2CX3A

Crystal structure of a bacterioferritin comigratory protein peroxiredoxin from the aeropyrum pernix k1 (form-1 crystal)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
160
structure length
160
Chain Sequence
LVELGEKAPDFTLPNQDFEPVNLYEVLKRGRPAVLIFFPAAFSPVCTKELCTFRDKMAQLEKANAEVLAISVDSPWCLKKFKDENRLAFNLLSDYNREVIKLYNVYHEDLKGLKMVAKRAVFIVKPDGTVAYKWVTDNPLNEPDYDEVVREANKIAGELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords bacterioferritin comigratory protein
publication title Crystal structure of a bacterioferritin comigratory protein peroxiredoxin from the Aeropyrum pernix K1 (form-1 crystal)
rcsb
source organism Aeropyrum pernix
molecule tags Oxidoreductase
total genus 42
structure length 160
sequence length 160
chains with identical sequence B, C, D
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2cx3A00
4ML6A 4LMVA 5FHIA 4GXZA 4HI7A 5GSTA 4N30A 3VWXA 4K7NA 1K3YA 2PVOC 2VLUA 4NMUA 1GRXA 3M9JA 4HJ2A 3GIXA 4NHWA 5B6NA 4KH7A 1ZMAA 3KP8A 4P3YB 3UBLA 2MZCA 1A2JA 1X9SB 4GSNA 2H19A 3GX8A 3GA4A 3F4TA 4MZWA 4ACSA 1UC7A 3TJKA 2DIZA 4ECIA 3G7IA 1EP7A 4L0WA 1THOA 1K3OA 3APSA 1X5CA 1FOVA 6GSSA 5D93A 3QMXA 3ZTLA 2YOIA 4AJ6A 1PX6A 3PINA 1PA3A 3VWVA 3GSSA 5EY6A 3GURA 2JZRA 4OWYA 3D6IA 1GUKA 4I8BA 3GH9A 1YJ6A 2E2MA 3L0HA 1QGVA 3RPPA 2F9SA 2X64A 2X8HA 1O73A 1EOHA 3ZYWA 4ECJA 4IKHA 3UVHA 1Z5YE 4IVFA 2EC4A 3TKSC 3LYKA 2PN8A 3TGZA 2B5XA 1SKRB 2DMLA 1M9AA 4ZBBA 4HU7A 2XHFA 1HQOA 1MD3A 2JZTA 1PL1A 3CTGA 1X9MB 2V2GA 1GH2A 4EXJA 5IPHA 1DE1A 3LFLA 5AIVA 5C04A 2QKEA 2BTOT 1GLQA 1QMVA 4IGJA 1G7EA 3GN3A 2PU9C 2VCWA 2H01A 3HCZA 3NIVA 5F05A 5J41A 1BJXA 1ERUA 1TU7A 2L4QA 2VLTA 3VI5A 2WS2A 2P5RA 4J2FA 4MP4A 4JRRA 5IQYA 4TN8A 3C73A 1K0CA 4IN0A 5E4WA 2LRCA 3FR9A 4YAPA 1EV9A 1ON4A 3HDCA 1Y6EA 5G30A 2A2RA 1S3CA 3GUSA 4Z7XA 1Z3EA 5KEJA 5DCGA 3HKRA 4X0XA 1EOGA 1B48A 4KAEA 4IS0A 4V1Ag 2NVLA 4FYBA 1PD21 4NV5A 2PVQA 3TRQA 5J9BA 2WULA 5CO3A 1JHBA 1VF2A 3ZVJA 3GFKA 3A3TA 1SKSB 1WWJA 5ELGA 2IIYA 2DC5A 2GS3A 2YZUA 1OE8A 2B1LA 5LCZA 4WKWA 2PPTA 4V2LA 1M2BA 1T3BA 4PXOA 3S9FA 1YKAA 2C0GA 3NZNA 4EVMA 1N8JA 4L0UA 4MK3A 1SJZA 5EVOA 2JU5A 2CA8A 4H86A 5IOWA 1UA5A 1X0RA 7GSSA 2FUG2 4JU5A 6GSUA 5LNKe 2X8CA 4WBRD 3GKMA 4I2UA 2GSRA 5F0GA 5A4UA 4K8MA 3A2XA 3TOTA 2RM5A 3G7JA 2GGTA 3H1NA 2G0FA 2PERA 1ERVA 2IJYA 5IO2A 3LXTA 3GYKA 1USBA 1ACVA 4PURA 2YP6A 1HNCA 1A8YA 4KSOA 3BD2A 4GRFA 4F03A 3TRPA 1XWAA 4K6XA 2H1DA 5CYYA 2RUFA 10GSA 1O6JA 5H5SA 3ME7A 4ISDA 2EIQA 1PRXA 3I9V2 4G9HA 3I6AA 3E9JB 2AUVA 4NWYA 1THXA 5LD0A 3EYTA 1F3AA 2FHEA 2CT6A 1GTBA 2JZSA 2WRTA 3ZMLA 4TXOB 1BEDA 3D4MA 3F3RA 1GTUA 2GDRA 5ECRB 3GV1A 3IE3A 5D9WA 4N0ZA 2C4JA 1K0DA 1A2LA 4G10A 1GUHA 2B1KA 3P2AA 3VURA 3IAM2 1XWKA 3C71A 1LBKA 5J4UA 3WGXA 5J5NA 3HXSA 2FA8A 1K0OA 1Z7PA 3CSJA 1RK4A 1LJRA 4CW9A 4MZBA 3DVWA 4ULXA 8GSSA 2VCTA 1M99A 4EUYA 5ECNB 1S3AA 1TDIA 3TJBA 4DSQA 3KH9A 2VIMA 1SU9A 2K8VA 1OAZA 4RUVA 1R26A 4IJ3A 12GSA 2OE1A 1V40A 2OACA 1NHYA 1ILOA 4ZXGA 2H0IA 2ON5A 3FK8A 2H30A 4OMVA 2X8GA 3L4NA 3ERGA 1T00A 1ABAA 1K0NA 3GMFA 2ZNMA 5JWOB 2HZFA 3FZ9A 5AIXA 2K8SA 4OCFA 1OC3A 1EGOA 3CMIA 3KZQA 4G19A 4HZ2A 5JCWA 5HQPA 1M2DA 4HS1A 4EF0A 3TOUA 1B4PA 5ABRA 2NDOA 2GQKA 1ZYEA 2WDUA 2C80A 1O7UA 1SJ6A 2TIRA 5DVBA 4BL7A 3TUEA 2JSYA 2L5OA 3NOFA 2YZHA 2V6OA 3UBKA 3GX0A 2WFCA 4MCUA 3HA9A 1AW9A 1WE0A 2A2SA 2M72A 1XXUA 2L6DA 2H1AA 2QSIA 4PQIA 3F4SA 3ZZXA 5ENUA 1GSFA 3SBCA 3APQA 4OFNA 5GAND 2LJRA 4TVEA 3IPZA 4BVXA 1R4WA 3ZVJD 2OA7A 1A24A 1R5AA 3EWLA 1GSUA 2H1GA 3F6DA 3RHBA 4DVCA 1TI3A 1FHEA 2VL9A 5D9VA 4TXOA 2B5YA 1XFLA 4HDEA 4TXVA 4TR0A 5A4VA 2H70A 5FT3A 4KGIA 5E59A 2V1MA 2B6MA 3PR8A 3F8UA 1OC9A 5ECOB 9GSSA 2L6CA 1HYUA 5DJMA 1A2MA 3HZ4A 1WIKA 2MYGA 1OVNA 5G1LA 3DGQA 3GRXA 4N11A 4WEYA 2YJHA 3BOAA 2O7KA 1JZRA 2OJLA 1A8LA 3CBUA 2I4AA 1E2YA 3IBHA 3FEUA 2LEGA 3A2VA 4POKA 2L57A 4IP1A 2MBSA 4QL7A 4DSSB 3N5OA 4WF5A 5DALB 3QDNA 1PX7A 1XOBA 2FWGA 4BA7A 5CREA 5EPFA 1R7HA 20GSA 2IMKA 2H6ZA 3HVVA 2GZYA 2LV3A 3FZ4A 3EU4A 1U3AA 1J0FA 5JCGA 2V32A 1EP8A 3Q18A 1W4VA 2QGVA 1Y25A 1UVZA 3BJ5A 4I2TA 4K9ZA 3WGDA 1V2AA 1PKWA 5CRHA 1NW2A 2D2ZA 4ZILA 3H8QA 4BWSA 1T7PB 3LYPA 3ED3A 4YQVA 1X5EA 3DMLA 4XIHA 3D21A 4RI7A 1PMTA 4LLRA 2HNLA 4GSTA 4DEJA 1WMJA 2DLXA 3KM6A 1M2AA 3D22A 2MMOA 1XW6A 2I3YA 4CDOA 2JL4A 5F06A 4RQRA 1PSQA 2R5GA 4POMA 3G7YA 3U5RE 3IK7A 3HJPA 2YWIA 3C1SA 3UIWA 1N2AA 3P90A 2VCXA 2JACA 2WJUA 1ML6A 2RUEA 2AHEA 3VLNA 5EL8A 3UARA 5KN2A 4WXTA 1VF4A 2WCIA 4BWQA 1SD8A 2H74A 3DRNA 3F0IA 4MJCA 3F9UA 6GSWA 1GNWA 2B7JA 1K0MA 1E6BA 2R6KA 3ZRDA 3DXBA 5ECKB 1FO5A 1OC8A 1TW9A 4OD7A 1TK0B 3QPMA 1AQVA 2LRTA 5ECSA 5CAXA 2HI7A 1F6MC 2F3MA 3W8JA 2ES7A 1ZGNA 2PMTA 1AC1A 4MF7A 3EE2A 3RBTA 3CSHA 2FA4A 5G2ZA 1JZOA 2CX3A 3ZMKA 1XW5A 4TW5A 3D5JA 4WBJA 2YWMA 1JZWA 3LQ7A 1X9WB 1SKWB 2B7KA 4KNDA 4WR5A 1ST9A 1FAAA 3KMOA 3WT2A 1XVWA 4WETA 3GL5A 3I43A 1MD4A 2FCHA 2GSQA 4MPFA 3Q74A 2OBIA 4J56E 1YEPA 2HE3A 3ZFLA 1V9WA 2AB6A 4DSSA 1SK1A 2ZCTA 4JR4A 3ZLPA 2A4VA 5DALA 5H5RA 1HNBA 2E7PA 4FH8A 2V6KA 3OR5A 2HRNA 2KHPA 2DSAA 3KXOA 1OE7A 1QK8A 5B7CA 3ME8A 1AUCA 4ML1A 4TR4A 3C7MA 5AISA 3F3QA 2H1BA 2L59A 5HR2A 5HR0A 2F8AA 3SWLA 2GTUA 3FR6A 1WJKA 5FWGA 3FW2A 1GL8A 5IO0A 1XW9A 3QFBC 4I5QA 2PWJA 1K3LA 3G9BA 3DWVA 4BPYA 1ZZYA 3KP9A 2LUSA 1M0UA 3UEMA 2N5AA 2GT5A 2VCQA 2HSHA 2O89A 1F9MA 4PX1A 2PUKC 1TJDA 2VOCA 1SL2B 16GSA 2VD0A 2VLVA 3EINA 3MWHA 2K18A 2GZPA 4KSMA 4O7HA 1Q98A 4IW9A 1XPVA 2E2GA 4EKZA 5DQYA 2YWOA 5DDLA 1B9YC 2AV4A 1F37A 2E0QA 4XS1A 3RDWA 3D4TA 3L9VA 18GSA 2GT6A 2TRXA 3VFIA 2V41A 4WR4A 4KB3A 3BBYA 2VUPA 5D73A 5ECQB 3GKKA 1B9XC 4YQUA 3MAKA 4O32A 4MA9A 5IMCA 2CAQA 1K0AA 3F4RA 4XCSA 1XBSA 2LS5A 3ERFA 1EEJA 4OO4A 5ECPB 1CQGA 2VO4A 2XPDA 5DQSA 2LSTA 5ID2B 5IPGA 3O76A 1TK8B 4F0BA 3P8WA 1VF1A 1O8WA 2LQQA 4IP6A 1OC9B 1PGTA 2MMAA 2C0DA 2LKUA 2YJ7A 2M80A 1KNGA 1BX9A 2IMDA 2LRNA 2NTOA 4K7IA 2P0GA 3RHCA 3ZREA 4AGSA 5IIZA 3UMAA 3TCOA 2J9HA 3P7XA 3QCPA 5INYA 3O6TA 3HVSA 1MDIA 2CZ2A 1AQWA 2AAWA 4LMWA 4L8EA 2L4CA 1XOAA 4L5LA 3UOMA 4PUAA 1Z6NA 4QQ7A 3L9UA 2VM2A 4KUNA 1HNAA 3M0FA 3H93A 4Q5NA 3HHVA 1YZXA 4AJ7A 4XHMA 3MNGA 3UAPA 5DJLA 2H0GA 5IMZA 4G2EA 3FZAA 3FR3A 1AAZA 1O81A 2G2QA 1YF1A 2PGTA 2VL3A 5DAKA 4PNGA 5GAPD 5ECLB 3LORA 3QD9A 1F3BA 1PN9A 3TJGA 3FZ5A 5KN1A 4N10A 1TI1A 2C1YA 1M9BA 1TOFA 2DJKA 2KOKA 1QUWA 5AGYA 1K0BA 2AYTA 2P31A 4ID0A 3JCML 3HVXA 1FVKA 1W89A 1AQXA 4MLYA 4GWRA 3RAZA 2LQOA 5CRDA 4NAXA 5D8IA 14GSA 2H75A 3VI7A 1A0RP 3EC3A 3Q6OA 2DJ2A 4HU9A 3VPQA 1AXDA 4HJMA 3FY7A 4GQFA 1B4QA 1Q4JA 2GSSA 5CRWA 4HOJA 3BCIA 1CQHA 2K6VA 3LJRA 1XIYA 2OBKA 3KMNA 3IHQA 4MMMA 2QC7A 2MMNA 3KTLA 5ECHB 1OYJA 2KLXA 2YCDA 3HZ8A 1JFUA 1NSWA 4JR6A 4NHZA 5GZZB 1UN2A 2HYXA 2FNOA 1I9DA 1XCCA 4KX4A 5ID2A 3ZITA 1TRSA 2PBJA 3TJJA 3CTFA 2EIOA 2RM6A 1YQ1A 4IHUA 3CSIA 2H76A 3IAS2 2YV7A 3O3TA 4POBA 1TRVA 2L5LA 1U3IA 4O92A 3RPNA 3LXZA 1Z9HA 5D96A 3F6FA 4OFTA 1RW1A 1O8XA 1TRWA 3CRUA 3IC4A 4XS4B 4Q5RA 1SD9A 1DUGA 5GSSA 4OO5A 2CQ9A 2HRFA 2O85A 11GSA 2YV9A 5HFKA 3E0UA 2RLIA 3QAVA 2KP2A 4O5RA 1BQ7A 2LNSA 3EMXA 4JZQA 1JLVA 4V1Ap 2N5BA 1HD2A 1MDKA 2C0FA 2O8VB 3GTUB 4D73B 4KDXA 3VK9A 1U88A 19GSA 1X5DA 3PH9A 2CVDA 3US3A 3Q19A 4E8EA 4MABA 1ERWA 1TU8A 1YEXA 5G1KA 1NM3A 2B5EA 3DYRA 4FYCA 2R4VA 4ZB6A 1WOUA 2FWHA 4PGTA 4Q5QA 5JWQB 4PUFC 4GLTA 1TXXA 4ZBDA 2F51A 4V2MA 5IOXA 3W6GA 4HEA2 2NBSA 1U6TA 5HFGA 5JWRB 2BJXA 4ZB8A 1KBNA 2EIRA 2HT9A 3LG6A 5IMVA 1H75A 3CYNA 3VWUA 1H4OA 3A5WA 4ZL9A 1T4YA 3GL3A 4MJAA 4KW6A 4ZL7A 1EZKA 2LJKA 1GUMA 4PNFA 1YY7A 4OFMA 2F8FA 4MF5A 1F2EA 4GCIA 1SL1B 3MSZA 2HZEA 3I69A 1JZDA 1VGLA 4IBPA 4ZL8A 1ZL9A 4E8HA 3GNJA 3QR6A 3WD6A 1EEMA 2VD1A 2H8LA 1GWCA 3DKSA 3ZFBA 1G0TA 2MMZA 3L9SA 4FO5A 3QFAC 1V57A 4XS6A 4PQHA 1YF0A 1KEBA 3LEFA 3ZIVA 5HR1A 3FRCA 4MJBA 3IDVA 2DJ3A 2XPEA 5B8AA 1GSDA 1EWXA 1GTIA 1TTZA 1I5GA 4GF0A 4EE0A 1QQ2A 3DVXA 5HFIA 1G6YA 5B6MA 2VM1A 1BYEA 2DMMA 3FYGA 2XC2A 4HZ4A 3HJOA 5IM9A 4TR1B 3HD5A 4K1FA 4HUAA 3F63A 1MTCA 3FHKA 1U87A 3TKQA 2YN1A 5A5KA 2IWTA 3H4KA 1V58A 2IN3A 3TRXA 2H66A 1PL2A 2FLSA 1G7OA 3IK9A 4XS4A 3PGTA 2C0EA 3GKXA 2GLRA 1GSQA 1URMA 3IXRA 4ZBAA 1FG4A 4MDCA 4WF4A 3CXGA 2VL2A 2NPBA 13GSA 1TP9A 4MZCA 3IV4A 2BMXA 1Z7RA 3KCMA 1SK0A 2OKAA 2ZUPA 3E3EA 2C3QA 1XZOA 3DD3A 2WB9A 3GTUA 22GSA 4D73A 2C8UA 1SK2A 5JCUA 4MPGA 4ECCA 3WT1A 3UJ1A 1OKTA 2ALBA 4AJ8A 4QL9A 1VRSD 4EL1A 2C3TA 5ECMB 3GKNA 2OE3A 2IMFA 2XBIA 4JE1A 1S3DA 2IFQB 4GQCA 2DJJA 3ZL5A 1XVQA 4CHSA 4XTSA 2YWNA 2FWFA 3DEXA 3C8EA 4IQAA 1IYIA 1DBYA 4KCAA 2YANA 5ECIB 1XWBA 5J3RA 1FB0A 4EDZA 2FD3A 1C72A 2OE0A 1PKZA 5DAKB 5B8BA 3LWAA 4GSSA 2R37A 2GZZA 2GQMA 2OADA 4TR3A 2N5FA 4NV2A 3EURA 1QXHA 4ZB9A 1GSEA 3EVIA 3IA1A 4NPBA 1TRUA 2O87A 2H6YA 3DIEA 4GTUA 2CAIA 17GSA 2YNXA 1GSYA 1A0FA 2ON7A 5KN0A 2CV4A 2R2JA 2KUCA 4K0GA 5G5EA 4KDYA 4Q5FA 1J9BA 3M9KA 3UVTA 4EDYA 1MDJA 4RI6A 3GSTA 3A2WA 3UL3A 5G5FA 5CRGA 2WZ9A 2IMEA 3KJYA 1BG5A 2CX4A 2I1UA 2DIYA 2JSZA 2K9FA 2JADA 1A23A 1FVJA 4HQSA 4AF2A 5D9TA 1V98A 4EO3A 4TR1A 1WRYA 2P5QA 4MH3A 1FW1A 4JBBA 1ZYQB 4F9ZA 3IOSA 2LTKA 4MF6A 5DCHA 3HJMA 1ZCPA 3AY8A 1EGRA 4F0CA 3QAGA 1SYRA 4KE3A 2LJAA 3L78A 2XBQA 4BVYA 3J7Yk 1WP0A 4LL4B 4ILFA 2VCVA 2HSYA 2CVBA 4IJIA 2HFDA 3M8NA 4TKYA 1SYXA 4X1UA 6GSYA 1T1VA 4EC0A 5G31A 1RQMA 4K7OA 1GSSA 1TKDB 1GTAA 1SL0B 4I6XA 3W8SA 4L5OA 1R5PA 2R3XA 1GLPA 1DSBA 5COHA 1T4ZA 4XRDA 3TKSE 1KTEA 2M46A 5HR3A 2IFQA 1GULA 4TRXA 3TKPA 4I97A 2FGXA 5L71A 4PQ1A 1BAYA 2GSTA 1AIUA 4YQMA 3N9JA 1VF3A 1JLWA 1MEKA 4NXIA 5IMFA 1XWCA 2DBCA 2CVKA 4JEDA 2LNTA 2KP1A 3KGKA 3M3MA 6GSXA 4LL1B 2H71A 3TKSA 1B8XA 3IR4A 5J9CA 6GSVA 1YDKA 4POLA 2VCZA 2MBTA 4YAVA 3KH7A 4ZIJA 2VL2C 5AN1A 3GH6A 4TOPA 2CZ3A 4F2IA 1SENA 2GVPA 3LGCA 3U6VA 3HY2A 1J08A 1SJIA 5KN3A 3FKFA 5C00A 3J7Yb 2DJ1A 2X99A 3MDKA 2IL3A 4OCEA 2HZEB 2HLSA 4LA1A 1IYHA 4F82A 1Z6MA 5F07A 1LU4A 1G6WA 1M7TA 3KEBA 3C1RA 3V1WA 4X43A 2IMIA 2J23A 2I9HA 4YH2A 2Z9SA 5F8BA 2GQLA 4MJEA 3IRAA 3VWWA 3D0ZA 5IMDA 1O85A 5D9XA 1FB6A 3K8NA 3KTBA 4HQZA 1T8EB 2WGRA 3GHAA 1QFNA 2REMA 4N0VA 3TDGA 1PQNA 4MH2A 3HYPA 1GP1A 2HXKA 5H5QA 4DSRA 4IQ1A 5ELAA 2H72A 3WGEA 3M1GA 2H73A 3WYWA 3BCKA 1DE2A 4ECBA 4XRAA 5DBQA 3VPTA 4V2NA 5A4WA 5IMAA 4KDUA 3TB2A 4KCEA 3EU3A 3CRTA 3TJFA 2H6XA 3ISOA 3EMPA 2IPAA 3KIJA 1NHOA 5CP1A 2VAFA 3ERWA 1GNEA 4K2DA 1YKCA 1ERTA 1EV4A 1OKDA 3R2QA 4KA0A 4RQXA 3TKRA 4K0NA 1TK5B 2TRCP 1WPIA 2YPMA 4FYUA 5CNWA 3QOUA 6GSTA 4FIWA 3H79A 2AJQB 2I81A 2C3NA 2DJ0A 3KD0A 1ZOFA 4J57E 2RIIA 3APOA 2B3SA 1XWGA 2FWEA 4IELA 3ZIJA 2FY6A 3QAWA 2H0HA 3LSZA
