5CAXA

Crystal structure of methanosarcina acetivorans methanoredoxin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
96
structure length
96
Chain Sequence
KDTDKGKHVSGIDRGKIVMYGLSTCVWCKKTKKLLTDLGVDFEYVFVDLLEEEEKSNAIKQVSRFNPSVSFPTTILNDEKAIVGFKEKQIREALGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glutaredoxin
publication title Structural and Biochemical Characterizations of Methanoredoxin from Methanosarcina acetivorans, a Glutaredoxin-Like Enzyme with Coenzyme M-Dependent Protein Disulfide Reductase Activity.
pubmed doi rcsb
source organism Methanosarcina acetivorans (strain atcc 35395 / dsm 2834 / jcm 12185 / c2a)
total genus 25
structure length 96
sequence length 96
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5caxA00
2H75A 3FY7A 2CAIA 4XS4B 1T4YA 1SK1A 3HJPA 4HUAA 4XRAA 3TOUA 3M9JA 3DYRA 4ECIA 5C04A 1TK5B 2PMTA 4NMUA 13GSA 2HXKA 1XOBA 2IPAA 3Q74A 1YY7A 2FD3A 1T1VA 2GQMA 1FVJA 3TRPA 2FWEA 3GHAA 2L6DA 5KEJA 3QAVA 1SD8A 4L5LA 2PU9C 4BVXA 4TVEA 2WB9A 3C71A 4EO3A 4ZBAA 5ELAA 2F8AA 5DAKA 5JWOB 2DJ2A 1M2DA 4K7NA 2H72A 1TRWA 1LBKA 1R26A 2OE0A 3RAZA 1A2LA 3FZ4A 2JACA 4OFNA 2DMMA 5GZZB 2LJKA 5IM9A 1GTBA 2R3XA 1EGRA 5ECIB 5DQYA 4TR3A 1F3BA 4LMWA 5DBQA 1VF1A 4PXOA 1MD4A 4FYUA 22GSA 2OBIA 5G30A 1AQWA 2N5AA 3WGXA 2N5FA 3FRCA 1GSFA 2LS5A 1Z6MA 4V1Ap 4ZXGA 3KH9A 1ZCPA 1J08A 2XPDA 1I5GA 1TP9A 4FIWA 1GLPA 1RQMA 1B9XC 5E59A 4WKWA 1BQ7A 4WF5A 5HR0A 1Z5YE 3DKSA 1QK8A 2X8HA 2VL9A 1TOFA 2CAQA 1SD9A 4ZILA 1ZMAA 4KNDA 3ERWA 3US3A 4RI7A 1XVQA 4AF2A 1F2EA 5A4WA 3GFKA 2GTUA 3ZL5A 1YF1A 1AQXA 4V2LA 2X8CA 1R5AA 3N5OA 4MA9A 2RM5A 4PQ1A 4TR0A 1VF3A 5ABRA 5IOWA 10GSA 1FO5A 2CVBA 1JFUA 2WULA 2KLXA 5ECRB 4EL1A 3FYGA 8GSSA 2VCWA 1JLVA 2HFDA 1G7EA 5A4UA 4IJ3A 1OKDA 1QFNA 4DSSB 2WFCA 1PA3A 4HU7A 2ZNMA 1A23A 16GSA 1THOA 3IPZA 4K7IA 2CX3A 1A2JA 2IIYA 2QC7A 2VOCA 4JR4A 4MP4A 3GNJA 2LQQA 1PGTA 3NIVA 5GSSA 1MDIA 1BYEA 2EIRA 2TRXA 2YWMA 4ML1A 4MH3A 4OO4A 2BJXA 2CVDA 2PBJA 5HFIA 1NHOA 3QOUA 2RIIA 3UBLA 1FVKA 1A0FA 3GV1A 1HYUA 4JU5A 3Q6OA 3GYKA 3LXTA 5H5QA 2EIOA 4GSNA 1YDKA 2YPMA 1T00A 2E2GA 5ECHB 4XS6A 5KN3A 1A24A 5ID2A 2VD1A 1E2YA 2YWIA 2AAWA 3F63A 2H0HA 3EYTA 4K9ZA 4K7OA 2H71A 3GTUB 2HZEB 3TKRA 12GSA 1Y6EA 4OMVA 4GRFA 5CP1A 1U87A 4L5OA 1EP8A 3KMNA 4MPFA 3CTFA 5G1KA 3QFAC 4YQUA 4GF0A 4F0BA 2OADA 5D9TA 2JZTA 4NV2A 1OE8A 1V9WA 2GT6A 5CRDA 2QGVA 5IMDA 4K0NA 1GNWA 3IK9A 2I81A 3GKMA 1GULA 20GSA 3EMPA 4GSSA 2B7KA 1GH2A 2VM1A 4XS1A 3ME7A 3IE3A 5LNKe 3D6IA 2PWJA 2H76A 4HQZA 2AUVA 2IFQB 4L8EA 3K8NA 3ZIJA 4HJ2A 3UAPA 3TUEA 2WDUA 1TXXA 2CZ2A 2PPTA 1Q98A 4ZB9A 2B6MA 4IELA 5J5NA 1MDJA 4F9ZA 4QL9A 2HNLA 1O8XA 1RK4A 1TI1A 3TRXA 5G5EA 3UMAA 2NBSA 3TJFA 3CSHA 2OACA 3KGKA 2IJYA 1A2MA 3J7Yk 3UEMA 4F2IA 2JSYA 3MAKA 1WOUA 5IQYA 3ZZXA 1O7UA 4YQVA 1B8XA 3QR6A 3HKRA 2X8GA 4O32A 2D2ZA 2WS2A 3LXZA 4EXJA 4O5RA 4POMA 3U5RE 4J56E 2C80A 4IJIA 3TKSA 4X43A 3DVXA 1G6WA 1WWJA 2FCHA 5G2ZA 3E3EA 2FA4A 4FYBA 2HI7A 3IDVA 4XTSA 1K3OA 2XC2A 2CZ3A 1Q4JA 5ID2B 5CYYA 2I1UA 2X64A 4IW9A 4HEA2 4GXZA 1ZOFA 3GX0A 2LNSA 1VRSD 1MD3A 2LTKA 3IC4A 5DDLA 3IHQA 2Z9SA 5CNWA 2H1BA 1XXUA 4HS1A 2VD0A 2IMDA 3WGDA 1Z7PA 2V2GA 2VLTA 1GSSA 2PVQA 1YKCA 1X9WB 3O6TA 3F8UA 1OC9B 1HNAA 2GVPA 5EPFA 1T7PB 1XBSA 2OKAA 1ERUA 1GSUA 2C1YA 1ILOA 1W4VA 3VFIA 4BPYA 1GTAA 2A2SA 3A2WA 3I6AA 3J7Yb 2L59A 3R2QA 