4TXOB

Crystal structure of the mixed disulfide complex of thioredoxin-like tlpas(c110s) and copper chaperone scois(c74s)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
158
structure length
158
Chain Sequence
AAIGGPFQLTDQNGKAVTDKSLKGKPTLIFFGYTHSPDVCPTSLFEISEVLRAMGKDADKVNAIFISVDPERDTPATMKNYLSSFDPHLEGLSGDPAEIAKVITSYRVYAKKVPTKDGDYTMDHTALIYLMDRDGRFVSPFNLKRTPEEAAADLKRYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidodreductase/copper binding protein
molecule keywords Thiol:disulfide interchange protein TlpA
publication title How Periplasmic Thioredoxin TlpA Reduces Bacterial Copper Chaperone ScoI and Cytochrome Oxidase Subunit II (CoxB) Prior to Metallation.
pubmed doi rcsb
source organism Bradyrhizobium diazoefficiens usda 110
total genus 46
structure length 158
sequence length 158
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2014-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02630 SCO1-SenC SCO1/SenC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4txoB00
9GSSA 1SKWB 1H75A 2IJYA 3VWVA 2VM1A 2GQMA 5DVBA 4O32A 1ERVA 3DEXA 3C1RA 3EE2A 3PGTA 5CYYA 4HEA2 1A2MA 3UVHA 1K0OA 4N11A 4XCSA 3M3MA 3IC4A 4ZB8A 5D9WA 4V2LA 1A8YA 3LYKA 16GSA 1THOA 4HS1A 22GSA 1XOAA 3GKXA 1OC8A 4V1Ap 2EIQA 4V1Ag 3HXSA 3EWLA 1BX9A 1QFNA 1PGTA 4EUYA 3RPNA 2R3XA 5AISA 4TR1B 3F9UA 1H4OA 4KCEA 1M2BA 1MEKA 3PR8A 2WS2A 2VIMA 1K0BA 2RM6A 3MWHA 2AHEA 3D0ZA 1PX6A 4TR0A 3M9KA 5ECMB 3ZITA 1QK8A 2H1AA 3P2AA 2YN1A 4PNFA 5IMVA 3GH6A 1SD8A 3KXOA 1Y6EA 4IP6A 4Q5RA 4NHZA 2O85A 4ZB6A 2GT5A 5F8BA 3WT1A 3EYTA 1XPVA 3M0FA 3FR6A 1XWKA 1B48A 3LQ7A 5GZZB 3S9FA 1J0FA 4MK3A 2WRTA 4IVFA 5ECQB 4ZXGA 4HUAA 2LTKA 1X9MB 4N0ZA 3BD2A 5D93A 2QSIA 4KSMA 4MJEA 1XVWA 4MP4A 11GSA 2H6ZA 2JZSA 1M0UA 5HFKA 2B5EA 4IQ1A 2DIYA 3RDWA 2B7JA 5LD0A 3DYRA 5CRHA 3I6AA 3W6GA 4BVYA 1R7HA 1AUCA 4IQAA 4ILFA 5KEJA 3HZ8A 4XS4A 4TXVA 3A5WA 1AIUA 3G9BA 4ZIJA 3GV1A 3HY2A 4JBBA 4MH3A 1TK8B 5HR3A 1O8XA 4AJ7A 2GQLA 3F0IA 2AB6A 1G6WA 4F03A 2DIZA 5DAKB 1DBYA 2VL3A 2H6XA 5H5RA 3GA4A 2N5FA 2CZ2A 3BJ5A 3H79A 5ELGA 5ECLB 2FCHA 1ML6A 2LRTA 3GX8A 1XW5A 5DALB 4IJ3A 1X5EA 4KW6A 4HU7A 1K0CA 2WB9A 4X43A 4WXTA 3APSA 3QR6A 3H93A 3F4RA 1GNEA 2AV4A 3IPZA 4EO3A 3TGZA 3DD3A 2H30A 2M46A 2QKEA 3LWAA 2LRCA 2GSQA 2OBIA 2PPTA 3HHVA 1OKDA 4I2UA 4CW9A 3FZ4A 4HOJA 4LMVA 1V9WA 3HCZA 4IKHA 3LYPA 1TRWA 3KZQA 1PSQA 3DKSA 4GTUA 1W4VA 3H4KA 3TDGA 5KN0A 1YEPA 3ZMLA 4F0BA 1EOGA 4MZWA 5FHIA 1PKZA 2TRXA 5IMDA 5HFGA 1ZMAA 3CSIA 2RIIA 2WFCA 1TI1A 4AF2A 3DWVA 1VF2A 1AQVA 4TR1A 5A4UA 4POMA 7GSSA 4GF0A 3GSSA 1I9DA 2FA8A 3F6FA 1N8JA 2I4AA 2PN8A 5DCGA 3TJJA 4GXZA 3FR9A 5CREA 3SWLA 2ZUPA 1T8EB 1MDJA 1R4WA 1NW2A 1WOUA 4I8BA 5ECHB 2CAIA 3LG6A 4K7OA 4OCEA 4JRRA 5DQYA 3GL3A 2YANA 1GTBA 2LNTA 4PNGA 5B6MA 3TJFA 3H1NA 3QOUA 2H8LA 4MDCA 1JZWA 5G5EA 3GX0A 4PURA 5COHA 4HU9A 4ZL9A 1MD3A 2VAFA 2R37A 2B3SA 4MABA 1V40A 4PQIA 3Q74A 5GAND 1JZOA 2EC4A 3L78A 1Z6NA 2OA7A 4IS0A 1PQNA 2MMNA 1XFLA 3D4TA 2HYXA 4TW5A 1HYUA 2FD3A 3KMOA 3QCPA 1C72A 4I5QA 5JWQB 2V41A 3ZLPA 2B1KA 1NSWA 4I6XA 6GSTA 5J41A 2VL2C 2VCXA 1O6JA 1XIYA 1GSEA 3L9SA 3E3EA 3MSZA 19GSA 4XS1A 1UVZA 4ZBDA 5ELAA 1K3OA 2H1BA 5JCWA 1ZOFA 2H73A 2M80A 4J2FA 2MBSA 2WZ9A 3IAM2 2LUSA 1ON4A 3C7MA 1SENA 4EXJA 3ZIVA 3HVXA 3CXGA 2H66A 2CA8A 5DAKA 1GSFA 3R2QA 3HVVA 5D9VA 3TKQA 5CNWA 3RPPA 1UC7A 2K8SA 3D6IA 5DALA 1SK2A 2PWJA 1BEDA 2H19A 2AJQB 4WEYA 1O8WA 2CZ3A 1AC1A 5D8IA 4KNDA 3ZVJA 1TRVA 2HFDA 3LXZA 3KTBA 2JZTA 4PUFC 1HNCA 3EINA 2NVLA 1FB0A 3WT2A 3RBTA 3DRNA 4HJ2A 1K0NA 1X9WB 4HI7A 4OMVA 3CYNA 1TJDA 1VGLA 1XW9A 2IN3A 2E7PA 2L57A 2GZZA 3TKRA 3U5RE 5B8BA 3IA1A 1YY7A 2IMIA 5CRGA 1A2LA 3KGKA 3C8EA 4IP1A 5ECIB 1GWCA 3O76A 2DSAA 2VCQA 4OCFA 4PGTA 3VFIA 3DIEA 1ERUA 4HQZA 1GUMA 3NZNA 3GL5A 3UBLA 1JLVA 4MH2A 1CQHA 1RQMA 4POBA 4TXOB 4WR5A 1GUKA 3MNGA 4GQCA 3CSJA 3F3RA 4KCAA 3I43A 2O7KA 3Q18A 1WIKA 2I1UA 3BOAA 4YAVA 3QAGA 1EEJA 2E0QA 1MTCA 4XS6A 4WBJA 3FZ9A 2P5RA 2VL2A 4GCIA 3FK8A 3UVTA 2L4CA 3GRXA 1N2AA 2VOCA 2JZRA 1XZOA 1O81A 3E9JB 2MMZA 2LSTA 3ZYWA 1WPIA 1PL1A 2AUVA 1B9XC 4L0UA 6GSXA 1Z5YE 4ZB9A 3QAVA 2C0GA 3ME7A 4BA7A 3CRTA 1V58A 4J56E 1FOVA 4QL7A 2IMEA 1OYJA 1RW1A 5EVOA 3L9UA 3KIJA 1TW9A 5F07A 3TB2A 4N0VA 2IMDA 4RI7A 1Q98A 3IV4A 4TR3A 4WR4A 3QPMA 4GSTA 2DJ1A 3SBCA 2HXKA 2BMXA 4KUNA 2X8CA 1URMA 2DMLA 2VCWA 2WCIA 3FEUA 2VL9A 2HSYA 4NAXA 4ISDA 1OKTA 1V98A 2H72A 4EKZA 3KCMA 4G2EA 2X99A 1DE1A 5CP1A 1R5AA 1AQWA 5DJMA 1AAZA 4XRDA 5ID2A 5F05A 5JCUA 5C04A 4L8EA 4G10A 3CBUA 2G2QA 4LL1B 2J23A 1T1VA 2CVBA 4IELA 1O7UA 1J08A 2CVKA 3EURA 2B6MA 2JACA 5EPFA 3P7XA 4EC0A 5HR2A 3C1SA 2VLVA 3ED3A 3OR5A 5IMAA 3PINA 2DMMA 5DDLA 2NTOA 2NPBA 3GTUB 3QFBC 1HNBA 1PKWA 5H5QA 4O92A 1JZRA 2MZCA 1KNGA 2KHPA 2VD0A 3EU3A 1K0AA 2VLUA 2MYGA 3KD0A 2LS5A 2HE3A 2OJLA 1J9BA 4PUAA 2HRFA 1B9YC 1X5DA 1QXHA 3GHAA 2DLXA 1EWXA 2LRNA 3IRAA 4J57E 3GNJA 3Q6OA 2FA4A 1FB6A 1AQXA 3FY7A 5KN3A 1XXUA 3F6DA 4OFNA 2H1GA 3FHKA 4OFMA 2DJ0A 1EOHA 2J9HA 1CQGA 4L0WA 1PN9A 2H0GA 3V1WA 2WULA 2FWFA 2C8UA 2GS3A 3KH9A 4NV2A 5B7CA 2C3QA 1V2AA 1EZKA 1NM3A 5ENUA 4XHMA 4TXOA 4K6XA 3APOA 2D2ZA 4X0XA 3O6TA 1SKRB 4OO5A 2HT9A 2RUFA 3F63A 1A8LA 2LJAA 2P5QA 1PRXA 1O73A 2C0DA 2MMAA 2FNOA 2GSRA 2IMFA 3DGQA 1M2AA 2DBCA 4ZBAA 5G1KA 2KP1A 1GSSA 1YEXA 2I3YA 5LNKe 1ZYQB 1VRSD 2YWMA 1DSBA 4Q5FA 4KH7A 2A2RA 2LNSA 4LL4B 3M9JA 2CQ9A 3GURA 3TJKA 3TOTA 4ECIA 1JFUA 4MJBA 2RLIA 1YF0A 4O5RA 2ON5A 13GSA 4KA0A 3ERWA 3GUSA 5JCGA 1SJZA 1B8XA 1BQ7A 2H1DA 1F9MA 2K9FA 3D21A 3WGXA 4F82A 3TCOA 1UA5A 2C0FA 3EMPA 1K0MA 1U87A 1A0FA 4N10A 4F0CA 5H5SA 4TVEA 2YP6A 3UARA 4LA1A 4NXIA 1GTAA 1A2JA 3L9VA 1R26A 2H6YA 2YCDA 2H01A 3TKPA 2L5OA 2XBQA 3VLNA 1F37A 4DVCA 5IOXA 4ML6A 4BPYA 3PH9A 4ZL8A 5KN2A 3KJYA 1T3BA 3ZIJA 1GRXA 6GSVA 1DUGA 2GSTA 1XWAA 3CTFA 3F8UA 2C4JA 3BCIA 4XTSA 4AJ6A 1NHYA 3JCML 1FVJA 2XPEA 4FIWA 4ZILA 4IW9A 3WGEA 1M9AA 4JEDA 3DVWA 3VWWA 4NMUA 1FW1A 4MA9A 4CHSA 2JL4A 5IQYA 3FYGA 1OC3A 1ABAA 2C80A 1YDKA 17GSA 1GP1A 3GTUA 2DJKA 1TK0B 5G5FA 5E4WA 1BG5A 1ZL9A 1Z7RA 2YWNA 2V6KA 3L4NA 4DSRA 3ZREA 2XHFA 1K3YA 5CRDA 3CRUA 2O87A 4FYCA 4JU5A 3US3A 3ERFA 3TOUA 3KEBA 1YKCA 3LEFA 3KTLA 2O89A 3DMLA 3FZ5A 2PGTA 4BL7A 3TKSC 3FZAA 2WDUA 2YWIA 1MD4A 5EY6A 4YH2A 2DC5A 1IYIA 2KUCA 1OE7A 1F2EA 4MJCA 4K8MA 4PQHA 1WE0A 2A2SA 2HNLA 1X9SB 4V2NA 3KP9A 4X1UA 1ERTA 1SJIA 4YQUA 2YNXA 2N5AA 5ID2B 3WGDA 1OAZA 2I81A 2GLRA 4JZQA 5GSSA 5ECSA 1XVQA 3VWXA 4CDOA 2FGXA 2GT6A 1EGRA 2IMKA 2YZUA 4XIHA 1SL0B 2H75A 2L6DA 4OD7A 1TP9A 4FYUA 5JWOB 1WMJA 2GQKA 5DBQA 4JR4A 5AGYA 5ABRA 1S3CA 5A4WA 1M2DA 2PUKC 1XOBA 3UJ1A 2LV3A 4OFTA 1GSYA 5ECNB 2IL3A 4NWYA 3FR3A 1ERWA 3J7Yk 2YOIA 2YWOA 2B7KA 1OVNA 4K2DA 1JHBA 4Q5NA 2REMA 4AJ8A 1EV9A 4WETA 4K1FA 2BTOT 3A2WA 2XC2A 4EE0A 5C00A 2OBKA 2H0HA 4WF4A 3HVSA 3W8JA 4K0GA 4K9ZA 4HJMA 5D9XA 2YZHA 3FRCA 4G9HA 1LU4A 3LFLA 5D96A 4IN0A 1JZDA 4KDUA 2HRNA 5FT3A 1HQOA 1Z6MA 3G7JA 2P0GA 4BVXA 4L5OA 2H70A 3CMIA 2X8GA 1G0TA 2F3MA 4BWQA 3UMAA 4QQ7A 4ECBA 3GH9A 5IMFA 4LMWA 2VCZA 3NOFA 2CX3A 4MF7A 2PBJA 4MCUA 3ZFLA 3VPQA 2IWTA 4OO4A 4RI6A 2B1LA 3AY8A 3HA9A 1FVKA 4EDYA 3TKSA 4EF0A 4YQMA 3KM6A 2F9SA 1YQ1A 3C73A 3ERGA 1HD2A 5EL8A 4FH8A 1TTZA 5JWRB 5IO2A 3H8QA 2PMTA 1XBSA 4MF6A 2OE3A 2X64A 1GH2A 1XCCA 1O85A 5F06A 4WF5A 4EVMA 1TU7A 2QC7A 4P3YB 3ZTLA 4GSSA 5KN1A 5DQSA 3GMFA 2N5BA 1Z7PA 1GSQA 1TOFA 4HDEA 1HNAA 4N30A 1K0DA 1EP7A 1TI3A 3TKSE 1ST9A 3TJBA 3A2XA 2CX4A 4IBPA 3VWUA 5DCHA 4GRFA 1WWJA 1TXXA 2E2MA 1G7OA 2OE1A 2L6CA 1SK0A 4K7NA 4TR4A 3WD6A 2LKUA 2L5LA 3GFKA 3HJMA 2A4VA 1ZGNA 4MZCA 2XPDA 1Q4JA 4MLYA 2YPMA 4F2IA 1GTIA 2CVDA 3L0HA 4POLA 4EL1A 2K8VA 3EVIA 1FHEA 4PX1A 5E59A 3IBHA 1QGVA 4E8EA 4ECJA 1S3DA 3MAKA 2YJ7A 4FYBA 4RQXA 3GKNA 2MBTA 2ZNMA 4ZBBA 2HZEB 6GSUA 1G6YA 1E6BA 1B4QA 3RHCA 3IAS2 1GLQA 3Q19A 2H0IA 1XW6A 2VLTA 4LLRA 2IFQA 3ZVJD 4L5LA 2OE0A 14GSA 5G1LA 4KAEA 5AIVA 1G7EA 5IMZA 4ACSA 3ZRDA 5LCZA 2G0FA 3G7IA 3KP8A 1UN2A 2I9HA 5ECRB 3VI5A 4GSNA 3UIWA 2V2GA 2CT6A 4NV5A 2CAQA 1RK4A 2BJXA 3MDKA 1SYRA 2LQQA 1GSDA 2IIYA 1U3AA 3FKFA 4TRXA 1TKDB 1GTUA 5HR0A 1F6MC 1AXDA 4DEJA 1QUWA 3DXBA 2FUG2 3GN3A 1QQ2A 3IXRA 3E0UA 2F8AA 1EP8A 5J4UA 3W8SA 5IPHA 3RAZA 3TRQA 3GYKA 4O7HA 3I69A 5F0GA 2HLSA 4ECCA 4GQFA 1X5CA 5A5KA 1WP0A 2V1MA 2VUPA 1V57A 1Z9HA 2KOKA 1KTEA 1AW9A 4ZL7A 1LBKA 2NDOA 1TRSA 2LQOA 1ZYEA 5D73A 1XWBA 1TK5B 1E2YA 1B4PA 1ZZYA 1A23A 1M7TA 2DJ3A 4HZ4A 4KGIA 2YV9A 1SU9A 3D5JA 2Z9SA 2GVPA 4IJIA 6GSSA 5INYA 3IOSA 4OWYA 3LSZA 3KH7A 5J9BA 2P31A 5CRWA 3QD9A 5G30A 8GSSA 2C0EA 2V6OA 2WJUA 5CO3A 2HI7A 4D73B 2O8VB 3G7YA 5G31A 3O3TA 4WBRD 1KBNA 2YV7A 5AIXA 1EEMA 4Q5QA 3KMNA 3HZ4A 1S3AA 10GSA 4DSSB 3LGCA 4ULXA 5IO0A 1X0RA 5IOWA 5J9CA 2OACA 2H76A 3QDNA 2K6VA 5CAXA 2TIRA 3ME8A 1PL2A 3BBYA 2FLSA 3EMXA 4KDYA 4TKYA 1SJ6A 4WKWA 1YZXA 2DJJA 1T4ZA 4YQVA 3IK9A 2AYTA 3IDVA 5GAPD 1EGOA 3EU4A 2ES7A 1U3IA 5J5NA 1WRYA 4MZBA 6GSWA 1GULA 3QMXA 4I2TA 3CTGA 1T7PB 2PVOC 2FHEA 2H74A 4MJAA 20GSA 1Z3EA 3HDCA 3N9JA 2KLXA 4E8HA 1EV4A 2TRCP 1W89A 3K8NA 3GKKA 1KEBA 1T00A 3HKRA 2HZEA 4IHUA 4NPBA 1SD9A 5IPGA 1PX7A 5IIZA 4MMMA 1K3LA 2GZYA 1F3AA 2IPAA 2QGVA 5FWGA 4JR6A 1BAYA 2C1YA 1PD21 3I9V2 2AAWA 3QFAC 4HQSA 4KSOA 1A24A 2GTUA 2L4QA 2F8FA 4EDZA 1PMTA 3DVXA 1SL2B 1VF4A 1YKAA 2EIOA 3VK9A 3TRXA 2E2GA 5G2ZA 3TJGA 1VF3A 1GL8A 2LJRA 2FWHA 1MDIA 2LEGA 3ZZXA 2FWGA 3F4SA 5ECKB 1TRUA 1NHOA 2DJ2A 1U6TA 2VCTA 3GSTA 4HZ2A 3EC3A 3LJRA 3GKMA 1T4YA 2FY6A 5B6NA 1OC9B 2VCVA 5HQPA 4RUVA 1FAAA 3ZL5A 4PXOA 1OE8A 2GGTA 2VD1A 3M8NA 3A2VA 2GSSA 2R6KA 2L59A 2JSZA 1USBA 2JSYA 1IYHA 2B5XA 4ML1A 2YJHA 2VM2A 3TRPA 4ID0A 4KDXA 1GLPA 5IM9A 3F3QA 3TUEA 1M9BA 1SK1A 1THXA 2GZPA 5HFIA 2CV4A 1SL1B 3P8WA 1SKSB 2R5GA 5B8AA 1Y25A 1QMVA 1FO5A 1U88A 2WGRA 4NHWA 2OADA 3VI7A 3HYPA 3IHQA 3NIVA 4F9ZA 2IFQB 1JLWA 1PA3A 2JADA 4MF5A 4QL9A 3IK7A 4D73A 4PQ1A 5D9TA 4FO5A 3WYWA 3QAWA 2OKAA 1ILOA 4GWRA 4Z7XA 1GNWA 3UOMA 2RUEA 3LORA 3RHBA 3UEMA 4BWSA 4H86A 1FG4A 4I97A 1I5GA 5IMCA 12GSA 4DSSA 2PVQA 2EIRA 5AN1A 3CSHA 3UBKA 3APQA 2M72A 4KE3A 3C71A 4AGSA 2HZFA 1ACVA 5J3RA 5L71A 4MPFA 2X8HA 3HJPA 3D4MA 5ECOB 1WJKA 2KP2A 5DJLA 1BYEA 4KX4A 2XBIA 4KB3A 18GSA 1LJRA 4GLTA 3J7Yb 2MMOA 4TOPA 2R4VA 3P90A 3D22A 3UAPA 4XRAA 2H71A 4YAPA 3VPTA 2FWEA 4JE1A 3IE3A 2F51A 4TN8A 1YJ6A 2K18A 1TU8A 3HJOA 2PERA 3LXTA 3M1GA 4K0NA 5GSTA 2R2JA 1TDIA 2RM5A 4V2MA 4XS4B 1R5PA 3HD5A 4POKA 2JU5A 3U6VA 1XWCA 3ZMKA 1ZCPA 3UL3A 2ZCTA 4IGJA 2LJKA 2ALBA 5ECPB 2B5YA 2HSHA 1MDKA 4RQRA 3GIXA 2C3TA 4DSQA 2PU9C 3IR4A 3FW2A 1VF1A 2NBSA 2VO4A 3ZFBA 3VURA 1XWGA 2V32A 3ISOA 6GSYA 5HR1A 1BJXA 5A4VA 1A0RP 3BCKA 4MPGA 1SYXA 4G19A 2C3NA 3A3TA 2ON7A 2GDRA 1GSUA 1F3BA 3N5OA 4K7IA 1GUHA 3F4TA 1DE2A 1OC9A 1YF1A 1M99A