chains in the Genus database with same CATH superfamily
4ML6A 4LMVA 5FHIA 4GXZA 4HI7A 5GSTA 4N30A 3VWXA 4K7NA 1K3YA 2PVOC 2VLUA 4NMUA 1GRXA 3M9JA 4HJ2A 3GIXA 4NHWA 5B6NA 4KH7A 1ZMAA 3KP8A 4P3YB 3UBLA 2MZCA 4G0LA 1A2JA 1X9SB 4GSNA 2H19A 3GX8A 3GA4A 3F4TA 4MZWA 4ACSA 2HSMA 1UC7A 3TJKA 2DIZA 4ECIA 3G7IA 1EP7A 4L0WA 1THOA 1K3OA 3APSA 1X5CA 1FOVA 6GSSA 5D93A 3QMXA 3ZTLA 2YOIA 4AJ6A 1PX6A 3PINA 1PA3A 3VWVA 3GSSA 5EY6A 3GURA 2JZRA 4OWYA 3D6IA 1GUKA 4I8BA 3GH9A 1YJ6A 2E2MA 3L0HA 1QGVA 3RPPA 2F9SA 2X64A 2X8HA 1O73A 1EOHA 3ZYWA 4K5SA 4ECJA 4IKHA 3UVHA 1Z5YE 4IVFA 2EC4A 3TKSC 3LYKA 2PN8A 3TGZA 2B5XA 1SKRB 2DMLA 1M9AA 4ZBBA 4HU7A 2XHFA 1HQOA 1MD3A 2JZTA 1PL1A 3CTGA 1X9MB 2V2GA 1GH2A 4EXJA 5IPHA 1DE1A 3LFLA 5AIVA 5C04A 2QKEA 2BTOT 1GLQA 1QMVA 4IGJA 1G7EA 3GN3A 3HVNA 2PU9C 2VCWA 2H01A 3HCZA 3NIVA 5F05A 5J41A 1BJXA 2HRAA 1ERUA 1TU7A 4BVYB 2L4QA 2VLTA 3VI5A 2WS2A 2P5RA 4J2FA 4MP4A 4JRRA 5IQYA 4TN8A 3C73A 3MYDA 1K0CA 4IN0A 5E4WA 2LRCA 3FR9A 4YAPA 1EV9A 1ON4A 3HDCA 1Y6EA 5G30A 2A2RA 1S3CA 3GUSA 4Z7XA 1Z3EA 5KEJA 5DCGA 3HKRA 4X0XA 1EOGA 1B48A 4KAEA 4IS0A 4V1Ag 2NVLA 4FYBA 1PD21 4NV5A 2PVQA 3TRQA 5J9BA 2WULA 5CO3A 1JHBA 1VF2A 3ZVJA 3GFKA 3A3TA 1SKSB 5BRTA 1WWJA 5ELGA 2IIYA 2DC5A 3A5IA 2GS3A 2YZUA 1OE8A 2B1LA 5LCZA 4WKWA 2PPTA 4V2LA 1M2BA 1T3BA 4PXOA 3S9FA 1YKAA 2C0GA 3NZNA 4EVMA 1N8JA 4L0UA 4MK3A 1SJZA 5EVOA 1ZYNA 2JU5A 2CA8A 4H86A 5IOWA 1UA5A 1X0RA 7GSSA 2FUG2 4JU5A 6GSUA 5LNKe 2X8CA 4WBRD 3GKMA 4I2UA 2GSRA 5F0GA 5A4UA 4K8MA 3A2XA 3TOTA 2RM5A 5BMUA 3G7JA 2GGTA 3H1NA 2G0FA 2PERA 1ERVA 2IJYA 5IO2A 3LXTA 3GYKA 1USBA 1ACVA 4PURA 2YP6A 1HNCA 1A8YA 4KSOA 3BD2A 4GRFA 4F03A 3TRPA 1XWAA 4K6XA 2H1DA 5CYYA 2RUFA 10GSA 1O6JA 5H5SA 3ME7A 4ISDA 2EIQA 1PRXA 4BVXB 3I9V2 4G9HA 3I6AA 3E9JB 2AUVA 4NWYA 1THXA 5LD0A 3EYTA 1F3AA 2FHEA 2CT6A 1GTBA 2JZSA 2WRTA 3ZMLA 4TXOB 1BEDA 3D4MA 3F3RA 1GTUA 2GDRA 5ECRB 3GV1A 3IE3A 5D9WA 4N0ZA 2C4JA 1K0DA 1A2LA 4G10A 1GUHA 2B1KA 3P2AA 3VURA 4FQUA 3IAM2 1XWKA 3C71A 1LBKA 5J4UA 3WGXA 5J5NA 3HXSA 2FA8A 1K0OA 1Z7PA 3CSJA 1RK4A 1LJRA 4CW9A 4MZBA 3DVWA 4ULXA 8GSSA 2VCTA 1M99A 4EUYA 5ECNB 1S3AA 1TDIA 3TJBA 4DSQA 3KH9A 2VIMA 1SU9A 2K8VA 1OAZA 4RUVA 1R26A 4IJ3A 12GSA 2OE1A 1V40A 2OACA 1NHYA 1ILOA 4ZXGA 2H0IA 2ON5A 3FK8A 2H30A 4OMVA 2DKIA 2X8GA 3L4NA 3ERGA 1T00A 1ABAA 1K0NA 3GMFA 2ZNMA 5JWOB 2HZFA 3FZ9A 5AIXA 2K8SA 4OCFA 1OC3A 1EGOA 3CMIA 3KZQA 2X49A 4G19A 4HZ2A 5JCWA 5HQPA 1M2DA 4HS1A 4EF0A 3TOUA 1B4PA 5ABRA 2NDOA 2GQKA 1ZYEA 2WDUA 2C80A 1O7UA 1SJ6A 2TIRA 5DVBA 4BL7A 3TUEA 2JSYA 2L5OA 3NOFA 2YZHA 2V6OA 3UBKA 3GX0A 2WFCA 4MCUA 3HA9A 1AW9A 1WE0A 2A2SA 2M72A 1XXUA 2L6DA 2H1AA 2QSIA 4PQIA 3F4SA 3ZZXA 5ENUA 1GSFA 3SBCA 3APQA 4OFNA 5GAND 2LJRA 4TVEA 3IPZA 4BVXA 1R4WA 3ZVJD 2OA7A 1A24A 1R5AA 3EWLA 1GSUA 2H1GA 3F6DA 3RHBA 4DVCA 1TI3A 1FHEA 2VL9A 5D9VA 4TXOA 4YKFA 2B5YA 1XFLA 4HDEA 4TXVA 4O5UA 4TR0A 5A4VA 2H70A 5FT3A 1PFOA 4KGIA 5E59A 2V1MA 2B6MA 3PR8A 3F8UA 1OC9A 3IC8A 5ECOB 9GSSA 2L6CA 1HYUA 3HZ4A 1A2MA 5DJMA 1WIKA 2MYGA 1OVNA 5G1LA 3DGQA 3GRXA 4N11A 4WEYA 2YJHA 3BOAA 2O7KA 1JZRA 2OJLA 1A8LA 3CBUA 2I4AA 1E2YA 3IBHA 3FEUA 2LEGA 3A2VA 4POKA 2R0CA 2L57A 4IP1A 2MBSA 4QL7A 4DSSB 3N5OA 2UZ8A 4WF5A 5DALB 3QDNA 1PX7A 1XOBA 2FWGA 4BA7A 5CREA 5EPFA 1R7HA 20GSA 2IMKA 2H6ZA 3HVVA 2GZYA 2LV3A 3FZ4A 3EU4A 1U3AA 1J0FA 5JCGA 2V32A 1EP8A 3Q18A 1W4VA 2QGVA 1Y25A 1UVZA 3BJ5A 4I2TA 4K9ZA 3WGDA 1V2AA 1PKWA 5CRHA 1NW2A 2D2ZA 4ZILA 3H8QA 4BWSA 1T7PB 3LYPA 3ED3A 4YQVA 1X5EA 3DMLA 4XIHA 3D21A 4RI7A 1PMTA 4LLRA 2HNLA 4GSTA 4DEJA 1WMJA 2DLXA 3KM6A 1M2AA 3D22A 2MMOA 1XW6A 2I3YA 4CDOA 2JL4A 5F06A 4RQRA 1PSQA 2R5GA 4Z2RA 4POMA 3G7YA 3U5RE 3IK7A 3HJPA 2YWIA 3C1SA 3UIWA 1N2AA 3P90A 2VCXA 2JACA 2WJUA 1ML6A 2RUEA 2AHEA 3VLNA 5EL8A 3UARA 5KN2A 4WXTA 1VF4A 2WCIA 4BWQA 1SD8A 2H74A 3DRNA 5KOXA 3F0IA 4MJCA 3F9UA 6GSWA 1GNWA 2B7JA 1K0MA 1E6BA 2R6KA 3ZRDA 4EIQA 3DXBA 5ECKB 1FO5A 1OC8A 1TW9A 4OD7A 1TK0B 3QPMA 1AQVA 2LRTA 5ECSA 5CAXA 2HI7A 1F6MC 2F3MA 3W8JA 2ES7A 1ZGNA 2PMTA 1AC1A 4PTSA 4MF7A 3EE2A 3RBTA 3CSHA 2FA4A 5G2ZA 1JZOA 2CX3A 3ZMKA 1XW5A 4TW5A 2A2PA 3D5JA 3PPUA 4WBJA 2YWMA 1JZWA 3LQ7A 1X9WB 1SKWB 2B7KA 4KNDA 4WR5A 1ST9A 1FAAA 3KMOA 3WT2A 1XVWA 4WETA 3GL5A 3I43A 1MD4A 2FCHA 2GSQA 4MPFA 3Q74A 2OBIA 4J56E 1YEPA 2HE3A 3ZFLA 1V9WA 2AB6A 4DSSA 1SK1A 2ZCTA 4JR4A 3ZLPA 2A4VA 5DALA 5H5RA 1HNBA 2E7PA 4FH8A 2A4HA 2V6KA 3OR5A 2HRNA 2KHPA 2DSAA 3KXOA 4Z2TA 1OE7A 1QK8A 5B7CA 4G0KA 3ME8A 1AUCA 4ML1A 4TR4A 3C7MA 5AISA 3F3QA 2H1BA 2X4AA 2L59A 5HR2A 5HR0A 2F8AA 2R0PA 3SWLA 2GTUA 3FR6A 1WJKA 5FWGA 3FW2A 1GL8A 5IO0A 1XW9A 3QFBC 4I5QA 2PWJA 1K3LA 3G9BA 3DWVA 4BPYA 4K2XA 1ZZYA 3KP9A 2LUSA 1M0UA 3UEMA 2N5AA 2GT5A 2VCQA 2HSHA 2O89A 1F9MA 4PX1A 4BL7B 2PUKC 1TJDA 2VOCA 1SL2B 2HRKA 16GSA 2QA2A 2VD0A 2VLVA 3EINA 3MWHA 2K18A 2GZPA 4KSMA 4O7HA 1Q98A 4IW9A 1XPVA 2E2GA 4EKZA 5DQYA 2YWOA 5DDLA 1B9YC 2AV4A 4CY6A 1F37A 2E0QA 4XS1A 3RDWA 1XG8A 3D4TA 3L9VA 18GSA 2GT6A 2TRXA 3VFIA 2V41A 4WR4A 4KB3A 3BBYA 2VUPA 5D73A 5ECQB 3GKKA 1B9XC 4YQUA 3MAKA 4O32A 4MA9A 5IMCA 2CAQA 1K0AA 3F4RA 4XCSA 1XBSA 2LS5A 3ERFA 1EEJA 4OO4A 5ECPB 1CQGA 2VO4A 2XPDA 5DQSA 2LSTA 5ID2B 1M3JA 5IPGA 3O76A 1TK8B 4F0BA 3P8WA 1VF1A 1O8WA 2LQQA 4IP6A 1OC9B 1PGTA 2MMAA 2C0DA 2LKUA 2YJ7A 3IHGA 2M80A 1KNGA 1BX9A 2IMDA 2LRNA 2NTOA 4K7IA 2P0GA 3RHCA 3ZREA 4AGSA 4A5PA 5IIZA 3UMAA 3TCOA 2J9HA 3P7XA 3QCPA 5INYA 3O6TA 3HVSA 1MDIA 2CZ2A 1AQWA 2AAWA 4LMWA 4L8EA 2L4CA 1XOAA 4L5LA 3UOMA 4PUAA 1Z6NA 4QQ7A 3L9UA 2VM2A 4KUNA 1HNAA 3M0FA 3H93A 4Q5NA 3HHVA 1YZXA 4AJ7A 4XHMA 3MNGA 3UAPA 5DJLA 2H0GA 5IMZA 4G2EA 3FZAA 3FR3A 4ICYA 1AAZA 1O81A 1S3RA 2G2QA 1YF1A 2PGTA 2VL3A 5DAKA 4PNGA 5GAPD 5ECLB 3LORA 3QD9A 1F3BA 1PN9A 3TJGA 3FZ5A 5KN1A 4N10A 1TI1A 2C1YA 1M9BA 1TOFA 2DJKA 2KOKA 1QUWA 5AGYA 1K0BA 2AYTA 2P31A 4ID0A 3JCML 3HVXA 1FVKA 1W89A 1AQXA 4MLYA 4GWRA 3RAZA 2LQOA 5CRDA 4NAXA 5D8IA 14GSA 2H75A 3VI7A 1A0RP 3EC3A 3Q6OA 2DJ2A 4HU9A 3VPQA 1AXDA 4YKGA 4HJMA 3FY7A 4GQFA 1B4QA 1Q4JA 2GSSA 5CRWA 4HOJA 3BCIA 1CQHA 2K6VA 3LJRA 1XIYA 2OBKA 3KMNA 3IHQA 4MMMA 2QC7A 2MMNA 3KTLA 5ECHB 1OYJA 2KLXA 2YCDA 3HZ8A 1JFUA 1NSWA 4JR6A 4NHZA 5GZZB 1UN2A 2HYXA 2FNOA 1I9DA 3CQFA 1XCCA 4KX4A 5ID2A 3ZITA 1TRSA 2PBJA 3TJJA 3CTFA 2EIOA 2RM6A 1YQ1A 4IHUA 3CSIA 2H76A 3IAS2 2YV7A 3O3TA 4POBA 1TRVA 2L5LA 1U3IA 4O92A 3RPNA 3LXZA 1Z9HA 5D96A 3F6FA 4OFTA 1RW1A 1O8XA 1TRWA 3CRUA 3IC4A 4XS4B 4Q5RA 1SD9A 1DUGA 5GSSA 4OO5A 2CQ9A 2HRFA 2O85A 11GSA 2YV9A 5HFKA 3E0UA 2RLIA 3QAVA 2KP2A 4O5RA 1BQ7A 2LNSA 3EMXA 4JZQA 1JLVA 4V1Ap 2N5BA 1HD2A 1MDKA 2C0FA 2O8VB 3GTUB 4D73B 4KDXA 3VK9A 1PN0A 1U88A 1X5DA 19GSA 3PH9A 2CVDA 3US3A 3Q19A 4E8EA 4MABA 1ERWA 3LW9A 1TU8A 1YEXA 5G1KA 1NM3A 2B5EA 3DYRA 4FYCA 2R4VA 4ZB6A 1WOUA 1FOHA 2FWHA 4PGTA 4Q5QA 5JWQB 4PUFC 4GLTA 1TXXA 4ZBDA 2F51A 4V2MA 5IOXA 3W6GA 4HEA2 2NBSA 1U6TA 5HFGA 5JWRB 4CY8A 2BJXA 4ZB8A 1KBNA 2EIRA 2HT9A 3LG6A 5IMVA 1H75A 3CYNA 3VWUA 1H4OA 3A5WA 4ZL9A 1T4YA 3GL3A 4MJAA 4KW6A 4ZL7A 1EZKA 2LJKA 1GUMA 4PNFA 1YY7A 4OFMA 2F8FA 4MF5A 1F2EA 4GCIA 1SL1B 3MSZA 2HZEA 3I69A 1JZDA 1VGLA 4IBPA 4ZL8A 1ZL9A 4E8HA 3GNJA 3QR6A 3WD6A 1EEMA 2VD1A 2H8LA 1GWCA 3DKSA 3ZFBA 1G0TA 2MMZA 3L9SA 4FO5A 3QFAC 1V57A 4XS6A 4PQHA 1YF0A 1KEBA 3LEFA 3ZIVA 5HR1A 3FRCA 4EIPA 4MJBA 3IDVA 2DJ3A 2XPEA 5B8AA 1GSDA 4G0IA 1EWXA 1GTIA 1TTZA 1I5GA 4GF0A 4EE0A 1QQ2A 3DVXA 5HFIA 1G6YA 5B6MA 2VM1A 1BYEA 2DMMA 3FYGA 2XC2A 4HZ4A 3HJOA 5IM9A 4TR1B 3HD5A 4K1FA 4HUAA 3F63A 1MTCA 3FHKA 4X4JA 1U87A 3TKQA 2YN1A 5A5KA 2IWTA 3H4KA 1V58A 2IN3A 3TRXA 2H66A 1PL2A 2FLSA 1G7OA 3IK9A 4XS4A 3PGTA 2C0EA 3GKXA 2GLRA 1GSQA 1URMA 3IXRA 4ZBAA 1FG4A 4MDCA 4WF4A 3CXGA 2VL2A 2NPBA 13GSA 1TP9A 4MZCA 3IV4A 2BMXA 1Z7RA 3KCMA 4Z2UA 1SK0A 2OKAA 2ZUPA 3E3EA 2C3QA 1XZOA 3DD3A 2WB9A 3GTUA 22GSA 4D73A 2C8UA 1SK2A 5JCUA 4MPGA 4ECCA 3WT1A 3UJ1A 1OKTA 2ALBA 4AJ8A 4QL9A 1VRSD 4EL1A 2C3TA 5ECMB 3GKNA 2OE3A 2IMFA 2XBIA 4JE1A 1S3DA 2IFQB 4GQCA 2DJJA 3ZL5A 1XVQA 4CHSA 4XTSA 2YWNA 2FWFA 3DEXA 4KF9A 3C8EA 4IQAA 1IYIA 1DBYA 4KCAA 2YANA 5ECIB 1XWBA 5J3RA 1FB0A 4EDZA 2FD3A 1C72A 2OE0A 1PKZA 5DAKB 5B8BA 3LWAA 4GSSA 2R37A 2GZZA 2GQMA 2OADA 4TR3A 2N5FA 4NV2A 3EURA 1QXHA 4ZB9A 1GSEA 3EVIA 3IA1A 4NPBA 1TRUA 2O87A 2H6YA 3DIEA 4GTUA 2CAIA 17GSA 2YNXA 1GSYA 1A0FA 2ON7A 5KN0A 2CV4A 2R2JA 2KUCA 4K0GA 5G5EA 4KDYA 4Q5FA 1J9BA 3M9KA 3UVTA 4EDYA 1MDJA 4RI6A 3GSTA 