3MWHA

The 1.4 ang crystal structure of the arsd arsenic metallochaperone provides insights into its interactions with the arsa atpase
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
109
structure length
99
Chain Sequence
MKTLMVFDPTDVDQALVDFSTDVQWLKQCGVQIERFNLAQQPMSFVQNEKVKAFIEASGAEGLPLLLLDGETVMAGRYPKRAELARWFGIPLDKVGLAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Arsenical resistance operon trans-acting repressor arsD
source organism Escherichia coli
total genus 25
structure length 99
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3mwhA00
4XS1A 4G10A 2X8HA 1T8EB 1I5GA 3M0FA 3LYKA 3BBYA 2L59A 2K8VA 4NMUA 2OJLA 2PN8A 4WF5A 4HQSA 5FWGA 1T1VA 4J2FA 4V2LA 4G2EA 1PD21 5AISA 2X8CA 2CVKA 4PNGA 5C00A 1BEDA 3NZNA 4KX4A 12GSA 1PA3A 1TRVA 1J9BA 1GSEA 4MABA 1TKDB 3QMXA 1X9SB 3R2QA 4ECJA 3FZ5A 5HR2A 6GSVA 4YQVA 1W4VA 2QSIA 5IMFA 1S3CA 2AHEA 4EL1A 4MJEA 1YF1A 4GF0A 4WR4A 1GTAA 3HJOA 3QAWA 3GN3A 1SK0A 4JE1A 5DQSA 2OE1A 4L0UA 3ZMKA 1SKWB 2F8AA 2MMOA 4OMVA 2H1BA 2C4JA 3IR4A 2OBIA 4WXTA 2JZRA 2M72A 5AIXA 5IO0A 3WYWA 4HZ2A 3F6DA 3A3TA 4V1Ag 2YWMA 2KLXA 16GSA 2RUFA 2DMMA 3ZZXA 4DVCA 2V41A 3TJGA 4RI7A 2GZYA 5G2ZA 2HE3A 2IJYA 1HYUA 3FKFA 3FW2A 2B1LA 3I43A 3KEBA 5F06A 1IYIA 4WR5A 2LSTA 2AYTA 4EUYA 2E7PA 1WMJA 1YF0A 2B7JA 3IC4A 2LKUA 3E9JB 2H0IA 4IJIA 4HU7A 4KUNA 2AJQB 4DSRA 5ECHB 4HJMA 4N30A 4IELA 4J57E 4NAXA 2F9SA 5B8AA 3KH9A 3FRCA 1QMVA 1PQNA 5B6NA 3TUEA 2ZNMA 1V2AA 3FEUA 5GSTA 3ME7A 1THXA 2FD3A 4K6XA 5H5SA 1FVKA 1GUKA 4EO3A 3P7XA 3F3QA 3ZTLA 4MP4A 1X5DA 3VWVA 3PGTA 3TKSE 3TCOA 3QPMA 1V9WA 3CXGA 2H6YA 17GSA 5G1LA 2H66A 4GSNA 2WZ9A 1PRXA 2B5YA 4N11A 1NHOA 4OCFA 4TW5A 4ID0A 5KN1A 1A24A 5ELAA 3ZRDA 2V32A 1XOAA 4K1FA 2GLRA 1ZGNA 1U3AA 3H8QA 3J7Yb 5D93A 5GAND 3VWWA 4MJBA 1MTCA 3F4SA 1GTIA 4WKWA 4GSTA 4O92A 2DJ0A 3A2XA 3C1SA 1EWXA 3ZL5A 4KA0A 5B6MA 2XPDA 1NM3A 1QXHA 4DSSB 5JCUA 2L5OA 5GZZB 3IK9A 3L9VA 2O89A 4Q5RA 3MSZA 2C3TA 4MMMA 4AJ8A 3ERWA 4ML6A 2O8VB 4GWRA 1USBA 2J9HA 3EURA 2OACA 3HHVA 2FCHA 3D21A 2VCZA 2X64A 4KSOA 4F82A 1JZDA 2MMZA 5IOWA 1F9MA 1C72A 2ZCTA 2CV4A 5ECSA 1TI3A 1THOA 1TRWA 2XBIA 3FHKA 3F4RA 3KJYA 3IAM2 2GGTA 1CQHA 4NWYA 3N9JA 2LTKA 2PMTA 4XRAA 3VPQA 3Q19A 1Y25A 2LS5A 5H5RA 1WJKA 1JLVA 2YJ7A 2LJRA 4I2UA 5B7CA 3KTLA 2CX4A 4ZB9A 4PX1A 2FWHA 1I9DA 1DBYA 3HJPA 1M2AA 3BOAA 3DRNA 4ZB6A 2H71A 3DGQA 4DSSA 3A2WA 5DQYA 4O5RA 1VF4A 1HQOA 2Z9SA 4X1UA 1ST9A 2GSSA 2OKAA 3ZVJD 3QDNA 2P5RA 5CRHA 2YCDA 2R6KA 3HZ4A 3HKRA 2WULA 1OE7A 3H4KA 5JCWA 5IO2A 3CRTA 3LGCA 5ECRB 2GVPA 3GKNA 2IFQA 3VURA 2YP6A 5ELGA 2GZPA 1SK2A 2DJ2A 2HLSA 1PL2A 3GSSA 1SKRB 4ISDA 1TRUA 3UBLA 1K0CA 1AUCA 5DALB 4PQHA 2OBKA 3G7YA 4OD7A 3TJFA 5F8BA 4MPGA 2K9FA 4IBPA 1XW9A 3UJ1A 4HOJA 2VM2A 3I6AA 3F63A 3DXBA 3P8WA 3F6FA 1OC9A 3GA4A 2RIIA 4POBA 4I6XA 3FR6A 4LMWA 2M80A 3SWLA 1EV9A 1OAZA 1T4ZA 3WGEA 5IM9A 2DLXA 1DE1A 3ZMLA 3TKSC 3KP8A 3P90A 1GTUA 3E0UA 5D9XA 5DDLA 1G6WA 2B6MA 4OFNA 4MPFA 2PGTA 2M46A 2VD1A 3C73A 2KOKA 2I81A 3QCPA 2GZZA 3UOMA 1U88A 1ZOFA 1WPIA 2C8UA 1GSUA 5INYA 5DALA 4ZILA 4MF5A 3UVTA 1XPVA 2KP2A 3GYKA 3PR8A 3GTUA 1B9XC 3VK9A 1XOBA 3TDGA 4BWQA 3IA1A 4V2MA 2HNLA 4KCEA 3UL3A 5HFKA 1LJRA 1AQXA 1M9AA 4XIHA 1X0RA 5HR1A 1Z9HA 1LBKA 2LQQA 4K0NA 14GSA 1A0FA 4ZIJA 4EKZA 5G1KA 1FVJA 2N5BA 2LNTA 4GSSA 3TKSA 1R26A 5JWQB 3EVIA 6GSXA 5CNWA 2H0HA 3TB2A 4L8EA 2DSAA 1DSBA 4MA9A 5HQPA 3MAKA 2YNXA 1QFNA 4XHMA 1SYXA 2WS2A 4KDUA 1OC8A 3TKPA 3GIXA 1YKAA 5HR3A 1M9BA 1WP0A 4HI7A 3CRUA 1JZOA 1XWAA 1ERTA 1A23A 4MZWA 5D9TA 5IMZA 4BVXA 1MDJA 3Q74A 2LRTA 1OKTA 3RDWA 2DIZA 4MZBA 1Z6MA 3Q6OA 3D5JA 2AUVA 4XCSA 2DJKA 4F0CA 5J4UA 2H30A 4NV2A 2TIRA 4HS1A 1UC7A 2RLIA 2KP1A 3AY8A 3GKXA 1O8XA 1OE8A 4NXIA 3GURA 1U3IA 5E4WA 1KNGA 3DKSA 2VCTA 2A4VA 4POLA 1A0RP 3SBCA 1GRXA 2A2RA 2BMXA 1TW9A 1WIKA 1B48A 3M9JA 3S9FA 1B9YC 5AGYA 2EIQA 3L0HA 1VRSD 4OWYA 2IIYA 1EP7A 2JZTA 1MEKA 3M3MA 4IJ3A 3UVHA 4ZBBA 3TRXA 2GSRA 5CRDA 1A2JA 1Y6EA 4IGJA 2LRNA 2HSYA 2LRCA 5D96A 3GL5A 3GRXA 5ECPB 5KN0A 4K9ZA 2LJAA 3ZREA 4HDEA 2IMFA 1AXDA 3EU3A 4F03A 1NHYA 2GQLA 3ZYWA 5KN2A 3F3RA 2O87A 1A8YA 3FY7A 3F8UA 2NVLA 2C3NA 2YWOA 2AAWA 1GTBA 3CSHA 2IMKA 3L9UA 4WBRD 3WT1A 2WGRA 2LEGA 1TK5B 2B5EA 2CA8A 1FHEA 5DVBA 4I5QA 1AQVA 2VLVA 1B4QA 5IMDA 2GQMA 4CDOA 4GQFA 1E2YA 2JACA 1PSQA 1VF3A 4GTUA 3WGXA 3KXOA 1G6YA 1RK4A 2L6DA 4MF6A 2B1KA 3TKRA 1DUGA 11GSA 3CMIA 3F0IA 3RHBA 2HSHA 1GSDA 1SK1A 4JRRA 5G5FA 5J9BA 2YJHA 2R5GA 4EDZA 4KCAA 5HR0A 2JL4A 1Q98A 2WJUA 1GSSA 5CP1A 4LA1A 2FLSA 1GH2A 2HRNA 2LUSA 2C0EA 1JFUA 3NOFA 1T4YA 2DJ1A 4MH2A 2OE0A 3CYNA 2FY6A 2YN1A 3L4NA 2N5FA 1K0DA 1ZCPA 1HD2A 1ZYEA 2IMDA 1QUWA 3BD2A 2H8LA 5EVOA 3HDCA 2GDRA 2VCWA 3EMPA 1Q4JA 3FK8A 4GXZA 2WDUA 4L5LA 4YH2A 3WGDA 1M0UA 4TVEA 3APQA 2NDOA 2DBCA 3K8NA 2EIRA 1O8WA 3TOTA 3KD0A 5E59A 4LL1B 1SKSB 3JCML 4F2IA 5HFGA 4L0WA 18GSA 2K6VA 1Z7PA 2WCIA 4DEJA 1HNCA 3Q18A 1M2BA 3HVVA 2VLTA 1CQGA 2R3XA 3GKMA 2CAQA 1EEJA 3IK7A 1FOVA 4XS6A 3KIJA 2H6XA 2L6CA 2VCXA 4LMVA 2C3QA 3UAPA 3GHAA 2H0GA 2YANA 3QOUA 4YQMA 3UBKA 5ECOB 2I9HA 2IN3A 2GSQA 5COHA 4ZL7A 4RQXA 1TU8A 1NW2A 5ID2A 2CZ2A 5IIZA 2VCVA 4KDYA 2PVQA 5IPGA 4KB3A 2G0FA 1GULA 2AB6A 4MLYA 3ZFBA 1TU7A 1X9MB 3ZIJA 2C1YA 4J56E 1ABAA 1MD3A 2C80A 3H93A 3QFBC 4YAPA 7GSSA 2VD0A 1V58A 2YV7A 3UIWA 1K3OA 1F3AA 2VL2C 1J08A 1GSQA 5GAPD 2FHEA 1ILOA 2BTOT 1AIUA 3TJBA 3HCZA 4ZXGA 4O7HA 4N10A 1SL2B 3HVXA 2IFQB 2V1MA 3HJMA 3N5OA 1TK8B 4FO5A 2LV3A 2HT9A 4NPBA 1UN2A 2VM1A 4HQZA 4HEA2 4KH7A 2TRXA 2FUG2 3KH7A 2MBTA 3DIEA 4TR3A 4ZBDA 3VWXA 3QR6A 3HXSA 5LNKe 1YDKA 2H70A 3GL3A 4K7NA 4IP1A 1EGOA 3M8NA 3U5RE 1YEPA 3CTFA 2HFDA 1OC9B 3KTBA 3LXTA 4BA7A 1J0FA 2WFCA 1XZOA 4IQAA 4YQUA 2G2QA 1K0NA 3KMOA 5D73A 2KUCA 2VL2A 2YZUA 4EDYA 1Z6NA 3LG6A 4QL7A 3FR3A 1GLQA 4LLRA 5ENUA 4TR1B 1SJIA 3H79A 2VOCA 1H75A 3VFIA 1ERVA 1EOGA 2NTOA 2TRCP 1SYRA 2CX3A 4Q5QA 1JZWA 2REMA 2XBQA 5DJLA 4BVYA 4FYUA 1GUHA 4AJ7A 1WWJA 5C04A 5HFIA 3DWVA 3GTUB 1PKZA 1V57A 1YKCA 2IL3A 3DVXA 3A5WA 5A4VA 5IPHA 5J41A 3L78A 1GSFA 2DIYA 2MYGA 2HZEA 1X9WB 4TXOA 3APSA 2CT6A 1K0BA 3W8SA 1OYJA 2R37A 4OO4A 3G7IA 2CVBA 1EV4A 2I3YA 3M9KA 4TR1A 4RI6A 1PN9A 4L5OA 3QFAC 2H1AA 3VI5A 2ZUPA 4PQ1A 1K3YA 3ZFLA 4K8MA 6GSTA 4QQ7A 2YPMA 1KBNA 3HA9A 1YQ1A 3C8EA 2H19A 3KM6A 4YAVA 3LJRA 2QKEA 1N2AA 5ECNB 4ZB8A 4Q5FA 2X8GA 5AIVA 3D4MA 3HYPA 1GNEA 3LORA 1XXUA 4POMA 4KAEA 1V40A 4G19A 5A4UA 1GLPA 2C0FA 3UEMA 2FA8A 2FWFA 1Z7RA 3KMNA 3O76A 2YOIA 1RW1A 4O32A 4TXVA 1LU4A 4AF2A 5ECIB 4TKYA 1R4WA 4Z7XA 5GSSA 2OA7A 3O3TA 5A5KA 2XHFA 4K2DA 3ZITA 3DMLA 3ERGA 4D73B 2LJKA 1FAAA 4MJAA 3GV1A 1OKDA 3F4TA 2H76A 3HVSA 1G7EA 1KTEA 4BPYA 3EWLA 2E0QA 2XC2A 3GH6A 1EOHA 2CAIA 1TK0B 8GSSA 2BJXA 5J9CA 20GSA 2I4AA 3US3A 3HZ8A 1XWCA 1URMA 1E6BA 2KHPA 1XW5A 3HD5A 4ZL8A 3GSTA 3LSZA 5LD0A 4XRDA 3IAS2 5EPFA 1K0OA 1PKWA 3BCIA 1M2DA 1TJDA 4Q5NA 1FO5A 3EC3A 4EF0A 2OE3A 2HRFA 3IPZA 2R4VA 1GWCA 4OO5A 4XTSA 3C71A 3FYGA 2H74A 5F05A 5LCZA 3TRQA 4PGTA 1FG4A 4N0ZA 4D73A 3GMFA 2PU9C 3KCMA 4MZCA 5FT3A 4TRXA 2GS3A 1XCCA 1TTZA 3FR9A 4IN0A 3E3EA 1BAYA 1UVZA 4KDXA 4PNFA 3VWUA 4FIWA 4QL9A 1R5AA 1S3DA 1HNBA 3OR5A 3IE3A 2HXKA 1F37A 2MBSA 1FB6A 2VL3A 1F2EA 3M1GA 4WF4A 3KGKA 1FB0A 3G9BA 5EL8A 4ZL9A 2R2JA 2O85A 1UA5A 4DSQA 2V2GA 2MMAA 4ACSA 1M99A 1VF2A 9GSSA 2IPAA 3LXZA 2E2MA 4GLTA 4IP6A 3GFKA 3DD3A 4RQRA 1X5CA 1XVQA 1PGTA 3G7JA 4EXJA 1BG5A 1ERWA 3D0ZA 1A2LA 2CQ9A 1AQWA 1GL8A 1XWKA 2HI7A 5IMVA 1AC1A 2VUPA 3RPPA 3TOUA 2JZSA 2MZCA 1O81A 4IVFA 1BQ7A 4I2TA 2H1GA 5KN3A 4K7OA 6GSUA 2VLUA 4KW6A 4KGIA 3J7Yk 1Z3EA 6GSWA 2GTUA 2PUKC 4ILFA 1NSWA 1JZRA 3GX0A 3LEFA 5DJMA 5ID2B 5F0GA 1B8XA 1SU9A 3U6VA 3P2AA 2CZ3A 2K8SA 2XPEA 1GSYA 3GX8A 2FNOA 3ME8A 5DCHA 4GRFA 1K3LA 1ACVA 2O7KA 4PXOA 1TDIA 4FYCA 4NHWA 4ECCA 5ABRA 4WEYA 3LWAA 3FZAA 4IKHA 6GSYA 1ZL9A 4POKA 2I1UA 3ZLPA 5J3RA 3IOSA 3KP9A 2F51A 4HZ4A 4JR4A 1PL1A 1PX7A 4F0BA 3MNGA 2YWNA 2YZHA 4ECIA 5L71A 5AN1A 2OADA 2ON5A 2J23A 1XVWA 4CW9A 3BJ5A 4WBJA 3QAGA 3DYRA 3D6IA 1YJ6A 1G0TA 1H4OA 2PPTA 4PUAA 2C0GA 2F8FA 4EC0A 4TR0A 3MWHA 5B8BA 3IRAA 4KNDA 1SD9A 2GQKA 3IBHA 4XS4B 2EC4A 4RUVA 1GNWA 1K0AA 4CHSA 2N5AA 1SJZA 4HJ2A 1SENA 3BCKA 2B3SA 4OFMA 2DC5A 1W89A 5JWOB 2EIOA 3LFLA 4IW9A 3D22A 4FYBA 1QGVA 1A8LA 1MDKA 1AW9A 1TXXA 4JBBA 1XFLA 3ED3A 4HU9A 2H6ZA 1BYEA 1GUMA 2QGVA 2H1DA 1N8JA 1EZKA 4IQ1A 1XIYA 13GSA 2D2ZA 3TKQA 3DVWA 3LQ7A 4GQCA 2GT5A 3CBUA 2DJJA 2X99A 2DJ3A 4TN8A 3RAZA 4FH8A 1O6JA 3GNJA 2VIMA 4MH3A 2GT6A 1TRSA 3L9SA 3RBTA 3EU4A 5G31A 2YWIA 2IWTA 5D9WA 3F9UA 1VGLA 1ERUA 4AJ6A 2FWEA 1DE2A 2P5QA 1U87A 4XS4A 3PH9A 2RM6A 5ECQB 4MDCA 3DEXA 2HZEB 1GP1A 2H73A 4TXOB 2H01A 3EINA 4V1Ap 2JADA 3APOA 3TJKA 1A2MA 3C7MA 2WRTA 4JR6A 3CTGA 4MK3A 5IMCA 4OCEA 2CVDA 1XBSA 1YZXA 3NIVA 1ON4A 3HY2A 1FW1A 1BX9A 3LYPA 4K7IA 5IMAA 4K0GA 4IS0A 3ZIVA 1PX6A 2H75A 2QC7A 5A4WA 1T00A 5CYYA 1WOUA 2V6KA 5J5NA 2NPBA 2B5XA 2L57A 2E2GA 3UMAA 4F9ZA 4ULXA 5H5QA 1B4PA 1XWGA 19GSA 4IHUA 3WT2A 4PUFC 2F3MA 3PINA 4MF7A 5CO3A 1YEXA 1VF1A 1EEMA 4NHZA 2LQOA 2C0DA 4JZQA 2FWGA 2JSYA 3V1WA 1X5EA 22GSA 4GCIA 2PVOC 5FHIA 1F3BA 4EVMA 2IMEA 1HNAA 1G7OA 2H72A 3GKKA 1ZYQB 3C1RA 2VO4A 5CREA 2HYXA 3O6TA 10GSA 2ES7A 4MCUA 4BL7A 4I8BA 3H1NA 2JU5A 4JU5A 4ECBA 4E8EA 1TP9A 4PURA 2ALBA 1WRYA 4PQIA 1T7PB 1R7HA 4ML1A 2P31A 2L4QA 3W6GA 3EMXA 2WB9A 1EP8A 3TRPA 5ECLB 2RM5A 3EYTA 1BJXA 2PBJA 3IV4A 3ERFA 4ZBAA 1KEBA 4NV5A 2FA4A 3CSJA 3EE2A 3CSIA 5G5EA 5D8IA 1WE0A 1S3AA 3RPNA 4I97A 4HUAA 1O7UA 3FZ4A 4V2NA 1SL1B 4H86A 2RUEA 3I9V2 2DMLA 2L5LA 1QQ2A 2HZFA 4KSMA 2V6OA 1U6TA 1TI1A 1JHBA 5CAXA 1XW6A 2PWJA 3W8JA 5DAKB 1ML6A 3QD9A 1MD4A 2GSTA 3RHCA 5IQYA 1PMTA 1SD8A 3ZVJA 2NBSA 2IMIA 2L4CA 1K0MA 5KEJA 4JEDA 5DCGA 2PERA 5G30A 3TGZA 5CRWA 3I69A 3VI7A 1O73A 3GUSA 5DBQA 5F07A 1MDIA 1XWBA 3FZ9A 2P0GA 1SL0B 2VCQA 4EE0A 4KE3A 4G9HA 3TJJA 4WETA 1RQMA 2FGXA 4LL4B 5D9VA 4AGSA 2A2SA 3IDVA 5ECKB 2VAFA 3KZQA 1QK8A 4TR4A 2ON7A 4P3YB 3QAVA 2YV9A 1SJ6A 1Z5YE 1OVNA 2LNSA 1F6MC 1EGRA 5DAKA 2VL9A 3MDKA 5EY6A 4E8HA 4N0VA 1AAZA 1V98A 5JCGA 2K18A 2JSZA 3UARA 3A2VA 4MJCA 4BWSA 4X43A 2AV4A 3ISOA 5ECMB 1TOFA 4TOPA 3WD6A 6GSSA 3VLNA 5IOXA 2MMNA 1R5PA 1ZMAA 3IXRA 1T3BA 1ZZYA 3GH9A 1O85A 1IYHA 4OFTA 3VPTA 1JLWA 1OC3A 3IHQA 1M7TA 5CRGA 3D4TA 4X0XA 1YY7A 2B7KA 5JWRB