chains in the Genus database with same CATH superfamily
9GSSA 1SKWB 1H75A 2IJYA 3VWVA 2VM1A 2GQMA 5DVBA 4O32A 1ERVA 3DEXA 3C1RA 3EE2A 3PGTA 5CYYA 4HEA2 1A2MA 3UVHA 1K0OA 4G0KA 4N11A 2A2PA 4XCSA 3M3MA 3IC4A 4ZB8A 5D9WA 4V2LA 1A8YA 3LYKA 16GSA 1THOA 4HS1A 22GSA 1XOAA 3GKXA 1OC8A 4V1Ap 2EIQA 4V1Ag 3HXSA 3EWLA 1BX9A 1QFNA 1PGTA 4EUYA 3RPNA 2R3XA 5AISA 4TR1B 3F9UA 1H4OA 4KCEA 1M2BA 1MEKA 3PR8A 2WS2A 2VIMA 1K0BA 2RM6A 3MWHA 2AHEA 3D0ZA 1PX6A 4TR0A 3M9KA 5ECMB 3ZITA 1QK8A 2H1AA 3P2AA 2YN1A 4PNFA 5IMVA 5BRTA 3GH6A 1SD8A 3KXOA 1Y6EA 4IP6A 4Q5RA 4NHZA 2R0PA 2O85A 4ZB6A 2GT5A 5F8BA 3WT1A 3EYTA 1XPVA 3M0FA 3FR6A 1XWKA 1B48A 3LQ7A 4X4JA 5GZZB 3S9FA 1J0FA 4MK3A 2WRTA 4IVFA 5ECQB 4ZXGA 4HUAA 2LTKA 1X9MB 4N0ZA 3BD2A 5D93A 2QSIA 4KSMA 4MJEA 1XVWA 4MP4A 11GSA 2H6ZA 2JZSA 1M0UA 5HFKA 2B5EA 4IQ1A 2DIYA 3RDWA 2B7JA 5LD0A 3DYRA 5CRHA 3I6AA 3W6GA 4BVYA 1R7HA 1AUCA 4IQAA 4ILFA 5KEJA 3HZ8A 4XS4A 4TXVA 3A5WA 1AIUA 3G9BA 4ZIJA 3GV1A 3IC8A 3HY2A 4JBBA 4MH3A 1TK8B 5HR3A 1O8XA 4AJ7A 2GQLA 3F0IA 2AB6A 1G6WA 4F03A 2DIZA 5DAKB 1DBYA 2VL3A 2H6XA 5H5RA 3GA4A 2N5FA 2CZ2A 3HVNA 3BJ5A 3H79A 5ELGA 5ECLB 2FCHA 1ML6A 2LRTA 3GX8A 1XW5A 5DALB 4IJ3A 1X5EA 4KW6A 4HU7A 1K0CA 2QA1A 2WB9A 4X43A 4WXTA 3APSA 3QR6A 3H93A 3F4RA 1GNEA 2AV4A 3IPZA 4EO3A 3TGZA 3DD3A 2H30A 2M46A 2QKEA 3LWAA 2LRCA 2GSQA 2OBIA 2PPTA 3HHVA 1OKDA 4I2UA 4CW9A 3FZ4A 4HOJA 4LMVA 1V9WA 3HCZA 4IKHA 3LYPA 1TRWA 3KZQA 1PSQA 3DKSA 4GTUA 1W4VA 3H4KA 3TDGA 5KN0A 1YEPA 3ZMLA 4F0BA 1EOGA 4MZWA 5FHIA 1PKZA 2TRXA 5IMDA 5HFGA 1ZMAA 3CSIA 2RIIA 2WFCA 1TI1A 4AF2A 3DWVA 1VF2A 1AQVA 4TR1A 5A4UA 4POMA 7GSSA 4GF0A 3GSSA 1I9DA 2FA8A 4CY6A 3F6FA 1N8JA 2I4AA 2PN8A 5DCGA 3TJJA 4GXZA 3FR9A 5CREA 3SWLA 2ZUPA 1T8EB 1MDJA 1R4WA 1WOUA 1NW2A 4I8BA 5ECHB 2CAIA 3LG6A 4K7OA 4OCEA 4JRRA 5DQYA 3GL3A 2YANA 1GTBA 2LNTA 4PNGA 5B6MA 3TJFA 3H1NA 3QOUA 2H8LA 4MDCA 1JZWA 5G5EA 3GX0A 4PURA 5COHA 4HU9A 4ZL9A 1MD3A 2VAFA 2R37A 2B3SA 4MABA 1V40A 4PQIA 3Q74A 5GAND 1JZOA 2EC4A 3MIXA 4K2XA 3L78A 1Z6NA 2OA7A 4IS0A 1PQNA 2MMNA 1XFLA 3D4TA 2HYXA 4TW5A 1HYUA 2FD3A 3KMOA 3QCPA 1C72A 4I5QA 5JWQB 2V41A 3ZLPA 2B1KA 1NSWA 4I6XA 6GSTA 5J41A 2VL2C 4HSCX 2VCXA 1O6JA 1XIYA 1GSEA 3L9SA 3E3EA 3MSZA 19GSA 4XS1A 1UVZA 4ZBDA 1XG8A 5ELAA 1K3OA 2H1BA 5JCWA 1ZOFA 2H73A 2M80A 4J2FA 2MBSA 2WZ9A 3IAM2 2LUSA 1ON4A 3C7MA 1SENA 4EXJA 3ZIVA 3HVXA 3CXGA 1PN0A 2H66A 2CA8A 5DAKA 1GSFA 3R2QA 3HVVA 5D9VA 3TKQA 5CNWA 3RPPA 1UC7A 2K8SA 3D6IA 5DALA 1SK2A 2PWJA 3R3EA 1BEDA 2H19A 2AJQB 4WEYA 1O8WA 2CZ3A 1AC1A 5D8IA 4KNDA 3ZVJA 1TRVA 4YKFA 2HFDA 3LXZA 3KTBA 2JZTA 4PUFC 1HNCA 3EINA 2NVLA 1FB0A 3WT2A 3RBTA 3DRNA 4HJ2A 1K0NA 1X9WB 4HI7A 4OMVA 3CYNA 1TJDA 1VGLA 1XW9A 2IN3A 2E7PA 2L57A 2GZZA 3TKRA 3U5RE 5B8BA 3IA1A 1YY7A 2IMIA 5CRGA 1A2LA 3KGKA 4MNNA 3C8EA 4IP1A 5ECIB 1GWCA 3O76A 2DSAA 4BVYB 2VCQA 4OCFA 4PGTA 3EPTA 3VFIA 3DIEA 1ERUA 4HQZA 1GUMA 3NZNA 3GL5A 3UBLA 1JLVA 4MH2A 1CQHA 1RQMA 4POBA 4TXOB 4WR5A 1GUKA 3MNGA 4GQCA 3CSJA 3F3RA 4KCAA 3I43A 2O7KA 3Q18A 1WIKA 2I1UA 3BOAA 4YAVA 3QAGA 1EEJA 2E0QA 1MTCA 4XS6A 4WBJA 3FZ9A 2P5RA 2VL2A 4GCIA 3FK8A 3UVTA 2L4CA 3GRXA 1N2AA 2VOCA 2JZRA 1XZOA 1O81A 3E9JB 2MMZA 2LSTA 3ZYWA 1WPIA 1PL1A 2AUVA 1B9XC 4L0UA 6GSXA 1Z5YE 4ZB9A 3QAVA 2C0GA 3ME7A 1FOHA 4BA7A 3CRTA 1V58A 4J56E 1FOVA 4QL7A 2IMEA 1OYJA 1RW1A 5EVOA 3L9UA 3KIJA 1TW9A 5F07A 3TB2A 4N0VA 2IMDA 4RI7A 1Q98A 3IV4A 4TR3A 4WR4A 3QPMA 4GSTA 2DJ1A 3SBCA 2HXKA 2BMXA 4KUNA 2X8CA 1URMA 2DMLA 2VCWA 2WCIA 3FEUA 2VL9A 2HSYA 4NAXA 4ISDA 1OKTA 1V98A 2H72A 4EKZA 3KCMA 4G2EA 2X99A 1DE1A 5CP1A 4A5PA 1R5AA 4Z2RA 1AQWA 5DJMA 1AAZA 4XRDA 4Z2UA 5ID2A 5F05A 5JCUA 5C04A 4L8EA 4G10A 3CBUA 2G2QA 4LL1B 2J23A 1T1VA 2CVBA 4IELA 1O7UA 1J08A 2CVKA 3EURA 2B6MA 2JACA 3MYDA 5EPFA 3P7XA 4EC0A 5HR2A 3C1SA 2VLVA 3ED3A 3OR5A 5IMAA 3PINA 2DMMA 5DDLA 2NTOA 2R0GA 2NPBA 3GTUB 3QFBC 1HNBA 1PKWA 5H5QA 4O92A 1JZRA 2MZCA 1KNGA 2KHPA 2VD0A 3EU3A 1K0AA 2VLUA 2MYGA 3KD0A 2LS5A 2HE3A 2OJLA 1J9BA 4PUAA 2HRFA 1B9YC 1X5DA 1QXHA 3GHAA 2DLXA 1EWXA 2LRNA 3IRAA 4J57E 4BL7B 3GNJA 3Q6OA 2FA4A 1FB6A 1AQXA 3FY7A 4G0IA 5KN3A 1XXUA 3F6DA 4OFNA 2H1GA 3FHKA 4OFMA 2DJ0A 1EOHA 2J9HA 1CQGA 4L0WA 1PN9A 2H0GA 3V1WA 2WULA 2FWFA 2C8UA 2GS3A 3KH9A 4NV2A 5B7CA 2C3QA 1V2AA 1EZKA 4BIKA 1NM3A 5ENUA 4XHMA 2HRAA 4TXOA 4K6XA 3APOA 2D2ZA 4X0XA 3O6TA 1SKRB 4EIQA 4OO5A 2HT9A 2RUFA 3F63A 1A8LA 2LJAA 2P5QA 1PRXA 1O73A 2C0DA 2MMAA 2FNOA 2GSRA 2IMFA 3DGQA 1M2AA 2DBCA 4ZBAA 5G1KA 2KP1A 1GSSA 1PFOA 1YEXA 2I3YA 4Z2TA 5KOXA 5LNKe 1ZYQB 1VRSD 2YWMA 1DSBA 4Q5FA 4KH7A 2A2RA 2LNSA 4LL4B 3M9JA 2CQ9A 3GURA 3TJKA 3TOTA 4ECIA 1JFUA 4MJBA 2RLIA 1YF0A 4O5RA 2ON5A 13GSA 4KA0A 3ERWA 3GUSA 5JCGA 2HRKA 1SJZA 1B8XA 4O5UA 1BQ7A 2H1DA 1F9MA 2K9FA 3D21A 3WGXA 4F82A 3TCOA 1UA5A 2C0FA 3EMPA 1K0MA 1U87A 1A0FA 4N10A 4F0CA 5H5SA 4TVEA 2YP6A 3UARA 4LA1A 4NXIA 1GTAA 1A2JA 3L9VA 1R26A 2H6YA 2YCDA 2H01A 3TKPA 2L5OA 2XBQA 3VLNA 1F37A 4DVCA 5IOXA 4ML6A 4BPYA 1S3RA 3PH9A 4ZL8A 5KN2A 3KJYA 1T3BA 3ZIJA 1GRXA 6GSVA 1DUGA 2GSTA 1XWAA 3CTFA 3F8UA 2C4JA 3BCIA 4XTSA 4AJ6A 1NHYA 3JCML 1FVJA 2XPEA 4FIWA 4ZILA 4IW9A 3WGEA 2DKHA 1M9AA 4JEDA 3DVWA 3VWWA 4NMUA 1FW1A 4MA9A 4CHSA 2JL4A 5IQYA 3FYGA 1OC3A 1ABAA 2C80A 1YDKA 17GSA 1GP1A 3GTUA 2DJKA 1TK0B 5G5FA 5E4WA 1BG5A 1ZL9A 1Z7RA 2YWNA 2V6KA 3L4NA 4DSRA 3ZREA 2XHFA 1K3YA 5CRDA 3CRUA 2O87A 4FYCA 4JU5A 3US3A 3ERFA 3TOUA 3KEBA 1YKCA 3LEFA 3KTLA 2O89A 3DMLA 3FZ5A 2PGTA 4BL7A 3TKSC 3FZAA 2WDUA 2YWIA 1MD4A 5EY6A 4PTSA 4YH2A 2DC5A 1IYIA 2KUCA 1OE7A 1F2EA 4MJCA 4K8MA 4PQHA 1WE0A 2A2SA 2HNLA 1X9SB 4V2NA 3KP9A 4X1UA 1ERTA 1SJIA 4YQUA 2YNXA 2N5AA 5ID2B 3WGDA 1OAZA 4CY8A 2I81A 2GLRA 4JZQA 5GSSA 5ECSA 1XVQA 3VWXA 4CDOA 2FGXA 2GT6A 1EGRA 2IMKA 2YZUA 4XIHA 4K5RA 1SL0B 2H75A 2L6DA 4OD7A 1TP9A 4FYUA 5JWOB 1WMJA 2GQKA 5DBQA 4JR4A 5AGYA 4EIPA 5ABRA 1S3CA 5A4WA 1M2DA 2PUKC 1XOBA 3UJ1A 2LV3A 4OFTA 1GSYA 5ECNB 2IL3A 4NWYA 2R0CA 3FR3A 1ERWA 3J7Yk 2YOIA 2YWOA 2B7KA 1OVNA 4K2DA 4YKGA 1JHBA 4Q5NA 2REMA 4AJ8A 1EV9A 4WETA 4K1FA 2BTOT 3A2WA 2XC2A 4EE0A 5C00A 2OBKA 2H0HA 4WF4A 3HVSA 3W8JA 4K0GA 4K9ZA 4HJMA 5D9XA 2YZHA 3FRCA 4G9HA 1LU4A 3LFLA 5D96A 4IN0A 1JZDA 4KDUA 2HRNA 5FT3A 1HQOA 1Z6MA 3G7JA 2P0GA 4BVXA 4L5OA 2H70A 3CMIA 2X8GA 1G0TA 2F3MA 4BWQA 3UMAA 4QQ7A 4USSA 4ECBA 3GH9A 5IMFA 4LMWA 2VCZA 3NOFA 2CX3A 4MF7A 2PBJA 4MCUA 3ZFLA 3VPQA 2IWTA 4OO4A 4RI6A 2B1LA 3AY8A 3HA9A 1FVKA 4EDYA 3TKSA 4EF0A 4YQMA 3IHGA 3KM6A 2F9SA 1YQ1A 3C73A 3ERGA 1HD2A 5EL8A 4G0LA 4FH8A 1TTZA 5JWRB 5IO2A 3H8QA 2PMTA 1XBSA 4MF6A 2OE3A 2X64A 2HSMA 1GH2A 1XCCA 1O85A 5F06A 4WF5A 4EVMA 1TU7A 2QC7A 4P3YB 3ZTLA 4GSSA 5KN1A 3GMFA 5DQSA 2N5BA 1Z7PA 1GSQA 1TOFA 4HDEA 1HNAA 4N30A 1K0DA 1EP7A 1TI3A 3TKSE 1ST9A 3TJBA 3A2XA 2CX4A 4IBPA 3VWUA 5DCHA 4GRFA 1WWJA 1TXXA 2E2MA 1G7OA 2OE1A 2L6CA 1SK0A 4K7NA 4TR4A 3WD6A 2LKUA 2L5LA 3GFKA 3HJMA 2A4VA 1ZGNA 4MZCA 2XPDA 1Q4JA 4MLYA 2YPMA 4F2IA 1GTIA 2CVDA 3L0HA 4POLA 4EL1A 2K8VA 3EVIA 1FHEA 4PX1A 5E59A 3IBHA 1QGVA 4E8EA 4ICYA 4ECJA 1S3DA 3MAKA 2YJ7A 4FYBA 4KF9A 4RQXA 3GKNA 2MBTA 2ZNMA 4ZBBA 2HZEB 6GSUA 1G6YA 1E6BA 1B4QA 3RHCA 3IAS2 1GLQA 3Q19A 2H0IA 1XW6A 2VLTA 4LLRA 2IFQA 3ZVJD 4L5LA 2OE0A 14GSA 5G1LA 4KAEA 5AIVA 1G7EA 5IMZA 4ACSA 3ZRDA 5LCZA 2G0FA 3G7IA 3KP8A 1UN2A 2I9HA 5ECRB 3VI5A 4GSNA 3UIWA 2V2GA 2CT6A 4NV5A 2CAQA 1RK4A 2BJXA 1M3IA 3MDKA 1SYRA 2LQQA 1GSDA 2IIYA 1U3AA 3FKFA 4TRXA 1TKDB 1GTUA 5HR0A 1F6MC 1AXDA 4DEJA 1QUWA 3DXBA 2FUG2 3GN3A 1QQ2A 3IXRA 3E0UA 2F8AA 1EP8A 5BMUA 5J4UA 3W8SA 5IPHA 3RAZA 3TRQA 3GYKA 4O7HA 3I69A 5F0GA 4FQUA 2HLSA 4ECCA 3PPUA 4GQFA 1X5CA 5A5KA 1WP0A 2V1MA 2VUPA 1V57A 1Z9HA 2KOKA 1KTEA 1AW9A 4ZL7A 1LBKA 2NDOA 1TRSA 2LQOA 1ZYEA 5D73A 1XWBA 1TK5B 1E2YA 1B4PA 1ZZYA 1A23A 1M7TA 2DJ3A 4HZ4A 4KGIA 5KOWA 2YV9A 1SU9A 3D5JA 2Z9SA 2GVPA 4IJIA 6GSSA 5INYA 3IOSA 4OWYA 3LSZA 3KH7A 5J9BA 2P31A 5CRWA 3QD9A 5G30A 8GSSA 2C0EA 2V6OA 2WJUA 5CO3A 2HI7A 4D73B 3A5IA 2O8VB 3G7YA 5G31A 3O3TA 4WBRD 1KBNA 2YV7A 3CQFA 5AIXA 1EEMA 4Q5QA 3KMNA 2X49A 3HZ4A 1S3AA 10GSA 2X4AA 4DSSB 3LGCA 4ULXA 5IO0A 1X0RA 5IOWA 5J9CA 2OACA 2H76A 3QDNA 2K6VA 5CAXA 2TIRA 3ME8A 1PL2A 3BBYA 2FLSA 3EMXA 4KDYA 4TKYA 1SJ6A 4WKWA 1YZXA 2DJJA 1T4ZA 4YQVA 4K5SA 3IK9A 2AYTA 3IDVA 5GAPD 1EGOA 3EU4A 2ES7A 1U3IA 5J5NA 