3A2WA 3UL3A 5G5FA 5CRGA 2WZ9A 2IMEA 3KJYA 1BG5A 2CX4A 2I1UA 2DIYA 2JSZA 2K9FA 4HSCX 2JADA 1A23A 1FVJA 4HQSA 4AF2A 5D9TA 1V98A 4EO3A 4TR1A 1WRYA 5KOWA 2P5QA 4MH3A 1FW1A 4JBBA 1ZYQB 4F9ZA 3IOSA 2LTKA 4MF6A 5DCHA 3HJMA 1ZCPA 3AY8A 1EGRA 4F0CA 3QAGA 1SYRA 4KE3A 2LJAA 3L78A 2XBQA 4BVYA 3J7Yk 1WP0A 4LL4B 4ILFA 2VCVA 2HSYA 2CVBA 4IJIA 2HFDA 3M8NA 4TKYA 1SYXA 4X1UA 6GSYA 1T1VA 4EC0A 5G31A 1RQMA 1ZYPA 4K7OA 1GSSA 1TKDB 1GTAA 1SL0B 4I6XA 3W8SA 4L5OA 1R5PA 2R3XA 4O5QA 1GLPA 1DSBA 5COHA 1T4ZA 4XRDA 3TKSE 1KTEA 2M46A 5HR3A 2IFQA 1GULA 4TRXA 3TKPA 4I97A 2FGXA 5L71A 4PQ1A 1BAYA 2GSTA 1AIUA 4YQMA 3N9JA 1VF3A 1JLWA 1MEKA 4NXIA 5IMFA 1XWCA 2DBCA 2CVKA 4JEDA 2LNTA 2KP1A 3KGKA 3M3MA 6GSXA 4LL1B 2H71A 3TKSA 1B8XA 3IR4A 5J9CA 6GSVA 1YDKA 4POLA 2VCZA 2MBTA 4YAVA 3KH7A 4ZIJA 2VL2C 5AN1A 3GH6A 4TOPA 2CZ3A 4K5RA 4F2IA 1SENA 2GVPA 3LGCA 3U6VA 3HY2A 1J08A 1SJIA 5KN3A 3FKFA 3MIXA 5C00A 3J7Yb 4MNNA 2DJ1A 2X99A 3MDKA 2IL3A 4OCEA 2HZEB 2HLSA 4LA1A 1IYHA 4F82A 1Z6MA 5F07A 2QA1A 1LU4A 3FMWA 1G6WA 1M7TA 3KEBA 3C1RA 3V1WA 4X43A 2IMIA 2J23A 2I9HA 4YH2A 2Z9SA 5F8BA 2GQLA 4MJEA 3R3EA 4USSA 3IRAA 3VWWA 2R0GA 3D0ZA 5IMDA 1O85A 5D9XA 1FB6A 3K8NA 3KTBA 4HQZA 1T8EB 2WGRA 3GHAA 1QFNA 2REMA 4N0VA 3TDGA 1PQNA 4MH2A 3HYPA 1GP1A 2HXKA 5H5QA 4DSRA 4IQ1A 5ELAA 2H72A 3WGEA 3M1GA 1M3IA 2H73A 3WYWA 3BCKA 1DE2A 4ECBA 4XRAA 5DBQA 4BIKA 3VPTA 4V2NA 5A4WA 5IMAA 4KDUA 3TB2A 4KCEA 3EU3A 3CRTA 3TJFA 2H6XA 3ISOA 3EMPA 2IPAA 3KIJA 1NHOA 5CP1A 2VAFA 3ERWA 1GNEA 4K2DA 1YKCA 1ERTA 1EV4A 1OKDA 3R2QA 2DKHA 4KA0A 4RQXA 3TKRA 4K0NA 1TK5B 2TRCP 1WPIA 2YPMA 4FYUA 5CNWA 3QOUA 6GSTA 4FIWA 3H79A 2AJQB 2I81A 2C3NA 3EPTA 2DJ0A 3KD0A 1ZOFA 4J57E 2RIIA 3APOA 2B3SA 1XWGA 2FWEA 4IELA 3ZIJA 2FY6A 3QAWA 2H0HA 3LSZA
chains in the Genus database with same CATH topology
4ML6A 4LMVA 5FHIA 4GXZA 4HI7A 5GSTA 4N30A 3VWXA 4K7NA 1K3YA 2PVOC 2VLUA 4NMUA 1GRXA 3M9JA 4HJ2A 3GIXA 4NHWA 5B6NA 4KH7A 1ZMAA 3KP8A 4P3YB 3UBLA 2MZCA 4G0LA 1A2JA 1X9SB 4GSNA 2H19A 3GX8A 3GA4A 3F4TA 4MZWA 4ACSA 2HSMA 1UC7A 3TJKA 2DIZA 4ECIA 3G7IA 1EP7A 4L0WA 1THOA 1K3OA 3APSA 1X5CA 1FOVA 6GSSA 5D93A 3QMXA 3ZTLA 2YOIA 4AJ6A 1PX6A 3PINA 1PA3A 3VWVA 3GSSA 5EY6A 3GURA 2JZRA 4OWYA 3D6IA 1GUKA 4I8BA 3GH9A 1YJ6A 2E2MA 3L0HA 1QGVA 3RPPA 2F9SA 2X64A 2X8HA 1O73A 1EOHA 3ZYWA 4K5SA 4ECJA 4IKHA 3UVHA 1Z5YE 4IVFA 2EC4A 3TKSC 3LYKA 2PN8A 3TGZA 2B5XA 1SKRB 2DMLA 1M9AA 4ZBBA 4HU7A 2XHFA 1HQOA 1MD3A 2JZTA 1PL1A 3CTGA 1X9MB 2V2GA 1GH2A 4EXJA 5IPHA 1DE1A 3LFLA 5AIVA 5C04A 2QKEA 2BTOT 1GLQA 1QMVA 4IGJA 1G7EA 3GN3A 2PU9C 2VCWA 2H01A 3HCZA 3NIVA 5F05A 5J41A 1BJXA 2HRAA 1ERUA 1TU7A 4BVYB 2L4QA 2VLTA 3VI5A 2WS2A 2P5RA 4J2FA 4MP4A 4JRRA 5IQYA 4TN8A 3C73A 3MYDA 1K0CA 4IN0A 5E4WA 2LRCA 3FR9A 4YAPA 1EV9A 1ON4A 3HDCA 1Y6EA 5G30A 2A2RA 1S3CA 3GUSA 4Z7XA 1Z3EA 5KEJA 5DCGA 3HKRA 4X0XA 1EOGA 1B48A 4KAEA 4IS0A 4V1Ag 2NVLA 4FYBA 1PD21 4NV5A 2PVQA 3TRQA 5J9BA 2WULA 5CO3A 1JHBA 1VF2A 3ZVJA 3GFKA 3A3TA 1SKSB 5BRTA 1WWJA 5ELGA 2IIYA 2DC5A 3A5IA 2GS3A 2YZUA 1OE8A 2B1LA 5LCZA 4WKWA 2PPTA 4V2LA 1M2BA 1T3BA 4PXOA 3S9FA 1YKAA 2C0GA 3NZNA 4EVMA 1N8JA 4L0UA 4MK3A 1SJZA 5EVOA 1ZYNA 2JU5A 2CA8A 4H86A 5IOWA 1UA5A 1X0RA 7GSSA 2FUG2 4JU5A 6GSUA 5LNKe 2X8CA 4WBRD 3GKMA 4I2UA 2GSRA 5F0GA 5A4UA 4K8MA 3A2XA 3TOTA 2RM5A 5BMUA 3G7JA 2GGTA 3H1NA 2G0FA 2PERA 1ERVA 2IJYA 5IO2A 3LXTA 3GYKA 1USBA 1ACVA 4PURA 2YP6A 1HNCA 1A8YA 4KSOA 3BD2A 4GRFA 4F03A 3TRPA 1XWAA 4K6XA 2H1DA 5CYYA 2RUFA 10GSA 1O6JA 5H5SA 3ME7A 4ISDA 2EIQA 1PRXA 4BVXB 3I9V2 4G9HA 3I6AA 3E9JB 2AUVA 4NWYA 1THXA 5LD0A 3EYTA 1F3AA 2FHEA 2CT6A 1GTBA 2JZSA 2WRTA 3ZMLA 4TXOB 1BEDA 3D4MA 3F3RA 1GTUA 2GDRA 5ECRB 3GV1A 3IE3A 5D9WA 4N0ZA 2C4JA 1K0DA 1A2LA 4G10A 1GUHA 2B1KA 3P2AA 3VURA 4FQUA 3IAM2 1XWKA 3C71A 1LBKA 5J4UA 3WGXA 5J5NA 3HXSA 2FA8A 1K0OA 1Z7PA 3CSJA 1RK4A 1LJRA 4CW9A 4MZBA 3DVWA 4ULXA 8GSSA 2VCTA 1M99A 4EUYA 5ECNB 1S3AA 1TDIA 3TJBA 4DSQA 3KH9A 2VIMA 1SU9A 2K8VA 1OAZA 4RUVA 1R26A 4IJ3A 12GSA 2OE1A 1V40A 2OACA 1NHYA 1ILOA 4ZXGA 2H0IA 2ON5A 3FK8A 2H30A 4OMVA 2DKIA 2X8GA 3L4NA 3ERGA 1T00A 1ABAA 1K0NA 3GMFA 2ZNMA 5JWOB 2HZFA 3FZ9A 5AIXA 2K8SA 4OCFA 1OC3A 1EGOA 3CMIA 3KZQA 2X49A 4G19A 4HZ2A 5JCWA 5HQPA 1M2DA 4HS1A 4EF0A 3TOUA 1B4PA 5ABRA 2NDOA 2GQKA 1ZYEA 2WDUA 2C80A 1O7UA 1SJ6A 2TIRA 5DVBA 4BL7A 3TUEA 2JSYA 2L5OA 3NOFA 2YZHA 2V6OA 3UBKA 3GX0A 2WFCA 4MCUA 3HA9A 1AW9A 1WE0A 2A2SA 2M72A 1XXUA 2L6DA 2H1AA 2QSIA 4PQIA 3F4SA 3ZZXA 5ENUA 1GSFA 3SBCA 3APQA 4OFNA 5GAND 2LJRA 4TVEA 3IPZA 4BVXA 1R4WA 3ZVJD 2OA7A 1A24A 1R5AA 3EWLA 1GSUA 2H1GA 3F6DA 3RHBA 4DVCA 1TI3A 1FHEA 2VL9A 5D9VA 4TXOA 4YKFA 2B5YA 1XFLA 4HDEA 4TXVA 4O5UA 4TR0A 5A4VA 2H70A 5FT3A 4KGIA 5E59A 2V1MA 2B6MA 3PR8A 3F8UA 1OC9A 3IC8A 5ECOB 9GSSA 2L6CA 1HYUA 3HZ4A 1A2MA 5DJMA 1WIKA 2MYGA 1OVNA 5G1LA 3DGQA 3GRXA 4N11A 4WEYA 2YJHA 3BOAA 2O7KA 1JZRA 2OJLA 1A8LA 3CBUA 2I4AA 1E2YA 3IBHA 3FEUA 2LEGA 3A2VA 4POKA 2R0CA 2L57A 4IP1A 2MBSA 4QL7A 4DSSB 3N5OA 2UZ8A 4WF5A 5DALB 3QDNA 1PX7A 1XOBA 2FWGA 4BA7A 5CREA 5EPFA 1R7HA 20GSA 2IMKA 2H6ZA 3HVVA 2GZYA 2LV3A 3FZ4A 3EU4A 1U3AA 1J0FA 5JCGA 2V32A 1EP8A 3Q18A 1W4VA 2QGVA 1Y25A 1UVZA 3BJ5A 4I2TA 4K9ZA 3WGDA 1V2AA 1PKWA 5CRHA 1NW2A 2D2ZA 4ZILA 3H8QA 4BWSA 1T7PB 3LYPA 3ED3A 4YQVA 1X5EA 3DMLA 4XIHA 3D21A 4RI7A 1PMTA 4LLRA 2HNLA 4GSTA 4DEJA 1WMJA 2DLXA 3KM6A 1M2AA 3D22A 2MMOA 1XW6A 2I3YA 4CDOA 2JL4A 5F06A 4RQRA 1PSQA 2R5GA 4Z2RA 4POMA 3G7YA 3U5RE 3IK7A 3HJPA 2YWIA 3C1SA 3UIWA 1N2AA 3P90A 2VCXA 2JACA 2WJUA 1ML6A 2RUEA 2AHEA 3VLNA 5EL8A 3UARA 5KN2A 4WXTA 1VF4A 2WCIA 4BWQA 1SD8A 2H74A 3DRNA 5KOXA 3F0IA 4MJCA 3F9UA 6GSWA 1GNWA 2B7JA 1K0MA 1E6BA 2R6KA 3ZRDA 4EIQA 3DXBA 5ECKB 1FO5A 1OC8A 1TW9A 4OD7A 1TK0B 3QPMA 1AQVA 2LRTA 5ECSA 5CAXA 2HI7A 1F6MC 2F3MA 3W8JA 2ES7A 1ZGNA 2PMTA 1AC1A 4PTSA 4MF7A 3EE2A 3RBTA 3CSHA 2FA4A 5G2ZA 1JZOA 2CX3A 3ZMKA 1XW5A 4TW5A 2A2PA 3D5JA 3PPUA 4WBJA 2YWMA 1JZWA 3LQ7A 1X9WB 1SKWB 2B7KA 4KNDA 4WR5A 1ST9A 1FAAA 3KMOA 3WT2A 1XVWA 4WETA 3GL5A 3I43A 1MD4A 2FCHA 2GSQA 4MPFA 3Q74A 2OBIA 4J56E 1YEPA 2HE3A 3ZFLA 1V9WA 2AB6A 4DSSA 1SK1A 2ZCTA 4JR4A 3ZLPA 2A4VA 5DALA 5H5RA 1HNBA 2E7PA 4FH8A 2A4HA 2V6KA 3OR5A 2HRNA 2KHPA 2DSAA 3KXOA 4Z2TA 1OE7A 1QK8A 5B7CA 4G0KA 3ME8A 1AUCA 4ML1A 4TR4A 3C7MA 5AISA 3F3QA 2H1BA 2X4AA 2L59A 5HR2A 5HR0A 2F8AA 2R0PA 3SWLA 2GTUA 3FR6A 1WJKA 5FWGA 3FW2A 1GL8A 5IO0A 1XW9A 3QFBC 4I5QA 2PWJA 1K3LA 3G9BA 3DWVA 4BPYA 4K2XA 1ZZYA 3KP9A 2LUSA 1M0UA 3UEMA 2N5AA 2GT5A 2VCQA 2HSHA 2O89A 1F9MA 4PX1A 4BL7B 2PUKC 1TJDA 2VOCA 1SL2B 2HRKA 16GSA 2QA2A 2VD0A 2VLVA 3EINA 3MWHA 2K18A 2GZPA 4KSMA 4O7HA 1Q98A 4IW9A 1XPVA 2E2GA 4EKZA 5DQYA 2YWOA 5DDLA 1B9YC 2AV4A 4CY6A 1F37A 2E0QA 4XS1A 3RDWA 3D4TA 3L9VA 18GSA 2GT6A 2TRXA 3VFIA 2V41A 4WR4A 4KB3A 3BBYA 2VUPA 5D73A 5ECQB 3GKKA 1B9XC 4YQUA 3MAKA 4O32A 4MA9A 5IMCA 2CAQA 1K0AA 3F4RA 4XCSA 1XBSA 2LS5A 3ERFA 1EEJA 4OO4A 5ECPB 1CQGA 2VO4A 2XPDA 5DQSA 2LSTA 5ID2B 5IPGA 3O76A 1TK8B 4F0BA 3P8WA 1VF1A 1O8WA 2LQQA 4IP6A 1OC9B 1PGTA 2MMAA 2C0DA 2LKUA 2YJ7A 3IHGA 2M80A 1KNGA 1BX9A 2IMDA 2LRNA 2NTOA 4K7IA 2P0GA 3RHCA 3ZREA 4AGSA 4A5PA 5IIZA 3UMAA 3TCOA 2J9HA 3P7XA 3QCPA 5INYA 3O6TA 3HVSA 1MDIA 2CZ2A 1AQWA 2AAWA 4LMWA 4L8EA 2L4CA 1XOAA 4L5LA 3UOMA 4PUAA 1Z6NA 4QQ7A 3L9UA 2VM2A 4KUNA 1HNAA 3M0FA 3H93A 4Q5NA 3HHVA 1YZXA 4AJ7A 4XHMA 3MNGA 3UAPA 5DJLA 2H0GA 5IMZA 4G2EA 3FZAA 3FR3A 4ICYA 1AAZA 1O81A 2G2QA 1YF1A 2PGTA 2VL3A 5DAKA 4PNGA 5GAPD 5ECLB 3LORA 3QD9A 1F3BA 1PN9A 3TJGA 3FZ5A 5KN1A 4N10A 1TI1A 2C1YA 1M9BA 1TOFA 2DJKA 2KOKA 1QUWA 5AGYA 1K0BA 2AYTA 2P31A 4ID0A 3JCML 3HVXA 1FVKA 1W89A 1AQXA 4MLYA 4GWRA 3RAZA 2LQOA 5CRDA 4NAXA 5D8IA 14GSA 2H75A 3VI7A 1A0RP 3EC3A 3Q6OA 2DJ2A 4HU9A 3VPQA 1AXDA 4YKGA 4HJMA 3FY7A 4GQFA 1B4QA 1Q4JA 2GSSA 5CRWA 4HOJA 3BCIA 1CQHA 2K6VA 3LJRA 1XIYA 2OBKA 3KMNA 3IHQA 4MMMA 2QC7A 2MMNA 3KTLA 5ECHB 1OYJA 2KLXA 2YCDA 3HZ8A 1JFUA 1NSWA 4JR6A 4NHZA 5GZZB 1UN2A 2HYXA 2FNOA 1I9DA 1XCCA 4KX4A 5ID2A 3ZITA 1TRSA 2PBJA 3TJJA 3CTFA 2EIOA 2RM6A 1YQ1A 4IHUA 3CSIA 2H76A 3IAS2 2YV7A 3O3TA 4POBA 1TRVA 2L5LA 1U3IA 4O92A 3RPNA 3LXZA 1Z9HA 5D96A 3F6FA 4OFTA 1RW1A 1O8XA 1TRWA 3CRUA 3IC4A 4XS4B 4Q5RA 1SD9A 1DUGA 5GSSA 4OO5A 2CQ9A 2HRFA 2O85A 11GSA 2YV9A 5HFKA 3E0UA 2RLIA 3QAVA 2KP2A 4O5RA 1BQ7A 2LNSA 3EMXA 4JZQA 1JLVA 4V1Ap 2N5BA 1HD2A 1MDKA 2C0FA 2O8VB 3GTUB 4D73B 4KDXA 3VK9A 1PN0A 1U88A 1X5DA 19GSA 3PH9A 2CVDA 3US3A 3Q19A 4E8EA 4MABA 1ERWA 3LW9A 1TU8A 1YEXA 5G1KA 1NM3A 2B5EA 3DYRA 4FYCA 2R4VA 4ZB6A 1WOUA 1FOHA 2FWHA 4PGTA 4Q5QA 5JWQB 4PUFC 4GLTA 1TXXA 4ZBDA 2F51A 4V2MA 5IOXA 3W6GA 4HEA2 2NBSA 1U6TA 5HFGA 5JWRB 4CY8A 2BJXA 4ZB8A 1KBNA 2EIRA 2HT9A 3LG6A 5IMVA 1H75A 3CYNA 3VWUA 1H4OA 3A5WA 4ZL9A 1T4YA 3GL3A 4MJAA 4KW6A 4ZL7A 1EZKA 2LJKA 1GUMA 4PNFA 1YY7A 4OFMA 2F8FA 4MF5A 1F2EA 4GCIA 1SL1B 3MSZA 2HZEA 3I69A 1JZDA 1VGLA 4IBPA 4ZL8A 1ZL9A 4E8HA 3GNJA 3QR6A 3WD6A 1EEMA 2VD1A 2H8LA 1GWCA 3DKSA 3ZFBA 1G0TA 2MMZA 3L9SA 4FO5A 3QFAC 1V57A 4XS6A 4PQHA 1YF0A 1KEBA 3LEFA 3ZIVA 5HR1A 3FRCA 4EIPA 4MJBA 3IDVA 2DJ3A 2XPEA 5B8AA 1GSDA 4G0IA 1EWXA 1GTIA 1TTZA 1I5GA 4GF0A 4EE0A 1QQ2A 3DVXA 5HFIA 1G6YA 5B6MA 2VM1A 1BYEA 2DMMA 3FYGA 2XC2A 4HZ4A 3HJOA 5IM9A 4TR1B 3HD5A 4K1FA 4HUAA 3F63A 1MTCA 3FHKA 4X4JA 1U87A 3TKQA 2YN1A 5A5KA 2IWTA 3H4KA 1V58A 2IN3A 3TRXA 2H66A 1PL2A 2FLSA 1G7OA 3IK9A 4XS4A 3PGTA 2C0EA 3GKXA 2GLRA 1GSQA 1URMA 3IXRA 4ZBAA 1FG4A 4MDCA 4WF4A 3CXGA 2VL2A 2NPBA 13GSA 1TP9A 4MZCA 3IV4A 2BMXA 1Z7RA 3KCMA 4Z2UA 