3ZVJA

Crystal structure of high molecular weight (hmw) form of peroxiredoxin i from schistosoma mansoni
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
165
structure length
165
Chain Sequence
MVLLPNRPAPEFKGQAVINGEFKEICLKDYRGKYVVLFFYPADFTFVCPTEIIAFSDQVEEFNSRNCQVIACSTDSQYSHLAWDNLDRKSGGLGHMKIPLLADRKQEISKAYGVFDEEDGNAFRGLFIIDPNGILRQITINDKPVGRSVDETLRLLDAFQFVEKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN PEROXIDASE
publication title Moonlighting by Different Stressors: Crystal Structure of the Chaperone Species of a 2-Cys Peroxiredoxin.
pubmed doi rcsb
source organism Schistosoma mansoni
total genus 33
structure length 165
sequence length 165
chains with identical sequence B, C, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3zvjA00
3UBKA 2C0FA 4DVCA 1TJDA 3N9JA 1EV4A 5E59A 4AJ8A 4O7HA 2JZTA 2H0HA 1V57A 1ZYEA 2FCHA 4WR4A 3EMPA 2XPDA 4F0CA 3KTBA 1XVQA 1SJZA 5C04A 5FT3A 4TN8A 5D73A 3HD5A 3WGEA 5D8IA 4CDOA 4JR4A 4K6XA 4XS4A 3RPPA 5AISA 2B7KA 3KMNA 1SJIA 3GX0A 2VL2C 2Z9SA 1TRSA 2LKUA 1XWCA 2IMEA 4TKYA 3LWAA 1EWXA 3ERWA 4I6XA 4MPGA 2X8HA 5HR3A 3ZIVA 3ZRDA 4JEDA 19GSA 4DSRA 1XBSA 4I5QA 1Z7PA 1U3IA 2TRCP 1QUWA 3DRNA 3I43A 1S3DA 3RDWA 4EUYA 1ERWA 4HI7A 3UVHA 1ERVA 4NMUA 3FR9A 4KSOA 4K9ZA 4WBRD 3CBUA 3LORA 3TRPA 2M72A 1XW5A 4RI7A 4ZL7A 1X9WB 4LMWA 5AIVA 1XCCA 3GSSA 1A24A 1DUGA 1K0OA 4WXTA 1HNBA 5CO3A 2CVDA 2WRTA 4KX4A 1Y25A 4GWRA 3IE3A 4I2TA 1AQWA 18GSA 3DVXA 3U6VA 4EE0A 4V2NA 2YCDA 4JR6A 2E7PA 2G0FA 5HFKA 4RQRA 1K0NA 1U87A 1A8YA 2VM2A 4TW5A 2P5QA 1CQHA 4LA1A 1HYUA 4XRDA 5EY6A 1TXXA 3TUEA 1MEKA 1GWCA 2R4VA 4N0VA 2B1LA 1ML6A 4GQCA 1BG5A 3KXOA 3SBCA 4MJBA 2C0GA 3TOTA 4XS1A 3W6GA 22GSA 2YJHA 2YWMA 1IYIA 3HJOA 1GH2A 3DIEA 1SKWB 4OO4A 5EVOA 1AC1A 3ME8A 3QD9A 2N5FA 4XCSA 3TJJA 3WGDA 3D4MA 4HJMA 1Z9HA 2YOIA 1T4YA 2EIRA 4ML6A 2B5YA 3NIVA 3LSZA 1JHBA 1K0DA 5ECOB 5EL8A 5ENUA 5DDLA 2PUKC 4PQIA 3Q18A 3ME7A 2HZEB 4XS6A 1GL8A 8GSSA 3GYKA 5DCGA 3DMLA 1Y6EA 3UEMA 1I9DA 3KMOA 1FVJA 4RUVA 5COHA 1SJ6A 3VFIA 3LYPA 1Q4JA 4FIWA 4KW6A 3NZNA 2LRTA 3TKQA 2C1YA 3VK9A 1TI3A 3GIXA 2IL3A 3UMAA 2VLUA 4PNGA 2V6KA 3IK7A 1VF3A 2JADA 3BCIA 2OBIA 4E8HA 2I1UA 2NVLA 1UA5A 3F0IA 2XPEA 2M46A 2DJ1A 1G7EA 2MBSA 1GLPA 1TK5B 4WF5A 5A4WA 3WYWA 3GA4A 4NHZA 1R5PA 2X8GA 4I97A 1UVZA 1XOBA 1B48A 4ZBAA 4ZL8A 4K7IA 5ID2B 1URMA 1EZKA 2VCQA 2WULA 5KN1A 1WRYA 2YWNA 2H0IA 3D4TA 3M9JA 4D73A 4Q5FA 1XOAA 1K3OA 3APQA 5HFIA 7GSSA 2E0QA 2FA8A 3ZVJD 2C3NA 2FY6A 3M8NA 2IFQB 4FH8A 3ZTLA 3QFBC 5IMFA 4X0XA 1EEMA 1H75A 2YJ7A 1TRUA 2GSSA 2DJ3A 5HR1A 2DBCA 5JWOB 1JZWA 3R2QA 3W8JA 2VD1A 2O85A 1N8JA 2YANA 3GKMA 5DQSA 2H72A 2CV4A 5G30A 3QR6A 1KNGA 4OMVA 2RIIA 2MBTA 2VCVA 5DBQA 5F0GA 4KDYA 3GKKA 3CMIA 3G7JA 3GURA 3M9KA 4ZBBA 1K0CA 2HSHA 4V1Ap 3CSHA 2GQKA 2K8VA 2RM5A 5CP1A 4ZXGA 3S9FA 2JZSA 3GTUB 2FA4A 4YH2A 2YWIA 2VUPA 4WETA 1YJ6A 4GSNA 2VL2A 5AIXA 2WS2A 2ON7A 2TIRA 3GUSA 3I69A 4TXVA 5B7CA 1ZOFA 3D21A 5DCHA 1ZYQB 3UAPA 1Z5YE 2D2ZA 5CRGA 1A2LA 3KTLA 1FVKA 1YF0A 5DJMA 4OFTA 2MMNA 4HOJA 3VWXA 1DE1A 1AXDA 6GSYA 3LYKA 1F9MA 2GTUA 4TR1A 1XFLA 4EKZA 4NXIA 5B6NA 1K0AA 5CREA 2AV4A 5F8BA 2IMIA 4LL1B 3FKFA 4LMVA 1SL1B 5DJLA 1V98A 2B1KA 3WT1A 2KLXA 5DAKA 1MDIA 1MD4A 3MWHA 2OE0A 2B5XA 3PR8A 4MJCA 1GSYA 1C72A 3KP8A 4MP4A 2EC4A 2H73A 4ZL9A 20GSA 2YWOA 1VF4A 4F2IA 3FW2A 2H6YA 2DIYA 2H70A 4K8MA 3D6IA 4TXOA 3A5WA 4KNDA 4EF0A 4ID0A 1HNCA 1THXA 3TDGA 4MDCA 1F6MC 5FHIA 1SKRB 5EPFA 1HNAA 3GMFA 2AJQB 3TRQA 4PNFA 4KCEA 2EIOA 1UN2A 3J7Yb 2J9HA 2LV3A 2L6CA 2O7KA 4HZ4A 2RUEA 4AJ7A 1XWKA 5H5RA 1X5DA 2V2GA 1EOHA 2NBSA 1NHYA 3HVVA 5IMCA 2VCWA 4BWQA 3P7XA 4ZIJA 3TB2A 3IXRA 4POMA 3C73A 4TR0A 4GCIA 1T1VA 2L5OA 1LJRA 5CNWA 1TRVA 3RPNA 1FHEA 2L59A 4ZB6A 2L4CA 1PL2A 4IJ3A 2A2SA 3FZ9A 4IKHA 5DVBA 3H4KA 5IMZA 2HFDA 1HQOA 2ZNMA 4L0UA 3E0UA 2AYTA 1THOA 1PKWA 2OBKA 4IS0A 2H66A 2OE1A 4K0NA 1EOGA 4PUFC 3OR5A 3HVSA 2YN1A 1Z7RA 1PQNA 3RHBA 1T00A 4XS4B 1QMVA 4K0GA 4P3YB 5DALA 3WT2A 2VCXA 4CW9A 2L57A 4MABA 1EGOA 3ZFLA 1XZOA 1DSBA 1K0MA 4PGTA 5F05A 1B4PA 2V32A 1K3LA 2H6XA 4DSSA 5ECKB 1EEJA 4MA9A 2CAIA 4OFNA 3CRUA 3F3RA 2MMAA 2GZZA 5IPHA 1A2MA 1SK2A 1M2DA 1MD3A 1RQMA 6GSWA 4PURA 3F9UA 1FO5A 1I5GA 2ZCTA 4Q5NA 4AF2A 1XXUA 3C7MA 1YQ1A 5D9WA 3KGKA 4MJAA 1O81A 14GSA 1AQXA 2P31A 3MNGA 1QQ2A 4OD7A 3TJBA 3FK8A 2AAWA 1FOVA 1WIKA 4IGJA 2FHEA 3L4NA 4FO5A 2YZHA 3O3TA 3G9BA 12GSA 3FYGA 5HR2A 3HYPA 3V1WA 2LNSA 4HJ2A 2REMA 1B8XA 2IJYA 4O32A 2CT6A 4OFMA 5JWRB 2IWTA 2H74A 2NDOA 1K0BA 2K18A 1NW2A 2GS3A 3GH9A 3BD2A 4IQAA 1XW6A 3KZQA 3FZ4A 3E3EA 1R7HA 5F06A 1FW1A 3C71A 2R2JA 4HZ2A 2FD3A 3P8WA 1YF1A 5A4VA 2MMOA 2LQQA 2B7JA 1CQGA 3Q19A 1DBYA 6GSUA 1BYEA 2VCZA 5AN1A 5IQYA 4EVMA 5B8BA 1XVWA 2HZFA 5J5NA 3IDVA 4HU7A 1B9YC 1MTCA 1YY7A 5KN2A 2F51A 4KAEA 3QFAC 1PKZA 3MSZA 1GSUA 5ABRA 3MAKA 5ECNB 3HA9A 2QGVA 4K7NA 2GQMA 3EE2A 5IOXA 2R6KA 3KM6A 4FYUA 2GLRA 1FG4A 1X9SB 4ULXA 3D5JA 3VPQA 1A2JA 1WMJA 2CQ9A 1WWJA 3KH9A 4I8BA 1T7PB 3I9V2 4BVXA 4PXOA 2ES7A 4KB3A 5F07A 5CRHA 3EMXA 4MK3A 1PA3A 1W4VA 1ZL9A 2R5GA 4IW9A 11GSA 4IBPA 2JL4A 4NAXA 2DIZA 2AHEA 4KH7A 3LG6A 3ERGA 3DVWA 4JZQA 4EXJA 2PERA 3O6TA 2LJRA 2C0DA 3HJPA 4BVYA 2WB9A 5IMVA 3IA1A 2PPTA 3EYTA 5G5EA 2TRXA 3CXGA 2A2RA 3FEUA 1TK8B 3H93A 4HS1A 3Q6OA 1SD9A 2C3TA 4D73B 1O85A 3ZFBA 4GSTA 3J7Yk 2CVBA 1PL1A 1U3AA 3L9UA 3UIWA 3ERFA 2HYXA 3IRAA 5HQPA 2GVPA 4ACSA 2FNOA 3G7IA 1W89A 2H6ZA 1AIUA 3W8SA 2H1GA 2PBJA 4HDEA 4O92A 4L8EA 4K7OA 3IOSA 4KDUA 2F8AA 4X1UA 2N5BA 3JCML 3FR3A 5B6MA 4V2LA 4AGSA 4MZCA 4MLYA 2H1AA 1DE2A 4YAVA 3F3QA 2VM1A 4TRXA 2LNTA 1GTUA 4FYCA 1PGTA 3TOUA 3HZ4A 3A2WA 1XW9A 3GN3A 1V9WA 1AAZA 3GL5A 4PUAA 5FWGA 3VI5A 1ERTA 5HR0A 2DJ0A 3C1SA 1NSWA 3TKRA 1KTEA 1TDIA 3TKSC 2H76A 2L5LA 2P0GA 4KCAA 4WF4A 1PX7A 3ZITA 3N5OA 1GTBA 1A0RP 4MMMA 1ZMAA 5ECHB 2HZEA 3A2XA 2M80A 4MZBA 3Q74A 1B4QA 3PGTA 3GKNA 3GFKA 1TW9A 4Q5RA 2JU5A 1TK0B 3APSA 3L0HA 1FB6A 5GZZB 1J9BA 1J0FA 2LSTA 5D9XA 5A4UA 1FAAA 1LBKA 1U88A 4IHUA 16GSA 3ZMKA 3IAM2 5GAND 3CSIA 3KCMA 1H4OA 2H30A 1OE8A 4MJEA 4F0BA 1SK1A 2VD0A 3EURA 5G2ZA 3ZREA 4WBJA 4TR1B 2CX4A 5ECRB 5J4UA 5ID2A 3UBLA 2HI7A 2R3XA 5GAPD 3VURA 3HXSA 1EP8A 4J57E 3LFLA 4GLTA 5D9TA 2C0EA 1RK4A 4NPBA 5IPGA 3QAGA 4NHWA 1O8WA 1GLQA 2IFQA 2GGTA 1XIYA 2C3QA 3WGXA 3ISOA 3GRXA 3PINA 2KUCA 3TGZA 1OAZA 3MDKA 1XWAA 4N30A 2LJAA 5CAXA 3F8UA 2H19A 1GSFA 1M99A 3FZAA 4TXOB 1S3AA 3UOMA 5ECMB 5C00A 4L5OA 2VIMA 2YNXA 3PH9A 1V40A 3EVIA 4XIHA 4KA0A 4HQSA 2FWGA 2K6VA 3RHCA 4ML1A 13GSA 2JSYA 2DSAA 3ZVJA 3FRCA 4RQXA 2I4AA 3P90A 2KHPA 6GSSA 1ABAA 1OKDA 1GSEA 3FR6A 4ISDA 5JCGA 2VCTA 2OACA 4XTSA 1SENA 3H1NA 2GDRA 5E4WA 3QMXA 3GTUA 3ZZXA 5IOWA 4DSQA 1BAYA 5KEJA 3IC4A 1A23A 3EC3A 5ECLB 3GHAA 5IMDA 2HXKA 2DMLA 5G5FA 2GSRA 1GUMA 3TKPA 2O8VB 1GSQA 1YZXA 4QL9A 1ZCPA 3LXTA 4POBA 1TI1A 1OC9B 4G2EA 3I6AA 1GP1A 2CZ2A 2JSZA 1GNWA 1OVNA 4GQFA 2WZ9A 3BJ5A 4MZWA 2I3YA 4ECIA 2H0GA 1YDKA 4G9HA 2GT6A 2O89A 4E8EA 1QK8A 4HUAA 1EV9A 4ZBDA 5J9CA 2LEGA 3CTFA 4MH3A 1AQVA 1OYJA 1RW1A 1FB0A 1YKAA 1M9BA 3DGQA 2I81A 2HNLA 4YQUA 1GUHA 2QSIA 1QGVA 2E2MA 3UARA 1UC7A 2KP1A 3L9SA 3U5RE 3GX8A 1V2AA 1Z6NA 5G1LA 1GUKA 3HHVA 5ECIB 1JZDA 2HLSA 2J23A 3TJFA 4Q5QA 1ACVA 3F4SA 4OCEA 1G7OA 3EWLA 1SKSB 2R37A 3HVXA 17GSA 2KP2A 3DXBA 1O6JA 2H1DA 1ON4A 1SYXA 1KEBA 3L78A 4K2DA 4EL1A 3KEBA 2YPMA 1GULA 2A4VA 3H8QA 5H5SA 4NV2A 2MYGA 5ELGA 1Z3EA 1ZGNA 4DEJA 1VRSD 1WJKA 3L9VA 3P2AA 2VL9A 1F37A 1EP7A 3TKSA 4L5LA 2L6DA 1PD21 3LGCA 2V1MA 1PN9A 2HRFA 2WDUA 2LTKA 4KE3A 4ZB9A 2KOKA 3ZLPA 2PMTA 3KH7A 1R4WA 6GSTA 1JZOA 1A8LA 3DEXA 1GNEA 2OA7A 2DJJA 1O8XA 1O7UA 2IMKA 2XHFA 2B5EA 1HD2A 3ZL5A 3IHQA 2F3MA 1YKCA 1TU7A 5HFGA 4LL4B 3K8NA 1G6WA 1NM3A 3RAZA 3ED3A 2C4JA 6GSXA 4Z7XA 3IV4A 1T4ZA 4HQZA 2ZUPA 4O5RA 5J9BA 1XPVA 4G19A 1BQ7A 2PWJA 4PQ1A 4EDYA 2C80A 4IJIA 2EIQA 1PX6A 2DJ2A 2GZYA 4K1FA 2AUVA 2PVQA 1T3BA 3BCKA 3VLNA 3LJRA 2OADA 2MZCA 4F03A 1LU4A 1N2AA 2YV9A 3LXZA 5IO0A 5KN3A 2NTOA 3A2VA 3RBTA 4OCFA 4HU9A 4WEYA 1J08A 1GSSA 1JLVA 2H1BA 1TOFA 3KIJA 5J41A 1A0FA 1F3AA 1IYHA 2FUG2 3AY8A 4WKWA 1USBA 1U6TA 4KGIA 1OE7A 3F4TA 1AUCA 3TRXA 4KDXA 4YAPA 2CA8A 4EC0A 2K8SA 3HKRA 3EU4A 3FHKA 2H71A 4BA7A 4IQ1A 5JCUA 2H8LA 4IN0A 1YEPA 2VOCA 5B8AA 1R5AA 3EU3A 4TVEA 2AB6A 4MF7A 4IP1A 2PGTA 4PX1A 4OO5A 4ZB8A 3ZMLA 2HE3A 2YV7A 3GH6A 2F8FA 4V2MA 5ECQB 3ZIJA 3QDNA 1T8EB 1TKDB 2N5AA 3E9JB 1TP9A 2L4QA 5JWQB 2XC2A 4LLRA 4EO3A 2OE3A 3TCOA 1PRXA 1K3YA 5INYA 4POKA 3CRTA 1NHOA 1SL0B 4ECCA 3QAWA 3BBYA 2ON5A 1BX9A 3H79A 1GTAA 2NPBA 2I9HA 6GSVA 3QCPA 3ZYWA 1BEDA 3BOAA 1M2BA 3FY7A 5H5QA 3LEFA 2CAQA 2H01A 4N0ZA 3F63A 1XWGA 2FWEA 4ZILA 1X5EA 3EINA 5J3RA 3DYRA 2VAFA 3F4RA 3QOUA 3TJGA 3GKXA 4JRRA 2VLVA 4MF6A 2VLTA 2DMMA 5G31A 5CRDA 1WP0A 3IBHA 2GQLA 2V41A 4QL7A 3QAVA 4V1Ag 4N11A 4ECJA 1E2YA 1M9AA 4GSSA 1G6YA 3O76A 3VWWA 2X99A 4FYBA 2P5RA 2CVKA 3C1RA 3VWUA 1JLWA 3KD0A 2V6OA 3HY2A 4F9ZA 1WE0A 5D9VA 1PSQA 1TRWA 1R26A 2PN8A 2RUFA 1OC3A 4JBBA 4F82A 3M3MA 3KJYA 3DWVA 3NOFA 2WGRA 5JCWA 2DJKA 1VGLA 3CYNA 1OC8A 2LRNA 1QFNA 4L0WA 4YQMA 2LQOA 2JZRA 1O73A 1SYRA 2HRNA 1MDJA 3IPZA 1ST9A 4MH2A 5IM9A 3C8EA 4MCUA 1JFUA 4J2FA 3IK9A 1TTZA 1SD8A 4AJ6A 5LNKe 4N10A 3GNJA 1M0UA 2B3SA 1ERUA 2E2GA 9GSSA 1BJXA 3HJMA 5DAKB 3CTGA 2VO4A 1EGRA 1S3CA 1KBNA 4HEA2 2F9SA 1SU9A 2CX3A 4ECBA 1F2EA 5GSSA 1WPIA 2OKAA 1PMTA 3F6FA 4JE1A 3WD6A 3QPMA 5L71A 4NWYA 2QC7A 2LRCA 2IMFA 3GV1A 1GSDA 5ECPB 1F3BA 5CYYA 2FLSA 5D93A 3LQ7A 3TKSE 3VPTA 2PVOC 2O87A 3UJ1A 1SK0A 3M0FA 3D22A 4RI6A 1X5CA 3TJKA 1GRXA 4MF5A 2PU9C 1ILOA 2B6MA 2FWHA 5D96A 4XHMA 3A3TA 1XWBA 2CZ3A 1YEXA 4J56E 3VI7A 2XBQA 1WOUA 1ZZYA 5LCZA 3UVTA 2OJLA 5G1KA 4GXZA 2RLIA 4X43A 2IN3A 4YQVA 4BPYA 2HSYA 2BJXA 4ILFA 5A5KA 2G2QA 2X8CA 5DQYA 4JU5A 1X9MB 4I2UA 4TOPA 2HT9A 2LJKA 2MMZA 3HCZA 4G10A 4KSMA 4MPFA 2K9FA 2ALBA 2IMDA 4IP6A 5KN0A 4XRAA 1MDKA 3D0ZA 4POLA 4BL7A 2YP6A 2BMXA 4KUNA 4GTUA 3US3A 4CHSA 5IMAA 2JACA 5ECSA 5GSTA 2GSTA 1SL2B 2YZUA 2WJUA 3CSJA 2C8UA 3IAS2 2WCIA 4EDZA 2VL3A 4BWSA 3APOA 3DKSA 3FZ5A 3HDCA 5CRWA 1V58A 3GSTA 10GSA 1VF1A 5DALB 2WFCA 1QXHA 2QKEA 4IVFA 1Z6MA 4WR5A 3VWVA 1OKTA 1GTIA 4TR4A 2XBIA 1M7TA 2RM6A 4DSSB 5ELAA 1G0TA 4IELA 3KP9A 4TR3A 3DD3A 1B9XC 1X0RA 1JZRA 2GT5A 2DC5A 3SWLA 5IO2A 2BTOT 4GF0A 5LD0A 5AGYA 1AW9A 1E6BA 3M1GA 3F6DA 4GRFA 3IR4A 1OC9A 2X64A 4H86A 2LS5A 1M2AA 2DLXA 2IIYA 3UL3A 1Q98A 4PQHA 3G7YA 5IIZA 2FGXA 4NV5A 4QQ7A 2GSQA 2FWFA 3GL3A 2H75A 4OWYA 2GZPA 2LUSA 2IPAA 3HZ8A 1VF2A 1TU8A
