2CX3A

Crystal structure of a bacterioferritin comigratory protein peroxiredoxin from the aeropyrum pernix k1 (form-1 crystal)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
160
structure length
160
Chain Sequence
LVELGEKAPDFTLPNQDFEPVNLYEVLKRGRPAVLIFFPAAFSPVCTKELCTFRDKMAQLEKANAEVLAISVDSPWCLKKFKDENRLAFNLLSDYNREVIKLYNVYHEDLKGLKMVAKRAVFIVKPDGTVAYKWVTDNPLNEPDYDEVVREANKIAGELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords bacterioferritin comigratory protein
publication title Crystal structure of a bacterioferritin comigratory protein peroxiredoxin from the Aeropyrum pernix K1 (form-1 crystal)
rcsb
source organism Aeropyrum pernix
total genus 42
structure length 160
sequence length 160
chains with identical sequence B, C, D
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2cx3A00
2EIOA 4IW9A 4MMMA 3GA4A 3DKSA 1TW9A 2I3YA 4GWRA 3US3A 3ZZXA 2YNXA 1ERTA 3P8WA 2B7KA 5D9TA 4XCSA 2VCXA 4ECIA 4N10A 2H1DA 2GQLA 2JZTA 3BD2A 6GSWA 3FEUA 3UMAA 1FHEA 1Y25A 4OD7A 5DCHA 4XS4B 5JWOB 4GSSA 4KSOA 3KCMA 4KX4A 2IIYA 1XVQA 4MJCA 4JRRA 2OBIA 1UA5A 3MNGA 3DMLA 3DRNA 1ACVA 3EYTA 4I2TA 1PL1A 1E2YA 2WGRA 3SWLA 4LMWA 2GGTA 2RLIA 2IMIA 1PSQA 6GSSA 4YQMA 4V2NA 6GSUA 2H19A 2GDRA 3AY8A 1XVWA 2R3XA 1EEJA 1AIUA 3F6DA 1KNGA 4ZB9A 3F6FA 3VFIA 1ON4A 2F8AA 2YOIA 4ECBA 3WD6A 2IMDA 14GSA 3QAWA 2OADA 5H5SA 2V6OA 6GSTA 16GSA 2KP1A 4E8EA 1QK8A 2L4QA 4GSTA 1ILOA 4PQIA 4MK3A 4GQCA 3F3QA 4KW6A 4EL1A 2H72A 1AXDA 3LGCA 2VLTA 3DD3A 3H4KA 1SU9A 1AQVA 4FYUA 2MMOA 2P0GA 2H66A 1GSSA 1XW6A 1TK5B 5EY6A 1T4ZA 4RUVA 3VI5A 3TJGA 1FVKA 1F6MC 4HEA2 1WOUA 4XRDA 1GTUA 3F9UA 2JSZA 1ZCPA 3QFBC 1OKTA 3TUEA 1KEBA 1TRUA 1PRXA 3MSZA 2EIRA 5JCWA 3IK9A 2O87A 4YH2A 1T3BA 3EVIA 3A2VA 3UOMA 2H1AA 1TXXA 1PN9A 2F3MA 1AQWA 2AV4A 2YCDA 4KA0A 1TRSA 4OFNA 3E0UA 3TOUA 2WFCA 4H86A 5CNWA 2AYTA 4HS1A 4AGSA 1TKDB 5CRDA 2CX4A 1JZWA 2GSTA 2WRTA 2PN8A 1EZKA 2VM1A 4XIHA 3IDVA 3MDKA 4K7OA 1YF0A 2KLXA 2VCWA 2XPEA 2IFQA 1LU4A 1YZXA 1FB0A 3BBYA 3NOFA 2GTUA 4D73A 2C1YA 4N11A 2PVOC 1DE1A 2JSYA 2YJ7A 3LQ7A 2VD1A 2FHEA 5F8BA 5IMZA 2O8VB 5KN0A 3GKKA 1B4PA 1R5PA 2DJ3A 1A8YA 1YY7A 2CX3A 4DSSA 2L4CA 1XW5A 2B5YA 2V2GA 4I8BA 1W89A 1M2BA 5A4VA 4L5LA 4IGJA 3PR8A 1WRYA 4WR4A 4EDZA 3HD5A 4O92A 4AJ6A 2KOKA 1H4OA 1RQMA 3KH7A 3M3MA 1PKWA 2AB6A 1OVNA 5FHIA 1O8WA 2GSRA 4MF6A 4IQ1A 4L5OA 4K7NA 2KP2A 3FYGA 4FO5A 4ID0A 1O8XA 2L6CA 3Q6OA 4FIWA 5C04A 3S9FA 2C8UA 2HT9A 4L8EA 1JLVA 5F0GA 4XS1A 1QUWA 3KH9A 3ME8A 2REMA 2WULA 3DYRA 2YWMA 3RAZA 2G2QA 3OR5A 4BWSA 1H75A 4V1Ap 3K8NA 2C0FA 5L71A 4POMA 2L57A 2VO4A 4MJAA 3APOA 1RW1A 2ON7A 2FY6A 4WKWA 5ECRB 3EC3A 2P5QA 2X64A 2HSYA 1ZYQB 4LL4B 4BA7A 3FK8A 4G2EA 2DJKA 1A23A 3VK9A 3HVVA 4KCAA 3RBTA 1DSBA 2FWGA 4NXIA 3IPZA 4OCEA 1SK0A 3PGTA 2QC7A 1GTBA 5B6MA 2YJHA 4ML6A 4LL1B 1A0FA 3FZ9A 1EOHA 4J2FA 3ERFA 4RQXA 4TOPA 3GH6A 3NZNA 5DJLA 1GSFA 5AIVA 3Q19A 3G7IA 4JR6A 3CSIA 3ZMKA 1V40A 1ABAA 1TK8B 2LRCA 3L78A 4ZBAA 1X9SB 1M2DA 3LEFA 3ZLPA 2PPTA 4OFMA 4NMUA 12GSA 2E2GA 2FA8A 3RPPA 3R2QA 1URMA 3HVXA 1X0RA 2HSHA 4KDYA 4GXZA 1BEDA 3C1SA 3EMPA 5A4WA 1SENA 1OC8A 2LJAA 2WS2A 1PQNA 4F9ZA 5A4UA 1OC9A 2DLXA 5IMCA 2LSTA 6GSXA 1CQGA 2YP6A 4IBPA 1OAZA 3RHBA 5LCZA 2PERA 2YPMA 1SYRA 4CW9A 3HY2A 2HZEA 2BMXA 5D8IA 1VF3A 1XXUA 4RI7A 5G5EA 5ECIB 1ERWA 1T4YA 2OE1A 1JLWA 3KD0A 1TU8A 2E0QA 4OO5A 2JZRA 4GLTA 3GIXA 4ISDA 2MYGA 5HR0A 1DE2A 1T00A 2DMMA 1GUMA 4NAXA 2C3NA 5GSSA 2KHPA 2H74A 4AJ8A 1ZGNA 3EE2A 1S3CA 3LWAA 2HNLA 3L9UA 4J57E 1U88A 3F63A 3W8SA 2B5EA 4PXOA 1AC1A 2VCZA 1M99A 5IPGA 5JCGA 2DJJA 2CZ3A 4LMVA 3EINA 13GSA 4JZQA 4PURA 4POKA 8GSSA 1Z9HA 3D4TA 4TW5A 1ERVA 3J7Yk 2DJ1A 4NV5A 2DC5A 3APSA 4F0BA 2CVDA 3TCOA 1S3DA 1M9AA 4HZ2A 1AW9A 3DEXA 4Q5QA 5GAND 2F51A 4MPFA 3LFLA 3UBLA 2B1KA 1M9BA 3C7MA 4DSRA 2IFQB 5CREA 1ZZYA 2MMAA 3A2WA 3FY7A 1EEMA 3UVTA 4DSQA 2CAIA 4D73B 3D0ZA 2I81A 3RHCA 4WF5A 5IMVA 1GTIA 3MWHA 3CXGA 1YKCA 4CHSA 1TRWA 3EURA 3KMOA 2GZYA 2ZUPA 2A4VA 2GT6A 4PQHA 1J9BA 2FUG2 3GMFA 4EKZA 4DSSB 1OC3A 1OKDA 1QQ2A 2I9HA 3F4TA 1WIKA 1PD21 2X8GA 3A5WA 2I4AA 3Q74A 4HZ4A 3HKRA 2GQKA 2AJQB 3DXBA 1ZL9A 1KBNA 1NHYA 1WWJA 1K0CA 3GKMA 3QAGA 4K0NA 3DGQA 4IKHA 1YJ6A 2K8VA 2C0EA 2TRXA 3BCKA 1YQ1A 3PINA 2EIQA 3HJPA 2HXKA 1OE7A 1Z6NA 3QFAC 2LUSA 2DMLA 4TR1A 2LNTA 1ST9A 4KDUA 4ZB6A 4YQVA 3TOTA 1AUCA 3Q18A 5ECMB 1GSYA 4HI7A 5AIXA 5D93A 3U5RE 5FWGA 2CT6A 1EOGA 1SK1A 1A24A 3BOAA 5LNKe 3F0IA 2XBIA 2HZFA 1PL2A 2B1LA 4EXJA 3KJYA 3ZITA 1BX9A 2B6MA 7GSSA 2FCHA 5GZZB 2LQQA 5D96A 2GT5A 5ECHB 1XWGA 5DALA 2XBQA 4IHUA 2RM6A 4BVXA 2LRTA 3IAS2 5DJMA 2G0FA 3N9JA 5HFGA 3LG6A 4ZILA 2XC2A 2H70A 2PVQA 1GSQA 5IIZA 4WR5A 3L4NA 2OACA 4KDXA 2C3TA 2LKUA 1TOFA 5F05A 3GTUA 5B8AA 2O89A 2BTOT 1GL8A 5EVOA 4L0UA 3TJKA 3VWXA 3VPQA 5IO2A 2FNOA 3HHVA 1W4VA 3M1GA 3A2XA 5G1KA 1SL0B 2YWIA 1V9WA 2LEGA 2M72A 1WPIA 3TB2A 5ABRA 2VL2A 1XWCA 1UVZA 1TJDA 1SL2B 3DVWA 1GULA 2OJLA 1B9YC 4XRAA 1QXHA 4KNDA 3TKPA 3CMIA 2B3SA 1THXA 3C8EA 3VURA 4GCIA 5HR1A 2C4JA 1BG5A 1X5EA 2DSAA 1OC9B 3GRXA 3ED3A 5KEJA 4K9ZA 4TR0A 1GNWA 1WP0A 3DWVA 1B48A 3QCPA 3ZTLA 1G6YA 3ISOA 4X0XA 4PNGA 4KAEA 1MD4A 4V2LA 2F9SA 2IJYA 3QDNA 3CTFA 1O85A 1FG4A 2GS3A 3H93A 2MMZA 2K8SA 1EV4A 2A2SA 2BJXA 2N5BA 3EU4A 5HQPA 2CAQA 2QKEA 5ID2B 5DQYA 5C00A 3GL3A 4MZBA 1Z7RA 1MDJA 3M8NA 1XWAA 5DAKA 4QQ7A 3UIWA 2H6ZA 4MZCA 1M2AA 1AAZA 3KTLA 4DEJA 4ECJA 4GQFA 2FWFA 1F9MA 5IMAA 5ECQB 4GF0A 1XIYA 4IP6A 4BWQA 2X8HA 1B8XA 1K3LA 3IRAA 4MLYA 3A3TA 3VLNA 2PU9C 2XHFA 1ZMAA 4LLRA 4IJ3A 1B4QA 3D6IA 3ZFBA 2JL4A 5CO3A 2AHEA 2NTOA 1A8LA 5FT3A 2Z9SA 3IE3A 1XBSA 3TRQA 4FYCA 4LA1A 5E59A 3WYWA 2VM2A 1R4WA 2IMKA 4K7IA 3IA1A 1GSEA 2DJ2A 2H0HA 1SYXA 2HLSA 4TVEA 4GSNA 1GRXA 3HA9A 4XS4A 2GLRA 4CDOA 1NW2A 2OBKA 3TKSE 4IJIA 2CQ9A 3TJJA 2EC4A 3DIEA 9GSSA 4PUFC 4ZIJA 4TXVA 3HDCA 3LXTA 4F0CA 3TGZA 5KN3A 2O85A 1I5GA 1THOA 1YDKA 3N5OA 1R7HA 4WETA 1A2MA 3ZVJD 3CYNA 3GSTA 1DUGA 3FZAA 3BJ5A 1Z7PA 3KP8A 2PUKC 19GSA 4RI6A 3P90A 5ECKB 4POLA 1SL1B 3M0FA 1G6WA 2YV9A 2V6KA 4TR1B 1XPVA 1GWCA 5IOWA 3QOUA 1B9XC 4NWYA 4XHMA 3HZ8A 3W8JA 4QL9A 3CBUA 1G7EA 1F2EA 3W6GA 2CV4A 4JU5A 2H76A 4MF5A 5CYYA 1WE0A 4AJ7A 2HRNA 3TKSC 4OWYA 5INYA 1NHOA 4TKYA 3WT2A 4PNFA 3WT1A 3F4RA 1WMJA 5DALB 3QPMA 1VF2A 3L0HA 4MA9A 5ECSA 1BYEA 5HFIA 4NPBA 5CRHA 3UJ1A 2DIYA 4NHWA 2H73A 4EO3A 3KMNA 4KB3A 1V98A 4MCUA 3D22A 3TRXA 2VOCA 1U3AA 4NV2A 1U6TA 3D21A 1MDKA 3I9V2 1BAYA 2VL2C 1EP8A 2J23A 5GSTA 2H6YA 5D9XA 5G1LA 4MH2A 3RPNA 2V1MA 1IYHA 2HE3A 2C3QA 4MPGA 2GSSA 3GTUB 1A0RP 5D9WA 5JWRB 1N8JA 4Q5RA 3M9JA 4KH7A 2OA7A 2AUVA 2RM5A 3TRPA 3TKRA 3UBKA 3CRTA 5GAPD 2FD3A 4QL7A 1Z5YE 3CRUA 2VCVA 6GSVA 3GSSA 4K0GA 2CVKA 2PGTA 3G9BA 1ZYEA 3ZFLA 2IMEA 1OYJA 4ZXGA 4PUAA 5ECNB 2TIRA 5J5NA 4IVFA 3F8UA 2VCTA 1LBKA 4G19A 1T7PB 1I9DA 2H1GA 1GP1A 2FWEA 4N0VA 2YZUA 1VF4A 2WZ9A 2OE3A 4POBA 2O7KA 1X5DA 1TI1A 4MP4A 4KGIA 3FW2A 3HVSA 1K0MA 3IXRA 3O76A 4ML1A 2DBCA 1TRVA 1U3IA 1J08A 3IAM2 1K0BA 3FHKA 3EWLA 4EF0A 4FH8A 4HJMA 2LTKA 4TR4A 1A2JA 4MF7A 2AAWA 5J3RA 1K0NA 2M46A 2VL3A 1TDIA 3MAKA 1SKRB 1PA3A 1UN2A 5KN1A 2VL9A 2IN3A 1ERUA 4ZB8A 4BVYA 2F8FA 1FW1A 2R6KA 4F2IA 2GQMA 1LJRA 5D73A 5CRWA 4ZL9A 2N5FA 5DAKB 4O32A 3H1NA 4IS0A 2ZCTA 3LXZA 1PX7A 4PQ1A 1BQ7A 4WBRD 5IO0A 3L9SA 1MD3A 3IK7A 3GN3A 4HOJA 5ECOB 1PMTA 1GH2A 1EP7A 3C1RA 4GTUA 1GLQA 2B7JA 4L0WA 2JZSA 5G2ZA 3F4SA 3IHQA 2HRFA 2OKAA 4X1UA 2K9FA 2H75A 3D4MA 4OO4A 1GSUA 2NPBA 3QAVA 3P7XA 3E3EA 1EGRA 1HNCA 4I6XA 3IV4A 2PBJA 2IMFA 4YAVA 2VD0A 4I97A 3GNJA 1K3OA 4MH3A 3HJOA 4G10A 3DVXA 1XOAA 1GNEA 4HJ2A 2HFDA 2FWHA 4PGTA 3HCZA 1F3BA 5J41A 3ZREA 1ML6A 1Z3EA 3WGXA 1JHBA 5G30A 4AF2A 4ECCA 4TXOA 5KN2A 4MJEA 1MTCA 2VLVA 3GL5A 1HNBA 2GSQA 4ZL8A 2E2MA 3H8QA 5ELGA 2JU5A 3IBHA 4YAPA 4TR3A 3KM6A 1QMVA 3KIJA 3LYKA 1SJZA 2WB9A 2JACA 3UEMA 10GSA 1V58A 3TKSA 1A2LA 1F37A 2MBTA 4GRFA 2YZHA 2FA4A 2QSIA 1XWBA 3KTBA 1JZOA 4IELA 4O5RA 1N2AA 5AN1A 1VRSD 1TTZA 2MMNA 3FKFA 5J9BA 1GSDA 3UVHA 1TP9A 2P5RA 1GLPA 2YWOA 2C0DA 2VLUA 5IMFA 3KGKA 4J56E 4K6XA 1PGTA 1RK4A 1JZDA 2H6XA 5CP1A 3KXOA 5IQYA 3QMXA 4F03A 1ZOFA 1FAAA 1O73A 1XZOA 3UL3A 1YEXA 1AQXA 3LJRA 11GSA 4NHZA 3WGDA 4ULXA 1YEPA 3GURA 1MDIA 4YQUA 2MBSA 3GX0A 3HJMA 2H71A 3UAPA 2IWTA 2VCQA 1R26A 2H30A 4IQAA 1O81A 1QGVA 2LS5A 1EWXA 2LNSA 3EU3A 2RIIA 5DVBA 4DVCA 2L6DA 2WCIA 2NVLA 3I69A 2HZEB 2L5OA 4WF4A 1J0FA 4JR4A 5F07A 2CVBA 2M80A 1GUHA 1DBYA 4X43A 4EDYA 3H79A 4V1Ag 4HQZA 2V32A 4TN8A 3P2AA 1T8EB 1JFUA 3TJFA 4JBBA 5AISA 4Q5FA 1YF1A 3G7YA 18GSA 1X5CA 5DCGA 5EL8A 5J4UA 1PX6A 3GHAA 4FYBA 3ERGA 1V57A 5CAXA 2K18A 3UARA 5ECLB 2GZZA 4KCEA 1MEKA 1HD2A 2X99A 1XOBA 1KTEA 4JE1A 2K6VA 2R5GA 3IR4A 5ELAA 2OE0A 3IC4A 5J9CA 5IPHA 1Z6MA 2PWJA 3ZIJA 1M7TA 4MDCA 4RQRA 4WXTA 2YV7A 2E7PA 3ZL5A 5D9VA 4KSMA 5HFKA 4I5QA 1Q98A 3LYPA 4ZBBA 1Q4JA 4KUNA 4WBJA 1G0TA 3C71A 2NDOA 3D5JA 3U6VA 2IL3A 1VGLA 2MZCA 2P31A 2H0GA 1X9MB 5IMDA 3ZMLA 2C80A 2LJKA 1USBA 2R2JA 1SD9A 3VWUA 1HQOA 3ZVJA 3ZYWA 3E9JB 3J7Yb 3HYPA 4IP1A 5LD0A 3FR9A 4N30A 1GUKA 3VWWA 3M9KA 3KP9A 2DJ0A 1XW9A 5B7CA 1T1VA 2VAFA 2NBSA 3VI7A 1GTAA 3V1WA 2ES7A 3EMXA 3I6AA 4O7HA 1OE8A 3KEBA 5F06A 3TJBA 1FVJA 1FB6A 3LORA 1G7OA 4EVMA 4EC0A 1CQHA 1SK2A 2IPAA 1TU7A 2N5AA 4HDEA 1M0UA 2H01A 1PKZA 1XCCA 1X9WB 5H5RA 3HZ4A 3APQA 4Q5NA 2GVPA 2X8CA 1NM3A 1S3AA 3KZQA 2VIMA 4IN0A 3FZ4A 5IM9A 5ECPB 2H1BA 4PX1A 4MJBA 1SJ6A 2V41A 3GV1A 4HU7A 4TXOB 1SKSB 4MABA 3CSHA 4EE0A 3ZIVA 4XS6A 4E8HA 2ALBA 3CSJA 1NSWA 4BL7A 4BPYA 3TDGA 6GSYA 3I43A 5DQSA 3O3TA 5DBQA 2TRCP 4Z7XA 1K3YA 1TK0B 3O6TA 5A5KA 2HYXA 1K0OA 2I1UA 4N0ZA 5AGYA 1K0DA 3HXSA 2L59A 3SBCA 4WEYA 3L9VA 2L5LA 2XPDA 3GX8A 2R4VA 1C72A 1O6JA 3FRCA 4K8MA 4ZL7A 4TRXA 1FOVA 1U87A 4HQSA 2H8LA 4V2MA 2VUPA 5DDLA 5B6NA 5H5QA 2PMTA 1R5AA 1TI3A 2JADA 3CTGA 3QD9A 1BJXA 4XTSA 2GZPA 4K2DA 3GKXA 1VF1A 4OFTA 1O7UA 2D2ZA 1E6BA 1HNAA 1SD8A 1QFNA 2LRNA 3WGEA 1YKAA 2A2RA 4JEDA 2J9HA 2YWNA 3G7JA 3GH9A 4K1FA 22GSA 5ID2A 4ZBDA 1IYIA 2B5XA 2LQOA 3PH9A 3QR6A 5ENUA 2YN1A 3VPTA 4HU9A 4MZWA 4ACSA 1F3AA 1HYUA 2RUFA 3TKQA 2DIZA 5IOXA 3ERWA 2YANA 5JWQB 17GSA 3ZRDA 2RUEA 3F3RA 4P3YB 2FGXA 1XFLA 5JCUA 4OMVA 4KE3A 3ME7A 2C0GA 3FZ5A 5G5FA 4OCFA 3JCML 2R37A 2HI7A 5HR3A 3GUSA 4I2UA 2H0IA 3NIVA 1XWKA 20GSA 3IOSA 2WDUA 2CA8A 2QGVA 4F82A 3GKNA 2LJRA 1FO5A 5E4WA 1WJKA 1JZRA 2WJUA 3GFKA 4ILFA 5EPFA 1K0AA 2KUCA 1V2AA 2FLSA 1Y6EA 1SKWB 3FR6A 1EGOA 3FR3A 5COHA 4HUAA 5G31A 1UC7A 2CZ2A 3RDWA 3VWVA 1EV9A 4G9HA 5HR2A 2LV3A 3C73A 4EUYA 2ZNMA 3GYKA 2ON5A 5CRGA 3LSZA 3BCIA 1SJIA 5B8BA