2VAFA 2C0DA 4HQSA 3WGEA 2VL2A 1U3AA 1S3AA 3CRUA 3RPPA 3F4SA 5L71A 6GSSA 3QD9A 5ECNB 3ZVJD 2M72A 1V58A 5HR1A 5CREA 2IMIA 3KP9A 2L5OA 2H1GA 3CSIA 2DC5A 3KCMA 1BEDA 5HQPA 4J2FA 1ZYEA 2GZYA 4PX1A 4TXVA 3C8EA 3EE2A 4BVYA 3BJ5A 5J3RA 3IAM2 5DALA 1Z3EA 1GSYA 2V6OA 2CV4A 3ZIVA 3KD0A 2H30A 5J9CA 1TK8B 2YJ7A 1UN2A 7GSSA 5IMFA 2GGTA 1EV4A 2KUCA 4POLA 5GSTA 1QGVA 1ON4A 4KAEA 5G5FA 2K9FA 2P0GA 4G19A 1JLWA 1YF0A 3L0HA 3W8JA 5COHA 1TDIA 1SJ6A 1SL1B 2E7PA 2DJ3A 1PL2A 2WCIA 4I2UA 5IIZA 3PGTA 3GL5A 2V41A 3QFBC 1OE7A 4ZB8A 1WPIA 4D73B 3F6DA 1X9MB 2MBSA 1ACVA 2HRFA 2WRTA 3FR6A 4IQAA 4OCEA 4IGJA 5ELGA 1SL0B 1S3CA 1SK0A 1T3BA 2FUG2 2L4CA 3F6FA 4PQIA 2K18A 2VCXA 4N10A 4DSSA 2AHEA 5AIXA 4P3YB 5IMAA 1PL1A 3BOAA 2YZHA 4E8HA 2H70A 4MLYA 2J9HA 4HZ4A 1MEKA 3VLNA 4Q5NA 4IP6A 1HD2A 2OE3A 2I3YA 1AIUA 5DJMA 3G7IA 3HVXA 3ZFBA 3RPNA 3ZREA 2M46A 2KP1A 1SU9A 1U3IA 5F8BA 6GSTA 5ECKB 3DVWA 4E8EA 3HVSA 5KN0A 1F3AA 1FG4A 2JSZA 3EWLA 2OE1A 3FR3A 3ZLPA 1X5DA 3GKNA 1PD21 2LV3A 1A8LA 4MJCA 4ID0A 3GTUA 2C3NA 2HZEA 3M0FA 1SK2A 2FWHA 2V32A 2CX4A 4XCSA 4PNFA 4POKA 2PGTA 1ABAA 2HE3A 4BWQA 1AC1A 5DALB 3HJOA 3A5WA 1QMVA 1CQHA 1XWBA 5FHIA 3D0ZA 3GH6A 2GZZA 1THXA 1FHEA 4K8MA 2HLSA 3E0UA 3SBCA 4TR1A 1G0TA 3QMXA 1DBYA 2H6ZA 4IP1A 5LCZA 3NOFA 1KEBA 1ZYQB 3KTBA 1XW9A 3TKQA 5CAXA 2F51A 4BA7A 5JWRB 2FGXA 4MJAA 2N5BA 2ZUPA 3KTLA 5E4WA 4K0GA 2CQ9A 1GSDA 2XHFA 1USBA 4KDXA 4OO5A 2WJUA 3DRNA 2IFQA 5JCUA 1AQVA 4LL4B 2YANA 4ILFA 1XWKA 4RI6A 1V98A 4AGSA 4EKZA 3SWLA 1NW2A 5H5SA 1YJ6A 1T8EB 1FAAA 1WMJA 3WYWA 4MDCA 5HFGA 3MDKA 6GSUA 3NZNA 3TOTA 2DJ0A 3CXGA 2DJ1A 3LYKA 3UJ1A 3ISOA 18GSA 1F9MA 3DWVA 2VO4A 1GWCA 2VCTA 3RBTA 3F0IA 2LEGA 2VM2A 3A3TA 1TK0B 2MYGA 2YP6A 2R5GA 4HZ2A 3P2AA 4GCIA 4TKYA 1V2AA 5D9WA 1B4PA 3D5JA 3GH9A 4OCFA 3EU3A 1VF2A 2AJQB 5B6NA 4MH2A 4KB3A 4PUFC 1TI3A 4BWSA 4EVMA 3PR8A 3HZ8A 4PUAA 3KMOA 4NHZA 1XPVA 3I43A 4OFMA 1OAZA 4Q5FA 3TJGA 6GSXA 5F0GA 3KZQA 3ED3A 4TOPA 1EOGA 4ZBDA 3H4KA 3CTGA 1JHBA 3ZFLA 1NM3A 1XFLA 4JEDA 3VK9A 5J4UA 3IRAA 1GUKA 3FK8A 3IOSA 3PINA 4PGTA 3GMFA 3CRTA 4PQHA 2VCZA 3ERGA 3HCZA 4F0CA 3QDNA 1OC9A 1J0FA 4Q5QA 5DJLA 3HXSA 1U88A 1YQ1A 2DMLA 2C0FA 2VLVA 2GSQA 1O81A 2O87A 4TR1B 3GUSA 3VURA 3EINA 1GTUA 3VWXA 3H8QA 4EE0A 4CDOA 3GKXA 2C0EA 1O6JA 1K0CA 5CRHA 1K3YA 4CW9A 2B5YA 1HQOA 3HD5A 1XWAA 3MSZA 2IMKA 3M9KA 1GUMA 5F06A 3ZRDA 1GRXA 5HFKA 1Z6NA 3UARA 5DCGA 1XW5A 4O7HA 3APSA 2H66A 5EVOA 2MZCA 2LKUA 3GKKA 2P5RA 3I69A 1SKRB 2ZCTA 4Q5RA 5EY6A 4TN8A 17GSA 4WXTA 2B7JA 2FWFA 3APQA 4NAXA 4ZBBA 2LQOA 4HDEA 2RUFA 1SYXA 1V40A 3HJMA 4YQMA 3GL3A 3FZ5A 2H73A 2LUSA 3VWUA 2F9SA 1JZWA 2VLUA 1VF4A 4XHMA 3FW2A 4WBJA 3W8SA 1N8JA 3G9BA 4MF6A 4ISDA 4PNGA 2LNTA 2FHEA 3TCOA 1F6MC 4L0UA 3TKSC 3GRXA 2QSIA 5DCHA 2O85A 2V1MA 2FY6A 3ERFA 5B8AA 1E6BA 4NV5A 1M99A 5IPHA 2EC4A 3FKFA 2V6KA 2H01A 4GSTA 3V1WA 5IOXA 5IMZA 5D9VA 1ST9A 1KTEA 2REMA 4D73A 4ULXA 3H1NA 2XPEA 4MABA 3D4TA 2KOKA 5ECSA 4HJMA 1B4QA 1URMA 3W6GA 5B6MA 3HA9A 1PMTA 3P7XA 2HRNA 2AYTA 1B9YC 2NVLA 1W89A 1R7HA 2C4JA 4KE3A 4ZL9A 2YOIA 4GWRA 1PKZA 4O92A 1XW6A 1HNBA 4EDYA 1OKTA 3LGCA 3O76A 3UOMA 5G31A 3H79A 4NPBA 3KH7A 3UBKA 1DSBA 2RLIA 1PKWA 3GN3A 1ZGNA 1SL2B 2VL2C 2OJLA 2MMOA 2B1KA 3HHVA 3CMIA 1YEXA 1SENA 3CBUA 1UA5A 2LRTA 1SJIA 3GURA 1LU4A 2HT9A 4ECBA 11GSA 1AXDA 4BL7A 4TW5A 1SKWB 1EWXA 2I4AA 3IA1A 4N11A 1AUCA 2H0GA 2X99A 1EEMA 