1SK0A 2OKAA 2ZUPA 3E3EA 2C3QA 1XZOA 3DD3A 2WB9A 3GTUA 22GSA 4D73A 2C8UA 1SK2A 5JCUA 4MPGA 4ECCA 3WT1A 3UJ1A 1OKTA 2ALBA 4AJ8A 4QL9A 1VRSD 4EL1A 2C3TA 5ECMB 3GKNA 2OE3A 2IMFA 2XBIA 4JE1A 1S3DA 2IFQB 4GQCA 2DJJA 3ZL5A 1XVQA 4CHSA 4XTSA 2YWNA 2FWFA 3DEXA 4KF9A 3C8EA 4IQAA 1IYIA 1DBYA 4KCAA 2YANA 5ECIB 1XWBA 5J3RA 1FB0A 4EDZA 2FD3A 1C72A 2OE0A 1PKZA 5DAKB 5B8BA 3LWAA 4GSSA 2R37A 2GZZA 2GQMA 2OADA 4TR3A 2N5FA 4NV2A 3EURA 1QXHA 4ZB9A 1GSEA 3EVIA 3IA1A 4NPBA 1TRUA 2O87A 2H6YA 3DIEA 4GTUA 2CAIA 17GSA 2YNXA 1GSYA 1A0FA 2ON7A 5KN0A 2CV4A 2R2JA 2KUCA 4K0GA 5G5EA 4KDYA 4Q5FA 1J9BA 3M9KA 3UVTA 4EDYA 1MDJA 4RI6A 3GSTA 3A2WA 3UL3A 5G5FA 5CRGA 2WZ9A 2IMEA 3KJYA 1BG5A 2CX4A 2I1UA 2DIYA 2JSZA 2K9FA 2JADA 1A23A 1FVJA 4HQSA 4AF2A 5D9TA 1V98A 4EO3A 4TR1A 1WRYA 5KOWA 2P5QA 4MH3A 1FW1A 4JBBA 1ZYQB 4F9ZA 3IOSA 2LTKA 4MF6A 5DCHA 3HJMA 1ZCPA 3AY8A 1EGRA 4F0CA 3QAGA 1SYRA 4KE3A 2LJAA 3L78A 2XBQA 4BVYA 3J7Yk 1WP0A 4LL4B 4ILFA 2VCVA 2HSYA 2CVBA 4IJIA 2HFDA 3M8NA 4TKYA 1SYXA 4X1UA 6GSYA 1T1VA 4EC0A 5G31A 1RQMA 1ZYPA 4K7OA 1GSSA 1TKDB 1GTAA 1SL0B 4I6XA 3W8SA 4L5OA 1R5PA 2R3XA 4O5QA 1GLPA 1DSBA 5COHA 1T4ZA 4XRDA 3TKSE 1KTEA 2M46A 5HR3A 2IFQA 1GULA 4TRXA 3TKPA 4I97A 2FGXA 5L71A 4PQ1A 1BAYA 2GSTA 1AIUA 4YQMA 3N9JA 1VF3A 1JLWA 1MEKA 4NXIA 5IMFA 1XWCA 2DBCA 2CVKA 4JEDA 2LNTA 2KP1A 3KGKA 3M3MA 6GSXA 4LL1B 2H71A 3TKSA 1B8XA 3IR4A 5J9CA 6GSVA 1YDKA 4POLA 2VCZA 2MBTA 4YAVA 3KH7A 4ZIJA 2VL2C 5AN1A 3GH6A 4TOPA 2CZ3A 4K5RA 4F2IA 1SENA 2GVPA 3LGCA 3U6VA 3HY2A 1J08A 1SJIA 5KN3A 3FKFA 3MIXA 5C00A 3J7Yb 4MNNA 2DJ1A 2X99A 3MDKA 2IL3A 4OCEA 2HZEB 2HLSA 4LA1A 1IYHA 4F82A 1Z6MA 5F07A 2QA1A 1LU4A 3FMWA 1G6WA 1M7TA 3KEBA 3C1RA 3V1WA 4X43A 2IMIA 2J23A 2I9HA 4YH2A 2Z9SA 5F8BA 2GQLA 4MJEA 3R3EA 4USSA 3IRAA 3VWWA 2R0GA 3D0ZA 5IMDA 1O85A 5D9XA 1FB6A 3K8NA 3KTBA 4HQZA 1T8EB 2WGRA 3GHAA 1QFNA 2REMA 4N0VA 3TDGA 1PQNA 4MH2A 3HYPA 1GP1A 2HXKA 5H5QA 4DSRA 4IQ1A 5ELAA 2H72A 3WGEA 3M1GA 2H73A 3WYWA 3BCKA 1DE2A 4ECBA 4XRAA 5DBQA 3VPTA 4V2NA 5A4WA 5IMAA 4KDUA 3TB2A 4KCEA 3EU3A 3CRTA 3TJFA 2H6XA 3ISOA 3EMPA 2IPAA 3KIJA 1NHOA 5CP1A 2VAFA 3ERWA 1GNEA 4K2DA 1YKCA 1ERTA 1EV4A 1OKDA 3R2QA 2DKHA 4KA0A 4RQXA 3TKRA 4K0NA 1TK5B 2TRCP 1WPIA 2YPMA 4FYUA 5CNWA 3QOUA 6GSTA 4FIWA 3H79A 2AJQB 2I81A 2C3NA 3EPTA 2DJ0A 3KD0A 1ZOFA 4J57E 2RIIA 3APOA 2B3SA 1XWGA 2FWEA 4IELA 3ZIJA 2FY6A 3QAWA 2H0HA 3LSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ML6 A;  4LMV A;  5FHI A;  4GXZ A;  4HI7 A;  5GST A;  4N30 A;  3VWX A;  4K7N A;  1K3Y A;  2PVO C;  2VLU A;  4NMU A;  1GRX A;  3M9J A;  4HJ2 A;  3GIX A;  4NHW A;  5B6N A;  4KH7 A;  1ZMA A;  3KP8 A;  4P3Y B;  3UBL A;  2MZC A;  1A2J A;  1X9S B;  4GSN A;  2H19 A;  3GX8 A;  3GA4 A;  3F4T A;  4MZW A;  4ACS A;  1UC7 A;  3TJK A;  2DIZ A;  4ECI A;  3G7I A;  1EP7 A;  4L0W A;  1THO A;  1K3O A;  3APS A;  1X5C A;  1FOV A;  6GSS A;  5D93 A;  3QMX A;  3ZTL A;  2YOI A;  4AJ6 A;  1PX6 A;  3PIN A;  1PA3 A;  3VWV A;  3GSS A;  5EY6 A;  3GUR A;  2JZR A;  4OWY A;  3D6I A;  1GUK A;  4I8B A;  3GH9 A;  1YJ6 A;  2E2M A;  3L0H A;  1QGV A;  3RPP A;  2F9S A;  2X64 A;  2X8H A;  1O73 A;  1EOH A;  3ZYW A;  4ECJ A;  4IKH A;  3UVH A;  1Z5Y E;  4IVF A;  2EC4 A;  3TKS C;  3LYK A;  2PN8 A;  3TGZ A;  2B5X A;  1SKR B;  2DML A;  1M9A A;  4ZBB A;  4HU7 A;  2XHF A;  1HQO A;  1MD3 A;  2JZT A;  1PL1 A;  3CTG A;  1X9M B;  2V2G A;  1GH2 A;  4EXJ A;  5IPH A;  1DE1 A;  3LFL A;  5AIV A;  5C04 A;  2QKE A;  2BTO T;  1GLQ A;  1QMV A;  4IGJ A;  1G7E A;  3GN3 A;  2PU9 C;  2VCW A;  2H01 A;  3HCZ A;  3NIV A;  5F05 A;  5J41 A;  1BJX A;  1ERU A;  1TU7 A;  2L4Q A;  2VLT A;  3VI5 A;  2WS2 A;  2P5R A;  4J2F A;  4MP4 A;  4JRR A;  5IQY A;  4TN8 A;  3C73 A;  1K0C A;  4IN0 A;  5E4W A;  2LRC A;  3FR9 A;  4YAP A;  1EV9 A;  1ON4 A;  3HDC A;  1Y6E A;  5G30 A;  2A2R A;  1S3C A;  3GUS A;  4Z7X A;  1Z3E A;  5KEJ A;  5DCG A;  3HKR A;  4X0X A;  1EOG A;  1B48 A;  4KAE A;  4IS0 A;  4V1A g;  2NVL A;  4FYB A;  1PD2 1;  4NV5 A;  2PVQ A;  3TRQ A;  5J9B A;  2WUL A;  5CO3 A;  1JHB A;  1VF2 A;  3ZVJ A;  3GFK A;  3A3T A;  1SKS B;  1WWJ A;  5ELG A;  2IIY A;  2DC5 A;  2GS3 A;  2YZU A;  1OE8 A;  2B1L A;  5LCZ A;  4WKW A;  2PPT A;  4V2L A;  1M2B A;  1T3B A;  4PXO A;  3S9F A;  1YKA A;  2C0G A;  3NZN A;  4EVM A;  1N8J A;  4L0U A;  4MK3 A;  1SJZ A;  5EVO A;  2JU5 A;  2CA8 A;  4H86 A;  5IOW A;  1UA5 A;  1X0R A;  7GSS A;  2FUG 2;  4JU5 A;  6GSU A;  5LNK e;  2X8C A;  4WBR D;  3GKM A;  4I2U A;  2GSR A;  5F0G A;  5A4U A;  4K8M A;  3A2X A;  3TOT A;  2RM5 A;  3G7J A;  2GGT A;  3H1N A;  2G0F A;  2PER A;  1ERV A;  2IJY A;  5IO2 A;  3LXT A;  3GYK A;  1USB A;  1ACV A;  4PUR A;  2YP6 A;  1HNC A;  1A8Y A;  4KSO A;  3BD2 A;  4GRF A;  4F03 A;  3TRP A;  1XWA A;  4K6X A;  2H1D A;  5CYY A;  2RUF A;  10GS A;  1O6J A;  5H5S A;  3ME7 A;  4ISD A;  2EIQ A;  1PRX A;  3I9V 2;  4G9H A;  3I6A A;  3E9J B;  2AUV A;  4NWY A;  1THX A;  5LD0 A;  3EYT A;  1F3A A;  2FHE A;  2CT6 A;  1GTB A;  2JZS A;  2WRT A;  3ZML A;  4TXO B;  1BED A;  3D4M A;  3F3R A;  1GTU A;  2GDR A;  5ECR B;  3GV1 A;  3IE3 A;  5D9W A;  4N0Z A;  2C4J A;  1K0D A;  1A2L A;  4G10 A;  1GUH A;  2B1K A;  3P2A A;  3VUR A;  3IAM 2;  1XWK A;  3C71 A;  1LBK A;  5J4U A;  3WGX A;  5J5N A;  3HXS A;  2FA8 A;  1K0O A;  1Z7P A;  3CSJ A;  1RK4 A;  1LJR A;  4CW9 A;  4MZB A;  3DVW A;  4ULX A;  8GSS A;  2VCT A;  1M99 A;  4EUY A;  5ECN B;  1S3A A;  1TDI A;  3TJB A;  4DSQ A;  3KH9 A;  2VIM A;  1SU9 A;  2K8V A;  1OAZ A;  4RUV A;  1R26 A;  4IJ3 A;  12GS A;  2OE1 A;  1V40 A;  2OAC A;  1NHY A;  1ILO A;  4ZXG A;  2H0I A;  2ON5 A;  3FK8 A;  2H30 A;  4OMV A;  2X8G A;  3L4N A;  3ERG A;  1T00 A;  1ABA A;  1K0N A;  3GMF A;  2ZNM A;  5JWO B;  2HZF A;  3FZ9 A;  5AIX A;  2K8S A;  4OCF A;  1OC3 A;  1EGO A;  3CMI A;  3KZQ A;  4G19 A;  4HZ2 A;  5JCW A;  5HQP A;  1M2D A;  4HS1 A;  4EF0 A;  3TOU A;  1B4P A;  5ABR A;  2NDO A;  2GQK A;  1ZYE A;  2WDU A;  2C80 A;  1O7U A;  1SJ6 A;  2TIR A;  5DVB A;  4BL7 A;  3TUE A;  2JSY A;  2L5O A;  3NOF A;  2YZH A;  2V6O A;  3UBK A;  3GX0 A;  2WFC A;  4MCU A;  3HA9 A;  1AW9 A;  1WE0 A;  2A2S A;  2M72 A;  1XXU A;  2L6D A;  2H1A A;  2QSI A;  4PQI A;  3F4S A;  3ZZX A;  5ENU A;  1GSF A;  3SBC A;  3APQ A;  4OFN A;  5GAN D;  2LJR A;  4TVE A;  3IPZ A;  4BVX A;  1R4W A;  3ZVJ D;  2OA7 A;  1A24 A;  1R5A A;  3EWL A;  1GSU A;  2H1G A;  3F6D A;  3RHB A;  4DVC A;  1TI3 A;  1FHE A;  2VL9 A;  5D9V A;  4TXO A;  2B5Y A;  1XFL A;  4HDE A;  4TXV A;  4TR0 A;  5A4V A;  2H70 A;  5FT3 A;  4KGI A;  5E59 A;  2V1M A;  2B6M A;  3PR8 A;  3F8U A;  1OC9 A;  5ECO B;  9GSS A;  2L6C A;  1HYU A;  5DJM A;  1A2M A;  3HZ4 A;  1WIK A;  2MYG A;  1OVN A;  5G1L A;  3DGQ A;  3GRX A;  4N11 A;  4WEY A;  2YJH A;  3BOA A;  2O7K A;  1JZR A;  2OJL A;  1A8L A;  3CBU A;  2I4A A;  1E2Y A;  3IBH A;  3FEU A;  2LEG A;  3A2V A;  4POK A;  2L57 A;  4IP1 A;  2MBS A;  4QL7 A;  4DSS B;  3N5O A;  4WF5 A;  5DAL B;  3QDN A;  1PX7 A;  1XOB A;  2FWG A;  4BA7 A;  5CRE A;  5EPF A;  1R7H A;  20GS A;  2IMK A;  2H6Z A;  3HVV A;  2GZY A;  2LV3 A;  3FZ4 A;  3EU4 A;  1U3A A;  1J0F A;  5JCG A;  2V32 A;  1EP8 A;  3Q18 A;  1W4V A;  2QGV A;  1Y25 A;  1UVZ A;  3BJ5 A;  4I2T A;  4K9Z A;  3WGD A;  1V2A A;  1PKW A;  5CRH A;  1NW2 A;  2D2Z A;  4ZIL A;  3H8Q A;  4BWS A;  1T7P B;  3LYP A;  3ED3 A;  4YQV A;  1X5E A;  3DML A;  4XIH A;  3D21 A;  4RI7 A;  1PMT A;  4LLR A;  2HNL A;  4GST A;  4DEJ A;  1WMJ A;  2DLX A;  3KM6 A;  1M2A A;  3D22 A;  2MMO A;  1XW6 A;  2I3Y A;  4CDO A;  2JL4 A;  5F06 A;  4RQR A;  1PSQ A;  2R5G A;  4POM A;  3G7Y A;  3U5R E;  3IK7 A;  3HJP A;  2YWI A;  3C1S A;  3UIW A;  1N2A A;  3P90 A;  2VCX A;  2JAC A;  2WJU A;  1ML6 A;  2RUE A;  2AHE A;  3VLN A;  5EL8 A;  3UAR A;  5KN2 A;  4WXT A;  1VF4 A;  2WCI A;  4BWQ A;  1SD8 A;  2H74 A;  3DRN A;  3F0I A;  4MJC A;  3F9U A;  6GSW A;  1GNW A;  2B7J A;  1K0M A;  1E6B A;  2R6K A;  3ZRD A;  3DXB A;  5ECK B;  1FO5 A;  1OC8 A;  1TW9 A;  4OD7 A;  1TK0 B;  3QPM A;  1AQV A;  2LRT A;  5ECS A;  5CAX A;  2HI7 A;  1F6M C;  2F3M A;  3W8J A;  2ES7 A;  1ZGN A;  2PMT A;  1AC1 A;  4MF7 A;  3EE2 A;  3RBT A;  3CSH A;  2FA4 A;  5G2Z A;  1JZO A;  2CX3 A;  3ZMK A;  1XW5 A;  4TW5 A;  3D5J A;  4WBJ A;  2YWM A;  1JZW A;  3LQ7 A;  1X9W B;  1SKW B;  2B7K A;  4KND A;  4WR5 A;  1ST9 A;  1FAA A;  3KMO A;  3WT2 A;  1XVW A;  4WET A;  3GL5 A;  3I43 A;  1MD4 A;  2FCH A;  2GSQ A;  4MPF A;  3Q74 A;  2OBI A;  4J56 E;  1YEP A;  2HE3 A;  3ZFL A;  1V9W A;  2AB6 A;  4DSS A;  1SK1 A;  2ZCT A;  4JR4 A;  3ZLP A;  2A4V A;  5DAL A;  5H5R A;  1HNB A;  2E7P A;  4FH8 A;  2V6K A;  3OR5 A;  2HRN A;  2KHP A;  2DSA A;  3KXO A;  1OE7 A;  1QK8 A;  5B7C A;  3ME8 A;  1AUC A;  4ML1 A;  4TR4 A;  3C7M A;  5AIS A;  3F3Q A;  2H1B A;  2L59 A;  5HR2 A;  5HR0 A;  2F8A A;  3SWL A;  2GTU A;  3FR6 A;  1WJK A;  5FWG A;  3FW2 A;  1GL8 A;  5IO0 A;  1XW9 A;  3QFB C;  4I5Q A;  2PWJ A;  1K3L A;  3G9B A;  3DWV A;  4BPY A;  1ZZY A;  3KP9 A;  2LUS A;  1M0U A;  3UEM A;  2N5A A;  2GT5 A;  2VCQ A;  2HSH A;  2O89 A;  1F9M A;  4PX1 A;  2PUK C;  1TJD A;  2VOC A;  1SL2 B;  16GS A;  2VD0 A;  2VLV A;  3EIN A;  3MWH A;  2K18 A;  2GZP A;  4KSM A;  4O7H A;  1Q98 A;  4IW9 A;  1XPV A;  2E2G A;  4EKZ A;  5DQY A;  2YWO A;  5DDL A;  1B9Y C;  2AV4 A;  1F37 A;  2E0Q A;  4XS1 A;  3RDW A;  3D4T A;  3L9V A;  18GS A;  2GT6 