chains in the Genus database with same CATH superfamily
3UBKA 2C0FA 4DVCA 1TJDA 3N9JA 1EV4A 5E59A 4AJ8A 4O7HA 2JZTA 2H0HA 1V57A 1ZYEA 2FCHA 4WR4A 3EMPA 2XPDA 1PFOA 4F0CA 3KTBA 1XVQA 1SJZA 3A5IA 5C04A 5FT3A 4TN8A 5D73A 3HD5A 3WGEA 5D8IA 1M3IA 4CDOA 4JR4A 4K6XA 4XS4A 3RPPA 5AISA 2B7KA 3KMNA 1SJIA 3GX0A 2VL2C 2Z9SA 4HSCX 1TRSA 2LKUA 1XWCA 2IMEA 4TKYA 3LWAA 1EWXA 3ERWA 4I6XA 4MPGA 2X8HA 5HR3A 3ZIVA 3ZRDA 4JEDA 19GSA 4DSRA 1XBSA 4I5QA 1Z7PA 1U3IA 4BVXB 2TRCP 1QUWA 3DRNA 3I43A 1S3DA 3RDWA 4EUYA 1ERWA 4HI7A 3UVHA 1ERVA 4NMUA 3FR9A 4KSOA 4K9ZA 4WBRD 3CBUA 3LORA 3TRPA 2M72A 1XW5A 4RI7A 4ZL7A 1X9WB 4LMWA 5AIVA 1XCCA 3GSSA 1A24A 3MIXA 1DUGA 1K0OA 4WXTA 1HNBA 5CO3A 2CVDA 2WRTA 4KX4A 1Y25A 4GWRA 3IE3A 4I2TA 1AQWA 18GSA 3PPUA 3DVXA 3U6VA 4EE0A 4V2NA 2YCDA 4JR6A 2E7PA 2G0FA 5HFKA 4RQRA 1K0NA 1U87A 1A8YA 2VM2A 4TW5A 2P5QA 1CQHA 4LA1A 1HYUA 4XRDA 5EY6A 1TXXA 2R0GA 3TUEA 1MEKA 1GWCA 4G0LA 2R4VA 4N0VA 2B1LA 1ML6A 4GQCA 1BG5A 3KXOA 3SBCA 4MJBA 2C0GA 3TOTA 4XS1A 3W6GA 22GSA 2YJHA 2YWMA 1IYIA 3HJOA 1GH2A 3DIEA 1SKWB 4OO4A 5EVOA 1AC1A 3ME8A 3QD9A 2N5FA 4XCSA 3TJJA 3WGDA 3D4MA 1M3JA 4HJMA 1Z9HA 2YOIA 1T4YA 2EIRA 4ML6A 2B5YA 3NIVA 3LSZA 1JHBA 1K0DA 5ECOB 5EL8A 5ENUA 5DDLA 2PUKC 4PQIA 3Q18A 3ME7A 2HZEB 4XS6A 1GL8A 8GSSA 3GYKA 5DCGA 3DMLA 1Y6EA 3UEMA 1I9DA 3KMOA 1FVJA 4RUVA 4BIKA 5COHA 1SJ6A 3VFIA 3LYPA 1Q4JA 4Z2UA 4FIWA 4KW6A 3NZNA 2LRTA 3TKQA 2C1YA 3VK9A 1TI3A 3GIXA 2IL3A 3UMAA 2VLUA 4PNGA 2V6KA 3IK7A 1VF3A 2JADA 3BCIA 2OBIA 4E8HA 2I1UA 2NVLA 1UA5A 3F0IA 2XPEA 2M46A 2DJ1A 1G7EA 2MBSA 1GLPA 1TK5B 4WF5A 5A4WA 3WYWA 3GA4A 4NHZA 1R5PA 2X8GA 4I97A 1UVZA 1XOBA 1B48A 4ZBAA 4ZL8A 4K7IA 5ID2B 4K2XA 1URMA 1EZKA 2VCQA 2WULA 5KN1A 1WRYA 2YWNA 2H0IA 3D4TA 3M9JA 4D73A 4Q5FA 1XOAA 1K3OA 3APQA 5HFIA 7GSSA 2DKHA 2E0QA 2FA8A 3ZVJD 2C3NA 2FY6A 3M8NA 2IFQB 4FH8A 3ZTLA 3LW9A 3QFBC 5IMFA 4X0XA 1EEMA 1H75A 2YJ7A 1TRUA 2GSSA 2DJ3A 5HR1A 2DBCA 5JWOB 1JZWA 3R2QA 3W8JA 2VD1A 2O85A 1N8JA 2YANA 3GKMA 5DQSA 2H72A 2CV4A 5G30A 3QR6A 1KNGA 4OMVA 2RIIA 1PN0A 2MBTA 3EPTA 2VCVA 5DBQA 5F0GA 4KDYA 3GKKA 3CMIA 3G7JA 3GURA 3M9KA 4ZBBA 1K0CA 2HSHA 4V1Ap 3CSHA 2GQKA 2K8VA 2RM5A 5CP1A 4ZXGA 3S9FA 2JZSA 3GTUB 2FA4A 4YH2A 2YWIA 2VUPA 4WETA 1YJ6A 4GSNA 2VL2A 5AIXA 4A5PA 2WS2A 2ON7A 2TIRA 3GUSA 3I69A 4TXVA 5B7CA 2X4AA 1ZOFA 3D21A 5DCHA 1ZYQB 3UAPA 1Z5YE 2A4HA 2D2ZA 5CRGA 1A2LA 3KTLA 1FVKA 1YF0A 5DJMA 4OFTA 2MMNA 4HOJA 3VWXA 1DE1A 1AXDA 6GSYA 3LYKA 1F9MA 2GTUA 4TR1A 4USSA 1XFLA 4EKZA 4NXIA 5B6NA 1K0AA 5CREA 2AV4A 5F8BA 2IMIA 4LL1B 3FKFA 4LMVA 1SL1B 5DJLA 1V98A 2B1KA 3WT1A 2R0PA 2KLXA 5DAKA 1MDIA 1MD4A 3MWHA 2OE0A 2B5XA 3PR8A 4MJCA 1GSYA 1C72A 3KP8A 4MP4A 2EC4A 2H73A 4ZL9A 20GSA 2YWOA 1VF4A 4F2IA 3FW2A 2H6YA 2DIYA 2H70A 4K8MA 3D6IA 4TXOA 3A5WA 4KNDA 4EF0A 4ID0A 2HRAA 1HNCA 1THXA 3TDGA 4MDCA 1F6MC 5FHIA 1SKRB 5EPFA 1HNAA 3GMFA 2AJQB 3TRQA 4PNFA 4G0IA 4KCEA 2EIOA 1UN2A 3J7Yb 2J9HA 2LV3A 2L6CA 2O7KA 4HZ4A 2RUEA 4AJ7A 1XWKA 5H5RA 1X5DA 2V2GA 1EOHA 2NBSA 1NHYA 3HVVA 5IMCA 2VCWA 4BWQA 3P7XA 4ZIJA 3TB2A 3IXRA 4POMA 3C73A 4TR0A 4GCIA 1T1VA 2L5OA 1LJRA 5CNWA 1TRVA 3RPNA 1FHEA 2L59A 4ZB6A 2L4CA 1PL2A 4IJ3A 2A2SA 3FZ9A 4IKHA 5DVBA 3H4KA 5IMZA 2HFDA 1HQOA 2ZNMA 4L0UA 3E0UA 2AYTA 1THOA 1PKWA 2OBKA 4IS0A 2H66A 2OE1A 4K0NA 1EOGA 4PUFC 3OR5A 3HVSA 2YN1A 1Z7RA 1PQNA 3RHBA 1T00A 4XS4B 1QMVA 4K0GA 4P3YB 5DALA 3WT2A 2VCXA 4CW9A 2L57A 4MABA 1EGOA 3ZFLA 1XZOA 1DSBA 1K0MA 4PGTA 5F05A 1B4PA 2V32A 1K3LA 2H6XA 4DSSA 5ECKB 1EEJA 4MA9A 2CAIA 4OFNA 3CRUA 3F3RA 2MMAA 2GZZA 5IPHA 1A2MA 1SK2A 1M2DA 1MD3A 1RQMA 6GSWA 4PURA 3F9UA 2HRKA 1FO5A 1I5GA 2ZCTA 4Q5NA 4AF2A 1XXUA 3C7MA 4Z2TA 1YQ1A 5D9WA 3KGKA 4MJAA 1O81A 14GSA 1AQXA 5BMUA 2P31A 3MNGA 1QQ2A 5KOWA 4OD7A 3TJBA 3FK8A 2AAWA 1FOVA 1WIKA 4IGJA 2FHEA 3L4NA 4FO5A 2YZHA 3O3TA 3G9BA 12GSA 3FYGA 5HR2A 3HYPA 3V1WA 2LNSA 4HJ2A 2REMA 1B8XA 2IJYA 4O32A 2CT6A 4OFMA 5JWRB 2IWTA 2H74A 2NDOA 1K0BA 2K18A 1NW2A 2GS3A 3GH9A 3BD2A 4IQAA 1XW6A 3KZQA 3FZ4A 3E3EA 1R7HA 5F06A 1FW1A 3C71A 2R2JA 4HZ2A 2FD3A 3P8WA 1YF1A 5A4VA 2MMOA 2LQQA 2B7JA 1CQGA 3Q19A 1DBYA 6GSUA 1BYEA 2VCZA 5AN1A 5IQYA 4EVMA 5B8BA 1XVWA 2HZFA 5J5NA 3IDVA 4HU7A 1B9YC 1MTCA 1YY7A 5KN2A 2F51A 4KAEA 3QFAC 1PKZA 3MSZA 1GSUA 5ABRA 3MAKA 5ECNB 3HA9A 2QGVA 4K7NA 2GQMA 3EE2A 5IOXA 2R6KA 3KM6A 4FYUA 2GLRA 1FG4A 4K5SA 1X9SB 4ULXA 3D5JA 3VPQA 1A2JA 1WMJA 2CQ9A 1WWJA 3KH9A 4I8BA 1T7PB 3I9V2 4BVXA 4PXOA 2ES7A 4KB3A 5F07A 5CRHA 3EMXA 4MK3A 1PA3A 1W4VA 1ZL9A 2R5GA 4IW9A 11GSA 4IBPA 2JL4A 4NAXA 2DIZA 2AHEA 4KH7A 3LG6A 3ERGA 3DVWA 4JZQA 4EXJA 2PERA 3O6TA 2LJRA 2C0DA 3HJPA 4X4JA 4BVYA 2WB9A 5IMVA 3IA1A 2PPTA 3EYTA 5G5EA 2TRXA 3CXGA 2A2RA 3FEUA 1TK8B 3H93A 4HS1A 3Q6OA 1SD9A 2C3TA 4D73B 1O85A 3ZFBA 4GSTA 3J7Yk 2CVBA 1PL1A 1U3AA 3L9UA 3UIWA 1ZYNA 3ERFA 2HYXA 3IRAA 5HQPA 2GVPA 4ACSA 2FNOA 3G7IA 1W89A 2H6ZA 1AIUA 3W8SA 2H1GA 2PBJA 4HDEA 4O92A 4L8EA 4K7OA 3IOSA 4KDUA 2F8AA 4X1UA 2N5BA 3JCML 3FR3A 5B6MA 4V2LA 1FOHA 4AGSA 4MZCA 4MLYA 2H1AA 1DE2A 4YAVA 3F3QA 2VM1A 4TRXA 2LNTA 1GTUA 4FYCA 1PGTA 3TOUA 3HZ4A 3A2WA 1XW9A 3GN3A 1V9WA 1AAZA 3GL5A 4PUAA 5FWGA 3VI5A 1ERTA 5HR0A 2DJ0A 3C1SA 1NSWA 3TKRA 1KTEA 1TDIA 3TKSC 2H76A 2L5LA 2P0GA 4KCAA 4WF4A 1PX7A 3ZITA 3N5OA 1GTBA 1A0RP 4MMMA 1ZMAA 5ECHB 2HZEA 3A2XA 2M80A 4MZBA 3Q74A 1B4QA 3PGTA 3GKNA 3GFKA 1TW9A 4Q5RA 2JU5A 1TK0B 3APSA 3L0HA 1FB6A 5GZZB 1J9BA 1J0FA 2LSTA 5D9XA 5A4UA 1FAAA 1LBKA 1U88A 4IHUA 16GSA 3ZMKA 3IAM2 5GAND 3CSIA 3KCMA 1H4OA 2H30A 1OE8A 4MJEA 4F0BA 1SK1A 2VD0A 3EURA 5G2ZA 3ZREA 4WBJA 2QA2A 4TR1B 2CX4A 5ECRB 5J4UA 5ID2A 3UBLA 2HI7A 2R3XA 5GAPD 3VURA 3HXSA 1EP8A 4J57E 3LFLA 4GLTA 5D9TA 2C0EA 1RK4A 4NPBA 5IPGA 3QAGA 4NHWA 1O8WA 1GLQA 2IFQA 2GGTA 4YKFA 1XIYA 2C3QA 3WGXA 3ISOA 3GRXA 3PINA 2KUCA 3MYDA 3TGZA 1OAZA 3MDKA 1XWAA 4N30A 2LJAA 5CAXA 4MNNA 4BL7B 3F8UA 2H19A 1GSFA 1M99A 3FZAA 4TXOB 1S3AA 3UOMA 5ECMB 5C00A 4L5OA 2VIMA 2YNXA 3PH9A 1V40A 3EVIA 4XIHA 4KA0A 4HQSA 2FWGA 2K6VA 3RHCA 4ML1A 13GSA 2JSYA 2DSAA 3ZVJA 3FRCA 4RQXA 2I4AA 3P90A 2KHPA 6GSSA 1ABAA 1OKDA 1GSEA 3FR6A 4ISDA 5JCGA 2VCTA 2OACA 4XTSA 1SENA 3H1NA 2GDRA 5E4WA 3QMXA 3GTUA 2UZ8A 3ZZXA 5IOWA 4DSQA 1BAYA 5KEJA 3IC4A 1A23A 3EC3A 5ECLB 3GHAA 5IMDA 2HXKA 2DMLA 5G5FA 2GSRA 1GUMA 4FQUA 2O8VB 3TKPA 1GSQA 1YZXA 4QL9A 1ZCPA 3LXTA 4POBA 1TI1A 1OC9B 4G2EA 2R0CA 3I6AA 1GP1A 2CZ2A 2JSZA 1GNWA 1OVNA 4GQFA 2WZ9A 3BJ5A 4MZWA 2I3YA 4ECIA 2H0GA 3FMWA 1YDKA 4G9HA 2GT6A 2O89A 4E8EA 1QK8A 3CQFA 4HUAA 1EV9A 4ZBDA 5J9CA 2LEGA 3CTFA 4MH3A 1AQVA 1OYJA 1RW1A 1FB0A 1YKAA 1M9BA 3DGQA 2I81A 2HNLA 4YQUA 1GUHA 2QSIA 1QGVA 2E2MA 3UARA 1UC7A 2KP1A 3L9SA 3U5RE 3GX8A 1V2AA 1Z6NA 5G1LA 1GUKA 3HHVA 5ECIB 1JZDA 2HLSA 1XG8A 2J23A 3TJFA 4Q5QA 1ACVA 3F4SA 4OCEA 1G7OA 3EWLA 1SKSB 2R37A 3HVXA 17GSA 2KP2A 3DXBA 4EIPA 1O6JA 2H1DA 1ON4A 1SYXA 1KEBA 3L78A 4K2DA 4EL1A 3KEBA 2YPMA 1GULA 2A4VA 3H8QA 5H5SA 4NV2A 2MYGA 5ELGA 1Z3EA 1ZGNA 4DEJA 1VRSD 1WJKA 3L9VA 3P2AA 2VL9A 1F37A 1EP7A 3TKSA 4L5LA 2L6DA 1PD21 3LGCA 2V1MA 1PN9A 2HRFA 2WDUA 2LTKA 4KE3A 4ZB9A 2KOKA 3ZLPA 2PMTA 3KH7A 1R4WA 6GSTA 1JZOA 1A8LA 3DEXA 1GNEA 2OA7A 2DJJA 3IC8A 4PTSA 1O8XA 1O7UA 2IMKA 2XHFA 2B5EA 1HD2A 3ZL5A 3IHQA 2F3MA 1YKCA 1TU7A 5HFGA 4LL4B 3K8NA 1G6WA 1NM3A 3RAZA 3ED3A 2C4JA 6GSXA 4Z7XA 3IV4A 1T4ZA 4HQZA 2ZUPA 4O5RA 5J9BA 1XPVA 4G19A 1BQ7A 2PWJA 4PQ1A 4EDYA 2C80A 4IJIA 2EIQA 1PX6A 2DJ2A 2GZYA 4ICYA 4K1FA 2AUVA 2PVQA 1T3BA 3BCKA 3VLNA 3LJRA 2OADA 2MZCA 4F03A 1LU4A 1N2AA 2YV9A 3LXZA 5IO0A 5KN3A 2NTOA 3A2VA 3RBTA 4OCFA 4HU9A 4WEYA 1J08A 1GSSA 1JLVA 2H1BA 4BVYB 1TOFA 3KIJA 5J41A 1A0FA 1F3AA 1IYHA 2FUG2 3AY8A 4WKWA 1USBA 1U6TA 4KGIA 1OE7A 3F4TA 1AUCA 3TRXA 2X49A 4KDXA 4YAPA 2CA8A 4EC0A 2K8SA 3HKRA 3EU4A 3FHKA 2H71A 4BA7A 4IQ1A 5JCUA 2H8LA 4IN0A 1YEPA 2VOCA 5B8AA 1R5AA 3EU3A 4KF9A 4TVEA 2AB6A 4MF7A 4IP1A 4CY6A 4YKGA 2PGTA 4PX1A 4OO5A 5KOXA 4ZB8A 3ZMLA 2HE3A 2YV7A 3GH6A 3R3EA 2F8FA 4V2MA 5ECQB 3ZIJA 3QDNA 1T8EB 1TKDB 2N5AA 3E9JB 1TP9A 2L4QA 5JWQB 2XC2A 4LLRA 4EO3A 2OE3A 3TCOA 1PRXA 1K3YA 5INYA 4POKA 3CRTA 1NHOA 4G0KA 1SL0B 4ECCA 3QAWA 3BBYA 2ON5A 1BX9A 3H79A 1GTAA 2NPBA 2A2PA 2I9HA 6GSVA 4K5RA 3QCPA 3ZYWA 1BEDA 3BOAA 1M2BA 3FY7A 5H5QA 3LEFA 2CAQA 2H01A 4N0ZA 3F63A 1XWGA 2FWEA 4ZILA 1X5EA 3EINA 5J3RA 3DYRA 2VAFA 3F4RA 3QOUA 3TJGA 3GKXA 4JRRA 2VLVA 4MF6A 2VLTA 2DMMA 5G31A 5CRDA 1WP0A 3IBHA 2GQLA 2V41A 4QL7A 3QAVA 4V1Ag 5BRTA 4N11A 4ECJA 1E2YA 1M9AA 4GSSA 1G6YA 3O76A 3VWWA 2X99A 