1WRYA 4MZBA 6GSWA 1GULA 3QMXA 4I2TA 3CTGA 1T7PB 2PVOC 4BVXB 2FHEA 2H74A 4MJAA 20GSA 1Z3EA 3HDCA 3N9JA 2KLXA 4E8HA 1EV4A 2TRCP 1W89A 3K8NA 3GKKA 1KEBA 1T00A 3HKRA 2HZEA 4IHUA 4NPBA 1SD9A 5IPGA 1PX7A 5IIZA 4MMMA 1K3LA 2GZYA 1F3AA 2IPAA 2QGVA 5FWGA 4JR6A 1BAYA 2C1YA 1PD21 3I9V2 2AAWA 3QFAC 4HQSA 4KSOA 1A24A 2GTUA 2L4QA 2F8FA 1M3JA 4EDZA 3LW9A 1PMTA 3DVXA 1SL2B 1VF4A 1YKAA 2EIOA 3VK9A 3TRXA 2E2GA 5G2ZA 3TJGA 1VF3A 1GL8A 2LJRA 2FWHA 1MDIA 2LEGA 3ZZXA 2FWGA 3F4SA 5ECKB 1TRUA 1NHOA 2DJ2A 1U6TA 2VCTA 3GSTA 4HZ2A 3EC3A 3LJRA 3GKMA 1T4YA 2FY6A 5B6NA 1OC9B 2VCVA 5HQPA 4RUVA 1FAAA 3ZL5A 4PXOA 1OE8A 2GGTA 2VD1A 3M8NA 3A2VA 2GSSA 2R6KA 2L59A 2JSZA 1USBA 2JSYA 1IYHA 2B5XA 4ML1A 2YJHA 2VM2A 3TRPA 4ID0A 4KDXA 1GLPA 5IM9A 3F3QA 3TUEA 1M9BA 1SK1A 1THXA 2GZPA 5HFIA 2CV4A 1SL1B 3P8WA 1SKSB 2R5GA 5B8AA 1Y25A 1QMVA 1FO5A 1U88A 2WGRA 4NHWA 2OADA 3VI7A 3HYPA 3IHQA 3NIVA 4F9ZA 2IFQB 1JLWA 1PA3A 2JADA 4MF5A 4QL9A 3IK7A 4D73A 4PQ1A 2A4HA 5D9TA 4FO5A 3WYWA 3QAWA 2OKAA 1ILOA 4GWRA 4Z7XA 1GNWA 3UOMA 2RUEA 3LORA 3RHBA 3UEMA 4BWSA 4H86A 1FG4A 4I97A 1I5GA 5IMCA 12GSA 4DSSA 2PVQA 2EIRA 1ZYNA 5AN1A 3CSHA 3UBKA 3APQA 2M72A 4KE3A 3C71A 4AGSA 2HZFA 1ACVA 5J3RA 5L71A 4MPFA 2X8HA 3HJPA 3D4MA 5ECOB 1WJKA 2KP2A 5DJLA 1BYEA 4KX4A 2XBIA 4KB3A 18GSA 1LJRA 4GLTA 3J7Yb 2MMOA 4TOPA 2R4VA 3P90A 3D22A 3UAPA 4XRAA 2H71A 4YAPA 3VPTA 2FWEA 4JE1A 3IE3A 2F51A 2DKIA 4TN8A 1YJ6A 2K18A 1TU8A 3HJOA 2PERA 3LXTA 3M1GA 4K0NA 5GSTA 2R2JA 1TDIA 2RM5A 4V2MA 4XS4B 1R5PA 3HD5A 4POKA 2JU5A 3U6VA 1XWCA 3ZMKA 1ZCPA 3UL3A 2ZCTA 2QA2A 4IGJA 2LJKA 2ALBA 5ECPB 2B5YA 2UZ8A 2HSHA 1MDKA 4RQRA 3GIXA 2C3TA 4DSQA 2PU9C 3IR4A 3FW2A 1VF1A 2NBSA 2VO4A 3ZFBA 3VURA 1XWGA 2V32A 3ISOA 6GSYA 5HR1A 1BJXA 5A4VA 1A0RP 3BCKA 4MPGA 1SYXA 4G19A 2C3NA 3A3TA 2ON7A 2GDRA 1GSUA 1F3BA 3FMWA 3N5OA 4K7IA 1GUHA 1ZYPA 3F4TA 4O5QA 1DE2A 1OC9A 1YF1A 1M99A
chains in the Genus database with same CATH topology
9GSSA 1SKWB 1H75A 2IJYA 3VWVA 2VM1A 2GQMA 5DVBA 4O32A 1ERVA 3DEXA 3C1RA 3EE2A 3PGTA 5CYYA 4HEA2 1A2MA 3UVHA 1K0OA 4G0KA 4N11A 2A2PA 4XCSA 3M3MA 3IC4A 4ZB8A 5D9WA 4V2LA 1A8YA 3LYKA 16GSA 1THOA 4HS1A 22GSA 1XOAA 3GKXA 1OC8A 4V1Ap 2EIQA 4V1Ag 3HXSA 3EWLA 1BX9A 1QFNA 1PGTA 4EUYA 3RPNA 2R3XA 5AISA 4TR1B 3F9UA 1H4OA 4KCEA 1M2BA 1MEKA 3PR8A 2WS2A 2VIMA 1K0BA 2RM6A 3MWHA 2AHEA 3D0ZA 1PX6A 4TR0A 3M9KA 5ECMB 3ZITA 1QK8A 2H1AA 3P2AA 2YN1A 4PNFA 5IMVA 5BRTA 3GH6A 1SD8A 3KXOA 1Y6EA 4IP6A 4Q5RA 4NHZA 2R0PA 2O85A 4ZB6A 2GT5A 5F8BA 3WT1A 3EYTA 1XPVA 3M0FA 3FR6A 1XWKA 1B48A 3LQ7A 4X4JA 5GZZB 3S9FA 1J0FA 4MK3A 2WRTA 4IVFA 5ECQB 4ZXGA 4HUAA 2LTKA 1X9MB 4N0ZA 3BD2A 5D93A 2QSIA 4KSMA 4MJEA 1XVWA 4MP4A 11GSA 2H6ZA 2JZSA 1M0UA 5HFKA 2B5EA 4IQ1A 2DIYA 3RDWA 2B7JA 5LD0A 3DYRA 5CRHA 3I6AA 3W6GA 4BVYA 1R7HA 1AUCA 4IQAA 4ILFA 5KEJA 3HZ8A 4XS4A 4TXVA 3A5WA 1AIUA 3G9BA 4ZIJA 3GV1A 3IC8A 3HY2A 4JBBA 4MH3A 1TK8B 5HR3A 1O8XA 4AJ7A 2GQLA 3F0IA 2AB6A 1G6WA 4F03A 2DIZA 5DAKB 1DBYA 2VL3A 2H6XA 5H5RA 3GA4A 2N5FA 2CZ2A 3BJ5A 3H79A 5ELGA 5ECLB 2FCHA 1ML6A 2LRTA 3GX8A 1XW5A 5DALB 4IJ3A 1X5EA 4KW6A 4HU7A 1K0CA 2QA1A 2WB9A 4X43A 4WXTA 3APSA 3QR6A 3H93A 3F4RA 1GNEA 2AV4A 3IPZA 4EO3A 3TGZA 3DD3A 2H30A 2M46A 2QKEA 3LWAA 2LRCA 2GSQA 2OBIA 2PPTA 3HHVA 1OKDA 4I2UA 4CW9A 3FZ4A 4HOJA 4LMVA 1V9WA 3HCZA 4IKHA 3LYPA 1TRWA 3KZQA 1PSQA 3DKSA 4GTUA 1W4VA 3H4KA 3TDGA 5KN0A 1YEPA 3ZMLA 4F0BA 1EOGA 4MZWA 5FHIA 1PKZA 2TRXA 5IMDA 5HFGA 1ZMAA 3CSIA 2RIIA 2WFCA 1TI1A 4AF2A 3DWVA 1VF2A 1AQVA 4TR1A 5A4UA 4POMA 7GSSA 4GF0A 3GSSA 1I9DA 2FA8A 4CY6A 3F6FA 1N8JA 2I4AA 2PN8A 5DCGA 3TJJA 4GXZA 3FR9A 5CREA 3SWLA 2ZUPA 1T8EB 1MDJA 1R4WA 1WOUA 1NW2A 4I8BA 5ECHB 2CAIA 3LG6A 4K7OA 4OCEA 4JRRA 5DQYA 3GL3A 2YANA 1GTBA 2LNTA 4PNGA 5B6MA 3TJFA 3H1NA 3QOUA 2H8LA 4MDCA 1JZWA 5G5EA 3GX0A 4PURA 5COHA 4HU9A 4ZL9A 1MD3A 2VAFA 2R37A 2B3SA 4MABA 1V40A 4PQIA 3Q74A 5GAND 1JZOA 2EC4A 3MIXA 4K2XA 3L78A 1Z6NA 2OA7A 4IS0A 1PQNA 2MMNA 1XFLA 3D4TA 2HYXA 4TW5A 1HYUA 2FD3A 3KMOA 3QCPA 1C72A 4I5QA 5JWQB 2V41A 3ZLPA 2B1KA 1NSWA 4I6XA 6GSTA 5J41A 2VL2C 2VCXA 1O6JA 1XIYA 1GSEA 3L9SA 3E3EA 3MSZA 19GSA 4XS1A 1UVZA 4ZBDA 5ELAA 1K3OA 2H1BA 5JCWA 1ZOFA 2H73A 2M80A 4J2FA 2MBSA 2WZ9A 3IAM2 2LUSA 1ON4A 3C7MA 1SENA 4EXJA 3ZIVA 3HVXA 3CXGA 1PN0A 2H66A 2CA8A 5DAKA 1GSFA 3R2QA 3HVVA 5D9VA 3TKQA 5CNWA 3RPPA 1UC7A 2K8SA 3D6IA 5DALA 1SK2A 2PWJA 3R3EA 1BEDA 2H19A 2AJQB 4WEYA 1O8WA 2CZ3A 1AC1A 5D8IA 4KNDA 3ZVJA 1TRVA 4YKFA 2HFDA 3LXZA 3KTBA 2JZTA 4PUFC 1HNCA 3EINA 2NVLA 1FB0A 3WT2A 3RBTA 3DRNA 4HJ2A 1K0NA 1X9WB 4HI7A 4OMVA 3CYNA 1TJDA 1VGLA 1XW9A 2IN3A 2E7PA 2L57A 2GZZA 3TKRA 3U5RE 5B8BA 3IA1A 1YY7A 2IMIA 5CRGA 1A2LA 3KGKA 4MNNA 3C8EA 4IP1A 5ECIB 1GWCA 3O76A 2DSAA 4BVYB 2VCQA 4OCFA 4PGTA 3EPTA 3VFIA 3DIEA 1ERUA 4HQZA 1GUMA 3NZNA 3GL5A 3UBLA 1JLVA 4MH2A 1CQHA 1RQMA 4POBA 4TXOB 4WR5A 1GUKA 3MNGA 4GQCA 3CSJA 3F3RA 4KCAA 3I43A 2O7KA 3Q18A 1WIKA 2I1UA 3BOAA 4YAVA 3QAGA 1EEJA 2E0QA 1MTCA 4XS6A 4WBJA 3FZ9A 2P5RA 2VL2A 4GCIA 3FK8A 3UVTA 2L4CA 3GRXA 1N2AA 2VOCA 2JZRA 1XZOA 1O81A 3E9JB 2MMZA 2LSTA 3ZYWA 1WPIA 1PL1A 2AUVA 1B9XC 4L0UA 6GSXA 1Z5YE 4ZB9A 3QAVA 2C0GA 3ME7A 1FOHA 4BA7A 3CRTA 1V58A 4J56E 1FOVA 4QL7A 2IMEA 1OYJA 1RW1A 5EVOA 3L9UA 3KIJA 1TW9A 5F07A 3TB2A 4N0VA 2IMDA 4RI7A 1Q98A 3IV4A 4TR3A 4WR4A 3QPMA 4GSTA 2DJ1A 3SBCA 2HXKA 2BMXA 4KUNA 2X8CA 1URMA 2DMLA 2VCWA 2WCIA 3FEUA 2VL9A 2HSYA 4NAXA 4ISDA 1OKTA 1V98A 2H72A 4EKZA 3KCMA 4G2EA 2X99A 1DE1A 5CP1A 4A5PA 1R5AA 4Z2RA 1AQWA 5DJMA 1AAZA 4XRDA 4Z2UA 5ID2A 5F05A 5JCUA 5C04A 4L8EA 4G10A 3CBUA 2G2QA 4LL1B 2J23A 1T1VA 2CVBA 4IELA 1O7UA 1J08A 2CVKA 3EURA 2B6MA 2JACA 3MYDA 5EPFA 3P7XA 4EC0A 5HR2A 3C1SA 2VLVA 3ED3A 3OR5A 5IMAA 3PINA 2DMMA 5DDLA 2NTOA 2R0GA 2NPBA 3GTUB 3QFBC 1HNBA 1PKWA 5H5QA 4O92A 1JZRA 2MZCA 1KNGA 2KHPA 2VD0A 3EU3A 1K0AA 2VLUA 2MYGA 3KD0A 2LS5A 2HE3A 2OJLA 1J9BA 4PUAA 2HRFA 1B9YC 1X5DA 1QXHA 3GHAA 2DLXA 1EWXA 2LRNA 3IRAA 4J57E 4BL7B 3GNJA 3Q6OA 2FA4A 1FB6A 1AQXA 3FY7A 4G0IA 5KN3A 1XXUA 3F6DA 4OFNA 2H1GA 3FHKA 4OFMA 2DJ0A 1EOHA 2J9HA 1CQGA 4L0WA 1PN9A 2H0GA 3V1WA 2WULA 2FWFA 2C8UA 2GS3A 3KH9A 4NV2A 5B7CA 2C3QA 1V2AA 1EZKA 1NM3A 5ENUA 4XHMA 2HRAA 4TXOA 4K6XA 3APOA 2D2ZA 4X0XA 3O6TA 1SKRB 4EIQA 4OO5A 2HT9A 2RUFA 3F63A 1A8LA 2LJAA 2P5QA 1PRXA 1O73A 2C0DA 2MMAA 2FNOA 2GSRA 2IMFA 3DGQA 1M2AA 2DBCA 4ZBAA 5G1KA 2KP1A 1GSSA 1YEXA 2I3YA 4Z2TA 5KOXA 5LNKe 1ZYQB 1VRSD 2YWMA 1DSBA 4Q5FA 4KH7A 2A2RA 2LNSA 4LL4B 3M9JA 2CQ9A 3GURA 3TJKA 3TOTA 4ECIA 1JFUA 4MJBA 2RLIA 1YF0A 4O5RA 2ON5A 13GSA 4KA0A 3ERWA 3GUSA 5JCGA 2HRKA 1SJZA 1B8XA 4O5UA 1BQ7A 2H1DA 1F9MA 2K9FA 3D21A 3WGXA 4F82A 3TCOA 1UA5A 2C0FA 3EMPA 1K0MA 1U87A 1A0FA 4N10A 4F0CA 5H5SA 4TVEA 2YP6A 3UARA 4LA1A 4NXIA 1GTAA 1A2JA 3L9VA 1R26A 2H6YA 2YCDA 2H01A 3TKPA 2L5OA 2XBQA 3VLNA 1F37A 4DVCA 5IOXA 4ML6A 4BPYA 3PH9A 4ZL8A 5KN2A 3KJYA 1T3BA 3ZIJA 1GRXA 6GSVA 1DUGA 2GSTA 1XWAA 3CTFA 3F8UA 2C4JA 3BCIA 4XTSA 4AJ6A 1NHYA 3JCML 1FVJA 2XPEA 4FIWA 4ZILA 4IW9A 3WGEA 2DKHA 1M9AA 4JEDA 3DVWA 3VWWA 4NMUA 1FW1A 4MA9A 4CHSA 2JL4A 5IQYA 3FYGA 1OC3A 1ABAA 2C80A 1YDKA 17GSA 1GP1A 3GTUA 2DJKA 1TK0B 5G5FA 5E4WA 1BG5A 1ZL9A 1Z7RA 2YWNA 2V6KA 3L4NA 4DSRA 3ZREA 2XHFA 1K3YA 5CRDA 3CRUA 2O87A 4FYCA 4JU5A 3US3A 3ERFA 3TOUA 3KEBA 1YKCA 3LEFA 3KTLA 2O89A 3DMLA 3FZ5A 2PGTA 4BL7A 3TKSC 3FZAA 2WDUA 2YWIA 1MD4A 5EY6A 4PTSA 4YH2A 2DC5A 1IYIA 2KUCA 1OE7A 1F2EA 4MJCA 4K8MA 4PQHA 1WE0A 2A2SA 2HNLA 1X9SB 4V2NA 3KP9A 4X1UA 1ERTA 1SJIA 4YQUA 2YNXA 2N5AA 5ID2B 3WGDA 1OAZA 4CY8A 2I81A 2GLRA 4JZQA 5GSSA 5ECSA 1XVQA 3VWXA 4CDOA 2FGXA 2GT6A 1EGRA 2IMKA 2YZUA 4XIHA 4K5RA 1SL0B 2H75A 2L6DA 4OD7A 1TP9A 4FYUA 5JWOB 1WMJA 2GQKA 5DBQA 4JR4A 5AGYA 4EIPA 5ABRA 1S3CA 5A4WA 1M2DA 2PUKC 1XOBA 3UJ1A 2LV3A 4OFTA 1GSYA 5ECNB 2IL3A 4NWYA 2R0CA 3FR3A 1ERWA 3J7Yk 2YOIA 2YWOA 2B7KA 1OVNA 4K2DA 4YKGA 1JHBA 4Q5NA 2REMA 4AJ8A 1EV9A 4WETA 4K1FA 2BTOT 3A2WA 2XC2A 4EE0A 5C00A 2OBKA 2H0HA 4WF4A 3HVSA 3W8JA 4K0GA 4K9ZA 4HJMA 5D9XA 2YZHA 3FRCA 4G9HA 1LU4A 3LFLA 5D96A 4IN0A 1JZDA 4KDUA 2HRNA 5FT3A 1HQOA 1Z6MA 3G7JA 2P0GA 4BVXA 4L5OA 2H70A 3CMIA 2X8GA 1G0TA 2F3MA 4BWQA 3UMAA 4QQ7A 4USSA 4ECBA 3GH9A 5IMFA 4LMWA 2VCZA 3NOFA 2CX3A 4MF7A 2PBJA 4MCUA 3ZFLA 3VPQA 2IWTA 4OO4A 4RI6A 2B1LA 3AY8A 3HA9A 1FVKA 4EDYA 3TKSA 4EF0A 4YQMA 3IHGA 3KM6A 2F9SA 1YQ1A 3C73A 3ERGA 1HD2A 5EL8A 4G0LA 4FH8A 1TTZA 5JWRB 5IO2A 3H8QA 2PMTA 1XBSA 4MF6A 2OE3A 2X64A 2HSMA 1GH2A 1XCCA 1O85A 5F06A 4WF5A 4EVMA 1TU7A 2QC7A 4P3YB 3ZTLA 4GSSA 5KN1A 3GMFA 5DQSA 2N5BA 1Z7PA 1GSQA 1TOFA 4HDEA 1HNAA 4N30A 1K0DA 1EP7A 1TI3A 3TKSE 1ST9A 3TJBA 3A2XA 2CX4A 4IBPA 3VWUA 5DCHA 4GRFA 1WWJA 1TXXA 2E2MA 1G7OA 2OE1A 2L6CA 1SK0A 4K7NA 4TR4A 3WD6A 2LKUA 2L5LA 3GFKA 3HJMA 2A4VA 1ZGNA 4MZCA 2XPDA 1Q4JA 4MLYA 2YPMA 4F2IA 1GTIA 2CVDA 3L0HA 4POLA 4EL1A 2K8VA 3EVIA 1FHEA 4PX1A 5E59A 3IBHA 1QGVA 4E8EA 4ICYA 4ECJA 1S3DA 3MAKA 2YJ7A 4FYBA 4KF9A 4RQXA 3GKNA 2MBTA 2ZNMA 4ZBBA 2HZEB 6GSUA 1G6YA 1E6BA 1B4QA 3RHCA 3IAS2 1GLQA 3Q19A 2H0IA 1XW6A 2VLTA 4LLRA 2IFQA 3ZVJD 4L5LA 2OE0A 14GSA 5G1LA 4KAEA 5AIVA 1G7EA 5IMZA 4ACSA 3ZRDA 5LCZA 2G0FA 3G7IA 3KP8A 1UN2A 2I9HA 5ECRB 3VI5A 4GSNA 3UIWA 2V2GA 2CT6A 4NV5A 2CAQA 1RK4A 2BJXA 3MDKA 1SYRA 2LQQA 1GSDA 2IIYA 1U3AA 3FKFA 4TRXA 1TKDB 1GTUA 5HR0A 1F6MC 1AXDA 4DEJA 1QUWA 3DXBA 2FUG2 3GN3A 1QQ2A 3IXRA 3E0UA 2F8AA 1EP8A 5BMUA 5J4UA 3W8SA 5IPHA 3RAZA 3TRQA 3GYKA 4O7HA 3I69A 5F0GA 4FQUA 2HLSA 4ECCA 3PPUA 4GQFA 1X5CA 5A5KA 1WP0A 2V1MA 2VUPA 1V57A 1Z9HA 2KOKA 