A;  2TRX A;  3VFI A;  2V41 A;  4WR4 A;  4KB3 A;  3BBY A;  2VUP A;  5D73 A;  5ECQ B;  3GKK A;  1B9X C;  4YQU A;  3MAK A;  4O32 A;  4MA9 A;  5IMC A;  2CAQ A;  1K0A A;  3F4R A;  4XCS A;  1XBS A;  2LS5 A;  3ERF A;  1EEJ A;  4OO4 A;  5ECP B;  1CQG A;  2VO4 A;  2XPD A;  5DQS A;  2LST A;  5ID2 B;  5IPG A;  3O76 A;  1TK8 B;  4F0B A;  3P8W A;  1VF1 A;  1O8W A;  2LQQ A;  4IP6 A;  1OC9 B;  1PGT A;  2MMA A;  2C0D A;  2LKU A;  2YJ7 A;  2M80 A;  1KNG A;  1BX9 A;  2IMD A;  2LRN A;  2NTO A;  4K7I A;  2P0G A;  3RHC A;  3ZRE A;  4AGS A;  5IIZ A;  3UMA A;  3TCO A;  2J9H A;  3P7X A;  3QCP A;  5INY A;  3O6T A;  3HVS A;  1MDI A;  2CZ2 A;  1AQW A;  2AAW A;  4LMW A;  4L8E A;  2L4C A;  1XOA A;  4L5L A;  3UOM A;  4PUA A;  1Z6N A;  4QQ7 A;  3L9U A;  2VM2 A;  4KUN A;  1HNA A;  3M0F A;  3H93 A;  4Q5N A;  3HHV A;  1YZX A;  4AJ7 A;  4XHM A;  3MNG A;  3UAP A;  5DJL A;  2H0G A;  5IMZ A;  4G2E A;  3FZA A;  3FR3 A;  1AAZ A;  1O81 A;  2G2Q A;  1YF1 A;  2PGT A;  2VL3 A;  5DAK A;  4PNG A;  5GAP D;  5ECL B;  3LOR A;  3QD9 A;  1F3B A;  1PN9 A;  3TJG A;  3FZ5 A;  5KN1 A;  4N10 A;  1TI1 A;  2C1Y A;  1M9B A;  1TOF A;  2DJK A;  2KOK A;  1QUW A;  5AGY A;  1K0B A;  2AYT A;  2P31 A;  4ID0 A;  3JCM L;  3HVX A;  1FVK A;  1W89 A;  1AQX A;  4MLY A;  4GWR A;  3RAZ A;  2LQO A;  5CRD A;  4NAX A;  5D8I A;  14GS A;  2H75 A;  3VI7 A;  1A0R P;  3EC3 A;  3Q6O A;  2DJ2 A;  4HU9 A;  3VPQ A;  1AXD A;  4HJM A;  3FY7 A;  4GQF A;  1B4Q A;  1Q4J A;  2GSS A;  5CRW A;  4HOJ A;  3BCI A;  1CQH A;  2K6V A;  3LJR A;  1XIY A;  2OBK A;  3KMN A;  3IHQ A;  4MMM A;  2QC7 A;  2MMN A;  3KTL A;  5ECH B;  1OYJ A;  2KLX A;  2YCD A;  3HZ8 A;  1JFU A;  1NSW A;  4JR6 A;  4NHZ A;  5GZZ B;  1UN2 A;  2HYX A;  2FNO A;  1I9D A;  1XCC A;  4KX4 A;  5ID2 A;  3ZIT A;  1TRS A;  2PBJ A;  3TJJ A;  3CTF A;  2EIO A;  2RM6 A;  1YQ1 A;  4IHU A;  3CSI A;  2H76 A;  3IAS 2;  2YV7 A;  3O3T A;  4POB A;  1TRV A;  2L5L A;  1U3I A;  4O92 A;  3RPN A;  3LXZ A;  1Z9H A;  5D96 A;  3F6F A;  4OFT A;  1RW1 A;  1O8X A;  1TRW A;  3CRU A;  3IC4 A;  4XS4 B;  4Q5R A;  1SD9 A;  1DUG A;  5GSS A;  4OO5 A;  2CQ9 A;  2HRF A;  2O85 A;  11GS A;  2YV9 A;  5HFK A;  3E0U A;  2RLI A;  3QAV A;  2KP2 A;  4O5R A;  1BQ7 A;  2LNS A;  3EMX A;  4JZQ A;  1JLV A;  4V1A p;  2N5B A;  1HD2 A;  1MDK A;  2C0F A;  2O8V B;  3GTU B;  4D73 B;  4KDX A;  3VK9 A;  1U88 A;  19GS A;  1X5D A;  3PH9 A;  2CVD A;  3US3 A;  3Q19 A;  4E8E A;  4MAB A;  1ERW A;  1TU8 A;  1YEX A;  5G1K A;  1NM3 A;  2B5E A;  3DYR A;  4FYC A;  2R4V A;  4ZB6 A;  1WOU A;  2FWH A;  4PGT A;  4Q5Q A;  5JWQ B;  4PUF C;  4GLT A;  1TXX A;  4ZBD A;  2F51 A;  4V2M A;  5IOX A;  3W6G A;  4HEA 2;  2NBS A;  1U6T A;  5HFG A;  5JWR B;  2BJX A;  4ZB8 A;  1KBN A;  2EIR A;  2HT9 A;  3LG6 A;  5IMV A;  1H75 A;  3CYN A;  3VWU A;  1H4O A;  3A5W A;  4ZL9 A;  1T4Y A;  3GL3 A;  4MJA A;  4KW6 A;  4ZL7 A;  1EZK A;  2LJK A;  1GUM A;  4PNF A;  1YY7 A;  4OFM A;  2F8F A;  4MF5 A;  1F2E A;  4GCI A;  1SL1 B;  3MSZ A;  2HZE A;  3I69 A;  1JZD A;  1VGL A;  4IBP A;  4ZL8 A;  1ZL9 A;  4E8H A;  3GNJ A;  3QR6 A;  3WD6 A;  1EEM A;  2VD1 A;  2H8L A;  1GWC A;  3DKS A;  3ZFB A;  1G0T A;  2MMZ A;  3L9S A;  4FO5 A;  3QFA C;  1V57 A;  4XS6 A;  4PQH A;  1YF0 A;  1KEB A;  3LEF A;  3ZIV A;  5HR1 A;  3FRC A;  4MJB A;  3IDV A;  2DJ3 A;  2XPE A;  5B8A A;  1GSD A;  1EWX A;  1GTI A;  1TTZ A;  1I5G A;  4GF0 A;  4EE0 A;  1QQ2 A;  3DVX A;  5HFI A;  1G6Y A;  5B6M A;  2VM1 A;  1BYE A;  2DMM A;  3FYG A;  2XC2 A;  4HZ4 A;  3HJO A;  5IM9 A;  4TR1 B;  3HD5 A;  4K1F A;  4HUA A;  3F63 A;  1MTC A;  3FHK A;  1U87 A;  3TKQ A;  2YN1 A;  5A5K A;  2IWT A;  3H4K A;  1V58 A;  2IN3 A;  3TRX A;  2H66 A;  1PL2 A;  2FLS A;  1G7O A;  3IK9 A;  4XS4 A;  3PGT A;  2C0E A;  3GKX A;  2GLR A;  1GSQ A;  1URM A;  3IXR A;  4ZBA A;  1FG4 A;  4MDC A;  4WF4 A;  3CXG A;  2VL2 A;  2NPB A;  13GS A;  1TP9 A;  4MZC A;  3IV4 A;  2BMX A;  1Z7R A;  3KCM A;  1SK0 A;  2OKA A;  2ZUP A;  3E3E A;  2C3Q A;  1XZO A;  3DD3 A;  2WB9 A;  3GTU A;  22GS A;  4D73 A;  2C8U A;  1SK2 A;  5JCU A;  4MPG A;  4ECC A;  3WT1 A;  3UJ1 A;  1OKT A;  2ALB A;  4AJ8 A;  4QL9 A;  1VRS D;  4EL1 A;  2C3T A;  5ECM B;  3GKN A;  2OE3 A;  2IMF A;  2XBI A;  4JE1 A;  1S3D A;  2IFQ B;  4GQC A;  2DJJ A;  3ZL5 A;  1XVQ A;  4CHS A;  4XTS A;  2YWN A;  2FWF A;  3DEX A;  3C8E A;  4IQA A;  1IYI A;  1DBY A;  4KCA A;  2YAN A;  5ECI B;  1XWB A;  5J3R A;  1FB0 A;  4EDZ A;  2FD3 A;  1C72 A;  2OE0 A;  1PKZ A;  5DAK B;  5B8B A;  3LWA A;  4GSS A;  2R37 A;  2GZZ A;  2GQM A;  2OAD A;  4TR3 A;  2N5F A;  4NV2 A;  3EUR A;  1QXH A;  4ZB9 A;  1GSE A;  3EVI A;  3IA1 A;  4NPB A;  1TRU A;  2O87 A;  2H6Y A;  3DIE A;  4GTU A;  2CAI A;  17GS A;  2YNX A;  1GSY A;  1A0F A;  2ON7 A;  5KN0 A;  2CV4 A;  2R2J A;  2KUC A;  4K0G A;  5G5E A;  4KDY A;  4Q5F A;  1J9B A;  3M9K A;  3UVT A;  4EDY A;  1MDJ A;  4RI6 A;  3GST A;  3A2W A;  3UL3 A;  5G5F A;  5CRG A;  2WZ9 A;  2IME A;  3KJY A;  1BG5 A;  2CX4 A;  2I1U A;  2DIY A;  2JSZ A;  2K9F A;  2JAD A;  1A23 A;  1FVJ A;  4HQS A;  4AF2 A;  5D9T A;  1V98 A;  4EO3 A;  4TR1 A;  1WRY A;  2P5Q A;  4MH3 A;  1FW1 A;  4JBB A;  1ZYQ B;  4F9Z A;  3IOS A;  2LTK A;  4MF6 A;  5DCH A;  3HJM A;  1ZCP A;  3AY8 A;  1EGR A;  4F0C A;  3QAG A;  1SYR A;  4KE3 A;  2LJA A;  3L78 A;  2XBQ A;  4BVY A;  3J7Y k;  1WP0 A;  4LL4 B;  4ILF A;  2VCV A;  2HSY A;  2CVB A;  4IJI A;  2HFD A;  3M8N A;  4TKY A;  1SYX A;  4X1U A;  6GSY A;  1T1V A;  4EC0 A;  5G31 A;  1RQM A;  4K7O A;  1GSS A;  1TKD B;  1GTA A;  1SL0 B;  4I6X A;  3W8S A;  4L5O A;  1R5P A;  2R3X A;  1GLP A;  1DSB A;  5COH A;  1T4Z A;  4XRD A;  3TKS E;  1KTE A;  2M46 A;  5HR3 A;  2IFQ A;  1GUL A;  4TRX A;  3TKP A;  4I97 A;  2FGX A;  5L71 A;  4PQ1 A;  1BAY A;  2GST A;  1AIU A;  4YQM A;  3N9J A;  1VF3 A;  1JLW A;  1MEK A;  4NXI A;  5IMF A;  1XWC A;  2DBC A;  2CVK A;  4JED A;  2LNT A;  2KP1 A;  3KGK A;  3M3M A;  6GSX A;  4LL1 B;  2H71 A;  3TKS A;  1B8X A;  3IR4 A;  5J9C A;  6GSV A;  1YDK A;  4POL A;  2VCZ A;  2MBT A;  4YAV A;  3KH7 A;  4ZIJ A;  2VL2 C;  5AN1 A;  3GH6 A;  4TOP A;  2CZ3 A;  4F2I A;  1SEN A;  2GVP A;  3LGC A;  3U6V A;  3HY2 A;  1J08 A;  1SJI A;  5KN3 A;  3FKF A;  5C00 A;  3J7Y b;  2DJ1 A;  2X99 A;  3MDK A;  2IL3 A;  4OCE A;  2HZE B;  2HLS A;  4LA1 A;  1IYH A;  4F82 A;  1Z6M A;  5F07 A;  1LU4 A;  1G6W A;  1M7T A;  3KEB A;  3C1R A;  3V1W A;  4X43 A;  2IMI A;  2J23 A;  2I9H A;  4YH2 A;  2Z9S A;  5F8B A;  2GQL A;  4MJE A;  3IRA A;  3VWW A;  3D0Z A;  5IMD A;  1O85 A;  5D9X A;  1FB6 A;  3K8N A;  3KTB A;  4HQZ A;  1T8E B;  2WGR A;  3GHA A;  1QFN A;  2REM A;  4N0V A;  3TDG A;  1PQN A;  4MH2 A;  3HYP A;  1GP1 A;  2HXK A;  5H5Q A;  4DSR A;  4IQ1 A;  5ELA A;  2H72 A;  3WGE A;  3M1G A;  2H73 A;  3WYW A;  3BCK A;  1DE2 A;  4ECB A;  4XRA A;  5DBQ A;  3VPT A;  4V2N A;  5A4W A;  5IMA A;  4KDU A;  3TB2 A;  4KCE A;  3EU3 A;  3CRT A;  3TJF A;  2H6X A;  3ISO A;  3EMP A;  2IPA A;  3KIJ A;  1NHO A;  5CP1 A;  2VAF A;  3ERW A;  1GNE A;  4K2D A;  1YKC A;  1ERT A;  1EV4 A;  1OKD A;  3R2Q A;  4KA0 A;  4RQX A;  3TKR A;  4K0N A;  1TK5 B;  2TRC P;  1WPI A;  2YPM A;  4FYU A;  5CNW A;  3QOU A;  6GST A;  4FIW A;  3H79 A;  2AJQ B;  2I81 A;  2C3N A;  2DJ0 A;  3KD0 A;  1ZOF A;  4J57 E;  2RII A;  3APO A;  2B3S A;  1XWG A;  2FWE A;  4IEL A;  3ZIJ A;  2FY6 A;  3QAW A;  2H0H A;  3LSZ A; 
#chains in the Genus database with same CATH topology
 4ML6 A;  4LMV A;  5FHI A;  4GXZ A;  4HI7 A;  5GST A;  4N30 A;  3VWX A;  4K7N A;  1K3Y A;  2PVO C;  2VLU A;  4NMU A;  1GRX A;  3M9J A;  4HJ2 A;  3GIX A;  4NHW A;  5B6N A;  4KH7 A;  1ZMA A;  3KP8 A;  4P3Y B;  3UBL A;  2MZC A;  4G0L A;  1A2J A;  1X9S B;  4GSN A;  2H19 A;  3GX8 A;  3GA4 A;  3F4T A;  4MZW A;  4ACS A;  2HSM A;  1UC7 A;  3TJK A;  2DIZ A;  4ECI A;  3G7I A;  1EP7 A;  4L0W A;  1THO A;  1K3O A;  3APS A;  1X5C A;  1FOV A;  6GSS A;  5D93 A;  3QMX A;  3ZTL A;  2YOI A;  4AJ6 A;  1PX6 A;  3PIN A;  1PA3 A;  3VWV A;  3GSS A;  5EY6 A;  3GUR A;  2JZR A;  4OWY A;  3D6I A;  1GUK A;  4I8B A;  3GH9 A;  1YJ6 A;  2E2M A;  3L0H A;  1QGV A;  3RPP A;  2F9S A;  2X64 A;  2X8H A;  1O73 A;  1EOH A;  3ZYW A;  4K5S A;  4ECJ A;  4IKH A;  3UVH A;  1Z5Y E;  4IVF A;  2EC4 A;  3TKS C;  3LYK A;  2PN8 A;  3TGZ A;  2B5X A;  1SKR B;  2DML A;  1M9A A;  4ZBB A;  4HU7 A;  2XHF A;  1HQO A;  1MD3 A;  2JZT A;  1PL1 A;  3CTG A;  1X9M B;  2V2G A;  1GH2 A;  4EXJ A;  5IPH A;  1DE1 A;  3LFL A;  5AIV A;  5C04 A;  2QKE A;  2BTO T;  1GLQ A;  1QMV A;  4IGJ A;  1G7E A;  3GN3 A;  3HVN A;  2PU9 C;  2VCW A;  2H01 A;  3HCZ A;  3NIV A;  5F05 A;  5J41 A;  1BJX A;  2HRA A;  1ERU A;  1TU7 A;  4BVY B;  2L4Q A;  2VLT A;  3VI5 A;  2WS2 A;  2P5R A;  4J2F A;  4MP4 A;  4JRR A;  5IQY A;  4TN8 A;  3C73 A;  3MYD A;  1K0C A;  4IN0 A;  5E4W A;  2LRC A;  3FR9 A;  4YAP A;  1EV9 A;  1ON4 A;  3HDC A;  1Y6E A;  5G30 A;  2A2R A;  1S3C A;  3GUS A;  4Z7X A;  1Z3E A;  5KEJ A;  5DCG A;  3HKR A;  4X0X A;  1EOG A;  1B48 A;  4KAE A;  4IS0 A;  4V1A g;  2NVL A;  4FYB A;  1PD2 1;  4NV5 A;  2PVQ A;  3TRQ A;  5J9B A;  2WUL A;  5CO3 A;  1JHB A;  1VF2 A;  3ZVJ A;  3GFK A;  3A3T A;  1SKS B;  5BRT A;  1WWJ A;  5ELG A;  2IIY A;  2DC5 A;  3A5I A;  2GS3 A;  2YZU A;  1OE8 A;  2B1L A;  5LCZ A;  4WKW A;  2PPT A;  4V2L A;  1M2B A;  1T3B A;  4PXO A;  3S9F A;  1YKA A;  