chains in the Genus database with same CATH superfamily
4XS1A 4G10A 2X8HA 1T8EB 1I5GA 3M0FA 3LYKA 3BBYA 2L59A 2K8VA 4NMUA 2OJLA 2PN8A 3IC8A 4WF5A 4HQSA 5FWGA 1T1VA 4J2FA 4V2LA 4G2EA 1PD21 5AISA 2X8CA 2CVKA 4PNGA 5C00A 1BEDA 3NZNA 4KX4A 12GSA 1PA3A 1TRVA 1J9BA 1GSEA 4MABA 1TKDB 3QMXA 1X9SB 3R2QA 4ECJA 3FZ5A 5HR2A 6GSVA 4YQVA 1W4VA 2QSIA 5IMFA 1S3CA 2AHEA 4EL1A 4MJEA 1YF1A 4GF0A 4WR4A 1GTAA 3HJOA 3QAWA 3HVNA 3GN3A 1SK0A 4JE1A 5DQSA 2OE1A 4L0UA 3ZMKA 4MNNA 1SKWB 2F8AA 5BMUA 2MMOA 4OMVA 2H1BA 2C4JA 3IR4A 2OBIA 4WXTA 2JZRA 2M72A 5AIXA 5IO0A 3WYWA 4HZ2A 3F6DA 3A3TA 4V1Ag 2YWMA 4Z2TA 2KLXA 16GSA 2RUFA 2DMMA 3ZZXA 4DVCA 2V41A 3TJGA 4RI7A 2GZYA 5G2ZA 2HE3A 2IJYA 1HYUA 3FKFA 3FW2A 2B1LA 3I43A 3KEBA 5F06A 3MYDA 1IYIA 4WR5A 2LSTA 2AYTA 4EUYA 2E7PA 1WMJA 1YF0A 2B7JA 3IC4A 2LKUA 3E9JB 2H0IA 4IJIA 4HU7A 4KUNA 2AJQB 4DSRA 5ECHB 4HJMA 4N30A 3PPUA 4IELA 4J57E 4NAXA 2F9SA 2R0GA 5B8AA 3KH9A 3FRCA 1QMVA 1PQNA 2A2PA 5B6NA 3TUEA 2ZNMA 1V2AA 3FEUA 5GSTA 3ME7A 1THXA 2FD3A 4K6XA 2A4HA 5H5SA 1FVKA 1GUKA 4EO3A 3P7XA 3F3QA 3ZTLA 4MP4A 1X5DA 3VWVA 3PGTA 3TKSE 3TCOA 3QPMA 1V9WA 3CXGA 2H6YA 17GSA 5G1LA 2H66A 3IHGA 4GSNA 2WZ9A 1PRXA 2B5YA 4N11A 1NHOA 4OCFA 4TW5A 4ID0A 5KN1A 1A24A 5ELAA 3ZRDA 2V32A 1XOAA 4K1FA 2GLRA 1ZGNA 1U3AA 3H8QA 3J7Yb 5D93A 5GAND 3VWWA 4MJBA 1MTCA 3F4SA 1GTIA 4WKWA 3EPTA 4GSTA 4O92A 2DJ0A 3A2XA 3C1SA 1EWXA 3ZL5A 4KA0A 5B6MA 2XPDA 1NM3A 1QXHA 4DSSB 5JCUA 2L5OA 5GZZB 3IK9A 3L9VA 2O89A 4Q5RA 3MSZA 2C3TA 4MMMA 4AJ8A 3ERWA 4ML6A 2O8VB 4GWRA 1USBA 2J9HA 3EURA 2OACA 3HHVA 2FCHA 3D21A 2VCZA 2X64A 4KSOA 4F82A 1JZDA 2MMZA 5IOWA 1F9MA 1C72A 2ZCTA 2R0PA 2CV4A 5ECSA 1TI3A 1THOA 1TRWA 2XBIA 3FHKA 3F4RA 3KJYA 3IAM2 2GGTA 1CQHA 4NWYA 3N9JA 2LTKA 2PMTA 4XRAA 3VPQA 3Q19A 1Y25A 2LS5A 5H5RA 4BL7B 1WJKA 1JLVA 2YJ7A 2LJRA 4I2UA 5B7CA 3KTLA 2CX4A 4ZB9A 4PX1A 2FWHA 1I9DA 1DBYA 3HJPA 4YKFA 1M2AA 3BOAA 3DRNA 4ZB6A 1ZYPA 2H71A 3DGQA 4DSSA 3A2WA 5DQYA 4O5RA 1VF4A 1HQOA 2Z9SA 4X1UA 1ST9A 2GSSA 4G0KA 2OKAA 3ZVJD 5CRHA 3QDNA 2P5RA 2YCDA 2R6KA 3HZ4A 3HKRA 2WULA 1OE7A 3H4KA 5JCWA 5IO2A 3CRTA 3LGCA 5ECRB 2GVPA 3GKNA 2IFQA 3VURA 2YP6A 5ELGA 2GZPA 1SK2A 2DJ2A 2HLSA 1PL2A 3GSSA 1SKRB 4ISDA 1TRUA 3UBLA 1K0CA 1AUCA 5DALB 4PQHA 2OBKA 3G7YA 4OD7A 3TJFA 5F8BA 4MPGA 2K9FA 4IBPA 1XW9A 3UJ1A 2HRKA 4HOJA 2VM2A 3I6AA 4PTSA 3F63A 3DXBA 3P8WA 3F6FA 1OC9A 3GA4A 2RIIA 4POBA 4I6XA 3FR6A 4LMWA 2M80A 3SWLA 1EV9A 1OAZA 1T4ZA 3WGEA 5IM9A 2DLXA 1DE1A 3ZMLA 3TKSC 3KP8A 3P90A 1GTUA 3E0UA 5D9XA 5DDLA 1G6WA 2B6MA 4OFNA 4MPFA 2PGTA 2M46A 2VD1A 3C73A 2KOKA 2I81A 3QCPA 2GZZA 3UOMA 1U88A 1ZOFA 1WPIA 3R3EA 2C8UA 1GSUA 5INYA 5DALA 4ZILA 4MF5A 3UVTA 2HSMA 1XPVA 2KP2A 3GYKA 4BVXB 3PR8A 3GTUA 1B9XC 3VK9A 4YKGA 1XOBA 3TDGA 4BWQA 3IA1A 4V2MA 2HNLA 4KCEA 3UL3A 5HFKA 1LJRA 1AQXA 1M9AA 4XIHA 1X0RA 5HR1A 1Z9HA 1LBKA 2LQQA 4K0NA 14GSA 1A0FA 4ZIJA 4EKZA 5G1KA 1FVJA 2N5BA 2LNTA 4GSSA 3TKSA 1R26A 5JWQB 3EVIA 6GSXA 5CNWA 2H0HA 3TB2A 4CY6A 4L8EA 2DSAA 1DSBA 4MA9A 5HQPA 3MAKA 2YNXA 1QFNA 4XHMA 1SYXA 2WS2A 4KDUA 1OC8A 3TKPA 3GIXA 1YKAA 5HR3A 1M9BA 1WP0A 4HI7A 3CRUA 1JZOA 1XWAA 1ERTA 1A23A 4MZWA 5D9TA 5IMZA 4BVXA 1MDJA 3Q74A 2LRTA 1OKTA 3RDWA 2DIZA 4MZBA 1Z6MA 3Q6OA 3D5JA 2AUVA 4XCSA 2DJKA 4F0CA 5J4UA 2H30A 4NV2A 2TIRA 4HS1A 1UC7A 2RLIA 2KP1A 3AY8A 3GKXA 1O8XA 1OE8A 4NXIA 3GURA 1U3IA 5E4WA 1KNGA 3DKSA 2VCTA 2A4VA 4POLA 1A0RP 3SBCA 1GRXA 2A2RA 2BMXA 4BIKA 1TW9A 1WIKA 1B48A 3M9JA 3S9FA 1B9YC 5AGYA 2EIQA 3L0HA 1VRSD 4OWYA 2IIYA 1EP7A 2JZTA 1MEKA 3M3MA 4IJ3A 3UVHA 4ZBBA 3TRXA 2GSRA 5CRDA 1A2JA 1Y6EA 4IGJA 2LRNA 2HSYA 2LRCA 5D96A 3GL5A 3LW9A 3GRXA 5ECPB 5KN0A 4K9ZA 2LJAA 3ZREA 4HDEA 2IMFA 1AXDA 3EU3A 4F03A 1NHYA 2GQLA 3ZYWA 5KN2A 3F3RA 2O87A 1A8YA 3FY7A 3F8UA 2NVLA 2C3NA 2YWOA 2AAWA 1GTBA 3CSHA 2IMKA 3L9UA 4WBRD 3WT1A 2WGRA 2LEGA 1TK5B 2B5EA 2CA8A 1FHEA 5DVBA 4I5QA 1AQVA 2VLVA 1B4QA 5IMDA 2GQMA 4CDOA 4GQFA 1E2YA 2JACA 1PSQA 1VF3A 4GTUA 3WGXA 3KXOA 2UZ8A 1G6YA 1RK4A 1PN0A 2L6DA 4MF6A 2B1KA 3TKRA 1DUGA 11GSA 3CMIA 3F0IA 3RHBA 2HSHA 1GSDA 1SK1A 4JRRA 5G5FA 5J9BA 2YJHA 2R5GA 4EDZA 4KCAA 5HR0A 2JL4A 1Q98A 2WJUA 1GSSA 5CP1A 4LA1A 2FLSA 1GH2A 2HRNA 2LUSA 2C0EA 1JFUA 3NOFA 1T4YA 2DJ1A 4MH2A 2OE0A 3CYNA 2FY6A 2YN1A 3L4NA 2N5FA 1K0DA 1ZCPA 1HD2A 1ZYEA 2IMDA 1QUWA 3BD2A 2H8LA 5EVOA 3HDCA 2GDRA 2VCWA 3EMPA 1Q4JA 3FK8A 4GXZA 2WDUA 4L5LA 4YH2A 3WGDA 1M0UA 4TVEA 3APQA 2NDOA 2DBCA 3K8NA 2EIRA 1O8WA 3TOTA 3KD0A 5E59A 4LL1B 1SKSB 3JCML 4F2IA 5HFGA 4L0WA 18GSA 2K6VA 1Z7PA 2WCIA 4DEJA 1HNCA 3Q18A 1M2BA 3HVVA 2VLTA 1CQGA 4K5SA 2R3XA 4EIQA 3GKMA 2CAQA 1EEJA 3A5IA 3IK7A 1FOVA 4XS6A 3KIJA 2H6XA 2L6CA 2VCXA 4LMVA 2C3QA 3UAPA 3GHAA 2H0GA 2YANA 3QOUA 4YQMA 3UBKA 5ECOB 2I9HA 2IN3A 2GSQA 5COHA 4ZL7A 4RQXA 1TU8A 1NW2A 5ID2A 2CZ2A 5IIZA 2VCVA 4KDYA 2PVQA 5IPGA 4KB3A 2G0FA 1GULA 2AB6A 4MLYA 3ZFBA 1TU7A 1X9MB 3ZIJA 2C1YA 4J56E 1ABAA 1MD3A 2C80A 3H93A 3QFBC 4YAPA 1ZYNA 2VD0A 7GSSA 1V58A 2YV7A 3UIWA 1K3OA 1F3AA 2VL2C 4EIPA 1J08A 1GSQA 5GAPD 2FHEA 1ILOA 2BTOT 1AIUA 2DKIA 3TJBA 3HCZA 4ZXGA 4O7HA 4N10A 1SL2B 3HVXA 2IFQB 2V1MA 3HJMA 3N5OA 1TK8B 4X4JA 4FO5A 4O5QA 2LV3A 2HT9A 4NPBA 1UN2A 2VM1A 4HQZA 4HEA2 4KH7A 2TRXA 2FUG2 3KH7A 2MBTA 3DIEA 4TR3A 4ZBDA 3VWXA 4G0IA 4USSA 3QR6A 3HXSA 5LNKe 1YDKA 2H70A 3GL3A 4K7NA 4IP1A 1EGOA 3M8NA 3U5RE 1YEPA 3CTFA 2HFDA 1OC9B 3KTBA 3LXTA 4BA7A 1J0FA 2WFCA 1XZOA 4IQAA 4YQUA 2G2QA 1K0NA 3KMOA 5D73A 2KUCA 2VL2A 2YZUA 4EDYA 1Z6NA 3LG6A 4QL7A 3FR3A 1GLQA 4LLRA 5ENUA 4TR1B 1SJIA 3H79A 2VOCA 1H75A 3VFIA 1ERVA 4ICYA 1EOGA 2NTOA 2TRCP 1SYRA 2CX3A 4Q5QA 1JZWA 2REMA 2XBQA 5DJLA 4BVYA 4CY8A 4FYUA 1GUHA 4AJ7A 1WWJA 5C04A 5HFIA 3DWVA 3GTUB 1PKZA 1V57A 1YKCA 2IL3A 3DVXA 3A5WA 5A4VA 5IPHA 5J41A 3L78A 1GSFA 2DIYA 2MYGA 2HZEA 1X9WB 4TXOA 3APSA 2CT6A 1K0BA 3W8SA 1OYJA 2R37A 4OO4A 3G7IA 2CVBA 1EV4A 2I3YA 3M9KA 4TR1A 4RI6A 1PN9A 4L5OA 2HRAA 3QFAC 2H1AA 3VI5A 2ZUPA 4PQ1A 1K3YA 3ZFLA 4K8MA 6GSTA 4QQ7A 2YPMA 1KBNA 3HA9A 1YQ1A 3C8EA 2H19A 3FMWA 3KM6A 4YAVA 3LJRA 2QKEA 1N2AA 5ECNB 4ZB8A 4Q5FA 2X8GA 2DKHA 5AIVA 3D4MA 3HYPA 1GNEA 3LORA 1XXUA 4POMA 4KAEA 1V40A 4G19A 5A4UA 1GLPA 2C0FA 3UEMA 2FA8A 2FWFA 1Z7RA 3KMNA 3O76A 2YOIA 1RW1A 4O32A 4TXVA 1LU4A 4AF2A 5ECIB 4TKYA 1R4WA 4Z7XA 5GSSA 2OA7A 4K2XA 3O3TA 5A5KA 2XHFA 4K2DA 3ZITA 3DMLA 3ERGA 4D73B 2LJKA 1FAAA 4MJAA 3GV1A 1OKDA 3F4TA 2H76A 3HVSA 1G7EA 1KTEA 4BPYA 3EWLA 2E0QA 2XC2A 3GH6A 1EOHA 2CAIA 1TK0B 8GSSA 2BJXA 5J9CA 20GSA 2I4AA 3US3A 3HZ8A 1M3JA 1XWCA 1URMA 1E6BA 2KHPA 1XW5A 3HD5A 4ZL8A 3GSTA 3LSZA 5LD0A 4XRDA 3IAS2 5EPFA 1K0OA 1PKWA 3BCIA 1M2DA 1TJDA 4Q5NA 1FO5A 3EC3A 4EF0A 2OE3A 2HRFA 3IPZA 2R4VA 1GWCA 2QA1A 4OO5A 4XTSA 3C71A 3FYGA 2H74A 5F05A 5LCZA 3TRQA 4G0LA 4PGTA 1FG4A 4N0ZA 4D73A 3GMFA 2PU9C 3KCMA 4MZCA 5FT3A 4TRXA 2GS3A 1XCCA 4IN0A 1TTZA 3FR9A 4FQUA 3E3EA 1BAYA 1UVZA 4KDXA 4PNFA 3VWUA 4FIWA 4QL9A 1R5AA 1S3DA 3MIXA 1HNBA 3OR5A 3IE3A 2HXKA 1F37A 2MBSA 1FB6A 2VL3A 2X4AA 1F2EA 3M1GA 4WF4A 3KGKA 1FB0A 3G9BA 5EL8A 4ZL9A 2R2JA 2O85A 1UA5A 4DSQA 2V2GA 2MMAA 4ACSA 1M99A 1VF2A 9GSSA 2IPAA 3LXZA 2E2MA 4GLTA 4IP6A 3GFKA 3DD3A 4RQRA 1X5CA 1XVQA 1PGTA 3G7JA 4EXJA 1BG5A 1ERWA 3D0ZA 1A2LA 2CQ9A 1AQWA 1GL8A 1XWKA 2HI7A 5IMVA 1AC1A 2VUPA 3RPPA 3TOUA 2JZSA 2MZCA 1O81A 4IVFA 1BQ7A 4I2TA 2H1GA 5KN3A 4K7OA 6GSUA 5KOXA 2VLUA 4KW6A 4KGIA 3J7Yk 1Z3EA 6GSWA 2GTUA 2PUKC 4ILFA 1NSWA 1JZRA 3GX0A 3LEFA 5DJMA 5ID2B 5F0GA 1B8XA 1SU9A 3U6VA 3P2AA 2CZ3A 2K8SA 2XPEA 1GSYA 3GX8A 2FNOA 3ME8A 2X49A 5DCHA 4GRFA 1K3LA 1ACVA 2O7KA 4PXOA 1TDIA 4FYCA 4NHWA 4ECCA 5ABRA 4WEYA 3LWAA 3FZAA 4IKHA 6GSYA 1ZL9A 4POKA 2I1UA 3ZLPA 5J3RA 3IOSA 3KP9A 2F51A 4HZ4A 4JR4A 1PL1A 1PX7A 4F0BA 3MNGA 2YWNA 2YZHA 4ECIA 5L71A 4HSCX 4Z2RA 5AN1A 2OADA 2ON5A 2J23A 1XVWA 4CW9A 3BJ5A 4WBJA 3QAGA 3DYRA 3D6IA 1YJ6A 1G0TA 1H4OA 2PPTA 4PUAA 2C0GA 2F8FA 4EC0A 4TR0A 3MWHA 5B8BA 3IRAA 4KNDA 1SD9A 2GQKA 3IBHA 4XS4B 2EC4A 4RUVA 1GNWA 1K0AA 4CHSA 2N5AA 1SJZA 4HJ2A 1SENA 3BCKA 2B3SA 4OFMA 2DC5A 1W89A 5JWOB 2EIOA 3LFLA 4IW9A 3D22A 4FYBA 1QGVA 1A8LA 1MDKA 1AW9A 1TXXA 4JBBA 1XFLA 3ED3A 4HU9A 2H6ZA 1BYEA 1GUMA 2QGVA 2H1DA 1N8JA 1EZKA 4IQ1A 1XIYA 13GSA 2D2ZA 3TKQA 3DVWA 3CQFA 3LQ7A 4GQCA 2GT5A 3CBUA 2DJJA 1M3IA 2X99A 2DJ3A 4BVYB 4TN8A 3RAZA 4FH8A 1O6JA 3GNJA 2VIMA 4MH3A 5BRTA 2GT6A 1TRSA 3L9SA 3RBTA 3EU4A 5G31A 2YWIA 2IWTA 5D9WA 3F9UA 1VGLA 1ERUA 2QA2A 4AJ6A 2FWEA 1DE2A 2P5QA 1U87A 4XS4A 3PH9A 2RM6A 5ECQB 1XG8A 4MDCA 3DEXA 2HZEB 1GP1A 2H73A 4TXOB 2H01A 3EINA 4V1Ap 2JADA 3APOA 3TJKA 1A2MA 3C7MA 2WRTA 4JR6A 3CTGA 4MK3A 5IMCA 4OCEA 2CVDA 1XBSA 1YZXA 3NIVA 4A5PA 1ON4A 3HY2A 1FW1A 