1KTEA 1AW9A 4ZL7A 1LBKA 2NDOA 1TRSA 2LQOA 1ZYEA 5D73A 1XWBA 1TK5B 1E2YA 1B4PA 1ZZYA 1A23A 1M7TA 2DJ3A 4HZ4A 4KGIA 5KOWA 2YV9A 1SU9A 3D5JA 2Z9SA 2GVPA 4IJIA 6GSSA 5INYA 3IOSA 4OWYA 3LSZA 3KH7A 5J9BA 2P31A 5CRWA 3QD9A 5G30A 8GSSA 2C0EA 2V6OA 2WJUA 5CO3A 2HI7A 4D73B 3A5IA 2O8VB 3G7YA 5G31A 3O3TA 4WBRD 1KBNA 2YV7A 5AIXA 1EEMA 4Q5QA 3KMNA 2X49A 3HZ4A 1S3AA 10GSA 2X4AA 4DSSB 3LGCA 4ULXA 5IO0A 1X0RA 5IOWA 5J9CA 2OACA 2H76A 3QDNA 2K6VA 5CAXA 2TIRA 3ME8A 1PL2A 3BBYA 2FLSA 3EMXA 4KDYA 4TKYA 1SJ6A 4WKWA 1YZXA 2DJJA 1T4ZA 4YQVA 4K5SA 3IK9A 2AYTA 3IDVA 5GAPD 1EGOA 3EU4A 2ES7A 1U3IA 5J5NA 1WRYA 4MZBA 6GSWA 1GULA 3QMXA 4I2TA 3CTGA 1T7PB 2PVOC 4BVXB 2FHEA 2H74A 4MJAA 20GSA 1Z3EA 3HDCA 3N9JA 2KLXA 4E8HA 1EV4A 2TRCP 1W89A 3K8NA 3GKKA 1KEBA 1T00A 3HKRA 2HZEA 4IHUA 4NPBA 1SD9A 5IPGA 1PX7A 5IIZA 4MMMA 1K3LA 2GZYA 1F3AA 2IPAA 2QGVA 5FWGA 4JR6A 1BAYA 2C1YA 1PD21 3I9V2 2AAWA 3QFAC 4HQSA 4KSOA 1A24A 2GTUA 2L4QA 2F8FA 4EDZA 3LW9A 1PMTA 3DVXA 1SL2B 1VF4A 1YKAA 2EIOA 3VK9A 3TRXA 2E2GA 5G2ZA 3TJGA 1VF3A 1GL8A 2LJRA 2FWHA 1MDIA 2LEGA 3ZZXA 2FWGA 3F4SA 5ECKB 1TRUA 1NHOA 2DJ2A 1U6TA 2VCTA 3GSTA 4HZ2A 3EC3A 3LJRA 3GKMA 1T4YA 2FY6A 5B6NA 1OC9B 2VCVA 5HQPA 4RUVA 1FAAA 3ZL5A 4PXOA 1OE8A 2GGTA 2VD1A 3M8NA 3A2VA 2GSSA 2R6KA 2L59A 2JSZA 1USBA 2JSYA 1IYHA 2B5XA 4ML1A 2YJHA 2VM2A 3TRPA 4ID0A 4KDXA 1GLPA 5IM9A 3F3QA 3TUEA 1M9BA 1SK1A 1THXA 2GZPA 5HFIA 2CV4A 1SL1B 3P8WA 1SKSB 2R5GA 5B8AA 1Y25A 1QMVA 1FO5A 1U88A 2WGRA 4NHWA 2OADA 3VI7A 3HYPA 3IHQA 3NIVA 4F9ZA 2IFQB 1JLWA 1PA3A 2JADA 4MF5A 4QL9A 3IK7A 4D73A 4PQ1A 2A4HA 5D9TA 4FO5A 3WYWA 3QAWA 2OKAA 1ILOA 4GWRA 4Z7XA 1GNWA 3UOMA 2RUEA 3LORA 3RHBA 3UEMA 4BWSA 4H86A 1FG4A 4I97A 1I5GA 5IMCA 12GSA 4DSSA 2PVQA 2EIRA 1ZYNA 5AN1A 3CSHA 3UBKA 3APQA 2M72A 4KE3A 3C71A 4AGSA 2HZFA 1ACVA 5J3RA 5L71A 4MPFA 2X8HA 3HJPA 3D4MA 5ECOB 1WJKA 2KP2A 5DJLA 1BYEA 4KX4A 2XBIA 4KB3A 18GSA 1LJRA 4GLTA 3J7Yb 2MMOA 4TOPA 2R4VA 3P90A 3D22A 3UAPA 4XRAA 2H71A 4YAPA 3VPTA 2FWEA 4JE1A 3IE3A 2F51A 2DKIA 4TN8A 1YJ6A 2K18A 1TU8A 3HJOA 2PERA 3LXTA 3M1GA 4K0NA 5GSTA 2R2JA 1TDIA 2RM5A 4V2MA 4XS4B 1R5PA 3HD5A 4POKA 2JU5A 3U6VA 1XWCA 3ZMKA 1ZCPA 3UL3A 2ZCTA 2QA2A 4IGJA 2LJKA 2ALBA 5ECPB 2B5YA 2UZ8A 2HSHA 1MDKA 4RQRA 3GIXA 2C3TA 4DSQA 2PU9C 3IR4A 3FW2A 1VF1A 2NBSA 2VO4A 3ZFBA 3VURA 1XWGA 2V32A 3ISOA 6GSYA 5HR1A 1BJXA 5A4VA 1A0RP 3BCKA 4MPGA 1SYXA 4G19A 2C3NA 3A3TA 2ON7A 2GDRA 1GSUA 1F3BA 3FMWA 3N5OA 4K7IA 1GUHA 1ZYPA 3F4TA 4O5QA 1DE2A 1OC9A 1YF1A 1M99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 9GSS A;  1SKW B;  1H75 A;  2IJY A;  3VWV A;  2VM1 A;  2GQM A;  5DVB A;  4O32 A;  1ERV A;  3DEX A;  3C1R A;  3EE2 A;  3PGT A;  5CYY A;  4HEA 2;  1A2M A;  3UVH A;  1K0O A;  4N11 A;  4XCS A;  3M3M A;  3IC4 A;  4ZB8 A;  5D9W A;  4V2L A;  1A8Y A;  3LYK A;  16GS A;  1THO A;  4HS1 A;  22GS A;  1XOA A;  3GKX A;  1OC8 A;  4V1A p;  2EIQ A;  4V1A g;  3HXS A;  3EWL A;  1BX9 A;  1QFN A;  1PGT A;  4EUY A;  3RPN A;  2R3X A;  5AIS A;  4TR1 B;  3F9U A;  1H4O A;  4KCE A;  1M2B A;  1MEK A;  3PR8 A;  2WS2 A;  2VIM A;  1K0B A;  2RM6 A;  3MWH A;  2AHE A;  3D0Z A;  1PX6 A;  4TR0 A;  3M9K A;  5ECM B;  3ZIT A;  1QK8 A;  2H1A A;  3P2A A;  2YN1 A;  4PNF A;  5IMV A;  3GH6 A;  1SD8 A;  3KXO A;  1Y6E A;  4IP6 A;  4Q5R A;  4NHZ A;  2O85 A;  4ZB6 A;  2GT5 A;  5F8B A;  3WT1 A;  3EYT A;  1XPV A;  3M0F A;  3FR6 A;  1XWK A;  1B48 A;  3LQ7 A;  5GZZ B;  3S9F A;  1J0F A;  4MK3 A;  2WRT A;  4IVF A;  5ECQ B;  4ZXG A;  4HUA A;  2LTK A;  1X9M B;  4N0Z A;  3BD2 A;  5D93 A;  2QSI A;  4KSM A;  4MJE A;  1XVW A;  4MP4 A;  11GS A;  2H6Z A;  2JZS A;  1M0U A;  5HFK A;  2B5E A;  4IQ1 A;  2DIY A;  3RDW A;  2B7J A;  5LD0 A;  3DYR A;  5CRH A;  3I6A A;  3W6G A;  4BVY A;  1R7H A;  1AUC A;  4IQA A;  4ILF A;  5KEJ A;  3HZ8 A;  4XS4 A;  4TXV A;  3A5W A;  1AIU A;  3G9B A;  4ZIJ A;  3GV1 A;  3HY2 A;  4JBB A;  4MH3 A;  1TK8 B;  5HR3 A;  1O8X A;  4AJ7 A;  2GQL A;  3F0I A;  2AB6 A;  1G6W A;  4F03 A;  2DIZ A;  5DAK B;  1DBY A;  2VL3 A;  2H6X A;  5H5R A;  3GA4 A;  2N5F A;  2CZ2 A;  3BJ5 A;  3H79 A;  5ELG A;  5ECL B;  2FCH A;  1ML6 A;  2LRT A;  3GX8 A;  1XW5 A;  5DAL B;  4IJ3 A;  1X5E A;  4KW6 A;  4HU7 A;  1K0C A;  2WB9 A;  4X43 A;  4WXT A;  3APS A;  3QR6 A;  3H93 A;  3F4R A;  1GNE A;  2AV4 A;  3IPZ A;  4EO3 A;  3TGZ A;  3DD3 A;  2H30 A;  2M46 A;  2QKE A;  3LWA A;  2LRC A;  2GSQ A;  2OBI A;  2PPT A;  3HHV A;  1OKD A;  4I2U A;  4CW9 A;  3FZ4 A;  4HOJ A;  4LMV A;  1V9W A;  3HCZ A;  4IKH A;  3LYP A;  1TRW A;  3KZQ A;  1PSQ A;  3DKS A;  4GTU A;  1W4V A;  3H4K A;  3TDG A;  5KN0 A;  1YEP A;  3ZML A;  4F0B A;  1EOG A;  4MZW A;  5FHI A;  1PKZ A;  2TRX A;  5IMD A;  5HFG A;  1ZMA A;  3CSI A;  2RII A;  2WFC A;  1TI1 A;  4AF2 A;  3DWV A;  1VF2 A;  1AQV A;  4TR1 A;  5A4U A;  4POM A;  7GSS A;  4GF0 A;  3GSS A;  1I9D A;  2FA8 A;  3F6F A;  1N8J A;  2I4A A;  2PN8 A;  5DCG A;  3TJJ A;  4GXZ A;  3FR9 A;  5CRE A;  3SWL A;  2ZUP A;  1T8E B;  1MDJ A;  1R4W A;  1NW2 A;  1WOU A;  4I8B A;  5ECH B;  2CAI A;  3LG6 A;  4K7O A;  4OCE A;  4JRR A;  5DQY A;  3GL3 A;  2YAN A;  1GTB A;  2LNT A;  4PNG A;  5B6M A;  3TJF A;  3H1N A;  3QOU A;  2H8L A;  4MDC A;  1JZW A;  5G5E A;  3GX0 A;  4PUR A;  5COH A;  4HU9 A;  4ZL9 A;  1MD3 A;  2VAF A;  2R37 A;  2B3S A;  4MAB A;  1V40 A;  4PQI A;  3Q74 A;  5GAN D;  1JZO A;  2EC4 A;  3L78 A;  1Z6N A;  2OA7 A;  4IS0 A;  1PQN A;  2MMN A;  1XFL A;  3D4T A;  2HYX A;  4TW5 A;  1HYU A;  2FD3 A;  3KMO A;  3QCP A;  1C72 A;  4I5Q A;  5JWQ B;  2V41 A;  3ZLP A;  2B1K A;  1NSW A;  4I6X A;  6GST A;  5J41 A;  2VL2 C;  2VCX A;  1O6J A;  1XIY A;  1GSE A;  3L9S A;  3E3E A;  3MSZ A;  19GS A;  4XS1 A;  1UVZ A;  4ZBD A;  5ELA A;  1K3O A;  2H1B A;  5JCW A;  1ZOF A;  2H73 A;  2M80 A;  4J2F A;  2MBS A;  2WZ9 A;  3IAM 2;  2LUS A;  1ON4 A;  3C7M A;  1SEN A;  4EXJ A;  3ZIV A;  3HVX A;  3CXG A;  2H66 A;  2CA8 A;  5DAK A;  1GSF A;  3R2Q A;  3HVV A;  5D9V A;  3TKQ A;  5CNW A;  3RPP A;  1UC7 A;  2K8S A;  3D6I A;  5DAL A;  1SK2 A;  2PWJ A;  1BED A;  2H19 A;  2AJQ B;  4WEY A;  1O8W A;  2CZ3 A;  1AC1 A;  5D8I A;  4KND A;  3ZVJ A;  1TRV A;  2HFD A;  3LXZ A;  3KTB A;  2JZT A;  4PUF C;  1HNC A;  3EIN A;  2NVL A;  1FB0 A;  3WT2 A;  3RBT A;  3DRN A;  4HJ2 A;  1K0N A;  1X9W B;  4HI7 A;  4OMV A;  3CYN A;  1TJD A;  1VGL A;  1XW9 A;  2IN3 A;  2E7P A;  2L57 A;  2GZZ A;  3TKR A;  3U5R E;  5B8B A;  3IA1 A;  1YY7 A;  2IMI A;  5CRG A;  1A2L A;  3KGK A;  3C8E A;  4IP1 A;  5ECI B;  1GWC A;  3O76 A;  2DSA A;  2VCQ A;  4OCF A;  4PGT A;  3VFI A;  3DIE A;  1ERU A;  4HQZ A;  1GUM A;  3NZN A;  3GL5 A;  3UBL A;  1JLV A;  4MH2 A;  1CQH A;  1RQM A;  4POB A;  4TXO B;  4WR5 A;  1GUK A;  3MNG A;  4GQC A;  3CSJ A;  3F3R A;  4KCA A;  3I43 A;  2O7K A;  3Q18 A;  1WIK A;  2I1U A;  3BOA A;  4YAV A;  3QAG A;  1EEJ A;  2E0Q A;  1MTC A;  4XS6 A;  4WBJ A;  3FZ9 A;  2P5R A;  2VL2 A;  4GCI A;  3FK8 A;  3UVT A;  2L4C A;  3GRX A;  1N2A A;  2VOC A;  2JZR A;  1XZO A;  1O81 A;  3E9J B;  2MMZ A;  2LST A;  3ZYW A;  1WPI A;  1PL1 A;  2AUV A;  1B9X C;  4L0U A;  6GSX A;  1Z5Y E;  4ZB9 A;  3QAV A;  2C0G A;  3ME7 A;  4BA7 A;  3CRT A;  1V58 A;  4J56 E;  1FOV A;  4QL7 A;  2IME A;  1OYJ A;  1RW1 A;  5EVO A;  3L9U A;  3KIJ A;  1TW9 A;  5F07 A;  3TB2 A;  4N0V A;  2IMD A;  4RI7 A;  1Q98 A;  3IV4 A;  4TR3 A;  4WR4 A;  3QPM A;  4GST A;  2DJ1 A;  3SBC A;  2HXK A;  2BMX A;  4KUN A;  2X8C A;  1URM A;  2DML A;  2VCW A;  2WCI A;  3FEU A;  2VL9 A;  2HSY A;  4NAX A;  4ISD A;  1OKT A;  1V98 A;  2H72 A;  4EKZ A;  3KCM A;  4G2E A;  2X99 A;  1DE1 A;  5CP1 A;  1R5A A;  1AQW A;  5DJM A;  1AAZ A;  4XRD A;  5ID2 A;  5F05 A;  5JCU A;  5C04 A;  4L8E A;  4G10 A;  3CBU A;  2G2Q A;  4LL1 B;  2J23 A;  1T1V A;  2CVB A;  4IEL A;  1O7U A;  1J08 A;  2CVK A;  3EUR A;  2B6M A;  2JAC A;  5EPF A;  3P7X A;  4EC0 A;  5HR2 A;  3C1S A;  2VLV A;  3ED3 A;  3OR5 A;  5IMA A;  3PIN A;  2DMM A;  5DDL A;  2NTO A;  2NPB A;  3GTU B;  3QFB C;  1HNB A;  1PKW A;  5H5Q A;  4O92 A;  1JZR A;  2MZC A;  1KNG A;  2KHP A;  2VD0 A;  3EU3 A;  1K0A A;  2VLU A;  2MYG A;  3KD0 A;  2LS5 A;  2HE3 A;  2OJL A;  1J9B A;  4PUA A;  2HRF A;  1B9Y C;  1X5D A;  1QXH A;  3GHA A;  2DLX A;  1EWX A;  2LRN A;  3IRA A;  4J57 E;  3GNJ A;  3Q6O A;  2FA4 A;  1FB6 A;  1AQX A;  3FY7 A;  5KN3 A;  1XXU A;  3F6D A;  4OFN A;  2H1G A;  3FHK A;  4OFM A;  2DJ0 A;  1EOH A;  2J9H A;  1CQG A;  4L0W A;  1PN9 A;  2H0G A;  3V1W A;  2WUL A;  2FWF A;  2C8U A;  2GS3 A;  3KH9 A;  4NV2 A;  5B7C A;  2C3Q A;  1V2A A;  1EZK A;  1NM3 A;  5ENU A;  4XHM A;  4TXO A;  4K6X A;  3APO A;  2D2Z A;  4X0X A;  3O6T A;  1SKR B;  4OO5 A;  2HT9 A;  2RUF A;  3F63 A;  1A8L A;  2LJA A;  2P5Q A;  1PRX A;  1O73 A;  2C0D A;  2MMA A;  2FNO A;  2GSR A;  2IMF A;  3DGQ A;  1M2A A;  2DBC A;  4ZBA A;  5G1K A;  2KP1 A;  1GSS A;  1YEX A;  2I3Y A;  5LNK e;  1ZYQ B;  1VRS D;  2YWM A;  1DSB A;  4Q5F A;  4KH7 A;  2A2R A;  2LNS A;  4LL4 B;  3M9J A;  2CQ9 A;  3GUR A;  3TJK A;  3TOT A;  4ECI A;  1JFU A;  4MJB A;  2RLI A;  1YF0 A;  4O5R A;  2ON5 A;  13GS A;  4KA0 A;  3ERW A;  3GUS A;  5JCG A;  1SJZ A;  1B8X A;  1BQ7 A;  2H1D A;  1F9M A;  2K9F A;  3D21 A;  3WGX A;  4F82 A;  3TCO A;  1UA5 A;  2C0F A;  3EMP A;  1K0M A;  1U87 A;  1A0F A;  4N10 A;  4F0C A;  5H5S A;  4TVE A;  2YP6 A;  3UAR A;  4LA1 A;  4NXI A;  1GTA A;  1A2J A;  3L9V A;  1R26 A;  2H6Y A;  2YCD