4FYBA 2P5RA 2CVKA 3C1RA 3VWUA 1JLWA 3KD0A 2V6OA 3HY2A 4F9ZA 1WE0A 5D9VA 1PSQA 1TRWA 1R26A 2PN8A 2RUFA 1OC3A 4JBBA 2HSMA 4F82A 3M3MA 3KJYA 2QA1A 3DWVA 3NOFA 2WGRA 5JCWA 2DJKA 1VGLA 3CYNA 1OC8A 2LRNA 1QFNA 4L0WA 4YQMA 2LQOA 2JZRA 1O73A 1SYRA 2HRNA 1MDJA 3IPZA 1ST9A 3IHGA 4MH2A 5IM9A 3C8EA 4MCUA 1JFUA 4J2FA 3IK9A 1TTZA 1S3RA 1SD8A 4AJ6A 5LNKe 4N10A 3GNJA 1M0UA 2B3SA 1ERUA 1ZYPA 2E2GA 9GSSA 1BJXA 3HJMA 5DAKB 3CTGA 2VO4A 1EGRA 1S3CA 1KBNA 4HEA2 2F9SA 4Z2RA 1SU9A 2CX3A 4ECBA 1F2EA 3HVNA 2DKIA 5GSSA 1WPIA 2OKAA 1PMTA 3F6FA 4JE1A 3WD6A 3QPMA 5L71A 4NWYA 2QC7A 2LRCA 2IMFA 3GV1A 1GSDA 5ECPB 1F3BA 5CYYA 2FLSA 5D93A 3LQ7A 3TKSE 4O5QA 3VPTA 2PVOC 2O87A 3UJ1A 1SK0A 3M0FA 3D22A 4RI6A 1X5CA 3TJKA 1GRXA 4MF5A 2PU9C 1ILOA 2B6MA 2FWHA 5D96A 4XHMA 3A3TA 4CY8A 1XWBA 2CZ3A 1YEXA 4J56E 3VI7A 2XBQA 1WOUA 1ZZYA 5LCZA 3UVTA 2OJLA 5G1KA 4GXZA 2RLIA 4X43A 2IN3A 4YQVA 4BPYA 2HSYA 2BJXA 4ILFA 5A5KA 2G2QA 2X8CA 5DQYA 4JU5A 1X9MB 4I2UA 4TOPA 2HT9A 2LJKA 2MMZA 3HCZA 4G10A 4KSMA 4MPFA 2K9FA 2ALBA 2IMDA 4IP6A 5KN0A 4XRAA 1MDKA 3D0ZA 4POLA 4BL7A 2YP6A 2BMXA 4KUNA 4GTUA 3US3A 4CHSA 5IMAA 2JACA 5ECSA 5GSTA 2GSTA 1SL2B 2YZUA 2WJUA 3CSJA 2C8UA 3IAS2 2WCIA 4EDZA 2VL3A 4BWSA 3APOA 3DKSA 3FZ5A 3HDCA 5CRWA 1V58A 3GSTA 10GSA 1VF1A 5DALB 2WFCA 1QXHA 2QKEA 4IVFA 1Z6MA 4WR5A 3VWVA 4O5UA 1OKTA 1GTIA 4EIQA 4TR4A 2XBIA 1M7TA 2RM6A 4DSSB 5ELAA 1G0TA 4IELA 3KP9A 4TR3A 3DD3A 1B9XC 1X0RA 1JZRA 2GT5A 2DC5A 3SWLA 5IO2A 2BTOT 4GF0A 5LD0A 5AGYA 1AW9A 1E6BA 3M1GA 3F6DA 4GRFA 3IR4A 1OC9A 2X64A 4H86A 2LS5A 1M2AA 2DLXA 2IIYA 3UL3A 1Q98A 4PQHA 3G7YA 5IIZA 2FGXA 4NV5A 4QQ7A 2GSQA 2FWFA 3GL3A 2H75A 4OWYA 2GZPA 2LUSA 2IPAA 3HZ8A 1VF2A 1TU8A
chains in the Genus database with same CATH topology
3UBKA 2C0FA 4DVCA 1TJDA 3N9JA 1EV4A 5E59A 4AJ8A 4O7HA 2JZTA 2H0HA 1V57A 1ZYEA 2FCHA 4WR4A 3EMPA 2XPDA 4F0CA 3KTBA 1XVQA 1SJZA 3A5IA 5C04A 5FT3A 4TN8A 5D73A 3HD5A 3WGEA 5D8IA 4CDOA 4JR4A 4K6XA 4XS4A 3RPPA 5AISA 2B7KA 3KMNA 1SJIA 3GX0A 2VL2C 2Z9SA 1TRSA 2LKUA 1XWCA 2IMEA 4TKYA 3LWAA 1EWXA 3ERWA 4I6XA 4MPGA 2X8HA 5HR3A 3ZIVA 3ZRDA 4JEDA 19GSA 4DSRA 1XBSA 4I5QA 1Z7PA 1U3IA 4BVXB 2TRCP 1QUWA 3DRNA 3I43A 1S3DA 3RDWA 4EUYA 1ERWA 4HI7A 3UVHA 1ERVA 4NMUA 3FR9A 4KSOA 4K9ZA 4WBRD 3CBUA 3LORA 3TRPA 2M72A 1XW5A 4RI7A 4ZL7A 1X9WB 4LMWA 5AIVA 1XCCA 3GSSA 1A24A 3MIXA 1DUGA 1K0OA 4WXTA 1HNBA 5CO3A 2CVDA 2WRTA 4KX4A 1Y25A 4GWRA 3IE3A 4I2TA 1AQWA 18GSA 3PPUA 3DVXA 3U6VA 4EE0A 4V2NA 2YCDA 4JR6A 2E7PA 2G0FA 5HFKA 4RQRA 1K0NA 1U87A 1A8YA 2VM2A 4TW5A 2P5QA 1CQHA 4LA1A 1HYUA 4XRDA 5EY6A 1TXXA 2R0GA 3TUEA 1MEKA 1GWCA 4G0LA 2R4VA 4N0VA 2B1LA 1ML6A 4GQCA 1BG5A 3KXOA 3SBCA 4MJBA 2C0GA 3TOTA 4XS1A 3W6GA 22GSA 2YJHA 2YWMA 1IYIA 3HJOA 1GH2A 3DIEA 1SKWB 4OO4A 5EVOA 1AC1A 3ME8A 3QD9A 2N5FA 4XCSA 3TJJA 3WGDA 3D4MA 4HJMA 1Z9HA 2YOIA 1T4YA 2EIRA 4ML6A 2B5YA 3NIVA 3LSZA 1JHBA 1K0DA 5ECOB 5EL8A 5ENUA 5DDLA 2PUKC 4PQIA 3Q18A 3ME7A 2HZEB 4XS6A 1GL8A 8GSSA 3GYKA 5DCGA 3DMLA 1Y6EA 3UEMA 1I9DA 3KMOA 1FVJA 4RUVA 5COHA 1SJ6A 3VFIA 3LYPA 1Q4JA 4Z2UA 4FIWA 4KW6A 3NZNA 2LRTA 3TKQA 2C1YA 3VK9A 1TI3A 3GIXA 2IL3A 3UMAA 2VLUA 4PNGA 2V6KA 3IK7A 1VF3A 2JADA 3BCIA 2OBIA 4E8HA 2I1UA 2NVLA 1UA5A 3F0IA 2XPEA 2M46A 2DJ1A 1G7EA 2MBSA 1GLPA 1TK5B 4WF5A 5A4WA 3WYWA 3GA4A 4NHZA 1R5PA 2X8GA 4I97A 1UVZA 1XOBA 1B48A 4ZBAA 4ZL8A 4K7IA 5ID2B 4K2XA 1URMA 1EZKA 2VCQA 2WULA 5KN1A 1WRYA 2YWNA 2H0IA 3D4TA 3M9JA 4D73A 4Q5FA 1XOAA 1K3OA 3APQA 5HFIA 7GSSA 2DKHA 2E0QA 2FA8A 3ZVJD 2C3NA 2FY6A 3M8NA 2IFQB 4FH8A 3ZTLA 3LW9A 3QFBC 5IMFA 4X0XA 1EEMA 1H75A 2YJ7A 1TRUA 2GSSA 2DJ3A 5HR1A 2DBCA 5JWOB 1JZWA 3R2QA 3W8JA 2VD1A 2O85A 1N8JA 2YANA 3GKMA 5DQSA 2H72A 2CV4A 5G30A 3QR6A 1KNGA 4OMVA 2RIIA 1PN0A 2MBTA 3EPTA 2VCVA 5DBQA 5F0GA 4KDYA 3GKKA 3CMIA 3G7JA 3GURA 3M9KA 4ZBBA 1K0CA 2HSHA 4V1Ap 3CSHA 2GQKA 2K8VA 2RM5A 5CP1A 4ZXGA 3S9FA 2JZSA 3GTUB 2FA4A 4YH2A 2YWIA 2VUPA 4WETA 1YJ6A 4GSNA 2VL2A 5AIXA 4A5PA 2WS2A 2ON7A 2TIRA 3GUSA 3I69A 4TXVA 5B7CA 2X4AA 1ZOFA 3D21A 5DCHA 1ZYQB 3UAPA 1Z5YE 2A4HA 2D2ZA 5CRGA 1A2LA 3KTLA 1FVKA 1YF0A 5DJMA 4OFTA 2MMNA 4HOJA 3VWXA 1DE1A 1AXDA 6GSYA 3LYKA 1F9MA 2GTUA 4TR1A 4USSA 1XFLA 4EKZA 4NXIA 5B6NA 1K0AA 5CREA 2AV4A 5F8BA 2IMIA 4LL1B 3FKFA 4LMVA 1SL1B 5DJLA 1V98A 2B1KA 3WT1A 2R0PA 2KLXA 5DAKA 1MDIA 1MD4A 3MWHA 2OE0A 2B5XA 3PR8A 4MJCA 1GSYA 1C72A 3KP8A 4MP4A 2EC4A 2H73A 4ZL9A 20GSA 2YWOA 1VF4A 4F2IA 3FW2A 2H6YA 2DIYA 2H70A 4K8MA 3D6IA 4TXOA 3A5WA 4KNDA 4EF0A 4ID0A 2HRAA 1HNCA 1THXA 3TDGA 4MDCA 1F6MC 5FHIA 1SKRB 5EPFA 1HNAA 3GMFA 2AJQB 3TRQA 4PNFA 4G0IA 4KCEA 2EIOA 1UN2A 3J7Yb 2J9HA 2LV3A 2L6CA 2O7KA 4HZ4A 2RUEA 4AJ7A 1XWKA 5H5RA 1X5DA 2V2GA 1EOHA 2NBSA 1NHYA 3HVVA 5IMCA 2VCWA 4BWQA 3P7XA 4ZIJA 3TB2A 3IXRA 4POMA 3C73A 4TR0A 4GCIA 1T1VA 2L5OA 1LJRA 5CNWA 1TRVA 3RPNA 1FHEA 2L59A 4ZB6A 2L4CA 1PL2A 4IJ3A 2A2SA 3FZ9A 4IKHA 5DVBA 3H4KA 5IMZA 2HFDA 1HQOA 2ZNMA 4L0UA 3E0UA 2AYTA 1THOA 1PKWA 2OBKA 4IS0A 2H66A 2OE1A 4K0NA 1EOGA 4PUFC 3OR5A 3HVSA 2YN1A 1Z7RA 1PQNA 3RHBA 1T00A 4XS4B 1QMVA 4K0GA 4P3YB 5DALA 3WT2A 2VCXA 4CW9A 2L57A 4MABA 1EGOA 3ZFLA 1XZOA 1DSBA 1K0MA 4PGTA 5F05A 1B4PA 2V32A 1K3LA 2H6XA 4DSSA 5ECKB 1EEJA 4MA9A 2CAIA 4OFNA 3CRUA 3F3RA 2MMAA 2GZZA 5IPHA 1A2MA 1SK2A 1M2DA 1MD3A 1RQMA 6GSWA 4PURA 3F9UA 2HRKA 1FO5A 1I5GA 2ZCTA 4Q5NA 4AF2A 1XXUA 3C7MA 4Z2TA 1YQ1A 5D9WA 3KGKA 4MJAA 1O81A 14GSA 1AQXA 5BMUA 2P31A 3MNGA 1QQ2A 5KOWA 4OD7A 3TJBA 3FK8A 2AAWA 1FOVA 1WIKA 4IGJA 2FHEA 3L4NA 4FO5A 2YZHA 3O3TA 3G9BA 12GSA 3FYGA 5HR2A 3HYPA 3V1WA 2LNSA 4HJ2A 2REMA 1B8XA 2IJYA 4O32A 2CT6A 4OFMA 5JWRB 2IWTA 2H74A 2NDOA 1K0BA 2K18A 1NW2A 2GS3A 3GH9A 3BD2A 4IQAA 1XW6A 3KZQA 3FZ4A 3E3EA 1R7HA 5F06A 1FW1A 3C71A 2R2JA 4HZ2A 2FD3A 3P8WA 1YF1A 5A4VA 2MMOA 2LQQA 2B7JA 1CQGA 3Q19A 1DBYA 6GSUA 1BYEA 2VCZA 5AN1A 5IQYA 4EVMA 5B8BA 1XVWA 2HZFA 5J5NA 3IDVA 4HU7A 1B9YC 1MTCA 1YY7A 5KN2A 2F51A 4KAEA 3QFAC 1PKZA 3MSZA 1GSUA 5ABRA 3MAKA 5ECNB 3HA9A 2QGVA 4K7NA 2GQMA 3EE2A 5IOXA 2R6KA 3KM6A 4FYUA 2GLRA 1FG4A 4K5SA 1X9SB 4ULXA 3D5JA 3VPQA 1A2JA 1WMJA 2CQ9A 1WWJA 3KH9A 4I8BA 1T7PB 3I9V2 4BVXA 4PXOA 2ES7A 4KB3A 5F07A 5CRHA 3EMXA 4MK3A 1PA3A 1W4VA 1ZL9A 2R5GA 4IW9A 11GSA 4IBPA 2JL4A 4NAXA 2DIZA 2AHEA 4KH7A 3LG6A 3ERGA 3DVWA 4JZQA 4EXJA 2PERA 3O6TA 2LJRA 2C0DA 3HJPA 4X4JA 4BVYA 2WB9A 5IMVA 3IA1A 2PPTA 3EYTA 5G5EA 2TRXA 3CXGA 2A2RA 3FEUA 1TK8B 3H93A 4HS1A 3Q6OA 1SD9A 2C3TA 4D73B 1O85A 3ZFBA 4GSTA 3J7Yk 2CVBA 1PL1A 1U3AA 3L9UA 3UIWA 1ZYNA 3ERFA 2HYXA 3IRAA 5HQPA 2GVPA 4ACSA 2FNOA 3G7IA 1W89A 2H6ZA 1AIUA 3W8SA 2H1GA 2PBJA 4HDEA 4O92A 4L8EA 4K7OA 3IOSA 4KDUA 2F8AA 4X1UA 2N5BA 3JCML 3FR3A 5B6MA 4V2LA 1FOHA 4AGSA 4MZCA 4MLYA 2H1AA 1DE2A 4YAVA 3F3QA 2VM1A 4TRXA 2LNTA 1GTUA 4FYCA 1PGTA 3TOUA 3HZ4A 3A2WA 1XW9A 3GN3A 1V9WA 1AAZA 3GL5A 4PUAA 5FWGA 3VI5A 1ERTA 5HR0A 2DJ0A 3C1SA 1NSWA 3TKRA 1KTEA 1TDIA 3TKSC 2H76A 2L5LA 2P0GA 4KCAA 4WF4A 1PX7A 3ZITA 3N5OA 1GTBA 1A0RP 4MMMA 1ZMAA 5ECHB 2HZEA 3A2XA 2M80A 4MZBA 3Q74A 1B4QA 3PGTA 3GKNA 3GFKA 1TW9A 4Q5RA 2JU5A 1TK0B 3APSA 3L0HA 1FB6A 5GZZB 1J9BA 1J0FA 2LSTA 5D9XA 5A4UA 1FAAA 1LBKA 1U88A 4IHUA 16GSA 3ZMKA 3IAM2 5GAND 3CSIA 3KCMA 1H4OA 2H30A 1OE8A 4MJEA 4F0BA 1SK1A 2VD0A 3EURA 5G2ZA 3ZREA 4WBJA 2QA2A 4TR1B 2CX4A 5ECRB 5J4UA 5ID2A 3UBLA 2HI7A 2R3XA 5GAPD 3VURA 3HXSA 1EP8A 4J57E 3LFLA 4GLTA 5D9TA 2C0EA 1RK4A 4NPBA 5IPGA 3QAGA 4NHWA 1O8WA 1GLQA 2IFQA 2GGTA 4YKFA 1XIYA 2C3QA 3WGXA 3ISOA 3GRXA 3PINA 2KUCA 3MYDA 3TGZA 1OAZA 3MDKA 1XWAA 4N30A 2LJAA 5CAXA 4MNNA 4BL7B 3F8UA 2H19A 1GSFA 1M99A 3FZAA 4TXOB 1S3AA 3UOMA 5ECMB 5C00A 4L5OA 2VIMA 2YNXA 3PH9A 1V40A 3EVIA 4XIHA 4KA0A 4HQSA 2FWGA 2K6VA 3RHCA 4ML1A 13GSA 2JSYA 2DSAA 3ZVJA 3FRCA 4RQXA 2I4AA 3P90A 2KHPA 6GSSA 1ABAA 1OKDA 1GSEA 3FR6A 4ISDA 5JCGA 2VCTA 2OACA 4XTSA 1SENA 3H1NA 2GDRA 5E4WA 3QMXA 3GTUA 2UZ8A 3ZZXA 5IOWA 4DSQA 1BAYA 5KEJA 3IC4A 1A23A 3EC3A 5ECLB 3GHAA 5IMDA 2HXKA 2DMLA 5G5FA 2GSRA 1GUMA 4FQUA 2O8VB 3TKPA 1GSQA 1YZXA 4QL9A 1ZCPA 3LXTA 4POBA 1TI1A 1OC9B 4G2EA 2R0CA 3I6AA 1GP1A 2CZ2A 2JSZA 1GNWA 1OVNA 4GQFA 2WZ9A 3BJ5A 4MZWA 2I3YA 4ECIA 2H0GA 3FMWA 1YDKA 4G9HA 2GT6A 2O89A 4E8EA 1QK8A 4HUAA 1EV9A 4ZBDA 5J9CA 2LEGA 3CTFA 4MH3A 1AQVA 1OYJA 1RW1A 1FB0A 1YKAA 1M9BA 3DGQA 2I81A 2HNLA 4YQUA 1GUHA 2QSIA 1QGVA 2E2MA 3UARA 1UC7A 2KP1A 3L9SA 3U5RE 3GX8A 1V2AA 1Z6NA 5G1LA 1GUKA 3HHVA 5ECIB 1JZDA 2HLSA 2J23A 3TJFA 4Q5QA 1ACVA 3F4SA 4OCEA 1G7OA 3EWLA 1SKSB 2R37A 3HVXA 17GSA 2KP2A 3DXBA 4EIPA 1O6JA 2H1DA 1ON4A 1SYXA 1KEBA 3L78A 4K2DA 4EL1A 3KEBA 2YPMA 1GULA 2A4VA 3H8QA 5H5SA 4NV2A 2MYGA 5ELGA 1Z3EA 1ZGNA 4DEJA 1VRSD 1WJKA 3L9VA 3P2AA 2VL9A 1F37A 1EP7A 3TKSA 4L5LA 2L6DA 1PD21 3LGCA 2V1MA 1PN9A 2HRFA 2WDUA 2LTKA 4KE3A 4ZB9A 2KOKA 3ZLPA 2PMTA 3KH7A 1R4WA 6GSTA 1JZOA 1A8LA 3DEXA 1GNEA 2OA7A 2DJJA 3IC8A 4PTSA 1O8XA 1O7UA 2IMKA 2XHFA 2B5EA 1HD2A 3ZL5A 3IHQA 2F3MA 1YKCA 1TU7A 5HFGA 4LL4B 3K8NA 1G6WA 1NM3A 3RAZA 3ED3A 2C4JA 6GSXA 4Z7XA 3IV4A 1T4ZA 4HQZA 2ZUPA 4O5RA 5J9BA 1XPVA 4G19A 1BQ7A 2PWJA 4PQ1A 4EDYA 2C80A 4IJIA 2EIQA 1PX6A 2DJ2A 2GZYA 4ICYA 4K1FA 2AUVA 2PVQA 1T3BA 3BCKA 3VLNA 3LJRA 2OADA 2MZCA 4F03A 1LU4A 1N2AA 2YV9A 3LXZA 5IO0A 5KN3A 2NTOA 3A2VA 3RBTA 4OCFA 4HU9A 4WEYA 1J08A 1GSSA 1JLVA 2H1BA 4BVYB 1TOFA 3KIJA 5J41A 1A0FA 1F3AA 1IYHA 2FUG2 3AY8A 4WKWA 1USBA 1U6TA 4KGIA 1OE7A 3F4TA 1AUCA 3TRXA 2X49A 4KDXA 4YAPA 2CA8A 4EC0A 2K8SA 3HKRA 3EU4A 3FHKA 2H71A 4BA7A 4IQ1A 5JCUA 2H8LA 4IN0A 1YEPA 2VOCA 5B8AA 1R5AA 3EU3A 4KF9A 4TVEA 2AB6A 4MF7A 4IP1A 4CY6A 4YKGA 2PGTA 4PX1A 4OO5A 5KOXA 4ZB8A 3ZMLA 2HE3A 2YV7A 3GH6A 3R3EA 2F8FA 4V2MA 5ECQB 3ZIJA 3QDNA 1T8EB 1TKDB 2N5AA 3E9JB 1TP9A 2L4QA 5JWQB 2XC2A 4LLRA 4EO3A 2OE3A 3TCOA 1PRXA 1K3YA 5INYA 4POKA 3CRTA 1NHOA 4G0KA 1SL0B 4ECCA 3QAWA 3BBYA 2ON5A 1BX9A 3H79A 1GTAA 2NPBA 2A2PA 2I9HA 6GSVA 4K5RA 3QCPA 3ZYWA 1BEDA 3BOAA 1M2BA 3FY7A 5H5QA 3LEFA 2CAQA 2H01A 4N0ZA 3F63A 1XWGA 2FWEA 4ZILA 1X5EA 3EINA 5J3RA 3DYRA 2VAFA 3F4RA 3QOUA 3TJGA 3GKXA 4JRRA 2VLVA 4MF6A 2VLTA 2DMMA 5G31A 5CRDA 1WP0A 3IBHA 2GQLA 2V41A 4QL7A 3QAVA 4V1Ag 5BRTA 4N11A 4ECJA 1E2YA 1M9AA 4GSSA 1G6YA 3O76A 3VWWA 2X99A 4FYBA 2P5RA 2CVKA 3C1RA 3VWUA 1JLWA 3KD0A 2V6OA 3HY2A 4F9ZA 1WE0A 5D9VA 1PSQA 1TRWA 1R26A 2PN8A 2RUFA 1OC3A 4JBBA 2HSMA 4F82A 3M3MA 3KJYA 2QA1A 3DWVA 3NOFA 2WGRA 5JCWA 2DJKA 1VGLA 3CYNA 1OC8A 2LRNA 1QFNA 4L0WA 4YQMA 2LQOA 2JZRA 1O73A 1SYRA 2HRNA 1MDJA 3IPZA 1ST9A 3IHGA 4MH2A 5IM9A 3C8EA 4MCUA 1JFUA 4J2FA 3IK9A 1TTZA 1SD8A 4AJ6A 5LNKe 4N10A 3GNJA 1M0UA 2B3SA 1ERUA 1ZYPA 2E2GA 9GSSA 1BJXA 3HJMA 5DAKB 3CTGA 2VO4A 1EGRA 1S3CA 1KBNA 4HEA2 2F9SA 4Z2RA 1SU9A 2CX3A 4ECBA 1F2EA 2DKIA 5GSSA 1WPIA 2OKAA 1PMTA 3F6FA 4JE1A 3WD6A 3QPMA 5L71A 4NWYA 2QC7A 2LRCA 2IMFA 3GV1A 1GSDA 5ECPB 1F3BA 5CYYA 2FLSA 5D93A 3LQ7A 3TKSE 4O5QA 3VPTA 2PVOC 2O87A 3UJ1A 1SK0A 3M0FA 3D22A 4RI6A 1X5CA 3TJKA 1GRXA 4MF5A 2PU9C 1ILOA 2B6MA 2FWHA 5D96A 4XHMA 3A3TA 4CY8A 1XWBA 2CZ3A 1YEXA 4J56E 3VI7A 2XBQA 1WOUA 1ZZYA 5LCZA 3UVTA 2OJLA 5G1KA 4GXZA 2RLIA 4X43A 2IN3A 4YQVA 4BPYA 2HSYA 2BJXA 4ILFA 5A5KA 2G2QA 2X8CA 5DQYA 4JU5A 1X9MB 4I2UA 4TOPA 2HT9A 2LJKA 2MMZA 3HCZA 4G10A 4KSMA 4MPFA 2K9FA 2ALBA 2IMDA 4IP6A 5KN0A 4XRAA 1MDKA 3D0ZA 4POLA 4BL7A 2YP6A 2BMXA 4KUNA 4GTUA 3US3A 4CHSA 5IMAA 2JACA 5ECSA 5GSTA 2GSTA 1SL2B 2YZUA 2WJUA 3CSJA 2C8UA 3IAS2 2WCIA 4EDZA 2VL3A 4BWSA 3APOA 3DKSA 3FZ5A 3HDCA 5CRWA 1V58A 3GSTA 10GSA 1VF1A 5DALB 2WFCA 1QXHA 2QKEA 4IVFA 1Z6MA 4WR5A 3VWVA 4O5UA 1OKTA 1GTIA 4EIQA 4TR4A 2XBIA 1M7TA 2RM6A 4DSSB 5ELAA 1G0TA 4IELA 3KP9A 4TR3A 3DD3A 1B9XC 1X0RA 1JZRA 2GT5A 2DC5A 3SWLA 5IO2A 2BTOT 4GF0A 5LD0A 5AGYA 1AW9A 1E6BA 3M1GA 3F6DA 4GRFA 3IR4A 1OC9A 2X64A 4H86A 2LS5A 1M2AA 2DLXA 2IIYA 3UL3A 1Q98A 4PQHA 3G7YA 5IIZA 2FGXA 4NV5A 4QQ7A 2GSQA 2FWFA 3GL3A 2H75A 4OWYA 2GZPA 2LUSA 2IPAA 3HZ8A 1VF2A 1TU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UBK A;  2C0F A;  4DVC A;  1TJD A;  3N9J A;  1EV4 A;  5E59 A;  4AJ8 A;  4O7H A;  2JZT A;  2H0H A;  1V57 A;  1ZYE A;  2FCH A;  4WR4 A;  3EMP A;  2XPD A;  4F0C A;  3KTB A;  1XVQ A;  1SJZ A;  5C04 A;  5FT3 A;  4TN8 A;  5D73 A;  3HD5 A;  3WGE A;  5D8I A;  4CDO A;  4JR4 A;  4K6X A;  4XS4 A;  3RPP A;  5AIS A;  2B7K A;  3KMN A;  1SJI A;  3GX0 A;  2VL2 C;  2Z9S A;  1TRS A;  2LKU A;  1XWC A;  2IME A;  4TKY A;  3LWA A;  1EWX A;  3ERW A;  4I6X A;  4MPG A;  2X8H A;  5HR3 A;  3ZIV A;  3ZRD A;  4JED A;  19GS A;  4DSR A;  1XBS A;  4I5Q A;  1Z7P A;  1U3I A;  2TRC P;  1QUW A;  3DRN A;  3I43 A;  1S3D A;  3RDW A;  4EUY A;  1ERW A;  4HI7 A;  3UVH A;  1ERV A;  4NMU A;  3FR9 A;  4KSO A;  4K9Z A;  4WBR D;  3CBU A;  3LOR A;  3TRP A;  2M72 A;  1XW5 A;  4RI7 A;  4ZL7 A;  1X9W B;  4LMW A;  5AIV A;  1XCC A;  3GSS A;  1A24 A;  1DUG A;  1K0O A;  4WXT A;  1HNB A;  5CO3 A;  2CVD A;  2WRT A;  4KX4 A;  1Y25 A;  4GWR A;  3IE3 A;  4I2T A;  1AQW A;  18GS A;  3DVX A;  3U6V A;  4EE0 A;  4V2N A;  2YCD A;  4JR6 A;  2E7P A;  2G0F A;  5HFK A;  4RQR A;  1K0N A;  1U87 A;  1A8Y A;  2VM2 A;  4TW5 A;  2P5Q A;  1CQH A;  4LA1 A;  1HYU A;  4XRD A;  5EY6 A;  1TXX A;  3TUE A;  1MEK A;  1GWC A;  2R4V A;  4N0V A;  2B1L A;  1ML6 A;  4GQC A;  1BG5 A;  3KXO A;  3SBC A;  4MJB A;  2C0G A;  3TOT A;  4XS1 A;  3W6G A;  22GS A;  2YJH A;  2YWM A;  1IYI A;  3HJO A;  1GH2 A;  3DIE A;  1SKW B;  4OO4 A;  5EVO A;  1AC1 A;  3ME8 A;  3QD9 A;  2N5F A;  4XCS A;  3TJJ A;  3WGD A;  3D4M A;  4HJM A;  1Z9H A;  2YOI A;  1T4Y A;  2EIR A;  4ML6 A;  2B5Y A;  3NIV A;  3LSZ A;  1JHB A;  1K0D A;  5ECO B;  5EL8 A;  5ENU A;  5DDL A;  2PUK C;  4PQI A;  3Q18 A;  3ME7 A;  2HZE B;  4XS6 A;  1GL8 A;  8GSS A;  3GYK A;  5DCG A;  3DML A;  1Y6E A;  3UEM A;  1I9D A;  3KMO A;  1FVJ A;  4RUV A;  5COH A;  1SJ6 A;  3VFI A;  3LYP A;  1Q4J A;  4FIW A;  4KW6 A;  3NZN A;  2LRT A;  3TKQ A;  2C1Y A;  3VK9 A;  1TI3 A;  3GIX A;  2IL3 A;  3UMA A;  2VLU A;  4PNG A;  2V6K A;  3IK7 A;  1VF3 A;  2JAD A;  3BCI A;  2OBI A;  4E8H A;  2I1U A;  2NVL A;  1UA5 A;  3F0I A;  2XPE A;  2M46 A;  2DJ1 A;  1G7E A;  2MBS A;  1GLP A;  1TK5 B;  4WF5 A;  5A4W A;  3WYW A;  3GA4 A;  4NHZ A;  1R5P A;  2X8G A;  4I97 A;  1UVZ A;  1XOB A;  1B48 A;  4ZBA A;  4ZL8 A;  4K7I A;  5ID2 B;  1URM A;  1EZK A;  2VCQ A;  2WUL A;  5KN1 A;  1WRY A;  2YWN A;  2H0I A;  3D4T A;  3M9J A;  4D73 A;  4Q5F A;  1XOA A;  1K3O A;  3APQ A;  5HFI A;  7GSS A;  2E0Q A;  2FA8 A;  3ZVJ D;  2C3N A;  2FY6 A;  3M8N A;  2IFQ B;  4FH8 A;  3ZTL A;  3QFB C;  5IMF A;  4X0X A;  1EEM A;  1H75 A;  2YJ7 A;  1TRU A;  2GSS A;  2DJ3 A;  5HR1 A;  2DBC A;  5JWO B;  1JZW A;  3R2Q A;  3W8J A;  2VD1 A;  2O85 A;  1N8J A;  2YAN A;  3GKM A;  5DQS A;  2H72 A;  2CV4 A;  5G30 A;  3QR6 A;  1KNG A;  4OMV A;  2RII A;  2MBT A;  2VCV A;  5DBQ A;  5F0G A;  4KDY A;  3GKK A;  3CMI A;  3G7J A;  3GUR A;  3M9K A;  4ZBB A;  1K0C A;  2HSH A;  4V1A p;  3CSH A;  2GQK A;  2K8V A;  2RM5 A;  5CP1 A;  4ZXG A;  3S9F A;  2JZS A;  3GTU B;  2FA4 A;  4YH2 A;  2YWI A;  2VUP A;  4WET A;  1YJ6 A;  4GSN A;  2VL2 A;  5AIX A;  2WS2 A;  2ON7 A;  2TIR A;  3GUS A;  3I69 A;  4TXV A;  5B7C A;  1ZOF A;  3D21 A;  5DCH A;  1ZYQ B;  3UAP A;  1Z5Y E;  2D2Z A;  5CRG A;  1A2L A;  3KTL A;  1FVK A;  1YF0 A;  5DJM A;  4OFT A;  2MMN A;  4HOJ A;  3VWX A;  1DE1 A;  1AXD A;  6GSY A;  3LYK A;  1F9M A;  2GTU A;  4TR1 A;  1XFL A;  4EKZ A;  4NXI A;  5B6N A;  1K0A A;  5CRE A;  2AV4 A;  5F8B A;  2IMI A;  4LL1 B;  3FKF A;  4LMV A;  1SL1 B;  5DJL A;  1V98 A;  2B1K A;  3WT1 A;  2KLX A;  5DAK A;  1MDI A;  1MD4 A;  3MWH A;  2OE0 A;  2B5X A;  3PR8 A;  4MJC A;  1GSY A;  1C72 A;  3KP8 A;  4MP4 A;  2EC4 A;  2H73 A;  4ZL9 A;  20GS A;  2YWO A;  1VF4 A;  4F2I A;  3FW2 A;  2H6Y A;  2DIY A;  2H70 A;  4K8M A;  3D6I A;  4TXO A;  3A5W A;  4KND A;  4EF0 A;  4ID0 A;  1HNC A;  1THX A;  3TDG A;  4MDC A;  1F6M C;  5FHI A;  1SKR B;  5EPF A;  1HNA A;  3GMF A;  2AJQ B;  3TRQ A;  4PNF A;  4KCE A;  2EIO A;  1UN2 A;  3J7Y b;  2J9H A;  2LV3 A;  2L6C A;  2O7K A;  4HZ4 A;  2RUE A;  4AJ7 A;  1XWK A;  5H5R A;  1X5D A;  2V2G A;  1EOH A;  2NBS A;  1NHY A;  3HVV A;  5IMC A;  2VCW A;  4BWQ A;  3P7X A;  4ZIJ A;  3TB2 A;  3IXR A;  4POM A;  3C73 A;  4TR0 A;  4GCI A;  1T1V A;  2L5O A;  1LJR A;  5CNW A;  1TRV A;  3RPN A;  1FHE A;  2L59 A;  4ZB6 A;  2L4C A;  1PL2 A;  4IJ3 A;  2A2S A;  3FZ9 A;  4IKH A;  5DVB A;  3H4K A;  5IMZ A;  2HFD A;  1HQO A;  2ZNM A;  4L0U A;  3E0U A;  2AYT A;  1THO A;  1PKW A;  2OBK A;  4IS0 A;  2H66 A;  2OE1 A;  4K0N A;  1EOG A;  4PUF C;  3OR5 A;  3HVS A;  2YN1 A;  1Z7R A;  1PQN A;  3RHB A;  1T00 A;  4XS4 B;  1QMV A;  4K0G A;  4P3Y B;  5DAL A;  3WT2 A;  2VCX A;  4CW9 A;  2L57 A;  4MAB A;  1EGO A;  3ZFL A;  1XZO A;  1DSB A;  1K0M A;  4PGT A;  5F05 A;  1B4P A;  2V32 A;  1K3L A;  2H6X A;  4DSS A;  5ECK B;  1EEJ A;  4MA9 A;  2CAI A;  4OFN A;  3CRU A;  3F3R A;  2MMA A;  2GZZ A;  5IPH A;  1A2M A;  1SK2 A;  1M2D A;  1MD3 A;  1RQM A;  6GSW A;  4PUR A;  3F9U A;  1FO5 A;  1I5G A;  2ZCT A;  4Q5N A;  4AF2 A;  1XXU A;  3C7M A;  1YQ1 A;  5D9W A;  3KGK A;  4MJA A;  1O81 A;  14GS A;  1AQX A;  2P31 A;  3MNG A;  1QQ2 A;  4OD7 A;  3TJB A;  3FK8 A;  2AAW A;  1FOV A;  1WIK A;  4IGJ A;  2FHE A;  3L4N A;  4FO5 A;  2YZH A;  3O3T A;  3G9B A;  12GS A;  3FYG A;  5HR2 A;  3HYP A;  3V1W A;  2LNS A;  4HJ2 A;  2REM A;  1B8X A;  2IJY A;  4O32 A;  2CT6 A;  4OFM A;  5JWR B;  2IWT A;  2H74 A;  2NDO A;  1K0B A;  2K18 A;  1NW2 A;  2GS3 A;  3GH9 A;  3BD2 A;  4IQA A;  1XW6 A;  3KZQ A;  3FZ4 A;  3E3E A;  1R7H A;  5F06 A;  1FW1 A;  3C71 A;  2R2J A;  4HZ2 A;  2FD3 A;  3P8W A;  1YF1 A;  5A4V A;  2MMO A;  2LQQ A;  2B7J A;  1CQG A;  3Q19 A;  1DBY A;  6GSU A;  1BYE A;  2VCZ A;  5AN1 A;  5IQY A;  4EVM A;  5B8B A;  1XVW A;  2HZF A;  5J5N A;  3IDV A;  4HU7 A;  1B9Y C;  1MTC A;  1YY7 A;  5KN2 A;  2F51 A;  4KAE A;  3QFA C;  1PKZ A;  3MSZ A;  1GSU A;  5ABR A;  3MAK A;  5ECN B;  3HA9 A;  2QGV A;  4K7N A;  2GQM A;  3EE2 A;  5IOX A;  2R6K A;  3KM6 A;  4FYU A;  2GLR A;  1FG4 A;  1X9S B;  4ULX A;  3D5J A;  3VPQ A;  1A2J A;  1WMJ A;  2CQ9 A;  1WWJ A;  3KH9 A;  4I8B A;  1T7P B;  3I9V 2;  4BVX A;  4PXO A;  2ES7 A;  4KB3 A;  5F07 A;  5CRH A;  3EMX A;  4MK3 A;  1PA3 A;  1W4V A;  1ZL9 A;  2R5G A;  4IW9 A;  11GS A;  4IBP A;  2JL4 A;  4NAX A;  2DIZ A;  2AHE A;  4KH7 A;  3LG6 A;  3ERG A;  3DVW A;  4JZQ A;  4EXJ A;  2PER A;  3O6T A;  2LJR A;  2C0D A;  3HJP A;  4BVY A;  2WB9 A;  5IMV A;  3IA1 A;  2PPT A;  3EYT A;  5G5E A;  2TRX A;  3CXG A;  2A2R A;  3FEU A;  1TK8 B;  3H93 A;  4HS1 A;  3Q6O A;  1SD9 A;  2C3T A;  4D73 B;  1O85 A;  3ZFB A;  4GST A;  3J7Y k;  2CVB A;  1PL1 A;  1U3A A;  3L9U A;  3UIW A;  3ERF A;  2HYX A;  3IRA A;  5HQP A;  2GVP A;  4ACS A;  2FNO A;  3G7I A;  1W89 A;  2H6Z A;  1AIU A;  3W8S A;  2H1G A;  2PBJ A;  4HDE A;  4O92 A;  4L8E A;  4K7O A;  3IOS A;  4KDU A;  2F8A A;  4X1U A;  2N5B A;  3JCM L;  