1BX9A 3LYPA 4K5RA 4K7IA 5IMAA 4K0GA 4IS0A 4O5UA 3ZIVA 1PX6A 2H75A 2QC7A 5A4WA 1T00A 5CYYA 1WOUA 2V6KA 5J5NA 2NPBA 2B5XA 2L57A 2E2GA 3UMAA 4F9ZA 4ULXA 5H5QA 1B4PA 1XWGA 19GSA 4IHUA 3WT2A 4PUFC 2F3MA 3PINA 4MF7A 5CO3A 1YEXA 1VF1A 1EEMA 4NHZA 2LQOA 2C0DA 4JZQA 2FWGA 2JSYA 3V1WA 1X5EA 22GSA 4GCIA 2PVOC 5FHIA 1F3BA 4EVMA 2IMEA 1HNAA 1G7OA 2H72A 3GKKA 1ZYQB 3C1RA 2VO4A 5CREA 2HYXA 3O6TA 10GSA 2ES7A 4MCUA 4BL7A 4I8BA 3H1NA 2JU5A 4JU5A 4ECBA 4E8EA 1TP9A 4PURA 2ALBA 1WRYA 4PQIA 1T7PB 1R7HA 4ML1A 2P31A 2L4QA 3W6GA 3EMXA 2WB9A 1EP8A 3TRPA 5ECLB 2RM5A 3EYTA 1PFOA 1BJXA 2PBJA 3IV4A 4KF9A 3ERFA 4ZBAA 1KEBA 4NV5A 2FA4A 3CSJA 3EE2A 1S3RA 3CSIA 5G5EA 5D8IA 1WE0A 1S3AA 3RPNA 4I97A 4HUAA 1O7UA 3FZ4A 4V2NA 1SL1B 4H86A 2RUEA 3I9V2 4Z2UA 2DMLA 2L5LA 5KOWA 1QQ2A 2HZFA 4KSMA 2V6OA 1U6TA 1TI1A 1JHBA 5CAXA 1XW6A 2PWJA 3W8JA 5DAKB 1ML6A 3QD9A 1MD4A 2GSTA 3RHCA 5IQYA 1PMTA 1SD8A 3ZVJA 2NBSA 2IMIA 2R0CA 2L4CA 1K0MA 5KEJA 4JEDA 5DCGA 2PERA 5G30A 3TGZA 5CRWA 3I69A 3VI7A 1O73A 3GUSA 5DBQA 5F07A 1MDIA 1XWBA 3FZ9A 2P0GA 1SL0B 2VCQA 4EE0A 4KE3A 4G9HA 3TJJA 4WETA 1RQMA 2FGXA 4LL4B 5D9VA 4AGSA 2A2SA 3IDVA 5ECKB 2VAFA 3KZQA 1FOHA 1QK8A 4TR4A 2ON7A 4P3YB 3QAVA 2YV9A 1SJ6A 1Z5YE 1OVNA 2LNSA 1F6MC 1EGRA 5DAKA 2VL9A 3MDKA 5EY6A 4E8HA 4N0VA 1AAZA 1V98A 5JCGA 2K18A 2JSZA 3UARA 3A2VA 4MJCA 4BWSA 4X43A 2AV4A 3ISOA 5ECMB 1TOFA 4TOPA 3WD6A 6GSSA 3VLNA 5IOXA 2MMNA 1R5PA 1ZMAA 3IXRA 1T3BA 1ZZYA 3GH9A 1O85A 1IYHA 4OFTA 3VPTA 1JLWA 1OC3A 3IHQA 1M7TA 5CRGA 3D4TA 4X0XA 1YY7A 2B7KA 5JWRB
chains in the Genus database with same CATH topology
4XS1A 4G10A 2X8HA 1T8EB 1I5GA 3M0FA 3LYKA 3BBYA 2L59A 2K8VA 4NMUA 2OJLA 2PN8A 3IC8A 4WF5A 4HQSA 5FWGA 1T1VA 4J2FA 4V2LA 4G2EA 1PD21 5AISA 2X8CA 2CVKA 4PNGA 5C00A 1BEDA 3NZNA 4KX4A 12GSA 1PA3A 1TRVA 1J9BA 1GSEA 4MABA 1TKDB 3QMXA 1X9SB 3R2QA 4ECJA 3FZ5A 5HR2A 6GSVA 4YQVA 1W4VA 2QSIA 5IMFA 1S3CA 2AHEA 4EL1A 4MJEA 1YF1A 4GF0A 4WR4A 1GTAA 3HJOA 3QAWA 3GN3A 1SK0A 4JE1A 5DQSA 2OE1A 4L0UA 3ZMKA 4MNNA 1SKWB 2F8AA 5BMUA 2MMOA 4OMVA 2H1BA 2C4JA 3IR4A 2OBIA 4WXTA 2JZRA 2M72A 5AIXA 5IO0A 3WYWA 4HZ2A 3F6DA 3A3TA 4V1Ag 2YWMA 4Z2TA 2KLXA 16GSA 2RUFA 2DMMA 3ZZXA 4DVCA 2V41A 3TJGA 4RI7A 2GZYA 5G2ZA 2HE3A 2IJYA 1HYUA 3FKFA 3FW2A 2B1LA 3I43A 3KEBA 5F06A 3MYDA 1IYIA 4WR5A 2LSTA 2AYTA 4EUYA 2E7PA 1WMJA 1YF0A 2B7JA 3IC4A 2LKUA 3E9JB 2H0IA 4IJIA 4HU7A 4KUNA 2AJQB 4DSRA 5ECHB 4HJMA 4N30A 3PPUA 4IELA 4J57E 4NAXA 2F9SA 2R0GA 5B8AA 3KH9A 3FRCA 1QMVA 1PQNA 2A2PA 5B6NA 3TUEA 2ZNMA 1V2AA 3FEUA 5GSTA 3ME7A 1THXA 2FD3A 4K6XA 2A4HA 5H5SA 1FVKA 1GUKA 4EO3A 3P7XA 3F3QA 3ZTLA 4MP4A 1X5DA 3VWVA 3PGTA 3TKSE 3TCOA 3QPMA 1V9WA 3CXGA 2H6YA 17GSA 5G1LA 2H66A 3IHGA 4GSNA 2WZ9A 1PRXA 2B5YA 4N11A 1NHOA 4OCFA 4TW5A 4ID0A 5KN1A 1A24A 5ELAA 3ZRDA 2V32A 1XOAA 4K1FA 2GLRA 1ZGNA 1U3AA 3H8QA 3J7Yb 5D93A 5GAND 3VWWA 4MJBA 1MTCA 3F4SA 1GTIA 4WKWA 3EPTA 4GSTA 4O92A 2DJ0A 3A2XA 3C1SA 1EWXA 3ZL5A 4KA0A 5B6MA 2XPDA 1NM3A 1QXHA 4DSSB 5JCUA 2L5OA 5GZZB 3IK9A 3L9VA 2O89A 4Q5RA 3MSZA 2C3TA 4MMMA 4AJ8A 3ERWA 4ML6A 2O8VB 4GWRA 1USBA 2J9HA 3EURA 2OACA 3HHVA 2FCHA 3D21A 2VCZA 2X64A 4KSOA 4F82A 1JZDA 2MMZA 5IOWA 1F9MA 1C72A 2ZCTA 2R0PA 2CV4A 5ECSA 1TI3A 1THOA 1TRWA 2XBIA 3FHKA 3F4RA 3KJYA 3IAM2 2GGTA 1CQHA 4NWYA 3N9JA 2LTKA 2PMTA 4XRAA 3VPQA 3Q19A 1Y25A 2LS5A 5H5RA 4BL7B 1WJKA 1JLVA 2YJ7A 2LJRA 4I2UA 5B7CA 3KTLA 2CX4A 4ZB9A 4PX1A 2FWHA 1I9DA 1DBYA 3HJPA 4YKFA 1M2AA 3BOAA 3DRNA 4ZB6A 1ZYPA 2H71A 3DGQA 4DSSA 3A2WA 5DQYA 4O5RA 1VF4A 1HQOA 2Z9SA 4X1UA 1ST9A 2GSSA 4G0KA 2OKAA 3ZVJD 5CRHA 3QDNA 2P5RA 2YCDA 2R6KA 3HZ4A 3HKRA 2WULA 1OE7A 3H4KA 5JCWA 5IO2A 3CRTA 3LGCA 5ECRB 2GVPA 3GKNA 2IFQA 3VURA 2YP6A 5ELGA 2GZPA 1SK2A 2DJ2A 2HLSA 1PL2A 3GSSA 1SKRB 4ISDA 1TRUA 3UBLA 1K0CA 1AUCA 5DALB 4PQHA 2OBKA 3G7YA 4OD7A 3TJFA 5F8BA 4MPGA 2K9FA 4IBPA 1XW9A 3UJ1A 2HRKA 4HOJA 2VM2A 3I6AA 4PTSA 3F63A 3DXBA 3P8WA 3F6FA 1OC9A 3GA4A 2RIIA 4POBA 4I6XA 3FR6A 4LMWA 2M80A 3SWLA 1EV9A 1OAZA 1T4ZA 3WGEA 5IM9A 2DLXA 1DE1A 3ZMLA 3TKSC 3KP8A 3P90A 1GTUA 3E0UA 5D9XA 5DDLA 1G6WA 2B6MA 4OFNA 4MPFA 2PGTA 2M46A 2VD1A 3C73A 2KOKA 2I81A 3QCPA 2GZZA 3UOMA 1U88A 1ZOFA 1WPIA 3R3EA 2C8UA 1GSUA 5INYA 5DALA 4ZILA 4MF5A 3UVTA 2HSMA 1XPVA 2KP2A 3GYKA 4BVXB 3PR8A 3GTUA 1B9XC 3VK9A 4YKGA 1XOBA 3TDGA 4BWQA 3IA1A 4V2MA 2HNLA 4KCEA 3UL3A 5HFKA 1LJRA 1AQXA 1M9AA 4XIHA 1X0RA 5HR1A 1Z9HA 1LBKA 2LQQA 4K0NA 14GSA 1A0FA 4ZIJA 4EKZA 5G1KA 1FVJA 2N5BA 2LNTA 4GSSA 3TKSA 1R26A 5JWQB 3EVIA 6GSXA 5CNWA 2H0HA 3TB2A 4CY6A 4L8EA 2DSAA 1DSBA 4MA9A 5HQPA 3MAKA 2YNXA 1QFNA 4XHMA 1SYXA 2WS2A 4KDUA 1OC8A 3TKPA 3GIXA 1YKAA 5HR3A 1M9BA 1WP0A 4HI7A 3CRUA 1JZOA 1XWAA 1ERTA 1A23A 4MZWA 5D9TA 5IMZA 4BVXA 1MDJA 3Q74A 2LRTA 1OKTA 3RDWA 2DIZA 4MZBA 1Z6MA 3Q6OA 3D5JA 2AUVA 4XCSA 2DJKA 4F0CA 5J4UA 2H30A 4NV2A 2TIRA 4HS1A 1UC7A 2RLIA 2KP1A 3AY8A 3GKXA 1O8XA 1OE8A 4NXIA 3GURA 1U3IA 5E4WA 1KNGA 3DKSA 2VCTA 2A4VA 4POLA 1A0RP 3SBCA 1GRXA 2A2RA 2BMXA 1TW9A 1WIKA 1B48A 3M9JA 3S9FA 1B9YC 5AGYA 2EIQA 3L0HA 1VRSD 4OWYA 2IIYA 1EP7A 2JZTA 1MEKA 3M3MA 4IJ3A 3UVHA 4ZBBA 3TRXA 2GSRA 5CRDA 1A2JA 1Y6EA 4IGJA 2LRNA 2HSYA 2LRCA 5D96A 3GL5A 3LW9A 3GRXA 5ECPB 5KN0A 4K9ZA 2LJAA 3ZREA 4HDEA 2IMFA 1AXDA 3EU3A 4F03A 1NHYA 2GQLA 3ZYWA 5KN2A 3F3RA 2O87A 1A8YA 3FY7A 3F8UA 2NVLA 2C3NA 2YWOA 2AAWA 1GTBA 3CSHA 2IMKA 3L9UA 4WBRD 3WT1A 2WGRA 2LEGA 1TK5B 2B5EA 2CA8A 1FHEA 5DVBA 4I5QA 1AQVA 2VLVA 1B4QA 5IMDA 2GQMA 4CDOA 4GQFA 1E2YA 2JACA 1PSQA 1VF3A 4GTUA 3WGXA 3KXOA 2UZ8A 1G6YA 1RK4A 1PN0A 2L6DA 4MF6A 2B1KA 3TKRA 1DUGA 11GSA 3CMIA 3F0IA 3RHBA 2HSHA 1GSDA 1SK1A 4JRRA 5G5FA 5J9BA 2YJHA 2R5GA 4EDZA 4KCAA 5HR0A 2JL4A 1Q98A 2WJUA 1GSSA 5CP1A 4LA1A 2FLSA 1GH2A 2HRNA 2LUSA 2C0EA 1JFUA 3NOFA 1T4YA 2DJ1A 4MH2A 2OE0A 3CYNA 2FY6A 2YN1A 3L4NA 2N5FA 1K0DA 1ZCPA 1HD2A 1ZYEA 2IMDA 1QUWA 3BD2A 2H8LA 5EVOA 3HDCA 2GDRA 2VCWA 3EMPA 1Q4JA 3FK8A 4GXZA 2WDUA 4L5LA 4YH2A 3WGDA 1M0UA 4TVEA 3APQA 2NDOA 2DBCA 3K8NA 2EIRA 1O8WA 3TOTA 3KD0A 5E59A 4LL1B 1SKSB 3JCML 4F2IA 5HFGA 4L0WA 18GSA 2K6VA 1Z7PA 2WCIA 4DEJA 1HNCA 3Q18A 1M2BA 3HVVA 2VLTA 1CQGA 4K5SA 2R3XA 4EIQA 3GKMA 2CAQA 1EEJA 3A5IA 3IK7A 1FOVA 4XS6A 3KIJA 2H6XA 2L6CA 2VCXA 4LMVA 2C3QA 3UAPA 3GHAA 2H0GA 2YANA 3QOUA 4YQMA 3UBKA 5ECOB 2I9HA 2IN3A 2GSQA 5COHA 4ZL7A 4RQXA 1TU8A 1NW2A 5ID2A 2CZ2A 5IIZA 2VCVA 4KDYA 2PVQA 5IPGA 4KB3A 2G0FA 1GULA 2AB6A 4MLYA 3ZFBA 1TU7A 1X9MB 3ZIJA 2C1YA 4J56E 1ABAA 1MD3A 2C80A 3H93A 3QFBC 4YAPA 1ZYNA 2VD0A 7GSSA 1V58A 2YV7A 3UIWA 1K3OA 1F3AA 2VL2C 4EIPA 1J08A 1GSQA 5GAPD 2FHEA 1ILOA 2BTOT 1AIUA 2DKIA 3TJBA 3HCZA 4ZXGA 4O7HA 4N10A 1SL2B 3HVXA 2IFQB 2V1MA 3HJMA 3N5OA 1TK8B 4X4JA 4FO5A 4O5QA 2LV3A 2HT9A 4NPBA 1UN2A 2VM1A 4HQZA 4HEA2 4KH7A 2TRXA 2FUG2 3KH7A 2MBTA 3DIEA 4TR3A 4ZBDA 3VWXA 4G0IA 4USSA 3QR6A 3HXSA 5LNKe 1YDKA 2H70A 3GL3A 4K7NA 4IP1A 1EGOA 3M8NA 3U5RE 1YEPA 3CTFA 2HFDA 1OC9B 3KTBA 3LXTA 4BA7A 1J0FA 2WFCA 1XZOA 4IQAA 4YQUA 2G2QA 1K0NA 3KMOA 5D73A 2KUCA 2VL2A 2YZUA 4EDYA 1Z6NA 3LG6A 4QL7A 3FR3A 1GLQA 4LLRA 5ENUA 4TR1B 1SJIA 3H79A 2VOCA 1H75A 3VFIA 1ERVA 4ICYA 1EOGA 2NTOA 2TRCP 1SYRA 2CX3A 4Q5QA 1JZWA 2REMA 2XBQA 5DJLA 4BVYA 4CY8A 4FYUA 1GUHA 4AJ7A 1WWJA 5C04A 5HFIA 3DWVA 3GTUB 1PKZA 1V57A 1YKCA 2IL3A 3DVXA 3A5WA 5A4VA 5IPHA 5J41A 3L78A 1GSFA 2DIYA 2MYGA 2HZEA 1X9WB 4TXOA 3APSA 2CT6A 1K0BA 3W8SA 1OYJA 2R37A 4OO4A 3G7IA 2CVBA 1EV4A 2I3YA 3M9KA 4TR1A 4RI6A 1PN9A 4L5OA 2HRAA 3QFAC 2H1AA 3VI5A 2ZUPA 4PQ1A 1K3YA 3ZFLA 4K8MA 6GSTA 4QQ7A 2YPMA 1KBNA 3HA9A 1YQ1A 3C8EA 2H19A 3FMWA 3KM6A 4YAVA 3LJRA 2QKEA 1N2AA 5ECNB 4ZB8A 4Q5FA 2X8GA 2DKHA 5AIVA 3D4MA 3HYPA 1GNEA 3LORA 1XXUA 4POMA 4KAEA 1V40A 4G19A 5A4UA 1GLPA 2C0FA 3UEMA 2FA8A 2FWFA 1Z7RA 3KMNA 3O76A 2YOIA 1RW1A 4O32A 4TXVA 1LU4A 4AF2A 5ECIB 4TKYA 1R4WA 4Z7XA 5GSSA 2OA7A 4K2XA 3O3TA 5A5KA 2XHFA 4K2DA 3ZITA 3DMLA 3ERGA 4D73B 2LJKA 1FAAA 4MJAA 3GV1A 1OKDA 3F4TA 2H76A 3HVSA 1G7EA 1KTEA 4BPYA 3EWLA 2E0QA 2XC2A 3GH6A 1EOHA 2CAIA 1TK0B 8GSSA 2BJXA 5J9CA 20GSA 2I4AA 3US3A 3HZ8A 1XWCA 1URMA 1E6BA 2KHPA 1XW5A 3HD5A 4ZL8A 3GSTA 3LSZA 5LD0A 4XRDA 3IAS2 5EPFA 1K0OA 1PKWA 3BCIA 1M2DA 1TJDA 4Q5NA 1FO5A 3EC3A 4EF0A 2OE3A 2HRFA 3IPZA 2R4VA 1GWCA 2QA1A 4OO5A 4XTSA 3C71A 3FYGA 2H74A 5F05A 5LCZA 3TRQA 4G0LA 4PGTA 1FG4A 4N0ZA 4D73A 3GMFA 2PU9C 3KCMA 4MZCA 5FT3A 4TRXA 2GS3A 1XCCA 4IN0A 1TTZA 3FR9A 4FQUA 3E3EA 1BAYA 1UVZA 4KDXA 4PNFA 3VWUA 4FIWA 4QL9A 1R5AA 1S3DA 3MIXA 1HNBA 3OR5A 3IE3A 2HXKA 1F37A 2MBSA 1FB6A 2VL3A 2X4AA 1F2EA 3M1GA 4WF4A 3KGKA 1FB0A 3G9BA 5EL8A 4ZL9A 2R2JA 2O85A 1UA5A 4DSQA 2V2GA 2MMAA 4ACSA 1M99A 1VF2A 9GSSA 2IPAA 3LXZA 2E2MA 4GLTA 4IP6A 3GFKA 3DD3A 4RQRA 1X5CA 1XVQA 1PGTA 3G7JA 4EXJA 1BG5A 1ERWA 3D0ZA 1A2LA 2CQ9A 1AQWA 1GL8A 1XWKA 2HI7A 5IMVA 1AC1A 2VUPA 3RPPA 3TOUA 2JZSA 2MZCA 1O81A 4IVFA 1BQ7A 4I2TA 2H1GA 5KN3A 4K7OA 6GSUA 5KOXA 2VLUA 4KW6A 4KGIA 3J7Yk 1Z3EA 6GSWA 2GTUA 2PUKC 4ILFA 1NSWA 1JZRA 3GX0A 3LEFA 5DJMA 5ID2B 5F0GA 1B8XA 1SU9A 3U6VA 3P2AA 2CZ3A 2K8SA 2XPEA 1GSYA 3GX8A 2FNOA 3ME8A 2X49A 5DCHA 4GRFA 1K3LA 1ACVA 2O7KA 4PXOA 1TDIA 4FYCA 4NHWA 4ECCA 5ABRA 4WEYA 3LWAA 3FZAA 4IKHA 6GSYA 1ZL9A 4POKA 2I1UA 3ZLPA 5J3RA 3IOSA 3KP9A 2F51A 4HZ4A 4JR4A 1PL1A 1PX7A 4F0BA 3MNGA 2YWNA 2YZHA 4ECIA 5L71A 4Z2RA 5AN1A 2OADA 2ON5A 2J23A 1XVWA 4CW9A 3BJ5A 4WBJA 3QAGA 3DYRA 3D6IA 1YJ6A 1G0TA 1H4OA 2PPTA 4PUAA 2C0GA 2F8FA 4EC0A 4TR0A 3MWHA 5B8BA 3IRAA 4KNDA 1SD9A 2GQKA 3IBHA 4XS4B 2EC4A 