chains in the Genus database with same CATH superfamily
2EIOA 4IW9A 4MMMA 3GA4A 3DKSA 1TW9A 2I3YA 4GWRA 3US3A 3ZZXA 2YNXA 1ERTA 3P8WA 2B7KA 5D9TA 4XCSA 2VCXA 4ECIA 4N10A 2H1DA 2GQLA 2JZTA 3BD2A 6GSWA 3FEUA 3UMAA 1FHEA 1Y25A 4OD7A 5DCHA 4XS4B 5JWOB 4GSSA 4KSOA 3KCMA 4KX4A 2IIYA 1XVQA 4YKFA 4MJCA 4KF9A 4JRRA 2OBIA 1UA5A 3MNGA 3DMLA 3DRNA 1ACVA 3EYTA 4I2TA 1PL1A 1E2YA 2WGRA 3SWLA 4LMWA 2GGTA 2RLIA 2IMIA 1PSQA 6GSSA 4YQMA 4V2NA 6GSUA 2H19A 2GDRA 3AY8A 1XVWA 2R3XA 1EEJA 1AIUA 3F6DA 1KNGA 4ZB9A 3F6FA 3VFIA 1ON4A 2F8AA 2YOIA 4ECBA 3WD6A 2IMDA 14GSA 3QAWA 2OADA 5H5SA 2V6OA 6GSTA 16GSA 2KP1A 4E8EA 1QK8A 2L4QA 4GSTA 1ILOA 4PQIA 4MK3A 4GQCA 3F3QA 4KW6A 4EL1A 2H72A 1AXDA 4Z2RA 3LGCA 2VLTA 3DD3A 3H4KA 1SU9A 1AQVA 4FYUA 2MMOA 2P0GA 2H66A 1GSSA 1XW6A 1TK5B 5EY6A 1T4ZA 4RUVA 3VI5A 3TJGA 1FVKA 1F6MC 4HEA2 1WOUA 4XRDA 1GTUA 3F9UA 2JSZA 1ZCPA 3QFBC 1OKTA 3TUEA 1KEBA 1TRUA 1PRXA 3MSZA 2EIRA 5JCWA 3IK9A 2O87A 4YH2A 1T3BA 3EVIA 3A2VA 3UOMA 2H1AA 1TXXA 1PN9A 2F3MA 1AQWA 2AV4A 2YCDA 4KA0A 1TRSA 4OFNA 3E0UA 3TOUA 2WFCA 4H86A 5CNWA 2AYTA 4HS1A 4AGSA 1TKDB 5CRDA 2CX4A 1JZWA 2GSTA 2WRTA 2PN8A 1EZKA 2VM1A 4XIHA 3IDVA 3MDKA 2HSMA 4K7OA 1YF0A 2KLXA 2VCWA 2XPEA 2IFQA 1LU4A 1YZXA 1FB0A 3BBYA 3NOFA 2GTUA 4D73A 2C1YA 4N11A 2PVOC 1DE1A 2JSYA 2YJ7A 3LQ7A 2VD1A 2FHEA 4G0KA 5F8BA 5IMZA 2O8VB 5KN0A 3GKKA 1B4PA 1R5PA 2DJ3A 1A8YA 1YY7A 2CX3A 4DSSA 2L4CA 1XW5A 2B5YA 2V2GA 4I8BA 1W89A 1M2BA 5A4VA 4L5LA 4IGJA 3PR8A 1WRYA 4WR4A 4EDZA 3HD5A 4O92A 4AJ6A 2KOKA 1H4OA 1RQMA 3KH7A 1PN0A 1S3RA 3M3MA 3EPTA 1PKWA 2AB6A 1OVNA 5FHIA 1O8WA 2GSRA 4MF6A 4IQ1A 4L5OA 4K7NA 2KP2A 3FYGA 4FO5A 4ID0A 1O8XA 2L6CA 3Q6OA 4FIWA 5C04A 3S9FA 2C8UA 2HT9A 4L8EA 1JLVA 5F0GA 4XS1A 1QUWA 3KH9A 3ME8A 4BVYB 2REMA 2WULA 3DYRA 2YWMA 3RAZA 2G2QA 3OR5A 4BWSA 1H75A 4V1Ap 3K8NA 2C0FA 5L71A 4POMA 2L57A 2VO4A 4MJAA 3APOA 1RW1A 2ON7A 2FY6A 4WKWA 5ECRB 1M3IA 3EC3A 2P5QA 2X64A 2HSYA 1ZYQB 4LL4B 4BA7A 3FK8A 4G2EA 2DJKA 1A23A 3VK9A 3HVVA 4KCAA 3RBTA 1DSBA 2FWGA 4NXIA 3IPZA 4OCEA 1SK0A 3PGTA 2QC7A 1GTBA 5B6MA 2YJHA 4ML6A 4LL1B 1A0FA 3FZ9A 1EOHA 4J2FA 3ERFA 4RQXA 4TOPA 3GH6A 3NZNA 5DJLA 1GSFA 5AIVA 3Q19A 3G7IA 4JR6A 3CSIA 3ZMKA 1V40A 1ABAA 4O5QA 1TK8B 2LRCA 2X4AA 3L78A 4ZBAA 1X9SB 1M2DA 3LEFA 3ZLPA 2PPTA 4OFMA 4NMUA 12GSA 2E2GA 2FA8A 3RPPA 3R2QA 3R3EA 1URMA 3HVXA 1X0RA 2HSHA 4KDYA 4GXZA 1BEDA 3C1SA 3EMPA 5A4WA 1SENA 1OC8A 2LJAA 2WS2A 1PQNA 4F9ZA 4Z2UA 5A4UA 1OC9A 2DLXA 5IMCA 2LSTA 6GSXA 1CQGA 2YP6A 4IBPA 1OAZA 3RHBA 5LCZA 2PERA 2YPMA 1SYRA 4CW9A 3HY2A 2HZEA 2BMXA 5D8IA 1VF3A 1XXUA 4RI7A 5G5EA 5ECIB 1ERWA 1T4YA 2OE1A 1JLWA 3KD0A 1TU8A 2E0QA 4OO5A 2JZRA 4GLTA 3GIXA 4ISDA 2MYGA 5HR0A 1DE2A 1T00A 2DMMA 2R0CA 1GUMA 4NAXA 2C3NA 5GSSA 2KHPA 2H74A 4AJ8A 1ZGNA 3EE2A 1S3CA 3LWAA 2HNLA 3L9UA 4J57E 1U88A 3F63A 3W8SA 2B5EA 4PXOA 1AC1A 2VCZA 1M99A 4O5UA 5IPGA 5JCGA 2DJJA 2CZ3A 4LMVA 3EINA 13GSA 4JZQA 4PURA 4POKA 8GSSA 1Z9HA 3D4TA 4TW5A 1ERVA 3J7Yk 2DJ1A 4NV5A 2DC5A 3APSA 4F0BA 2CVDA 3TCOA 1S3DA 1M9AA 4HZ2A 1AW9A 3DEXA 4Q5QA 5GAND 2F51A 4MPFA 3LFLA 2A2PA 3UBLA 2B1KA 1M9BA 3C7MA 4DSRA 2IFQB 5CREA 1ZZYA 2MMAA 3A2WA 3FY7A 1EEMA 3UVTA 4DSQA 2CAIA 4D73B 3D0ZA 2I81A 3RHCA 4WF5A 5IMVA 1GTIA 3MWHA 3CXGA 1YKCA 4CHSA 1TRWA 3EURA 3KMOA 2GZYA 2ZUPA 2A4VA 2GT6A 4PQHA 1J9BA 2FUG2 3GMFA 4EKZA 4DSSB 1OC3A 1OKDA 1QQ2A 2I9HA 3F4TA 1WIKA 1PD21 2X8GA 3A5WA 2I4AA 3Q74A 4HZ4A 3HKRA 2GQKA 2AJQB 3DXBA 1ZL9A 1KBNA 1NHYA 1PFOA 1WWJA 1K0CA 3GKMA 3QAGA 4K0NA 3DGQA 4IKHA 1YJ6A 2K8VA 2C0EA 2TRXA 3BCKA 1YQ1A 3PINA 2EIQA 3HJPA 2HXKA 1OE7A 1Z6NA 3QFAC 2LUSA 2DMLA 4TR1A 2LNTA 1ST9A 4KDUA 4ZB6A 4YQVA 3TOTA 1AUCA 1ZYPA 3Q18A 5ECMB 1GSYA 4HI7A 5AIXA 5D93A 3U5RE 3FMWA 5FWGA 2CT6A 5BMUA 1EOGA 1SK1A 1A24A 3BOAA 5LNKe 3F0IA 2XBIA 2HZFA 1PL2A 2B1LA 4EXJA 3KJYA 3ZITA 1BX9A 3LW9A 2B6MA 7GSSA 4HSCX 2FCHA 5GZZB 2LQQA 5D96A 2GT5A 5ECHB 1XWGA 5DALA 3MIXA 2XBQA 4IHUA 2RM6A 4BVXA 2LRTA 3IAS2 5DJMA 2G0FA 3N9JA 5HFGA 3LG6A 4ZILA 2XC2A 2H70A 2PVQA 1GSQA 5IIZA 4WR5A 3L4NA 2OACA 4KDXA 2C3TA 2LKUA 1TOFA 5F05A 3GTUA 5B8AA 2O89A 2BTOT 1GL8A 5EVOA 4L0UA 3TJKA 3VWXA 3VPQA 5IO2A 2FNOA 3HHVA 1W4VA 3M1GA 3A2XA 5G1KA 3IHGA 1SL0B 2YWIA 3MYDA 1V9WA 2LEGA 2M72A 1WPIA 3TB2A 5ABRA 2VL2A 1XWCA 1UVZA 1TJDA 1SL2B 3DVWA 1GULA 2OJLA 4BL7B 1B9YC 4XRAA 1QXHA 4KNDA 3TKPA 3CMIA 4CY8A 2B3SA 1THXA 3C8EA 3VURA 4GCIA 5HR1A 2C4JA 1BG5A 1X5EA 2DSAA 1OC9B 3GRXA 3ED3A 5KEJA 4K9ZA 4TR0A 1GNWA 1WP0A 3DWVA 1B48A 3QCPA 3ZTLA 1G6YA 3ISOA 4X0XA 2HRKA 4PNGA 4KAEA 1MD4A 4V2LA 2F9SA 2IJYA 3QDNA 3CTFA 1O85A 1FG4A 2GS3A 3H93A 2MMZA 2K8SA 1EV4A 2A2SA 2BJXA 2N5BA 3EU4A 5HQPA 2CAQA 2QKEA 5ID2B 5DQYA 5C00A 3GL3A 4MZBA 1Z7RA 1MDJA 3M8NA 1XWAA 4FQUA 4QQ7A 5DAKA 3UIWA 2H6ZA 4MZCA 1M2AA 1AAZA 3KTLA 4DEJA 4ECJA 4GQFA 2FWFA 1F9MA 5IMAA 4USSA 4GF0A 1XIYA 5ECQB 4IP6A 4BWQA 2X8HA 1B8XA 1K3LA 3IRAA 4MLYA 3A3TA 3VLNA 2PU9C 2XHFA 1ZMAA 4LLRA 4IJ3A 1B4QA 1FOHA 3D6IA 3ZFBA 2JL4A 5CO3A 2AHEA 2NTOA 1A8LA 5FT3A 2Z9SA 4CY6A 3IE3A 1XBSA 3TRQA 4FYCA 4LA1A 5E59A 3WYWA 2VM2A 1R4WA 2IMKA 4K7IA 3IA1A 1GSEA 2DJ2A 2H0HA 1SYXA 2HLSA 4TVEA 4GSNA 1GRXA 3HA9A 4XS4A 2GLRA 4CDOA 1NW2A 2OBKA 3TKSE 3PPUA 4IJIA 2CQ9A 3TJJA 2EC4A 4X4JA 3DIEA 9GSSA 4PUFC 4ZIJA 4TXVA 3HDCA 3LXTA 4F0CA 4MNNA 3TGZA 5KN3A 2O85A 1I5GA 1THOA 1YDKA 3N5OA 1R7HA 4WETA 1A2MA 3ZVJD 3CYNA 3GSTA 1DUGA 3FZAA 3BJ5A 1Z7PA 3KP8A 2PUKC 19GSA 4RI6A 3P90A 5ECKB 4POLA 1SL1B 3M0FA 1G6WA 2YV9A 2V6KA 4TR1B 1XPVA 1GWCA 5IOWA 3QOUA 1B9XC 4NWYA 4XHMA 5KOXA 3HZ8A 3W8JA 4QL9A 3CBUA 1G7EA 1F2EA 3W6GA 2CV4A 4JU5A 2H76A 4MF5A 5CYYA 1WE0A 4AJ7A 2HRNA 3TKSC 4OWYA 5INYA 1NHOA 4TKYA 3WT2A 4PNFA 3WT1A 3A5IA 3F4RA 4K2XA 1WMJA 5DALB 3QPMA 1VF2A 3L0HA 4MA9A 5ECSA 1BYEA 5HFIA 2HRAA 4BVXB 4NPBA 5CRHA 3UJ1A 2DIYA 4NHWA 2H73A 4EO3A 3KMNA 4KB3A 1V98A 1M3JA 4MCUA 3D22A 3TRXA 2VOCA 1U3AA 4NV2A 1U6TA 3D21A 1MDKA 3I9V2 1BAYA 2VL2C 1EP8A 2J23A 3IC8A 5GSTA 2H6YA 5D9XA 5G1LA 4MH2A 3RPNA 4PTSA 2V1MA 1IYHA 2HE3A 2C3QA 4MPGA 2GSSA 3GTUB 1A0RP 5D9WA 5JWRB 1N8JA 4Q5RA 3M9JA 4KH7A 2OA7A 2AUVA 2RM5A 3TRPA 3TKRA 3UBKA 3CRTA 5GAPD 2FD3A 4QL7A 1Z5YE 3CRUA 2VCVA 6GSVA 3GSSA 4K0GA 2CVKA 2PGTA 3G9BA 1ZYEA 3ZFLA 2IMEA 1OYJA 4ZXGA 4PUAA 5ECNB 2TIRA 5J5NA 4IVFA 3F8UA 2VCTA 1LBKA 4G19A 1T7PB 1I9DA 2H1GA 1GP1A 4BIKA 2FWEA 4N0VA 2YZUA 1VF4A 2WZ9A 2OE3A 4POBA 2O7KA 1X5DA 1TI1A 4MP4A 4KGIA 3FW2A 3HVSA 2A4HA 1K0MA 3IXRA 3O76A 4ML1A 2DBCA 1TRVA 1U3IA 1J08A 3IAM2 1K0BA 3FHKA 3EWLA 4EF0A 4FH8A 4HJMA 2LTKA 4TR4A 1A2JA 4MF7A 2AAWA 5J3RA 1K0NA 2M46A 2VL3A 1TDIA 2DKHA 3MAKA 1SKRB 1PA3A 1UN2A 5KN1A 2VL9A 2IN3A 1ERUA 4ZB8A 4BVYA 2F8FA 1FW1A 2R6KA 2X49A 3HVNA 4F2IA 2GQMA 1LJRA 2QA1A 5D73A 5CRWA 4ZL9A 2N5FA 5DAKB 4O32A 3H1NA 4IS0A 2ZCTA 3LXZA 1PX7A 4PQ1A 1BQ7A 4WBRD 5IO0A 3L9SA 1MD3A 3IK7A 3GN3A 4HOJA 5ECOB 1PMTA 1GH2A 1EP7A 3C1RA 4GTUA 1GLQA 2B7JA 4L0WA 2JZSA 5G2ZA 3F4SA 3IHQA 2HRFA 2OKAA 2UZ8A 4X1UA 2K9FA 2H75A 3D4MA 4OO4A 1GSUA 2NPBA 3QAVA 3P7XA 3E3EA 1EGRA 1HNCA 4I6XA 3IV4A 2PBJA 2IMFA 4YAVA 2VD0A 4I97A 3GNJA 1K3OA 4MH3A 3HJOA 4G10A 3DVXA 1XOAA 1GNEA 4HJ2A 2HFDA 2FWHA 4PGTA 3HCZA 1F3BA 5J41A 3ZREA 1ML6A 1Z3EA 3WGXA 1JHBA 5G30A 4AF2A 4ECCA 4TXOA 5KN2A 4MJEA 1MTCA 2VLVA 3GL5A 1HNBA 2GSQA 4ZL8A 5KOWA 2E2MA 3H8QA 5ELGA 2JU5A 3IBHA 4YAPA 4TR3A 3KM6A 1QMVA 3KIJA 3LYKA 1SJZA 2WB9A 2JACA 3UEMA 10GSA 1V58A 3TKSA 1A2LA 1F37A 2MBTA 4GRFA 2YZHA 2FA4A 2QSIA 1XWBA 3KTBA 1JZOA 4IELA 4O5RA 1N2AA 5AN1A 1VRSD 1TTZA 4EIQA 2MMNA 3FKFA 5J9BA 1GSDA 3UVHA 1TP9A 2P5RA 1GLPA 2YWOA 2C0DA 2R0PA 2VLUA 5IMFA 3KGKA 4J56E 4K6XA 1PGTA 1RK4A 1JZDA 2H6XA 5CP1A 3KXOA 5IQYA 3QMXA 4F03A 1ZOFA 1FAAA 1O73A 1XZOA 3UL3A 1YEXA 1AQXA 3LJRA 11GSA 4NHZA 3WGDA 4ULXA 1YEPA 3GURA 1MDIA 4YQUA 2MBSA 3GX0A 3HJMA 2H71A 3UAPA 2IWTA 2VCQA 1R26A 2H30A 4IQAA 1O81A 1QGVA 2LS5A 1EWXA 2LNSA 3EU3A 2RIIA 5DVBA 4DVCA 2L6DA 2R0GA 2WCIA 2NVLA 3I69A 2HZEB 2L5OA 4WF4A 1J0FA 4JR4A 5F07A 2CVBA 2M80A 1GUHA 4K5RA 1DBYA 4X43A 4EDYA 3H79A 4V1Ag 4HQZA 2V32A 4TN8A 3P2AA 1T8EB 4ICYA 4YKGA 1JFUA 3TJFA 4JBBA 5AISA 4Q5FA 1YF1A 3G7YA 2DKIA 18GSA 1X5CA 5DCGA 5EL8A 5J4UA 4A5PA 1PX6A 3GHAA 3CQFA 4FYBA 3ERGA 1V57A 5CAXA 2K18A 3UARA 5ECLB 2GZZA 4KCEA 5BRTA 1MEKA 1HD2A 2X99A 1XOBA 1KTEA 4JE1A 2K6VA 4EIPA 2R5GA 3IR4A 5ELAA 2OE0A 3IC4A 5J9CA 5IPHA 1XG8A 1Z6MA 2PWJA 3ZIJA 1M7TA 4MDCA 4RQRA 4WXTA 2YV7A 2E7PA 3ZL5A 5D9VA 4KSMA 5HFKA 4I5QA 1Q98A 3LYPA 4ZBBA 