2DJKA 3P8WA 4F03A 2J23A 4MMMA 4IQ1A 2DLXA 4KCEA 4DEJA 5D9XA 1PN9A 2G0FA 2YZUA 1TRUA 1X9SB 1EV9A 3JCML 4MK3A 2GQLA 2QKEA 2ALBA 2GSTA 4LL1B 1QQ2A 3A2XA 3KXOA 3A2VA 5ENUA 1M2AA 4HU9A 5DQSA 3RHCA 2PVOC 1J9BA 5AGYA 3IBHA 3EC3A 2TIRA 1NSWA 3G7YA 2K6VA 3PH9A 2FNOA 2FWGA 3MWHA 1VGLA 3BD2A 2GZPA 2O8VB 4WR5A 3UL3A 1UC7A 2GSRA 2VIMA 1TRVA 4ACSA 4ZL7A 4GQFA 3APOA 1S3DA 3D22A 4LLRA 1WE0A 3TKPA 2K8SA 1GSEA 3TJBA 1QUWA 4XIHA 1M2BA 4JR6A 1PRXA 4ZB6A 4ZL8A 3TJKA 4L0WA 2MMNA 5DVBA 3S9FA 3FR9A 3ZYWA 4YH2A 4I8BA 4JZQA 1K3LA 1XCCA 4G9HA 3VI7A 5FWGA 2LRCA 4QQ7A 2ES7A 4QL7A 2KP2A 5A4VA 4MF5A 4N0VA 2YV7A 2L4QA 4GQCA 4IN0A 2IN3A 4CHSA 3LSZA 4J57E 1PSQA 1OVNA 4V2MA 1BX9A 2H6XA 3FZAA 3QPMA 3L9SA 3LYPA 1A0RP 5AN1A 4WEYA 4H86A 3ZMKA 4KUNA 3D21A 3FHKA 1K0BA 4F82A 5H5RA 3C1SA 4LA1A 4IS0A 3HVVA 6GSYA 2BTOT 4G10A 3ZVJA 3MNGA 2O7KA 3DGQA 3DMLA 2H8LA 4WR4A 5GAND 4YAVA 4JE1A 3GSTA 3KEBA 2YJHA 4IVFA 4RQXA 4KW6A 3RHBA 3EURA 1F37A 1A8YA 1TKDB 5J41A 2TRCP 1XZOA 1O85A 5D93A 1OC8A 3C7MA 4PURA 3VWVA 4OWYA 3L9VA 1NHYA 2DJJA 5INYA 3KIJA 5JCWA 2MMAA 2WZ9A 1X0RA 1X5EA 2A2RA 4WF4A 1M9BA 4KDUA 1O73A 3EU4A 1C72A 2HSHA 2IMFA 3QAWA 4MPGA 1N2AA 3FEUA 1T4ZA 2YNXA 2CVKA 2HYXA 5B8BA 3M1GA 1H75A 2R6KA 2L57A 3BBYA 5IMVA 3M8NA 3DEXA 1OYJA 1RW1A 3WT1A 1SJZA 3VPTA 2IMEA 3UIWA 1PX6A 1FW1A 2YN1A 4EF0A 19GSA 2AV4A 2GSSA 4RQRA 4DVCA 4MF7A 1GTIA 3I9V2 3P90A 5EL8A 2CA8A 2PERA 2VL3A 2JL4A 5F07A 3L9UA 5FT3A 1EZKA 1OC3A 1FOVA 4GTUA 1G6YA 2YWOA 1K0AA 5HR2A 5KN2A 3F3QA 3E9JB 5D96A 2B5XA 1R4WA 2P5QA 3UVHA 5G1LA 2B1LA 3IAS2 1K0NA 2JZRA 3LEFA 3OR5A 2B5EA 4GLTA 5J9BA 1R5PA 3LWAA 1JZOA 1TU7A 1KNGA 2H1DA 3TGZA 2G2QA 3F4TA 1JZRA 4ECCA 1ERWA 2I9HA 3LORA 2VCVA 5DAKB 4OFTA 3DD3A 4AJ6A 2JZSA 3ME8A 4YAPA 3CYNA 2PUKC 3LQ7A 4KA0A 4FO5A 1TU8A 1WIKA 4RUVA 3N9JA 5LD0A 4DSRA 1WRYA 1LJRA 3AY8A 1DUGA 4I6XA 3DIEA 4K2DA 1M7TA 2ON5A 6GSVA 2PN8A 3C1RA 3EMXA 3HYPA 3CSJA 4MJEA 5A5KA 1WJKA 4AJ7A 4KH7A 1GLQA 1YZXA 2F3MA 3QAGA 2GT5A 4MCUA 1ZZYA 3VWWA 1Z9HA 1GNEA 5JCGA 2LJAA 2YCDA 2XBIA 3GA4A 2H74A 4TXOA 2O89A 3C73A 1ERTA 2MBTA 3RDWA 2C8UA 2H1AA 2ON7A 4DSQA 2DIYA 2DIZA 2NTOA 2R2JA 2R4VA 1Z7RA 3ZTLA 4Z7XA 3UVTA 3BCKA 4WBRD 2H0IA 2JADA 4KCAA 1PQNA 2IL3A 2MMZA 4N0ZA 3TDGA 1XWGA 3EVIA 5CRWA 3WD6A 1XIYA 1GP1A 1M0UA 4FYCA 5CO3A 2C0GA 3Q19A 1SYRA 2BMXA 3IK7A 1ZL9A 4FH8A 1BAYA 1H4OA 3BCIA 2NDOA 1PX7A 1ERVA 4ECJA 2OBKA 1QXHA 3KP8A 5CRGA 1TJDA 5ECOB 2F8FA 4NHWA 2R37A 2YWNA 2K8VA 1YEPA 3ZITA 5IPGA 3IXRA 1MDKA 5ECMB 2GDRA 1BG5A 2H19A 2DBCA 1AW9A 1TW9A 4HOJA 1GUHA 1DE2A 3KJYA 2AB6A 4NWYA 1FB0A 5ECQB 4I97A 3LFLA 5ECLB 1XVWA 2LRNA 4ZIJA 1V57A 1EOHA 2RM6A 4TR4A 5HR3A 2C3QA 3U6VA 3H93A 1UVZA 5JWQB 1O8WA 2P31A 1XWCA 4KSOA 1DE1A 2GS3A 4XS4A 4KX4A 2HZFA 1KBNA 2L5LA 2JU5A 1I9DA 5C00A 3QCPA 1U6TA 3TB2A 1SKSB 4KSMA 1B48A 4NXIA 2DSAA 5IO2A 2FA8A 14GSA 1XOAA 3LJRA 3F3RA 3HDCA 3HZ4A 2B3SA 2H6YA 3TRQA 1FB6A 3DXBA 4V1Ag 2HSYA 4MZCA 1JZDA 5GAPD 4V2NA 5B7CA 4TXOB 2XBQA 4OD7A 2C3TA 4JRRA 1CQGA 4JBBA 3WT2A 3L78A 9GSSA 4EC0A 5F05A 2E0QA 4XRDA 1HNCA 4I5QA 3KM6A 2YV9A 4KDYA 3M3MA 5D73A 3F9UA 4KGIA 3IR4A 3FZ9A 1BJXA 1MTCA 3D4MA 4I2TA 4K1FA 1EGOA 1YKAA 3G7JA 2WGRA 5IO0A 2KHPA 1GSQA 4TRXA 2NPBA 4IBPA 4X0XA 3IV4A 4IKHA 1GL8A 2L6CA 1X5CA 4WETA 4G2EA 1EP7A 2IWTA 4AJ8A 3GX8A 1ML6A 3VPQA 4IHUA 2VCQA 3GIXA 3HY2A 2VUPA 2CT6A 5IMCA 3GSSA 4X1UA 1EEJA 1TTZA 3TJJA 2OA7A 1K0MA 1M9AA 5KN1A 3LG6A 1Y25A 1G7OA 2LSTA 1IYHA 2RUEA 4MJBA 4N30A 4ML6A 4EUYA 4POBA 2GLRA 2GQKA 5ECPB 4HI7A 1K0DA 2FLSA 3ZMLA 2EIQA 5D8IA 1IYIA 3Q18A 1AAZA 3TKSE 5AISA 1TRSA 3F4RA 4MZWA 2E2MA 3L4NA 4MZBA 1K0OA 6GSWA 3O3TA 3VI5A 4LMVA 4EDZA 4K6XA 2M80A 5AIVA 2A4VA 2LJRA 1WP0A