2C0G A;  3NZN A;  4EVM A;  1N8J A;  4L0U A;  4MK3 A;  1SJZ A;  5EVO A;  1ZYN A;  2JU5 A;  2CA8 A;  4H86 A;  5IOW A;  1UA5 A;  1X0R A;  7GSS A;  2FUG 2;  4JU5 A;  6GSU A;  5LNK e;  2X8C A;  4WBR D;  3GKM A;  4I2U A;  2GSR A;  5F0G A;  5A4U A;  4K8M A;  3A2X A;  3TOT A;  2RM5 A;  5BMU A;  3G7J A;  2GGT A;  3H1N A;  2G0F A;  2PER A;  1ERV A;  2IJY A;  5IO2 A;  3LXT A;  3GYK A;  1USB A;  1ACV A;  4PUR A;  2YP6 A;  1HNC A;  1A8Y A;  4KSO A;  3BD2 A;  4GRF A;  4F03 A;  3TRP A;  1XWA A;  4K6X A;  2H1D A;  5CYY A;  2RUF A;  10GS A;  1O6J A;  5H5S A;  3ME7 A;  4ISD A;  2EIQ A;  1PRX A;  4BVX B;  3I9V 2;  4G9H A;  3I6A A;  3E9J B;  2AUV A;  4NWY A;  1THX A;  5LD0 A;  3EYT A;  1F3A A;  2FHE A;  2CT6 A;  1GTB A;  2JZS A;  2WRT A;  3ZML A;  4TXO B;  1BED A;  3D4M A;  3F3R A;  1GTU A;  2GDR A;  5ECR B;  3GV1 A;  3IE3 A;  5D9W A;  4N0Z A;  2C4J A;  1K0D A;  1A2L A;  4G10 A;  1GUH A;  2B1K A;  3P2A A;  3VUR A;  4FQU A;  3IAM 2;  1XWK A;  3C71 A;  1LBK A;  5J4U A;  3WGX A;  5J5N A;  3HXS A;  2FA8 A;  1K0O A;  1Z7P A;  3CSJ A;  1RK4 A;  1LJR A;  4CW9 A;  4MZB A;  3DVW A;  4ULX A;  8GSS A;  2VCT A;  1M99 A;  4EUY A;  5ECN B;  1S3A A;  1TDI A;  3TJB A;  4DSQ A;  3KH9 A;  2VIM A;  1SU9 A;  2K8V A;  1OAZ A;  4RUV A;  1R26 A;  4IJ3 A;  12GS A;  2OE1 A;  1V40 A;  2OAC A;  1NHY A;  1ILO A;  4ZXG A;  2H0I A;  2ON5 A;  3FK8 A;  2H30 A;  4OMV A;  2DKI A;  2X8G A;  3L4N A;  3ERG A;  1T00 A;  1ABA A;  1K0N A;  3GMF A;  2ZNM A;  5JWO B;  2HZF A;  3FZ9 A;  5AIX A;  2K8S A;  4OCF A;  1OC3 A;  1EGO A;  3CMI A;  3KZQ A;  2X49 A;  4G19 A;  4HZ2 A;  5JCW A;  5HQP A;  1M2D A;  4HS1 A;  4EF0 A;  3TOU A;  1B4P A;  5ABR A;  2NDO A;  2GQK A;  1ZYE A;  2WDU A;  2C80 A;  1O7U A;  1SJ6 A;  2TIR A;  5DVB A;  4BL7 A;  3TUE A;  2JSY A;  2L5O A;  3NOF A;  2YZH A;  2V6O A;  3UBK A;  3GX0 A;  2WFC A;  4MCU A;  3HA9 A;  1AW9 A;  1WE0 A;  2A2S A;  2M72 A;  1XXU A;  2L6D A;  2H1A A;  2QSI A;  4PQI A;  3F4S A;  3ZZX A;  5ENU A;  1GSF A;  3SBC A;  3APQ A;  4OFN A;  5GAN D;  2LJR A;  4TVE A;  3IPZ A;  4BVX A;  1R4W A;  3ZVJ D;  2OA7 A;  1A24 A;  1R5A A;  3EWL A;  1GSU A;  2H1G A;  3F6D A;  3RHB A;  4DVC A;  1TI3 A;  1FHE A;  2VL9 A;  5D9V A;  4TXO A;  4YKF A;  2B5Y A;  1XFL A;  4HDE A;  4TXV A;  4O5U A;  4TR0 A;  5A4V A;  2H70 A;  5FT3 A;  1PFO A;  4KGI A;  5E59 A;  2V1M A;  2B6M A;  3PR8 A;  3F8U A;  1OC9 A;  3IC8 A;  5ECO B;  9GSS A;  2L6C A;  1HYU A;  3HZ4 A;  1A2M A;  5DJM A;  1WIK A;  2MYG A;  1OVN A;  5G1L A;  3DGQ A;  3GRX A;  4N11 A;  4WEY A;  2YJH A;  3BOA A;  2O7K A;  1JZR A;  2OJL A;  1A8L A;  3CBU A;  2I4A A;  1E2Y A;  3IBH A;  3FEU A;  2LEG A;  3A2V A;  4POK A;  2R0C A;  2L57 A;  4IP1 A;  2MBS A;  4QL7 A;  4DSS B;  3N5O A;  2UZ8 A;  4WF5 A;  5DAL B;  3QDN A;  1PX7 A;  1XOB A;  2FWG A;  4BA7 A;  5CRE A;  5EPF A;  1R7H A;  20GS A;  2IMK A;  2H6Z A;  3HVV A;  2GZY A;  2LV3 A;  3FZ4 A;  3EU4 A;  1U3A A;  1J0F A;  5JCG A;  2V32 A;  1EP8 A;  3Q18 A;  1W4V A;  2QGV A;  1Y25 A;  1UVZ A;  3BJ5 A;  4I2T A;  4K9Z A;  3WGD A;  1V2A A;  1PKW A;  5CRH A;  1NW2 A;  2D2Z A;  4ZIL A;  3H8Q A;  4BWS A;  1T7P B;  3LYP A;  3ED3 A;  4YQV A;  1X5E A;  3DML A;  4XIH A;  3D21 A;  4RI7 A;  1PMT A;  4LLR A;  2HNL A;  4GST A;  4DEJ A;  1WMJ A;  2DLX A;  3KM6 A;  1M2A A;  3D22 A;  2MMO A;  1XW6 A;  2I3Y A;  4CDO A;  2JL4 A;  5F06 A;  4RQR A;  1PSQ A;  2R5G A;  4Z2R A;  4POM A;  3G7Y A;  3U5R E;  3IK7 A;  3HJP A;  2YWI A;  3C1S A;  3UIW A;  1N2A A;  3P90 A;  2VCX A;  2JAC A;  2WJU A;  1ML6 A;  2RUE A;  2AHE A;  3VLN A;  5EL8 A;  3UAR A;  5KN2 A;  4WXT A;  1VF4 A;  2WCI A;  4BWQ A;  1SD8 A;  2H74 A;  3DRN A;  5KOX A;  3F0I A;  4MJC A;  3F9U A;  6GSW A;  1GNW A;  2B7J A;  1K0M A;  1E6B A;  2R6K A;  3ZRD A;  4EIQ A;  3DXB A;  5ECK B;  1FO5 A;  1OC8 A;  1TW9 A;  4OD7 A;  1TK0 B;  3QPM A;  1AQV A;  2LRT A;  5ECS A;  5CAX A;  2HI7 A;  1F6M C;  2F3M A;  3W8J A;  2ES7 A;  1ZGN A;  2PMT A;  1AC1 A;  4PTS A;  4MF7 A;  3EE2 A;  3RBT A;  3CSH A;  2FA4 A;  5G2Z A;  1JZO A;  2CX3 A;  3ZMK A;  1XW5 A;  4TW5 A;  2A2P A;  3D5J A;  3PPU A;  4WBJ A;  2YWM A;  1JZW A;  3LQ7 A;  1X9W B;  1SKW B;  2B7K A;  4KND A;  4WR5 A;  1ST9 A;  1FAA A;  3KMO A;  3WT2 A;  1XVW A;  4WET A;  3GL5 A;  3I43 A;  1MD4 A;  2FCH A;  2GSQ A;  4MPF A;  3Q74 A;  2OBI A;  4J56 E;  1YEP A;  2HE3 A;  3ZFL A;  1V9W A;  2AB6 A;  4DSS A;  1SK1 A;  2ZCT A;  4JR4 A;  3ZLP A;  2A4V A;  5DAL A;  5H5R A;  1HNB A;  2E7P A;  4FH8 A;  2A4H A;  2V6K A;  3OR5 A;  2HRN A;  2KHP A;  2DSA A;  3KXO A;  4Z2T A;  1OE7 A;  1QK8 A;  5B7C A;  4G0K A;  3ME8 A;  1AUC A;  4ML1 A;  4TR4 A;  3C7M A;  5AIS A;  3F3Q A;  2H1B A;  2X4A A;  2L59 A;  5HR2 A;  5HR0 A;  2F8A A;  2R0P A;  3SWL A;  2GTU A;  3FR6 A;  1WJK A;  5FWG A;  3FW2 A;  1GL8 A;  5IO0 A;  1XW9 A;  3QFB C;  4I5Q A;  2PWJ A;  1K3L A;  3G9B A;  3DWV A;  4BPY A;  4K2X A;  1ZZY A;  3KP9 A;  2LUS A;  1M0U A;  3UEM A;  2N5A A;  2GT5 A;  2VCQ A;  2HSH A;  2O89 A;  1F9M A;  4PX1 A;  4BL7 B;  2PUK C;  1TJD A;  2VOC A;  1SL2 B;  2HRK A;  16GS A;  2QA2 A;  2VD0 A;  2VLV A;  3EIN A;  3MWH A;  2K18 A;  2GZP A;  4KSM A;  4O7H A;  1Q98 A;  4IW9 A;  1XPV A;  2E2G A;  4EKZ A;  5DQY A;  2YWO A;  5DDL A;  1B9Y C;  2AV4 A;  4CY6 A;  1F37 A;  2E0Q A;  4XS1 A;  3RDW A;  1XG8 A;  3D4T A;  3L9V A;  18GS A;  2GT6 A;  2TRX A;  3VFI A;  2V41 A;  4WR4 A;  4KB3 A;  3BBY A;  2VUP A;  5D73 A;  5ECQ B;  3GKK A;  1B9X C;  4YQU A;  3MAK A;  4O32 A;  4MA9 A;  5IMC A;  2CAQ A;  1K0A A;  3F4R A;  4XCS A;  1XBS A;  2LS5 A;  3ERF A;  1EEJ A;  4OO4 A;  5ECP B;  1CQG A;  2VO4 A;  2XPD A;  5DQS A;  2LST A;  5ID2 B;  1M3J A;  5IPG A;  3O76 A;  1TK8 B;  4F0B A;  3P8W A;  1VF1 A;  1O8W A;  2LQQ A;  4IP6 A;  1OC9 B;  1PGT A;  2MMA A;  2C0D A;  2LKU A;  2YJ7 A;  3IHG A;  2M80 A;  1KNG A;  1BX9 A;  2IMD A;  2LRN A;  2NTO A;  4K7I A;  2P0G A;  3RHC A;  3ZRE A;  4AGS A;  4A5P A;  5IIZ A;  3UMA A;  3TCO A;  2J9H A;  3P7X A;  3QCP A;  5INY A;  3O6T A;  3HVS A;  1MDI A;  2CZ2 A;  1AQW A;  2AAW A;  4LMW A;  4L8E A;  2L4C A;  1XOA A;  4L5L A;  3UOM A;  4PUA A;  1Z6N A;  4QQ7 A;  3L9U A;  2VM2 A;  4KUN A;  1HNA A;  3M0F A;  3H93 A;  4Q5N A;  3HHV A;  1YZX A;  4AJ7 A;  4XHM A;  3MNG A;  3UAP A;  5DJL A;  2H0G A;  5IMZ A;  4G2E A;  3FZA A;  3FR3 A;  4ICY A;  1AAZ A;  1O81 A;  1S3R A;  2G2Q A;  1YF1 A;  2PGT A;  2VL3 A;  5DAK A;  4PNG A;  5GAP D;  5ECL B;  3LOR A;  3QD9 A;  1F3B A;  1PN9 A;  3TJG A;  3FZ5 A;  5KN1 A;  4N10 A;  1TI1 A;  2C1Y A;  1M9B A;  1TOF A;  2DJK A;  2KOK A;  1QUW A;  5AGY A;  1K0B A;  2AYT A;  2P31 A;  4ID0 A;  3JCM L;  3HVX A;  1FVK A;  1W89 A;  1AQX A;  4MLY A;  4GWR A;  3RAZ A;  2LQO A;  5CRD A;  4NAX A;  5D8I A;  14GS A;  2H75 A;  3VI7 A;  1A0R P;  3EC3 A;  3Q6O A;  2DJ2 A;  4HU9 A;  3VPQ A;  1AXD A;  4YKG A;  4HJM A;  3FY7 A;  4GQF A;  1B4Q A;  1Q4J A;  2GSS A;  5CRW A;  4HOJ A;  3BCI A;  1CQH A;  2K6V A;  3LJR A;  1XIY A;  2OBK A;  3KMN A;  3IHQ A;  4MMM A;  2QC7 A;  2MMN A;  3KTL A;  5ECH B;  1OYJ A;  2KLX A;  2YCD A;  3HZ8 A;  1JFU A;  1NSW A;  4JR6 A;  4NHZ A;  5GZZ B;  1UN2 A;  2HYX A;  2FNO A;  1I9D A;  3CQF A;  1XCC A;  4KX4 A;  5ID2 A;  3ZIT A;  1TRS A;  2PBJ A;  3TJJ A;  3CTF A;  2EIO A;  2RM6 A;  1YQ1 A;  4IHU A;  3CSI A;  2H76 A;  3IAS 2;  2YV7 A;  3O3T A;  4POB A;  1TRV A;  2L5L A;  1U3I A;  4O92 A;  3RPN A;  3LXZ A;  1Z9H A;  5D96 A;  3F6F A;  4OFT A;  1RW1 A;  1O8X A;  1TRW A;  3CRU A;  3IC4 A;  4XS4 B;  4Q5R A;  1SD9 A;  1DUG A;  5GSS A;  4OO5 A;  2CQ9 A;  2HRF A;  2O85 A;  11GS A;  2YV9 A;  5HFK A;  3E0U A;  2RLI A;  3QAV A;  2KP2 A;  4O5R A;  1BQ7 A;  2LNS A;  3EMX A;  4JZQ A;  1JLV A;  4V1A p;  2N5B A;  1HD2 A;  1MDK A;  2C0F A;  2O8V B;  3GTU B;  4D73 B;  4KDX A;  3VK9 A;  1PN0 A;  1U88 A;  1X5D A;  19GS A;  3PH9 A;  2CVD A;  3US3 A;  3Q19 A;  4E8E A;  4MAB A;  1ERW A;  3LW9 A;  1TU8 A;  1YEX A;  5G1K A;  1NM3 A;  2B5E A;  3DYR A;  4FYC A;  2R4V A;  4ZB6 A;  1WOU A;  1FOH A;  2FWH A;  4PGT A;  4Q5Q A;  5JWQ B;  4PUF C;  4GLT A;  1TXX A;  4ZBD A;  2F51 A;  4V2M A;  5IOX A;  3W6G A;  4HEA 2;  2NBS A;  1U6T A;  5HFG A;  5JWR B;  4CY8 A;  2BJX A;  4ZB8 A;  1KBN A;  2EIR A;  2HT9 A;  3LG6 A;  5IMV A;  1H75 A;  3CYN A;  3VWU A;  1H4O A;  3A5W A;  4ZL9 A;  1T4Y A;  3GL3 A;  4MJA A;  4KW6 A;  4ZL7 A;  1EZK A;  2LJK A;  1GUM A;  4PNF A;  1YY7 A;  4OFM A;  2F8F A;  4MF5 A;  1F2E A;  4GCI A;  1SL1 B;  3MSZ A;  2HZE A;  3I69 A;  1JZD A;  1VGL A;  4IBP A;  4ZL8 A;  1ZL9 A;  4E8H A;  3GNJ A;  3QR6 A;  3WD6 A;  1EEM A;  2VD1 A;  2H8L A;  1GWC A;  3DKS A;  3ZFB A;  1G0T A;  2MMZ A;  3L9S A;  4FO5 A;  3QFA C;  1V57 A;  4XS6 A;  4PQH A;  1YF0 A;  1KEB A;  3LEF A;  3ZIV A;  5HR1 A;  3FRC A;  4EIP A;  4MJB A;  3IDV A;  2DJ3 A;  2XPE A;  5B8A A;  1GSD A;  4G0I A;  1EWX A;  1GTI A;  1TTZ A;  1I5G A;  4GF0 A;  4EE0 A;  1QQ2 A;  3DVX A;  5HFI A;  1G6Y A;  5B6M A;  2VM1 A;  1BYE A;  2DMM A;  3FYG A;  2XC2 A;  4HZ4 A;  3HJO A;  5IM9 A;  4TR1 B;  3HD5 A;  4K1F A;  4HUA A;  3F63 A;  1MTC A;  3FHK A;  4X4J A;  1U87 A;  3TKQ A;  2YN1 A;  5A5K A;  2IWT A;  3H4K A;  1V58 A;  2IN3 A;  3TRX A;  2H66 A;  1PL2 A;  2FLS A;  1G7O A;  3IK9 A;  4XS4 A;  3PGT A;  2C0E A;  3GKX A;  2GLR A;  1GSQ A;  1URM A;  3IXR A;  4ZBA A;  1FG4 A;  4MDC A;  