4RUVA 1GNWA 1K0AA 4CHSA 2N5AA 1SJZA 4HJ2A 1SENA 3BCKA 2B3SA 4OFMA 2DC5A 1W89A 5JWOB 2EIOA 3LFLA 4IW9A 3D22A 4FYBA 1QGVA 1A8LA 1MDKA 1AW9A 1TXXA 4JBBA 1XFLA 3ED3A 4HU9A 2H6ZA 1BYEA 1GUMA 2QGVA 2H1DA 1N8JA 1EZKA 4IQ1A 1XIYA 13GSA 2D2ZA 3TKQA 3DVWA 3LQ7A 4GQCA 2GT5A 3CBUA 2DJJA 2X99A 2DJ3A 4BVYB 4TN8A 3RAZA 4FH8A 1O6JA 3GNJA 2VIMA 4MH3A 5BRTA 2GT6A 1TRSA 3L9SA 3RBTA 3EU4A 5G31A 2YWIA 2IWTA 5D9WA 3F9UA 1VGLA 1ERUA 2QA2A 4AJ6A 2FWEA 1DE2A 2P5QA 1U87A 4XS4A 3PH9A 2RM6A 5ECQB 4MDCA 3DEXA 2HZEB 1GP1A 2H73A 4TXOB 2H01A 3EINA 4V1Ap 2JADA 3APOA 3TJKA 1A2MA 3C7MA 2WRTA 4JR6A 3CTGA 4MK3A 5IMCA 4OCEA 2CVDA 1XBSA 1YZXA 3NIVA 4A5PA 1ON4A 3HY2A 1FW1A 1BX9A 3LYPA 4K5RA 4K7IA 5IMAA 4K0GA 4IS0A 4O5UA 3ZIVA 1PX6A 2H75A 2QC7A 5A4WA 1T00A 5CYYA 1WOUA 2V6KA 5J5NA 2NPBA 2B5XA 2L57A 2E2GA 3UMAA 4F9ZA 4ULXA 5H5QA 1B4PA 1XWGA 19GSA 4IHUA 3WT2A 4PUFC 2F3MA 3PINA 4MF7A 5CO3A 1YEXA 1VF1A 1EEMA 4NHZA 2LQOA 2C0DA 4JZQA 2FWGA 2JSYA 3V1WA 1X5EA 22GSA 4GCIA 2PVOC 5FHIA 1F3BA 4EVMA 2IMEA 1HNAA 1G7OA 2H72A 3GKKA 1ZYQB 3C1RA 2VO4A 5CREA 2HYXA 3O6TA 10GSA 2ES7A 4MCUA 4BL7A 4I8BA 3H1NA 2JU5A 4JU5A 4ECBA 4E8EA 1TP9A 4PURA 2ALBA 1WRYA 4PQIA 1T7PB 1R7HA 4ML1A 2P31A 2L4QA 3W6GA 3EMXA 2WB9A 1EP8A 3TRPA 5ECLB 2RM5A 3EYTA 1BJXA 2PBJA 3IV4A 4KF9A 3ERFA 4ZBAA 1KEBA 4NV5A 2FA4A 3CSJA 3EE2A 3CSIA 5G5EA 5D8IA 1WE0A 1S3AA 3RPNA 4I97A 4HUAA 1O7UA 3FZ4A 4V2NA 1SL1B 4H86A 2RUEA 3I9V2 4Z2UA 2DMLA 2L5LA 5KOWA 1QQ2A 2HZFA 4KSMA 2V6OA 1U6TA 1TI1A 1JHBA 5CAXA 1XW6A 2PWJA 3W8JA 5DAKB 1ML6A 3QD9A 1MD4A 2GSTA 3RHCA 5IQYA 1PMTA 1SD8A 3ZVJA 2NBSA 2IMIA 2R0CA 2L4CA 1K0MA 5KEJA 4JEDA 5DCGA 2PERA 5G30A 3TGZA 5CRWA 3I69A 3VI7A 1O73A 3GUSA 5DBQA 5F07A 1MDIA 1XWBA 3FZ9A 2P0GA 1SL0B 2VCQA 4EE0A 4KE3A 4G9HA 3TJJA 4WETA 1RQMA 2FGXA 4LL4B 5D9VA 4AGSA 2A2SA 3IDVA 5ECKB 2VAFA 3KZQA 1FOHA 1QK8A 4TR4A 2ON7A 4P3YB 3QAVA 2YV9A 1SJ6A 1Z5YE 1OVNA 2LNSA 1F6MC 1EGRA 5DAKA 2VL9A 3MDKA 5EY6A 4E8HA 4N0VA 1AAZA 1V98A 5JCGA 2K18A 2JSZA 3UARA 3A2VA 4MJCA 4BWSA 4X43A 2AV4A 3ISOA 5ECMB 1TOFA 4TOPA 3WD6A 6GSSA 3VLNA 5IOXA 2MMNA 1R5PA 1ZMAA 3IXRA 1T3BA 1ZZYA 3GH9A 1O85A 1IYHA 4OFTA 3VPTA 1JLWA 1OC3A 3IHQA 1M7TA 5CRGA 3D4TA 4X0XA 1YY7A 2B7KA 5JWRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XS1 A;  4G10 A;  2X8H A;  1T8E B;  1I5G A;  3M0F A;  3LYK A;  3BBY A;  2L59 A;  2K8V A;  4NMU A;  2OJL A;  2PN8 A;  4WF5 A;  4HQS A;  5FWG A;  1T1V A;  4J2F A;  4V2L A;  4G2E A;  1PD2 1;  5AIS A;  2X8C A;  2CVK A;  4PNG A;  5C00 A;  1BED A;  3NZN A;  4KX4 A;  12GS A;  1PA3 A;  1TRV A;  1J9B A;  1GSE A;  4MAB A;  1TKD B;  3QMX A;  1X9S B;  3R2Q A;  4ECJ A;  3FZ5 A;  5HR2 A;  6GSV A;  4YQV A;  1W4V A;  2QSI A;  5IMF A;  1S3C A;  2AHE A;  4EL1 A;  4MJE A;  1YF1 A;  4GF0 A;  4WR4 A;  1GTA A;  3HJO A;  3QAW A;  3GN3 A;  1SK0 A;  4JE1 A;  5DQS A;  2OE1 A;  4L0U A;  3ZMK A;  1SKW B;  2F8A A;  2MMO A;  4OMV A;  2H1B A;  2C4J A;  3IR4 A;  2OBI A;  4WXT A;  2JZR A;  2M72 A;  5AIX A;  5IO0 A;  3WYW A;  4HZ2 A;  3F6D A;  3A3T A;  4V1A g;  2YWM A;  2KLX A;  16GS A;  2RUF A;  2DMM A;  3ZZX A;  4DVC A;  2V41 A;  3TJG A;  4RI7 A;  2GZY A;  5G2Z A;  2HE3 A;  2IJY A;  1HYU A;  3FKF A;  3FW2 A;  2B1L A;  3I43 A;  3KEB A;  5F06 A;  1IYI A;  4WR5 A;  2LST A;  2AYT A;  4EUY A;  2E7P A;  1WMJ A;  1YF0 A;  2B7J A;  3IC4 A;  2LKU A;  3E9J B;  2H0I A;  4IJI A;  4HU7 A;  4KUN A;  2AJQ B;  4DSR A;  5ECH B;  4HJM A;  4N30 A;  4IEL A;  4J57 E;  4NAX A;  2F9S A;  5B8A A;  3KH9 A;  3FRC A;  1QMV A;  1PQN A;  5B6N A;  3TUE A;  2ZNM A;  1V2A A;  3FEU A;  5GST A;  3ME7 A;  1THX A;  2FD3 A;  4K6X A;  5H5S A;  1FVK A;  1GUK A;  4EO3 A;  3P7X A;  3F3Q A;  3ZTL A;  4MP4 A;  1X5D A;  3VWV A;  3PGT A;  3TKS E;  3TCO A;  3QPM A;  1V9W A;  3CXG A;  2H6Y A;  17GS A;  5G1L A;  2H66 A;  4GSN A;  2WZ9 A;  1PRX A;  2B5Y A;  4N11 A;  1NHO A;  4OCF A;  4TW5 A;  4ID0 A;  5KN1 A;  1A24 A;  5ELA A;  3ZRD A;  2V32 A;  1XOA A;  4K1F A;  2GLR A;  1ZGN A;  1U3A A;  3H8Q A;  3J7Y b;  5D93 A;  5GAN D;  3VWW A;  4MJB A;  1MTC A;  3F4S A;  1GTI A;  4WKW A;  4GST A;  4O92 A;  2DJ0 A;  3A2X A;  3C1S A;  1EWX A;  3ZL5 A;  4KA0 A;  5B6M A;  2XPD A;  1NM3 A;  1QXH A;  4DSS B;  5JCU A;  2L5O A;  5GZZ B;  3IK9 A;  3L9V A;  2O89 A;  4Q5R A;  3MSZ A;  2C3T A;  4MMM A;  4AJ8 A;  3ERW A;  4ML6 A;  2O8V B;  4GWR A;  1USB A;  2J9H A;  3EUR A;  2OAC A;  3HHV A;  2FCH A;  3D21 A;  2VCZ A;  2X64 A;  4KSO A;  4F82 A;  1JZD A;  2MMZ A;  5IOW A;  1F9M A;  1C72 A;  2ZCT A;  2CV4 A;  5ECS A;  1TI3 A;  1THO A;  1TRW A;  2XBI A;  3FHK A;  3F4R A;  3KJY A;  3IAM 2;  2GGT A;  1CQH A;  4NWY A;  3N9J A;  2LTK A;  2PMT A;  4XRA A;  3VPQ A;  3Q19 A;  1Y25 A;  2LS5 A;  5H5R A;  1WJK A;  1JLV A;  2YJ7 A;  2LJR A;  4I2U A;  5B7C A;  3KTL A;  2CX4 A;  4ZB9 A;  4PX1 A;  2FWH A;  1I9D A;  1DBY A;  3HJP A;  1M2A A;  3BOA A;  3DRN A;  4ZB6 A;  2H71 A;  3DGQ A;  4DSS A;  3A2W A;  5DQY A;  4O5R A;  1VF4 A;  1HQO A;  2Z9S A;  4X1U A;  1ST9 A;  2GSS A;  2OKA A;  3ZVJ D;  3QDN A;  2P5R A;  5CRH A;  2YCD A;  2R6K A;  3HZ4 A;  3HKR A;  2WUL A;  1OE7 A;  3H4K A;  5JCW A;  5IO2 A;  3CRT A;  3LGC A;  5ECR B;  2GVP A;  3GKN A;  2IFQ A;  3VUR A;  2YP6 A;  5ELG A;  2GZP A;  1SK2 A;  2DJ2 A;  2HLS A;  1PL2 A;  3GSS A;  1SKR B;  4ISD A;  1TRU A;  3UBL A;  1K0C A;  1AUC A;  5DAL B;  4PQH A;  2OBK A;  3G7Y A;  4OD7 A;  3TJF A;  5F8B A;  4MPG A;  2K9F A;  4IBP A;  1XW9 A;  3UJ1 A;  4HOJ A;  2VM2 A;  3I6A A;  3F63 A;  3DXB A;  3P8W A;  3F6F A;  1OC9 A;  3GA4 A;  2RII A;  4POB A;  4I6X A;  3FR6 A;  4LMW A;  2M80 A;  3SWL A;  1EV9 A;  1OAZ A;  1T4Z A;  3WGE A;  5IM9 A;  2DLX A;  1DE1 A;  3ZML A;  3TKS C;  3KP8 A;  3P90 A;  1GTU A;  3E0U A;  5D9X A;  5DDL A;  1G6W A;  2B6M A;  4OFN A;  4MPF A;  2PGT A;  2M46 A;  2VD1 A;  3C73 A;  2KOK A;  2I81 A;  3QCP A;  2GZZ A;  3UOM A;  1U88 A;  1ZOF A;  1WPI A;  2C8U A;  1GSU A;  5INY A;  5DAL A;  4ZIL A;  4MF5 A;  3UVT A;  1XPV A;  2KP2 A;  3GYK A;  3PR8 A;  3GTU A;  1B9X C;  3VK9 A;  1XOB A;  3TDG A;  4BWQ A;  3IA1 A;  4V2M A;  2HNL A;  4KCE A;  3UL3 A;  5HFK A;  1LJR A;  1AQX A;  1M9A A;  4XIH A;  1X0R A;  5HR1 A;  1Z9H A;  1LBK A;  2LQQ A;  4K0N A;  14GS A;  1A0F A;  4ZIJ A;  4EKZ A;  5G1K A;  1FVJ A;  2N5B A;  2LNT A;  4GSS A;  3TKS A;  1R26 A;  5JWQ B;  3EVI A;  6GSX A;  5CNW A;  2H0H A;  3TB2 A;  4L8E A;  2DSA A;  1DSB A;  4MA9 A;  5HQP A;  3MAK A;  2YNX A;  1QFN A;  4XHM A;  1SYX A;  2WS2 A;  4KDU A;  1OC8 A;  3TKP A;  3GIX A;  1YKA A;  5HR3 A;  1M9B A;  1WP0 A;  4HI7 A;  3CRU A;  1JZO A;  1XWA A;  1ERT A;  1A23 A;  4MZW A;  5D9T A;  5IMZ A;  4BVX A;  1MDJ A;  3Q74 A;  2LRT A;  1OKT A;  3RDW A;  2DIZ A;  4MZB A;  1Z6M A;  3Q6O A;  3D5J A;  2AUV A;  4XCS A;  2DJK A;  4F0C A;  5J4U A;  2H30 A;  4NV2 A;  2TIR A;  4HS1 A;  1UC7 A;  2RLI A;  2KP1 A;  3AY8 A;  3GKX A;  1O8X A;  1OE8 A;  4NXI A;  3GUR A;  1U3I A;  5E4W A;  1KNG A;  3DKS A;  2VCT A;  2A4V A;  4POL A;  1A0R P;  3SBC A;  1GRX A;  2A2R A;  2BMX A;  1TW9 A;  1WIK A;  1B48 A;  3M9J A;  3S9F A;  1B9Y C;  5AGY A;  2EIQ A;  3L0H A;  1VRS D;  4OWY A;  2IIY A;  1EP7 A;  2JZT A;  1MEK A;  3M3M A;  4IJ3 A;  3UVH A;  4ZBB A;  3TRX A;  2GSR A;  5CRD A;  1A2J A;  1Y6E A;  4IGJ A;  2LRN A;  2HSY A;  2LRC A;  5D96 A;  3GL5 A;  3GRX A;  5ECP B;  5KN0 A;  4K9Z A;  2LJA A;  3ZRE A;  4HDE A;  2IMF A;  1AXD A;  3EU3 A;  4F03 A;  1NHY A;  2GQL A;  3ZYW A;  5KN2 A;  3F3R A;  2O87 A;  1A8Y A;  3FY7 A;  3F8U A;  2NVL A;  2C3N A;  2YWO A;  2AAW A;  1GTB A;  3CSH A;  2IMK A;  3L9U A;  4WBR D;  3WT1 A;  2WGR A;  2LEG A;  1TK5 B;  2B5E A;  2CA8 A;  1FHE A;  5DVB A;  4I5Q A;  1AQV A;  2VLV A;  1B4Q A;  5IMD A;  2GQM A;  4CDO A;  4GQF A;  1E2Y A;  2JAC A;  1PSQ A;  1VF3 A;  4GTU A;  3WGX A;  3KXO A;  1G6Y A;  1RK4 A;  2L6D A;  4MF6 A;  2B1K A;  3TKR A;  1DUG A;  11GS A;  3CMI A;  3F0I A;  3RHB A;  2HSH A;  1GSD A;  1SK1 A;  4JRR A;  5G5F A;  5J9B A;  2YJH A;  2R5G A;  4EDZ A;  4KCA A;  5HR0 A;  2JL4 A;  1Q98 A;  2WJU A;  1GSS A;  5CP1 A;  4LA1 A;  2FLS A;  1GH2 A;  2HRN A;  2LUS A;  2C0E A;  1JFU A;  3NOF A;  1T4Y A;  2DJ1 A;  4MH2 A;  2OE0 A;  3CYN A;  2FY6 A;  2YN1 A;  3L4N A;  2N5F A;  1K0D A;  1ZCP A;  1HD2 A;  1ZYE A;  2IMD A;  1QUW A;  3BD2 A;  2H8L A;  5EVO A;  3HDC A;  2GDR A;  2VCW A;  3EMP A;  1Q4J A;  3FK8 A;  4GXZ A;  2WDU A;  4L5L A;  4YH2 A;  3WGD A;  1M0U A;  4TVE A;  3APQ A;  2NDO A;  2DBC A;  3K8N A;  2EIR A;  1O8W A;  3TOT A;  3KD0 A;  5E59 A;  4LL1 B;  1SKS B;  3JCM L;  4F2I A;  5HFG A;  4L0W A;  18GS A;  2K6V A;  1Z7P A;  2WCI A;  4DEJ A;  1HNC A;  3Q18 A;  1M2B A;  3HVV A;  2VLT A;  1CQG A;  2R3X A;  3GKM A;  2CAQ A;  1EEJ A;  3IK7 A;  1FOV A;  4XS6 A;  3KIJ A;  2H6X A;  2L6C A;  2VCX A;  4LMV A;  2C3Q A;  3UAP A;  3GHA A;  2H0G A;  2YAN A;  3QOU A;  4YQM A;  3UBK A;  5ECO B;  2I9H A;  2IN3 A;  2GSQ A;  5COH A;  4ZL7 A;  4RQX A;  1TU8 A;  1NW2 A;  5ID2 A;  2CZ2 A;  5IIZ A;  2VCV A;  4KDY A;  2PVQ A;  5IPG A;  4KB3 A;  2G0F A;  1GUL A;  2AB6 A;  4MLY A;  3ZFB A;  1TU7 A;  1X9M B;  3ZIJ A;  2C1Y A;  4J56 E;  1ABA A;  1MD3 A;  2C80 A;  3H93 A;  3QFB C;  4YAP A;  7GSS A;  2VD0 A;  1V58 A;  2YV7 A;  3UIW A;  1K3O A;  1F3A A;  2VL2 C;  1J08 A;  1GSQ A;  5GAP D;  2FHE A;  1ILO A;  2BTO T;  1AIU A;  3TJB