1Q4JA 4KUNA 4WBJA 1G0TA 3C71A 2NDOA 3D5JA 3U6VA 2IL3A 1VGLA 2MZCA 2P31A 2H0GA 1X9MB 5IMDA 3ZMLA 2C80A 2LJKA 1USBA 2R2JA 1SD9A 3VWUA 1HQOA 3ZVJA 3ZYWA 3E9JB 3J7Yb 3HYPA 4IP1A 5LD0A 3FR9A 4N30A 1GUKA 3VWWA 3M9KA 3KP9A 2DJ0A 1XW9A 5B7CA 1T1VA 2VAFA 2NBSA 3VI7A 1GTAA 3V1WA 2ES7A 3EMXA 3I6AA 4O7HA 1OE8A 3KEBA 5F06A 3TJBA 1FVJA 1FB6A 3LORA 1G7OA 1ZYNA 4EVMA 4EC0A 1CQHA 1SK2A 2IPAA 1TU7A 2N5AA 4HDEA 1M0UA 2H01A 1PKZA 1XCCA 1X9WB 5H5RA 3HZ4A 3APQA 4Q5NA 2GVPA 2X8CA 1NM3A 1S3AA 3KZQA 2VIMA 4IN0A 3FZ4A 5IM9A 5ECPB 2H1BA 4PX1A 4MJBA 1SJ6A 2V41A 3GV1A 4HU7A 4TXOB 1SKSB 4MABA 2QA2A 3CSHA 4Z2TA 4EE0A 3ZIVA 4XS6A 4E8HA 2ALBA 3CSJA 1NSWA 4K5SA 4BL7A 4BPYA 3TDGA 6GSYA 3I43A 5DQSA 3O3TA 5DBQA 2TRCP 4Z7XA 1K3YA 1TK0B 3O6TA 5A5KA 2HYXA 1K0OA 2I1UA 4N0ZA 5AGYA 1K0DA 3HXSA 2L59A 3SBCA 4WEYA 3L9VA 2L5LA 2XPDA 3GX8A 2R4VA 1C72A 1O6JA 3FRCA 4K8MA 4ZL7A 4TRXA 1FOVA 1U87A 4HQSA 2H8LA 4V2MA 2VUPA 5DDLA 5B6NA 5H5QA 4G0IA 2PMTA 1R5AA 1TI3A 2JADA 3CTGA 3QD9A 1BJXA 4XTSA 2GZPA 4K2DA 3GKXA 1VF1A 4OFTA 1O7UA 2D2ZA 1E6BA 1HNAA 1SD8A 1QFNA 2LRNA 3WGEA 1YKAA 2A2RA 4JEDA 2J9HA 2YWNA 3G7JA 3GH9A 4K1FA 22GSA 5ID2A 4ZBDA 1IYIA 2B5XA 2LQOA 3PH9A 3QR6A 5ENUA 2YN1A 3VPTA 4HU9A 4MZWA 4ACSA 1F3AA 1HYUA 2RUFA 3TKQA 2DIZA 5IOXA 3ERWA 2YANA 5JWQB 17GSA 3ZRDA 2RUEA 3F3RA 4P3YB 2FGXA 1XFLA 5JCUA 4OMVA 4KE3A 3ME7A 2C0GA 3FZ5A 5G5FA 4OCFA 3JCML 2R37A 2HI7A 5HR3A 3GUSA 4I2UA 2H0IA 3NIVA 1XWKA 20GSA 3IOSA 2WDUA 2CA8A 2QGVA 4F82A 3GKNA 2LJRA 1FO5A 5E4WA 1WJKA 1JZRA 2WJUA 3GFKA 4ILFA 5EPFA 1K0AA 2KUCA 1V2AA 2FLSA 1Y6EA 1SKWB 3FR6A 1EGOA 3FR3A 5COHA 4G0LA 4HUAA 5G31A 1UC7A 2CZ2A 3RDWA 3VWVA 1EV9A 4G9HA 5HR2A 2LV3A 3C73A 4EUYA 2ZNMA 3GYKA 2ON5A 5CRGA 3LSZA 3BCIA 1SJIA 5B8BA
chains in the Genus database with same CATH topology
2EIOA 4IW9A 4MMMA 3GA4A 3DKSA 1TW9A 2I3YA 4GWRA 3US3A 3ZZXA 2YNXA 1ERTA 3P8WA 2B7KA 5D9TA 4XCSA 2VCXA 4ECIA 4N10A 2H1DA 2GQLA 2JZTA 3BD2A 6GSWA 3FEUA 3UMAA 1FHEA 1Y25A 4OD7A 5DCHA 4XS4B 5JWOB 4GSSA 4KSOA 3KCMA 4KX4A 2IIYA 1XVQA 4YKFA 4MJCA 4KF9A 4JRRA 2OBIA 1UA5A 3MNGA 3DMLA 3DRNA 1ACVA 3EYTA 4I2TA 1PL1A 1E2YA 2WGRA 3SWLA 4LMWA 2GGTA 2RLIA 2IMIA 1PSQA 6GSSA 4YQMA 4V2NA 6GSUA 2H19A 2GDRA 3AY8A 1XVWA 2R3XA 1EEJA 1AIUA 3F6DA 1KNGA 4ZB9A 3F6FA 3VFIA 1ON4A 2F8AA 2YOIA 4ECBA 3WD6A 2IMDA 14GSA 3QAWA 2OADA 5H5SA 2V6OA 6GSTA 16GSA 2KP1A 4E8EA 1QK8A 2L4QA 4GSTA 1ILOA 4PQIA 4MK3A 4GQCA 3F3QA 4KW6A 4EL1A 2H72A 1AXDA 4Z2RA 3LGCA 2VLTA 3DD3A 3H4KA 1SU9A 1AQVA 4FYUA 2MMOA 2P0GA 2H66A 1GSSA 1XW6A 1TK5B 5EY6A 1T4ZA 4RUVA 3VI5A 3TJGA 1FVKA 1F6MC 4HEA2 1WOUA 4XRDA 1GTUA 3F9UA 2JSZA 1ZCPA 3QFBC 1OKTA 3TUEA 1KEBA 1TRUA 1PRXA 3MSZA 2EIRA 5JCWA 3IK9A 2O87A 4YH2A 1T3BA 3EVIA 3A2VA 3UOMA 2H1AA 1TXXA 1PN9A 2F3MA 1AQWA 2AV4A 2YCDA 4KA0A 1TRSA 4OFNA 3E0UA 3TOUA 2WFCA 4H86A 5CNWA 2AYTA 4HS1A 4AGSA 1TKDB 5CRDA 2CX4A 1JZWA 2GSTA 2WRTA 2PN8A 1EZKA 2VM1A 4XIHA 3IDVA 3MDKA 2HSMA 4K7OA 1YF0A 2KLXA 2VCWA 2XPEA 2IFQA 1LU4A 1YZXA 1FB0A 3BBYA 3NOFA 2GTUA 4D73A 2C1YA 4N11A 2PVOC 1DE1A 2JSYA 2YJ7A 3LQ7A 2VD1A 2FHEA 4G0KA 5F8BA 5IMZA 2O8VB 5KN0A 3GKKA 1B4PA 1R5PA 2DJ3A 1A8YA 1YY7A 2CX3A 4DSSA 2L4CA 1XW5A 2B5YA 2V2GA 4I8BA 1W89A 1M2BA 5A4VA 4L5LA 4IGJA 3PR8A 1WRYA 4WR4A 4EDZA 3HD5A 4O92A 4AJ6A 2KOKA 1H4OA 1RQMA 3KH7A 1PN0A 3M3MA 3EPTA 1PKWA 2AB6A 1OVNA 5FHIA 1O8WA 2GSRA 4MF6A 4IQ1A 4L5OA 4K7NA 2KP2A 3FYGA 4FO5A 4ID0A 1O8XA 2L6CA 3Q6OA 4FIWA 5C04A 3S9FA 2C8UA 2HT9A 4L8EA 1JLVA 5F0GA 4XS1A 1QUWA 3KH9A 3ME8A 4BVYB 2REMA 2WULA 3DYRA 2YWMA 3RAZA 2G2QA 3OR5A 4BWSA 1H75A 4V1Ap 3K8NA 2C0FA 5L71A 4POMA 2L57A 2VO4A 4MJAA 3APOA 1RW1A 2ON7A 2FY6A 4WKWA 5ECRB 3EC3A 2P5QA 2X64A 2HSYA 1ZYQB 4LL4B 4BA7A 3FK8A 4G2EA 2DJKA 1A23A 3VK9A 3HVVA 4KCAA 3RBTA 1DSBA 2FWGA 4NXIA 3IPZA 4OCEA 1SK0A 3PGTA 2QC7A 1GTBA 5B6MA 2YJHA 4ML6A 4LL1B 1A0FA 3FZ9A 1EOHA 4J2FA 3ERFA 4RQXA 4TOPA 3GH6A 3NZNA 5DJLA 1GSFA 5AIVA 3Q19A 3G7IA 4JR6A 3CSIA 3ZMKA 1V40A 1ABAA 4O5QA 1TK8B 2LRCA 2X4AA 3L78A 4ZBAA 1X9SB 1M2DA 3LEFA 3ZLPA 2PPTA 4OFMA 4NMUA 12GSA 2E2GA 2FA8A 3RPPA 3R2QA 3R3EA 1URMA 3HVXA 1X0RA 2HSHA 4KDYA 4GXZA 1BEDA 3C1SA 3EMPA 5A4WA 1SENA 1OC8A 2LJAA 2WS2A 1PQNA 4F9ZA 4Z2UA 5A4UA 1OC9A 2DLXA 5IMCA 2LSTA 6GSXA 1CQGA 2YP6A 4IBPA 1OAZA 3RHBA 5LCZA 2PERA 2YPMA 1SYRA 4CW9A 3HY2A 2HZEA 2BMXA 5D8IA 1VF3A 1XXUA 4RI7A 5G5EA 5ECIB 1ERWA 1T4YA 2OE1A 1JLWA 3KD0A 1TU8A 2E0QA 4OO5A 2JZRA 4GLTA 3GIXA 4ISDA 2MYGA 5HR0A 1DE2A 1T00A 2DMMA 2R0CA 1GUMA 4NAXA 2C3NA 5GSSA 2KHPA 2H74A 4AJ8A 1ZGNA 3EE2A 1S3CA 3LWAA 2HNLA 3L9UA 4J57E 1U88A 3F63A 3W8SA 2B5EA 4PXOA 1AC1A 2VCZA 1M99A 4O5UA 5IPGA 5JCGA 2DJJA 2CZ3A 4LMVA 3EINA 13GSA 4JZQA 4PURA 4POKA 8GSSA 1Z9HA 3D4TA 4TW5A 1ERVA 3J7Yk 2DJ1A 4NV5A 2DC5A 3APSA 4F0BA 2CVDA 3TCOA 1S3DA 1M9AA 4HZ2A 1AW9A 3DEXA 4Q5QA 5GAND 2F51A 4MPFA 3LFLA 2A2PA 3UBLA 2B1KA 1M9BA 3C7MA 4DSRA 2IFQB 5CREA 1ZZYA 2MMAA 3A2WA 3FY7A 1EEMA 3UVTA 4DSQA 2CAIA 4D73B 3D0ZA 2I81A 3RHCA 4WF5A 5IMVA 1GTIA 3MWHA 3CXGA 1YKCA 4CHSA 1TRWA 3EURA 3KMOA 2GZYA 2ZUPA 2A4VA 2GT6A 4PQHA 1J9BA 2FUG2 3GMFA 4EKZA 4DSSB 1OC3A 1OKDA 1QQ2A 2I9HA 3F4TA 1WIKA 1PD21 2X8GA 3A5WA 2I4AA 3Q74A 4HZ4A 3HKRA 2GQKA 2AJQB 3DXBA 1ZL9A 1KBNA 1NHYA 1WWJA 1K0CA 3GKMA 3QAGA 4K0NA 3DGQA 4IKHA 1YJ6A 2K8VA 2C0EA 2TRXA 3BCKA 1YQ1A 3PINA 2EIQA 3HJPA 2HXKA 1OE7A 1Z6NA 3QFAC 2LUSA 2DMLA 4TR1A 2LNTA 1ST9A 4KDUA 4ZB6A 4YQVA 3TOTA 1AUCA 1ZYPA 3Q18A 5ECMB 1GSYA 4HI7A 5AIXA 5D93A 3U5RE 3FMWA 5FWGA 2CT6A 5BMUA 1EOGA 1SK1A 1A24A 3BOAA 5LNKe 3F0IA 2XBIA 2HZFA 1PL2A 2B1LA 4EXJA 3KJYA 3ZITA 1BX9A 3LW9A 2B6MA 7GSSA 2FCHA 5GZZB 2LQQA 5D96A 2GT5A 5ECHB 1XWGA 5DALA 3MIXA 2XBQA 4IHUA 2RM6A 4BVXA 2LRTA 3IAS2 5DJMA 2G0FA 3N9JA 5HFGA 3LG6A 4ZILA 2XC2A 2H70A 2PVQA 1GSQA 5IIZA 4WR5A 3L4NA 2OACA 4KDXA 2C3TA 2LKUA 1TOFA 5F05A 3GTUA 5B8AA 2O89A 2BTOT 1GL8A 5EVOA 4L0UA 3TJKA 3VWXA 3VPQA 5IO2A 2FNOA 3HHVA 1W4VA 3M1GA 3A2XA 5G1KA 3IHGA 1SL0B 2YWIA 3MYDA 1V9WA 2LEGA 2M72A 1WPIA 3TB2A 5ABRA 2VL2A 1XWCA 1UVZA 1TJDA 1SL2B 3DVWA 1GULA 2OJLA 4BL7B 1B9YC 4XRAA 1QXHA 4KNDA 3TKPA 3CMIA 4CY8A 2B3SA 1THXA 3C8EA 3VURA 4GCIA 5HR1A 2C4JA 1BG5A 1X5EA 2DSAA 1OC9B 3GRXA 3ED3A 5KEJA 4K9ZA 4TR0A 1GNWA 1WP0A 3DWVA 1B48A 3QCPA 3ZTLA 1G6YA 3ISOA 4X0XA 2HRKA 4PNGA 4KAEA 1MD4A 4V2LA 2F9SA 2IJYA 3QDNA 3CTFA 1O85A 1FG4A 2GS3A 3H93A 2MMZA 2K8SA 1EV4A 2A2SA 2BJXA 2N5BA 3EU4A 5HQPA 2CAQA 2QKEA 5ID2B 5DQYA 5C00A 3GL3A 4MZBA 1Z7RA 1MDJA 3M8NA 1XWAA 4FQUA 4QQ7A 5DAKA 3UIWA 2H6ZA 4MZCA 1M2AA 1AAZA 3KTLA 4DEJA 4ECJA 4GQFA 2FWFA 1F9MA 5IMAA 4USSA 4GF0A 1XIYA 5ECQB 4IP6A 4BWQA 2X8HA 1B8XA 1K3LA 3IRAA 4MLYA 3A3TA 3VLNA 2PU9C 2XHFA 1ZMAA 4LLRA 4IJ3A 1B4QA 1FOHA 3D6IA 3ZFBA 2JL4A 5CO3A 2AHEA 2NTOA 1A8LA 5FT3A 2Z9SA 4CY6A 3IE3A 1XBSA 3TRQA 4FYCA 4LA1A 5E59A 3WYWA 2VM2A 1R4WA 2IMKA 4K7IA 3IA1A 1GSEA 2DJ2A 2H0HA 1SYXA 2HLSA 4TVEA 4GSNA 1GRXA 3HA9A 4XS4A 2GLRA 4CDOA 1NW2A 2OBKA 3TKSE 3PPUA 4IJIA 2CQ9A 3TJJA 2EC4A 4X4JA 3DIEA 9GSSA 4PUFC 4ZIJA 4TXVA 3HDCA 3LXTA 4F0CA 4MNNA 3TGZA 5KN3A 2O85A 1I5GA 1THOA 1YDKA 3N5OA 1R7HA 4WETA 1A2MA 3ZVJD 3CYNA 3GSTA 1DUGA 3FZAA 3BJ5A 1Z7PA 3KP8A 2PUKC 19GSA 4RI6A 3P90A 5ECKB 4POLA 1SL1B 3M0FA 1G6WA 2YV9A 2V6KA 4TR1B 1XPVA 1GWCA 5IOWA 3QOUA 1B9XC 4NWYA 4XHMA 5KOXA 3HZ8A 3W8JA 4QL9A 3CBUA 1G7EA 1F2EA 3W6GA 2CV4A 4JU5A 2H76A 4MF5A 5CYYA 1WE0A 4AJ7A 2HRNA 3TKSC 4OWYA 5INYA 1NHOA 4TKYA 3WT2A 4PNFA 3WT1A 3A5IA 3F4RA 4K2XA 1WMJA 5DALB 3QPMA 1VF2A 3L0HA 4MA9A 5ECSA 1BYEA 5HFIA 2HRAA 4BVXB 4NPBA 5CRHA 3UJ1A 2DIYA 4NHWA 2H73A 4EO3A 3KMNA 4KB3A 1V98A 4MCUA 3D22A 3TRXA 2VOCA 1U3AA 4NV2A 1U6TA 3D21A 1MDKA 3I9V2 1BAYA 2VL2C 1EP8A 2J23A 3IC8A 5GSTA 2H6YA 5D9XA 5G1LA 4MH2A 3RPNA 4PTSA 2V1MA 1IYHA 2HE3A 2C3QA 4MPGA 2GSSA 3GTUB 1A0RP 5D9WA 5JWRB 1N8JA 4Q5RA 3M9JA 4KH7A 2OA7A 2AUVA 2RM5A 3TRPA 3TKRA 3UBKA 3CRTA 5GAPD 2FD3A 4QL7A 1Z5YE 3CRUA 2VCVA 6GSVA 3GSSA 4K0GA 2CVKA 2PGTA 3G9BA 1ZYEA 3ZFLA 2IMEA 1OYJA 4ZXGA 4PUAA 5ECNB 2TIRA 5J5NA 4IVFA 3F8UA 2VCTA 1LBKA 4G19A 1T7PB 1I9DA 2H1GA 1GP1A 2FWEA 4N0VA 2YZUA 1VF4A 2WZ9A 2OE3A 4POBA 2O7KA 1X5DA 1TI1A 4MP4A 4KGIA 3FW2A 3HVSA 2A4HA 1K0MA 3IXRA 3O76A 4ML1A 2DBCA 1TRVA 1U3IA 1J08A 3IAM2 1K0BA 3FHKA 3EWLA 4EF0A 4FH8A 4HJMA 2LTKA 4TR4A 1A2JA 4MF7A 2AAWA 5J3RA 1K0NA 2M46A 2VL3A 1TDIA 2DKHA 3MAKA 1SKRB 1PA3A 1UN2A 5KN1A 2VL9A 2IN3A 1ERUA 4ZB8A 4BVYA 2F8FA 1FW1A 2R6KA 2X49A 4F2IA 2GQMA 1LJRA 2QA1A 5D73A 5CRWA 4ZL9A 2N5FA 5DAKB 4O32A 3H1NA 4IS0A 2ZCTA 3LXZA 1PX7A 4PQ1A 1BQ7A 4WBRD 5IO0A 3L9SA 1MD3A 3IK7A 3GN3A 4HOJA 5ECOB 1PMTA 1GH2A 1EP7A 3C1RA 4GTUA 1GLQA 2B7JA 4L0WA 2JZSA 5G2ZA 3F4SA 3IHQA 2HRFA 2OKAA 2UZ8A 4X1UA 2K9FA 2H75A 3D4MA 4OO4A 1GSUA 2NPBA 3QAVA 3P7XA 3E3EA 1EGRA 1HNCA 4I6XA 3IV4A 2PBJA 2IMFA 4YAVA 2VD0A 4I97A 3GNJA 1K3OA 4MH3A 3HJOA 4G10A 3DVXA 1XOAA 1GNEA 4HJ2A 2HFDA 2FWHA 4PGTA 3HCZA 1F3BA 5J41A 3ZREA 1ML6A 1Z3EA 3WGXA 1JHBA 5G30A 4AF2A 4ECCA 4TXOA 5KN2A 4MJEA 1MTCA 2VLVA 3GL5A 1HNBA 2GSQA 4ZL8A 5KOWA 2E2MA 3H8QA 5ELGA 2JU5A 3IBHA 4YAPA 4TR3A 3KM6A 1QMVA 3KIJA 3LYKA 1SJZA 2WB9A 2JACA 3UEMA 10GSA 1V58A 3TKSA 1A2LA 1F37A 2MBTA 4GRFA 2YZHA 2FA4A 2QSIA 1XWBA 3KTBA 1JZOA 4IELA 4O5RA 1N2AA 5AN1A 1VRSD 1TTZA 4EIQA 2MMNA 3FKFA 5J9BA 1GSDA 3UVHA 1TP9A 2P5RA 1GLPA 2YWOA 2C0DA 2R0PA 2VLUA 5IMFA 3KGKA 4J56E 4K6XA 1PGTA 1RK4A 1JZDA 2H6XA 5CP1A 3KXOA 5IQYA 3QMXA 4F03A 1ZOFA 1FAAA 1O73A 1XZOA 3UL3A 1YEXA 1AQXA 3LJRA 11GSA 4NHZA 3WGDA 4ULXA 1YEPA 3GURA 1MDIA 4YQUA 2MBSA 3GX0A 3HJMA 2H71A 3UAPA 