4WF4 A;  3CXG A;  2VL2 A;  2NPB A;  13GS A;  1TP9 A;  4MZC A;  3IV4 A;  2BMX A;  1Z7R A;  3KCM A;  4Z2U A;  1SK0 A;  2OKA A;  2ZUP A;  3E3E A;  2C3Q A;  1XZO A;  3DD3 A;  2WB9 A;  3GTU A;  22GS A;  4D73 A;  2C8U A;  1SK2 A;  5JCU A;  4MPG A;  4ECC A;  3WT1 A;  3UJ1 A;  1OKT A;  2ALB A;  4AJ8 A;  4QL9 A;  1VRS D;  4EL1 A;  2C3T A;  5ECM B;  3GKN A;  2OE3 A;  2IMF A;  2XBI A;  4JE1 A;  1S3D A;  2IFQ B;  4GQC A;  2DJJ A;  3ZL5 A;  1XVQ A;  4CHS A;  4XTS A;  2YWN A;  2FWF A;  3DEX A;  4KF9 A;  3C8E A;  4IQA A;  1IYI A;  1DBY A;  4KCA A;  2YAN A;  5ECI B;  1XWB A;  5J3R A;  1FB0 A;  4EDZ A;  2FD3 A;  1C72 A;  2OE0 A;  1PKZ A;  5DAK B;  5B8B A;  3LWA A;  4GSS A;  2R37 A;  2GZZ A;  2GQM A;  2OAD A;  4TR3 A;  2N5F A;  4NV2 A;  3EUR A;  1QXH A;  4ZB9 A;  1GSE A;  3EVI A;  3IA1 A;  4NPB A;  1TRU A;  2O87 A;  2H6Y A;  3DIE A;  4GTU A;  2CAI A;  17GS A;  2YNX A;  1GSY A;  1A0F A;  2ON7 A;  5KN0 A;  2CV4 A;  2R2J A;  2KUC A;  4K0G A;  5G5E A;  4KDY A;  4Q5F A;  1J9B A;  3M9K A;  3UVT A;  4EDY A;  1MDJ A;  4RI6 A;  3GST A;  3A2W A;  3UL3 A;  5G5F A;  5CRG A;  2WZ9 A;  2IME A;  3KJY A;  1BG5 A;  2CX4 A;  2I1U A;  2DIY A;  2JSZ A;  2K9F A;  4HSC X;  2JAD A;  1A23 A;  1FVJ A;  4HQS A;  4AF2 A;  5D9T A;  1V98 A;  4EO3 A;  4TR1 A;  1WRY A;  5KOW A;  2P5Q A;  4MH3 A;  1FW1 A;  4JBB A;  1ZYQ B;  4F9Z A;  3IOS A;  2LTK A;  4MF6 A;  5DCH A;  3HJM A;  1ZCP A;  3AY8 A;  1EGR A;  4F0C A;  3QAG A;  1SYR A;  4KE3 A;  2LJA A;  3L78 A;  2XBQ A;  4BVY A;  3J7Y k;  1WP0 A;  4LL4 B;  4ILF A;  2VCV A;  2HSY A;  2CVB A;  4IJI A;  2HFD A;  3M8N A;  4TKY A;  1SYX A;  4X1U A;  6GSY A;  1T1V A;  4EC0 A;  5G31 A;  1RQM A;  1ZYP A;  4K7O A;  1GSS A;  1TKD B;  1GTA A;  1SL0 B;  4I6X A;  3W8S A;  4L5O A;  1R5P A;  2R3X A;  4O5Q A;  1GLP A;  1DSB A;  5COH A;  1T4Z A;  4XRD A;  3TKS E;  1KTE A;  2M46 A;  5HR3 A;  2IFQ A;  1GUL A;  4TRX A;  3TKP A;  4I97 A;  2FGX A;  5L71 A;  4PQ1 A;  1BAY A;  2GST A;  1AIU A;  4YQM A;  3N9J A;  1VF3 A;  1JLW A;  1MEK A;  4NXI A;  5IMF A;  1XWC A;  2DBC A;  2CVK A;  4JED A;  2LNT A;  2KP1 A;  3KGK A;  3M3M A;  6GSX A;  4LL1 B;  2H71 A;  3TKS A;  1B8X A;  3IR4 A;  5J9C A;  6GSV A;  1YDK A;  4POL A;  2VCZ A;  2MBT A;  4YAV A;  3KH7 A;  4ZIJ A;  2VL2 C;  5AN1 A;  3GH6 A;  4TOP A;  2CZ3 A;  4K5R A;  4F2I A;  1SEN A;  2GVP A;  3LGC A;  3U6V A;  3HY2 A;  1J08 A;  1SJI A;  5KN3 A;  3FKF A;  3MIX A;  5C00 A;  3J7Y b;  4MNN A;  2DJ1 A;  2X99 A;  3MDK A;  2IL3 A;  4OCE A;  2HZE B;  2HLS A;  4LA1 A;  1IYH A;  4F82 A;  1Z6M A;  5F07 A;  2QA1 A;  1LU4 A;  3FMW A;  1G6W A;  1M7T A;  3KEB A;  3C1R A;  3V1W A;  4X43 A;  2IMI A;  2J23 A;  2I9H A;  4YH2 A;  2Z9S A;  5F8B A;  2GQL A;  4MJE A;  3R3E A;  4USS A;  3IRA A;  3VWW A;  2R0G A;  3D0Z A;  5IMD A;  1O85 A;  5D9X A;  1FB6 A;  3K8N A;  3KTB A;  4HQZ A;  1T8E B;  2WGR A;  3GHA A;  1QFN A;  2REM A;  4N0V A;  3TDG A;  1PQN A;  4MH2 A;  3HYP A;  1GP1 A;  2HXK A;  5H5Q A;  4DSR A;  4IQ1 A;  5ELA A;  2H72 A;  3WGE A;  3M1G A;  1M3I A;  2H73 A;  3WYW A;  3BCK A;  1DE2 A;  4ECB A;  4XRA A;  5DBQ A;  4BIK A;  3VPT A;  4V2N A;  5A4W A;  5IMA A;  4KDU A;  3TB2 A;  4KCE A;  3EU3 A;  3CRT A;  3TJF A;  2H6X A;  3ISO A;  3EMP A;  2IPA A;  3KIJ A;  1NHO A;  5CP1 A;  2VAF A;  3ERW A;  1GNE A;  4K2D A;  1YKC A;  1ERT A;  1EV4 A;  1OKD A;  3R2Q A;  2DKH A;  4KA0 A;  4RQX A;  3TKR A;  4K0N A;  1TK5 B;  2TRC P;  1WPI A;  2YPM A;  4FYU A;  5CNW A;  3QOU A;  6GST A;  4FIW A;  3H79 A;  2AJQ B;  2I81 A;  2C3N A;  3EPT A;  2DJ0 A;  3KD0 A;  1ZOF A;  4J57 E;  2RII A;  3APO A;  2B3S A;  1XWG A;  2FWE A;  4IEL A;  3ZIJ A;  2FY6 A;  3QAW A;  2H0H A;  3LSZ A; 
#chains in the Genus database with same CATH homology
 4ML6 A;  4LMV A;  5FHI A;  4GXZ A;  4HI7 A;  5GST A;  4N30 A;  3VWX A;  4K7N A;  1K3Y A;  2PVO C;  2VLU A;  4NMU A;  1GRX A;  3M9J A;  4HJ2 A;  3GIX A;  4NHW A;  5B6N A;  4KH7 A;  1ZMA A;  3KP8 A;  4P3Y B;  3UBL A;  2MZC A;  4G0L A;  1A2J A;  1X9S B;  4GSN A;  2H19 A;  3GX8 A;  3GA4 A;  3F4T A;  4MZW A;  4ACS A;  2HSM A;  1UC7 A;  3TJK A;  2DIZ A;  4ECI A;  3G7I A;  1EP7 A;  4L0W A;  1THO A;  1K3O A;  3APS A;  1X5C A;  1FOV A;  6GSS A;  5D93 A;  3QMX A;  3ZTL A;  2YOI A;  4AJ6 A;  1PX6 A;  3PIN A;  1PA3 A;  3VWV A;  3GSS A;  5EY6 A;  3GUR A;  2JZR A;  4OWY A;  3D6I A;  1GUK A;  4I8B A;  3GH9 A;  1YJ6 A;  2E2M A;  3L0H A;  1QGV A;  3RPP A;  2F9S A;  2X64 A;  2X8H A;  1O73 A;  1EOH A;  3ZYW A;  4K5S A;  4ECJ A;  4IKH A;  3UVH A;  1Z5Y E;  4IVF A;  2EC4 A;  3TKS C;  3LYK A;  2PN8 A;  3TGZ A;  2B5X A;  1SKR B;  2DML A;  1M9A A;  4ZBB A;  4HU7 A;  2XHF A;  1HQO A;  1MD3 A;  2JZT A;  1PL1 A;  3CTG A;  1X9M B;  2V2G A;  1GH2 A;  4EXJ A;  5IPH A;  1DE1 A;  3LFL A;  5AIV A;  5C04 A;  2QKE A;  2BTO T;  1GLQ A;  1QMV A;  4IGJ A;  1G7E A;  3GN3 A;  2PU9 C;  2VCW A;  2H01 A;  3HCZ A;  3NIV A;  5F05 A;  5J41 A;  1BJX A;  2HRA A;  1ERU A;  1TU7 A;  4BVY B;  2L4Q A;  2VLT A;  3VI5 A;  2WS2 A;  2P5R A;  4J2F A;  4MP4 A;  4JRR A;  5IQY A;  4TN8 A;  3C73 A;  3MYD A;  1K0C A;  4IN0 A;  5E4W A;  2LRC A;  3FR9 A;  4YAP A;  1EV9 A;  1ON4 A;  3HDC A;  1Y6E A;  5G30 A;  2A2R A;  1S3C A;  3GUS A;  4Z7X A;  1Z3E A;  5KEJ A;  5DCG A;  3HKR A;  4X0X A;  1EOG A;  1B48 A;  4KAE A;  4IS0 A;  4V1A g;  2NVL A;  4FYB A;  1PD2 1;  4NV5 A;  2PVQ A;  3TRQ A;  5J9B A;  2WUL A;  5CO3 A;  1JHB A;  1VF2 A;  3ZVJ A;  3GFK A;  3A3T A;  1SKS B;  5BRT A;  1WWJ A;  5ELG A;  2IIY A;  2DC5 A;  3A5I A;  2GS3 A;  2YZU A;  1OE8 A;  2B1L A;  5LCZ A;  4WKW A;  2PPT A;  4V2L A;  1M2B A;  1T3B A;  4PXO A;  3S9F A;  1YKA A;  2C0G A;  3NZN A;  4EVM A;  1N8J A;  4L0U A;  4MK3 A;  1SJZ A;  5EVO A;  1ZYN A;  2JU5 A;  2CA8 A;  4H86 A;  5IOW A;  1UA5 A;  1X0R A;  7GSS A;  2FUG 2;  4JU5 A;  6GSU A;  5LNK e;  2X8C A;  4WBR D;  3GKM A;  4I2U A;  2GSR A;  5F0G A;  5A4U A;  4K8M A;  3A2X A;  3TOT A;  2RM5 A;  5BMU A;  3G7J A;  2GGT A;  3H1N A;  2G0F A;  2PER A;  1ERV A;  2IJY A;  5IO2 A;  3LXT A;  3GYK A;  1USB A;  1ACV A;  4PUR A;  2YP6 A;  1HNC A;  1A8Y A;  4KSO A;  3BD2 A;  4GRF A;  4F03 A;  3TRP A;  1XWA A;  4K6X A;  2H1D A;  5CYY A;  2RUF A;  10GS A;  1O6J A;  5H5S A;  3ME7 A;  4ISD A;  2EIQ A;  1PRX A;  4BVX B;  3I9V 2;  4G9H A;  3I6A A;  3E9J B;  2AUV A;  4NWY A;  1THX A;  5LD0 A;  3EYT A;  1F3A A;  2FHE A;  2CT6 A;  1GTB A;  2JZS A;  2WRT A;  3ZML A;  4TXO B;  1BED A;  3D4M A;  3F3R A;  1GTU A;  2GDR A;  5ECR B;  3GV1 A;  3IE3 A;  5D9W A;  4N0Z A;  2C4J A;  1K0D A;  1A2L A;  4G10 A;  1GUH A;  2B1K A;  3P2A A;  3VUR A;  4FQU A;  3IAM 2;  1XWK A;  3C71 A;  1LBK A;  5J4U A;  3WGX A;  5J5N A;  3HXS A;  2FA8 A;  1K0O A;  1Z7P A;  3CSJ A;  1RK4 A;  1LJR A;  4CW9 A;  4MZB A;  3DVW A;  4ULX A;  8GSS A;  2VCT A;  1M99 A;  4EUY A;  5ECN B;  1S3A A;  1TDI A;  3TJB A;  4DSQ A;  3KH9 A;  2VIM A;  1SU9 A;  2K8V A;  1OAZ A;  4RUV A;  1R26 A;  4IJ3 A;  12GS A;  2OE1 A;  1V40 A;  2OAC A;  1NHY A;  1ILO A;  4ZXG A;  2H0I A;  2ON5 A;  3FK8 A;  2H30 A;  4OMV A;  2DKI A;  2X8G A;  3L4N A;  3ERG A;  1T00 A;  1ABA A;  1K0N A;  3GMF A;  2ZNM A;  5JWO B;  2HZF A;  3FZ9 A;  5AIX A;  2K8S A;  4OCF A;  1OC3 A;  1EGO A;  3CMI A;  3KZQ A;  2X49 A;  4G19 A;  4HZ2 A;  5JCW A;  5HQP A;  1M2D A;  4HS1 A;  4EF0 A;  3TOU A;  1B4P A;  5ABR A;  2NDO A;  2GQK A;  1ZYE A;  2WDU A;  2C80 A;  1O7U A;  1SJ6 A;  2TIR A;  5DVB A;  4BL7 A;  3TUE A;  2JSY A;  2L5O A;  3NOF A;  2YZH A;  2V6O A;  3UBK A;  3GX0 A;  2WFC A;  4MCU A;  3HA9 A;  1AW9 A;  1WE0 A;  2A2S A;  2M72 A;  1XXU A;  2L6D A;  2H1A A;  2QSI A;  4PQI A;  3F4S A;  3ZZX A;  5ENU A;  1GSF A;  3SBC A;  3APQ A;  4OFN A;  5GAN D;  2LJR A;  4TVE A;  3IPZ A;  4BVX A;  1R4W A;  3ZVJ D;  2OA7 A;  1A24 A;  1R5A A;  3EWL A;  1GSU A;  2H1G A;  3F6D A;  3RHB A;  4DVC A;  1TI3 A;  1FHE A;  2VL9 A;  5D9V A;  4TXO A;  4YKF A;  2B5Y A;  1XFL A;  4HDE A;  4TXV A;  4O5U A;  4TR0 A;  5A4V A;  2H70 A;  5FT3 A;  4KGI A;  5E59 A;  2V1M A;  2B6M A;  3PR8 A;  3F8U A;  1OC9 A;  3IC8 A;  5ECO B;  9GSS A;  2L6C A;  1HYU A;  3HZ4 A;  1A2M A;  5DJM A;  1WIK A;  2MYG A;  1OVN A;  5G1L A;  3DGQ A;  3GRX A;  4N11 A;  4WEY A;  2YJH A;  3BOA A;  2O7K A;  1JZR A;  2OJL A;  1A8L A;  3CBU A;  2I4A A;  1E2Y A;  3IBH A;  3FEU A;  2LEG A;  3A2V A;  4POK A;  2R0C A;  2L57 A;  4IP1 A;  2MBS A;  4QL7 A;  4DSS B;  3N5O A;  2UZ8 A;  4WF5 A;  5DAL B;  3QDN A;  1PX7 A;  1XOB A;  2FWG A;  4BA7 A;  5CRE A;  5EPF A;  1R7H A;  20GS A;  2IMK A;  2H6Z A;  3HVV A;  2GZY A;  2LV3 A;  3FZ4 A;  3EU4 A;  1U3A A;  1J0F A;  5JCG A;  2V32 A;  1EP8 A;  3Q18 A;  1W4V A;  2QGV A;  1Y25 A;  1UVZ A;  3BJ5 A;  4I2T A;  4K9Z A;  3WGD A;  1V2A A;  1PKW A;  5CRH A;  1NW2 A;  2D2Z A;  4ZIL A;  3H8Q A;  4BWS A;  1T7P B;  3LYP A;  3ED3 A;  4YQV A;  1X5E A;  3DML A;  4XIH A;  3D21 A;  4RI7 A;  1PMT A;  4LLR A;  2HNL A;  4GST A;  4DEJ A;  1WMJ A;  2DLX A;  3KM6 A;  1M2A A;  3D22 A;  2MMO A;  1XW6 A;  2I3Y A;  4CDO A;  2JL4 A;  5F06 A;  4RQR A;  1PSQ A;  2R5G A;  4Z2R A;  4POM A;  3G7Y A;  3U5R E;  3IK7 A;  3HJP A;  2YWI A;  3C1S A;  3UIW A;  1N2A A;  3P90 A;  2VCX A;  2JAC A;  2WJU A;  1ML6 A;  2RUE A;  2AHE A;  3VLN A;  5EL8 A;  3UAR A;  5KN2 A;  4WXT A;  1VF4 A;  2WCI A;  4BWQ A;  1SD8 A;  2H74 A;  3DRN A;  5KOX