3FR3 A;  5B6M A;  4V2L A;  4AGS A;  4MZC A;  4MLY A;  2H1A A;  1DE2 A;  4YAV A;  3F3Q A;  2VM1 A;  4TRX A;  2LNT A;  1GTU A;  4FYC A;  1PGT A;  3TOU A;  3HZ4 A;  3A2W A;  1XW9 A;  3GN3 A;  1V9W A;  1AAZ A;  3GL5 A;  4PUA A;  5FWG A;  3VI5 A;  1ERT A;  5HR0 A;  2DJ0 A;  3C1S A;  1NSW A;  3TKR A;  1KTE A;  1TDI A;  3TKS C;  2H76 A;  2L5L A;  2P0G A;  4KCA A;  4WF4 A;  1PX7 A;  3ZIT A;  3N5O A;  1GTB A;  1A0R P;  4MMM A;  1ZMA A;  5ECH B;  2HZE A;  3A2X A;  2M80 A;  4MZB A;  3Q74 A;  1B4Q A;  3PGT A;  3GKN A;  3GFK A;  1TW9 A;  4Q5R A;  2JU5 A;  1TK0 B;  3APS A;  3L0H A;  1FB6 A;  5GZZ B;  1J9B A;  1J0F A;  2LST A;  5D9X A;  5A4U A;  1FAA A;  1LBK A;  1U88 A;  4IHU A;  16GS A;  3ZMK A;  3IAM 2;  5GAN D;  3CSI A;  3KCM A;  1H4O A;  2H30 A;  1OE8 A;  4MJE A;  4F0B A;  1SK1 A;  2VD0 A;  3EUR A;  5G2Z A;  3ZRE A;  4WBJ A;  4TR1 B;  2CX4 A;  5ECR B;  5J4U A;  5ID2 A;  3UBL A;  2HI7 A;  2R3X A;  5GAP D;  3VUR A;  3HXS A;  1EP8 A;  4J57 E;  3LFL A;  4GLT A;  5D9T A;  2C0E A;  1RK4 A;  4NPB A;  5IPG A;  3QAG A;  4NHW A;  1O8W A;  1GLQ A;  2IFQ A;  2GGT A;  1XIY A;  2C3Q A;  3WGX A;  3ISO A;  3GRX A;  3PIN A;  2KUC A;  3TGZ A;  1OAZ A;  3MDK A;  1XWA A;  4N30 A;  2LJA A;  5CAX A;  3F8U A;  2H19 A;  1GSF A;  1M99 A;  3FZA A;  4TXO B;  1S3A A;  3UOM A;  5ECM B;  5C00 A;  4L5O A;  2VIM A;  2YNX A;  3PH9 A;  1V40 A;  3EVI A;  4XIH A;  4KA0 A;  4HQS A;  2FWG A;  2K6V A;  3RHC A;  4ML1 A;  13GS A;  2JSY A;  2DSA A;  3ZVJ A;  3FRC A;  4RQX A;  2I4A A;  3P90 A;  2KHP A;  6GSS A;  1ABA A;  1OKD A;  1GSE A;  3FR6 A;  4ISD A;  5JCG A;  2VCT A;  2OAC A;  4XTS A;  1SEN A;  3H1N A;  2GDR A;  5E4W A;  3QMX A;  3GTU A;  3ZZX A;  5IOW A;  4DSQ A;  1BAY A;  5KEJ A;  3IC4 A;  1A23 A;  3EC3 A;  5ECL B;  3GHA A;  5IMD A;  2HXK A;  2DML A;  5G5F A;  2GSR A;  1GUM A;  3TKP A;  2O8V B;  1GSQ A;  1YZX A;  4QL9 A;  1ZCP A;  3LXT A;  4POB A;  1TI1 A;  1OC9 B;  4G2E A;  3I6A A;  1GP1 A;  2CZ2 A;  2JSZ A;  1GNW A;  1OVN A;  4GQF A;  2WZ9 A;  3BJ5 A;  4MZW A;  2I3Y A;  4ECI A;  2H0G A;  1YDK A;  4G9H A;  2GT6 A;  2O89 A;  4E8E A;  1QK8 A;  4HUA A;  1EV9 A;  4ZBD A;  5J9C A;  2LEG A;  3CTF A;  4MH3 A;  1AQV A;  1OYJ A;  1RW1 A;  1FB0 A;  1YKA A;  1M9B A;  3DGQ A;  2I81 A;  2HNL A;  4YQU A;  1GUH A;  2QSI A;  1QGV A;  2E2M A;  3UAR A;  1UC7 A;  2KP1 A;  3L9S A;  3U5R E;  3GX8 A;  1V2A A;  1Z6N A;  5G1L A;  1GUK A;  3HHV A;  5ECI B;  1JZD A;  2HLS A;  2J23 A;  3TJF A;  4Q5Q A;  1ACV A;  3F4S A;  4OCE A;  1G7O A;  3EWL A;  1SKS B;  2R37 A;  3HVX A;  17GS A;  2KP2 A;  3DXB A;  1O6J A;  2H1D A;  1ON4 A;  1SYX A;  1KEB A;  3L78 A;  4K2D A;  4EL1 A;  3KEB A;  2YPM A;  1GUL A;  2A4V A;  3H8Q A;  5H5S A;  4NV2 A;  2MYG A;  5ELG A;  1Z3E A;  1ZGN A;  4DEJ A;  1VRS D;  1WJK A;  3L9V A;  3P2A A;  2VL9 A;  1F37 A;  1EP7 A;  3TKS A;  4L5L A;  2L6D A;  1PD2 1;  3LGC A;  2V1M A;  1PN9 A;  2HRF A;  2WDU A;  2LTK A;  4KE3 A;  4ZB9 A;  2KOK A;  3ZLP A;  2PMT A;  3KH7 A;  1R4W A;  6GST A;  1JZO A;  1A8L A;  3DEX A;  1GNE A;  2OA7 A;  2DJJ A;  1O8X A;  1O7U A;  2IMK A;  2XHF A;  2B5E A;  1HD2 A;  3ZL5 A;  3IHQ A;  2F3M A;  1YKC A;  1TU7 A;  5HFG A;  4LL4 B;  3K8N A;  1G6W A;  1NM3 A;  3RAZ A;  3ED3 A;  2C4J A;  6GSX A;  4Z7X A;  3IV4 A;  1T4Z A;  4HQZ A;  2ZUP A;  4O5R A;  5J9B A;  1XPV A;  4G19 A;  1BQ7 A;  2PWJ A;  4PQ1 A;  4EDY A;  2C80 A;  4IJI A;  2EIQ A;  1PX6 A;  2DJ2 A;  2GZY A;  4K1F A;  2AUV A;  2PVQ A;  1T3B A;  3BCK A;  3VLN A;  3LJR A;  2OAD A;  2MZC A;  4F03 A;  1LU4 A;  1N2A A;  2YV9 A;  3LXZ A;  5IO0 A;  5KN3 A;  2NTO A;  3A2V A;  3RBT A;  4OCF A;  4HU9 A;  4WEY A;  1J08 A;  1GSS A;  1JLV A;  2H1B A;  1TOF A;  3KIJ A;  5J41 A;  1A0F A;  1F3A A;  1IYH A;  2FUG 2;  3AY8 A;  4WKW A;  1USB A;  1U6T A;  4KGI A;  1OE7 A;  3F4T A;  1AUC A;  3TRX A;  4KDX A;  4YAP A;  2CA8 A;  4EC0 A;  2K8S A;  3HKR A;  3EU4 A;  3FHK A;  2H71 A;  4BA7 A;  4IQ1 A;  5JCU A;  2H8L A;  4IN0 A;  1YEP A;  2VOC A;  5B8A A;  1R5A A;  3EU3 A;  4TVE A;  2AB6 A;  4MF7 A;  4IP1 A;  2PGT A;  4PX1 A;  4OO5 A;  4ZB8 A;  3ZML A;  2HE3 A;  2YV7 A;  3GH6 A;  2F8F A;  4V2M A;  5ECQ B;  3ZIJ A;  3QDN A;  1T8E B;  1TKD B;  2N5A A;  3E9J B;  1TP9 A;  2L4Q A;  5JWQ B;  2XC2 A;  4LLR A;  4EO3 A;  2OE3 A;  3TCO A;  1PRX A;  1K3Y A;  5INY A;  4POK A;  3CRT A;  1NHO A;  1SL0 B;  4ECC A;  3QAW A;  3BBY A;  2ON5 A;  1BX9 A;  3H79 A;  1GTA A;  2NPB A;  2I9H A;  6GSV A;  3QCP A;  3ZYW A;  1BED A;  3BOA A;  1M2B A;  3FY7 A;  5H5Q A;  3LEF A;  2CAQ A;  2H01 A;  4N0Z A;  3F63 A;  1XWG A;  2FWE A;  4ZIL A;  1X5E A;  3EIN A;  5J3R A;  3DYR A;  2VAF A;  3F4R A;  3QOU A;  3TJG A;  3GKX A;  4JRR A;  2VLV A;  4MF6 A;  2VLT A;  2DMM A;  5G31 A;  5CRD A;  1WP0 A;  3IBH A;  2GQL A;  2V41 A;  4QL7 A;  3QAV A;  4V1A g;  4N11 A;  4ECJ A;  1E2Y A;  1M9A A;  4GSS A;  1G6Y A;  3O76 A;  3VWW A;  2X99 A;  4FYB A;  2P5R A;  2CVK A;  3C1R A;  3VWU A;  1JLW A;  3KD0 A;  2V6O A;  3HY2 A;  4F9Z A;  1WE0 A;  5D9V A;  1PSQ A;  1TRW A;  1R26 A;  2PN8 A;  2RUF A;  1OC3 A;  4JBB A;  4F82 A;  3M3M A;  3KJY A;  3DWV A;  3NOF A;  2WGR A;  5JCW A;  2DJK A;  1VGL A;  3CYN A;  1OC8 A;  2LRN A;  1QFN A;  4L0W A;  4YQM A;  2LQO A;  2JZR A;  1O73 A;  1SYR A;  2HRN A;  1MDJ A;  3IPZ A;  1ST9 A;  4MH2 A;  5IM9 A;  3C8E A;  4MCU A;  1JFU A;  4J2F A;  3IK9 A;  1TTZ A;  1SD8 A;  4AJ6 A;  5LNK e;  4N10 A;  3GNJ A;  1M0U A;  2B3S A;  1ERU A;  2E2G A;  9GSS A;  1BJX A;  3HJM A;  5DAK B;  3CTG A;  2VO4 A;  1EGR A;  1S3C A;  1KBN A;  4HEA 2;  2F9S A;  1SU9 A;  2CX3 A;  4ECB A;  1F2E A;  5GSS A;  1WPI A;  2OKA A;  1PMT A;  3F6F A;  4JE1 A;  3WD6 A;  3QPM A;  5L71 A;  4NWY A;  2QC7 A;  2LRC A;  2IMF A;  3GV1 A;  1GSD A;  5ECP B;  1F3B A;  5CYY A;  2FLS A;  5D93 A;  3LQ7 A;  3TKS E;  3VPT A;  2PVO C;  2O87 A;  3UJ1 A;  1SK0 A;  3M0F A;  3D22 A;  4RI6 A;  1X5C A;  3TJK A;  1GRX A;  4MF5 A;  2PU9 C;  1ILO A;  2B6M A;  2FWH A;  5D96 A;  4XHM A;  3A3T A;  1XWB A;  2CZ3 A;  1YEX A;  4J56 E;  3VI7 A;  2XBQ A;  1WOU A;  1ZZY A;  5LCZ A;  3UVT A;  2OJL A;  5G1K A;  4GXZ A;  2RLI A;  4X43 A;  2IN3 A;  4YQV A;  4BPY A;  2HSY A;  2BJX A;  4ILF A;  5A5K A;  2G2Q A;  2X8C A;  5DQY A;  4JU5 A;  1X9M B;  4I2U A;  4TOP A;  2HT9 A;  2LJK A;  2MMZ A;  3HCZ A;  4G10 A;  4KSM A;  4MPF A;  2K9F A;  2ALB A;  2IMD A;  4IP6 A;  5KN0 A;  4XRA A;  1MDK A;  3D0Z A;  4POL A;  4BL7 A;  2YP6 A;  2BMX A;  4KUN A;  4GTU A;  3US3 A;  4CHS A;  5IMA A;  2JAC A;  5ECS A;  5GST A;  2GST A;  1SL2 B;  2YZU A;  2WJU A;  3CSJ A;  2C8U A;  3IAS 2;  2WCI A;  4EDZ A;  2VL3 A;  4BWS A;  3APO A;  3DKS A;  3FZ5 A;  3HDC A;  5CRW A;  1V58 A;  3GST A;  10GS A;  1VF1 A;  5DAL B;  2WFC A;  1QXH A;  2QKE A;  4IVF A;  1Z6M A;  4WR5 A;  3VWV A;  1OKT A;  1GTI A;  4TR4 A;  2XBI A;  1M7T A;  2RM6 A;  4DSS B;  5ELA A;  1G0T A;  4IEL A;  3KP9 A;  4TR3 A;  3DD3 A;  1B9X C;  1X0R A;  1JZR A;  2GT5 A;  2DC5 A;  3SWL A;  5IO2 A;  2BTO T;  4GF0 A;  5LD0 A;  5AGY A;  1AW9 A;  1E6B A;  3M1G A;  3F6D A;  4GRF A;  3IR4 A;  1OC9 A;  2X64 A;  4H86 A;  2LS5 A;  1M2A A;  2DLX A;  2IIY A;  3UL3 A;  1Q98 A;  4PQH A;  3G7Y A;  5IIZ A;  2FGX A;  4NV5 A;  4QQ7 A;  2GSQ A;  2FWF A;  3GL3 A;  2H75 A;  4OWY A;  2GZP A;  2LUS A;  2IPA A;  3HZ8 A;  1VF2 A;  1TU8 A; 
#chains in the Genus database with same CATH topology
 3UBK A;  2C0F A;  4DVC A;  1TJD A;  3N9J A;  1EV4 A;  5E59 A;  4AJ8 A;  4O7H A;  2JZT A;  2H0H A;  1V57 A;  1ZYE A;  2FCH A;  4WR4 A;  3EMP A;  2XPD A;  1PFO A;  4F0C A;  3KTB A;  1XVQ A;  1SJZ A;  3A5I A;  5C04 A;  5FT3 A;  4TN8 A;  5D73 A;  3HD5 A;  3WGE A;  5D8I A;  1M3I A;  4CDO A;  4JR4 A;  4K6X A;  4XS4 A;  3RPP A;  5AIS A;  2B7K A;  3KMN A;  1SJI A;  3GX0 A;  2VL2 C;  2Z9S A;  4HSC X;  1TRS A;  2LKU A;  1XWC A;  2IME A;  4TKY A;  3LWA A;  1EWX A;  3ERW A;  4I6X A;  4MPG A;  2X8H A;  5HR3 A;  3ZIV A;  3ZRD A;  4JED A;  19GS A;  4DSR A;  1XBS A;  4I5Q A;  1Z7P A;  1U3I A;  4BVX B;  2TRC P;  1QUW A;  3DRN A;  3I43 A;  1S3D A;  3RDW A;  4EUY A;  1ERW A;  4HI7 A;  3UVH A;  1ERV A;  4NMU A;  3FR9 A;  4KSO A;  4K9Z A;  4WBR D;  3CBU A;  3LOR A;  3TRP A;  2M72 A;  1XW5 A;  4RI7 A;  4ZL7 A;  1X9W B;  4LMW A;  5AIV A;  1XCC A;  3GSS A;  1A24 A;  3MIX A;  1DUG A;  1K0O A;  4WXT A;  1HNB A;  5CO3 A;  2CVD A;  2WRT A;  4KX4 A;  1Y25 A;  4GWR A;  3IE3 A;  4I2T A;  1AQW A;  18GS A;  3PPU A;  3DVX A;  3U6V A;  4EE0 A;  4V2N A;  2YCD A;  4JR6 A;  2E7P A;  2G0F A;  5HFK A;  4RQR A;  1K0N A;  1U87 A;  1A8Y A;  2VM2 A;  4TW5 A;  2P5Q A;  1CQH A;  4LA1 A;  1HYU A;  4XRD A;  5EY6 A;  1TXX A;  2R0G A;  3TUE A;  1MEK A;  1GWC A;  4G0L A;  2R4V A;  4N0V A;  2B1L A;  1ML6 A;  4GQC A;  1BG5 A;  3KXO A;  3SBC A;  4MJB A;  2C0G A;  3TOT A;  4XS1 A;  3W6G A;  22GS A;  2YJH A;  2YWM A;  1IYI A;  3HJO A;  1GH2 A;  3DIE A;  1SKW B;  4OO4 A;  5EVO A;  1AC1 A;  3ME8 A;  3QD9 A;  2N5F A;  4XCS A;  3TJJ A;  3WGD A;  3D4M A;  1M3J A;  4HJM A;  1Z9H A;  2YOI A;  1T4Y A;  2EIR A;  4ML6 A;  2B5Y A;  3NIV A;  3LSZ A;  1JHB A;  1K0D A;  5ECO B;  5EL8 A;  5ENU A;  5DDL A;  2PUK C;  4PQI A;  3Q18 A;  3ME7 A;  2HZE B;  4XS6 A;  1GL8 A;  8GSS A;  3GYK A;  5DCG A;  3DML A;  1Y6E A;  3UEM A;  1I9D A;  3KMO A;  1FVJ A;  4RUV A;  4BIK A;  5COH A;  1SJ6 