2IWTA 2VCQA 1R26A 2H30A 4IQAA 1O81A 1QGVA 2LS5A 1EWXA 2LNSA 3EU3A 2RIIA 5DVBA 4DVCA 2L6DA 2R0GA 2WCIA 2NVLA 3I69A 2HZEB 2L5OA 4WF4A 1J0FA 4JR4A 5F07A 2CVBA 2M80A 1GUHA 4K5RA 1DBYA 4X43A 4EDYA 3H79A 4V1Ag 4HQZA 2V32A 4TN8A 3P2AA 1T8EB 4ICYA 4YKGA 1JFUA 3TJFA 4JBBA 5AISA 4Q5FA 1YF1A 3G7YA 2DKIA 18GSA 1X5CA 5DCGA 5EL8A 5J4UA 4A5PA 1PX6A 3GHAA 4FYBA 3ERGA 1V57A 5CAXA 2K18A 3UARA 5ECLB 2GZZA 4KCEA 5BRTA 1MEKA 1HD2A 2X99A 1XOBA 1KTEA 4JE1A 2K6VA 4EIPA 2R5GA 3IR4A 5ELAA 2OE0A 3IC4A 5J9CA 5IPHA 1Z6MA 2PWJA 3ZIJA 1M7TA 4MDCA 4RQRA 4WXTA 2YV7A 2E7PA 3ZL5A 5D9VA 4KSMA 5HFKA 4I5QA 1Q98A 3LYPA 4ZBBA 1Q4JA 4KUNA 4WBJA 1G0TA 3C71A 2NDOA 3D5JA 3U6VA 2IL3A 1VGLA 2MZCA 2P31A 2H0GA 1X9MB 5IMDA 3ZMLA 2C80A 2LJKA 1USBA 2R2JA 1SD9A 3VWUA 1HQOA 3ZVJA 3ZYWA 3E9JB 3J7Yb 3HYPA 4IP1A 5LD0A 3FR9A 4N30A 1GUKA 3VWWA 3M9KA 3KP9A 2DJ0A 1XW9A 5B7CA 1T1VA 2VAFA 2NBSA 3VI7A 1GTAA 3V1WA 2ES7A 3EMXA 3I6AA 4O7HA 1OE8A 3KEBA 5F06A 3TJBA 1FVJA 1FB6A 3LORA 1G7OA 1ZYNA 4EVMA 4EC0A 1CQHA 1SK2A 2IPAA 1TU7A 2N5AA 4HDEA 1M0UA 2H01A 1PKZA 1XCCA 1X9WB 5H5RA 3HZ4A 3APQA 4Q5NA 2GVPA 2X8CA 1NM3A 1S3AA 3KZQA 2VIMA 4IN0A 3FZ4A 5IM9A 5ECPB 2H1BA 4PX1A 4MJBA 1SJ6A 2V41A 3GV1A 4HU7A 4TXOB 1SKSB 4MABA 2QA2A 3CSHA 4Z2TA 4EE0A 3ZIVA 4XS6A 4E8HA 2ALBA 3CSJA 1NSWA 4K5SA 4BL7A 4BPYA 3TDGA 6GSYA 3I43A 5DQSA 3O3TA 5DBQA 2TRCP 4Z7XA 1K3YA 1TK0B 3O6TA 5A5KA 2HYXA 1K0OA 2I1UA 4N0ZA 5AGYA 1K0DA 3HXSA 2L59A 3SBCA 4WEYA 3L9VA 2L5LA 2XPDA 3GX8A 2R4VA 1C72A 1O6JA 3FRCA 4K8MA 4ZL7A 4TRXA 1FOVA 1U87A 4HQSA 2H8LA 4V2MA 2VUPA 5DDLA 5B6NA 5H5QA 4G0IA 2PMTA 1R5AA 1TI3A 2JADA 3CTGA 3QD9A 1BJXA 4XTSA 2GZPA 4K2DA 3GKXA 1VF1A 4OFTA 1O7UA 2D2ZA 1E6BA 1HNAA 1SD8A 1QFNA 2LRNA 3WGEA 1YKAA 2A2RA 4JEDA 2J9HA 2YWNA 3G7JA 3GH9A 4K1FA 22GSA 5ID2A 4ZBDA 1IYIA 2B5XA 2LQOA 3PH9A 3QR6A 5ENUA 2YN1A 3VPTA 4HU9A 4MZWA 4ACSA 1F3AA 1HYUA 2RUFA 3TKQA 2DIZA 5IOXA 3ERWA 2YANA 5JWQB 17GSA 3ZRDA 2RUEA 3F3RA 4P3YB 2FGXA 1XFLA 5JCUA 4OMVA 4KE3A 3ME7A 2C0GA 3FZ5A 5G5FA 4OCFA 3JCML 2R37A 2HI7A 5HR3A 3GUSA 4I2UA 2H0IA 3NIVA 1XWKA 20GSA 3IOSA 2WDUA 2CA8A 2QGVA 4F82A 3GKNA 2LJRA 1FO5A 5E4WA 1WJKA 1JZRA 2WJUA 3GFKA 4ILFA 5EPFA 1K0AA 2KUCA 1V2AA 2FLSA 1Y6EA 1SKWB 3FR6A 1EGOA 3FR3A 5COHA 4G0LA 4HUAA 5G31A 1UC7A 2CZ2A 3RDWA 3VWVA 1EV9A 4G9HA 5HR2A 2LV3A 3C73A 4EUYA 2ZNMA 3GYKA 2ON5A 5CRGA 3LSZA 3BCIA 1SJIA 5B8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIO A;  4IW9 A;  4MMM A;  3GA4 A;  3DKS A;  1TW9 A;  2I3Y A;  4GWR A;  3US3 A;  3ZZX A;  2YNX A;  1ERT A;  3P8W A;  2B7K A;  5D9T A;  4XCS A;  2VCX A;  4ECI A;  4N10 A;  2H1D A;  2GQL A;  2JZT A;  3BD2 A;  6GSW A;  3FEU A;  3UMA A;  1FHE A;  1Y25 A;  4OD7 A;  5DCH A;  4XS4 B;  5JWO B;  4GSS A;  4KSO A;  3KCM A;  4KX4 A;  2IIY A;  1XVQ A;  4MJC A;  4JRR A;  2OBI A;  1UA5 A;  3MNG A;  3DML A;  3DRN A;  1ACV A;  3EYT A;  4I2T A;  1PL1 A;  1E2Y A;  2WGR A;  3SWL A;  4LMW A;  2GGT A;  2RLI A;  2IMI A;  1PSQ A;  6GSS A;  4YQM A;  4V2N A;  6GSU A;  2H19 A;  2GDR A;  3AY8 A;  1XVW A;  2R3X A;  1EEJ A;  1AIU A;  3F6D A;  1KNG A;  4ZB9 A;  3F6F A;  3VFI A;  1ON4 A;  2F8A A;  2YOI A;  4ECB A;  3WD6 A;  2IMD A;  14GS A;  3QAW A;  2OAD A;  5H5S A;  2V6O A;  6GST A;  16GS A;  2KP1 A;  4E8E A;  1QK8 A;  2L4Q A;  4GST A;  1ILO A;  4PQI A;  4MK3 A;  4GQC A;  3F3Q A;  4KW6 A;  4EL1 A;  2H72 A;  1AXD A;  3LGC A;  2VLT A;  3DD3 A;  3H4K A;  1SU9 A;  1AQV A;  4FYU A;  2MMO A;  2P0G A;  2H66 A;  1GSS A;  1XW6 A;  1TK5 B;  5EY6 A;  1T4Z A;  4RUV A;  3VI5 A;  3TJG A;  1FVK A;  1F6M C;  4HEA 2;  1WOU A;  4XRD A;  1GTU A;  3F9U A;  2JSZ A;  1ZCP A;  3QFB C;  1OKT A;  3TUE A;  1KEB A;  1TRU A;  1PRX A;  3MSZ A;  2EIR A;  5JCW A;  3IK9 A;  2O87 A;  4YH2 A;  1T3B A;  3EVI A;  3A2V A;  3UOM A;  2H1A A;  1TXX A;  1PN9 A;  2F3M A;  1AQW A;  2AV4 A;  2YCD A;  4KA0 A;  1TRS A;  4OFN A;  3E0U A;  3TOU A;  2WFC A;  4H86 A;  5CNW A;  2AYT A;  4HS1 A;  4AGS A;  1TKD B;  5CRD A;  2CX4 A;  1JZW A;  2GST A;  2WRT A;  2PN8 A;  1EZK A;  2VM1 A;  4XIH A;  3IDV A;  3MDK A;  4K7O A;  1YF0 A;  2KLX A;  2VCW A;  2XPE A;  2IFQ A;  1LU4 A;  1YZX A;  1FB0 A;  3BBY A;  3NOF A;  2GTU A;  4D73 A;  2C1Y A;  4N11 A;  2PVO C;  1DE1 A;  2JSY A;  2YJ7 A;  3LQ7 A;  2VD1 A;  2FHE A;  5F8B A;  5IMZ A;  2O8V B;  5KN0 A;  3GKK A;  1B4P A;  1R5P A;  2DJ3 A;  1A8Y A;  1YY7 A;  2CX3 A;  4DSS A;  2L4C A;  1XW5 A;  2B5Y A;  2V2G A;  4I8B A;  1W89 A;  1M2B A;  5A4V A;  4L5L A;  4IGJ A;  3PR8 A;  1WRY A;  4WR4 A;  4EDZ A;  3HD5 A;  4O92 A;  4AJ6 A;  2KOK A;  1H4O A;  1RQM A;  3KH7 A;  3M3M A;  1PKW A;  2AB6 A;  1OVN A;  5FHI A;  1O8W A;  2GSR A;  4MF6 A;  4IQ1 A;  4L5O A;  4K7N A;  2KP2 A;  3FYG A;  4FO5 A;  4ID0 A;  1O8X A;  2L6C A;  3Q6O A;  4FIW A;  5C04 A;  3S9F A;  2C8U A;  2HT9 A;  4L8E A;  1JLV A;  5F0G A;  4XS1 A;  1QUW A;  3KH9 A;  3ME8 A;  2REM A;  2WUL A;  3DYR A;  2YWM A;  3RAZ A;  2G2Q A;  3OR5 A;  4BWS A;  1H75 A;  4V1A p;  3K8N A;  2C0F A;  5L71 A;  4POM A;  2L57 A;  2VO4 A;  4MJA A;  3APO A;  1RW1 A;  2ON7 A;  2FY6 A;  4WKW A;  5ECR B;  3EC3 A;  2P5Q A;  2X64 A;  2HSY A;  1ZYQ B;  4LL4 B;  4BA7 A;  3FK8 A;  4G2E A;  2DJK A;  1A23 A;  3VK9 A;  3HVV A;  4KCA A;  3RBT A;  1DSB A;  2FWG A;  4NXI A;  3IPZ A;  4OCE A;  1SK0 A;  3PGT A;  2QC7 A;  1GTB A;  5B6M A;  2YJH A;  4ML6 A;  4LL1 B;  1A0F A;  3FZ9 A;  1EOH A;  4J2F A;  3ERF A;  4RQX A;  4TOP A;  3GH6 A;  3NZN A;  5DJL A;  1GSF A;  5AIV A;  3Q19 A;  3G7I A;  4JR6 A;  3CSI A;  3ZMK A;  1V40 A;  1ABA A;  1TK8 B;  2LRC A;  3L78 A;  4ZBA A;  1X9S B;  1M2D A;  3LEF A;  3ZLP A;  2PPT A;  4OFM A;  4NMU A;  12GS A;  2E2G A;  2FA8 A;  3RPP A;  3R2Q A;  1URM A;  3HVX A;  1X0R A;  2HSH A;  4KDY A;  4GXZ A;  1BED A;  3C1S A;  3EMP A;  5A4W A;  1SEN A;  1OC8 A;  2LJA A;  2WS2 A;  1PQN A;  4F9Z A;  5A4U A;  1OC9 A;  2DLX A;  5IMC A;  2LST A;  6GSX A;  1CQG A;  2YP6 A;  4IBP A;  1OAZ A;  3RHB A;  5LCZ A;  2PER A;  2YPM A;  1SYR A;  4CW9 A;  3HY2 A;  2HZE A;  2BMX A;  5D8I A;  1VF3 A;  1XXU A;  4RI7 A;  5G5E A;  5ECI B;  1ERW A;  1T4Y A;  2OE1 A;  1JLW A;  3KD0 A;  1TU8 A;  2E0Q A;  4OO5 A;  2JZR A;  4GLT A;  3GIX A;  4ISD A;  2MYG A;  5HR0 A;  1DE2 A;  1T00 A;  2DMM A;  1GUM A;  4NAX A;  2C3N A;  5GSS A;  2KHP A;  2H74 A;  4AJ8 A;  1ZGN A;  3EE2 A;  1S3C A;  3LWA A;  2HNL A;  3L9U A;  4J57 E;  1U88 A;  3F63 A;  3W8S A;  2B5E A;  4PXO A;  1AC1 A;  2VCZ A;  1M99 A;  5IPG A;  5JCG A;  2DJJ A;  2CZ3 A;  4LMV A;  3EIN A;  13GS A;  4JZQ A;  4PUR A;  4POK A;  8GSS A;  1Z9H A;  3D4T A;  4TW5 A;  1ERV A;  3J7Y k;  2DJ1 A;  4NV5 A;  2DC5 A;  3APS A;  4F0B A;  2CVD A;  3TCO A;  1S3D A;  1M9A A;  4HZ2 A;  1AW9 A;  3DEX A;  4Q5Q A;  5GAN D;  2F51 A;  4MPF A;  3LFL A;  3UBL A;  2B1K A;  1M9B A;  3C7M A;  4DSR A;  2IFQ B;  5CRE A;  1ZZY A;  2MMA A;  3A2W A;  3FY7 A;  1EEM A;  3UVT A;  4DSQ A;  2CAI A;  4D73 B;  3D0Z A;  2I81 A;  3RHC A;  4WF5 A;  5IMV A;  1GTI A;  3MWH A;  3CXG A;  1YKC A;  4CHS A;  1TRW A;  3EUR A;  3KMO A;  2GZY A;  2ZUP A;  2A4V A;  2GT6 A;  4PQH A;  1J9B A;  2FUG 2;  3GMF A;  4EKZ A;  4DSS B;  1OC3 A;  1OKD A;  1QQ2 A;  2I9H A;  3F4T A;  1WIK A;  1PD2 1;  2X8G A;  3A5W A;  2I4A A;  3Q74 A;  4HZ4 A;  3HKR A;  2GQK A;  2AJQ B;  3DXB A;  1ZL9 A;  1KBN A;  1NHY A;  1WWJ A;  1K0C A;  3GKM A;  3QAG A;  4K0N A;  3DGQ A;  4IKH A;  1YJ6 A;  2K8V A;  2C0E A;  2TRX A;  3BCK A;  1YQ1 A;  3PIN A;  2EIQ A;  3HJP A;  2HXK A;  1OE7 A;  1Z6N A;  3QFA C;  2LUS A;  2DML A;  4TR1 A;  2LNT A;  1ST9 A;  4KDU A;  4ZB6 A;  4YQV A;  3TOT A;  1AUC A;  3Q18 A;  5ECM B;  1GSY A;  4HI7 A;  5AIX A;  5D93 A;  3U5R E;  5FWG A;  2CT6 A;  1EOG A;  1SK1 A;  1A24 A;  3BOA A;  5LNK e;  3F0I A;  2XBI A;  2HZF A;  1PL2 A;  2B1L A;  4EXJ A;  3KJY A;  3ZIT A;  1BX9 A;  2B6M A;  7GSS A;  2FCH A;  5GZZ B;  2LQQ A;  5D96 A;  2GT5 A;  5ECH B;  1XWG A;  5DAL A;  2XBQ A;  4IHU A;  2RM6 A;  4BVX A;  2LRT A;  3IAS 2;  5DJM A;  2G0F A;  3N9J A;  5HFG A;  3LG6 A;  4ZIL A;  2XC2 A;  2H70 A;  2PVQ A;  1GSQ A;  5IIZ A;  4WR5 A;  3L4N A;  2OAC A;  4KDX A;  2C3T A;  2LKU A;  1TOF A;  5F05 A;  3GTU A;  5B8A A;  2O89 A;  2BTO T;  1GL8 A;  5EVO A;  4L0U A;  3TJK A;  3VWX A;  3VPQ A;  5IO2 A;  2FNO A;  3HHV A;  1W4V A;  3M1G A;  3A2X A;  5G1K A;  1SL0 B;  2YWI A;  1V9W A;  2LEG A;  2M72 A;  1WPI A;  3TB2 A;  5ABR A;  2VL2 A;  1XWC A;  1UVZ A;  1TJD A;  1SL2 B;  3DVW A;  1GUL A;  2OJL A;  1B9Y C;  4XRA A;  1QXH A;  4KND A;  3TKP A;  3CMI A;  2B3S A;  1THX A;  3C8E A;  3VUR A;  4GCI A;  5HR1 A;  2C4J A;  1BG5 A;  1X5E A;  2DSA A;  1OC9 B;  3GRX A;  3ED3 A;  5KEJ A;  4K9Z A;  4TR0 A;  1GNW A;  1WP0 A;  3DWV A;  1B48 A;  3QCP A;  3ZTL A;  1G6Y A;  3ISO A;  4X0X A;  4PNG A;  4KAE A;  1MD4 A;  4V2L A;  2F9S A;  2IJY A;  3QDN A;  3CTF A;  1O85 A;  1FG4 A;  2GS3 A;  3H93 A;  2MMZ A;  2K8S A;  1EV4 A;  2A2S A;  2BJX A;  2N5B A;  3EU4 A;  5HQP A;  2CAQ A;  2QKE A;  5ID2 B;  5DQY A;  5C00 A;  3GL3 A;  4MZB A;  1Z7R A;  1MDJ A;  3M8N A;  1XWA A;  5DAK A;  4QQ7 A;  3UIW A;  2H6Z A;  4MZC A;  1M2A A;  1AAZ A;  3KTL A;  4DEJ A;  4ECJ A;  4GQF A;  2FWF A;  1F9M A;  5IMA A;  5ECQ B;  4GF0 A;  1XIY A;  4IP6 A;  4BWQ A;  2X8H A;  1B8X A;  1K3L A;  3IRA A;  4MLY A;  3A3T A;  3VLN A;  2PU9 C;  2XHF A;  1ZMA A;  4LLR A;  4IJ3 A;  1B4Q A;  3D6I A;  