A;  3F0I A;  4MJC A;  3F9U A;  6GSW A;  1GNW A;  2B7J A;  1K0M A;  1E6B A;  2R6K A;  3ZRD A;  4EIQ A;  3DXB A;  5ECK B;  1FO5 A;  1OC8 A;  1TW9 A;  4OD7 A;  1TK0 B;  3QPM A;  1AQV A;  2LRT A;  5ECS A;  5CAX A;  2HI7 A;  1F6M C;  2F3M A;  3W8J A;  2ES7 A;  1ZGN A;  2PMT A;  1AC1 A;  4PTS A;  4MF7 A;  3EE2 A;  3RBT A;  3CSH A;  2FA4 A;  5G2Z A;  1JZO A;  2CX3 A;  3ZMK A;  1XW5 A;  4TW5 A;  2A2P A;  3D5J A;  3PPU A;  4WBJ A;  2YWM A;  1JZW A;  3LQ7 A;  1X9W B;  1SKW B;  2B7K A;  4KND A;  4WR5 A;  1ST9 A;  1FAA A;  3KMO A;  3WT2 A;  1XVW A;  4WET A;  3GL5 A;  3I43 A;  1MD4 A;  2FCH A;  2GSQ A;  4MPF A;  3Q74 A;  2OBI A;  4J56 E;  1YEP A;  2HE3 A;  3ZFL A;  1V9W A;  2AB6 A;  4DSS A;  1SK1 A;  2ZCT A;  4JR4 A;  3ZLP A;  2A4V A;  5DAL A;  5H5R A;  1HNB A;  2E7P A;  4FH8 A;  2A4H A;  2V6K A;  3OR5 A;  2HRN A;  2KHP A;  2DSA A;  3KXO A;  4Z2T A;  1OE7 A;  1QK8 A;  5B7C A;  4G0K A;  3ME8 A;  1AUC A;  4ML1 A;  4TR4 A;  3C7M A;  5AIS A;  3F3Q A;  2H1B A;  2X4A A;  2L59 A;  5HR2 A;  5HR0 A;  2F8A A;  2R0P A;  3SWL A;  2GTU A;  3FR6 A;  1WJK A;  5FWG A;  3FW2 A;  1GL8 A;  5IO0 A;  1XW9 A;  3QFB C;  4I5Q A;  2PWJ A;  1K3L A;  3G9B A;  3DWV A;  4BPY A;  4K2X A;  1ZZY A;  3KP9 A;  2LUS A;  1M0U A;  3UEM A;  2N5A A;  2GT5 A;  2VCQ A;  2HSH A;  2O89 A;  1F9M A;  4PX1 A;  4BL7 B;  2PUK C;  1TJD A;  2VOC A;  1SL2 B;  2HRK A;  16GS A;  2QA2 A;  2VD0 A;  2VLV A;  3EIN A;  3MWH A;  2K18 A;  2GZP A;  4KSM A;  4O7H A;  1Q98 A;  4IW9 A;  1XPV A;  2E2G A;  4EKZ A;  5DQY A;  2YWO A;  5DDL A;  1B9Y C;  2AV4 A;  4CY6 A;  1F37 A;  2E0Q A;  4XS1 A;  3RDW A;  3D4T A;  3L9V A;  18GS A;  2GT6 A;  2TRX A;  3VFI A;  2V41 A;  4WR4 A;  4KB3 A;  3BBY A;  2VUP A;  5D73 A;  5ECQ B;  3GKK A;  1B9X C;  4YQU A;  3MAK A;  4O32 A;  4MA9 A;  5IMC A;  2CAQ A;  1K0A A;  3F4R A;  4XCS A;  1XBS A;  2LS5 A;  3ERF A;  1EEJ A;  4OO4 A;  5ECP B;  1CQG A;  2VO4 A;  2XPD A;  5DQS A;  2LST A;  5ID2 B;  5IPG A;  3O76 A;  1TK8 B;  4F0B A;  3P8W A;  1VF1 A;  1O8W A;  2LQQ A;  4IP6 A;  1OC9 B;  1PGT A;  2MMA A;  2C0D A;  2LKU A;  2YJ7 A;  3IHG A;  2M80 A;  1KNG A;  1BX9 A;  2IMD A;  2LRN A;  2NTO A;  4K7I A;  2P0G A;  3RHC A;  3ZRE A;  4AGS A;  4A5P A;  5IIZ A;  3UMA A;  3TCO A;  2J9H A;  3P7X A;  3QCP A;  5INY A;  3O6T A;  3HVS A;  1MDI A;  2CZ2 A;  1AQW A;  2AAW A;  4LMW A;  4L8E A;  2L4C A;  1XOA A;  4L5L A;  3UOM A;  4PUA A;  1Z6N A;  4QQ7 A;  3L9U A;  2VM2 A;  4KUN A;  1HNA A;  3M0F A;  3H93 A;  4Q5N A;  3HHV A;  1YZX A;  4AJ7 A;  4XHM A;  3MNG A;  3UAP A;  5DJL A;  2H0G A;  5IMZ A;  4G2E A;  3FZA A;  3FR3 A;  4ICY A;  1AAZ A;  1O81 A;  2G2Q A;  1YF1 A;  2PGT A;  2VL3 A;  5DAK A;  4PNG A;  5GAP D;  5ECL B;  3LOR A;  3QD9 A;  1F3B A;  1PN9 A;  3TJG A;  3FZ5 A;  5KN1 A;  4N10 A;  1TI1 A;  2C1Y A;  1M9B A;  1TOF A;  2DJK A;  2KOK A;  1QUW A;  5AGY A;  1K0B A;  2AYT A;  2P31 A;  4ID0 A;  3JCM L;  3HVX A;  1FVK A;  1W89 A;  1AQX A;  4MLY A;  4GWR A;  3RAZ A;  2LQO A;  5CRD A;  4NAX A;  5D8I A;  14GS A;  2H75 A;  3VI7 A;  1A0R P;  3EC3 A;  3Q6O A;  2DJ2 A;  4HU9 A;  3VPQ A;  1AXD A;  4YKG A;  4HJM A;  3FY7 A;  4GQF A;  1B4Q A;  1Q4J A;  2GSS A;  5CRW A;  4HOJ A;  3BCI A;  1CQH A;  2K6V A;  3LJR A;  1XIY A;  2OBK A;  3KMN A;  3IHQ A;  4MMM A;  2QC7 A;  2MMN A;  3KTL A;  5ECH B;  1OYJ A;  2KLX A;  2YCD A;  3HZ8 A;  1JFU A;  1NSW A;  4JR6 A;  4NHZ A;  5GZZ B;  1UN2 A;  2HYX A;  2FNO A;  1I9D A;  1XCC A;  4KX4 A;  5ID2 A;  3ZIT A;  1TRS A;  2PBJ A;  3TJJ A;  3CTF A;  2EIO A;  2RM6 A;  1YQ1 A;  4IHU A;  3CSI A;  2H76 A;  3IAS 2;  2YV7 A;  3O3T A;  4POB A;  1TRV A;  2L5L A;  1U3I A;  4O92 A;  3RPN A;  3LXZ A;  1Z9H A;  5D96 A;  3F6F A;  4OFT A;  1RW1 A;  1O8X A;  1TRW A;  3CRU A;  3IC4 A;  4XS4 B;  4Q5R A;  1SD9 A;  1DUG A;  5GSS A;  4OO5 A;  2CQ9 A;  2HRF A;  2O85 A;  11GS A;  2YV9 A;  5HFK A;  3E0U A;  2RLI A;  3QAV A;  2KP2 A;  4O5R A;  1BQ7 A;  2LNS A;  3EMX A;  4JZQ A;  1JLV A;  4V1A p;  2N5B A;  1HD2 A;  1MDK A;  2C0F A;  2O8V B;  3GTU B;  4D73 B;  4KDX A;  3VK9 A;  1PN0 A;  1U88 A;  1X5D A;  19GS A;  3PH9 A;  2CVD A;  3US3 A;  3Q19 A;  4E8E A;  4MAB A;  1ERW A;  3LW9 A;  1TU8 A;  1YEX A;  5G1K A;  1NM3 A;  2B5E A;  3DYR A;  4FYC A;  2R4V A;  4ZB6 A;  1WOU A;  1FOH A;  2FWH A;  4PGT A;  4Q5Q A;  5JWQ B;  4PUF C;  4GLT A;  1TXX A;  4ZBD A;  2F51 A;  4V2M A;  5IOX A;  3W6G A;  4HEA 2;  2NBS A;  1U6T A;  5HFG A;  5JWR B;  4CY8 A;  2BJX A;  4ZB8 A;  1KBN A;  2EIR A;  2HT9 A;  3LG6 A;  5IMV A;  1H75 A;  3CYN A;  3VWU A;  1H4O A;  3A5W A;  4ZL9 A;  1T4Y A;  3GL3 A;  4MJA A;  4KW6 A;  4ZL7 A;  1EZK A;  2LJK A;  1GUM A;  4PNF A;  1YY7 A;  4OFM A;  2F8F A;  4MF5 A;  1F2E A;  4GCI A;  1SL1 B;  3MSZ A;  2HZE A;  3I69 A;  1JZD A;  1VGL A;  4IBP A;  4ZL8 A;  1ZL9 A;  4E8H A;  3GNJ A;  3QR6 A;  3WD6 A;  1EEM A;  2VD1 A;  2H8L A;  1GWC A;  3DKS A;  3ZFB A;  1G0T A;  2MMZ A;  3L9S A;  4FO5 A;  3QFA C;  1V57 A;  4XS6 A;  4PQH A;  1YF0 A;  1KEB A;  3LEF A;  3ZIV A;  5HR1 A;  3FRC A;  4EIP A;  4MJB A;  3IDV A;  2DJ3 A;  2XPE A;  5B8A A;  1GSD A;  4G0I A;  1EWX A;  1GTI A;  1TTZ A;  1I5G A;  4GF0 A;  4EE0 A;  1QQ2 A;  3DVX A;  5HFI A;  1G6Y A;  5B6M A;  2VM1 A;  1BYE A;  2DMM A;  3FYG A;  2XC2 A;  4HZ4 A;  3HJO A;  5IM9 A;  4TR1 B;  3HD5 A;  4K1F A;  4HUA A;  3F63 A;  1MTC A;  3FHK A;  4X4J A;  1U87 A;  3TKQ A;  2YN1 A;  5A5K A;  2IWT A;  3H4K A;  1V58 A;  2IN3 A;  3TRX A;  2H66 A;  1PL2 A;  2FLS A;  1G7O A;  3IK9 A;  4XS4 A;  3PGT A;  2C0E A;  3GKX A;  2GLR A;  1GSQ A;  1URM A;  3IXR A;  4ZBA A;  1FG4 A;  4MDC A;  4WF4 A;  3CXG A;  2VL2 A;  2NPB A;  13GS A;  1TP9 A;  4MZC A;  3IV4 A;  2BMX A;  1Z7R A;  3KCM A;  4Z2U A;  1SK0 A;  2OKA A;  2ZUP A;  3E3E A;  2C3Q A;  1XZO A;  3DD3 A;  2WB9 A;  3GTU A;  22GS A;  4D73 A;  2C8U A;  1SK2 A;  5JCU A;  4MPG A;  4ECC A;  3WT1 A;  3UJ1 A;  1OKT A;  2ALB A;  4AJ8 A;  4QL9 A;  1VRS D;  4EL1 A;  2C3T A;  5ECM B;  3GKN A;  2OE3 A;  2IMF A;  2XBI A;  4JE1 A;  1S3D A;  2IFQ B;  4GQC A;  2DJJ A;  3ZL5 A;  1XVQ A;  4CHS A;  4XTS A;  2YWN A;  2FWF A;  3DEX A;  4KF9 A;  3C8E A;  4IQA A;  1IYI A;  1DBY A;  4KCA A;  2YAN A;  5ECI B;  1XWB A;  5J3R A;  1FB0 A;  4EDZ A;  2FD3 A;  1C72 A;  2OE0 A;  1PKZ A;  5DAK B;  5B8B A;  3LWA A;  4GSS A;  2R37 A;  2GZZ A;  2GQM A;  2OAD A;  4TR3 A;  2N5F A;  4NV2 A;  3EUR A;  1QXH A;  4ZB9 A;  1GSE A;  3EVI A;  3IA1 A;  4NPB A;  1TRU A;  2O87 A;  2H6Y A;  3DIE A;  4GTU A;  2CAI A;  17GS A;  2YNX A;  1GSY A;  1A0F A;  2ON7 A;  5KN0 A;  2CV4 A;  2R2J A;  2KUC A;  4K0G A;  5G5E A;  4KDY A;  4Q5F A;  1J9B A;  3M9K A;  3UVT A;  4EDY A;  1MDJ A;  4RI6 A;  3GST A;  3A2W A;  3UL3 A;  5G5F A;  5CRG A;  2WZ9 A;  2IME A;  3KJY A;  1BG5 A;  2CX4 A;  2I1U A;  2DIY A;  2JSZ A;  2K9F A;  2JAD A;  1A23 A;  1FVJ A;  4HQS A;  4AF2 A;  5D9T A;  1V98 A;  4EO3 A;  4TR1 A;  1WRY A;  5KOW A;  2P5Q A;  4MH3 A;  1FW1 A;  4JBB A;  1ZYQ B;  4F9Z A;  3IOS A;  2LTK A;  4MF6 A;  5DCH A;  3HJM A;  1ZCP A;  3AY8 A;  1EGR A;  4F0C A;  3QAG A;  1SYR A;  4KE3 A;  2LJA A;  3L78 A;  2XBQ A;  4BVY A;  3J7Y k;  1WP0 A;  4LL4 B;  4ILF A;  2VCV A;  2HSY A;  2CVB A;  4IJI A;  2HFD A;  3M8N A;  4TKY A;  1SYX A;  4X1U A;  6GSY A;  1T1V A;  4EC0 A;  5G31 A;  1RQM A;  1ZYP A;  4K7O A;  1GSS A;  1TKD B;  1GTA A;  1SL0 B;  4I6X A;  3W8S A;  4L5O A;  1R5P A;  2R3X A;  4O5Q A;  1GLP A;  1DSB A;  5COH A;  1T4Z A;  4XRD A;  3TKS E;  1KTE A;  2M46 A;  5HR3 A;  2IFQ A;  1GUL A;  4TRX A;  3TKP A;  4I97 A;  2FGX A;  5L71 A;  4PQ1 A;  1BAY A;  2GST A;  1AIU A;  4YQM A;  3N9J A;  1VF3 A;  1JLW A;  1MEK A;  4NXI A;  5IMF A;  1XWC A;  2DBC A;  2CVK A;  4JED A;  2LNT A;  2KP1 A;  3KGK A;  3M3M A;  6GSX A;  4LL1 B;  2H71 A;  3TKS A;  1B8X A;  3IR4 A;  5J9C A;  6GSV A;  1YDK A;  4POL A;  2VCZ A;  2MBT A;  4YAV A;  3KH7 A;  4ZIJ A;  2VL2 C;  5AN1 A;  3GH6 A;  4TOP A;  2CZ3 A;  4K5R A;  4F2I A;  1SEN A;  2GVP A;  3LGC A;  3U6V A;  3HY2 A;  1J08 A;  1SJI A;  5KN3 A;  3FKF A;  3MIX A;  5C00 A;  3J7Y b;  4MNN A;  2DJ1 A;  2X99 A;  3MDK A;  2IL3 A;  4OCE A;  2HZE B;  2HLS A;  4LA1 A;  1IYH A;  4F82 A;  1Z6M A;  5F07 A;  2QA1 A;  1LU4 A;  3FMW A;  1G6W A;  1M7T A;  3KEB A;  3C1R A;  3V1W A;  4X43 A;  2IMI A;  2J23 A;  2I9H A;  4YH2 A;  2Z9S A;  5F8B A;  2GQL A;  4MJE A;  3R3E A;  4USS A;  3IRA A;  3VWW A;  2R0G A;  3D0Z A;  5IMD A;  1O85 A;  5D9X A;  1FB6 A;  3K8N A;  3KTB A;  4HQZ A;  1T8E B;  2WGR A;  3GHA A;  1QFN A;  2REM A;  4N0V A;  3TDG A;  1PQN A;  4MH2 A;  3HYP A;  1GP1 A;  2HXK A;  5H5Q A;  4DSR A;  4IQ1 A;  5ELA A;  2H72 A;  3WGE A;  3M1G A;  2H73 A;  3WYW A;  3BCK A;  1DE2 A;  4ECB A;  4XRA A;  5DBQ A;  3VPT A;  4V2N A;  5A4W A;  5IMA A;  4KDU A;  3TB2 A;  4KCE A;  3EU3 A;  3CRT A;  3TJF A;  2H6X A;  3ISO A;  3EMP A;  2IPA A;  3KIJ A;  1NHO A;  5CP1 A;  2VAF A;  3ERW A;  1GNE A;  4K2D A;  1YKC A;  1ERT A;  1EV4 A;  1OKD A;  3R2Q A;  2DKH A;  4KA0 A;  4RQX A;  3TKR A;  4K0N A;  1TK5 B;  2TRC P;  1WPI A;  2YPM A;  4FYU A;  5CNW A;  3QOU A;  6GST A;  4FIW A;  3H79 A;  2AJQ B;  2I81 A;  2C3N A;  3EPT A;  2DJ0 A;  3KD0 A;  1ZOF A;  4J57 E;  2RII A;  3APO A;  2B3S A;  1XWG A;  2FWE A;  4IEL A;  3ZIJ A;  2FY6 A;  3QAW A;  2H0H A;  3LSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...