A;  3VFI A;  3LYP A;  1Q4J A;  4Z2U A;  4FIW A;  4KW6 A;  3NZN A;  2LRT A;  3TKQ A;  2C1Y A;  3VK9 A;  1TI3 A;  3GIX A;  2IL3 A;  3UMA A;  2VLU A;  4PNG A;  2V6K A;  3IK7 A;  1VF3 A;  2JAD A;  3BCI A;  2OBI A;  4E8H A;  2I1U A;  2NVL A;  1UA5 A;  3F0I A;  2XPE A;  2M46 A;  2DJ1 A;  1G7E A;  2MBS A;  1GLP A;  1TK5 B;  4WF5 A;  5A4W A;  3WYW A;  3GA4 A;  4NHZ A;  1R5P A;  2X8G A;  4I97 A;  1UVZ A;  1XOB A;  1B48 A;  4ZBA A;  4ZL8 A;  4K7I A;  5ID2 B;  4K2X A;  1URM A;  1EZK A;  2VCQ A;  2WUL A;  5KN1 A;  1WRY A;  2YWN A;  2H0I A;  3D4T A;  3M9J A;  4D73 A;  4Q5F A;  1XOA A;  1K3O A;  3APQ A;  5HFI A;  7GSS A;  2DKH A;  2E0Q A;  2FA8 A;  3ZVJ D;  2C3N A;  2FY6 A;  3M8N A;  2IFQ B;  4FH8 A;  3ZTL A;  3LW9 A;  3QFB C;  5IMF A;  4X0X A;  1EEM A;  1H75 A;  2YJ7 A;  1TRU A;  2GSS A;  2DJ3 A;  5HR1 A;  2DBC A;  5JWO B;  1JZW A;  3R2Q A;  3W8J A;  2VD1 A;  2O85 A;  1N8J A;  2YAN A;  3GKM A;  5DQS A;  2H72 A;  2CV4 A;  5G30 A;  3QR6 A;  1KNG A;  4OMV A;  2RII A;  1PN0 A;  2MBT A;  3EPT A;  2VCV A;  5DBQ A;  5F0G A;  4KDY A;  3GKK A;  3CMI A;  3G7J A;  3GUR A;  3M9K A;  4ZBB A;  1K0C A;  2HSH A;  4V1A p;  3CSH A;  2GQK A;  2K8V A;  2RM5 A;  5CP1 A;  4ZXG A;  3S9F A;  2JZS A;  3GTU B;  2FA4 A;  4YH2 A;  2YWI A;  2VUP A;  4WET A;  1YJ6 A;  4GSN A;  2VL2 A;  5AIX A;  4A5P A;  2WS2 A;  2ON7 A;  2TIR A;  3GUS A;  3I69 A;  4TXV A;  5B7C A;  2X4A A;  1ZOF A;  3D21 A;  5DCH A;  1ZYQ B;  3UAP A;  1Z5Y E;  2A4H A;  2D2Z A;  5CRG A;  1A2L A;  3KTL A;  1FVK A;  1YF0 A;  5DJM A;  4OFT A;  2MMN A;  4HOJ A;  3VWX A;  1DE1 A;  1AXD A;  6GSY A;  3LYK A;  1F9M A;  2GTU A;  4TR1 A;  4USS A;  1XFL A;  4EKZ A;  4NXI A;  5B6N A;  1K0A A;  5CRE A;  2AV4 A;  5F8B A;  2IMI A;  4LL1 B;  3FKF A;  4LMV A;  1SL1 B;  5DJL A;  1V98 A;  2B1K A;  3WT1 A;  2R0P A;  2KLX A;  5DAK A;  1MDI A;  1MD4 A;  3MWH A;  2OE0 A;  2B5X A;  3PR8 A;  4MJC A;  1GSY A;  1C72 A;  3KP8 A;  4MP4 A;  2EC4 A;  2H73 A;  4ZL9 A;  20GS A;  2YWO A;  1VF4 A;  4F2I A;  3FW2 A;  2H6Y A;  2DIY A;  2H70 A;  4K8M A;  3D6I A;  4TXO A;  3A5W A;  4KND A;  4EF0 A;  4ID0 A;  2HRA A;  1HNC A;  1THX A;  3TDG A;  4MDC A;  1F6M C;  5FHI A;  1SKR B;  5EPF A;  1HNA A;  3GMF A;  2AJQ B;  3TRQ A;  4PNF A;  4G0I A;  4KCE A;  2EIO A;  1UN2 A;  3J7Y b;  2J9H A;  2LV3 A;  2L6C A;  2O7K A;  4HZ4 A;  2RUE A;  4AJ7 A;  1XWK A;  5H5R A;  1X5D A;  2V2G A;  1EOH A;  2NBS A;  1NHY A;  3HVV A;  5IMC A;  2VCW A;  4BWQ A;  3P7X A;  4ZIJ A;  3TB2 A;  3IXR A;  4POM A;  3C73 A;  4TR0 A;  4GCI A;  1T1V A;  2L5O A;  1LJR A;  5CNW A;  1TRV A;  3RPN A;  1FHE A;  2L59 A;  4ZB6 A;  2L4C A;  1PL2 A;  4IJ3 A;  2A2S A;  3FZ9 A;  4IKH A;  5DVB A;  3H4K A;  5IMZ A;  2HFD A;  1HQO A;  2ZNM A;  4L0U A;  3E0U A;  2AYT A;  1THO A;  1PKW A;  2OBK A;  4IS0 A;  2H66 A;  2OE1 A;  4K0N A;  1EOG A;  4PUF C;  3OR5 A;  3HVS A;  2YN1 A;  1Z7R A;  1PQN A;  3RHB A;  1T00 A;  4XS4 B;  1QMV A;  4K0G A;  4P3Y B;  5DAL A;  3WT2 A;  2VCX A;  4CW9 A;  2L57 A;  4MAB A;  1EGO A;  3ZFL A;  1XZO A;  1DSB A;  1K0M A;  4PGT A;  5F05 A;  1B4P A;  2V32 A;  1K3L A;  2H6X A;  4DSS A;  5ECK B;  1EEJ A;  4MA9 A;  2CAI A;  4OFN A;  3CRU A;  3F3R A;  2MMA A;  2GZZ A;  5IPH A;  1A2M A;  1SK2 A;  1M2D A;  1MD3 A;  1RQM A;  6GSW A;  4PUR A;  3F9U A;  2HRK A;  1FO5 A;  1I5G A;  2ZCT A;  4Q5N A;  4AF2 A;  1XXU A;  3C7M A;  4Z2T A;  1YQ1 A;  5D9W A;  3KGK A;  4MJA A;  1O81 A;  14GS A;  1AQX A;  5BMU A;  2P31 A;  3MNG A;  1QQ2 A;  5KOW A;  4OD7 A;  3TJB A;  3FK8 A;  2AAW A;  1FOV A;  1WIK A;  4IGJ A;  2FHE A;  3L4N A;  4FO5 A;  2YZH A;  3O3T A;  3G9B A;  12GS A;  3FYG A;  5HR2 A;  3HYP A;  3V1W A;  2LNS A;  4HJ2 A;  2REM A;  1B8X A;  2IJY A;  4O32 A;  2CT6 A;  4OFM A;  5JWR B;  2IWT A;  2H74 A;  2NDO A;  1K0B A;  2K18 A;  1NW2 A;  2GS3 A;  3GH9 A;  3BD2 A;  4IQA A;  1XW6 A;  3KZQ A;  3FZ4 A;  3E3E A;  1R7H A;  5F06 A;  1FW1 A;  3C71 A;  2R2J A;  4HZ2 A;  2FD3 A;  3P8W A;  1YF1 A;  5A4V A;  2MMO A;  2LQQ A;  2B7J A;  1CQG A;  3Q19 A;  1DBY A;  6GSU A;  1BYE A;  2VCZ A;  5AN1 A;  5IQY A;  4EVM A;  5B8B A;  1XVW A;  2HZF A;  5J5N A;  3IDV A;  4HU7 A;  1B9Y C;  1MTC A;  1YY7 A;  5KN2 A;  2F51 A;  4KAE A;  3QFA C;  1PKZ A;  3MSZ A;  1GSU A;  5ABR A;  3MAK A;  5ECN B;  3HA9 A;  2QGV A;  4K7N A;  2GQM A;  3EE2 A;  5IOX A;  2R6K A;  3KM6 A;  4FYU A;  2GLR A;  1FG4 A;  4K5S A;  1X9S B;  4ULX A;  3D5J A;  3VPQ A;  1A2J A;  1WMJ A;  2CQ9 A;  1WWJ A;  3KH9 A;  4I8B A;  1T7P B;  3I9V 2;  4BVX A;  4PXO A;  2ES7 A;  4KB3 A;  5F07 A;  5CRH A;  3EMX A;  4MK3 A;  1PA3 A;  1W4V A;  1ZL9 A;  2R5G A;  4IW9 A;  11GS A;  4IBP A;  2JL4 A;  4NAX A;  2DIZ A;  2AHE A;  4KH7 A;  3LG6 A;  3ERG A;  3DVW A;  4JZQ A;  4EXJ A;  2PER A;  3O6T A;  2LJR A;  2C0D A;  3HJP A;  4X4J A;  4BVY A;  2WB9 A;  5IMV A;  3IA1 A;  2PPT A;  3EYT A;  5G5E A;  2TRX A;  3CXG A;  2A2R A;  3FEU A;  1TK8 B;  3H93 A;  4HS1 A;  3Q6O A;  1SD9 A;  2C3T A;  4D73 B;  1O85 A;  3ZFB A;  4GST A;  3J7Y k;  2CVB A;  1PL1 A;  1U3A A;  3L9U A;  3UIW A;  1ZYN A;  3ERF A;  2HYX A;  3IRA A;  5HQP A;  2GVP A;  4ACS A;  2FNO A;  3G7I A;  1W89 A;  2H6Z A;  1AIU A;  3W8S A;  2H1G A;  2PBJ A;  4HDE A;  4O92 A;  4L8E A;  4K7O A;  3IOS A;  4KDU A;  2F8A A;  4X1U A;  2N5B A;  3JCM L;  3FR3 A;  5B6M A;  4V2L A;  1FOH A;  4AGS A;  4MZC A;  4MLY A;  2H1A A;  1DE2 A;  4YAV A;  3F3Q A;  2VM1 A;  4TRX A;  2LNT A;  1GTU A;  4FYC A;  1PGT A;  3TOU A;  3HZ4 A;  3A2W A;  1XW9 A;  3GN3 A;  1V9W A;  1AAZ A;  3GL5 A;  4PUA A;  5FWG A;  3VI5 A;  1ERT A;  5HR0 A;  2DJ0 A;  3C1S A;  1NSW A;  3TKR A;  1KTE A;  1TDI A;  3TKS C;  2H76 A;  2L5L A;  2P0G A;  4KCA A;  4WF4 A;  1PX7 A;  3ZIT A;  3N5O A;  1GTB A;  1A0R P;  4MMM A;  1ZMA A;  5ECH B;  2HZE A;  3A2X A;  2M80 A;  4MZB A;  3Q74 A;  1B4Q A;  3PGT A;  3GKN A;  3GFK A;  1TW9 A;  4Q5R A;  2JU5 A;  1TK0 B;  3APS A;  3L0H A;  1FB6 A;  5GZZ B;  1J9B A;  1J0F A;  2LST A;  5D9X A;  5A4U A;  1FAA A;  1LBK A;  1U88 A;  4IHU A;  16GS A;  3ZMK A;  3IAM 2;  5GAN D;  3CSI A;  3KCM A;  1H4O A;  2H30 A;  1OE8 A;  4MJE A;  4F0B A;  1SK1 A;  2VD0 A;  3EUR A;  5G2Z A;  3ZRE A;  4WBJ A;  2QA2 A;  4TR1 B;  2CX4 A;  5ECR B;  5J4U A;  5ID2 A;  3UBL A;  2HI7 A;  2R3X A;  5GAP D;  3VUR A;  3HXS A;  1EP8 A;  4J57 E;  3LFL A;  4GLT A;  5D9T A;  2C0E A;  1RK4 A;  4NPB A;  5IPG A;  3QAG A;  4NHW A;  1O8W A;  1GLQ A;  2IFQ A;  2GGT A;  4YKF A;  1XIY A;  2C3Q A;  3WGX A;  3ISO A;  3GRX A;  3PIN A;  2KUC A;  3MYD A;  3TGZ A;  1OAZ A;  3MDK A;  1XWA A;  4N30 A;  2LJA A;  5CAX A;  4MNN A;  4BL7 B;  3F8U A;  2H19 A;  1GSF A;  1M99 A;  3FZA A;  4TXO B;  1S3A A;  3UOM A;  5ECM B;  5C00 A;  4L5O A;  2VIM A;  2YNX A;  3PH9 A;  1V40 A;  3EVI A;  4XIH A;  4KA0 A;  4HQS A;  2FWG A;  2K6V A;  3RHC A;  4ML1 A;  13GS A;  2JSY A;  2DSA A;  3ZVJ A;  3FRC A;  4RQX A;  2I4A A;  3P90 A;  2KHP A;  6GSS A;  1ABA A;  1OKD A;  1GSE A;  3FR6 A;  4ISD A;  5JCG A;  2VCT A;  2OAC A;  4XTS A;  1SEN A;  3H1N A;  2GDR A;  5E4W A;  3QMX A;  3GTU A;  2UZ8 A;  3ZZX A;  5IOW A;  4DSQ A;  1BAY A;  5KEJ A;  3IC4 A;  1A23 A;  3EC3 A;  5ECL B;  3GHA A;  5IMD A;  2HXK A;  2DML A;  5G5F A;  2GSR A;  1GUM A;  4FQU A;  2O8V B;  3TKP A;  1GSQ A;  1YZX A;  4QL9 A;  1ZCP A;  3LXT A;  4POB A;  1TI1 A;  1OC9 B;  4G2E A;  2R0C A;  3I6A A;  1GP1 A;  2CZ2 A;  2JSZ A;  1GNW A;  1OVN A;  4GQF A;  2WZ9 A;  3BJ5 A;  4MZW A;  2I3Y A;  4ECI A;  2H0G A;  3FMW A;  1YDK A;  4G9H A;  2GT6 A;  2O89 A;  4E8E A;  1QK8 A;  3CQF A;  4HUA A;  1EV9 A;  4ZBD A;  5J9C A;  2LEG A;  3CTF A;  4MH3 A;  1AQV A;  1OYJ A;  1RW1 A;  1FB0 A;  1YKA A;  1M9B A;  3DGQ A;  2I81 A;  2HNL A;  4YQU A;  1GUH A;  2QSI A;  1QGV A;  2E2M A;  3UAR A;  1UC7 A;  2KP1 A;  3L9S A;  3U5R E;  3GX8 A;  1V2A A;  1Z6N A;  5G1L A;  1GUK A;  3HHV A;  5ECI B;  1JZD A;  2HLS A;  1XG8 A;  2J23 A;  3TJF A;  4Q5Q A;  1ACV A;  3F4S A;  4OCE A;  1G7O A;  3EWL A;  1SKS B;  2R37 A;  3HVX A;  17GS A;  2KP2 A;  3DXB A;  4EIP A;  1O6J A;  2H1D A;  1ON4 A;  1SYX A;  1KEB A;  3L78 A;  4K2D A;  4EL1 A;  3KEB A;  2YPM A;  1GUL A;  2A4V A;  3H8Q A;  5H5S A;  4NV2 A;  2MYG A;  5ELG A;  1Z3E A;  1ZGN A;  4DEJ A;  1VRS D;  1WJK A;  3L9V A;  3P2A A;  2VL9 A;  1F37 A;  1EP7 A;  3TKS A;  4L5L A;  2L6D A;  1PD2 1;  3LGC A;  2V1M A;  1PN9 A;  2HRF A;  2WDU A;  2LTK A;  4KE3 A;  4ZB9 A;  2KOK A;  3ZLP A;  2PMT A;  3KH7 A;  1R4W A;  6GST A;  1JZO A;  1A8L A;  3DEX A;  1GNE A;  2OA7 A;  2DJJ A;  3IC8 A;  4PTS A;  1O8X A;  1O7U A;  2IMK A;  2XHF A;  2B5E A;  1HD2 A;  3ZL5 A;  3IHQ A;  2F3M A;  1YKC A;  1TU7 A;  5HFG A;  4LL4 B;  3K8N A;  1G6W A;  1NM3 A;  3RAZ A;  3ED3 A;  2C4J A;  6GSX A;  4Z7X A;  3IV4 A;  1T4Z A;  4HQZ A;  2ZUP A;  4O5R A;  5J9B A;  1XPV A;  4G19 A;  1BQ7 A;  2PWJ A;  4PQ1 A;  4EDY A;  2C80 A;  4IJI A;  2EIQ A;  1PX6 A;  2DJ2 A;  2GZY A;  4ICY A;  4K1F A;  2AUV A;  2PVQ A;  1T3B A;  3BCK A;  3VLN A;  3LJR A;  2OAD A;  2MZC A;  4F03 A;  1LU4 A;  1N2A A;  2YV9 A;  3LXZ A;  5IO0 A;  5KN3 A;  2NTO A;  3A2V A;  3RBT A;  4OCF A;  4HU9 A;  4WEY A;  1J08 A;  1GSS A;  1JLV A;  2H1B A;  4BVY B;  1TOF A;  3KIJ A;  5J41 A;  1A0F A;  1F3A A;  1IYH A;  2FUG 2;  3AY8 A;  4WKW A;  1USB A;  1U6T A;  4KGI A;  1OE7 A;  3F4T A;  1AUC A;  3TRX A;  