chains in the Genus database with same CATH superfamily
2H75A 3FY7A 2CAIA 4XS4B 1T4YA 1SK1A 3HJPA 4HUAA 4XRAA 3TOUA 3M9JA 3DYRA 4ECIA 2X49A 5C04A 1TK5B 2PMTA 4NMUA 13GSA 2HXKA 1XOBA 2IPAA 3Q74A 1YY7A 2FD3A 1T1VA 2GQMA 1FVJA 3TRPA 2FWEA 3GHAA 2L6DA 5KEJA 3QAVA 1SD8A 4L5LA 2PU9C 4BVXA 4TVEA 2WB9A 3C71A 4EO3A 4USSA 4ZBAA 5ELAA 2F8AA 5DAKA 5JWOB 2DJ2A 1M2DA 4K7NA 2H72A 1TRWA 1LBKA 1R26A 2OE0A 3RAZA 1A2LA 4KF9A 3FZ4A 2JACA 4OFNA 2DMMA 5GZZB 2LJKA 5IM9A 1GTBA 2R3XA 1EGRA 5ECIB 5DQYA 2R0GA 4TR3A 1F3BA 4LMWA 4K5SA 5DBQA 1VF1A 4PXOA 1MD4A 4FYUA 22GSA 2OBIA 5G30A 1AQWA 2N5AA 3WGXA 2N5FA 3FRCA 1GSFA 2LS5A 1Z6MA 4V1Ap 4ZXGA 3KH9A 1ZCPA 1J08A 2XPDA 1I5GA 1TP9A 4FIWA 1GLPA 1RQMA 1B9XC 5E59A 4WKWA 1BQ7A 4WF5A 5HR0A 1Z5YE 3DKSA 1QK8A 2X8HA 2VL9A 1TOFA 2CAQA 1SD9A 4ZILA 3MIXA 1ZMAA 4KNDA 3ERWA 3US3A 4RI7A 1XVQA 4AF2A 1F2EA 5A4WA 3GFKA 2GTUA 3ZL5A 1YF1A 1AQXA 4V2LA 2X8CA 1R5AA 3N5OA 4MA9A 2RM5A 4PQ1A 4TR0A 1VF3A 5ABRA 5IOWA 10GSA 1FO5A 2CVBA 1JFUA 2WULA 2KLXA 5ECRB 4EL1A 3FYGA 8GSSA 2VCWA 1JLVA 2HFDA 1G7EA 5A4UA 4IJ3A 4PTSA 1OKDA 1QFNA 4DSSB 2WFCA 1PA3A 4HU7A 2ZNMA 1A23A 16GSA 1THOA 3IPZA 4K7IA 2CX3A 1A2JA 2IIYA 2QC7A 2VOCA 4JR4A 4MP4A 3LW9A 3GNJA 4BVXB 2LQQA 1PGTA 3NIVA 2DKIA 5GSSA 1MDIA 1BYEA 2EIRA 2TRXA 2YWMA 1M3JA 4ML1A 4MH3A 4OO4A 2BJXA 2CVDA 2PBJA 5HFIA 1NHOA 3QOUA 2RIIA 3UBLA 1FVKA 1A0FA 3GV1A 3EPTA 1HYUA 4JU5A 3Q6OA 1FOHA 3GYKA 3LXTA 5H5QA 2EIOA 4GSNA 1YDKA 2YPMA 1T00A 2E2GA 5ECHB 4XS6A 5KN3A 1A24A 5ID2A 2VD1A 1E2YA 2YWIA 2AAWA 3F63A 2H0HA 3EYTA 4K9ZA 4K7OA 2H71A 3GTUB 2HZEB 3TKRA 12GSA 1Y6EA 4OMVA 4GRFA 5CP1A 1U87A 4L5OA 1EP8A 3KMNA 4MPFA 3CTFA 5G1KA 3QFAC 4YQUA 4GF0A 4F0BA 2OADA 5D9TA 2JZTA 4NV2A 1OE8A 1V9WA 4G0LA 2GT6A 5CRDA 2QGVA 5IMDA 4K0NA 1GNWA 3IK9A 2I81A 3GKMA 1GULA 20GSA 3EMPA 4GSSA 2B7KA 1GH2A 2VM1A 4XS1A 3ME7A 3IE3A 5LNKe 3D6IA 2PWJA 2H76A 4HQZA 2AUVA 2IFQB 4L8EA 3K8NA 3ZIJA 4HJ2A 3UAPA 3TUEA 2WDUA 1TXXA 2CZ2A 2PPTA 1Q98A 4ZB9A 2B6MA 4IELA 5J5NA 1MDJA 4F9ZA 4QL9A 2HNLA 1O8XA 1RK4A 1TI1A 3TRXA 2QA1A 5G5EA 3UMAA 2NBSA 3TJFA 3CSHA 2OACA 3KGKA 2IJYA 1A2MA 4HSCX 3J7Yk 3UEMA 4F2IA 2JSYA 3MAKA 1WOUA 5IQYA 3ZZXA 1O7UA 4YQVA 1B8XA 3QR6A 3HKRA 2X8GA 4O32A 2D2ZA 2WS2A 3LXZA 4EXJA 4X4JA 4O5RA 4POMA 3U5RE 4J56E 1ZYPA 2C80A 4IJIA 3TKSA 4X43A 3DVXA 1S3RA 1G6WA 1WWJA 2FCHA 5G2ZA 3E3EA 2FA4A 4FYBA 2HI7A 3IDVA 4XTSA 1K3OA 2XC2A 2CZ3A 1Q4JA 5ID2B 5CYYA 2I1UA 2X64A 4IW9A 4MNNA 2X4AA 4HEA2 4GXZA 1ZOFA 3GX0A 2LNSA 1VRSD 1MD3A 2LTKA 3IC4A 5DDLA 3IHQA 2Z9SA 5CNWA 2H1BA 1XXUA 4HS1A 2VD0A 2IMDA 3WGDA 1Z7PA 2V2GA 2VLTA 1GSSA 2PVQA 1YKCA 1X9WB 3O6TA 3F8UA 1OC9B 1HNAA 2GVPA 5EPFA 1T7PB 1XBSA 2OKAA 1ERUA 1GSUA 2C1YA 1ILOA 1W4VA 3VFIA 4BPYA 1GTAA 2A2SA 3A2WA 3I6AA 3J7Yb 2L59A 3R2QA 2VAFA 2C0DA 4HQSA 3WGEA 2VL2A 1U3AA 1S3AA 4FQUA 3CRUA 3RPPA 3F4SA 5L71A 6GSSA 3QD9A 5ECNB 3ZVJD 2M72A 1V58A 5HR1A 5CREA 2IMIA 3KP9A 2L5OA 4O5UA 2H1GA 3CSIA 2DC5A 3KCMA 1BEDA 5HQPA 4J2FA 1ZYEA 2GZYA 4PX1A 4TXVA 3C8EA 3EE2A 4BVYA 3BJ5A 5J3RA 3IAM2 5DALA 1PN0A 1Z3EA 1GSYA 2V6OA 2CV4A 