A;  3HCZ A;  4ZXG A;  4O7H A;  4N10 A;  1SL2 B;  3HVX A;  2IFQ B;  2V1M A;  3HJM A;  3N5O A;  1TK8 B;  4FO5 A;  2LV3 A;  2HT9 A;  4NPB A;  1UN2 A;  2VM1 A;  4HQZ A;  4HEA 2;  4KH7 A;  2TRX A;  2FUG 2;  3KH7 A;  2MBT A;  3DIE A;  4TR3 A;  4ZBD A;  3VWX A;  3QR6 A;  3HXS A;  5LNK e;  1YDK A;  2H70 A;  3GL3 A;  4K7N A;  4IP1 A;  1EGO A;  3M8N A;  3U5R E;  1YEP A;  3CTF A;  2HFD A;  1OC9 B;  3KTB A;  3LXT A;  4BA7 A;  1J0F A;  2WFC A;  1XZO A;  4IQA A;  4YQU A;  2G2Q A;  1K0N A;  3KMO A;  5D73 A;  2KUC A;  2VL2 A;  2YZU A;  4EDY A;  1Z6N A;  3LG6 A;  4QL7 A;  3FR3 A;  1GLQ A;  4LLR A;  5ENU A;  4TR1 B;  1SJI A;  3H79 A;  2VOC A;  1H75 A;  3VFI A;  1ERV A;  1EOG A;  2NTO A;  2TRC P;  1SYR A;  2CX3 A;  4Q5Q A;  1JZW A;  2REM A;  2XBQ A;  5DJL A;  4BVY A;  4FYU A;  1GUH A;  4AJ7 A;  1WWJ A;  5C04 A;  5HFI A;  3DWV A;  3GTU B;  1PKZ A;  1V57 A;  1YKC A;  2IL3 A;  3DVX A;  3A5W A;  5A4V A;  5IPH A;  5J41 A;  3L78 A;  1GSF A;  2DIY A;  2MYG A;  2HZE A;  1X9W B;  4TXO A;  3APS A;  2CT6 A;  1K0B A;  3W8S A;  1OYJ A;  2R37 A;  4OO4 A;  3G7I A;  2CVB A;  1EV4 A;  2I3Y A;  3M9K A;  4TR1 A;  4RI6 A;  1PN9 A;  4L5O A;  3QFA C;  2H1A A;  3VI5 A;  2ZUP A;  4PQ1 A;  1K3Y A;  3ZFL A;  4K8M A;  6GST A;  4QQ7 A;  2YPM A;  1KBN A;  3HA9 A;  1YQ1 A;  3C8E A;  2H19 A;  3KM6 A;  4YAV A;  3LJR A;  2QKE A;  1N2A A;  5ECN B;  4ZB8 A;  4Q5F A;  2X8G A;  5AIV A;  3D4M A;  3HYP A;  1GNE A;  3LOR A;  1XXU A;  4POM A;  4KAE A;  1V40 A;  4G19 A;  5A4U A;  1GLP A;  2C0F A;  3UEM A;  2FA8 A;  2FWF A;  1Z7R A;  3KMN A;  3O76 A;  2YOI A;  1RW1 A;  4O32 A;  4TXV A;  1LU4 A;  4AF2 A;  5ECI B;  4TKY A;  1R4W A;  4Z7X A;  5GSS A;  2OA7 A;  3O3T A;  5A5K A;  2XHF A;  4K2D A;  3ZIT A;  3DML A;  3ERG A;  4D73 B;  2LJK A;  1FAA A;  4MJA A;  3GV1 A;  1OKD A;  3F4T A;  2H76 A;  3HVS A;  1G7E A;  1KTE A;  4BPY A;  3EWL A;  2E0Q A;  2XC2 A;  3GH6 A;  1EOH A;  2CAI A;  1TK0 B;  8GSS A;  2BJX A;  5J9C A;  20GS A;  2I4A A;  3US3 A;  3HZ8 A;  1XWC A;  1URM A;  1E6B A;  2KHP A;  1XW5 A;  3HD5 A;  4ZL8 A;  3GST A;  3LSZ A;  5LD0 A;  4XRD A;  3IAS 2;  5EPF A;  1K0O A;  1PKW A;  3BCI A;  1M2D A;  1TJD A;  4Q5N A;  1FO5 A;  3EC3 A;  4EF0 A;  2OE3 A;  2HRF A;  3IPZ A;  2R4V A;  1GWC A;  4OO5 A;  4XTS A;  3C71 A;  3FYG A;  2H74 A;  5F05 A;  5LCZ A;  3TRQ A;  4PGT A;  1FG4 A;  4N0Z A;  4D73 A;  3GMF A;  2PU9 C;  3KCM A;  4MZC A;  5FT3 A;  4TRX A;  2GS3 A;  1XCC A;  1TTZ A;  3FR9 A;  4IN0 A;  3E3E A;  1BAY A;  1UVZ A;  4KDX A;  4PNF A;  3VWU A;  4FIW A;  4QL9 A;  1R5A A;  1S3D A;  1HNB A;  3OR5 A;  3IE3 A;  2HXK A;  1F37 A;  2MBS A;  1FB6 A;  2VL3 A;  1F2E A;  3M1G A;  4WF4 A;  3KGK A;  1FB0 A;  3G9B A;  5EL8 A;  4ZL9 A;  2R2J A;  2O85 A;  1UA5 A;  4DSQ A;  2V2G A;  2MMA A;  4ACS A;  1M99 A;  1VF2 A;  9GSS A;  2IPA A;  3LXZ A;  2E2M A;  4GLT A;  4IP6 A;  3GFK A;  3DD3 A;  4RQR A;  1X5C A;  1XVQ A;  1PGT A;  3G7J A;  4EXJ A;  1BG5 A;  1ERW A;  3D0Z A;  1A2L A;  2CQ9 A;  1AQW A;  1GL8 A;  1XWK A;  2HI7 A;  5IMV A;  1AC1 A;  2VUP A;  3RPP A;  3TOU A;  2JZS A;  2MZC A;  1O81 A;  4IVF A;  1BQ7 A;  4I2T A;  2H1G A;  5KN3 A;  4K7O A;  6GSU A;  2VLU A;  4KW6 A;  4KGI A;  3J7Y k;  1Z3E A;  6GSW A;  2GTU A;  2PUK C;  4ILF A;  1NSW A;  1JZR A;  3GX0 A;  3LEF A;  5DJM A;  5ID2 B;  5F0G A;  1B8X A;  1SU9 A;  3U6V A;  3P2A A;  2CZ3 A;  2K8S A;  2XPE A;  1GSY A;  3GX8 A;  2FNO A;  3ME8 A;  5DCH A;  4GRF A;  1K3L A;  1ACV A;  2O7K A;  4PXO A;  1TDI A;  4FYC A;  4NHW A;  4ECC A;  5ABR A;  4WEY A;  3LWA A;  3FZA A;  4IKH A;  6GSY A;  1ZL9 A;  4POK A;  2I1U A;  3ZLP A;  5J3R A;  3IOS A;  3KP9 A;  2F51 A;  4HZ4 A;  4JR4 A;  1PL1 A;  1PX7 A;  4F0B A;  3MNG A;  2YWN A;  2YZH A;  4ECI A;  5L71 A;  5AN1 A;  2OAD A;  2ON5 A;  2J23 A;  1XVW A;  4CW9 A;  3BJ5 A;  4WBJ A;  3QAG A;  3DYR A;  3D6I A;  1YJ6 A;  1G0T A;  1H4O A;  2PPT A;  4PUA A;  2C0G A;  2F8F A;  4EC0 A;  4TR0 A;  3MWH A;  5B8B A;  3IRA A;  4KND A;  1SD9 A;  2GQK A;  3IBH A;  4XS4 B;  2EC4 A;  4RUV A;  1GNW A;  1K0A A;  4CHS A;  2N5A A;  1SJZ A;  4HJ2 A;  1SEN A;  3BCK A;  2B3S A;  4OFM A;  2DC5 A;  1W89 A;  5JWO B;  2EIO A;  3LFL A;  4IW9 A;  3D22 A;  4FYB A;  1QGV A;  1A8L A;  1MDK A;  1AW9 A;  1TXX A;  4JBB A;  1XFL A;  3ED3 A;  4HU9 A;  2H6Z A;  1BYE A;  1GUM A;  2QGV A;  2H1D A;  1N8J A;  1EZK A;  4IQ1 A;  1XIY A;  13GS A;  2D2Z A;  3TKQ A;  3DVW A;  3LQ7 A;  4GQC A;  2GT5 A;  3CBU A;  2DJJ A;  2X99 A;  2DJ3 A;  4TN8 A;  3RAZ A;  4FH8 A;  1O6J A;  3GNJ A;  2VIM A;  4MH3 A;  2GT6 A;  1TRS A;  3L9S A;  3RBT A;  3EU4 A;  5G31 A;  2YWI A;  2IWT A;  5D9W A;  3F9U A;  1VGL A;  1ERU A;  4AJ6 A;  2FWE A;  1DE2 A;  2P5Q A;  1U87 A;  4XS4 A;  3PH9 A;  2RM6 A;  5ECQ B;  4MDC A;  3DEX A;  2HZE B;  1GP1 A;  2H73 A;  4TXO B;  2H01 A;  3EIN A;  4V1A p;  2JAD A;  3APO A;  3TJK A;  1A2M A;  3C7M A;  2WRT A;  4JR6 A;  3CTG A;  4MK3 A;  5IMC A;  4OCE A;  2CVD A;  1XBS A;  1YZX A;  3NIV A;  1ON4 A;  3HY2 A;  1FW1 A;  1BX9 A;  3LYP A;  4K7I A;  5IMA A;  4K0G A;  4IS0 A;  3ZIV A;  1PX6 A;  2H75 A;  2QC7 A;  5A4W A;  1T00 A;  5CYY A;  1WOU A;  2V6K A;  5J5N A;  2NPB A;  2B5X A;  2L57 A;  2E2G A;  3UMA A;  4F9Z A;  4ULX A;  5H5Q A;  1B4P A;  1XWG A;  19GS A;  4IHU A;  3WT2 A;  4PUF C;  2F3M A;  3PIN A;  4MF7 A;  5CO3 A;  1YEX A;  1VF1 A;  1EEM A;  4NHZ A;  2LQO A;  2C0D A;  4JZQ A;  2FWG A;  2JSY A;  3V1W A;  1X5E A;  22GS A;  4GCI A;  2PVO C;  5FHI A;  1F3B A;  4EVM A;  2IME A;  1HNA A;  1G7O A;  2H72 A;  3GKK A;  1ZYQ B;  3C1R A;  2VO4 A;  5CRE A;  2HYX A;  3O6T A;  10GS A;  2ES7 A;  4MCU A;  4BL7 A;  4I8B A;  3H1N A;  2JU5 A;  4JU5 A;  4ECB A;  4E8E A;  1TP9 A;  4PUR A;  2ALB A;  1WRY A;  4PQI A;  1T7P B;  1R7H A;  4ML1 A;  2P31 A;  2L4Q A;  3W6G A;  3EMX A;  2WB9 A;  1EP8 A;  3TRP A;  5ECL B;  2RM5 A;  3EYT A;  1BJX A;  2PBJ A;  3IV4 A;  3ERF A;  4ZBA A;  1KEB A;  4NV5 A;  2FA4 A;  3CSJ A;  3EE2 A;  3CSI A;  5G5E A;  5D8I A;  1WE0 A;  1S3A A;  3RPN A;  4I97 A;  4HUA A;  1O7U A;  3FZ4 A;  4V2N A;  1SL1 B;  4H86 A;  2RUE A;  3I9V 2;  2DML A;  2L5L A;  1QQ2 A;  2HZF A;  4KSM A;  2V6O A;  1U6T A;  1TI1 A;  1JHB A;  5CAX A;  1XW6 A;  2PWJ A;  3W8J A;  5DAK B;  1ML6 A;  3QD9 A;  1MD4 A;  2GST A;  3RHC A;  5IQY A;  1PMT A;  1SD8 A;  3ZVJ A;  2NBS A;  2IMI A;  2L4C A;  1K0M A;  5KEJ A;  4JED A;  5DCG A;  2PER A;  5G30 A;  3TGZ A;  5CRW A;  3I69 A;  3VI7 A;  1O73 A;  3GUS A;  5DBQ A;  5F07 A;  1MDI A;  1XWB A;  3FZ9 A;  2P0G A;  1SL0 B;  2VCQ A;  4EE0 A;  4KE3 A;  4G9H A;  3TJJ A;  4WET A;  1RQM A;  2FGX A;  4LL4 B;  5D9V A;  4AGS A;  2A2S A;  3IDV A;  5ECK B;  2VAF A;  3KZQ A;  1QK8 A;  4TR4 A;  2ON7 A;  4P3Y B;  3QAV A;  2YV9 A;  1SJ6 A;  1Z5Y E;  1OVN A;  2LNS A;  1F6M C;  1EGR A;  5DAK A;  2VL9 A;  3MDK A;  5EY6 A;  4E8H A;  4N0V A;  1AAZ A;  1V98 A;  5JCG A;  2K18 A;  2JSZ A;  3UAR A;  3A2V A;  4MJC A;  4BWS A;  4X43 A;  2AV4 A;  3ISO A;  5ECM B;  1TOF A;  4TOP A;  3WD6 A;  6GSS A;  3VLN A;  5IOX A;  2MMN A;  1R5P A;  1ZMA A;  3IXR A;  1T3B A;  1ZZY A;  3GH9 A;  1O85 A;  1IYH A;  4OFT A;  3VPT A;  1JLW A;  1OC3 A;  3IHQ A;  1M7T A;  5CRG A;  3D4T A;  4X0X A;  1YY7 A;  2B7K A;  5JWR B; 
#chains in the Genus database with same CATH topology
 4XS1 A;  4G10 A;  2X8H A;  1T8E B;  1I5G A;  3M0F A;  3LYK A;  3BBY A;  2L59 A;  2K8V A;  4NMU A;  2OJL A;  2PN8 A;  3IC8 A;  4WF5 A;  4HQS A;  5FWG A;  1T1V A;  4J2F A;  4V2L A;  4G2E A;  1PD2 1;  5AIS A;  2X8C A;  2CVK A;  4PNG A;  5C00 A;  1BED A;  3NZN A;  4KX4 A;  12GS A;  1PA3 A;  1TRV A;  1J9B A;  1GSE A;  4MAB A;  1TKD B;  3QMX A;  1X9S B;  3R2Q A;  4ECJ A;  3FZ5 A;  5HR2 A;  6GSV A;  4YQV A;  1W4V A;  2QSI A;  5IMF A;  1S3C A;  2AHE A;  4EL1 A;  4MJE A;  1YF1 A;  4GF0 A;  4WR4 A;  1GTA A;  3HJO A;  3QAW A;  3HVN A;  3GN3 A;  1SK0 A;  4JE1 A;  5DQS A;  2OE1 A;  4L0U A;  3ZMK A;  4MNN A;  1SKW B;  2F8A A;  5BMU A;  2MMO A;  4OMV A;  2H1B A;  2C4J A;  3IR4 A;  2OBI A;  4WXT A;  2JZR A;  2M72 A;  5AIX A;  5IO0 A;  3WYW A;  4HZ2 A;  3F6D A;  3A3T A;  4V1A g;  2YWM A;  4Z2T A;  2KLX A;  16GS A;  2RUF A;  2DMM A;  3ZZX A;  4DVC A;  2V41 A;  3TJG A;  4RI7 A;  2GZY A;  5G2Z A;  2HE3 A;  2IJY A;  1HYU A;  3FKF A;  3FW2 A;  2B1L A;  3I43 A;  3KEB A;  5F06 A;  3MYD A;  1IYI A;  4WR5 A;  2LST A;  2AYT A;  4EUY A;  2E7P A;  1WMJ A;  1YF0 A;  2B7J A;  3IC4 A;  2LKU A;  3E9J B;  2H0I A;  4IJI A;  4HU7 A;  4KUN A;  2AJQ B;  4DSR A;  5ECH B;  4HJM A;  4N30 A;  3PPU A;  4IEL A;  4J57 E;  4NAX A;  2F9S A;  2R0G A;  5B8A A;  3KH9 A;  3FRC A;  1QMV A;  1PQN A;  2A2P A;  5B6N A;  3TUE A;  2ZNM A;  1V2A A;  3FEU A;  5GST A;  3ME7 A;  1THX A;  2FD3 A;  4K6X A;  2A4H A;  5H5S A;  1FVK A;  1GUK A;  4EO3 A;  3P7X A;  3F3Q A;  3ZTL A;  4MP4 A;  1X5D A;  3VWV A;  3PGT A;  3TKS E;  3TCO A;  3QPM A;  1V9W A;  3CXG A;  2H6Y A;  17GS A;  5G1L A;  2H66 A;  3IHG A;  4GSN A;  2WZ9 A;  1PRX A;  2B5Y A;  4N11 A;  1NHO A;  4OCF A;  4TW5 A;  4ID0 A;  5KN1 A;  1A24 A;  5ELA A;  3ZRD A;  2V32 A;  1XOA A;  4K1F A;  2GLR A;  1ZGN A;  1U3A A;  3H8Q A;  3J7Y b;  5D93 A;  5GAN D;  3VWW A;  4MJB A;  1MTC A;  3F4S A;  1GTI A;  4WKW A;  3EPT A;  4GST A;  4O92 A;  2DJ0 A;  3A2X A;  3C1S A;  1EWX A;  3ZL5 A;  4KA0 A;  5B6M