A;  2H01 A;  3TKP A;  2L5O A;  2XBQ A;  3VLN A;  1F37 A;  4DVC A;  5IOX A;  4ML6 A;  4BPY A;  3PH9 A;  4ZL8 A;  5KN2 A;  3KJY A;  1T3B A;  3ZIJ A;  1GRX A;  6GSV A;  1DUG A;  2GST A;  1XWA A;  3CTF A;  3F8U A;  2C4J A;  3BCI A;  4XTS A;  4AJ6 A;  1NHY A;  3JCM L;  1FVJ A;  2XPE A;  4FIW A;  4ZIL A;  4IW9 A;  3WGE A;  1M9A A;  4JED A;  3DVW A;  3VWW A;  4NMU A;  1FW1 A;  4MA9 A;  4CHS A;  2JL4 A;  5IQY A;  3FYG A;  1OC3 A;  1ABA A;  2C80 A;  1YDK A;  17GS A;  1GP1 A;  3GTU A;  2DJK A;  1TK0 B;  5G5F A;  5E4W A;  1BG5 A;  1ZL9 A;  1Z7R A;  2YWN A;  2V6K A;  3L4N A;  4DSR A;  3ZRE A;  2XHF A;  1K3Y A;  5CRD A;  3CRU A;  2O87 A;  4FYC A;  4JU5 A;  3US3 A;  3ERF A;  3TOU A;  3KEB A;  1YKC A;  3LEF A;  3KTL A;  2O89 A;  3DML A;  3FZ5 A;  2PGT A;  4BL7 A;  3TKS C;  3FZA A;  2WDU A;  2YWI A;  1MD4 A;  5EY6 A;  4YH2 A;  2DC5 A;  1IYI A;  2KUC A;  1OE7 A;  1F2E A;  4MJC A;  4K8M A;  4PQH A;  1WE0 A;  2A2S A;  2HNL A;  1X9S B;  4V2N A;  3KP9 A;  4X1U A;  1ERT A;  1SJI A;  4YQU A;  2YNX A;  2N5A A;  5ID2 B;  3WGD A;  1OAZ A;  2I81 A;  2GLR A;  4JZQ A;  5GSS A;  5ECS A;  1XVQ A;  3VWX A;  4CDO A;  2FGX A;  2GT6 A;  1EGR A;  2IMK A;  2YZU A;  4XIH A;  1SL0 B;  2H75 A;  2L6D A;  4OD7 A;  1TP9 A;  4FYU A;  5JWO B;  1WMJ A;  2GQK A;  5DBQ A;  4JR4 A;  5AGY A;  5ABR A;  1S3C A;  5A4W A;  1M2D A;  2PUK C;  1XOB A;  3UJ1 A;  2LV3 A;  4OFT A;  1GSY A;  5ECN B;  2IL3 A;  4NWY A;  3FR3 A;  1ERW A;  3J7Y k;  2YOI A;  2YWO A;  2B7K A;  1OVN A;  4K2D A;  1JHB A;  4Q5N A;  2REM A;  4AJ8 A;  1EV9 A;  4WET A;  4K1F A;  2BTO T;  3A2W A;  2XC2 A;  4EE0 A;  5C00 A;  2OBK A;  2H0H A;  4WF4 A;  3HVS A;  3W8J A;  4K0G A;  4K9Z A;  4HJM A;  5D9X A;  2YZH A;  3FRC A;  4G9H A;  1LU4 A;  3LFL A;  5D96 A;  4IN0 A;  1JZD A;  4KDU A;  2HRN A;  5FT3 A;  1HQO A;  1Z6M A;  3G7J A;  2P0G A;  4BVX A;  4L5O A;  2H70 A;  3CMI A;  2X8G A;  1G0T A;  2F3M A;  4BWQ A;  3UMA A;  4QQ7 A;  4ECB A;  3GH9 A;  5IMF A;  4LMW A;  2VCZ A;  3NOF A;  2CX3 A;  4MF7 A;  2PBJ A;  4MCU A;  3ZFL A;  3VPQ A;  2IWT A;  4OO4 A;  4RI6 A;  2B1L A;  3AY8 A;  3HA9 A;  1FVK A;  4EDY A;  3TKS A;  4EF0 A;  4YQM A;  3KM6 A;  2F9S A;  1YQ1 A;  3C73 A;  3ERG A;  1HD2 A;  5EL8 A;  4FH8 A;  1TTZ A;  5JWR B;  5IO2 A;  3H8Q A;  2PMT A;  1XBS A;  4MF6 A;  2OE3 A;  2X64 A;  1GH2 A;  1XCC A;  1O85 A;  5F06 A;  4WF5 A;  4EVM A;  1TU7 A;  2QC7 A;  4P3Y B;  3ZTL A;  4GSS A;  5KN1 A;  5DQS A;  3GMF A;  2N5B A;  1Z7P A;  1GSQ A;  1TOF A;  4HDE A;  1HNA A;  4N30 A;  1K0D A;  1EP7 A;  1TI3 A;  3TKS E;  1ST9 A;  3TJB A;  3A2X A;  2CX4 A;  4IBP A;  3VWU A;  5DCH A;  4GRF A;  1WWJ A;  1TXX A;  2E2M A;  1G7O A;  2OE1 A;  2L6C A;  1SK0 A;  4K7N A;  4TR4 A;  3WD6 A;  2LKU A;  2L5L A;  3GFK A;  3HJM A;  2A4V A;  1ZGN A;  4MZC A;  2XPD A;  1Q4J A;  4MLY A;  2YPM A;  4F2I A;  1GTI A;  2CVD A;  3L0H A;  4POL A;  4EL1 A;  2K8V A;  3EVI A;  1FHE A;  4PX1 A;  5E59 A;  3IBH A;  1QGV A;  4E8E A;  4ECJ A;  1S3D A;  3MAK A;  2YJ7 A;  4FYB A;  4RQX A;  3GKN A;  2MBT A;  2ZNM A;  4ZBB A;  2HZE B;  6GSU A;  1G6Y A;  1E6B A;  1B4Q A;  3RHC A;  3IAS 2;  1GLQ A;  3Q19 A;  2H0I A;  1XW6 A;  2VLT A;  4LLR A;  2IFQ A;  3ZVJ D;  4L5L A;  2OE0 A;  14GS A;  5G1L A;  4KAE A;  5AIV A;  1G7E A;  5IMZ A;  4ACS A;  3ZRD A;  5LCZ A;  2G0F A;  3G7I A;  3KP8 A;  1UN2 A;  2I9H A;  5ECR B;  3VI5 A;  4GSN A;  3UIW A;  2V2G A;  2CT6 A;  4NV5 A;  2CAQ A;  1RK4 A;  2BJX A;  3MDK A;  1SYR A;  2LQQ A;  1GSD A;  2IIY A;  1U3A A;  3FKF A;  4TRX A;  1TKD B;  1GTU A;  5HR0 A;  1F6M C;  1AXD A;  4DEJ A;  1QUW A;  3DXB A;  2FUG 2;  3GN3 A;  1QQ2 A;  3IXR A;  3E0U A;  2F8A A;  1EP8 A;  5J4U A;  3W8S A;  5IPH A;  3RAZ A;  3TRQ A;  3GYK A;  4O7H A;  3I69 A;  5F0G A;  2HLS A;  4ECC A;  4GQF A;  1X5C A;  5A5K A;  1WP0 A;  2V1M A;  2VUP A;  1V57 A;  1Z9H A;  2KOK A;  1KTE A;  1AW9 A;  4ZL7 A;  1LBK A;  2NDO A;  1TRS A;  2LQO A;  1ZYE A;  5D73 A;  1XWB A;  1TK5 B;  1E2Y A;  1B4P A;  1ZZY A;  1A23 A;  1M7T A;  2DJ3 A;  4HZ4 A;  4KGI A;  2YV9 A;  1SU9 A;  3D5J A;  2Z9S A;  2GVP A;  4IJI A;  6GSS A;  5INY A;  3IOS A;  4OWY A;  3LSZ A;  3KH7 A;  5J9B A;  2P31 A;  5CRW A;  3QD9 A;  5G30 A;  8GSS A;  2C0E A;  2V6O A;  2WJU A;  5CO3 A;  2HI7 A;  4D73 B;  2O8V B;  3G7Y A;  5G31 A;  3O3T A;  4WBR D;  1KBN A;  2YV7 A;  5AIX A;  1EEM A;  4Q5Q A;  3KMN A;  3HZ4 A;  1S3A A;  10GS A;  4DSS B;  3LGC A;  4ULX A;  5IO0 A;  1X0R A;  5IOW A;  5J9C A;  2OAC A;  2H76 A;  3QDN A;  2K6V A;  5CAX A;  2TIR A;  3ME8 A;  1PL2 A;  3BBY A;  2FLS A;  3EMX A;  4KDY A;  4TKY A;  1SJ6 A;  4WKW A;  1YZX A;  2DJJ A;  1T4Z A;  4YQV A;  3IK9 A;  2AYT A;  3IDV A;  5GAP D;  1EGO A;  3EU4 A;  2ES7 A;  1U3I A;  5J5N A;  1WRY A;  4MZB A;  6GSW A;  1GUL A;  3QMX A;  4I2T A;  3CTG A;  1T7P B;  2PVO C;  2FHE A;  2H74 A;  4MJA A;  20GS A;  1Z3E A;  3HDC A;  3N9J A;  2KLX A;  4E8H A;  1EV4 A;  2TRC P;  1W89 A;  3K8N A;  3GKK A;  1KEB A;  1T00 A;  3HKR A;  2HZE A;  4IHU A;  4NPB A;  1SD9 A;  5IPG A;  1PX7 A;  5IIZ A;  4MMM A;  1K3L A;  2GZY A;  1F3A A;  2IPA A;  2QGV A;  5FWG A;  4JR6 A;  1BAY A;  2C1Y A;  1PD2 1;  3I9V 2;  2AAW A;  3QFA C;  4HQS A;  4KSO A;  1A24 A;  2GTU A;  2L4Q A;  2F8F A;  4EDZ A;  1PMT A;  3DVX A;  1SL2 B;  1VF4 A;  1YKA A;  2EIO A;  3VK9 A;  3TRX A;  2E2G A;  5G2Z A;  3TJG A;  1VF3 A;  1GL8 A;  2LJR A;  2FWH A;  1MDI A;  2LEG A;  3ZZX A;  2FWG A;  3F4S A;  5ECK B;  1TRU A;  1NHO A;  2DJ2 A;  1U6T A;  2VCT A;  3GST A;  4HZ2 A;  3EC3 A;  3LJR A;  3GKM A;  1T4Y A;  2FY6 A;  5B6N A;  1OC9 B;  2VCV A;  5HQP A;  4RUV A;  1FAA A;  3ZL5 A;  4PXO A;  1OE8 A;  2GGT A;  2VD1 A;  3M8N A;  3A2V A;  2GSS A;  2R6K A;  2L59 A;  2JSZ A;  1USB A;  2JSY A;  1IYH A;  2B5X A;  4ML1 A;  2YJH A;  2VM2 A;  3TRP A;  4ID0 A;  4KDX A;  1GLP A;  5IM9 A;  3F3Q A;  3TUE A;  1M9B A;  1SK1 A;  1THX A;  2GZP A;  5HFI A;  2CV4 A;  1SL1 B;  3P8W A;  1SKS B;  2R5G A;  5B8A A;  1Y25 A;  1QMV A;  1FO5 A;  1U88 A;  2WGR A;  4NHW A;  2OAD A;  3VI7 A;  3HYP A;  3IHQ A;  3NIV A;  4F9Z A;  2IFQ B;  1JLW A;  1PA3 A;  2JAD A;  4MF5 A;  4QL9 A;  3IK7 A;  4D73 A;  4PQ1 A;  5D9T A;  4FO5 A;  3WYW A;  3QAW A;  2OKA A;  1ILO A;  4GWR A;  4Z7X A;  1GNW A;  3UOM A;  2RUE A;  3LOR A;  3RHB A;  3UEM A;  4BWS A;  4H86 A;  1FG4 A;  4I97 A;  1I5G A;  5IMC A;  12GS A;  4DSS A;  2PVQ A;  2EIR A;  5AN1 A;  3CSH A;  3UBK A;  3APQ A;  2M72 A;  4KE3 A;  3C71 A;  4AGS A;  2HZF A;  1ACV A;  5J3R A;  5L71 A;  4MPF A;  2X8H A;  3HJP A;  3D4M A;  5ECO B;  1WJK A;  2KP2 A;  5DJL A;  1BYE A;  4KX4 A;  2XBI A;  4KB3 A;  18GS A;  1LJR A;  4GLT A;  3J7Y b;  2MMO A;  4TOP A;  2R4V A;  3P90 A;  3D22 A;  3UAP A;  4XRA A;  2H71 A;  4YAP A;  3VPT A;  2FWE A;  4JE1 A;  3IE3 A;  2F51 A;  4TN8 A;  1YJ6 A;  2K18 A;  1TU8 A;  3HJO A;  2PER A;  3LXT A;  3M1G A;  4K0N A;  5GST A;  2R2J A;  1TDI A;  2RM5 A;  4V2M A;  4XS4 B;  1R5P A;  3HD5 A;  4POK A;  2JU5 A;  3U6V A;  1XWC A;  3ZMK A;  1ZCP A;  3UL3 A;  2ZCT A;  4IGJ A;  2LJK A;  2ALB A;  5ECP B;  2B5Y A;  2HSH A;  1MDK A;  4RQR A;  3GIX A;  2C3T A;  4DSQ A;  2PU9 C;  3IR4 A;  3FW2 A;  1VF1 A;  2NBS A;  2VO4 A;  3ZFB A;  3VUR A;  1XWG A;  2V32 A;  3ISO A;  6GSY A;  5HR1 A;  1BJX A;  5A4V A;  1A0R P;  3BCK A;  4MPG A;  1SYX A;  4G19 A;  2C3N A;  3A3T A;  2ON7 A;  2GDR A;  1GSU A;  1F3B A;  3N5O A;  4K7I A;  1GUH A;  3F4T A;  1DE2 A;  1OC9 A;  1YF1 A;  1M99 A; 
#chains in the Genus database with same CATH topology
 9GSS A;  1SKW B;  1H75 A;  2IJY A;  3VWV A;  2VM1 A;  2GQM A;  5DVB A;  4O32 A;  1ERV A;  3DEX A;  3C1R A;  3EE2 A;  3PGT A;  5CYY A;  4HEA 2;  1A2M A;  3UVH A;  1K0O A;  4G0K A;  4N11 A;  2A2P A;  4XCS A;  3M3M A;  3IC4 A;  4ZB8 A;  5D9W A;  4V2L A;  1A8Y A;  3LYK A;  16GS A;  1THO A;  4HS1 A;  22GS A;  1XOA A;  3GKX A;  1OC8 A;  4V1A p;  2EIQ A;  4V1A g;  3HXS A;  3EWL A;  1BX9 A;  1QFN A;  1PGT A;  4EUY A;  3RPN A;  2R3X A;  5AIS A;  4TR1 B;  3F9U A;  1H4O A;  4KCE A;  1M2B A;  1MEK A;  3PR8 A;  2WS2 A;  2VIM A;  1K0B A;  2RM6 A;  3MWH A;  2AHE A;  3D0Z A;  1PX6 A;  4TR0 A;  3M9K A;  5ECM B;  3ZIT A;  1QK8 A;  2H1A A;  3P2A A;  2YN1 A;  4PNF A;  5IMV A;  5BRT A;  3GH6 A;  1SD8 A;  3KXO A;  1Y6E A;  4IP6 A;  4Q5R A;  4NHZ A;  2R0P A;  2O85 A;  4ZB6 A;  2GT5 A;  5F8B A;  3WT1 A;  3EYT A;  1XPV A;  3M0F A;  3FR6 A;  1XWK A;  1B48 A;  3LQ7 A;  4X4J A;  5GZZ B;  3S9F A;  1J0F A;  4MK3 A;  2WRT A;  4IVF A;  5ECQ B;  4ZXG A;  4HUA A;  2LTK A;  1X9M B;  4N0Z A;  3BD2 A;  5D93 A;  2QSI A;  4KSM A;  4MJE A;  1XVW A;  4MP4 A;  11GS A;  2H6Z A;  2JZS A;  1M0U A;  5HFK A;  2B5E A;  4IQ1 A;  2DIY A;  3RDW A;  2B7J A;  5LD0 A;  3DYR A;  5CRH A;  3I6A A;  3W6G A;  4BVY A;  1R7H A;  1AUC A;  4IQA A;  4ILF A;  5KEJ A;  3HZ8 A;  4XS4 A;  4TXV A;  3A5W A;  1AIU A;  3G9B A;  4ZIJ A;  3GV1 A;  3IC8 A;  3HY2 A;  4JBB A;  4MH3 A;  1TK8 B;  5HR3 A;  1O8X A;  4AJ7 A;  2GQL A;  3F0I A;  2AB6 A;  1G6W A;  4F03 A;  2DIZ A;  5DAK B;  1DBY A;  2VL3 A;  2H6X A;  5H5R A;  3GA4 A;  2N5F A;  2CZ2 A;  3HVN A;  3BJ5 A;  3H79 A;  5ELG A;  5ECL B;  2FCH A;  1ML6 A;  2LRT A;  3GX8 A;  1XW5 A;  5DAL B;  4IJ3 A;  1X5E A;  4KW6 A;  4HU7 A;  1K0C A;  2QA1 A;  2WB9 A;  4X43 A;  4WXT A;  3APS A;  3QR6 A;  3H93 A;  3F4R A;  1GNE A;  2AV4 A;  3IPZ A;  4EO3 A;  3TGZ A;  3DD3 A;  2H30 A;  2M46 A;  2QKE A;  3LWA A;  2LRC A;  2GSQ A;  2OBI A;  2PPT A;  3HHV A;  1OKD A;  4I2U A;  4CW9 A;  3FZ4 A;  4HOJ A;  4LMV A;  1V9W A;  3HCZ A;  4IKH A;  3LYP A;  1TRW A;  3KZQ A;  1PSQ A;  3DKS A;  4GTU A;  1W4V A;  3H4K A;  3TDG A;  5KN0 A;  1YEP A;  3ZML A;  4F0B A;  1EOG A;  4MZW A;  5FHI A;  1PKZ A;  2TRX A;  5IMD A;  5HFG A;  1ZMA A;  3CSI A;  2RII A;  2WFC A;  1TI1 A;  4AF2 A;  3DWV A;  1VF2 A;  1AQV A;  4TR1 A;  5A4U A;  4POM A;  7GSS A;  4GF0 A;  3GSS A;  1I9D A;  2FA8 A;  4CY6 A;  3F6F A;  1N8J A;  2I4A A;  2PN8 A;  5DCG A;  3TJJ A;  4GXZ A;  3FR9 A;  5CRE A;  3SWL A;  2ZUP A;  1T8E B;  1MDJ A;  1R4W A;  1WOU A;  1NW2 A;  4I8B A;  5ECH B;  2CAI A;  3LG6 A;  4K7O A;  4OCE A;  4JRR A;  5DQY A;  3GL3 A;  2YAN A;  1GTB A;  2LNT A;  4PNG A;  5B6M A;  3TJF A;  3H1N A;  3QOU A;  2H8L A;  4MDC A;  1JZW A;  5G5E A;  3GX0 A;  4PUR A;  5COH A;  4HU9 A;  4ZL9 A;  1MD3 A;  2VAF A;  2R37 A;  2B3S A;  4MAB A;  1V40 A;  4PQI A;  3Q74 A;  5GAN D;  1JZO A;  2EC4 A;  3MIX A;  4K2X A;  3L78 A;  1Z6N A;  2OA7 A;  4IS0 A;  1PQN A;  2MMN A;  1XFL A;  3D4T A;  2HYX A;  4TW5 A;  1HYU A;  2FD3 A;  3KMO A;  3QCP A;  1C72 A;  4I5Q A;  5JWQ B;  2V41 A;  3ZLP A;  2B1K A;  1NSW A;  4I6X A;  6GST A;  5J41 A;  2VL2 C;  4HSC X;  2VCX A;  1O6J A;  1XIY A;  1GSE A;  3L9S A;  3E3E A;  3MSZ A;  19GS A;  4XS1 A;  1UVZ A;  4ZBD A;  1XG8 A;  5ELA A;  1K3O A;  2H1B A;  5JCW A;  1ZOF A;  2H73 A;  2M80 A;  4J2F A;  2MBS A;  2WZ9 A;  3IAM 2;  2LUS A;  1ON4 A;  3C7M A;  1SEN A;  4EXJ A;  3ZIV A;  3HVX A;  3CXG A;  1PN0 A;  2H66 A;  2CA8 A;  5DAK A;  1GSF A;  3R2Q A;  3HVV A;  5D9V A;  3TKQ A;  5CNW A;  3RPP A;  1UC7 A;  2K8S A;  3D6I A;  5DAL A;  1SK2 A;  2PWJ A;  3R3E A;  1BED A;  2H19 A;  2AJQ B;  4WEY A;  1O8W A;  2CZ3 A;  1AC1 A;  5D8I A;  4KND A;  3ZVJ A;  1TRV A;  4YKF A;  2HFD A;  3LXZ A;  3KTB A;  2JZT A;  4PUF C;  1HNC A;  3EIN A;  2NVL A;  1FB0 A;  3WT2 A;  3RBT A;  3DRN A;  4HJ2 A;  1K0N A;  1X9W B;  4HI7 A;  4OMV A;  3CYN A;  1TJD A;  1VGL A;  1XW9 A;  2IN3 A;  2E7P A;  2L57 A;  2GZZ A;  3TKR A;  3U5R E;  5B8B A;  3IA1 A;  1YY7 A;  2IMI A;  5CRG A;  1A2L A;  3KGK A;  4MNN A;  3C8E A;  4IP1 A;  5ECI B;  1GWC A;  3O76 A;  2DSA A;  4BVY B;  2VCQ A;  4OCF A;  4PGT A;  3EPT A;  3VFI A;  3DIE A;  1ERU A;  4HQZ A;  1GUM A;  3NZN A;  3GL5 A;  3UBL A;  1JLV A;  4MH2 A;  1CQH A;  1RQM A;  4POB A;  4TXO B;  4WR5 A;  1GUK A;  3MNG A;  4GQC A;  3CSJ A;  3F3R A;  4KCA A;  3I43 A;  2O7K A;  3Q18 A;  1WIK A;  2I1U A;  3BOA A;  4YAV A;  3QAG A;  1EEJ A;  2E0Q A;  1MTC A;  4XS6 A;  4WBJ A;  3FZ9 A;  2P5R A;  2VL2 A;  4GCI A;  3FK8 A;  3UVT A;  2L4C A;  3GRX A;  1N2A A;  2VOC A;  2JZR A;  1XZO A;  1O81 A;  3E9J B;  2MMZ A;  2LST A;  3ZYW A;  1WPI A;  1PL1 A;  2AUV A;  1B9X C;  4L0U A;  6GSX A;  1Z5Y E;  4ZB9 A;  3QAV A;  2C0G A;  3ME7 A;  1FOH A;  4BA7 A;  3CRT A;  1V58 A;  4J56 E;  1FOV A;  4QL7 A;  2IME A;  1OYJ A;  1RW1 A;  5EVO A;  3L9U A;  3KIJ A;  1TW9 A;  5F07 A;  3TB2 A;  4N0V A;  2IMD A;  4RI7 A;  1Q98 A;  3IV4 A;  4TR3 A;  4WR4 A;  3QPM A;  4GST A;  2DJ1 A;  3SBC A;  2HXK A;  2BMX A;  4KUN A;  2X8C A;  1URM A;  2DML A;  2VCW A;  2WCI A;  3FEU A;  2VL9 A;  2HSY A;  4NAX A;  4ISD A;  1OKT A;  1V98 A;  2H72 A;  4EKZ A;  3KCM A;  4G2E A;  2X99 A;  1DE1 A;  5CP1 A;  4A5P A;  1R5A A;  4Z2R A;  1AQW A;  5DJM A;  1AAZ A;  4XRD A;  4Z2U A;  5ID2 A;  5F05 A;  5JCU A;  5C04 A;  4L8E A;  4G10 A;  3CBU A;  2G2Q A;  4LL1 B;  2J23 A;  1T1V A;  2CVB A;  4IEL A;  1O7U A;  1J08 A;  2CVK A;  3EUR A;  2B6M A;  2JAC A;  3MYD A;  5EPF A;  3P7X A;  4EC0 A;  5HR2 A;  3C1S A;  2VLV A;  3ED3 A;  3OR5 A;  5IMA A;  3PIN A;  2DMM A;  5DDL A;  2NTO A;  2R0G A;  2NPB A;  3GTU B;  3QFB C;  1HNB A;  1PKW A;  5H5Q A;  4O92 A;  1JZR A;  2MZC A;  1KNG A;  2KHP A;  2VD0 A;  3EU3 A;  1K0A A;  2VLU A;  2MYG A;  3KD0 A;  2LS5 A;  2HE3 A;  2OJL A;  1J9B A;  4PUA A;  2HRF A;  1B9Y C;  1X5D A;  1QXH A;  3GHA A;  2DLX A;  1EWX A;  2LRN A;  3IRA A;  4J57 E;  4BL7 B;  3GNJ A;  3Q6O A;  2FA4 A;  1FB6 A;  1AQX A;  3FY7 A;  4G0I A;  5KN3 A;  1XXU A;  3F6D A;  4OFN A;  2H1G A;  3FHK A;  4OFM A;  2DJ0 A;  1EOH A;  2J9H A;  1CQG A;  4L0W A;  1PN9 A;  2H0G A;  3V1W A;  2WUL A;  2FWF A;  2C8U A;  2GS3 A;  3KH9 A;  4NV2 A;  5B7C A;  2C3Q A;  1V2A A;  1EZK A;  4BIK A;  1NM3 A;  5ENU A;  4XHM A;  2HRA A;  4TXO A;  4K6X A;  3APO A;  2D2Z A;  4X0X A;  3O6T A;  1SKR B;  4EIQ A;  4OO5 A;  2HT9 A;  2RUF A;  3F63 A;  1A8L A;  2LJA A;  2P5Q A;  1PRX A;  1O73 A;  2C0D A;  2MMA A;  2FNO A;  2GSR A;  2IMF A;  3DGQ A;  1M2A A;  2DBC A;  4ZBA A;  5G1K A;  2KP1 A;  1GSS A;  1PFO A;  1YEX A;  2I3Y A;  4Z2T A;  5KOX A;  5LNK e;  1ZYQ B;  1VRS D;  2YWM A;  1DSB A;  4Q5F A;  4KH7 A;  2A2R A;  2LNS A;  4LL4 B;  3M9J A;  2CQ9 A;  3GUR A;  3TJK A;  3TOT A;  4ECI A;  1JFU A;  4MJB A;  2RLI A;  1YF0 A;  4O5R A;  2ON5 A;  13GS A;  4KA0 A;  3ERW A;  3GUS A;  5JCG A;  2HRK A;  1SJZ A;  1B8X A;  4O5U A;  1BQ7 A;  2H1D A;  1F9M A;  2K9F A;  3D21 A;  3WGX A;  4F82 A;  3TCO A;  1UA5 A;  2C0F A;  3EMP A;  1K0M A;  1U87 A;  1A0F A;  4N10 A;  4F0C A;  5H5S A;  4TVE A;  2YP6 A;  3UAR A;  4LA1 A;  4NXI A;  1GTA A;  1A2J A;  3L9V A;  1R26 A;  2H6Y A;  2YCD A;  2H01 A;  3TKP A;  2L5O A;  2XBQ A;  3VLN A;  1F37 A;  4DVC A;  5IOX A;  4ML6 A;  4BPY A;  1S3R A;  3PH9 A;  4ZL8 A;  5KN2 A;  3KJY A;  1T3B A;  3ZIJ A;  1GRX A;  6GSV A;  1DUG A;  2GST A;  1XWA A;  3CTF A;  3F8U A;  2C4J A;  3BCI A;  4XTS A;  4AJ6 A;  1NHY A;  3JCM L;  1FVJ A;  2XPE A;  4FIW A;  4ZIL A;  4IW9 A;  3WGE A;  2DKH A;  1M9A A;  4JED A;  3DVW A;  3VWW A;  4NMU A;  1FW1 A;  4MA9 A;  4CHS A;  2JL4 A;  5IQY A;  3FYG A;  1OC3 A;  1ABA A;  2C80 A;  1YDK A;  17GS A;  1GP1 A;  3GTU A;  2DJK A;  1TK0 B;  5G5F A;  5E4W A;  1BG5 A;  1ZL9 A;  1Z7R A;  2YWN A;  2V6K A;  3L4N A;  4DSR A;  3ZRE A;  2XHF A;  1K3Y A;  5CRD A;  3CRU A;  2O87 A;  4FYC A;  4JU5 A;  3US3 A;  3ERF A;  3TOU A;  3KEB A;  1YKC A;  3LEF A;  3KTL A;  2O89 A;  3DML A;  3FZ5 A;  2PGT A;  4BL7 A;  3TKS C;  3FZA A;  2WDU A;  2YWI A;  1MD4 A;  5EY6 A;  4PTS A;  4YH2 A;  2DC5 A;  1IYI A;  2KUC A;  1OE7 A;  1F2E A;  4MJC A;  4K8M A;  4PQH A;  1WE0 A;  2A2S A;  2HNL A;  1X9S B;  4V2N A;  3KP9 A;  4X1U A;  1ERT A;  1SJI A;  4YQU A;  2YNX A;  2N5A A;  5ID2 B;  3WGD A;  1OAZ A;  4CY8 A;  2I81 A;  2GLR A;  4JZQ A;  5GSS A;  5ECS A;  1XVQ A;  3VWX A;  4CDO A;  2FGX A;  2GT6 A;  1EGR A;  2IMK A;  2YZU A;  4XIH A;  4K5R A;  1SL0 B;  2H75 A;  2L6D A;  4OD7 A;  1TP9 A;  4FYU A;  5JWO B;  1WMJ A;  2GQK A;  5DBQ A;  4JR4 A;  5AGY A;  4EIP A;  5ABR A;  1S3C A;  5A4W A;  1M2D A;  2PUK C;  1XOB A;  3UJ1 A;  2LV3 A;  4OFT A;  1GSY A;  5ECN B;  2IL3 A;  4NWY A;  2R0C A;  3FR3 A;  1ERW A;  3J7Y k;  2YOI A;  2YWO A;  2B7K A;  1OVN A;  4K2D A;  4YKG A;  1JHB A;  4Q5N A;  2REM A;  4AJ8 A;  1EV9 A;  4WET A;  4K1F A;  2BTO T;  3A2W A;  2XC2 A;  4EE0 A;  5C00 A;  2OBK A;  2H0H A;  4WF4 A;  3HVS A;  3W8J A;  4K0G A;  4K9Z A;  4HJM A;  5D9X A;  2YZH A;  3FRC A;  4G9H A;  1LU4 A;  3LFL A;  5D96 A;  4IN0 A;  1JZD A;  4KDU A;  2HRN A;  5FT3 A;  1HQO A;  1Z6M A;  3G7J A;  2P0G A;  4BVX A;  4L5O A;  2H70 A;  3CMI A;  2X8G A;  1G0T A;  2F3M A;  4BWQ A;  3UMA A;  4QQ7 A;  4USS A;  4ECB A;  3GH9 A;  5IMF A;  4LMW A;  2VCZ A;  3NOF A;  2CX3 A;  4MF7 A;  2PBJ A;  4MCU A;  3ZFL A;  3VPQ A;  2IWT A;  4OO4 A;  4RI6 A;  2B1L A;  3AY8 A;  3HA9 A;  1FVK A;  4EDY A;  3TKS A;  4EF0 A;  4YQM A;  3IHG A;  3KM6 A;  2F9S A;  1YQ1 A;  3C73 A;  3ERG A;  1HD2 A;  5EL8 A;  4G0L A;  4FH8 A;  1TTZ A;  5JWR B;  5IO2 A;  3H8Q A;  2PMT A;  1XBS A;  4MF6 A;  2OE3 A;  2X64 A;  2HSM A;  1GH2 A;  1XCC A;  1O85 A;  5F06 A;  4WF5 A;  4EVM A;  1TU7 A;  2QC7 A;  4P3Y B;  3ZTL A;  4GSS A;  5KN1 A;  3GMF A;  5DQS A;  2N5B A;  1Z7P A;  1GSQ A;  1TOF A;  4HDE A;  1HNA A;  4N30 A;  1K0D A;  1EP7 A;  1TI3 A;  3TKS E;  1ST9 A;  3TJB A;  3A2X A;  2CX4 A;  4IBP A;  3VWU A;  5DCH A;  4GRF A;  1WWJ A;  1TXX A;  2E2M A;  1G7O A;  2OE1 A;  2L6C A;  1SK0 A;  4K7N A;  4TR4 A;  3WD6 A;  2LKU A;  2L5L A;  3GFK A;  3HJM A;  2A4V A;  1ZGN A;  4MZC A;  2XPD A;  1Q4J A;  4MLY A;  2YPM A;  4F2I A;  1GTI A;  2CVD A;  3L0H A;  4POL A;  4EL1 A;  2K8V A;  3EVI A;  1FHE A;  4PX1 A;  5E59 A;  3IBH A;  1QGV A;  4E8E A;  4ICY A;  4ECJ A;  1S3D A;  3MAK A;  2YJ7 A;  4FYB A;  4KF9 A;  4RQX A;  3GKN A;  2MBT A;  2ZNM A;  4ZBB A;  2HZE B;  6GSU A;  1G6Y A;  1E6B A;  1B4Q A;  3RHC A;  3IAS 2;  1GLQ A;  3Q19 A;  2H0I A;  1XW6 A;  2VLT A;  4LLR A;  2IFQ A;  3ZVJ D;  4L5L A;  2OE0 A;  14GS A;  5G1L A;  4KAE A;  5AIV A;  1G7E A;  5IMZ A;  4ACS A;  3ZRD A;  5LCZ A;  2G0F A;  3G7I A;  3KP8 A;  1UN2 A;  2I9H A;  5ECR B;  3VI5 A;  4GSN A;  3UIW A;  2V2G A;  2CT6 A;  4NV5 A;  2CAQ A;  1RK4 A;  2BJX A;  1M3I A;  3MDK A;  1SYR A;  2LQQ A;  1GSD A;  2IIY A;  1U3A A;  3FKF A;  4TRX A;  1TKD B;  1GTU A;  5HR0 A;  1F6M C;  1AXD A;  4DEJ A;  1QUW A;  3DXB A;  2FUG 2;  3GN3 A;  1QQ2 A;  3IXR A;  3E0U A;  2F8A A;  1EP8 A;  5BMU A;  5J4U A;  3W8S A;  5IPH A;  3RAZ A;  3TRQ A;  3GYK A;  4O7H A;  3I69 A;  5F0G A;  4FQU A;  2HLS A;  4ECC A;  3PPU A;  4GQF A;  1X5C A;  5A5K A;  1WP0 A;  2V1M A;  2VUP A;  1V57 A;  1Z9H A;  2KOK