3ZIVA 3KD0A 2H30A 5J9CA 1TK8B 2YJ7A 1UN2A 7GSSA 5IMFA 2GGTA 1EV4A 2KUCA 4POLA 5GSTA 1QGVA 1ON4A 4KAEA 5G5FA 2K9FA 2P0GA 4G19A 1JLWA 1YF0A 3L0HA 3W8JA 5COHA 1TDIA 1SJ6A 1SL1B 2E7PA 2DJ3A 1PL2A 2WCIA 4I2UA 5IIZA 3PGTA 3GL5A 2V41A 3QFBC 1OE7A 4ZB8A 1WPIA 4D73B 3F6DA 1X9MB 2MBSA 1ACVA 2HRFA 2WRTA 3FR6A 4IQAA 4OCEA 4IGJA 5ELGA 1SL0B 1S3CA 1SK0A 1T3BA 2FUG2 2L4CA 3F6FA 4PQIA 2K18A 2VCXA 4N10A 4DSSA 2AHEA 5AIXA 4P3YB 5IMAA 1PL1A 3BOAA 2YZHA 4E8HA 2H70A 4MLYA 2J9HA 4HZ4A 1MEKA 4G0KA 3VLNA 4Q5NA 4IP6A 1HD2A 2OE3A 2I3YA 1AIUA 5DJMA 3G7IA 3HVXA 3ZFBA 3RPNA 3ZREA 3IHGA 2M46A 2KP1A 1SU9A 4YKFA 1U3IA 5F8BA 6GSTA 5ECKB 3DVWA 4E8EA 3HVSA 5KN0A 1F3AA 1FG4A 2JSZA 3EWLA 2OE1A 4BL7B 3FR3A 3ZLPA 1X5DA 3GKNA 1PD21 2LV3A 1A8LA 4MJCA 4ID0A 3GTUA 2C3NA 2HZEA 3M0FA 1SK2A 2FWHA 2V32A 2CX4A 4XCSA 4PNFA 4POKA 2PGTA 1ABAA 4BVYB 2HE3A 4BWQA 1AC1A 5DALB 3HJOA 3A5WA 1QMVA 1CQHA 1XWBA 5FHIA 4Z2RA 3D0ZA 3GH6A 2GZZA 1THXA 1FHEA 4K8MA 2HLSA 3E0UA 3SBCA 4TR1A 1G0TA 3QMXA 1DBYA 2H6ZA 4IP1A 5LCZA 3NOFA 1KEBA 1ZYQB 3KTBA 1XW9A 3TKQA 5CAXA 2F51A 4BA7A 5JWRB 2FGXA 4MJAA 2N5BA 2ZUPA 3KTLA 5E4WA 4K0GA 2CQ9A 1GSDA 2XHFA 1USBA 4KDXA 4OO5A 2WJUA 3DRNA 2IFQA 2HRAA 5JCUA 1AQVA 4LL4B 2YANA 4ILFA 1XWKA 5KOXA 4RI6A 1V98A 4AGSA 4EKZA 3SWLA 1NW2A 5H5SA 1YJ6A 1T8EB 1FAAA 1WMJA 3WYWA 4MDCA 5HFGA 3MDKA 6GSUA 3NZNA 3TOTA 2DJ0A 3CXGA 2DJ1A 3LYKA 3UJ1A 3ISOA 18GSA 1F9MA 3DWVA 2VO4A 1GWCA 2VCTA 3RBTA 3F0IA 2LEGA 2VM2A 3A3TA 1TK0B 2MYGA 2YP6A 2R5GA 4HZ2A 3P2AA 4GCIA 4TKYA 1V2AA 5D9WA 1B4PA 3D5JA 3GH9A 4OCFA 3EU3A 1VF2A 2AJQB 5B6NA 4MH2A 4KB3A 4PUFC 1TI3A 4BWSA 4EVMA 3PR8A 3HZ8A 4PUAA 3KMOA 4NHZA 1XPVA 3I43A 4OFMA 1OAZA 4Q5FA 3TJGA 6GSXA 5F0GA 3KZQA 3ED3A 3MYDA 4TOPA 1EOGA 4ZBDA 3H4KA 3CTGA 1JHBA 3ZFLA 1NM3A 1XFLA 4JEDA 3VK9A 5J4UA 3IRAA 1GUKA 3FK8A 3IOSA 3PINA 4PGTA 3GMFA 3CRTA 4PQHA 2VCZA 3ERGA 3HCZA 4F0CA 3QDNA 1OC9A 1J0FA 4Q5QA 2UZ8A 5DJLA 3HXSA 1U88A 1YQ1A 2DMLA 2C0FA 2VLVA 2GSQA 1O81A 2O87A 4TR1B 3GUSA 3VURA 3EINA 1GTUA 3VWXA 3H8QA 4EE0A 4CDOA 3GKXA 2C0EA 4K2XA 1O6JA 1K0CA 5CRHA 1K3YA 4CW9A 1ZYNA 2B5YA 1HQOA 3HD5A 1XWAA 3MSZA 2IMKA 3M9KA 1GUMA 5F06A 3ZRDA 1GRXA 5HFKA 1Z6NA 3UARA 5DCGA 1XW5A 4O7HA 3APSA 2H66A 5EVOA 2MZCA 2LKUA 4EIQA 3GKKA 2P5RA 3I69A 1SKRB 2ZCTA 4Q5RA 5EY6A 4TN8A 17GSA 4WXTA 2B7JA 2FWFA 3APQA 4NAXA 4ZBBA 2LQOA 4HDEA 2RUFA 1SYXA 1V40A 3HJMA 4YQMA 3GL3A 3FZ5A 2H73A 2LUSA 3VWUA 2F9SA 1JZWA 2VLUA 1VF4A 4XHMA 3FW2A 4WBJA 3W8SA 1N8JA 3G9BA 4MF6A 4ISDA 4PNGA 2LNTA 2FHEA 3TCOA 1F6MC 4L0UA 3TKSC 3GRXA 2QSIA 5DCHA 2O85A 2V1MA 2FY6A 3ERFA 5B8AA 1E6BA 4NV5A 1M99A 5IPHA 2EC4A 3FKFA 2V6KA 2H01A 4GSTA 3V1WA 5IOXA 5IMZA 5D9VA 1ST9A 1KTEA 2REMA 4D73A 4ULXA 3H1NA 2XPEA 4MABA 3D4TA 2KOKA 5ECSA 4HJMA 1B4QA 1URMA 3W6GA 5B6MA 3HA9A 1PMTA 3P7XA 2HRNA 2AYTA 1B9YC 2NVLA 1W89A 1R7HA 2C4JA 4KE3A 4ZL9A 2YOIA 4GWRA 1XG8A 1PKZA 4O92A 1XW6A 1HNBA 4EDYA 1OKTA 2DKHA 3LGCA 3O76A 3UOMA 5G31A 3H79A 4NPBA 3KH7A 3UBKA 1DSBA 2HSMA 2RLIA 1PKWA 3GN3A 1ZGNA 1SL2B 2VL2C 2OJLA 2MMOA 5KOWA 2B1KA 3HHVA 3CMIA 1YEXA 1SENA 3CBUA 1UA5A 2LRTA 1SJIA 3GURA 1LU4A 2HT9A 4ECBA 11GSA 1AXDA 4BL7A 4TW5A 1SKWB 1EWXA 2I4AA 3IA1A 4N11A 1AUCA 2H0GA 2X99A 1EEMA 2DJKA 3P8WA 4F03A 2J23A 4MMMA 4IQ1A 2DLXA 4KCEA 4DEJA 5D9XA 1PN9A 2G0FA 2YZUA 1TRUA 1X9SB 1EV9A 3JCML 4MK3A 2GQLA 2QKEA 2ALBA 2GSTA 4LL1B 1QQ2A 3A2XA 3KXOA 