3ZFB A;  2JL4 A;  5CO3 A;  2AHE A;  2NTO A;  1A8L A;  5FT3 A;  2Z9S A;  3IE3 A;  1XBS A;  3TRQ A;  4FYC A;  4LA1 A;  5E59 A;  3WYW A;  2VM2 A;  1R4W A;  2IMK A;  4K7I A;  3IA1 A;  1GSE A;  2DJ2 A;  2H0H A;  1SYX A;  2HLS A;  4TVE A;  4GSN A;  1GRX A;  3HA9 A;  4XS4 A;  2GLR A;  4CDO A;  1NW2 A;  2OBK A;  3TKS E;  4IJI A;  2CQ9 A;  3TJJ A;  2EC4 A;  3DIE A;  9GSS A;  4PUF C;  4ZIJ A;  4TXV A;  3HDC A;  3LXT A;  4F0C A;  3TGZ A;  5KN3 A;  2O85 A;  1I5G A;  1THO A;  1YDK A;  3N5O A;  1R7H A;  4WET A;  1A2M A;  3ZVJ D;  3CYN A;  3GST A;  1DUG A;  3FZA A;  3BJ5 A;  1Z7P A;  3KP8 A;  2PUK C;  19GS A;  4RI6 A;  3P90 A;  5ECK B;  4POL A;  1SL1 B;  3M0F A;  1G6W A;  2YV9 A;  2V6K A;  4TR1 B;  1XPV A;  1GWC A;  5IOW A;  3QOU A;  1B9X C;  4NWY A;  4XHM A;  3HZ8 A;  3W8J A;  4QL9 A;  3CBU A;  1G7E A;  1F2E A;  3W6G A;  2CV4 A;  4JU5 A;  2H76 A;  4MF5 A;  5CYY A;  1WE0 A;  4AJ7 A;  2HRN A;  3TKS C;  4OWY A;  5INY A;  1NHO A;  4TKY A;  3WT2 A;  4PNF A;  3WT1 A;  3F4R A;  1WMJ A;  5DAL B;  3QPM A;  1VF2 A;  3L0H A;  4MA9 A;  5ECS A;  1BYE A;  5HFI A;  4NPB A;  5CRH A;  3UJ1 A;  2DIY A;  4NHW A;  2H73 A;  4EO3 A;  3KMN A;  4KB3 A;  1V98 A;  4MCU A;  3D22 A;  3TRX A;  2VOC A;  1U3A A;  4NV2 A;  1U6T A;  3D21 A;  1MDK A;  3I9V 2;  1BAY A;  2VL2 C;  1EP8 A;  2J23 A;  5GST A;  2H6Y A;  5D9X A;  5G1L A;  4MH2 A;  3RPN A;  2V1M A;  1IYH A;  2HE3 A;  2C3Q A;  4MPG A;  2GSS A;  3GTU B;  1A0R P;  5D9W A;  5JWR B;  1N8J A;  4Q5R A;  3M9J A;  4KH7 A;  2OA7 A;  2AUV A;  2RM5 A;  3TRP A;  3TKR A;  3UBK A;  3CRT A;  5GAP D;  2FD3 A;  4QL7 A;  1Z5Y E;  3CRU A;  2VCV A;  6GSV A;  3GSS A;  4K0G A;  2CVK A;  2PGT A;  3G9B A;  1ZYE A;  3ZFL A;  2IME A;  1OYJ A;  4ZXG A;  4PUA A;  5ECN B;  2TIR A;  5J5N A;  4IVF A;  3F8U A;  2VCT A;  1LBK A;  4G19 A;  1T7P B;  1I9D A;  2H1G A;  1GP1 A;  2FWE A;  4N0V A;  2YZU A;  1VF4 A;  2WZ9 A;  2OE3 A;  4POB A;  2O7K A;  1X5D A;  1TI1 A;  4MP4 A;  4KGI A;  3FW2 A;  3HVS A;  1K0M A;  3IXR A;  3O76 A;  4ML1 A;  2DBC A;  1TRV A;  1U3I A;  1J08 A;  3IAM 2;  1K0B A;  3FHK A;  3EWL A;  4EF0 A;  4FH8 A;  4HJM A;  2LTK A;  4TR4 A;  1A2J A;  4MF7 A;  2AAW A;  5J3R A;  1K0N A;  2M46 A;  2VL3 A;  1TDI A;  3MAK A;  1SKR B;  1PA3 A;  1UN2 A;  5KN1 A;  2VL9 A;  2IN3 A;  1ERU A;  4ZB8 A;  4BVY A;  2F8F A;  1FW1 A;  2R6K A;  4F2I A;  2GQM A;  1LJR A;  5D73 A;  5CRW A;  4ZL9 A;  2N5F A;  5DAK B;  4O32 A;  3H1N A;  4IS0 A;  2ZCT A;  3LXZ A;  1PX7 A;  4PQ1 A;  1BQ7 A;  4WBR D;  5IO0 A;  3L9S A;  1MD3 A;  3IK7 A;  3GN3 A;  4HOJ A;  5ECO B;  1PMT A;  1GH2 A;  1EP7 A;  3C1R A;  4GTU A;  1GLQ A;  2B7J A;  4L0W A;  2JZS A;  5G2Z A;  3F4S A;  3IHQ A;  2HRF A;  2OKA A;  4X1U A;  2K9F A;  2H75 A;  3D4M A;  4OO4 A;  1GSU A;  2NPB A;  3QAV A;  3P7X A;  3E3E A;  1EGR A;  1HNC A;  4I6X A;  3IV4 A;  2PBJ A;  2IMF A;  4YAV A;  2VD0 A;  4I97 A;  3GNJ A;  1K3O A;  4MH3 A;  3HJO A;  4G10 A;  3DVX A;  1XOA A;  1GNE A;  4HJ2 A;  2HFD A;  2FWH A;  4PGT A;  3HCZ A;  1F3B A;  5J41 A;  3ZRE A;  1ML6 A;  1Z3E A;  3WGX A;  1JHB A;  5G30 A;  4AF2 A;  4ECC A;  4TXO A;  5KN2 A;  4MJE A;  1MTC A;  2VLV A;  3GL5 A;  1HNB A;  2GSQ A;  4ZL8 A;  2E2M A;  3H8Q A;  5ELG A;  2JU5 A;  3IBH A;  4YAP A;  4TR3 A;  3KM6 A;  1QMV A;  3KIJ A;  3LYK A;  1SJZ A;  2WB9 A;  2JAC A;  3UEM A;  10GS A;  1V58 A;  3TKS A;  1A2L A;  1F37 A;  2MBT A;  4GRF A;  2YZH A;  2FA4 A;  2QSI A;  1XWB A;  3KTB A;  1JZO A;  4IEL A;  4O5R A;  1N2A A;  5AN1 A;  1VRS D;  1TTZ A;  2MMN A;  3FKF A;  5J9B A;  1GSD A;  3UVH A;  1TP9 A;  2P5R A;  1GLP A;  2YWO A;  2C0D A;  2VLU A;  5IMF A;  3KGK A;  4J56 E;  4K6X A;  1PGT A;  1RK4 A;  1JZD A;  2H6X A;  5CP1 A;  3KXO A;  5IQY A;  3QMX A;  4F03 A;  1ZOF A;  1FAA A;  1O73 A;  1XZO A;  3UL3 A;  1YEX A;  1AQX A;  3LJR A;  11GS A;  4NHZ A;  3WGD A;  4ULX A;  1YEP A;  3GUR A;  1MDI A;  4YQU A;  2MBS A;  3GX0 A;  3HJM A;  2H71 A;  3UAP A;  2IWT A;  2VCQ A;  1R26 A;  2H30 A;  4IQA A;  1O81 A;  1QGV A;  2LS5 A;  1EWX A;  2LNS A;  3EU3 A;  2RII A;  5DVB A;  4DVC A;  2L6D A;  2WCI A;  2NVL A;  3I69 A;  2HZE B;  2L5O A;  4WF4 A;  1J0F A;  4JR4 A;  5F07 A;  2CVB A;  2M80 A;  1GUH A;  1DBY A;  4X43 A;  4EDY A;  3H79 A;  4V1A g;  4HQZ A;  2V32 A;  4TN8 A;  3P2A A;  1T8E B;  1JFU A;  3TJF A;  4JBB A;  5AIS A;  4Q5F A;  1YF1 A;  3G7Y A;  18GS A;  1X5C A;  5DCG A;  5EL8 A;  5J4U A;  1PX6 A;  3GHA A;  4FYB A;  3ERG A;  1V57 A;  5CAX A;  2K18 A;  3UAR A;  5ECL B;  2GZZ A;  4KCE A;  1MEK A;  1HD2 A;  2X99 A;  1XOB A;  1KTE A;  4JE1 A;  2K6V A;  2R5G A;  3IR4 A;  5ELA A;  2OE0 A;  3IC4 A;  5J9C A;  5IPH A;  1Z6M A;  2PWJ A;  3ZIJ A;  1M7T A;  4MDC A;  4RQR A;  4WXT A;  2YV7 A;  2E7P A;  3ZL5 A;  5D9V A;  4KSM A;  5HFK A;  4I5Q A;  1Q98 A;  3LYP A;  4ZBB A;  1Q4J A;  4KUN A;  4WBJ A;  1G0T A;  3C71 A;  2NDO A;  3D5J A;  3U6V A;  2IL3 A;  1VGL A;  2MZC A;  2P31 A;  2H0G A;  1X9M B;  5IMD A;  3ZML A;  2C80 A;  2LJK A;  1USB A;  2R2J A;  1SD9 A;  3VWU A;  1HQO A;  3ZVJ A;  3ZYW A;  3E9J B;  3J7Y b;  3HYP A;  4IP1 A;  5LD0 A;  3FR9 A;  4N30 A;  1GUK A;  3VWW A;  3M9K A;  3KP9 A;  2DJ0 A;  1XW9 A;  5B7C A;  1T1V A;  2VAF A;  2NBS A;  3VI7 A;  1GTA A;  3V1W A;  2ES7 A;  3EMX A;  3I6A A;  4O7H A;  1OE8 A;  3KEB A;  5F06 A;  3TJB A;  1FVJ A;  1FB6 A;  3LOR A;  1G7O A;  4EVM A;  4EC0 A;  1CQH A;  1SK2 A;  2IPA A;  1TU7 A;  2N5A A;  4HDE A;  1M0U A;  2H01 A;  1PKZ A;  1XCC A;  1X9W B;  5H5R A;  3HZ4 A;  3APQ A;  4Q5N A;  2GVP A;  2X8C A;  1NM3 A;  1S3A A;  3KZQ A;  2VIM A;  4IN0 A;  3FZ4 A;  5IM9 A;  5ECP B;  2H1B A;  4PX1 A;  4MJB A;  1SJ6 A;  2V41 A;  3GV1 A;  4HU7 A;  4TXO B;  1SKS B;  4MAB A;  3CSH A;  4EE0 A;  3ZIV A;  4XS6 A;  4E8H A;  2ALB A;  3CSJ A;  1NSW A;  4BL7 A;  4BPY A;  3TDG A;  6GSY A;  3I43 A;  5DQS A;  3O3T A;  5DBQ A;  2TRC P;  4Z7X A;  1K3Y A;  1TK0 B;  3O6T A;  5A5K A;  2HYX A;  1K0O A;  2I1U A;  4N0Z A;  5AGY A;  1K0D A;  3HXS A;  2L59 A;  3SBC A;  4WEY A;  3L9V A;  2L5L A;  2XPD A;  3GX8 A;  2R4V A;  1C72 A;  1O6J A;  3FRC A;  4K8M A;  4ZL7 A;  4TRX A;  1FOV A;  1U87 A;  4HQS A;  2H8L A;  4V2M A;  2VUP A;  5DDL A;  5B6N A;  5H5Q A;  2PMT A;  1R5A A;  1TI3 A;  2JAD A;  3CTG A;  3QD9 A;  1BJX A;  4XTS A;  2GZP A;  4K2D A;  3GKX A;  1VF1 A;  4OFT A;  1O7U A;  2D2Z A;  1E6B A;  1HNA A;  1SD8 A;  1QFN A;  2LRN A;  3WGE A;  1YKA A;  2A2R A;  4JED A;  2J9H A;  2YWN A;  3G7J A;  3GH9 A;  4K1F A;  22GS A;  5ID2 A;  4ZBD A;  1IYI A;  2B5X A;  2LQO A;  3PH9 A;  3QR6 A;  5ENU A;  2YN1 A;  3VPT A;  4HU9 A;  4MZW A;  4ACS A;  1F3A A;  1HYU A;  2RUF A;  3TKQ A;  2DIZ A;  5IOX A;  3ERW A;  2YAN A;  5JWQ B;  17GS A;  3ZRD A;  2RUE A;  3F3R A;  4P3Y B;  2FGX A;  1XFL A;  5JCU A;  4OMV A;  4KE3 A;  3ME7 A;  2C0G A;  3FZ5 A;  5G5F A;  4OCF A;  3JCM L;  2R37 A;  2HI7 A;  5HR3 A;  3GUS A;  4I2U A;  2H0I A;  3NIV A;  1XWK A;  20GS A;  3IOS A;  2WDU A;  2CA8 A;  2QGV A;  4F82 A;  3GKN A;  2LJR A;  1FO5 A;  5E4W A;  1WJK A;  1JZR A;  2WJU A;  3GFK A;  4ILF A;  5EPF A;  1K0A A;  2KUC A;  1V2A A;  2FLS A;  1Y6E A;  1SKW B;  3FR6 A;  1EGO A;  3FR3 A;  5COH A;  4HUA A;  5G31 A;  1UC7 A;  2CZ2 A;  3RDW A;  3VWV A;  1EV9 A;  4G9H A;  5HR2 A;  2LV3 A;  3C73 A;  4EUY A;  2ZNM A;  3GYK A;  2ON5 A;  5CRG A;  3LSZ A;  3BCI A;  1SJI A;  5B8B A; 
#chains in the Genus database with same CATH topology
 2EIO A;  4IW9 A;  4MMM A;  3GA4 A;  3DKS A;  1TW9 A;  2I3Y A;  4GWR A;  3US3 A;  3ZZX A;  2YNX A;  1ERT A;  3P8W A;  2B7K A;  5D9T A;  4XCS A;  2VCX A;  4ECI A;  4N10 A;  2H1D A;  2GQL A;  2JZT A;  3BD2 A;  6GSW A;  3FEU A;  3UMA A;  1FHE A;  1Y25 A;  4OD7 A;  5DCH A;  4XS4 B;  5JWO B;  4GSS A;  4KSO A;  3KCM A;  4KX4 A;  2IIY A;  1XVQ A;  4YKF A;  4MJC A;  4KF9 A;  4JRR A;  2OBI A;  1UA5 A;  3MNG A;  3DML A;  3DRN A;  1ACV A;  3EYT A;  4I2T A;  1PL1 A;  1E2Y A;  2WGR A;  3SWL A;  4LMW A;  2GGT A;  2RLI A;  2IMI A;  1PSQ A;  6GSS A;  4YQM A;  4V2N A;  6GSU A;  2H19 A;  2GDR A;  3AY8 A;  1XVW A;  2R3X A;  1EEJ A;  1AIU A;  3F6D A;  1KNG A;  4ZB9 A;  3F6F A;  3VFI A;  1ON4 A;  2F8A A;  2YOI A;  4ECB A;  3WD6 A;  2IMD A;  14GS A;  3QAW A;  2OAD A;  5H5S A;  2V6O A;  6GST A;  16GS A;  2KP1 A;  4E8E A;  1QK8 A;  2L4Q A;  4GST A;  1ILO A;  4PQI A;  4MK3 A;  4GQC A;  3F3Q A;  4KW6 A;  4EL1 A;  2H72 A;  1AXD A;  4Z2R A;  3LGC A;  2VLT A;  3DD3 A;  3H4K A;  1SU9 A;  1AQV A;  4FYU A;  2MMO A;  2P0G A;  2H66 A;  1GSS A;  1XW6 A;  1TK5 B;  5EY6 A;  1T4Z A;  4RUV A;  3VI5 A;  3TJG A;  1FVK A;  1F6M C;  4HEA 2;  1WOU A;  4XRD A;  1GTU A;  3F9U A;  2JSZ A;  1ZCP A;  3QFB C;  1OKT A;  3TUE A;  1KEB A;  1TRU A;  1PRX A;  3MSZ A;  2EIR A;  5JCW A;  3IK9 A;  2O87 A;  4YH2 A;  1T3B A;  3EVI A;  3A2V A;  3UOM A;  2H1A A;  1TXX A;  1PN9 A;  2F3M A;  1AQW A;  2AV4 A;  2YCD A;  4KA0 A;  1TRS A;  4OFN A;  3E0U A;  3TOU A;  2WFC A;  4H86 A;  5CNW A;  2AYT A;  4HS1 A;  4AGS A;  1TKD B;  5CRD A;  2CX4 A;  1JZW A;  2GST A;  2WRT A;  2PN8 A;  1EZK A;  2VM1 A;  4XIH A;  3IDV A;  3MDK A;  2HSM A;  4K7O A;  1YF0 A;  2KLX A;  2VCW A;  2XPE A;  2IFQ A;  1LU4 A;  1YZX A;  1FB0 A;  3BBY A;  3NOF A;  2GTU A;  4D73 A;  2C1Y A;  4N11 A;  2PVO C;  1DE1 A;  2JSY A;  2YJ7 A;  3LQ7 A;  2VD1 A;  2FHE A;  4G0K A;  5F8B A;  5IMZ A;  2O8V