A;  2XPD A;  1NM3 A;  1QXH A;  4DSS B;  5JCU A;  2L5O A;  5GZZ B;  3IK9 A;  3L9V A;  2O89 A;  4Q5R A;  3MSZ A;  2C3T A;  4MMM A;  4AJ8 A;  3ERW A;  4ML6 A;  2O8V B;  4GWR A;  1USB A;  2J9H A;  3EUR A;  2OAC A;  3HHV A;  2FCH A;  3D21 A;  2VCZ A;  2X64 A;  4KSO A;  4F82 A;  1JZD A;  2MMZ A;  5IOW A;  1F9M A;  1C72 A;  2ZCT A;  2R0P A;  2CV4 A;  5ECS A;  1TI3 A;  1THO A;  1TRW A;  2XBI A;  3FHK A;  3F4R A;  3KJY A;  3IAM 2;  2GGT A;  1CQH A;  4NWY A;  3N9J A;  2LTK A;  2PMT A;  4XRA A;  3VPQ A;  3Q19 A;  1Y25 A;  2LS5 A;  5H5R A;  4BL7 B;  1WJK A;  1JLV A;  2YJ7 A;  2LJR A;  4I2U A;  5B7C A;  3KTL A;  2CX4 A;  4ZB9 A;  4PX1 A;  2FWH A;  1I9D A;  1DBY A;  3HJP A;  4YKF A;  1M2A A;  3BOA A;  3DRN A;  4ZB6 A;  1ZYP A;  2H71 A;  3DGQ A;  4DSS A;  3A2W A;  5DQY A;  4O5R A;  1VF4 A;  1HQO A;  2Z9S A;  4X1U A;  1ST9 A;  2GSS A;  4G0K A;  2OKA A;  3ZVJ D;  5CRH A;  3QDN A;  2P5R A;  2YCD A;  2R6K A;  3HZ4 A;  3HKR A;  2WUL A;  1OE7 A;  3H4K A;  5JCW A;  5IO2 A;  3CRT A;  3LGC A;  5ECR B;  2GVP A;  3GKN A;  2IFQ A;  3VUR A;  2YP6 A;  5ELG A;  2GZP A;  1SK2 A;  2DJ2 A;  2HLS A;  1PL2 A;  3GSS A;  1SKR B;  4ISD A;  1TRU A;  3UBL A;  1K0C A;  1AUC A;  5DAL B;  4PQH A;  2OBK A;  3G7Y A;  4OD7 A;  3TJF A;  5F8B A;  4MPG A;  2K9F A;  4IBP A;  1XW9 A;  3UJ1 A;  2HRK A;  4HOJ A;  2VM2 A;  3I6A A;  4PTS A;  3F63 A;  3DXB A;  3P8W A;  3F6F A;  1OC9 A;  3GA4 A;  2RII A;  4POB A;  4I6X A;  3FR6 A;  4LMW A;  2M80 A;  3SWL A;  1EV9 A;  1OAZ A;  1T4Z A;  3WGE A;  5IM9 A;  2DLX A;  1DE1 A;  3ZML A;  3TKS C;  3KP8 A;  3P90 A;  1GTU A;  3E0U A;  5D9X A;  5DDL A;  1G6W A;  2B6M A;  4OFN A;  4MPF A;  2PGT A;  2M46 A;  2VD1 A;  3C73 A;  2KOK A;  2I81 A;  3QCP A;  2GZZ A;  3UOM A;  1U88 A;  1ZOF A;  1WPI A;  3R3E A;  2C8U A;  1GSU A;  5INY A;  5DAL A;  4ZIL A;  4MF5 A;  3UVT A;  2HSM A;  1XPV A;  2KP2 A;  3GYK A;  4BVX B;  3PR8 A;  3GTU A;  1B9X C;  3VK9 A;  4YKG A;  1XOB A;  3TDG A;  4BWQ A;  3IA1 A;  4V2M A;  2HNL A;  4KCE A;  3UL3 A;  5HFK A;  1LJR A;  1AQX A;  1M9A A;  4XIH A;  1X0R A;  5HR1 A;  1Z9H A;  1LBK A;  2LQQ A;  4K0N A;  14GS A;  1A0F A;  4ZIJ A;  4EKZ A;  5G1K A;  1FVJ A;  2N5B A;  2LNT A;  4GSS A;  3TKS A;  1R26 A;  5JWQ B;  3EVI A;  6GSX A;  5CNW A;  2H0H A;  3TB2 A;  4CY6 A;  4L8E A;  2DSA A;  1DSB A;  4MA9 A;  5HQP A;  3MAK A;  2YNX A;  1QFN A;  4XHM A;  1SYX A;  2WS2 A;  4KDU A;  1OC8 A;  3TKP A;  3GIX A;  1YKA A;  5HR3 A;  1M9B A;  1WP0 A;  4HI7 A;  3CRU A;  1JZO A;  1XWA A;  1ERT A;  1A23 A;  4MZW A;  5D9T A;  5IMZ A;  4BVX A;  1MDJ A;  3Q74 A;  2LRT A;  1OKT A;  3RDW A;  2DIZ A;  4MZB A;  1Z6M A;  3Q6O A;  3D5J A;  2AUV A;  4XCS A;  2DJK A;  4F0C A;  5J4U A;  2H30 A;  4NV2 A;  2TIR A;  4HS1 A;  1UC7 A;  2RLI A;  2KP1 A;  3AY8 A;  3GKX A;  1O8X A;  1OE8 A;  4NXI A;  3GUR A;  1U3I A;  5E4W A;  1KNG A;  3DKS A;  2VCT A;  2A4V A;  4POL A;  1A0R P;  3SBC A;  1GRX A;  2A2R A;  2BMX A;  4BIK A;  1TW9 A;  1WIK A;  1B48 A;  3M9J A;  3S9F A;  1B9Y C;  5AGY A;  2EIQ A;  3L0H A;  1VRS D;  4OWY A;  2IIY A;  1EP7 A;  2JZT A;  1MEK A;  3M3M A;  4IJ3 A;  3UVH A;  4ZBB A;  3TRX A;  2GSR A;  5CRD A;  1A2J A;  1Y6E A;  4IGJ A;  2LRN A;  2HSY A;  2LRC A;  5D96 A;  3GL5 A;  3LW9 A;  3GRX A;  5ECP B;  5KN0 A;  4K9Z A;  2LJA A;  3ZRE A;  4HDE A;  2IMF A;  1AXD A;  3EU3 A;  4F03 A;  1NHY A;  2GQL A;  3ZYW A;  5KN2 A;  3F3R A;  2O87 A;  1A8Y A;  3FY7 A;  3F8U A;  2NVL A;  2C3N A;  2YWO A;  2AAW A;  1GTB A;  3CSH A;  2IMK A;  3L9U A;  4WBR D;  3WT1 A;  2WGR A;  2LEG A;  1TK5 B;  2B5E A;  2CA8 A;  1FHE A;  5DVB A;  4I5Q A;  1AQV A;  2VLV A;  1B4Q A;  5IMD A;  2GQM A;  4CDO A;  4GQF A;  1E2Y A;  2JAC A;  1PSQ A;  1VF3 A;  4GTU A;  3WGX A;  3KXO A;  2UZ8 A;  1G6Y A;  1RK4 A;  1PN0 A;  2L6D A;  4MF6 A;  2B1K A;  3TKR A;  1DUG A;  11GS A;  3CMI A;  3F0I A;  3RHB A;  2HSH A;  1GSD A;  1SK1 A;  4JRR A;  5G5F A;  5J9B A;  2YJH A;  2R5G A;  4EDZ A;  4KCA A;  5HR0 A;  2JL4 A;  1Q98 A;  2WJU A;  1GSS A;  5CP1 A;  4LA1 A;  2FLS A;  1GH2 A;  2HRN A;  2LUS A;  2C0E A;  1JFU A;  3NOF A;  1T4Y A;  2DJ1 A;  4MH2 A;  2OE0 A;  3CYN A;  2FY6 A;  2YN1 A;  3L4N A;  2N5F A;  1K0D A;  1ZCP A;  1HD2 A;  1ZYE A;  2IMD A;  1QUW A;  3BD2 A;  2H8L A;  5EVO A;  3HDC A;  2GDR A;  2VCW A;  3EMP A;  1Q4J A;  3FK8 A;  4GXZ A;  2WDU A;  4L5L A;  4YH2 A;  3WGD A;  1M0U A;  4TVE A;  3APQ A;  2NDO A;  2DBC A;  3K8N A;  2EIR A;  1O8W A;  3TOT A;  3KD0 A;  5E59 A;  4LL1 B;  1SKS B;  3JCM L;  4F2I A;  5HFG A;  4L0W A;  18GS A;  2K6V A;  1Z7P A;  2WCI A;  4DEJ A;  1HNC A;  3Q18 A;  1M2B A;  3HVV A;  2VLT A;  1CQG A;  4K5S A;  2R3X A;  4EIQ A;  3GKM A;  2CAQ A;  1EEJ A;  3A5I A;  3IK7 A;  1FOV A;  4XS6 A;  3KIJ A;  2H6X A;  2L6C A;  2VCX A;  4LMV A;  2C3Q A;  3UAP A;  3GHA A;  2H0G A;  2YAN A;  3QOU A;  4YQM A;  3UBK A;  5ECO B;  2I9H A;  2IN3 A;  2GSQ A;  5COH A;  4ZL7 A;  4RQX A;  1TU8 A;  1NW2 A;  5ID2 A;  2CZ2 A;  5IIZ A;  2VCV A;  4KDY A;  2PVQ A;  5IPG A;  4KB3 A;  2G0F A;  1GUL A;  2AB6 A;  4MLY A;  3ZFB A;  1TU7 A;  1X9M B;  3ZIJ A;  2C1Y A;  4J56 E;  1ABA A;  1MD3 A;  2C80 A;  3H93 A;  3QFB C;  4YAP A;  1ZYN A;  2VD0 A;  7GSS A;  1V58 A;  2YV7 A;  3UIW A;  1K3O A;  1F3A A;  2VL2 C;  4EIP A;  1J08 A;  1GSQ A;  5GAP D;  2FHE A;  1ILO A;  2BTO T;  1AIU A;  2DKI A;  3TJB A;  3HCZ A;  4ZXG A;  4O7H A;  4N10 A;  1SL2 B;  3HVX A;  2IFQ B;  2V1M A;  3HJM A;  3N5O A;  1TK8 B;  4X4J A;  4FO5 A;  4O5Q A;  2LV3 A;  2HT9 A;  4NPB A;  1UN2 A;  2VM1 A;  4HQZ A;  4HEA 2;  4KH7 A;  2TRX A;  2FUG 2;  3KH7 A;  2MBT A;  3DIE A;  4TR3 A;  4ZBD A;  3VWX A;  4G0I A;  4USS A;  3QR6 A;  3HXS A;  5LNK e;  1YDK A;  2H70 A;  3GL3 A;  4K7N A;  4IP1 A;  1EGO A;  3M8N A;  3U5R E;  1YEP A;  3CTF A;  2HFD A;  1OC9 B;  3KTB A;  3LXT A;  4BA7 A;  1J0F A;  2WFC A;  1XZO A;  4IQA A;  4YQU A;  2G2Q A;  1K0N A;  3KMO A;  5D73 A;  2KUC A;  2VL2 A;  2YZU A;  4EDY A;  1Z6N A;  3LG6 A;  4QL7 A;  3FR3 A;  1GLQ A;  4LLR A;  5ENU A;  4TR1 B;  1SJI A;  3H79 A;  2VOC A;  1H75 A;  3VFI A;  1ERV A;  4ICY A;  1EOG A;  2NTO A;  2TRC P;  1SYR A;  2CX3 A;  4Q5Q A;  1JZW A;  2REM A;  2XBQ A;  5DJL A;  4BVY A;  4CY8 A;  4FYU A;  1GUH A;  4AJ7 A;  1WWJ A;  5C04 A;  5HFI A;  3DWV A;  3GTU B;  1PKZ A;  1V57 A;  1YKC A;  2IL3 A;  3DVX A;  3A5W A;  5A4V A;  5IPH A;  5J41 A;  3L78 A;  1GSF A;  2DIY A;  2MYG A;  2HZE A;  1X9W B;  4TXO A;  3APS A;  2CT6 A;  1K0B A;  3W8S A;  1OYJ A;  2R37 A;  4OO4 A;  3G7I A;  2CVB A;  1EV4 A;  2I3Y A;  3M9K A;  4TR1 A;  4RI6 A;  1PN9 A;  4L5O A;  2HRA A;  3QFA C;  2H1A A;  3VI5 A;  2ZUP A;  4PQ1 A;  1K3Y A;  3ZFL A;  4K8M A;  6GST A;  4QQ7 A;  2YPM A;  1KBN A;  3HA9 A;  1YQ1 A;  3C8E A;  2H19 A;  3FMW A;  3KM6 A;  4YAV A;  3LJR A;  2QKE A;  1N2A A;  5ECN B;  4ZB8 A;  4Q5F A;  2X8G A;  2DKH A;  5AIV A;  3D4M A;  3HYP A;  1GNE A;  3LOR A;  1XXU A;  4POM A;  4KAE A;  1V40 A;  4G19 A;  5A4U A;  1GLP A;  2C0F A;  3UEM A;  2FA8 A;  2FWF A;  1Z7R A;  3KMN A;  3O76 A;  2YOI A;  1RW1 A;  4O32 A;  4TXV A;  1LU4 A;  4AF2 A;  5ECI B;  4TKY A;  1R4W A;  4Z7X A;  5GSS A;  2OA7 A;  4K2X A;  3O3T A;  5A5K A;  2XHF A;  4K2D A;  3ZIT A;  3DML A;  3ERG A;  4D73 B;  2LJK A;  1FAA A;  4MJA A;  3GV1 A;  1OKD A;  3F4T A;  2H76 A;  3HVS A;  1G7E A;  1KTE A;  4BPY A;  3EWL A;  2E0Q A;  2XC2 A;  3GH6 A;  1EOH A;  2CAI A;  1TK0 B;  8GSS A;  2BJX A;  5J9C A;  20GS A;  2I4A A;  3US3 A;  3HZ8 A;  1M3J A;  1XWC A;  1URM A;  1E6B A;  2KHP A;  1XW5 A;  3HD5 A;  4ZL8 A;  3GST A;  3LSZ A;  5LD0 A;  4XRD A;  3IAS 2;  5EPF A;  1K0O A;  1PKW A;  3BCI A;  1M2D A;  1TJD A;  4Q5N A;  1FO5 A;  3EC3 A;  4EF0 A;  2OE3 A;  2HRF A;  3IPZ A;  2R4V A;  1GWC A;  2QA1 A;  4OO5 A;  4XTS A;  3C71 A;  3FYG A;  2H74 A;  5F05 A;  5LCZ A;  3TRQ A;  4G0L A;  4PGT A;  1FG4 A;  4N0Z A;  4D73 A;  3GMF A;  2PU9 C;  3KCM A;  4MZC A;  5FT3 A;  4TRX A;  2GS3 A;  1XCC A;  4IN0 A;  1TTZ A;  3FR9 A;  4FQU A;  3E3E A;  1BAY A;  1UVZ A;  4KDX A;  4PNF A;  3VWU A;  4FIW A;  4QL9 A;  1R5A A;  1S3D A;  3MIX A;  1HNB A;  3OR5 A;  3IE3 A;  2HXK A;  1F37 A;  2MBS A;  1FB6 A;  2VL3 A;  2X4A A;  1F2E A;  3M1G A;  4WF4 A;  3KGK A;  1FB0 A;  3G9B A;  5EL8 A;  4ZL9 A;  2R2J A;  2O85 A;  1UA5 A;  4DSQ A;  2V2G A;  2MMA A;  4ACS A;  1M99 A;  1VF2 A;  9GSS A;  2IPA A;  3LXZ A;  2E2M A;  4GLT A;  4IP6 A;  3GFK A;  3DD3 A;  4RQR A;  1X5C A;  1XVQ A;  1PGT A;  3G7J A;  4EXJ A;  1BG5 A;  1ERW A;  3D0Z A;  1A2L A;  2CQ9 A;  1AQW A;  1GL8 A;  1XWK A;  2HI7 A;  5IMV A;  1AC1 A;  2VUP A;  3RPP A;  3TOU A;  2JZS A;  2MZC A;  1O81 A;  4IVF A;  1BQ7 A;  4I2T A;  2H1G A;  5KN3 A;  4K7O A;  6GSU A;  5KOX A;  2VLU A;  4KW6 A;  4KGI A;  3J7Y k;  1Z3E A;  6GSW A;  2GTU A;  2PUK C;  4ILF A;  1NSW A;  1JZR A;  3GX0 A;  3LEF A;  5DJM A;  5ID2 B;  5F0G A;  1B8X A;  1SU9 A;  3U6V A;  3P2A A;  2CZ3 A;  2K8S A;  2XPE A;  1GSY A;  3GX8 A;  2FNO A;  3ME8 A;  2X49 A;  5DCH A;  4GRF A;  1K3L A;  1ACV A;  2O7K A;  4PXO A;  1TDI A;  4FYC A;  4NHW A;  4ECC A;  5ABR A;  4WEY A;  3LWA A;  3FZA A;  4IKH A;  6GSY A;  1ZL9 A;  4POK A;  2I1U A;  3ZLP A;  5J3R A;  3IOS A;  3KP9 A;  2F51 A;  4HZ4 A;  4JR4 A;  1PL1 A;  1PX7 A;  4F0B A;  3MNG A;  2YWN A;  2YZH A;  4ECI A;  5L71 A;  4HSC