3A2VA 5ENUA 1M2AA 4HU9A 5DQSA 3RHCA 2PVOC 1J9BA 5AGYA 3IBHA 3EC3A 2TIRA 1NSWA 4EIPA 3G7YA 2K6VA 3PH9A 2FNOA 2FWGA 3MWHA 1VGLA 3BD2A 2GZPA 2O8VB 4WR5A 3UL3A 1UC7A 2GSRA 2VIMA 1TRVA 3PPUA 4ACSA 4GQFA 4ZL7A 3APOA 1S3DA 3D22A 4LLRA 1WE0A 3TKPA 2K8SA 4Z2UA 1GSEA 3TJBA 3IC8A 1QUWA 4XIHA 1M2BA 4JR6A 1PRXA 4ZB6A 4ZL8A 1M3IA 4L0WA 3TJKA 2MMNA 5DVBA 3S9FA 3FR9A 3ZYWA 4YH2A 4I8BA 4JZQA 1K3LA 1XCCA 4G9HA 3VI7A 5FWGA 2LRCA 4QQ7A 2ES7A 4QL7A 2KP2A 5A4VA 4MF5A 4N0VA 2YV7A 2L4QA 4GQCA 4IN0A 2IN3A 4CHSA 3LSZA 4J57E 1PSQA 1OVNA 4V2MA 1BX9A 2H6XA 3FZAA 3QPMA 3L9SA 3LYPA 1A0RP 5AN1A 3FMWA 4WEYA 4H86A 3ZMKA 4KUNA 3D21A 3FHKA 1K0BA 4F82A 5H5RA 3C1SA 4LA1A 4IS0A 3HVVA 6GSYA 2BTOT 4G10A 3ZVJA 3MNGA 2O7KA 3DGQA 3DMLA 2H8LA 4WR4A 5GAND 4YAVA 4JE1A 3GSTA 3KEBA 2YJHA 4IVFA 4RQXA 4KW6A 3RHBA 3EURA 1F37A 1A8YA 1TKDB 5J41A 2TRCP 1XZOA 1O85A 5D93A 1OC8A 3C7MA 4PURA 3VWVA 4OWYA 4O5QA 3L9VA 1NHYA 2DJJA 5INYA 3KIJA 5JCWA 2MMAA 2WZ9A 1X0RA 2R0PA 1X5EA 2A2RA 4WF4A 1M9BA 4KDUA 5BMUA 1O73A 2A4HA 3EU4A 1C72A 2HSHA 2IMFA 3QAWA 4CY8A 4MPGA 1N2AA 3FEUA 1T4ZA 2YNXA 2CVKA 2HYXA 4Z2TA 3M1GA 5B8BA 1H75A 2R6KA 2L57A 4YKGA 3BBYA 5IMVA 3M8NA 3DEXA 1OYJA 1RW1A 3WT1A 1SJZA 3VPTA 2IMEA 3UIWA 1PX6A 1FW1A 2YN1A 4EF0A 19GSA 2AV4A 2GSSA 4RQRA 3CQFA 5BRTA 4DVCA 4MF7A 1GTIA 3I9V2 4ICYA 3P90A 5EL8A 2CA8A 2PERA 2VL3A 2JL4A 5F07A 3L9UA 5FT3A 1EZKA 1OC3A 1FOVA 4GTUA 1G6YA 2YWOA 1K0AA 5HR2A 5KN2A 3F3QA 3E9JB 5D96A 2B5XA 1R4WA 2P5QA 3UVHA 5G1LA 4BIKA 2B1LA 3IAS2 1K0NA 2JZRA 3LEFA 3OR5A 2B5EA 4GLTA 5J9BA 1R5PA 3LWAA 1JZOA 1TU7A 1KNGA 2H1DA 3TGZA 2G2QA 3F4TA 1JZRA 4ECCA 1ERWA 2I9HA 3LORA 2VCVA 5DAKB 4OFTA 3DD3A 4AJ6A 2JZSA 3ME8A 4YAPA 3CYNA 2PUKC 3LQ7A 4KA0A 4FO5A 1TU8A 1WIKA 4RUVA 3N9JA 5LD0A 4DSRA 1WRYA 1LJRA 3AY8A 1DUGA 3A5IA 4I6XA 3DIEA 4K2DA 1M7TA 2ON5A 6GSVA 2PN8A 3C1RA 3EMXA 3HYPA 3CSJA 4MJEA 5A5KA 1WJKA 4AJ7A 4KH7A 1GLQA 1YZXA 2F3MA 3QAGA 2GT5A 4MCUA 1ZZYA 3VWWA 1Z9HA 1GNEA 5JCGA 2LJAA 2YCDA 2XBIA 3GA4A 2H74A 4TXOA 2O89A 3C73A 1ERTA 2MBTA 3RDWA 2C8UA 2H1AA 2ON7A 4DSQA 2DIYA 2DIZA 2NTOA 2R2JA 2R4VA 1Z7RA 3ZTLA 4Z7XA 3UVTA 3BCKA 4WBRD 2H0IA 2JADA 4KCAA 1PQNA 2IL3A 2MMZA 4N0ZA 4K5RA 2QA2A 3TDGA 1XWGA 3EVIA 5CRWA 3WD6A 1XIYA 1GP1A 1M0UA 4FYCA 5CO3A 2C0GA 3Q19A 1SYRA 2BMXA 3IK7A 1ZL9A 4FH8A 1BAYA 1H4OA 3BCIA 2NDOA 1PX7A 1ERVA 4ECJA 2OBKA 1QXHA 3KP8A 5CRGA 1TJDA 5ECOB 2F8FA 4NHWA 2R37A 2YWNA 2K8VA 1YEPA 3ZITA 5IPGA 3IXRA 1MDKA 3HVNA 5ECMB 2GDRA 1BG5A 2H19A 2DBCA 1AW9A 1TW9A 4HOJA 1GUHA 1DE2A 3KJYA 2AB6A 4NWYA 1FB0A 5ECQB 4I97A 3LFLA 5ECLB 1XVWA 2LRNA 4ZIJA 1V57A 1EOHA 2RM6A 4TR4A 5HR3A 2C3QA 3U6VA 3H93A 1UVZA 5JWQB 1O8WA 2P31A 1XWCA 4KSOA 1DE1A 2GS3A 4XS4A 4KX4A 2HZFA 1KBNA 2L5LA 2JU5A 1I9DA 5C00A 3QCPA 2R0CA 1U6TA 3TB2A 1SKSB 4KSMA 1B48A 4NXIA 2DSAA 5IO2A 2FA8A 14GSA 1XOAA 3LJRA 3F3RA 3HDCA 3HZ4A 2B3SA 2H6YA 3TRQA 1FB6A 1PFOA 3DXBA 4V1Ag 2HSYA 4MZCA 1JZDA 5GAPD 4V2NA 5B7CA 4TXOB 2XBQA 4OD7A 2C3TA 4JRRA 1CQGA 4JBBA 3WT2A 3L78A 9GSSA 4EC0A 4CY6A 5F05A 2E0QA 4XRDA 1HNCA 4I5QA 3KM6A 2YV9A 4KDYA 3M3MA 5D73A 3F9UA 4KGIA 3IR4A 3FZ9A 1BJXA 1MTCA 3D4MA 4I2TA 4K1FA 1EGOA 1YKAA 3G7JA 2WGRA 5IO0A 2KHPA 1GSQA 4TRXA 2NPBA 4IBPA 2A2PA 4X0XA 3R3EA 3IV4A 4IKHA 1GL8A 2L6CA 2HRKA 1X5CA 4WETA 4G2EA 1EP7A 2IWTA 4AJ8A 3GX8A 1ML6A 3VPQA 4IHUA 2VCQA 3GIXA 3HY2A 2VUPA 2CT6A 5IMCA 3GSSA 4X1UA 1EEJA 1TTZA 3TJJA 2OA7A 1K0MA 1M9AA 5KN1A 3LG6A 1Y25A 1G7OA 2LSTA 1IYHA 2RUEA 4MJBA 4N30A 4ML6A 4EUYA 4POBA 2GLRA 2GQKA 5ECPB 4HI7A 1K0DA 2FLSA 3ZMLA 2EIQA 5D8IA 1IYIA 3Q18A 1AAZA 3TKSE 5AISA 4A5PA 1TRSA 3F4RA 4MZWA 2E2MA 3L4NA 4MZBA 1K0OA 4G0IA 6GSWA 3O3TA 3VI5A 4LMVA 4EDZA 4K6XA 2M80A 5AIVA 2A4VA 2LJRA 1WP0A