B;  5KN0 A;  3GKK A;  1B4P A;  1R5P A;  2DJ3 A;  1A8Y A;  1YY7 A;  2CX3 A;  4DSS A;  2L4C A;  1XW5 A;  2B5Y A;  2V2G A;  4I8B A;  1W89 A;  1M2B A;  5A4V A;  4L5L A;  4IGJ A;  3PR8 A;  1WRY A;  4WR4 A;  4EDZ A;  3HD5 A;  4O92 A;  4AJ6 A;  2KOK A;  1H4O A;  1RQM A;  3KH7 A;  1PN0 A;  1S3R A;  3M3M A;  3EPT A;  1PKW A;  2AB6 A;  1OVN A;  5FHI A;  1O8W A;  2GSR A;  4MF6 A;  4IQ1 A;  4L5O A;  4K7N A;  2KP2 A;  3FYG A;  4FO5 A;  4ID0 A;  1O8X A;  2L6C A;  3Q6O A;  4FIW A;  5C04 A;  3S9F A;  2C8U A;  2HT9 A;  4L8E A;  1JLV A;  5F0G A;  4XS1 A;  1QUW A;  3KH9 A;  3ME8 A;  4BVY B;  2REM A;  2WUL A;  3DYR A;  2YWM A;  3RAZ A;  2G2Q A;  3OR5 A;  4BWS A;  1H75 A;  4V1A p;  3K8N A;  2C0F A;  5L71 A;  4POM A;  2L57 A;  2VO4 A;  4MJA A;  3APO A;  1RW1 A;  2ON7 A;  2FY6 A;  4WKW A;  5ECR B;  1M3I A;  3EC3 A;  2P5Q A;  2X64 A;  2HSY A;  1ZYQ B;  4LL4 B;  4BA7 A;  3FK8 A;  4G2E A;  2DJK A;  1A23 A;  3VK9 A;  3HVV A;  4KCA A;  3RBT A;  1DSB A;  2FWG A;  4NXI A;  3IPZ A;  4OCE A;  1SK0 A;  3PGT A;  2QC7 A;  1GTB A;  5B6M A;  2YJH A;  4ML6 A;  4LL1 B;  1A0F A;  3FZ9 A;  1EOH A;  4J2F A;  3ERF A;  4RQX A;  4TOP A;  3GH6 A;  3NZN A;  5DJL A;  1GSF A;  5AIV A;  3Q19 A;  3G7I A;  4JR6 A;  3CSI A;  3ZMK A;  1V40 A;  1ABA A;  4O5Q A;  1TK8 B;  2LRC A;  2X4A A;  3L78 A;  4ZBA A;  1X9S B;  1M2D A;  3LEF A;  3ZLP A;  2PPT A;  4OFM A;  4NMU A;  12GS A;  2E2G A;  2FA8 A;  3RPP A;  3R2Q A;  3R3E A;  1URM A;  3HVX A;  1X0R A;  2HSH A;  4KDY A;  4GXZ A;  1BED A;  3C1S A;  3EMP A;  5A4W A;  1SEN A;  1OC8 A;  2LJA A;  2WS2 A;  1PQN A;  4F9Z A;  4Z2U A;  5A4U A;  1OC9 A;  2DLX A;  5IMC A;  2LST A;  6GSX A;  1CQG A;  2YP6 A;  4IBP A;  1OAZ A;  3RHB A;  5LCZ A;  2PER A;  2YPM A;  1SYR A;  4CW9 A;  3HY2 A;  2HZE A;  2BMX A;  5D8I A;  1VF3 A;  1XXU A;  4RI7 A;  5G5E A;  5ECI B;  1ERW A;  1T4Y A;  2OE1 A;  1JLW A;  3KD0 A;  1TU8 A;  2E0Q A;  4OO5 A;  2JZR A;  4GLT A;  3GIX A;  4ISD A;  2MYG A;  5HR0 A;  1DE2 A;  1T00 A;  2DMM A;  2R0C A;  1GUM A;  4NAX A;  2C3N A;  5GSS A;  2KHP A;  2H74 A;  4AJ8 A;  1ZGN A;  3EE2 A;  1S3C A;  3LWA A;  2HNL A;  3L9U A;  4J57 E;  1U88 A;  3F63 A;  3W8S A;  2B5E A;  4PXO A;  1AC1 A;  2VCZ A;  1M99 A;  4O5U A;  5IPG A;  5JCG A;  2DJJ A;  2CZ3 A;  4LMV A;  3EIN A;  13GS A;  4JZQ A;  4PUR A;  4POK A;  8GSS A;  1Z9H A;  3D4T A;  4TW5 A;  1ERV A;  3J7Y k;  2DJ1 A;  4NV5 A;  2DC5 A;  3APS A;  4F0B A;  2CVD A;  3TCO A;  1S3D A;  1M9A A;  4HZ2 A;  1AW9 A;  3DEX A;  4Q5Q A;  5GAN D;  2F51 A;  4MPF A;  3LFL A;  2A2P A;  3UBL A;  2B1K A;  1M9B A;  3C7M A;  4DSR A;  2IFQ B;  5CRE A;  1ZZY A;  2MMA A;  3A2W A;  3FY7 A;  1EEM A;  3UVT A;  4DSQ A;  2CAI A;  4D73 B;  3D0Z A;  2I81 A;  3RHC A;  4WF5 A;  5IMV A;  1GTI A;  3MWH A;  3CXG A;  1YKC A;  4CHS A;  1TRW A;  3EUR A;  3KMO A;  2GZY A;  2ZUP A;  2A4V A;  2GT6 A;  4PQH A;  1J9B A;  2FUG 2;  3GMF A;  4EKZ A;  4DSS B;  1OC3 A;  1OKD A;  1QQ2 A;  2I9H A;  3F4T A;  1WIK A;  1PD2 1;  2X8G A;  3A5W A;  2I4A A;  3Q74 A;  4HZ4 A;  3HKR A;  2GQK A;  2AJQ B;  3DXB A;  1ZL9 A;  1KBN A;  1NHY A;  1PFO A;  1WWJ A;  1K0C A;  3GKM A;  3QAG A;  4K0N A;  3DGQ A;  4IKH A;  1YJ6 A;  2K8V A;  2C0E A;  2TRX A;  3BCK A;  1YQ1 A;  3PIN A;  2EIQ A;  3HJP A;  2HXK A;  1OE7 A;  1Z6N A;  3QFA C;  2LUS A;  2DML A;  4TR1 A;  2LNT A;  1ST9 A;  4KDU A;  4ZB6 A;  4YQV A;  3TOT A;  1AUC A;  1ZYP A;  3Q18 A;  5ECM B;  1GSY A;  4HI7 A;  5AIX A;  5D93 A;  3U5R E;  3FMW A;  5FWG A;  2CT6 A;  5BMU A;  1EOG A;  1SK1 A;  1A24 A;  3BOA A;  5LNK e;  3F0I A;  2XBI A;  2HZF A;  1PL2 A;  2B1L A;  4EXJ A;  3KJY A;  3ZIT A;  1BX9 A;  3LW9 A;  2B6M A;  7GSS A;  4HSC X;  2FCH A;  5GZZ B;  2LQQ A;  5D96 A;  2GT5 A;  5ECH B;  1XWG A;  5DAL A;  3MIX A;  2XBQ A;  4IHU A;  2RM6 A;  4BVX A;  2LRT A;  3IAS 2;  5DJM A;  2G0F A;  3N9J A;  5HFG A;  3LG6 A;  4ZIL A;  2XC2 A;  2H70 A;  2PVQ A;  1GSQ A;  5IIZ A;  4WR5 A;  3L4N A;  2OAC A;  4KDX A;  2C3T A;  2LKU A;  1TOF A;  5F05 A;  3GTU A;  5B8A A;  2O89 A;  2BTO T;  1GL8 A;  5EVO A;  4L0U A;  3TJK A;  3VWX A;  3VPQ A;  5IO2 A;  2FNO A;  3HHV A;  1W4V A;  3M1G A;  3A2X A;  5G1K A;  3IHG A;  1SL0 B;  2YWI A;  3MYD A;  1V9W A;  2LEG A;  2M72 A;  1WPI A;  3TB2 A;  5ABR A;  2VL2 A;  1XWC A;  1UVZ A;  1TJD A;  1SL2 B;  3DVW A;  1GUL A;  2OJL A;  4BL7 B;  1B9Y C;  4XRA A;  1QXH A;  4KND A;  3TKP A;  3CMI A;  4CY8 A;  2B3S A;  1THX A;  3C8E A;  3VUR A;  4GCI A;  5HR1 A;  2C4J A;  1BG5 A;  1X5E A;  2DSA A;  1OC9 B;  3GRX A;  3ED3 A;  5KEJ A;  4K9Z A;  4TR0 A;  1GNW A;  1WP0 A;  3DWV A;  1B48 A;  3QCP A;  3ZTL A;  1G6Y A;  3ISO A;  4X0X A;  2HRK A;  4PNG A;  4KAE A;  1MD4 A;  4V2L A;  2F9S A;  2IJY A;  3QDN A;  3CTF A;  1O85 A;  1FG4 A;  2GS3 A;  3H93 A;  2MMZ A;  2K8S A;  1EV4 A;  2A2S A;  2BJX A;  2N5B A;  3EU4 A;  5HQP A;  2CAQ A;  2QKE A;  5ID2 B;  5DQY A;  5C00 A;  3GL3 A;  4MZB A;  1Z7R A;  1MDJ A;  3M8N A;  1XWA A;  4FQU A;  4QQ7 A;  5DAK A;  3UIW A;  2H6Z A;  4MZC A;  1M2A A;  1AAZ A;  3KTL A;  4DEJ A;  4ECJ A;  4GQF A;  2FWF A;  1F9M A;  5IMA A;  4USS A;  4GF0 A;  1XIY A;  5ECQ B;  4IP6 A;  4BWQ A;  2X8H A;  1B8X A;  1K3L A;  3IRA A;  4MLY A;  3A3T A;  3VLN A;  2PU9 C;  2XHF A;  1ZMA A;  4LLR A;  4IJ3 A;  1B4Q A;  1FOH A;  3D6I A;  3ZFB A;  2JL4 A;  5CO3 A;  2AHE A;  2NTO A;  1A8L A;  5FT3 A;  2Z9S A;  4CY6 A;  3IE3 A;  1XBS A;  3TRQ A;  4FYC A;  4LA1 A;  5E59 A;  3WYW A;  2VM2 A;  1R4W A;  2IMK A;  4K7I A;  3IA1 A;  1GSE A;  2DJ2 A;  2H0H A;  1SYX A;  2HLS A;  4TVE A;  4GSN A;  1GRX A;  3HA9 A;  4XS4 A;  2GLR A;  4CDO A;  1NW2 A;  2OBK A;  3TKS E;  3PPU A;  4IJI A;  2CQ9 A;  3TJJ A;  2EC4 A;  4X4J A;  3DIE A;  9GSS A;  4PUF C;  4ZIJ A;  4TXV A;  3HDC A;  3LXT A;  4F0C A;  4MNN A;  3TGZ A;  5KN3 A;  2O85 A;  1I5G A;  1THO A;  1YDK A;  3N5O A;  1R7H A;  4WET A;  1A2M A;  3ZVJ D;  3CYN A;  3GST A;  1DUG A;  3FZA A;  3BJ5 A;  1Z7P A;  3KP8 A;  2PUK C;  19GS A;  4RI6 A;  3P90 A;  5ECK B;  4POL A;  1SL1 B;  3M0F A;  1G6W A;  2YV9 A;  2V6K A;  4TR1 B;  1XPV A;  1GWC A;  5IOW A;  3QOU A;  1B9X C;  4NWY A;  4XHM A;  5KOX A;  3HZ8 A;  3W8J A;  4QL9 A;  3CBU A;  1G7E A;  1F2E A;  3W6G A;  2CV4 A;  4JU5 A;  2H76 A;  4MF5 A;  5CYY A;  1WE0 A;  4AJ7 A;  2HRN A;  3TKS C;  4OWY A;  5INY A;  1NHO A;  4TKY A;  3WT2 A;  4PNF A;  3WT1 A;  3A5I A;  3F4R A;  4K2X A;  1WMJ A;  5DAL B;  3QPM A;  1VF2 A;  3L0H A;  4MA9 A;  5ECS A;  1BYE A;  5HFI A;  2HRA A;  4BVX B;  4NPB A;  5CRH A;  3UJ1 A;  2DIY A;  4NHW A;  2H73 A;  4EO3 A;  3KMN A;  4KB3 A;  1V98 A;  1M3J A;  4MCU A;  3D22 A;  3TRX A;  2VOC A;  1U3A A;  4NV2 A;  1U6T A;  3D21 A;  1MDK A;  3I9V 2;  1BAY A;  2VL2 C;  1EP8 A;  2J23 A;  3IC8 A;  5GST A;  2H6Y A;  5D9X A;  5G1L A;  4MH2 A;  3RPN A;  4PTS A;  2V1M A;  1IYH A;  2HE3 A;  2C3Q A;  4MPG A;  2GSS A;  3GTU B;  1A0R P;  5D9W A;  5JWR B;  1N8J A;  4Q5R A;  3M9J A;  4KH7 A;  2OA7 A;  2AUV A;  2RM5 A;  3TRP A;  3TKR A;  3UBK A;  3CRT A;  5GAP D;  2FD3 A;  4QL7 A;  1Z5Y E;  3CRU A;  2VCV A;  6GSV A;  3GSS A;  4K0G A;  2CVK A;  2PGT A;  3G9B A;  1ZYE A;  3ZFL A;  2IME A;  1OYJ A;  4ZXG A;  4PUA A;  5ECN B;  2TIR A;  5J5N A;  4IVF A;  3F8U A;  2VCT A;  1LBK A;  4G19 A;  1T7P B;  1I9D A;  2H1G A;  1GP1 A;  4BIK A;  2FWE A;  4N0V A;  2YZU A;  1VF4 A;  2WZ9 A;  2OE3 A;  4POB A;  2O7K A;  1X5D A;  1TI1 A;  4MP4 A;  4KGI A;  3FW2 A;  3HVS A;  2A4H A;  1K0M A;  3IXR A;  3O76 A;  4ML1 A;  2DBC A;  1TRV A;  1U3I A;  1J08 A;  3IAM 2;  1K0B A;  3FHK A;  3EWL A;  4EF0 A;  4FH8 A;  4HJM A;  2LTK A;  4TR4 A;  1A2J A;  4MF7 A;  2AAW A;  5J3R A;  1K0N A;  2M46 A;  2VL3 A;  1TDI A;  2DKH A;  3MAK A;  1SKR B;  1PA3 A;  1UN2 A;  5KN1 A;  2VL9 A;  2IN3 A;  1ERU A;  4ZB8 A;  4BVY A;  2F8F A;  1FW1 A;  2R6K A;  2X49 A;  3HVN A;  4F2I A;  2GQM A;  1LJR A;  2QA1 A;  5D73 A;  5CRW A;  4ZL9 A;  2N5F A;  5DAK B;  4O32 A;  3H1N A;  4IS0 A;  2ZCT A;  3LXZ A;  1PX7 A;  4PQ1 A;  1BQ7 A;  4WBR D;  5IO0 A;  3L9S A;  1MD3 A;  3IK7 A;  3GN3 A;  4HOJ A;  5ECO B;  1PMT A;  1GH2 A;  1EP7 A;  3C1R A;  4GTU A;  1GLQ A;  2B7J A;  4L0W A;  2JZS A;  5G2Z A;  3F4S A;  3IHQ A;  2HRF A;  2OKA A;  2UZ8 A;  4X1U A;  2K9F A;  2H75 A;  3D4M A;  4OO4 A;  1GSU A;  2NPB A;  3QAV A;  3P7X A;  3E3E A;  1EGR A;  1HNC A;  4I6X A;  3IV4 A;  2PBJ A;  2IMF A;  4YAV A;  2VD0 A;  4I97 A;  3GNJ A;  1K3O A;  4MH3 A;  3HJO A;  4G10 A;  3DVX A;  1XOA A;  1GNE A;  4HJ2 A;  2HFD A;  2FWH A;  4PGT A;  3HCZ A;  1F3B A;  5J41 A;  3ZRE A;  1ML6 A;  1Z3E A;  3WGX A;  1JHB A;  5G30 A;  4AF2 A;  4ECC A;  4TXO A;  5KN2 A;  4MJE A;  1MTC A;  2VLV A;  3GL5 A;  1HNB A;  2GSQ A;  4ZL8 A;  5KOW A;  2E2M A;  3H8Q A;  5ELG A;  2JU5 A;  3IBH A;  4YAP A;  4TR3 A;  3KM6 A;  1QMV A;  3KIJ A;  3LYK A;  1SJZ A;  2WB9 A;  2JAC A;  3UEM A;  10GS A;  1V58 A;  3TKS A;  1A2L A;  1F37 A;  2MBT A;  4GRF A;  2YZH A;  2FA4 A;  2QSI A;  1XWB A;  3KTB A;  1JZO A;  4IEL A;  4O5R A;  1N2A A;  5AN1 A;  1VRS D;  1TTZ A;  4EIQ A;  2MMN A;  3FKF A;  5J9B A;  1GSD A;  3UVH A;  1TP9 A;  2P5R A;  1GLP A;  2YWO A;  2C0D A;  2R0P A;  2VLU A;  5IMF A;  3KGK A;  4J56 E;  4K6X A;  1PGT A;  1RK4 A;  1JZD A;  2H6X A;  5CP1 A;  3KXO A;  5IQY A;  3QMX A;  4F03 A;  1ZOF A;  1FAA A;  1O73 A;  1XZO A;  3UL3 A;  1YEX A;  