  3GHA A;  1LBK A;  3TRP A;  3ZIJ A;  4F03 A;  2JZS A;  4K7N A;  1R5P A;  4TRX A;  3GKK A;  2AB6 A;  1WIK A;  2DKH A;  2DLX A;  2VCQ A;  2D2Z A;  3LYK A;  3GN3 A;  2WUL A;  3EPT A;  5JWO B;  1N2A A;  1OYJ A;  1OC9 A;  2OE1 A;  1R7H A;  4NHZ A;  3UVT A;  4ZB8 A;  4LMV A;  2MYG A;  1TDI A;  1H4O A;  1B9X C;  1K0D A;  4KF9 A;  3U5R E;  4RQX A;  5BRT A;  1XW6 A;  2AHE A;  4GTU A;  2NTO A;  13GS A;  4ECB A;  1TU8 A;  1PN0 A;  3IRA A;  4HI7 A;  14GS A;  4KH7 A;  1MD4 A;  4G0I A;  3QD9 A;  1PL1 A;  3GSS A;  5DAL A;  5CRE A;  1GTB A;  4XCS A;  1OVN A;  4DSS A;  1ZYQ B;  1C72 A;  5ECS A;  3TUE A;  1A2L A;  1WMJ A;  2VL2 C;  1JZW A;  4IS0 A;  2LRC A;  4Q5N A;  2NVL A;  1NHY A;  4WF5 A;  2F3M A;  1PX6 A;  3IAS 2;  5D9X A;  4WF4 A;  3ZLP A;  1MDK A;  3RAZ A;  4MPG A;  1NHO A;  3I69 A;  4K2D A;  2FA4 A;  4BVX A;  4MJA A;  18GS A;  2IPA A;  3UAP A;  3WGX A;  4K5S A;  3M9J A;  2GZY A;  1IYH A;  3F4R A;  5LNK e;  5IPG A;  3N9J A;  3TKP A;  3DVW A;  5A4W A;  2MZC A;  1DUG A;  1ERU A;  4YKF A;  5ID2 B;  1S3A A;  1URM A;  2MBT A;  3APS A;  4KE3 A;  2C8U A;  4Z7X A;  2LQQ A;  3TB2 A;  4EVM A;  4HOJ A;  5JWQ B;  1WOU A;  3VPT A;  1SKS B;  2HRF A;  5GAP D;  3L9V A;  1XZO A;  2P31 A;  1OE8 A;  2C0F A;  2NDO A;  3ZRD A;  5C04 A;  2B5E A;  2F9S A;  4YH2 A;  2J9H A;  2P5R A;  1ABA A;  1J9B A;  3PIN A;  2X99 A;  5E4W A;  2YWN A;  4IEL A;  3D4M A;  3EYT A;  2HRA A;  4F82 A;  1QGV A;  3LXT A;  2WDU A;  3ZMK A;  2HE3 A;  2KLX A;  3D0Z A;  1UN2 A;  2LUS A;  4POB A;  1GNW A;  5EY6 A;  2CAI A;  1XWB A;  4MMM A;  1TKD B;  3CTG A;  4MP4 A;  4ECC A;  1GSF A;  5E59 A;  3L78 A;  5F0G A;  3Q19 A;  3FKF A;  3TCO A;  2B7J A;  2A2R A;  3U6V A;  3ZIT A;  2X49 A;  3VWV A;  3M9K A;  4FIW A;  4IBP A;  3VI5 A;  4K7I A;  2IL3 A;  5D9W A;  5D96 A;  2HSM A;  4HQS A;  5KEJ A;  2LST A;  3L9S A;  2X4A A;  1RQM A;  1ERW A;  3GV1 A;  3HVV A;  2PER A;  1X5D A;  3LYP A;  1VF1 A;  4BWQ A;  4O92 A;  2QA2 A;  2EC4 A;  2O85 A;  2PU9 C;  2K9F A;  1XXU A;  3Q18 A;  1WP0 A;  2VLU A;  5ECL B;  2LEG A;  1TXX A;  3G9B A;  5D9V A;  1M9A A;  5ECR B;  4PX1 A;  4DSR A;  3KCM A;  3FEU A;  3FRC A;  3M1G A;  1ERT A;  5AGY A;  3ZVJ A;  2B1L A;  2HZF A;  2HSY A;  5IO0 A;  2N5B A;  1BJX A;  2PN8 A;  2V2G A;  2K6V A;  2CA8 A;  2TRX A;  2CVB A;  3KP9 A;  2BMX A;  3MNG A;  3LXZ A;  5A4U A;  3UBK A;  1GSU A;  3IAM 2;  5LCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...