X;  4Z2R A;  5AN1 A;  2OAD A;  2ON5 A;  2J23 A;  1XVW A;  4CW9 A;  3BJ5 A;  4WBJ A;  3QAG A;  3DYR A;  3D6I A;  1YJ6 A;  1G0T A;  1H4O A;  2PPT A;  4PUA A;  2C0G A;  2F8F A;  4EC0 A;  4TR0 A;  3MWH A;  5B8B A;  3IRA A;  4KND A;  1SD9 A;  2GQK A;  3IBH A;  4XS4 B;  2EC4 A;  4RUV A;  1GNW A;  1K0A A;  4CHS A;  2N5A A;  1SJZ A;  4HJ2 A;  1SEN A;  3BCK A;  2B3S A;  4OFM A;  2DC5 A;  1W89 A;  5JWO B;  2EIO A;  3LFL A;  4IW9 A;  3D22 A;  4FYB A;  1QGV A;  1A8L A;  1MDK A;  1AW9 A;  1TXX A;  4JBB A;  1XFL A;  3ED3 A;  4HU9 A;  2H6Z A;  1BYE A;  1GUM A;  2QGV A;  2H1D A;  1N8J A;  1EZK A;  4IQ1 A;  1XIY A;  13GS A;  2D2Z A;  3TKQ A;  3DVW A;  3CQF A;  3LQ7 A;  4GQC A;  2GT5 A;  3CBU A;  2DJJ A;  1M3I A;  2X99 A;  2DJ3 A;  4BVY B;  4TN8 A;  3RAZ A;  4FH8 A;  1O6J A;  3GNJ A;  2VIM A;  4MH3 A;  5BRT A;  2GT6 A;  1TRS A;  3L9S A;  3RBT A;  3EU4 A;  5G31 A;  2YWI A;  2IWT A;  5D9W A;  3F9U A;  1VGL A;  1ERU A;  2QA2 A;  4AJ6 A;  2FWE A;  1DE2 A;  2P5Q A;  1U87 A;  4XS4 A;  3PH9 A;  2RM6 A;  5ECQ B;  1XG8 A;  4MDC A;  3DEX A;  2HZE B;  1GP1 A;  2H73 A;  4TXO B;  2H01 A;  3EIN A;  4V1A p;  2JAD A;  3APO A;  3TJK A;  1A2M A;  3C7M A;  2WRT A;  4JR6 A;  3CTG A;  4MK3 A;  5IMC A;  4OCE A;  2CVD A;  1XBS A;  1YZX A;  3NIV A;  4A5P A;  1ON4 A;  3HY2 A;  1FW1 A;  1BX9 A;  3LYP A;  4K5R A;  4K7I A;  5IMA A;  4K0G A;  4IS0 A;  4O5U A;  3ZIV A;  1PX6 A;  2H75 A;  2QC7 A;  5A4W A;  1T00 A;  5CYY A;  1WOU A;  2V6K A;  5J5N A;  2NPB A;  2B5X A;  2L57 A;  2E2G A;  3UMA A;  4F9Z A;  4ULX A;  5H5Q A;  1B4P A;  1XWG A;  19GS A;  4IHU A;  3WT2 A;  4PUF C;  2F3M A;  3PIN A;  4MF7 A;  5CO3 A;  1YEX A;  1VF1 A;  1EEM A;  4NHZ A;  2LQO A;  2C0D A;  4JZQ A;  2FWG A;  2JSY A;  3V1W A;  1X5E A;  22GS A;  4GCI A;  2PVO C;  5FHI A;  1F3B A;  4EVM A;  2IME A;  1HNA A;  1G7O A;  2H72 A;  3GKK A;  1ZYQ B;  3C1R A;  2VO4 A;  5CRE A;  2HYX A;  3O6T A;  10GS A;  2ES7 A;  4MCU A;  4BL7 A;  4I8B A;  3H1N A;  2JU5 A;  4JU5 A;  4ECB A;  4E8E A;  1TP9 A;  4PUR A;  2ALB A;  1WRY A;  4PQI A;  1T7P B;  1R7H A;  4ML1 A;  2P31 A;  2L4Q A;  3W6G A;  3EMX A;  2WB9 A;  1EP8 A;  3TRP A;  5ECL B;  2RM5 A;  3EYT A;  1PFO A;  1BJX A;  2PBJ A;  3IV4 A;  4KF9 A;  3ERF A;  4ZBA A;  1KEB A;  4NV5 A;  2FA4 A;  3CSJ A;  3EE2 A;  1S3R A;  3CSI A;  5G5E A;  5D8I A;  1WE0 A;  1S3A A;  3RPN A;  4I97 A;  4HUA A;  1O7U A;  3FZ4 A;  4V2N A;  1SL1 B;  4H86 A;  2RUE A;  3I9V 2;  4Z2U A;  2DML A;  2L5L A;  5KOW A;  1QQ2 A;  2HZF A;  4KSM A;  2V6O A;  1U6T A;  1TI1 A;  1JHB A;  5CAX A;  1XW6 A;  2PWJ A;  3W8J A;  5DAK B;  1ML6 A;  3QD9 A;  1MD4 A;  2GST A;  3RHC A;  5IQY A;  1PMT A;  1SD8 A;  3ZVJ A;  2NBS A;  2IMI A;  2R0C A;  2L4C A;  1K0M A;  5KEJ A;  4JED A;  5DCG A;  2PER A;  5G30 A;  3TGZ A;  5CRW A;  3I69 A;  3VI7 A;  1O73 A;  3GUS A;  5DBQ A;  5F07 A;  1MDI A;  1XWB A;  3FZ9 A;  2P0G A;  1SL0 B;  2VCQ A;  4EE0 A;  4KE3 A;  4G9H A;  3TJJ A;  4WET A;  1RQM A;  2FGX A;  4LL4 B;  5D9V A;  4AGS A;  2A2S A;  3IDV A;  5ECK B;  2VAF A;  3KZQ A;  1FOH A;  1QK8 A;  4TR4 A;  2ON7 A;  4P3Y B;  3QAV A;  2YV9 A;  1SJ6 A;  1Z5Y E;  1OVN A;  2LNS A;  1F6M C;  1EGR A;  5DAK A;  2VL9 A;  3MDK A;  5EY6 A;  4E8H A;  4N0V A;  1AAZ A;  1V98 A;  5JCG A;  2K18 A;  2JSZ A;  3UAR A;  3A2V A;  4MJC A;  4BWS A;  4X43 A;  2AV4 A;  3ISO A;  5ECM B;  1TOF A;  4TOP A;  3WD6 A;  6GSS A;  3VLN A;  5IOX A;  2MMN A;  1R5P A;  1ZMA A;  3IXR A;  1T3B A;  1ZZY A;  3GH9 A;  1O85 A;  1IYH A;  4OFT A;  3VPT A;  1JLW A;  1OC3 A;  3IHQ A;  1M7T A;  5CRG A;  3D4T A;  4X0X A;  1YY7 A;  2B7K A;  5JWR B; 
#chains in the Genus database with same CATH homology
 4XS1 A;  4G10 A;  2X8H A;  1T8E B;  1I5G A;  3M0F A;  3LYK A;  3BBY A;  2L59 A;  2K8V A;  4NMU A;  2OJL A;  2PN8 A;  3IC8 A;  4WF5 A;  4HQS A;  5FWG A;  1T1V A;  4J2F A;  4V2L A;  4G2E A;  1PD2 1;  5AIS A;  2X8C A;  2CVK A;  4PNG A;  5C00 A;  1BED A;  3NZN A;  4KX4 A;  12GS A;  1PA3 A;  1TRV A;  1J9B A;  1GSE A;  4MAB A;  1TKD B;  3QMX A;  1X9S B;  3R2Q A;  4ECJ A;  3FZ5 A;  5HR2 A;  6GSV A;  4YQV A;  1W4V A;  2QSI A;  5IMF A;  1S3C A;  2AHE A;  4EL1 A;  4MJE A;  1YF1 A;  4GF0 A;  4WR4 A;  1GTA A;  3HJO A;  3QAW A;  3GN3 A;  1SK0 A;  4JE1 A;  5DQS A;  2OE1 A;  4L0U A;  3ZMK A;  4MNN A;  1SKW B;  2F8A A;  5BMU A;  2MMO A;  4OMV A;  2H1B A;  2C4J A;  3IR4 A;  2OBI A;  4WXT A;  2JZR A;  2M72 A;  5AIX A;  5IO0 A;  3WYW A;  4HZ2 A;  3F6D A;  3A3T A;  4V1A g;  2YWM A;  4Z2T A;  2KLX A;  16GS A;  2RUF A;  2DMM A;  3ZZX A;  4DVC A;  2V41 A;  3TJG A;  4RI7 A;  2GZY A;  5G2Z A;  2HE3 A;  2IJY A;  1HYU A;  3FKF A;  3FW2 A;  2B1L A;  3I43 A;  3KEB A;  5F06 A;  3MYD A;  1IYI A;  4WR5 A;  2LST A;  2AYT A;  4EUY A;  2E7P A;  1WMJ A;  1YF0 A;  2B7J A;  3IC4 A;  2LKU A;  3E9J B;  2H0I A;  4IJI A;  4HU7 A;  4KUN A;  2AJQ B;  4DSR A;  5ECH B;  4HJM A;  4N30 A;  3PPU A;  4IEL A;  4J57 E;  4NAX A;  2F9S A;  2R0G A;  5B8A A;  3KH9 A;  3FRC A;  1QMV A;  1PQN A;  2A2P A;  5B6N A;  3TUE A;  2ZNM A;  1V2A A;  3FEU A;  5GST A;  3ME7 A;  1THX A;  2FD3 A;  4K6X A;  2A4H A;  5H5S A;  1FVK A;  1GUK A;  4EO3 A;  3P7X A;  3F3Q A;  3ZTL A;  4MP4 A;  1X5D A;  3VWV A;  3PGT A;  3TKS E;  3TCO A;  3QPM A;  1V9W A;  3CXG A;  2H6Y A;  17GS A;  5G1L A;  2H66 A;  3IHG A;  4GSN A;  2WZ9 A;  1PRX A;  2B5Y A;  4N11 A;  1NHO A;  4OCF A;  4TW5 A;  4ID0 A;  5KN1 A;  1A24 A;  5ELA A;  3ZRD A;  2V32 A;  1XOA A;  4K1F A;  2GLR A;  1ZGN A;  1U3A A;  3H8Q A;  3J7Y b;  5D93 A;  5GAN D;  3VWW A;  4MJB A;  1MTC A;  3F4S A;  1GTI A;  4WKW A;  3EPT A;  4GST A;  4O92 A;  2DJ0 A;  3A2X A;  3C1S A;  1EWX A;  3ZL5 A;  4KA0 A;  5B6M A;  2XPD A;  1NM3 A;  1QXH A;  4DSS B;  5JCU A;  2L5O A;  5GZZ B;  3IK9 A;  3L9V A;  2O89 A;  4Q5R A;  3MSZ A;  2C3T A;  4MMM A;  4AJ8 A;  3ERW A;  4ML6 A;  2O8V B;  4GWR A;  1USB A;  2J9H A;  3EUR A;  2OAC A;  3HHV A;  2FCH A;  3D21 A;  2VCZ A;  2X64 A;  4KSO A;  4F82 A;  1JZD A;  2MMZ A;  5IOW A;  1F9M A;  1C72 A;  2ZCT A;  2R0P A;  2CV4 A;  5ECS A;  1TI3 A;  1THO A;  1TRW A;  2XBI A;  3FHK A;  3F4R A;  3KJY A;  3IAM 2;  2GGT A;  1CQH A;  4NWY A;  3N9J A;  2LTK A;  2PMT A;  4XRA A;  3VPQ A;  3Q19 A;  1Y25 A;  2LS5 A;  5H5R A;  4BL7 B;  1WJK A;  1JLV A;  2YJ7 A;  2LJR A;  4I2U A;  5B7C A;  3KTL A;  2CX4 A;  4ZB9 A;  4PX1 A;  2FWH A;  1I9D A;  1DBY A;  3HJP A;  4YKF A;  1M2A A;  3BOA A;  3DRN A;  4ZB6 A;  1ZYP A;  2H71 A;  3DGQ A;  4DSS A;  3A2W A;  5DQY A;  4O5R A;  1VF4 A;  1HQO A;  2Z9S A;  4X1U A;  1ST9 A;  2GSS A;  4G0K A;  2OKA A;  3ZVJ D;  5CRH A;  3QDN A;  2P5R A;  2YCD A;  2R6K A;  3HZ4 A;  3HKR A;  2WUL A;  1OE7 A;  3H4K A;  5JCW A;  5IO2 A;  3CRT A;  3LGC A;  5ECR B;  2GVP A;  3GKN A;  2IFQ A;  3VUR A;  2YP6 A;  5ELG A;  2GZP A;  1SK2 A;  2DJ2 A;  2HLS A;  1PL2 A;  3GSS A;  1SKR B;  4ISD A;  1TRU A;  3UBL A;  1K0C A;  1AUC A;  5DAL B;  4PQH A;  2OBK A;  3G7Y A;  4OD7 A;  3TJF A;  5F8B A;  4MPG A;  2K9F A;  4IBP A;  1XW9 A;  3UJ1 A;  2HRK A;  4HOJ A;  2VM2 A;  3I6A A;  4PTS A;  3F63 A;  3DXB A;  3P8W A;  3F6F A;  1OC9 A;  3GA4 A;  2RII A;  4POB A;  4I6X A;  3FR6 A;  4LMW A;  2M80 A;  3SWL A;  1EV9 A;  1OAZ A;  1T4Z A;  3WGE A;  5IM9 A;  2DLX A;  1DE1 A;  3ZML A;  3TKS C;  3KP8 A;  3P90 A;  1GTU A;  3E0U A;  5D9X A;  5DDL A;  1G6W A;  2B6M A;  4OFN A;  4MPF A;  2PGT A;  2M46 A;  2VD1 A;  3C73 A;  2KOK A;  2I81 A;  3QCP A;  2GZZ A;  3UOM A;  1U88 A;  1ZOF A;  1WPI A;  3R3E A;  2C8U A;  1GSU A;  5INY A;  5DAL A;  4ZIL A;  4MF5 A;  3UVT A;  2HSM A;  1XPV A;  2KP2 A;  3GYK A;  4BVX B;  3PR8 A;  3GTU A;  1B9X C;  3VK9 A;  4YKG A;  1XOB A;  3TDG A;  4BWQ A;  3IA1 A;  4V2M A;  2HNL A;  4KCE A;  3UL3 A;  5HFK A;  1LJR A;  1AQX A;  1M9A A;  4XIH A;  1X0R A;  5HR1 A;  1Z9H A;  1LBK A;  2LQQ A;  4K0N A;  14GS A;  1A0F A;  4ZIJ A;  4EKZ A;  5G1K A;  1FVJ A;  2N5B A;  2LNT A;  4GSS A;  3TKS A;  1R26 A;  5JWQ B;  3EVI A;  6GSX A;  5CNW A;  2H0H A;  3TB2 A;  4CY6 A;  4L8E A;  2DSA A;  1DSB A;  4MA9 A;  5HQP A;  3MAK A;  2YNX A;  1QFN A;  4XHM A;  1SYX A;  2WS2 A;  4KDU A;  1OC8 A;  3TKP A;  3GIX A;  1YKA A;  5HR3 A;  1M9B A;  1WP0 A;  4HI7 A;  3CRU A;  1JZO A;  1XWA A;  1ERT A;  1A23 A;  4MZW A;  5D9T A;  5IMZ A;  4BVX A;  1MDJ A;  3Q74 A;  2LRT A;  1OKT A;  3RDW A;  2DIZ A;  4MZB A;  1Z6M A;  3Q6O A;  3D5J A;  2AUV A;  4XCS A;  2DJK A;  4F0C A;  5J4U A;  2H30 A;  4NV2 A;  2TIR A;  4HS1 A;  1UC7 A;  2RLI A;  2KP1 A;  3AY8 A;  3GKX A;  1O8X A;  1OE8 A;  4NXI A;  3GUR A;  1U3I A;  5E4W A;  1KNG A;  3DKS A;  2VCT A;  2A4V A;  4POL A;  1A0R P;  3SBC A;  1GRX A;  2A2R A;  2BMX A;  1TW9 A;  1WIK A;  1B48 A;  3M9J A;  3S9F A;  1B9Y C;  5AGY A;  2EIQ A;  3L0H A;  1VRS D;  4OWY A;  2IIY A;  1EP7 A;  2JZT A;  1MEK A;  3M3M A;  4IJ3 A;  3UVH A;  4ZBB A;  3TRX A;  2GSR A;  5CRD A;  1A2J A;  1Y6E A;  4IGJ A;  2LRN A;  2HSY A;  2LRC A;  5D96 A;  3GL5 A;  3LW9 A;  3GRX A;  5ECP B;  5KN0 A;  4K9Z A;  2LJA A;  3ZRE A;  4HDE A;  2IMF A;  1AXD A;  3EU3 A;  4F03 A;  1NHY A;  2GQL A;  3ZYW A;  5KN2 A;  3F3R A;  2O87 A;  1A8Y A;  3FY7 A;  3F8U A;  2NVL A;  2C3N A;  2YWO A;  2AAW A;  1GTB A;  3CSH A;  2IMK A;  3L9U A;  4WBR D;  3WT1 A;  2WGR A;  2LEG A;  1TK5 B;  2B5E A;  2CA8 A;  1FHE A;  5DVB