1AQX A;  3LJR A;  11GS A;  4NHZ A;  3WGD A;  4ULX A;  1YEP A;  3GUR A;  1MDI A;  4YQU A;  2MBS A;  3GX0 A;  3HJM A;  2H71 A;  3UAP A;  2IWT A;  2VCQ A;  1R26 A;  2H30 A;  4IQA A;  1O81 A;  1QGV A;  2LS5 A;  1EWX A;  2LNS A;  3EU3 A;  2RII A;  5DVB A;  4DVC A;  2L6D A;  2R0G A;  2WCI A;  2NVL A;  3I69 A;  2HZE B;  2L5O A;  4WF4 A;  1J0F A;  4JR4 A;  5F07 A;  2CVB A;  2M80 A;  1GUH A;  4K5R A;  1DBY A;  4X43 A;  4EDY A;  3H79 A;  4V1A g;  4HQZ A;  2V32 A;  4TN8 A;  3P2A A;  1T8E B;  4ICY A;  4YKG A;  1JFU A;  3TJF A;  4JBB A;  5AIS A;  4Q5F A;  1YF1 A;  3G7Y A;  2DKI A;  18GS A;  1X5C A;  5DCG A;  5EL8 A;  5J4U A;  4A5P A;  1PX6 A;  3GHA A;  3CQF A;  4FYB A;  3ERG A;  1V57 A;  5CAX A;  2K18 A;  3UAR A;  5ECL B;  2GZZ A;  4KCE A;  5BRT A;  1MEK A;  1HD2 A;  2X99 A;  1XOB A;  1KTE A;  4JE1 A;  2K6V A;  4EIP A;  2R5G A;  3IR4 A;  5ELA A;  2OE0 A;  3IC4 A;  5J9C A;  5IPH A;  1XG8 A;  1Z6M A;  2PWJ A;  3ZIJ A;  1M7T A;  4MDC A;  4RQR A;  4WXT A;  2YV7 A;  2E7P A;  3ZL5 A;  5D9V A;  4KSM A;  5HFK A;  4I5Q A;  1Q98 A;  3LYP A;  4ZBB A;  1Q4J A;  4KUN A;  4WBJ A;  1G0T A;  3C71 A;  2NDO A;  3D5J A;  3U6V A;  2IL3 A;  1VGL A;  2MZC A;  2P31 A;  2H0G A;  1X9M B;  5IMD A;  3ZML A;  2C80 A;  2LJK A;  1USB A;  2R2J A;  1SD9 A;  3VWU A;  1HQO A;  3ZVJ A;  3ZYW A;  3E9J B;  3J7Y b;  3HYP A;  4IP1 A;  5LD0 A;  3FR9 A;  4N30 A;  1GUK A;  3VWW A;  3M9K A;  3KP9 A;  2DJ0 A;  1XW9 A;  5B7C A;  1T1V A;  2VAF A;  2NBS A;  3VI7 A;  1GTA A;  3V1W A;  2ES7 A;  3EMX A;  3I6A A;  4O7H A;  1OE8 A;  3KEB A;  5F06 A;  3TJB A;  1FVJ A;  1FB6 A;  3LOR A;  1G7O A;  1ZYN A;  4EVM A;  4EC0 A;  1CQH A;  1SK2 A;  2IPA A;  1TU7 A;  2N5A A;  4HDE A;  1M0U A;  2H01 A;  1PKZ A;  1XCC A;  1X9W B;  5H5R A;  3HZ4 A;  3APQ A;  4Q5N A;  2GVP A;  2X8C A;  1NM3 A;  1S3A A;  3KZQ A;  2VIM A;  4IN0 A;  3FZ4 A;  5IM9 A;  5ECP B;  2H1B A;  4PX1 A;  4MJB A;  1SJ6 A;  2V41 A;  3GV1 A;  4HU7 A;  4TXO B;  1SKS B;  4MAB A;  2QA2 A;  3CSH A;  4Z2T A;  4EE0 A;  3ZIV A;  4XS6 A;  4E8H A;  2ALB A;  3CSJ A;  1NSW A;  4K5S A;  4BL7 A;  4BPY A;  3TDG A;  6GSY A;  3I43 A;  5DQS A;  3O3T A;  5DBQ A;  2TRC P;  4Z7X A;  1K3Y A;  1TK0 B;  3O6T A;  5A5K A;  2HYX A;  1K0O A;  2I1U A;  4N0Z A;  5AGY A;  1K0D A;  3HXS A;  2L59 A;  3SBC A;  4WEY A;  3L9V A;  2L5L A;  2XPD A;  3GX8 A;  2R4V A;  1C72 A;  1O6J A;  3FRC A;  4K8M A;  4ZL7 A;  4TRX A;  1FOV A;  1U87 A;  4HQS A;  2H8L A;  4V2M A;  2VUP A;  5DDL A;  5B6N A;  5H5Q A;  4G0I A;  2PMT A;  1R5A A;  1TI3 A;  2JAD A;  3CTG A;  3QD9 A;  1BJX A;  4XTS A;  2GZP A;  4K2D A;  3GKX A;  1VF1 A;  4OFT A;  1O7U A;  2D2Z A;  1E6B A;  1HNA A;  1SD8 A;  1QFN A;  2LRN A;  3WGE A;  1YKA A;  2A2R A;  4JED A;  2J9H A;  2YWN A;  3G7J A;  3GH9 A;  4K1F A;  22GS A;  5ID2 A;  4ZBD A;  1IYI A;  2B5X A;  2LQO A;  3PH9 A;  3QR6 A;  5ENU A;  2YN1 A;  3VPT A;  4HU9 A;  4MZW A;  4ACS A;  1F3A A;  1HYU A;  2RUF A;  3TKQ A;  2DIZ A;  5IOX A;  3ERW A;  2YAN A;  5JWQ B;  17GS A;  3ZRD A;  2RUE A;  3F3R A;  4P3Y B;  2FGX A;  1XFL A;  5JCU A;  4OMV A;  4KE3 A;  3ME7 A;  2C0G A;  3FZ5 A;  5G5F A;  4OCF A;  3JCM L;  2R37 A;  2HI7 A;  5HR3 A;  3GUS A;  4I2U A;  2H0I A;  3NIV A;  1XWK A;  20GS A;  3IOS A;  2WDU A;  2CA8 A;  2QGV A;  4F82 A;  3GKN A;  2LJR A;  1FO5 A;  5E4W A;  1WJK A;  1JZR A;  2WJU A;  3GFK A;  4ILF A;  5EPF A;  1K0A A;  2KUC A;  1V2A A;  2FLS A;  1Y6E A;  1SKW B;  3FR6 A;  1EGO A;  3FR3 A;  5COH A;  4G0L A;  4HUA A;  5G31 A;  1UC7 A;  2CZ2 A;  3RDW A;  3VWV A;  1EV9 A;  4G9H A;  5HR2 A;  2LV3 A;  3C73 A;  4EUY A;  2ZNM A;  3GYK A;  2ON5 A;  5CRG A;  3LSZ A;  3BCI A;  1SJI A;  5B8B A; 
#chains in the Genus database with same CATH homology
 2EIO A;  4IW9 A;  4MMM A;  3GA4 A;  3DKS A;  1TW9 A;  2I3Y A;  4GWR A;  3US3 A;  3ZZX A;  2YNX A;  1ERT A;  3P8W A;  2B7K A;  5D9T A;  4XCS A;  2VCX A;  4ECI A;  4N10 A;  2H1D A;  2GQL A;  2JZT A;  3BD2 A;  6GSW A;  3FEU A;  3UMA A;  1FHE A;  1Y25 A;  4OD7 A;  5DCH A;  4XS4 B;  5JWO B;  4GSS A;  4KSO A;  3KCM A;  4KX4 A;  2IIY A;  1XVQ A;  4YKF A;  4MJC A;  4KF9 A;  4JRR A;  2OBI A;  1UA5 A;  3MNG A;  3DML A;  3DRN A;  1ACV A;  3EYT A;  4I2T A;  1PL1 A;  1E2Y A;  2WGR A;  3SWL A;  4LMW A;  2GGT A;  2RLI A;  2IMI A;  1PSQ A;  6GSS A;  4YQM A;  4V2N A;  6GSU A;  2H19 A;  2GDR A;  3AY8 A;  1XVW A;  2R3X A;  1EEJ A;  1AIU A;  3F6D A;  1KNG A;  4ZB9 A;  3F6F A;  3VFI A;  1ON4 A;  2F8A A;  2YOI A;  4ECB A;  3WD6 A;  2IMD A;  14GS A;  3QAW A;  2OAD A;  5H5S A;  2V6O A;  6GST A;  16GS A;  2KP1 A;  4E8E A;  1QK8 A;  2L4Q A;  4GST A;  1ILO A;  4PQI A;  4MK3 A;  4GQC A;  3F3Q A;  4KW6 A;  4EL1 A;  2H72 A;  1AXD A;  4Z2R A;  3LGC A;  2VLT A;  3DD3 A;  3H4K A;  1SU9 A;  1AQV A;  4FYU A;  2MMO A;  2P0G A;  2H66 A;  1GSS A;  1XW6 A;  1TK5 B;  5EY6 A;  1T4Z A;  4RUV A;  3VI5 A;  3TJG A;  1FVK A;  1F6M C;  4HEA 2;  1WOU A;  4XRD A;  1GTU A;  3F9U A;  2JSZ A;  1ZCP A;  3QFB C;  1OKT A;  3TUE A;  1KEB A;  1TRU A;  1PRX A;  3MSZ A;  2EIR A;  5JCW A;  3IK9 A;  2O87 A;  4YH2 A;  1T3B A;  3EVI A;  3A2V A;  3UOM A;  2H1A A;  1TXX A;  1PN9 A;  2F3M A;  1AQW A;  2AV4 A;  2YCD A;  4KA0 A;  1TRS A;  4OFN A;  3E0U A;  3TOU A;  2WFC A;  4H86 A;  5CNW A;  2AYT A;  4HS1 A;  4AGS A;  1TKD B;  5CRD A;  2CX4 A;  1JZW A;  2GST A;  2WRT A;  2PN8 A;  1EZK A;  2VM1 A;  4XIH A;  3IDV A;  3MDK A;  2HSM A;  4K7O A;  1YF0 A;  2KLX A;  2VCW A;  2XPE A;  2IFQ A;  1LU4 A;  1YZX A;  1FB0 A;  3BBY A;  3NOF A;  2GTU A;  4D73 A;  2C1Y A;  4N11 A;  2PVO C;  1DE1 A;  2JSY A;  2YJ7 A;  3LQ7 A;  2VD1 A;  2FHE A;  4G0K A;  5F8B A;  5IMZ A;  2O8V B;  5KN0 A;  3GKK A;  1B4P A;  1R5P A;  2DJ3 A;  1A8Y A;  1YY7 A;  2CX3 A;  4DSS A;  2L4C A;  1XW5 A;  2B5Y A;  2V2G A;  4I8B A;  1W89 A;  1M2B A;  5A4V A;  4L5L A;  4IGJ A;  3PR8 A;  1WRY A;  4WR4 A;  4EDZ A;  3HD5 A;  4O92 A;  4AJ6 A;  2KOK A;  1H4O A;  1RQM A;  3KH7 A;  1PN0 A;  3M3M A;  3EPT A;  1PKW A;  2AB6 A;  1OVN A;  5FHI A;  1O8W A;  2GSR A;  4MF6 A;  4IQ1 A;  4L5O A;  4K7N A;  2KP2 A;  3FYG A;  4FO5 A;  4ID0 A;  1O8X A;  2L6C A;  3Q6O A;  4FIW A;  5C04 A;  3S9F A;  2C8U A;  2HT9 A;  4L8E A;  1JLV A;  5F0G A;  4XS1 A;  1QUW A;  3KH9 A;  3ME8 A;  4BVY B;  2REM A;  2WUL A;  3DYR A;  2YWM A;  3RAZ A;  2G2Q A;  3OR5 A;  4BWS A;  1H75 A;  4V1A p;  3K8N A;  2C0F A;  5L71 A;  4POM A;  2L57 A;  2VO4 A;  4MJA A;  3APO A;  1RW1 A;  2ON7 A;  2FY6 A;  4WKW A;  5ECR B;  3EC3 A;  2P5Q A;  2X64 A;  2HSY A;  1ZYQ B;  4LL4 B;  4BA7 A;  3FK8 A;  4G2E A;  2DJK A;  1A23 A;  3VK9 A;  3HVV A;  4KCA A;  3RBT A;  1DSB A;  2FWG A;  4NXI A;  3IPZ A;  4OCE A;  1SK0 A;  3PGT A;  2QC7 A;  1GTB A;  5B6M A;  2YJH A;  4ML6 A;  4LL1 B;  1A0F A;  3FZ9 A;  1EOH A;  4J2F A;  3ERF A;  4RQX A;  4TOP A;  3GH6 A;  3NZN A;  5DJL A;  1GSF A;  5AIV A;  3Q19 A;  3G7I A;  4JR6 A;  3CSI A;  3ZMK A;  1V40 A;  1ABA A;  4O5Q A;  1TK8 B;  2LRC A;  2X4A A;  3L78 A;  4ZBA A;  1X9S B;  1M2D A;  3LEF A;  3ZLP A;  2PPT A;  4OFM A;  4NMU A;  12GS A;  2E2G A;  2FA8 A;  3RPP A;  3R2Q A;  3R3E A;  1URM A;  3HVX A;  1X0R A;  2HSH A;  4KDY A;  4GXZ A;  1BED A;  3C1S A;  3EMP A;  5A4W A;  1SEN A;  1OC8 A;  2LJA A;  2WS2 A;  1PQN A;  4F9Z A;  4Z2U A;  5A4U A;  1OC9 A;  2DLX A;  5IMC A;  2LST A;  6GSX A;  1CQG A;  2YP6 A;  4IBP A;  1OAZ A;  3RHB A;  5LCZ A;  2PER A;  2YPM A;  1SYR A;  4CW9 A;  3HY2 A;  2HZE A;  2BMX A;  5D8I A;  1VF3 A;  1XXU A;  4RI7 A;  5G5E A;  5ECI B;  1ERW A;  1T4Y A;  2OE1 A;  1JLW A;  3KD0 A;  1TU8 A;  2E0Q A;  4OO5 A;  2JZR A;  4GLT A;  3GIX A;  4ISD A;  2MYG A;  5HR0 A;  1DE2 A;  1T00 A;  2DMM A;  2R0C A;  1GUM A;  4NAX A;  2C3N A;  5GSS A;  2KHP A;  2H74 A;  4AJ8 A;  1ZGN A;  3EE2 A;  1S3C A;  3LWA A;  2HNL A;  3L9U A;  4J57 E;  1U88 A;  3F63 A;  3W8S A;  2B5E A;  4PXO A;  1AC1 A;  2VCZ A;  1M99 A;  4O5U A;  5IPG A;  5JCG A;  2DJJ A;  2CZ3 A;  4LMV A;  3EIN A;  13GS A;  4JZQ A;  4PUR A;  4POK A;  8GSS A;  1Z9H A;  3D4T A;  4TW5 A;  1ERV A;  3J7Y k;  2DJ1 A;  4NV5 A;  2DC5 A;  3APS A;  4F0B A;  2CVD A;  3TCO A;  1S3D A;  1M9A A;  4HZ2 A;  1AW9 A;  3DEX A;  4Q5Q A;  5GAN D;  2F51 A;  4MPF A;  3LFL A;  2A2P A;  3UBL A;  2B1K A;  1M9B A;  3C7M A;  4DSR A;  2IFQ B;  5CRE A;  1ZZY A;  2MMA A;  3A2W A;  3FY7 A;  1EEM A;  3UVT A;  4DSQ A;  2CAI A;  4D73 B;  3D0Z A;  2I81 A;  3RHC A;  4WF5 A;  5IMV A;  1GTI A;  3MWH A;  3CXG A;  1YKC A;  4CHS A;  1TRW A;  3EUR A;  3KMO A;  2GZY A;  2ZUP A;  2A4V A;  2GT6 A;  4PQH A;  1J9B A;  2FUG 2;  3GMF A;  4EKZ A;  4DSS B;  1OC3 A;  1OKD A;  1QQ2 A;  2I9H A;  3F4T A;  1WIK A;  1PD2 1;  2X8G A;  3A5W A;  2I4A A;  3Q74 A;  4HZ4 A;  3HKR A;  2GQK A;  2AJQ B;  3DXB A;  1ZL9 A;  1KBN A;  1NHY A;  1WWJ A;  1K0C A;  3GKM A;  3QAG A;  4K0N A;  3DGQ A;  4IKH A;  1YJ6 A;  2K8V A;  2C0E A;  2TRX A;  3BCK A;  1YQ1 A;  3PIN A;  2EIQ A;  3HJP A;  2HXK A;  1OE7 A;  1Z6N A;  3QFA C;  2LUS A;  2DML A;  4TR1 A;  2LNT A;  1ST9 A;  4KDU A;  4ZB6 A;  4YQV A;  3TOT A;  1AUC A;  1ZYP A;  3Q18 A;  5ECM B;  1GSY A;  4HI7 A;  5AIX A;  5D93 A;  3U5R E;  3FMW A;  5FWG A;  2CT6 A;  5BMU A;  1EOG A;  1SK1 A;  1A24 A;  3BOA A;  5LNK e;  3F0I A;  2XBI A;  2HZF A;  1PL2 A;  2B1L A;  4EXJ A;  3KJY A;  3ZIT A;  1BX9 A;  3LW9 A;  2B6M A;  7GSS A;  