A;  1KTE A;  1AW9 A;  4ZL7 A;  1LBK A;  2NDO A;  1TRS A;  2LQO A;  1ZYE A;  5D73 A;  1XWB A;  1TK5 B;  1E2Y A;  1B4P A;  1ZZY A;  1A23 A;  1M7T A;  2DJ3 A;  4HZ4 A;  4KGI A;  5KOW A;  2YV9 A;  1SU9 A;  3D5J A;  2Z9S A;  2GVP A;  4IJI A;  6GSS A;  5INY A;  3IOS A;  4OWY A;  3LSZ A;  3KH7 A;  5J9B A;  2P31 A;  5CRW A;  3QD9 A;  5G30 A;  8GSS A;  2C0E A;  2V6O A;  2WJU A;  5CO3 A;  2HI7 A;  4D73 B;  3A5I A;  2O8V B;  3G7Y A;  5G31 A;  3O3T A;  4WBR D;  1KBN A;  2YV7 A;  3CQF A;  5AIX A;  1EEM A;  4Q5Q A;  3KMN A;  2X49 A;  3HZ4 A;  1S3A A;  10GS A;  2X4A A;  4DSS B;  3LGC A;  4ULX A;  5IO0 A;  1X0R A;  5IOW A;  5J9C A;  2OAC A;  2H76 A;  3QDN A;  2K6V A;  5CAX A;  2TIR A;  3ME8 A;  1PL2 A;  3BBY A;  2FLS A;  3EMX A;  4KDY A;  4TKY A;  1SJ6 A;  4WKW A;  1YZX A;  2DJJ A;  1T4Z A;  4YQV A;  4K5S A;  3IK9 A;  2AYT A;  3IDV A;  5GAP D;  1EGO A;  3EU4 A;  2ES7 A;  1U3I A;  5J5N A;  1WRY A;  4MZB A;  6GSW A;  1GUL A;  3QMX A;  4I2T A;  3CTG A;  1T7P B;  2PVO C;  4BVX B;  2FHE A;  2H74 A;  4MJA A;  20GS A;  1Z3E A;  3HDC A;  3N9J A;  2KLX A;  4E8H A;  1EV4 A;  2TRC P;  1W89 A;  3K8N A;  3GKK A;  1KEB A;  1T00 A;  3HKR A;  2HZE A;  4IHU A;  4NPB A;  1SD9 A;  5IPG A;  1PX7 A;  5IIZ A;  4MMM A;  1K3L A;  2GZY A;  1F3A A;  2IPA A;  2QGV A;  5FWG A;  4JR6 A;  1BAY A;  2C1Y A;  1PD2 1;  3I9V 2;  2AAW A;  3QFA C;  4HQS A;  4KSO A;  1A24 A;  2GTU A;  2L4Q A;  2F8F A;  1M3J A;  4EDZ A;  3LW9 A;  1PMT A;  3DVX A;  1SL2 B;  1VF4 A;  1YKA A;  2EIO A;  3VK9 A;  3TRX A;  2E2G A;  5G2Z A;  3TJG A;  1VF3 A;  1GL8 A;  2LJR A;  2FWH A;  1MDI A;  2LEG A;  3ZZX A;  2FWG A;  3F4S A;  5ECK B;  1TRU A;  1NHO A;  2DJ2 A;  1U6T A;  2VCT A;  3GST A;  4HZ2 A;  3EC3 A;  3LJR A;  3GKM A;  1T4Y A;  2FY6 A;  5B6N A;  1OC9 B;  2VCV A;  5HQP A;  4RUV A;  1FAA A;  3ZL5 A;  4PXO A;  1OE8 A;  2GGT A;  2VD1 A;  3M8N A;  3A2V A;  2GSS A;  2R6K A;  2L59 A;  2JSZ A;  1USB A;  2JSY A;  1IYH A;  2B5X A;  4ML1 A;  2YJH A;  2VM2 A;  3TRP A;  4ID0 A;  4KDX A;  1GLP A;  5IM9 A;  3F3Q A;  3TUE A;  1M9B A;  1SK1 A;  1THX A;  2GZP A;  5HFI A;  2CV4 A;  1SL1 B;  3P8W A;  1SKS B;  2R5G A;  5B8A A;  1Y25 A;  1QMV A;  1FO5 A;  1U88 A;  2WGR A;  4NHW A;  2OAD A;  3VI7 A;  3HYP A;  3IHQ A;  3NIV A;  4F9Z A;  2IFQ B;  1JLW A;  1PA3 A;  2JAD A;  4MF5 A;  4QL9 A;  3IK7 A;  4D73 A;  4PQ1 A;  2A4H A;  5D9T A;  4FO5 A;  3WYW A;  3QAW A;  2OKA A;  1ILO A;  4GWR A;  4Z7X A;  1GNW A;  3UOM A;  2RUE A;  3LOR A;  3RHB A;  3UEM A;  4BWS A;  4H86 A;  1FG4 A;  4I97 A;  1I5G A;  5IMC A;  12GS A;  4DSS A;  2PVQ A;  2EIR A;  1ZYN A;  5AN1 A;  3CSH A;  3UBK A;  3APQ A;  2M72 A;  4KE3 A;  3C71 A;  4AGS A;  2HZF A;  1ACV A;  5J3R A;  5L71 A;  4MPF A;  2X8H A;  3HJP A;  3D4M A;  5ECO B;  1WJK A;  2KP2 A;  5DJL A;  1BYE A;  4KX4 A;  2XBI A;  4KB3 A;  18GS A;  1LJR A;  4GLT A;  3J7Y b;  2MMO A;  4TOP A;  2R4V A;  3P90 A;  3D22 A;  3UAP A;  4XRA A;  2H71 A;  4YAP A;  3VPT A;  2FWE A;  4JE1 A;  3IE3 A;  2F51 A;  2DKI A;  4TN8 A;  1YJ6 A;  2K18 A;  1TU8 A;  3HJO A;  2PER A;  3LXT A;  3M1G A;  4K0N A;  5GST A;  2R2J A;  1TDI A;  2RM5 A;  4V2M A;  4XS4 B;  1R5P A;  3HD5 A;  4POK A;  2JU5 A;  3U6V A;  1XWC A;  3ZMK A;  1ZCP A;  3UL3 A;  2ZCT A;  2QA2 A;  4IGJ A;  2LJK A;  2ALB A;  5ECP B;  2B5Y A;  2UZ8 A;  2HSH A;  1MDK A;  4RQR A;  3GIX A;  2C3T A;  4DSQ A;  2PU9 C;  3IR4 A;  3FW2 A;  1VF1 A;  2NBS A;  2VO4 A;  3ZFB A;  3VUR A;  1XWG A;  2V32 A;  3ISO A;  6GSY A;  5HR1 A;  1BJX A;  5A4V A;  1A0R P;  3BCK A;  4MPG A;  1SYX A;  4G19 A;  2C3N A;  3A3T A;  2ON7 A;  2GDR A;  1GSU A;  1F3B A;  3FMW A;  3N5O A;  4K7I A;  1GUH A;  1ZYP A;  3F4T A;  4O5Q A;  1DE2 A;  1OC9 A;  1YF1 A;  1M99 A; 
#chains in the Genus database with same CATH homology
 9GSS A;  1SKW B;  1H75 A;  2IJY A;  3VWV A;  2VM1 A;  2GQM A;  5DVB A;  4O32 A;  1ERV A;  3DEX A;  3C1R A;  3EE2 A;  3PGT A;  5CYY A;  4HEA 2;  1A2M A;  3UVH A;  1K0O A;  4G0K A;  4N11 A;  2A2P A;  4XCS A;  3M3M A;  3IC4 A;  4ZB8 A;  5D9W A;  4V2L A;  1A8Y A;  3LYK A;  16GS A;  1THO A;  4HS1 A;  22GS A;  1XOA A;  3GKX A;  1OC8 A;  4V1A p;  2EIQ A;  4V1A g;  3HXS A;  3EWL A;  1BX9 A;  1QFN A;  1PGT A;  4EUY A;  3RPN A;  2R3X A;  5AIS A;  4TR1 B;  3F9U A;  1H4O A;  4KCE A;  1M2B A;  1MEK A;  3PR8 A;  2WS2 A;  2VIM A;  1K0B A;  2RM6 A;  3MWH A;  2AHE A;  3D0Z A;  1PX6 A;  4TR0 A;  3M9K A;  5ECM B;  3ZIT A;  1QK8 A;  2H1A A;  3P2A A;  2YN1 A;  4PNF A;  5IMV A;  5BRT A;  3GH6 A;  1SD8 A;  3KXO A;  1Y6E A;  4IP6 A;  4Q5R A;  4NHZ A;  2R0P A;  2O85 A;  4ZB6 A;  2GT5 A;  5F8B A;  3WT1 A;  3EYT A;  1XPV A;  3M0F A;  3FR6 A;  1XWK A;  1B48 A;  3LQ7 A;  4X4J A;  5GZZ B;  3S9F A;  1J0F A;  4MK3 A;  2WRT A;  4IVF A;  5ECQ B;  4ZXG A;  4HUA A;  2LTK A;  1X9M B;  4N0Z A;  3BD2 A;  5D93 A;  2QSI A;  4KSM A;  4MJE A;  1XVW A;  4MP4 A;  11GS A;  2H6Z A;  2JZS A;  1M0U A;  5HFK A;  2B5E A;  4IQ1 A;  2DIY A;  3RDW A;  2B7J A;  5LD0 A;  3DYR A;  5CRH A;  3I6A A;  3W6G A;  4BVY A;  1R7H A;  1AUC A;  4IQA A;  4ILF A;  5KEJ A;  3HZ8 A;  4XS4 A;  4TXV A;  3A5W A;  1AIU A;  3G9B A;  4ZIJ A;  3GV1 A;  3IC8 A;  3HY2 A;  4JBB A;  4MH3 A;  1TK8 B;  5HR3 A;  1O8X A;  4AJ7 A;  2GQL A;  3F0I A;  2AB6 A;  1G6W A;  4F03 A;  2DIZ A;  5DAK B;  1DBY A;  2VL3 A;  2H6X A;  5H5R A;  3GA4 A;  2N5F A;  2CZ2 A;  3BJ5 A;  3H79 A;  5ELG A;  5ECL B;  2FCH A;  1ML6 A;  2LRT A;  3GX8 A;  1XW5 A;  5DAL B;  4IJ3 A;  1X5E A;  4KW6 A;  4HU7 A;  1K0C A;  2QA1 A;  2WB9 A;  4X43 A;  4WXT A;  3APS A;  3QR6 A;  3H93 A;  3F4R A;  1GNE A;  2AV4 A;  3IPZ A;  4EO3 A;  3TGZ A;  3DD3 A;  2H30 A;  2M46 A;  2QKE A;  3LWA A;  2LRC A;  2GSQ A;  2OBI A;  2PPT A;  3HHV A;  1OKD A;  4I2U A;  4CW9 A;  3FZ4 A;  4HOJ A;  4LMV A;  1V9W A;  3HCZ A;  4IKH A;  3LYP A;  1TRW A;  3KZQ A;  1PSQ A;  3DKS A;  4GTU A;  1W4V A;  3H4K A;  3TDG A;  5KN0 A;  1YEP A;  3ZML A;  4F0B A;  1EOG A;  4MZW A;  5FHI A;  1PKZ A;  2TRX A;  5IMD A;  5HFG A;  1ZMA A;  3CSI A;  2RII A;  2WFC A;  1TI1 A;  4AF2 A;  3DWV A;  1VF2 A;  1AQV A;  4TR1 A;  5A4U A;  4POM A;  7GSS A;  4GF0 A;  3GSS A;  1I9D A;  2FA8 A;  4CY6 A;  3F6F A;  1N8J A;  2I4A A;  2PN8 A;  5DCG A;  3TJJ A;  4GXZ A;  3FR9 A;  5CRE A;  3SWL A;  2ZUP A;  1T8E B;  1MDJ A;  1R4W A;  1WOU A;  1NW2 A;  4I8B A;  5ECH B;  2CAI A;  3LG6 A;  4K7O A;  4OCE A;  4JRR A;  5DQY A;  3GL3 A;  2YAN A;  1GTB A;  2LNT A;  4PNG A;  5B6M A;  3TJF A;  3H1N A;  3QOU A;  2H8L A;  4MDC A;  1JZW A;  5G5E A;  3GX0 A;  4PUR A;  5COH A;  4HU9 A;  4ZL9 A;  1MD3 A;  2VAF A;  2R37 A;  2B3S A;  4MAB A;  1V40 A;  4PQI A;  3Q74 A;  5GAN D;  1JZO A;  2EC4 A;  3MIX A;  4K2X A;  3L78 A;  1Z6N A;  2OA7 A;  4IS0 A;  1PQN A;  2MMN A;  1XFL A;  3D4T A;  2HYX A;  4TW5 A;  1HYU A;  2FD3 A;  3KMO A;  3QCP A;  1C72 A;  4I5Q A;  5JWQ B;  2V41 A;  3ZLP A;  2B1K A;  1NSW A;  4I6X A;  6GST A;  5J41 A;  2VL2 C;  2VCX A;  1O6J A;  1XIY A;  1GSE A;  3L9S A;  3E3E A;  3MSZ A;  19GS A;  4XS1 A;  1UVZ A;  4ZBD A;  5ELA A;  1K3O A;  2H1B A;  5JCW A;  1ZOF A;  2H73 A;  2M80 A;  4J2F A;  2MBS A;  2WZ9 A;  3IAM 2;  2LUS A;  1ON4 A;  3C7M A;  1SEN A;  4EXJ A;  3ZIV A;  3HVX A;  3CXG A;  1PN0 A;  2H66 A;  2CA8 A;  5DAK A;  1GSF A;  3R2Q A;  3HVV A;  5D9V A;  3TKQ A;  5CNW A;  3RPP A;  1UC7 A;  2K8S A;  3D6I A;  5DAL A;  1SK2 A;  2PWJ A;  3R3E A;  1BED A;  2H19 A;  2AJQ B;  4WEY A;  1O8W A;  2CZ3 A;  1AC1 A;  5D8I A;  4KND A;  3ZVJ A;  1TRV A;  4YKF A;  2HFD A;  3LXZ A;  3KTB A;  2JZT A;  4PUF C;  1HNC A;  3EIN A;  2NVL A;  1FB0 A;  3WT2 A;  3RBT A;  3DRN A;  4HJ2 A;  1K0N A;  1X9W B;  4HI7 A;  4OMV A;  3CYN A;  1TJD A;  1VGL A;  1XW9 A;  2IN3 A;  2E7P A;  2L57 A;  2GZZ A;  3TKR A;  3U5R E;  5B8B A;  3IA1 A;  1YY7 A;  2IMI A;  5CRG A;  1A2L A;  3KGK A;  4MNN A;  3C8E A;  4IP1 A;  5ECI B;  1GWC A;  3O76 A;  2DSA A;  4BVY B;  2VCQ A;  4OCF A;  4PGT A;  3EPT A;  3VFI A;  3DIE A;  1ERU A;  4HQZ A;  1GUM A;  3NZN A;  3GL5 A;  3UBL A;  1JLV A;  4MH2 A;  1CQH A;  1RQM A;  4POB A;  4TXO B;  4WR5 A;  1GUK A;  3MNG A;  4GQC A;  3CSJ A;  3F3R A;  4KCA A;  3I43 A;  2O7K A;  3Q18 A;  1WIK A;  2I1U A;  3BOA A;  4YAV A;  3QAG A;  1EEJ A;  2E0Q A;  1MTC A;  4XS6 A;  4WBJ A;  3FZ9 A;  2P5R A;  2VL2 A;  4GCI A;  3FK8 A;  3UVT A;  2L4C A;  3GRX A;  1N2A A;  2VOC A;  2JZR A;  1XZO A;  1O81 A;  3E9J B;  2MMZ A;  2LST A;  3ZYW A;  1WPI A;  1PL1 A;  2AUV A;  1B9X C;  4L0U A;  6GSX A;  1Z5Y E;  4ZB9 A;  3QAV A;  2C0G A;  3ME7 A;  1FOH A;  4BA7 A;  3CRT A;  1V58 A;  4J56 E;  1FOV A;  4QL7 A;  2IME A;  1OYJ A;  1RW1 A;  5EVO A;  3L9U A;  3KIJ A;  1TW9 A;  5F07 A;  3TB2 A;  4N0V A;  2IMD A;  4RI7 A;  1Q98 A;  3IV4 A;  4TR3 A;  4WR4 A;  3QPM A;  4GST A;  2DJ1 A;  3SBC A;  2HXK A;  2BMX A;  4KUN A;  2X8C A;  1URM A;  2DML A;  2VCW A;  2WCI A;  3FEU A;  2VL9 A;  2HSY A;  4NAX A;  4ISD A;  1OKT A;  1V98 A;  2H72 A;  4EKZ A;  3KCM A;  4G2E A;  2X99 A;  1DE1 A;  5CP1 A;  4A5P A;  1R5A A;  4Z2R A;  1AQW A;  5DJM A;  1AAZ A;  4XRD A;  4Z2U A;  5ID2 A;  5F05 A;  5JCU A;  5C04 A;  4L8E A;  4G10 A;  3CBU A;  2G2Q A;  4LL1 B;  2J23 A;  1T1V A;  2CVB A;  4IEL A;  1O7U A;  1J08 A;  2CVK A;  3EUR A;  2B6M A;  2JAC A;  3MYD A;  5EPF A;  3P7X A;  4EC0 A;  5HR2 A;  3C1S A;  2VLV A;  3ED3 A;  3OR5 A;  5IMA A;  3PIN A;  2DMM