chains in the Genus database with same CATH topology
2H75A 3FY7A 2CAIA 4XS4B 1T4YA 1SK1A 3HJPA 4HUAA 4XRAA 3TOUA 3M9JA 3DYRA 4ECIA 2X49A 5C04A 1TK5B 2PMTA 4NMUA 13GSA 2HXKA 1XOBA 2IPAA 3Q74A 1YY7A 2FD3A 1T1VA 2GQMA 1FVJA 3TRPA 2FWEA 3GHAA 2L6DA 5KEJA 3QAVA 1SD8A 4L5LA 2PU9C 4BVXA 4TVEA 2WB9A 3C71A 4EO3A 4USSA 4ZBAA 5ELAA 2F8AA 5DAKA 5JWOB 2DJ2A 1M2DA 4K7NA 2H72A 1TRWA 1LBKA 1R26A 2OE0A 3RAZA 1A2LA 4KF9A 3FZ4A 2JACA 4OFNA 2DMMA 5GZZB 2LJKA 5IM9A 1GTBA 2R3XA 1EGRA 5ECIB 5DQYA 2R0GA 4TR3A 1F3BA 4LMWA 4K5SA 5DBQA 1VF1A 4PXOA 1MD4A 4FYUA 22GSA 2OBIA 5G30A 1AQWA 2N5AA 3WGXA 2N5FA 3FRCA 1GSFA 2LS5A 1Z6MA 4V1Ap 4ZXGA 3KH9A 1ZCPA 1J08A 2XPDA 1I5GA 1TP9A 4FIWA 1GLPA 1RQMA 1B9XC 5E59A 4WKWA 1BQ7A 4WF5A 5HR0A 1Z5YE 3DKSA 1QK8A 2X8HA 2VL9A 1TOFA 2CAQA 1SD9A 4ZILA 3MIXA 1ZMAA 4KNDA 3ERWA 3US3A 4RI7A 1XVQA 4AF2A 1F2EA 5A4WA 3GFKA 2GTUA 3ZL5A 1YF1A 1AQXA 4V2LA 2X8CA 1R5AA 3N5OA 4MA9A 2RM5A 4PQ1A 4TR0A 1VF3A 5ABRA 5IOWA 10GSA 1FO5A 2CVBA 1JFUA 2WULA 2KLXA 5ECRB 4EL1A 3FYGA 8GSSA 2VCWA 1JLVA 2HFDA 1G7EA 5A4UA 4IJ3A 4PTSA 1OKDA 1QFNA 4DSSB 2WFCA 1PA3A 4HU7A 2ZNMA 1A23A 16GSA 1THOA 3IPZA 4K7IA 2CX3A 1A2JA 2IIYA 2QC7A 2VOCA 4JR4A 4MP4A 3LW9A 3GNJA 4BVXB 2LQQA 1PGTA 3NIVA 2DKIA 5GSSA 1MDIA 1BYEA 2EIRA 2TRXA 2YWMA 4ML1A 4MH3A 4OO4A 2BJXA 2CVDA 2PBJA 5HFIA 1NHOA 3QOUA 2RIIA 3UBLA 1FVKA 1A0FA 3GV1A 3EPTA 1HYUA 4JU5A 3Q6OA 1FOHA 3GYKA 3LXTA 5H5QA 2EIOA 4GSNA 1YDKA 2YPMA 1T00A 2E2GA 5ECHB 4XS6A 5KN3A 1A24A 5ID2A 2VD1A 1E2YA 2YWIA 2AAWA 3F63A 2H0HA 3EYTA 4K9ZA 4K7OA 2H71A 3GTUB 2HZEB 3TKRA 12GSA 1Y6EA 4OMVA 4GRFA 5CP1A 1U87A 4L5OA 1EP8A 3KMNA 4MPFA 3CTFA 5G1KA 3QFAC 4YQUA 4GF0A 4F0BA 2OADA 5D9TA 2JZTA 4NV2A 1OE8A 1V9WA 4G0LA 2GT6A 5CRDA 2QGVA 5IMDA 4K0NA 1GNWA 3IK9A 2I81A 3GKMA 1GULA 20GSA 3EMPA 4GSSA 2B7KA 1GH2A 2VM1A 4XS1A 3ME7A 3IE3A 5LNKe 3D6IA 2PWJA 2H76A 4HQZA 2AUVA 2IFQB 4L8EA 3K8NA 3ZIJA 4HJ2A 3UAPA 3TUEA 2WDUA 1TXXA 2CZ2A 2PPTA 1Q98A 4ZB9A 2B6MA 4IELA 5J5NA 1MDJA 4F9ZA 4QL9A 2HNLA 1O8XA 1RK4A 1TI1A 3TRXA 2QA1A 5G5EA 3UMAA 2NBSA 3TJFA 3CSHA 2OACA 3KGKA 2IJYA 1A2MA 3J7Yk 3UEMA 4F2IA 2JSYA 3MAKA 1WOUA 5IQYA 3ZZXA 1O7UA 4YQVA 1B8XA 3QR6A 3HKRA 2X8GA 4O32A 2D2ZA 2WS2A 3LXZA 4EXJA 4X4JA 4O5RA 4POMA 3U5RE 4J56E 1ZYPA 2C80A 4IJIA 3TKSA 4X43A 3DVXA 1G6WA 1WWJA 2FCHA 5G2ZA 3E3EA 2FA4A 4FYBA 2HI7A 3IDVA 4XTSA 1K3OA 2XC2A 2CZ3A 1Q4JA 5ID2B 5CYYA 2I1UA 2X64A 4IW9A 4MNNA 2X4AA 4HEA2 4GXZA 1ZOFA 3GX0A 2LNSA 1VRSD 1MD3A 2LTKA 3IC4A 5DDLA 3IHQA 2Z9SA 5CNWA 2H1BA 1XXUA 4HS1A 2VD0A 2IMDA 3WGDA 1Z7PA 2V2GA 2VLTA 1GSSA 2PVQA 1YKCA 1X9WB 3O6TA 3F8UA 1OC9B 1HNAA 2GVPA 5EPFA 1T7PB 1XBSA 2OKAA 1ERUA 1GSUA 2C1YA 1ILOA 1W4VA 3VFIA 4BPYA 1GTAA 2A2SA 3A2WA 3I6AA 3J7Yb 2L59A 3R2QA 2VAFA 2C0DA 4HQSA 3WGEA 2VL2A 1U3AA 1S3AA 4FQUA 3CRUA 3RPPA 3F4SA 5L71A 6GSSA 3QD9A 5ECNB 3ZVJD 2M72A 1V58A 5HR1A 5CREA 2IMIA 3KP9A 2L5OA 4O5UA 2H1GA 3CSIA 2DC5A 3KCMA 1BEDA 5HQPA 4J2FA 1ZYEA 2GZYA 4PX1A 4TXVA 3C8EA 3EE2A 4BVYA 3BJ5A 5J3RA 3IAM2 5DALA 1PN0A 1Z3EA 1GSYA 2V6OA 2CV4A 3ZIVA 