2X49 A;  4KDX A;  4YAP A;  2CA8 A;  4EC0 A;  2K8S A;  3HKR A;  3EU4 A;  3FHK A;  2H71 A;  4BA7 A;  4IQ1 A;  5JCU A;  2H8L A;  4IN0 A;  1YEP A;  2VOC A;  5B8A A;  1R5A A;  3EU3 A;  4KF9 A;  4TVE A;  2AB6 A;  4MF7 A;  4IP1 A;  4CY6 A;  4YKG A;  2PGT A;  4PX1 A;  4OO5 A;  5KOX A;  4ZB8 A;  3ZML A;  2HE3 A;  2YV7 A;  3GH6 A;  3R3E A;  2F8F A;  4V2M A;  5ECQ B;  3ZIJ A;  3QDN A;  1T8E B;  1TKD B;  2N5A A;  3E9J B;  1TP9 A;  2L4Q A;  5JWQ B;  2XC2 A;  4LLR A;  4EO3 A;  2OE3 A;  3TCO A;  1PRX A;  1K3Y A;  5INY A;  4POK A;  3CRT A;  1NHO A;  4G0K A;  1SL0 B;  4ECC A;  3QAW A;  3BBY A;  2ON5 A;  1BX9 A;  3H79 A;  1GTA A;  2NPB A;  2A2P A;  2I9H A;  6GSV A;  4K5R A;  3QCP A;  3ZYW A;  1BED A;  3BOA A;  1M2B A;  3FY7 A;  5H5Q A;  3LEF A;  2CAQ A;  2H01 A;  4N0Z A;  3F63 A;  1XWG A;  2FWE A;  4ZIL A;  1X5E A;  3EIN A;  5J3R A;  3DYR A;  2VAF A;  3F4R A;  3QOU A;  3TJG A;  3GKX A;  4JRR A;  2VLV A;  4MF6 A;  2VLT A;  2DMM A;  5G31 A;  5CRD A;  1WP0 A;  3IBH A;  2GQL A;  2V41 A;  4QL7 A;  3QAV A;  4V1A g;  5BRT A;  4N11 A;  4ECJ A;  1E2Y A;  1M9A A;  4GSS A;  1G6Y A;  3O76 A;  3VWW A;  2X99 A;  4FYB A;  2P5R A;  2CVK A;  3C1R A;  3VWU A;  1JLW A;  3KD0 A;  2V6O A;  3HY2 A;  4F9Z A;  1WE0 A;  5D9V A;  1PSQ A;  1TRW A;  1R26 A;  2PN8 A;  2RUF A;  1OC3 A;  4JBB A;  2HSM A;  4F82 A;  3M3M A;  3KJY A;  2QA1 A;  3DWV A;  3NOF A;  2WGR A;  5JCW A;  2DJK A;  1VGL A;  3CYN A;  1OC8 A;  2LRN A;  1QFN A;  4L0W A;  4YQM A;  2LQO A;  2JZR A;  1O73 A;  1SYR A;  2HRN A;  1MDJ A;  3IPZ A;  1ST9 A;  3IHG A;  4MH2 A;  5IM9 A;  3C8E A;  4MCU A;  1JFU A;  4J2F A;  3IK9 A;  1TTZ A;  1S3R A;  1SD8 A;  4AJ6 A;  5LNK e;  4N10 A;  3GNJ A;  1M0U A;  2B3S A;  1ERU A;  1ZYP A;  2E2G A;  9GSS A;  1BJX A;  3HJM A;  5DAK B;  3CTG A;  2VO4 A;  1EGR A;  1S3C A;  1KBN A;  4HEA 2;  2F9S A;  4Z2R A;  1SU9 A;  2CX3 A;  4ECB A;  1F2E A;  3HVN A;  2DKI A;  5GSS A;  1WPI A;  2OKA A;  1PMT A;  3F6F A;  4JE1 A;  3WD6 A;  3QPM A;  5L71 A;  4NWY A;  2QC7 A;  2LRC A;  2IMF A;  3GV1 A;  1GSD A;  5ECP B;  1F3B A;  5CYY A;  2FLS A;  5D93 A;  3LQ7 A;  3TKS E;  4O5Q A;  3VPT A;  2PVO C;  2O87 A;  3UJ1 A;  1SK0 A;  3M0F A;  3D22 A;  4RI6 A;  1X5C A;  3TJK A;  1GRX A;  4MF5 A;  2PU9 C;  1ILO A;  2B6M A;  2FWH A;  5D96 A;  4XHM A;  3A3T A;  4CY8 A;  1XWB A;  2CZ3 A;  1YEX A;  4J56 E;  3VI7 A;  2XBQ A;  1WOU A;  1ZZY A;  5LCZ A;  3UVT A;  2OJL A;  5G1K A;  4GXZ A;  2RLI A;  4X43 A;  2IN3 A;  4YQV A;  4BPY A;  2HSY A;  2BJX A;  4ILF A;  5A5K A;  2G2Q A;  2X8C A;  5DQY A;  4JU5 A;  1X9M B;  4I2U A;  4TOP A;  2HT9 A;  2LJK A;  2MMZ A;  3HCZ A;  4G10 A;  4KSM A;  4MPF A;  2K9F A;  2ALB A;  2IMD A;  4IP6 A;  5KN0 A;  4XRA A;  1MDK A;  3D0Z A;  4POL A;  4BL7 A;  2YP6 A;  2BMX A;  4KUN A;  4GTU A;  3US3 A;  4CHS A;  5IMA A;  2JAC A;  5ECS A;  5GST A;  2GST A;  1SL2 B;  2YZU A;  2WJU A;  3CSJ A;  2C8U A;  3IAS 2;  2WCI A;  4EDZ A;  2VL3 A;  4BWS A;  3APO A;  3DKS A;  3FZ5 A;  3HDC A;  5CRW A;  1V58 A;  3GST A;  10GS A;  1VF1 A;  5DAL B;  2WFC A;  1QXH A;  2QKE A;  4IVF A;  1Z6M A;  4WR5 A;  3VWV A;  4O5U A;  1OKT A;  1GTI A;  4EIQ A;  4TR4 A;  2XBI A;  1M7T A;  2RM6 A;  4DSS B;  5ELA A;  1G0T A;  4IEL A;  3KP9 A;  4TR3 A;  3DD3 A;  1B9X C;  1X0R A;  1JZR A;  2GT5 A;  2DC5 A;  3SWL A;  5IO2 A;  2BTO T;  4GF0 A;  5LD0 A;  5AGY A;  1AW9 A;  1E6B A;  3M1G A;  3F6D A;  4GRF A;  3IR4 A;  1OC9 A;  2X64 A;  4H86 A;  2LS5 A;  1M2A A;  2DLX A;  2IIY A;  3UL3 A;  1Q98 A;  4PQH A;  3G7Y A;  5IIZ A;  2FGX A;  4NV5 A;  4QQ7 A;  2GSQ A;  2FWF A;  3GL3 A;  2H75 A;  4OWY A;  2GZP A;  2LUS A;  2IPA A;  3HZ8 A;  1VF2 A;  1TU8 A; 
#chains in the Genus database with same CATH homology
 3UBK A;  2C0F A;  4DVC A;  1TJD A;  3N9J A;  1EV4 A;  5E59 A;  4AJ8 A;  4O7H A;  2JZT A;  2H0H A;  1V57 A;  1ZYE A;  2FCH A;  4WR4 A;  3EMP A;  2XPD A;  4F0C A;  3KTB A;  1XVQ A;  1SJZ A;  3A5I A;  5C04 A;  5FT3 A;  4TN8 A;  5D73 A;  3HD5 A;  3WGE A;  5D8I A;  4CDO A;  4JR4 A;  4K6X A;  4XS4 A;  3RPP A;  5AIS A;  2B7K A;  3KMN A;  1SJI A;  3GX0 A;  2VL2 C;  2Z9S A;  1TRS A;  2LKU A;  1XWC A;  2IME A;  4TKY A;  3LWA A;  1EWX A;  3ERW A;  4I6X A;  4MPG A;  2X8H A;  5HR3 A;  3ZIV A;  3ZRD A;  4JED A;  19GS A;  4DSR A;  1XBS A;  4I5Q A;  1Z7P A;  1U3I A;  4BVX B;  2TRC P;  1QUW A;  3DRN A;  3I43 A;  1S3D A;  3RDW A;  4EUY A;  1ERW A;  4HI7 A;  3UVH A;  1ERV A;  4NMU A;  3FR9 A;  4KSO A;  4K9Z A;  4WBR D;  3CBU A;  3LOR A;  3TRP A;  2M72 A;  1XW5 A;  4RI7 A;  4ZL7 A;  1X9W B;  4LMW A;  5AIV A;  1XCC A;  3GSS A;  1A24 A;  3MIX A;  1DUG A;  1K0O A;  4WXT A;  1HNB A;  5CO3 A;  2CVD A;  2WRT A;  4KX4 A;  1Y25 A;  4GWR A;  3IE3 A;  4I2T A;  1AQW A;  18GS A;  3PPU A;  3DVX A;  3U6V A;  4EE0 A;  4V2N A;  2YCD A;  4JR6 A;  2E7P A;  2G0F A;  5HFK A;  4RQR A;  1K0N A;  1U87 A;  1A8Y A;  2VM2 A;  4TW5 A;  2P5Q A;  1CQH A;  4LA1 A;  1HYU A;  4XRD A;  5EY6 A;  1TXX A;  2R0G A;  3TUE A;  1MEK A;  1GWC A;  4G0L A;  2R4V A;  4N0V A;  2B1L A;  1ML6 A;  4GQC A;  1BG5 A;  3KXO A;  3SBC A;  4MJB A;  2C0G A;  3TOT A;  4XS1 A;  3W6G A;  22GS A;  2YJH A;  2YWM A;  1IYI A;  3HJO A;  1GH2 A;  3DIE A;  1SKW B;  4OO4 A;  5EVO A;  1AC1 A;  3ME8 A;  3QD9 A;  2N5F A;  4XCS A;  3TJJ A;  3WGD A;  3D4M A;  4HJM A;  1Z9H A;  2YOI A;  1T4Y A;  2EIR A;  4ML6 A;  2B5Y A;  3NIV A;  3LSZ A;  1JHB A;  1K0D A;  5ECO B;  5EL8 A;  5ENU A;  5DDL A;  2PUK C;  4PQI A;  3Q18 A;  3ME7 A;  2HZE B;  4XS6 A;  1GL8 A;  8GSS A;  3GYK A;  5DCG A;  3DML A;  1Y6E A;  3UEM A;  1I9D A;  3KMO A;  1FVJ A;  4RUV A;  5COH A;  1SJ6 A;  3VFI A;  3LYP A;  1Q4J A;  4Z2U A;  4FIW A;  4KW6 A;  3NZN A;  2LRT A;  3TKQ A;  2C1Y A;  3VK9 A;  1TI3 A;  3GIX A;  2IL3 A;  3UMA A;  2VLU A;  4PNG A;  2V6K A;  3IK7 A;  1VF3 A;  2JAD A;  3BCI A;  2OBI A;  4E8H A;  2I1U A;  2NVL A;  1UA5 A;  3F0I A;  2XPE A;  2M46 A;  2DJ1 A;  1G7E A;  2MBS A;  1GLP A;  1TK5 B;  4WF5 A;  5A4W A;  3WYW A;  3GA4 A;  4NHZ A;  1R5P A;  2X8G A;  4I97 A;  1UVZ A;  1XOB A;  1B48 A;  4ZBA A;  4ZL8 A;  4K7I A;  5ID2 B;  4K2X A;  1URM A;  1EZK A;  2VCQ A;  2WUL A;  5KN1 A;  1WRY A;  2YWN A;  2H0I A;  3D4T A;  3M9J A;  4D73 A;  4Q5F A;  1XOA A;  1K3O A;  3APQ A;  5HFI A;  7GSS A;  2DKH A;  2E0Q A;  2FA8 A;  3ZVJ D;  2C3N A;  2FY6 A;  3M8N A;  2IFQ B;  4FH8 A;  3ZTL A;  3LW9 A;  3QFB C;  5IMF A;  4X0X A;  1EEM A;  1H75 A;  2YJ7 A;  1TRU A;  2GSS A;  2DJ3 A;  5HR1 A;  2DBC A;  5JWO B;  1JZW A;  3R2Q A;  3W8J A;  2VD1 A;  2O85 A;  1N8J A;  2YAN A;  3GKM A;  5DQS A;  2H72 A;  2CV4 A;  5G30 A;  3QR6 A;  1KNG A;  4OMV A;  2RII A;  1PN0 A;  2MBT A;  3EPT A;  2VCV A;  5DBQ A;  5F0G A;  4KDY A;  3GKK A;  3CMI A;  3G7J A;  3GUR A;  3M9K A;  4ZBB A;  1K0C A;  2HSH A;  4V1A p;  3CSH A;  2GQK A;  2K8V A;  2RM5 A;  5CP1 A;  4ZXG A;  3S9F A;  2JZS A;  3GTU B;  2FA4 A;  4YH2 A;  2YWI A;  2VUP A;  4WET A;  1YJ6 A;  4GSN A;  2VL2 A;  5AIX A;  4A5P A;  2WS2 A;  2ON7 A;  2TIR A;  3GUS A;  3I69 A;  4TXV A;  5B7C A;  2X4A A;  1ZOF A;  3D21 A;  5DCH A;  1ZYQ B;  3UAP A;  1Z5Y E;  2A4H A;  2D2Z A;  5CRG A;  1A2L A;  3KTL A;  1FVK A;  1YF0 A;  5DJM A;  4OFT A;  2MMN A;  4HOJ A;  3VWX A;  1DE1 A;  1AXD A;  6GSY A;  3LYK A;  1F9M A;  2GTU A;  4TR1 A;  4USS A;  1XFL A;  4EKZ A;  4NXI A;  5B6N A;  1K0A A;  5CRE A;  2AV4 A;  5F8B A;  2IMI A;  4LL1 B;  3FKF A;  4LMV A;  1SL1 B;  5DJL A;  1V98 A;  2B1K A;  3WT1 A;  2R0P A;  2KLX A;  5DAK A;  1MDI A;  1MD4 A;  3MWH A;  2OE0 A;  2B5X A;  3PR8 A;  4MJC A;  1GSY A;  1C72 A;  3KP8 A;  4MP4 A;  2EC4 A;  2H73 A;  4ZL9 A;  20GS A;  2YWO A;  1VF4 A;  4F2I A;  3FW2 A;  2H6Y A;  2DIY A;  2H70 A;  4K8M A;  3D6I A;  4TXO A;  3A5W A;  4KND A;  4EF0 A;  4ID0 A;  2HRA A;  1HNC A;  1THX A;  3TDG A;  4MDC A;  1F6M C;  5FHI A;  1SKR B;  5EPF A;  1HNA A;  3GMF A;  2AJQ B;  3TRQ A;  4PNF A;  4G0I A;  4KCE A;  2EIO A;  1UN2 A;  3J7Y b;  2J9H A;  2LV3 A;  2L6C A;  2O7K A;  4HZ4 A;  2RUE A;  4AJ7 A;  1XWK A;  5H5R A;  1X5D A;  2V2G A;  1EOH A;  2NBS A;  1NHY A;  3HVV A;  5IMC A;  2VCW A;  4BWQ A;  3P7X A;  4ZIJ A;  3TB2 A;  3IXR A;  4POM A;  3C73 A;  4TR0 A;  4GCI A;  1T1V A;  2L5O A;  1LJR A;  5CNW A;  1TRV A;  3RPN A;  1FHE A;  2L59 A;  4ZB6 A;  2L4C A;  1PL2 A;  4IJ3 A;  2A2S A;  3FZ9 A;  4IKH A;  5DVB A;  3H4K A;  5IMZ A;  2HFD A;  1HQO A;  2ZNM A;  4L0U A;  3E0U A;  2AYT A;  1THO A;  1PKW A;  2OBK A;  4IS0 A;  2H66 A;  2OE1 A;  4K0N A;  1EOG A;  4PUF C;  3OR5 A;  3HVS A;  2YN1 A;  1Z7R A;  1PQN A;  3RHB A;  1T00 A;  4XS4 B;  1QMV A;  4K0G A;  4P3Y B;  5DAL A;  3WT2 A;  2VCX A;  4CW9 A;  2L57 A;  4MAB A;  1EGO A;  3ZFL A;  1XZO A;  1DSB A;  1K0M A;  4PGT A;  5F05 A;  1B4P A;  2V32 A;  1K3L A;  2H6X A;  4DSS A;  5ECK B;  1EEJ A;  4MA9 A;  2CAI A;  4OFN A;  3CRU A;  3F3R A;  2MMA A;  2GZZ A;  5IPH A;  1A2M A;  1SK2 A;  1M2D A;  1MD3 A;  1RQM A;  6GSW A;  4PUR A;  3F9U A;  2HRK A;  1FO5 A;  1I5G A;  2ZCT A;  4Q5N A;  4AF2 A;  1XXU A;  3C7M A;  4Z2T A;  1YQ1 A;  5D9W A;  3KGK A;  4MJA A;  1O81 A;  14GS A;  1AQX A;  5BMU A;  2P31 A;  3MNG A;  1QQ2 A;  5KOW A;  4OD7 A;  3TJB A;  3FK8 A;  2AAW A;  1FOV A;  1WIK A;  4IGJ A;  2FHE A;  3L4N A;  4FO5 A;  2YZH A;  3O3T A;  3G9B A;  12GS A;  3FYG A;  5HR2 A;  3HYP A;  3V1W A;  2LNS A;  