2FCH A;  5GZZ B;  2LQQ A;  5D96 A;  2GT5 A;  5ECH B;  1XWG A;  5DAL A;  3MIX A;  2XBQ A;  4IHU A;  2RM6 A;  4BVX A;  2LRT A;  3IAS 2;  5DJM A;  2G0F A;  3N9J A;  5HFG A;  3LG6 A;  4ZIL A;  2XC2 A;  2H70 A;  2PVQ A;  1GSQ A;  5IIZ A;  4WR5 A;  3L4N A;  2OAC A;  4KDX A;  2C3T A;  2LKU A;  1TOF A;  5F05 A;  3GTU A;  5B8A A;  2O89 A;  2BTO T;  1GL8 A;  5EVO A;  4L0U A;  3TJK A;  3VWX A;  3VPQ A;  5IO2 A;  2FNO A;  3HHV A;  1W4V A;  3M1G A;  3A2X A;  5G1K A;  3IHG A;  1SL0 B;  2YWI A;  3MYD A;  1V9W A;  2LEG A;  2M72 A;  1WPI A;  3TB2 A;  5ABR A;  2VL2 A;  1XWC A;  1UVZ A;  1TJD A;  1SL2 B;  3DVW A;  1GUL A;  2OJL A;  4BL7 B;  1B9Y C;  4XRA A;  1QXH A;  4KND A;  3TKP A;  3CMI A;  4CY8 A;  2B3S A;  1THX A;  3C8E A;  3VUR A;  4GCI A;  5HR1 A;  2C4J A;  1BG5 A;  1X5E A;  2DSA A;  1OC9 B;  3GRX A;  3ED3 A;  5KEJ A;  4K9Z A;  4TR0 A;  1GNW A;  1WP0 A;  3DWV A;  1B48 A;  3QCP A;  3ZTL A;  1G6Y A;  3ISO A;  4X0X A;  2HRK A;  4PNG A;  4KAE A;  1MD4 A;  4V2L A;  2F9S A;  2IJY A;  3QDN A;  3CTF A;  1O85 A;  1FG4 A;  2GS3 A;  3H93 A;  2MMZ A;  2K8S A;  1EV4 A;  2A2S A;  2BJX A;  2N5B A;  3EU4 A;  5HQP A;  2CAQ A;  2QKE A;  5ID2 B;  5DQY A;  5C00 A;  3GL3 A;  4MZB A;  1Z7R A;  1MDJ A;  3M8N A;  1XWA A;  4FQU A;  4QQ7 A;  5DAK A;  3UIW A;  2H6Z A;  4MZC A;  1M2A A;  1AAZ A;  3KTL A;  4DEJ A;  4ECJ A;  4GQF A;  2FWF A;  1F9M A;  5IMA A;  4USS A;  4GF0 A;  1XIY A;  5ECQ B;  4IP6 A;  4BWQ A;  2X8H A;  1B8X A;  1K3L A;  3IRA A;  4MLY A;  3A3T A;  3VLN A;  2PU9 C;  2XHF A;  1ZMA A;  4LLR A;  4IJ3 A;  1B4Q A;  1FOH A;  3D6I A;  3ZFB A;  2JL4 A;  5CO3 A;  2AHE A;  2NTO A;  1A8L A;  5FT3 A;  2Z9S A;  4CY6 A;  3IE3 A;  1XBS A;  3TRQ A;  4FYC A;  4LA1 A;  5E59 A;  3WYW A;  2VM2 A;  1R4W A;  2IMK A;  4K7I A;  3IA1 A;  1GSE A;  2DJ2 A;  2H0H A;  1SYX A;  2HLS A;  4TVE A;  4GSN A;  1GRX A;  3HA9 A;  4XS4 A;  2GLR A;  4CDO A;  1NW2 A;  2OBK A;  3TKS E;  3PPU A;  4IJI A;  2CQ9 A;  3TJJ A;  2EC4 A;  4X4J A;  3DIE A;  9GSS A;  4PUF C;  4ZIJ A;  4TXV A;  3HDC A;  3LXT A;  4F0C A;  4MNN A;  3TGZ A;  5KN3 A;  2O85 A;  1I5G A;  1THO A;  1YDK A;  3N5O A;  1R7H A;  4WET A;  1A2M A;  3ZVJ D;  3CYN A;  3GST A;  1DUG A;  3FZA A;  3BJ5 A;  1Z7P A;  3KP8 A;  2PUK C;  19GS A;  4RI6 A;  3P90 A;  5ECK B;  4POL A;  1SL1 B;  3M0F A;  1G6W A;  2YV9 A;  2V6K A;  4TR1 B;  1XPV A;  1GWC A;  5IOW A;  3QOU A;  1B9X C;  4NWY A;  4XHM A;  5KOX A;  3HZ8 A;  3W8J A;  4QL9 A;  3CBU A;  1G7E A;  1F2E A;  3W6G A;  2CV4 A;  4JU5 A;  2H76 A;  4MF5 A;  5CYY A;  1WE0 A;  4AJ7 A;  2HRN A;  3TKS C;  4OWY A;  5INY A;  1NHO A;  4TKY A;  3WT2 A;  4PNF A;  3WT1 A;  3A5I A;  3F4R A;  4K2X A;  1WMJ A;  5DAL B;  3QPM A;  1VF2 A;  3L0H A;  4MA9 A;  5ECS A;  1BYE A;  5HFI A;  2HRA A;  4BVX B;  4NPB A;  5CRH A;  3UJ1 A;  2DIY A;  4NHW A;  2H73 A;  4EO3 A;  3KMN A;  4KB3 A;  1V98 A;  4MCU A;  3D22 A;  3TRX A;  2VOC A;  1U3A A;  4NV2 A;  1U6T A;  3D21 A;  1MDK A;  3I9V 2;  1BAY A;  2VL2 C;  1EP8 A;  2J23 A;  3IC8 A;  5GST A;  2H6Y A;  5D9X A;  5G1L A;  4MH2 A;  3RPN A;  4PTS A;  2V1M A;  1IYH A;  2HE3 A;  2C3Q A;  4MPG A;  2GSS A;  3GTU B;  1A0R P;  5D9W A;  5JWR B;  1N8J A;  4Q5R A;  3M9J A;  4KH7 A;  2OA7 A;  2AUV A;  2RM5 A;  3TRP A;  3TKR A;  3UBK A;  3CRT A;  5GAP D;  2FD3 A;  4QL7 A;  1Z5Y E;  3CRU A;  2VCV A;  6GSV A;  3GSS A;  4K0G A;  2CVK A;  2PGT A;  3G9B A;  1ZYE A;  3ZFL A;  2IME A;  1OYJ A;  4ZXG A;  4PUA A;  5ECN B;  2TIR A;  5J5N A;  4IVF A;  3F8U A;  2VCT A;  1LBK A;  4G19 A;  1T7P B;  1I9D A;  2H1G A;  1GP1 A;  2FWE A;  4N0V A;  2YZU A;  1VF4 A;  2WZ9 A;  2OE3 A;  4POB A;  2O7K A;  1X5D A;  1TI1 A;  4MP4 A;  4KGI A;  3FW2 A;  3HVS A;  2A4H A;  1K0M A;  3IXR A;  3O76 A;  4ML1 A;  2DBC A;  1TRV A;  1U3I A;  1J08 A;  3IAM 2;  1K0B A;  3FHK A;  3EWL A;  4EF0 A;  4FH8 A;  4HJM A;  2LTK A;  4TR4 A;  1A2J A;  4MF7 A;  2AAW A;  5J3R A;  1K0N A;  2M46 A;  2VL3 A;  1TDI A;  2DKH A;  3MAK A;  1SKR B;  1PA3 A;  1UN2 A;  5KN1 A;  2VL9 A;  2IN3 A;  1ERU A;  4ZB8 A;  4BVY A;  2F8F A;  1FW1 A;  2R6K A;  2X49 A;  4F2I A;  2GQM A;  1LJR A;  2QA1 A;  5D73 A;  5CRW A;  4ZL9 A;  2N5F A;  5DAK B;  4O32 A;  3H1N A;  4IS0 A;  2ZCT A;  3LXZ A;  1PX7 A;  4PQ1 A;  1BQ7 A;  4WBR D;  5IO0 A;  3L9S A;  1MD3 A;  3IK7 A;  3GN3 A;  4HOJ A;  5ECO B;  1PMT A;  1GH2 A;  1EP7 A;  3C1R A;  4GTU A;  1GLQ A;  2B7J A;  4L0W A;  2JZS A;  5G2Z A;  3F4S A;  3IHQ A;  2HRF A;  2OKA A;  2UZ8 A;  4X1U A;  2K9F A;  2H75 A;  3D4M A;  4OO4 A;  1GSU A;  2NPB A;  3QAV A;  3P7X A;  3E3E A;  1EGR A;  1HNC A;  4I6X A;  3IV4 A;  2PBJ A;  2IMF A;  4YAV A;  2VD0 A;  4I97 A;  3GNJ A;  1K3O A;  4MH3 A;  3HJO A;  4G10 A;  3DVX A;  1XOA A;  1GNE A;  4HJ2 A;  2HFD A;  2FWH A;  4PGT A;  3HCZ A;  1F3B A;  5J41 A;  3ZRE A;  1ML6 A;  1Z3E A;  3WGX A;  1JHB A;  5G30 A;  4AF2 A;  4ECC A;  4TXO A;  5KN2 A;  4MJE A;  1MTC A;  2VLV A;  3GL5 A;  1HNB A;  2GSQ A;  4ZL8 A;  5KOW A;  2E2M A;  3H8Q A;  5ELG A;  2JU5 A;  3IBH A;  4YAP A;  4TR3 A;  3KM6 A;  1QMV A;  3KIJ A;  3LYK A;  1SJZ A;  2WB9 A;  2JAC A;  3UEM A;  10GS A;  1V58 A;  3TKS A;  1A2L A;  1F37 A;  2MBT A;  4GRF A;  2YZH A;  2FA4 A;  2QSI A;  1XWB A;  3KTB A;  1JZO A;  4IEL A;  4O5R A;  1N2A A;  5AN1 A;  1VRS D;  1TTZ A;  4EIQ A;  2MMN A;  3FKF A;  5J9B A;  1GSD A;  3UVH A;  1TP9 A;  2P5R A;  1GLP A;  2YWO A;  2C0D A;  2R0P A;  2VLU A;  5IMF A;  3KGK A;  4J56 E;  4K6X A;  1PGT A;  1RK4 A;  1JZD A;  2H6X A;  5CP1 A;  3KXO A;  5IQY A;  3QMX A;  4F03 A;  1ZOF A;  1FAA A;  1O73 A;  1XZO A;  3UL3 A;  1YEX A;  1AQX A;  3LJR A;  11GS A;  4NHZ A;  3WGD A;  4ULX A;  1YEP A;  3GUR A;  1MDI A;  4YQU A;  2MBS A;  3GX0 A;  3HJM A;  2H71 A;  3UAP A;  2IWT A;  2VCQ A;  1R26 A;  2H30 A;  4IQA A;  1O81 A;  1QGV A;  2LS5 A;  1EWX A;  2LNS A;  3EU3 A;  2RII A;  5DVB A;  4DVC A;  2L6D A;  2R0G A;  2WCI A;  2NVL A;  3I69 A;  2HZE B;  2L5O A;  4WF4 A;  1J0F A;  4JR4 A;  5F07 A;  2CVB A;  2M80 A;  1GUH A;  4K5R A;  1DBY A;  4X43 A;  4EDY A;  3H79 A;  4V1A g;  4HQZ A;  2V32 A;  4TN8 A;  3P2A A;  1T8E B;  4ICY A;  4YKG A;  1JFU A;  3TJF A;  4JBB A;  5AIS A;  4Q5F A;  1YF1 A;  3G7Y A;  2DKI A;  18GS A;  1X5C A;  5DCG A;  5EL8 A;  5J4U A;  4A5P A;  1PX6 A;  3GHA A;  4FYB A;  3ERG A;  1V57 A;  5CAX A;  2K18 A;  3UAR A;  5ECL B;  2GZZ A;  4KCE A;  5BRT A;  1MEK A;  1HD2 A;  2X99 A;  1XOB A;  1KTE A;  4JE1 A;  2K6V A;  4EIP A;  2R5G A;  3IR4 A;  5ELA A;  2OE0 A;  3IC4 A;  5J9C A;  5IPH A;  1Z6M A;  2PWJ A;  3ZIJ A;  1M7T A;  4MDC A;  4RQR A;  4WXT A;  2YV7 A;  2E7P A;  3ZL5 A;  5D9V A;  4KSM A;  5HFK A;  4I5Q A;  1Q98 A;  3LYP A;  4ZBB A;  1Q4J A;  4KUN A;  4WBJ A;  1G0T A;  3C71 A;  2NDO A;  3D5J A;  3U6V A;  2IL3 A;  1VGL A;  2MZC A;  2P31 A;  2H0G A;  1X9M B;  5IMD A;  3ZML A;  2C80 A;  2LJK A;  1USB A;  2R2J A;  1SD9 A;  3VWU A;  1HQO A;  3ZVJ A;  3ZYW A;  3E9J B;  3J7Y b;  3HYP A;  4IP1 A;  5LD0 A;  3FR9 A;  4N30 A;  1GUK A;  3VWW A;  3M9K A;  3KP9 A;  2DJ0 A;  1XW9 A;  5B7C A;  1T1V A;  2VAF A;  2NBS A;  3VI7 A;  1GTA A;  3V1W A;  2ES7 A;  3EMX A;  3I6A A;  4O7H A;  1OE8 A;  3KEB A;  5F06 A;  3TJB A;  1FVJ A;  1FB6 A;  3LOR A;  1G7O A;  1ZYN A;  4EVM A;  4EC0 A;  1CQH A;  1SK2 A;  2IPA A;  1TU7 A;  2N5A A;  4HDE A;  1M0U A;  2H01 A;  1PKZ A;  1XCC A;  1X9W B;  5H5R A;  3HZ4 A;  3APQ A;  4Q5N A;  2GVP A;  2X8C A;  1NM3 A;  1S3A A;  3KZQ A;  2VIM A;  4IN0 A;  3FZ4 A;  5IM9 A;  5ECP B;  2H1B A;  4PX1 A;  4MJB A;  1SJ6 A;  2V41 A;  3GV1 A;  4HU7 A;  4TXO B;  1SKS B;  4MAB A;  2QA2 A;  3CSH A;  4Z2T A;  4EE0 A;  3ZIV A;  4XS6 A;  4E8H A;  2ALB A;  3CSJ A;  1NSW A;  4K5S A;  4BL7 A;  4BPY A;  3TDG A;  6GSY A;  3I43 A;  5DQS A;  3O3T A;  5DBQ A;  2TRC P;  4Z7X A;  1K3Y A;  1TK0 B;  3O6T A;  5A5K A;  2HYX A;  1K0O A;  2I1U A;  4N0Z A;  5AGY A;  1K0D A;  3HXS A;  2L59 A;  3SBC A;  4WEY A;  3L9V A;  2L5L A;  2XPD A;  3GX8 A;  2R4V A;  1C72 A;  1O6J A;  3FRC A;  4K8M A;  4ZL7 A;  4TRX A;  1FOV A;  1U87 A;  4HQS A;  2H8L A;  4V2M A;  2VUP A;  5DDL A;  5B6N A;  5H5Q A;  4G0I A;  2PMT A;  1R5A A;  1TI3 A;  2JAD A;  3CTG A;  3QD9 A;  1BJX A;  4XTS A;  2GZP A;  4K2D A;  3GKX A;  1VF1 A;  4OFT A;  1O7U A;  2D2Z A;  1E6B A;  1HNA A;  1SD8 A;  1QFN A;  2LRN A;  3WGE A;  1YKA A;  2A2R A;  4JED A;  2J9H A;  2YWN A;  3G7J A;  3GH9 A;  4K1F A;  22GS A;  5ID2 A;  4ZBD A;  1IYI A;  2B5X A;  2LQO A;  3PH9 A;  3QR6 A;  5ENU A;  2YN1 A;  3VPT A;  4HU9 A;  4MZW A;  4ACS A;  1F3A A;  1HYU A;  2RUF A;  3TKQ A;  2DIZ A;  5IOX A;  3ERW A;  2YAN A;  5JWQ B;  17GS A;  3ZRD A;  2RUE A;  3F3R A;  4P3Y B;  2FGX A;  1XFL A;  5JCU A;  4OMV A;  4KE3 A;  3ME7 A;  2C0G A;  3FZ5 A;  5G5F A;  4OCF A;  3JCM L;  2R37 A;  2HI7 A;  5HR3 A;  3GUS A;  4I2U A;  2H0I A;  3NIV A;  1XWK A;  20GS A;  3IOS A;  2WDU A;  2CA8 A;  2QGV A;  4F82 A;  3GKN A;  2LJR A;  1FO5 A;  5E4W A;  1WJK A;  1JZR A;  2WJU A;  3GFK A;  4ILF A;  5EPF A;  1K0A A;  2KUC A;  1V2A A;  2FLS A;  1Y6E A;  1SKW B;  3FR6 A;  1EGO A;  3FR3 A;  5COH A;  4G0L A;  4HUA A;  5G31 A;  1UC7 A;  2CZ2 A;  3RDW A;  3VWV A;  1EV9 A;  4G9H A;  5HR2 A;  2LV3 A;  3C73 A;  4EUY A;  2ZNM A;  3GYK A;  2ON5 A;  5CRG A;  3LSZ A;  3BCI A;  1SJI A;  5B8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...