A;  5DDL A;  2NTO A;  2R0G A;  2NPB A;  3GTU B;  3QFB C;  1HNB A;  1PKW A;  5H5Q A;  4O92 A;  1JZR A;  2MZC A;  1KNG A;  2KHP A;  2VD0 A;  3EU3 A;  1K0A A;  2VLU A;  2MYG A;  3KD0 A;  2LS5 A;  2HE3 A;  2OJL A;  1J9B A;  4PUA A;  2HRF A;  1B9Y C;  1X5D A;  1QXH A;  3GHA A;  2DLX A;  1EWX A;  2LRN A;  3IRA A;  4J57 E;  4BL7 B;  3GNJ A;  3Q6O A;  2FA4 A;  1FB6 A;  1AQX A;  3FY7 A;  4G0I A;  5KN3 A;  1XXU A;  3F6D A;  4OFN A;  2H1G A;  3FHK A;  4OFM A;  2DJ0 A;  1EOH A;  2J9H A;  1CQG A;  4L0W A;  1PN9 A;  2H0G A;  3V1W A;  2WUL A;  2FWF A;  2C8U A;  2GS3 A;  3KH9 A;  4NV2 A;  5B7C A;  2C3Q A;  1V2A A;  1EZK A;  1NM3 A;  5ENU A;  4XHM A;  2HRA A;  4TXO A;  4K6X A;  3APO A;  2D2Z A;  4X0X A;  3O6T A;  1SKR B;  4EIQ A;  4OO5 A;  2HT9 A;  2RUF A;  3F63 A;  1A8L A;  2LJA A;  2P5Q A;  1PRX A;  1O73 A;  2C0D A;  2MMA A;  2FNO A;  2GSR A;  2IMF A;  3DGQ A;  1M2A A;  2DBC A;  4ZBA A;  5G1K A;  2KP1 A;  1GSS A;  1YEX A;  2I3Y A;  4Z2T A;  5KOX A;  5LNK e;  1ZYQ B;  1VRS D;  2YWM A;  1DSB A;  4Q5F A;  4KH7 A;  2A2R A;  2LNS A;  4LL4 B;  3M9J A;  2CQ9 A;  3GUR A;  3TJK A;  3TOT A;  4ECI A;  1JFU A;  4MJB A;  2RLI A;  1YF0 A;  4O5R A;  2ON5 A;  13GS A;  4KA0 A;  3ERW A;  3GUS A;  5JCG A;  2HRK A;  1SJZ A;  1B8X A;  4O5U A;  1BQ7 A;  2H1D A;  1F9M A;  2K9F A;  3D21 A;  3WGX A;  4F82 A;  3TCO A;  1UA5 A;  2C0F A;  3EMP A;  1K0M A;  1U87 A;  1A0F A;  4N10 A;  4F0C A;  5H5S A;  4TVE A;  2YP6 A;  3UAR A;  4LA1 A;  4NXI A;  1GTA A;  1A2J A;  3L9V A;  1R26 A;  2H6Y A;  2YCD A;  2H01 A;  3TKP A;  2L5O A;  2XBQ A;  3VLN A;  1F37 A;  4DVC A;  5IOX A;  4ML6 A;  4BPY A;  3PH9 A;  4ZL8 A;  5KN2 A;  3KJY A;  1T3B A;  3ZIJ A;  1GRX A;  6GSV A;  1DUG A;  2GST A;  1XWA A;  3CTF A;  3F8U A;  2C4J A;  3BCI A;  4XTS A;  4AJ6 A;  1NHY A;  3JCM L;  1FVJ A;  2XPE A;  4FIW A;  4ZIL A;  4IW9 A;  3WGE A;  2DKH A;  1M9A A;  4JED A;  3DVW A;  3VWW A;  4NMU A;  1FW1 A;  4MA9 A;  4CHS A;  2JL4 A;  5IQY A;  3FYG A;  1OC3 A;  1ABA A;  2C80 A;  1YDK A;  17GS A;  1GP1 A;  3GTU A;  2DJK A;  1TK0 B;  5G5F A;  5E4W A;  1BG5 A;  1ZL9 A;  1Z7R A;  2YWN A;  2V6K A;  3L4N A;  4DSR A;  3ZRE A;  2XHF A;  1K3Y A;  5CRD A;  3CRU A;  2O87 A;  4FYC A;  4JU5 A;  3US3 A;  3ERF A;  3TOU A;  3KEB A;  1YKC A;  3LEF A;  3KTL A;  2O89 A;  3DML A;  3FZ5 A;  2PGT A;  4BL7 A;  3TKS C;  3FZA A;  2WDU A;  2YWI A;  1MD4 A;  5EY6 A;  4PTS A;  4YH2 A;  2DC5 A;  1IYI A;  2KUC A;  1OE7 A;  1F2E A;  4MJC A;  4K8M A;  4PQH A;  1WE0 A;  2A2S A;  2HNL A;  1X9S B;  4V2N A;  3KP9 A;  4X1U A;  1ERT A;  1SJI A;  4YQU A;  2YNX A;  2N5A A;  5ID2 B;  3WGD A;  1OAZ A;  4CY8 A;  2I81 A;  2GLR A;  4JZQ A;  5GSS A;  5ECS A;  1XVQ A;  3VWX A;  4CDO A;  2FGX A;  2GT6 A;  1EGR A;  2IMK A;  2YZU A;  4XIH A;  4K5R A;  1SL0 B;  2H75 A;  2L6D A;  4OD7 A;  1TP9 A;  4FYU A;  5JWO B;  1WMJ A;  2GQK A;  5DBQ A;  4JR4 A;  5AGY A;  4EIP A;  5ABR A;  1S3C A;  5A4W A;  1M2D A;  2PUK C;  1XOB A;  3UJ1 A;  2LV3 A;  4OFT A;  1GSY A;  5ECN B;  2IL3 A;  4NWY A;  2R0C A;  3FR3 A;  1ERW A;  3J7Y k;  2YOI A;  2YWO A;  2B7K A;  1OVN A;  4K2D A;  4YKG A;  1JHB A;  4Q5N A;  2REM A;  4AJ8 A;  1EV9 A;  4WET A;  4K1F A;  2BTO T;  3A2W A;  2XC2 A;  4EE0 A;  5C00 A;  2OBK A;  2H0H A;  4WF4 A;  3HVS A;  3W8J A;  4K0G A;  4K9Z A;  4HJM A;  5D9X A;  2YZH A;  3FRC A;  4G9H A;  1LU4 A;  3LFL A;  5D96 A;  4IN0 A;  1JZD A;  4KDU A;  2HRN A;  5FT3 A;  1HQO A;  1Z6M A;  3G7J A;  2P0G A;  4BVX A;  4L5O A;  2H70 A;  3CMI A;  2X8G A;  1G0T A;  2F3M A;  4BWQ A;  3UMA A;  4QQ7 A;  4USS A;  4ECB A;  3GH9 A;  5IMF A;  4LMW A;  2VCZ A;  3NOF A;  2CX3 A;  4MF7 A;  2PBJ A;  4MCU A;  3ZFL A;  3VPQ A;  2IWT A;  4OO4 A;  4RI6 A;  2B1L A;  3AY8 A;  3HA9 A;  1FVK A;  4EDY A;  3TKS A;  4EF0 A;  4YQM A;  3IHG A;  3KM6 A;  2F9S A;  1YQ1 A;  3C73 A;  3ERG A;  1HD2 A;  5EL8 A;  4G0L A;  4FH8 A;  1TTZ A;  5JWR B;  5IO2 A;  3H8Q A;  2PMT A;  1XBS A;  4MF6 A;  2OE3 A;  2X64 A;  2HSM A;  1GH2 A;  1XCC A;  1O85 A;  5F06 A;  4WF5 A;  4EVM A;  1TU7 A;  2QC7 A;  4P3Y B;  3ZTL A;  4GSS A;  5KN1 A;  3GMF A;  5DQS A;  2N5B A;  1Z7P A;  1GSQ A;  1TOF A;  4HDE A;  1HNA A;  4N30 A;  1K0D A;  1EP7 A;  1TI3 A;  3TKS E;  1ST9 A;  3TJB A;  3A2X A;  2CX4 A;  4IBP A;  3VWU A;  5DCH A;  4GRF A;  1WWJ A;  1TXX A;  2E2M A;  1G7O A;  2OE1 A;  2L6C A;  1SK0 A;  4K7N A;  4TR4 A;  3WD6 A;  2LKU A;  2L5L A;  3GFK A;  3HJM A;  2A4V A;  1ZGN A;  4MZC A;  2XPD A;  1Q4J A;  4MLY A;  2YPM A;  4F2I A;  1GTI A;  2CVD A;  3L0H A;  4POL A;  4EL1 A;  2K8V A;  3EVI A;  1FHE A;  4PX1 A;  5E59 A;  3IBH A;  1QGV A;  4E8E A;  4ICY A;  4ECJ A;  1S3D A;  3MAK A;  2YJ7 A;  4FYB A;  4KF9 A;  4RQX A;  3GKN A;  2MBT A;  2ZNM A;  4ZBB A;  2HZE B;  6GSU A;  1G6Y A;  1E6B A;  1B4Q A;  3RHC A;  3IAS 2;  1GLQ A;  3Q19 A;  2H0I A;  1XW6 A;  2VLT A;  4LLR A;  2IFQ A;  3ZVJ D;  4L5L A;  2OE0 A;  14GS A;  5G1L A;  4KAE A;  5AIV A;  1G7E A;  5IMZ A;  4ACS A;  3ZRD A;  5LCZ A;  2G0F A;  3G7I A;  3KP8 A;  1UN2 A;  2I9H A;  5ECR B;  3VI5 A;  4GSN A;  3UIW A;  2V2G A;  2CT6 A;  4NV5 A;  2CAQ A;  1RK4 A;  2BJX A;  3MDK A;  1SYR A;  2LQQ A;  1GSD A;  2IIY A;  1U3A A;  3FKF A;  4TRX A;  1TKD B;  1GTU A;  5HR0 A;  1F6M C;  1AXD A;  4DEJ A;  1QUW A;  3DXB A;  2FUG 2;  3GN3 A;  1QQ2 A;  3IXR A;  3E0U A;  2F8A A;  1EP8 A;  5BMU A;  5J4U A;  3W8S A;  5IPH A;  3RAZ A;  3TRQ A;  3GYK A;  4O7H A;  3I69 A;  5F0G A;  4FQU A;  2HLS A;  4ECC A;  3PPU A;  4GQF A;  1X5C A;  5A5K A;  1WP0 A;  2V1M A;  2VUP A;  1V57 A;  1Z9H A;  2KOK A;  1KTE A;  1AW9 A;  4ZL7 A;  1LBK A;  2NDO A;  1TRS A;  2LQO A;  1ZYE A;  5D73 A;  1XWB A;  1TK5 B;  1E2Y A;  1B4P A;  1ZZY A;  1A23 A;  1M7T A;  2DJ3 A;  4HZ4 A;  4KGI A;  5KOW A;  2YV9 A;  1SU9 A;  3D5J A;  2Z9S A;  2GVP A;  4IJI A;  6GSS A;  5INY A;  3IOS A;  4OWY A;  3LSZ A;  3KH7 A;  5J9B A;  2P31 A;  5CRW A;  3QD9 A;  5G30 A;  8GSS A;  2C0E A;  2V6O A;  2WJU A;  5CO3 A;  2HI7 A;  4D73 B;  3A5I A;  2O8V B;  3G7Y A;  5G31 A;  3O3T A;  4WBR D;  1KBN A;  2YV7 A;  5AIX A;  1EEM A;  4Q5Q A;  3KMN A;  2X49 A;  3HZ4 A;  1S3A A;  10GS A;  2X4A A;  4DSS B;  3LGC A;  4ULX A;  5IO0 A;  1X0R A;  5IOW A;  5J9C A;  2OAC A;  2H76 A;  3QDN A;  2K6V A;  5CAX A;  2TIR A;  3ME8 A;  1PL2 A;  3BBY A;  2FLS A;  3EMX A;  4KDY A;  4TKY A;  1SJ6 A;  4WKW A;  1YZX A;  2DJJ A;  1T4Z A;  4YQV A;  4K5S A;  3IK9 A;  2AYT A;  3IDV A;  5GAP D;  1EGO A;  3EU4 A;  2ES7 A;  1U3I A;  5J5N A;  1WRY A;  4MZB A;  6GSW A;  1GUL A;  3QMX A;  4I2T A;  3CTG A;  1T7P B;  2PVO C;  4BVX B;  2FHE A;  2H74 A;  4MJA A;  20GS A;  1Z3E A;  3HDC A;  3N9J A;  2KLX A;  4E8H A;  1EV4 A;  2TRC P;  1W89 A;  3K8N A;  3GKK A;  1KEB A;  1T00 A;  3HKR A;  2HZE A;  4IHU A;  4NPB A;  1SD9 A;  5IPG A;  1PX7 A;  5IIZ A;  4MMM A;  1K3L A;  2GZY A;  1F3A A;  2IPA A;  2QGV A;  5FWG A;  4JR6 A;  1BAY A;  2C1Y A;  1PD2 1;  3I9V 2;  2AAW A;  3QFA C;  4HQS A;  4KSO A;  1A24 A;  2GTU A;  2L4Q A;  2F8F A;  4EDZ A;  3LW9 A;  1PMT A;  3DVX A;  1SL2 B;  1VF4 A;  1YKA A;  2EIO A;  3VK9 A;  3TRX A;  2E2G A;  5G2Z A;  3TJG A;  1VF3 A;  1GL8 A;  2LJR A;  2FWH A;  1MDI A;  2LEG A;  3ZZX A;  2FWG A;  3F4S A;  5ECK B;  1TRU A;  1NHO A;  2DJ2 A;  1U6T A;  2VCT A;  3GST A;  4HZ2 A;  3EC3 A;  3LJR A;  3GKM A;  1T4Y A;  2FY6 A;  5B6N A;  1OC9 B;  2VCV A;  5HQP A;  4RUV A;  1FAA A;  3ZL5 A;  4PXO A;  1OE8 A;  2GGT A;  2VD1 A;  3M8N A;  3A2V A;  2GSS A;  2R6K A;  2L59 A;  2JSZ A;  1USB A;  2JSY A;  1IYH A;  2B5X A;  4ML1 A;  2YJH A;  2VM2 A;  3TRP A;  4ID0 A;  4KDX A;  1GLP A;  5IM9 A;  3F3Q A;  3TUE A;  1M9B A;  1SK1 A;  1THX A;  2GZP A;  5HFI A;  2CV4 A;  1SL1 B;  3P8W A;  1SKS B;  2R5G A;  5B8A A;  1Y25 A;  1QMV A;  1FO5 A;  1U88 A;  2WGR A;  4NHW A;  2OAD A;  3VI7 A;  3HYP A;  3IHQ A;  3NIV A;  4F9Z A;  2IFQ B;  1JLW A;  1PA3 A;  2JAD A;  4MF5 A;  4QL9 A;  3IK7 A;  4D73 A;  4PQ1 A;  2A4H A;  5D9T A;  4FO5 A;  3WYW A;  3QAW A;  2OKA A;  1ILO A;  4GWR A;  4Z7X A;  1GNW A;  3UOM A;  2RUE A;  3LOR A;  3RHB A;  3UEM A;  4BWS A;  4H86 A;  1FG4 A;  4I97 A;  1I5G A;  5IMC A;  12GS A;  4DSS A;  2PVQ A;  2EIR A;  1ZYN A;  5AN1 A;  3CSH A;  3UBK A;  3APQ A;  2M72 A;  4KE3 A;  3C71 A;  4AGS A;  2HZF A;  1ACV A;  5J3R A;  5L71 A;  4MPF A;  2X8H A;  3HJP A;  3D4M A;  5ECO B;  1WJK A;  2KP2 A;  5DJL A;  1BYE A;  4KX4 A;  2XBI A;  4KB3 A;  18GS A;  1LJR A;  4GLT A;  3J7Y b;  2MMO A;  4TOP A;  2R4V A;  3P90 A;  3D22 A;  3UAP A;  4XRA A;  2H71 A;  4YAP A;  3VPT A;  2FWE A;  4JE1 A;  3IE3 A;  2F51 A;  2DKI A;  4TN8 A;  1YJ6 A;  2K18 A;  1TU8 A;  3HJO A;  2PER A;  3LXT A;  3M1G A;  4K0N A;  5GST A;  2R2J A;  1TDI A;  2RM5 A;  4V2M A;  4XS4 B;  1R5P A;  3HD5 A;  4POK A;  2JU5 A;  3U6V A;  1XWC A;  3ZMK A;  1ZCP A;  3UL3 A;  2ZCT A;  2QA2 A;  4IGJ A;  2LJK A;  2ALB A;  5ECP B;  2B5Y A;  2UZ8 A;  2HSH A;  1MDK A;  4RQR A;  3GIX A;  2C3T A;  4DSQ A;  2PU9 C;  3IR4 A;  3FW2 A;  1VF1 A;  2NBS A;  2VO4 A;  3ZFB A;  3VUR A;  1XWG A;  2V32 A;  3ISO A;  6GSY A;  5HR1 A;  1BJX A;  5A4V A;  1A0R P;  3BCK A;  4MPG A;  1SYX A;  4G19 A;  2C3N A;  3A3T A;  2ON7 A;  2GDR A;  1GSU A;  1F3B A;  3FMW A;  3N5O A;  4K7I A;  1GUH A;  1ZYP A;  3F4T A;  4O5Q A;  1DE2 A;  1OC9 A;  1YF1 A;  1M99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...