4HJ2 A;  2REM A;  1B8X A;  2IJY A;  4O32 A;  2CT6 A;  4OFM A;  5JWR B;  2IWT A;  2H74 A;  2NDO A;  1K0B A;  2K18 A;  1NW2 A;  2GS3 A;  3GH9 A;  3BD2 A;  4IQA A;  1XW6 A;  3KZQ A;  3FZ4 A;  3E3E A;  1R7H A;  5F06 A;  1FW1 A;  3C71 A;  2R2J A;  4HZ2 A;  2FD3 A;  3P8W A;  1YF1 A;  5A4V A;  2MMO A;  2LQQ A;  2B7J A;  1CQG A;  3Q19 A;  1DBY A;  6GSU A;  1BYE A;  2VCZ A;  5AN1 A;  5IQY A;  4EVM A;  5B8B A;  1XVW A;  2HZF A;  5J5N A;  3IDV A;  4HU7 A;  1B9Y C;  1MTC A;  1YY7 A;  5KN2 A;  2F51 A;  4KAE A;  3QFA C;  1PKZ A;  3MSZ A;  1GSU A;  5ABR A;  3MAK A;  5ECN B;  3HA9 A;  2QGV A;  4K7N A;  2GQM A;  3EE2 A;  5IOX A;  2R6K A;  3KM6 A;  4FYU A;  2GLR A;  1FG4 A;  4K5S A;  1X9S B;  4ULX A;  3D5J A;  3VPQ A;  1A2J A;  1WMJ A;  2CQ9 A;  1WWJ A;  3KH9 A;  4I8B A;  1T7P B;  3I9V 2;  4BVX A;  4PXO A;  2ES7 A;  4KB3 A;  5F07 A;  5CRH A;  3EMX A;  4MK3 A;  1PA3 A;  1W4V A;  1ZL9 A;  2R5G A;  4IW9 A;  11GS A;  4IBP A;  2JL4 A;  4NAX A;  2DIZ A;  2AHE A;  4KH7 A;  3LG6 A;  3ERG A;  3DVW A;  4JZQ A;  4EXJ A;  2PER A;  3O6T A;  2LJR A;  2C0D A;  3HJP A;  4X4J A;  4BVY A;  2WB9 A;  5IMV A;  3IA1 A;  2PPT A;  3EYT A;  5G5E A;  2TRX A;  3CXG A;  2A2R A;  3FEU A;  1TK8 B;  3H93 A;  4HS1 A;  3Q6O A;  1SD9 A;  2C3T A;  4D73 B;  1O85 A;  3ZFB A;  4GST A;  3J7Y k;  2CVB A;  1PL1 A;  1U3A A;  3L9U A;  3UIW A;  1ZYN A;  3ERF A;  2HYX A;  3IRA A;  5HQP A;  2GVP A;  4ACS A;  2FNO A;  3G7I A;  1W89 A;  2H6Z A;  1AIU A;  3W8S A;  2H1G A;  2PBJ A;  4HDE A;  4O92 A;  4L8E A;  4K7O A;  3IOS A;  4KDU A;  2F8A A;  4X1U A;  2N5B A;  3JCM L;  3FR3 A;  5B6M A;  4V2L A;  1FOH A;  4AGS A;  4MZC A;  4MLY A;  2H1A A;  1DE2 A;  4YAV A;  3F3Q A;  2VM1 A;  4TRX A;  2LNT A;  1GTU A;  4FYC A;  1PGT A;  3TOU A;  3HZ4 A;  3A2W A;  1XW9 A;  3GN3 A;  1V9W A;  1AAZ A;  3GL5 A;  4PUA A;  5FWG A;  3VI5 A;  1ERT A;  5HR0 A;  2DJ0 A;  3C1S A;  1NSW A;  3TKR A;  1KTE A;  1TDI A;  3TKS C;  2H76 A;  2L5L A;  2P0G A;  4KCA A;  4WF4 A;  1PX7 A;  3ZIT A;  3N5O A;  1GTB A;  1A0R P;  4MMM A;  1ZMA A;  5ECH B;  2HZE A;  3A2X A;  2M80 A;  4MZB A;  3Q74 A;  1B4Q A;  3PGT A;  3GKN A;  3GFK A;  1TW9 A;  4Q5R A;  2JU5 A;  1TK0 B;  3APS A;  3L0H A;  1FB6 A;  5GZZ B;  1J9B A;  1J0F A;  2LST A;  5D9X A;  5A4U A;  1FAA A;  1LBK A;  1U88 A;  4IHU A;  16GS A;  3ZMK A;  3IAM 2;  5GAN D;  3CSI A;  3KCM A;  1H4O A;  2H30 A;  1OE8 A;  4MJE A;  4F0B A;  1SK1 A;  2VD0 A;  3EUR A;  5G2Z A;  3ZRE A;  4WBJ A;  2QA2 A;  4TR1 B;  2CX4 A;  5ECR B;  5J4U A;  5ID2 A;  3UBL A;  2HI7 A;  2R3X A;  5GAP D;  3VUR A;  3HXS A;  1EP8 A;  4J57 E;  3LFL A;  4GLT A;  5D9T A;  2C0E A;  1RK4 A;  4NPB A;  5IPG A;  3QAG A;  4NHW A;  1O8W A;  1GLQ A;  2IFQ A;  2GGT A;  4YKF A;  1XIY A;  2C3Q A;  3WGX A;  3ISO A;  3GRX A;  3PIN A;  2KUC A;  3MYD A;  3TGZ A;  1OAZ A;  3MDK A;  1XWA A;  4N30 A;  2LJA A;  5CAX A;  4MNN A;  4BL7 B;  3F8U A;  2H19 A;  1GSF A;  1M99 A;  3FZA A;  4TXO B;  1S3A A;  3UOM A;  5ECM B;  5C00 A;  4L5O A;  2VIM A;  2YNX A;  3PH9 A;  1V40 A;  3EVI A;  4XIH A;  4KA0 A;  4HQS A;  2FWG A;  2K6V A;  3RHC A;  4ML1 A;  13GS A;  2JSY A;  2DSA A;  3ZVJ A;  3FRC A;  4RQX A;  2I4A A;  3P90 A;  2KHP A;  6GSS A;  1ABA A;  1OKD A;  1GSE A;  3FR6 A;  4ISD A;  5JCG A;  2VCT A;  2OAC A;  4XTS A;  1SEN A;  3H1N A;  2GDR A;  5E4W A;  3QMX A;  3GTU A;  2UZ8 A;  3ZZX A;  5IOW A;  4DSQ A;  1BAY A;  5KEJ A;  3IC4 A;  1A23 A;  3EC3 A;  5ECL B;  3GHA A;  5IMD A;  2HXK A;  2DML A;  5G5F A;  2GSR A;  1GUM A;  4FQU A;  2O8V B;  3TKP A;  1GSQ A;  1YZX A;  4QL9 A;  1ZCP A;  3LXT A;  4POB A;  1TI1 A;  1OC9 B;  4G2E A;  2R0C A;  3I6A A;  1GP1 A;  2CZ2 A;  2JSZ A;  1GNW A;  1OVN A;  4GQF A;  2WZ9 A;  3BJ5 A;  4MZW A;  2I3Y A;  4ECI A;  2H0G A;  3FMW A;  1YDK A;  4G9H A;  2GT6 A;  2O89 A;  4E8E A;  1QK8 A;  4HUA A;  1EV9 A;  4ZBD A;  5J9C A;  2LEG A;  3CTF A;  4MH3 A;  1AQV A;  1OYJ A;  1RW1 A;  1FB0 A;  1YKA A;  1M9B A;  3DGQ A;  2I81 A;  2HNL A;  4YQU A;  1GUH A;  2QSI A;  1QGV A;  2E2M A;  3UAR A;  1UC7 A;  2KP1 A;  3L9S A;  3U5R E;  3GX8 A;  1V2A A;  1Z6N A;  5G1L A;  1GUK A;  3HHV A;  5ECI B;  1JZD A;  2HLS A;  2J23 A;  3TJF A;  4Q5Q A;  1ACV A;  3F4S A;  4OCE A;  1G7O A;  3EWL A;  1SKS B;  2R37 A;  3HVX A;  17GS A;  2KP2 A;  3DXB A;  4EIP A;  1O6J A;  2H1D A;  1ON4 A;  1SYX A;  1KEB A;  3L78 A;  4K2D A;  4EL1 A;  3KEB A;  2YPM A;  1GUL A;  2A4V A;  3H8Q A;  5H5S A;  4NV2 A;  2MYG A;  5ELG A;  1Z3E A;  1ZGN A;  4DEJ A;  1VRS D;  1WJK A;  3L9V A;  3P2A A;  2VL9 A;  1F37 A;  1EP7 A;  3TKS A;  4L5L A;  2L6D A;  1PD2 1;  3LGC A;  2V1M A;  1PN9 A;  2HRF A;  2WDU A;  2LTK A;  4KE3 A;  4ZB9 A;  2KOK A;  3ZLP A;  2PMT A;  3KH7 A;  1R4W A;  6GST A;  1JZO A;  1A8L A;  3DEX A;  1GNE A;  2OA7 A;  2DJJ A;  3IC8 A;  4PTS A;  1O8X A;  1O7U A;  2IMK A;  2XHF A;  2B5E A;  1HD2 A;  3ZL5 A;  3IHQ A;  2F3M A;  1YKC A;  1TU7 A;  5HFG A;  4LL4 B;  3K8N A;  1G6W A;  1NM3 A;  3RAZ A;  3ED3 A;  2C4J A;  6GSX A;  4Z7X A;  3IV4 A;  1T4Z A;  4HQZ A;  2ZUP A;  4O5R A;  5J9B A;  1XPV A;  4G19 A;  1BQ7 A;  2PWJ A;  4PQ1 A;  4EDY A;  2C80 A;  4IJI A;  2EIQ A;  1PX6 A;  2DJ2 A;  2GZY A;  4ICY A;  4K1F A;  2AUV A;  2PVQ A;  1T3B A;  3BCK A;  3VLN A;  3LJR A;  2OAD A;  2MZC A;  4F03 A;  1LU4 A;  1N2A A;  2YV9 A;  3LXZ A;  5IO0 A;  5KN3 A;  2NTO A;  3A2V A;  3RBT A;  4OCF A;  4HU9 A;  4WEY A;  1J08 A;  1GSS A;  1JLV A;  2H1B A;  4BVY B;  1TOF A;  3KIJ A;  5J41 A;  1A0F A;  1F3A A;  1IYH A;  2FUG 2;  3AY8 A;  4WKW A;  1USB A;  1U6T A;  4KGI A;  1OE7 A;  3F4T A;  1AUC A;  3TRX A;  2X49 A;  4KDX A;  4YAP A;  2CA8 A;  4EC0 A;  2K8S A;  3HKR A;  3EU4 A;  3FHK A;  2H71 A;  4BA7 A;  4IQ1 A;  5JCU A;  2H8L A;  4IN0 A;  1YEP A;  2VOC A;  5B8A A;  1R5A A;  3EU3 A;  4KF9 A;  4TVE A;  2AB6 A;  4MF7 A;  4IP1 A;  4CY6 A;  4YKG A;  2PGT A;  4PX1 A;  4OO5 A;  5KOX A;  4ZB8 A;  3ZML A;  2HE3 A;  2YV7 A;  3GH6 A;  3R3E A;  2F8F A;  4V2M A;  5ECQ B;  3ZIJ A;  3QDN A;  1T8E B;  1TKD B;  2N5A A;  3E9J B;  1TP9 A;  2L4Q A;  5JWQ B;  2XC2 A;  4LLR A;  4EO3 A;  2OE3 A;  3TCO A;  1PRX A;  1K3Y A;  5INY A;  4POK A;  3CRT A;  1NHO A;  4G0K A;  1SL0 B;  4ECC A;  3QAW A;  3BBY A;  2ON5 A;  1BX9 A;  3H79 A;  1GTA A;  2NPB A;  2A2P A;  2I9H A;  6GSV A;  4K5R A;  3QCP A;  3ZYW A;  1BED A;  3BOA A;  1M2B A;  3FY7 A;  5H5Q A;  3LEF A;  2CAQ A;  2H01 A;  4N0Z A;  3F63 A;  1XWG A;  2FWE A;  4ZIL A;  1X5E A;  3EIN A;  5J3R A;  3DYR A;  2VAF A;  3F4R A;  3QOU A;  3TJG A;  3GKX A;  4JRR A;  2VLV A;  4MF6 A;  2VLT A;  2DMM A;  5G31 A;  5CRD A;  1WP0 A;  3IBH A;  2GQL A;  2V41 A;  4QL7 A;  3QAV A;  4V1A g;  5BRT A;  4N11 A;  4ECJ A;  1E2Y A;  1M9A A;  4GSS A;  1G6Y A;  3O76 A;  3VWW A;  2X99 A;  4FYB A;  2P5R A;  2CVK A;  3C1R A;  3VWU A;  1JLW A;  3KD0 A;  2V6O A;  3HY2 A;  4F9Z A;  1WE0 A;  5D9V A;  1PSQ A;  1TRW A;  1R26 A;  2PN8 A;  2RUF A;  1OC3 A;  4JBB A;  2HSM A;  4F82 A;  3M3M A;  3KJY A;  2QA1 A;  3DWV A;  3NOF A;  2WGR A;  5JCW A;  2DJK A;  1VGL A;  3CYN A;  1OC8 A;  2LRN A;  1QFN A;  4L0W A;  4YQM A;  2LQO A;  2JZR A;  1O73 A;  1SYR A;  2HRN A;  1MDJ A;  3IPZ A;  1ST9 A;  3IHG A;  4MH2 A;  5IM9 A;  3C8E A;  4MCU A;  1JFU A;  4J2F A;  3IK9 A;  1TTZ A;  1SD8 A;  4AJ6 A;  5LNK e;  4N10 A;  3GNJ A;  1M0U A;  2B3S A;  1ERU A;  1ZYP A;  2E2G A;  9GSS A;  1BJX A;  3HJM A;  5DAK B;  3CTG A;  2VO4 A;  1EGR A;  1S3C A;  1KBN A;  4HEA 2;  2F9S A;  4Z2R A;  1SU9 A;  2CX3 A;  4ECB A;  1F2E A;  2DKI A;  5GSS A;  1WPI A;  2OKA A;  1PMT A;  3F6F A;  4JE1 A;  3WD6 A;  3QPM A;  5L71 A;  4NWY A;  2QC7 A;  2LRC A;  2IMF A;  3GV1 A;  1GSD A;  5ECP B;  1F3B A;  5CYY A;  2FLS A;  5D93 A;  3LQ7 A;  3TKS E;  4O5Q A;  3VPT A;  2PVO C;  2O87 A;  3UJ1 A;  1SK0 A;  3M0F A;  3D22 A;  4RI6 A;  1X5C A;  3TJK A;  1GRX A;  4MF5 A;  2PU9 C;  1ILO A;  2B6M A;  2FWH A;  5D96 A;  4XHM A;  3A3T A;  4CY8 A;  1XWB A;  2CZ3 A;  1YEX A;  4J56 E;  3VI7 A;  2XBQ A;  1WOU A;  1ZZY A;  5LCZ A;  3UVT A;  2OJL A;  5G1K A;  4GXZ A;  2RLI A;  4X43 A;  2IN3 A;  4YQV A;  4BPY A;  2HSY A;  2BJX A;  4ILF A;  5A5K A;  2G2Q A;  2X8C A;  5DQY A;  4JU5 A;  1X9M B;  4I2U A;  4TOP A;  2HT9 A;  2LJK A;  2MMZ A;  3HCZ A;  4G10 A;  4KSM A;  4MPF A;  2K9F A;  2ALB A;  2IMD A;  4IP6 A;  5KN0 A;  4XRA A;  1MDK A;  3D0Z A;  4POL A;  4BL7 A;  2YP6 A;  2BMX A;  4KUN A;  4GTU A;  3US3 A;  4CHS A;  5IMA A;  2JAC A;  5ECS A;  5GST A;  2GST A;  1SL2 B;  2YZU A;  2WJU A;  3CSJ A;  2C8U A;  3IAS 2;  2WCI A;  4EDZ A;  2VL3 A;  4BWS A;  3APO A;  3DKS A;  3FZ5 A;  3HDC A;  5CRW A;  1V58 A;  3GST A;  10GS A;  1VF1 A;  5DAL B;  2WFC A;  1QXH A;  2QKE A;  4IVF A;  1Z6M A;  4WR5 A;  3VWV A;  4O5U A;  1OKT A;  1GTI A;  4EIQ A;  4TR4 A;  2XBI A;  1M7T A;  2RM6 A;  4DSS B;  5ELA A;  1G0T A;  4IEL A;  3KP9 A;  4TR3 A;  3DD3 A;  1B9X C;  1X0R A;  1JZR A;  2GT5 A;  2DC5 A;  3SWL A;  5IO2 A;  2BTO T;  4GF0 A;  5LD0 A;  5AGY A;  1AW9 A;  1E6B A;  3M1G A;  3F6D A;  4GRF A;  3IR4 A;  1OC9 A;  2X64 A;  4H86 A;  2LS5 A;  1M2A A;  2DLX A;  2IIY A;  3UL3 A;  1Q98 A;  4PQH A;  3G7Y A;  5IIZ A;  2FGX A;  4NV5 A;  4QQ7 A;  2GSQ A;  2FWF A;  3GL3 A;  2H75 A;  4OWY A;  2GZP A;  2LUS A;  2IPA A;  3HZ8 A;  1VF2 A;  1TU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...