A;  4I5Q A;  1AQV A;  2VLV A;  1B4Q A;  5IMD A;  2GQM A;  4CDO A;  4GQF A;  1E2Y A;  2JAC A;  1PSQ A;  1VF3 A;  4GTU A;  3WGX A;  3KXO A;  2UZ8 A;  1G6Y A;  1RK4 A;  1PN0 A;  2L6D A;  4MF6 A;  2B1K A;  3TKR A;  1DUG A;  11GS A;  3CMI A;  3F0I A;  3RHB A;  2HSH A;  1GSD A;  1SK1 A;  4JRR A;  5G5F A;  5J9B A;  2YJH A;  2R5G A;  4EDZ A;  4KCA A;  5HR0 A;  2JL4 A;  1Q98 A;  2WJU A;  1GSS A;  5CP1 A;  4LA1 A;  2FLS A;  1GH2 A;  2HRN A;  2LUS A;  2C0E A;  1JFU A;  3NOF A;  1T4Y A;  2DJ1 A;  4MH2 A;  2OE0 A;  3CYN A;  2FY6 A;  2YN1 A;  3L4N A;  2N5F A;  1K0D A;  1ZCP A;  1HD2 A;  1ZYE A;  2IMD A;  1QUW A;  3BD2 A;  2H8L A;  5EVO A;  3HDC A;  2GDR A;  2VCW A;  3EMP A;  1Q4J A;  3FK8 A;  4GXZ A;  2WDU A;  4L5L A;  4YH2 A;  3WGD A;  1M0U A;  4TVE A;  3APQ A;  2NDO A;  2DBC A;  3K8N A;  2EIR A;  1O8W A;  3TOT A;  3KD0 A;  5E59 A;  4LL1 B;  1SKS B;  3JCM L;  4F2I A;  5HFG A;  4L0W A;  18GS A;  2K6V A;  1Z7P A;  2WCI A;  4DEJ A;  1HNC A;  3Q18 A;  1M2B A;  3HVV A;  2VLT A;  1CQG A;  4K5S A;  2R3X A;  4EIQ A;  3GKM A;  2CAQ A;  1EEJ A;  3A5I A;  3IK7 A;  1FOV A;  4XS6 A;  3KIJ A;  2H6X A;  2L6C A;  2VCX A;  4LMV A;  2C3Q A;  3UAP A;  3GHA A;  2H0G A;  2YAN A;  3QOU A;  4YQM A;  3UBK A;  5ECO B;  2I9H A;  2IN3 A;  2GSQ A;  5COH A;  4ZL7 A;  4RQX A;  1TU8 A;  1NW2 A;  5ID2 A;  2CZ2 A;  5IIZ A;  2VCV A;  4KDY A;  2PVQ A;  5IPG A;  4KB3 A;  2G0F A;  1GUL A;  2AB6 A;  4MLY A;  3ZFB A;  1TU7 A;  1X9M B;  3ZIJ A;  2C1Y A;  4J56 E;  1ABA A;  1MD3 A;  2C80 A;  3H93 A;  3QFB C;  4YAP A;  1ZYN A;  2VD0 A;  7GSS A;  1V58 A;  2YV7 A;  3UIW A;  1K3O A;  1F3A A;  2VL2 C;  4EIP A;  1J08 A;  1GSQ A;  5GAP D;  2FHE A;  1ILO A;  2BTO T;  1AIU A;  2DKI A;  3TJB A;  3HCZ A;  4ZXG A;  4O7H A;  4N10 A;  1SL2 B;  3HVX A;  2IFQ B;  2V1M A;  3HJM A;  3N5O A;  1TK8 B;  4X4J A;  4FO5 A;  4O5Q A;  2LV3 A;  2HT9 A;  4NPB A;  1UN2 A;  2VM1 A;  4HQZ A;  4HEA 2;  4KH7 A;  2TRX A;  2FUG 2;  3KH7 A;  2MBT A;  3DIE A;  4TR3 A;  4ZBD A;  3VWX A;  4G0I A;  4USS A;  3QR6 A;  3HXS A;  5LNK e;  1YDK A;  2H70 A;  3GL3 A;  4K7N A;  4IP1 A;  1EGO A;  3M8N A;  3U5R E;  1YEP A;  3CTF A;  2HFD A;  1OC9 B;  3KTB A;  3LXT A;  4BA7 A;  1J0F A;  2WFC A;  1XZO A;  4IQA A;  4YQU A;  2G2Q A;  1K0N A;  3KMO A;  5D73 A;  2KUC A;  2VL2 A;  2YZU A;  4EDY A;  1Z6N A;  3LG6 A;  4QL7 A;  3FR3 A;  1GLQ A;  4LLR A;  5ENU A;  4TR1 B;  1SJI A;  3H79 A;  2VOC A;  1H75 A;  3VFI A;  1ERV A;  4ICY A;  1EOG A;  2NTO A;  2TRC P;  1SYR A;  2CX3 A;  4Q5Q A;  1JZW A;  2REM A;  2XBQ A;  5DJL A;  4BVY A;  4CY8 A;  4FYU A;  1GUH A;  4AJ7 A;  1WWJ A;  5C04 A;  5HFI A;  3DWV A;  3GTU B;  1PKZ A;  1V57 A;  1YKC A;  2IL3 A;  3DVX A;  3A5W A;  5A4V A;  5IPH A;  5J41 A;  3L78 A;  1GSF A;  2DIY A;  2MYG A;  2HZE A;  1X9W B;  4TXO A;  3APS A;  2CT6 A;  1K0B A;  3W8S A;  1OYJ A;  2R37 A;  4OO4 A;  3G7I A;  2CVB A;  1EV4 A;  2I3Y A;  3M9K A;  4TR1 A;  4RI6 A;  1PN9 A;  4L5O A;  2HRA A;  3QFA C;  2H1A A;  3VI5 A;  2ZUP A;  4PQ1 A;  1K3Y A;  3ZFL A;  4K8M A;  6GST A;  4QQ7 A;  2YPM A;  1KBN A;  3HA9 A;  1YQ1 A;  3C8E A;  2H19 A;  3FMW A;  3KM6 A;  4YAV A;  3LJR A;  2QKE A;  1N2A A;  5ECN B;  4ZB8 A;  4Q5F A;  2X8G A;  2DKH A;  5AIV A;  3D4M A;  3HYP A;  1GNE A;  3LOR A;  1XXU A;  4POM A;  4KAE A;  1V40 A;  4G19 A;  5A4U A;  1GLP A;  2C0F A;  3UEM A;  2FA8 A;  2FWF A;  1Z7R A;  3KMN A;  3O76 A;  2YOI A;  1RW1 A;  4O32 A;  4TXV A;  1LU4 A;  4AF2 A;  5ECI B;  4TKY A;  1R4W A;  4Z7X A;  5GSS A;  2OA7 A;  4K2X A;  3O3T A;  5A5K A;  2XHF A;  4K2D A;  3ZIT A;  3DML A;  3ERG A;  4D73 B;  2LJK A;  1FAA A;  4MJA A;  3GV1 A;  1OKD A;  3F4T A;  2H76 A;  3HVS A;  1G7E A;  1KTE A;  4BPY A;  3EWL A;  2E0Q A;  2XC2 A;  3GH6 A;  1EOH A;  2CAI A;  1TK0 B;  8GSS A;  2BJX A;  5J9C A;  20GS A;  2I4A A;  3US3 A;  3HZ8 A;  1XWC A;  1URM A;  1E6B A;  2KHP A;  1XW5 A;  3HD5 A;  4ZL8 A;  3GST A;  3LSZ A;  5LD0 A;  4XRD A;  3IAS 2;  5EPF A;  1K0O A;  1PKW A;  3BCI A;  1M2D A;  1TJD A;  4Q5N A;  1FO5 A;  3EC3 A;  4EF0 A;  2OE3 A;  2HRF A;  3IPZ A;  2R4V A;  1GWC A;  2QA1 A;  4OO5 A;  4XTS A;  3C71 A;  3FYG A;  2H74 A;  5F05 A;  5LCZ A;  3TRQ A;  4G0L A;  4PGT A;  1FG4 A;  4N0Z A;  4D73 A;  3GMF A;  2PU9 C;  3KCM A;  4MZC A;  5FT3 A;  4TRX A;  2GS3 A;  1XCC A;  4IN0 A;  1TTZ A;  3FR9 A;  4FQU A;  3E3E A;  1BAY A;  1UVZ A;  4KDX A;  4PNF A;  3VWU A;  4FIW A;  4QL9 A;  1R5A A;  1S3D A;  3MIX A;  1HNB A;  3OR5 A;  3IE3 A;  2HXK A;  1F37 A;  2MBS A;  1FB6 A;  2VL3 A;  2X4A A;  1F2E A;  3M1G A;  4WF4 A;  3KGK A;  1FB0 A;  3G9B A;  5EL8 A;  4ZL9 A;  2R2J A;  2O85 A;  1UA5 A;  4DSQ A;  2V2G A;  2MMA A;  4ACS A;  1M99 A;  1VF2 A;  9GSS A;  2IPA A;  3LXZ A;  2E2M A;  4GLT A;  4IP6 A;  3GFK A;  3DD3 A;  4RQR A;  1X5C A;  1XVQ A;  1PGT A;  3G7J A;  4EXJ A;  1BG5 A;  1ERW A;  3D0Z A;  1A2L A;  2CQ9 A;  1AQW A;  1GL8 A;  1XWK A;  2HI7 A;  5IMV A;  1AC1 A;  2VUP A;  3RPP A;  3TOU A;  2JZS A;  2MZC A;  1O81 A;  4IVF A;  1BQ7 A;  4I2T A;  2H1G A;  5KN3 A;  4K7O A;  6GSU A;  5KOX A;  2VLU A;  4KW6 A;  4KGI A;  3J7Y k;  1Z3E A;  6GSW A;  2GTU A;  2PUK C;  4ILF A;  1NSW A;  1JZR A;  3GX0 A;  3LEF A;  5DJM A;  5ID2 B;  5F0G A;  1B8X A;  1SU9 A;  3U6V A;  3P2A A;  2CZ3 A;  2K8S A;  2XPE A;  1GSY A;  3GX8 A;  2FNO A;  3ME8 A;  2X49 A;  5DCH A;  4GRF A;  1K3L A;  1ACV A;  2O7K A;  4PXO A;  1TDI A;  4FYC A;  4NHW A;  4ECC A;  5ABR A;  4WEY A;  3LWA A;  3FZA A;  4IKH A;  6GSY A;  1ZL9 A;  4POK A;  2I1U A;  3ZLP A;  5J3R A;  3IOS A;  3KP9 A;  2F51 A;  4HZ4 A;  4JR4 A;  1PL1 A;  1PX7 A;  4F0B A;  3MNG A;  2YWN A;  2YZH A;  4ECI A;  5L71 A;  4Z2R A;  5AN1 A;  2OAD A;  2ON5 A;  2J23 A;  1XVW A;  4CW9 A;  3BJ5 A;  4WBJ A;  3QAG A;  3DYR A;  3D6I A;  1YJ6 A;  1G0T A;  1H4O A;  2PPT A;  4PUA A;  2C0G A;  2F8F A;  4EC0 A;  4TR0 A;  3MWH A;  5B8B A;  3IRA A;  4KND A;  1SD9 A;  2GQK A;  3IBH A;  4XS4 B;  2EC4 A;  4RUV A;  1GNW A;  1K0A A;  4CHS A;  2N5A A;  1SJZ A;  4HJ2 A;  1SEN A;  3BCK A;  2B3S A;  4OFM A;  2DC5 A;  1W89 A;  5JWO B;  2EIO A;  3LFL A;  4IW9 A;  3D22 A;  4FYB A;  1QGV A;  1A8L A;  1MDK A;  1AW9 A;  1TXX A;  4JBB A;  1XFL A;  3ED3 A;  4HU9 A;  2H6Z A;  1BYE A;  1GUM A;  2QGV A;  2H1D A;  1N8J A;  1EZK A;  4IQ1 A;  1XIY A;  13GS A;  2D2Z A;  3TKQ A;  3DVW A;  3LQ7 A;  4GQC A;  2GT5 A;  3CBU A;  2DJJ A;  2X99 A;  2DJ3 A;  4BVY B;  4TN8 A;  3RAZ A;  4FH8 A;  1O6J A;  3GNJ A;  2VIM A;  4MH3 A;  5BRT A;  2GT6 A;  1TRS A;  3L9S A;  3RBT A;  3EU4 A;  5G31 A;  2YWI A;  2IWT A;  5D9W A;  3F9U A;  1VGL A;  1ERU A;  2QA2 A;  4AJ6 A;  2FWE A;  1DE2 A;  2P5Q A;  1U87 A;  4XS4 A;  3PH9 A;  2RM6 A;  5ECQ B;  4MDC A;  3DEX A;  2HZE B;  1GP1 A;  2H73 A;  4TXO B;  2H01 A;  3EIN A;  4V1A p;  2JAD A;  3APO A;  3TJK A;  1A2M A;  3C7M A;  2WRT A;  4JR6 A;  3CTG A;  4MK3 A;  5IMC A;  4OCE A;  2CVD A;  1XBS A;  1YZX A;  3NIV A;  4A5P A;  1ON4 A;  3HY2 A;  1FW1 A;  1BX9 A;  3LYP A;  4K5R A;  4K7I A;  5IMA A;  4K0G A;  4IS0 A;  4O5U A;  3ZIV A;  1PX6 A;  2H75 A;  2QC7 A;  5A4W A;  1T00 A;  5CYY A;  1WOU A;  2V6K A;  5J5N A;  2NPB A;  2B5X A;  2L57 A;  2E2G A;  3UMA A;  4F9Z A;  4ULX A;  5H5Q A;  1B4P A;  1XWG A;  19GS A;  4IHU A;  3WT2 A;  4PUF C;  2F3M A;  3PIN A;  4MF7 A;  5CO3 A;  1YEX A;  1VF1 A;  1EEM A;  4NHZ A;  2LQO A;  2C0D A;  4JZQ A;  2FWG A;  2JSY A;  3V1W A;  1X5E A;  22GS A;  4GCI A;  2PVO C;  5FHI A;  1F3B A;  4EVM A;  2IME A;  1HNA A;  1G7O A;  2H72 A;  3GKK A;  1ZYQ B;  3C1R A;  2VO4 A;  5CRE A;  2HYX A;  3O6T A;  10GS A;  2ES7 A;  4MCU A;  4BL7 A;  4I8B A;  3H1N A;  2JU5 A;  4JU5 A;  4ECB A;  4E8E A;  1TP9 A;  4PUR A;  2ALB A;  1WRY A;  4PQI A;  1T7P B;  1R7H A;  4ML1 A;  2P31 A;  2L4Q A;  3W6G A;  3EMX A;  2WB9 A;  1EP8 A;  3TRP A;  5ECL B;  2RM5 A;  3EYT A;  1BJX A;  2PBJ A;  3IV4 A;  4KF9 A;  3ERF A;  4ZBA A;  1KEB A;  4NV5 A;  2FA4 A;  3CSJ A;  3EE2 A;  3CSI A;  5G5E A;  5D8I A;  1WE0 A;  1S3A A;  3RPN A;  4I97 A;  4HUA A;  1O7U A;  3FZ4 A;  4V2N A;  1SL1 B;  4H86 A;  2RUE A;  3I9V 2;  4Z2U A;  2DML A;  2L5L A;  5KOW A;  1QQ2 A;  2HZF A;  4KSM A;  2V6O A;  1U6T A;  1TI1 A;  1JHB A;  5CAX A;  1XW6 A;  2PWJ A;  3W8J A;  5DAK B;  1ML6 A;  3QD9 A;  1MD4 A;  2GST A;  3RHC A;  5IQY A;  1PMT A;  1SD8 A;  3ZVJ A;  2NBS A;  2IMI A;  2R0C A;  2L4C A;  1K0M A;  5KEJ A;  4JED A;  5DCG A;  2PER A;  5G30 A;  3TGZ A;  5CRW A;  3I69 A;  3VI7 A;  1O73 A;  3GUS A;  5DBQ A;  5F07 A;  1MDI A;  1XWB A;  3FZ9 A;  2P0G A;  1SL0 B;  2VCQ A;  4EE0 A;  4KE3 A;  4G9H A;  3TJJ A;  4WET A;  1RQM A;  2FGX A;  4LL4 B;  5D9V A;  4AGS A;  2A2S A;  3IDV A;  5ECK B;  2VAF A;  3KZQ A;  1FOH A;  1QK8 A;  4TR4 A;  2ON7 A;  4P3Y B;  3QAV A;  2YV9 A;  1SJ6 A;  1Z5Y E;  1OVN A;  2LNS A;  1F6M C;  1EGR A;  5DAK A;  2VL9 A;  3MDK A;  5EY6 A;  4E8H A;  4N0V A;  1AAZ A;  1V98 A;  5JCG A;  2K18 A;  2JSZ A;  3UAR A;  3A2V A;  4MJC A;  4BWS A;  4X43 A;  2AV4 A;  3ISO A;  5ECM B;  1TOF A;  4TOP A;  3WD6 A;  6GSS A;  3VLN A;  5IOX A;  2MMN A;  1R5P A;  1ZMA A;  3IXR A;  1T3B A;  1ZZY A;  3GH9 A;  1O85 A;  1IYH A;  4OFT A;  3VPT A;  1JLW A;  1OC3 A;  3IHQ A;  1M7T A;  5CRG A;  3D4T A;  4X0X A;  1YY7 A;  2B7K A;  5JWR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...