3KD0A 2H30A 5J9CA 1TK8B 2YJ7A 1UN2A 7GSSA 5IMFA 2GGTA 1EV4A 2KUCA 4POLA 5GSTA 1QGVA 1ON4A 4KAEA 5G5FA 2K9FA 2P0GA 4G19A 1JLWA 1YF0A 3L0HA 3W8JA 5COHA 1TDIA 1SJ6A 1SL1B 2E7PA 2DJ3A 1PL2A 2WCIA 4I2UA 5IIZA 3PGTA 3GL5A 2V41A 3QFBC 1OE7A 4ZB8A 1WPIA 4D73B 3F6DA 1X9MB 2MBSA 1ACVA 2HRFA 2WRTA 3FR6A 4IQAA 4OCEA 4IGJA 5ELGA 1SL0B 1S3CA 1SK0A 1T3BA 2FUG2 2L4CA 3F6FA 4PQIA 2K18A 2VCXA 4N10A 4DSSA 2AHEA 5AIXA 4P3YB 5IMAA 1PL1A 3BOAA 2YZHA 4E8HA 2H70A 4MLYA 2J9HA 4HZ4A 1MEKA 4G0KA 3VLNA 4Q5NA 4IP6A 1HD2A 2OE3A 2I3YA 1AIUA 5DJMA 3G7IA 3HVXA 3ZFBA 3RPNA 3ZREA 3IHGA 2M46A 2KP1A 1SU9A 4YKFA 1U3IA 5F8BA 6GSTA 5ECKB 3DVWA 4E8EA 3HVSA 5KN0A 1F3AA 1FG4A 2JSZA 3EWLA 2OE1A 4BL7B 3FR3A 3ZLPA 1X5DA 3GKNA 1PD21 2LV3A 1A8LA 4MJCA 4ID0A 3GTUA 2C3NA 2HZEA 3M0FA 1SK2A 2FWHA 2V32A 2CX4A 4XCSA 4PNFA 4POKA 2PGTA 1ABAA 4BVYB 2HE3A 4BWQA 1AC1A 5DALB 3HJOA 3A5WA 1QMVA 1CQHA 1XWBA 5FHIA 4Z2RA 3D0ZA 3GH6A 2GZZA 1THXA 1FHEA 4K8MA 2HLSA 3E0UA 3SBCA 4TR1A 1G0TA 3QMXA 1DBYA 2H6ZA 4IP1A 5LCZA 3NOFA 1KEBA 1ZYQB 3KTBA 1XW9A 3TKQA 5CAXA 2F51A 4BA7A 5JWRB 2FGXA 4MJAA 2N5BA 2ZUPA 3KTLA 5E4WA 4K0GA 2CQ9A 1GSDA 2XHFA 1USBA 4KDXA 4OO5A 2WJUA 3DRNA 2IFQA 2HRAA 5JCUA 1AQVA 4LL4B 2YANA 4ILFA 1XWKA 5KOXA 4RI6A 1V98A 4AGSA 4EKZA 3SWLA 1NW2A 5H5SA 1YJ6A 1T8EB 1FAAA 1WMJA 3WYWA 4MDCA 5HFGA 3MDKA 6GSUA 3NZNA 3TOTA 2DJ0A 3CXGA 2DJ1A 3LYKA 3UJ1A 3ISOA 18GSA 1F9MA 3DWVA 2VO4A 1GWCA 2VCTA 3RBTA 3F0IA 2LEGA 2VM2A 3A3TA 1TK0B 2MYGA 2YP6A 2R5GA 4HZ2A 3P2AA 4GCIA 4TKYA 1V2AA 5D9WA 1B4PA 3D5JA 3GH9A 4OCFA 3EU3A 1VF2A 2AJQB 5B6NA 4MH2A 4KB3A 4PUFC 1TI3A 4BWSA 4EVMA 3PR8A 3HZ8A 4PUAA 3KMOA 4NHZA 1XPVA 3I43A 4OFMA 1OAZA 4Q5FA 3TJGA 6GSXA 5F0GA 3KZQA 3ED3A 3MYDA 4TOPA 1EOGA 4ZBDA 3H4KA 3CTGA 1JHBA 3ZFLA 1NM3A 1XFLA 4JEDA 3VK9A 5J4UA 3IRAA 1GUKA 3FK8A 3IOSA 3PINA 4PGTA 3GMFA 3CRTA 4PQHA 2VCZA 3ERGA 3HCZA 4F0CA 3QDNA 1OC9A 1J0FA 4Q5QA 2UZ8A 5DJLA 3HXSA 1U88A 1YQ1A 2DMLA 2C0FA 2VLVA 2GSQA 1O81A 2O87A 4TR1B 3GUSA 3VURA 3EINA 1GTUA 3VWXA 3H8QA 4EE0A 4CDOA 3GKXA 2C0EA 4K2XA 1O6JA 1K0CA 5CRHA 1K3YA 4CW9A 1ZYNA 2B5YA 1HQOA 3HD5A 1XWAA 3MSZA 2IMKA 3M9KA 1GUMA 5F06A 3ZRDA 1GRXA 5HFKA 1Z6NA 3UARA 5DCGA 1XW5A 4O7HA 3APSA 2H66A 5EVOA 2MZCA 2LKUA 4EIQA 3GKKA 2P5RA 3I69A 1SKRB 2ZCTA 4Q5RA 5EY6A 4TN8A 17GSA 4WXTA 2B7JA 2FWFA 3APQA 4NAXA 4ZBBA 2LQOA 4HDEA 2RUFA 1SYXA 1V40A 3HJMA 4YQMA 3GL3A 3FZ5A 2H73A 2LUSA 3VWUA 2F9SA 1JZWA 2VLUA 1VF4A 4XHMA 3FW2A 4WBJA 3W8SA 1N8JA 3G9BA 4MF6A 4ISDA 4PNGA 2LNTA 2FHEA 3TCOA 1F6MC 4L0UA 3TKSC 3GRXA 2QSIA 5DCHA 2O85A 2V1MA 2FY6A 3ERFA 5B8AA 1E6BA 4NV5A 1M99A 5IPHA 2EC4A 3FKFA 2V6KA 2H01A 4GSTA 3V1WA 5IOXA 5IMZA 5D9VA 1ST9A 1KTEA 2REMA 4D73A 4ULXA 3H1NA 2XPEA 4MABA 3D4TA 2KOKA 5ECSA 4HJMA 1B4QA 1URMA 3W6GA 5B6MA 3HA9A 1PMTA 3P7XA 2HRNA 2AYTA 1B9YC 2NVLA 1W89A 1R7HA 2C4JA 4KE3A 4ZL9A 2YOIA 4GWRA 1PKZA 4O92A 1XW6A 1HNBA 4EDYA 1OKTA 2DKHA 3LGCA 3O76A 3UOMA 5G31A 3H79A 4NPBA 3KH7A 3UBKA 1DSBA 2HSMA 2RLIA 1PKWA 3GN3A 1ZGNA 1SL2B 2VL2C 2OJLA 2MMOA 5KOWA 2B1KA 3HHVA 3CMIA 1YEXA 1SENA 3CBUA 1UA5A 2LRTA 1SJIA 3GURA 1LU4A 2HT9A 4ECBA 11GSA 1AXDA 4BL7A 4TW5A 1SKWB 1EWXA 2I4AA 3IA1A 4N11A 1AUCA 2H0GA 2X99A 1EEMA 2DJKA 3P8WA 4F03A 2J23A 4MMMA 4IQ1A 2DLXA 4KCEA 4DEJA 5D9XA 1PN9A 2G0FA 2YZUA 1TRUA 1X9SB 1EV9A 3JCML 4MK3A 2GQLA 2QKEA 2ALBA 2GSTA 4LL1B 1QQ2A 3A2XA 3KXOA 3A2VA 5ENUA 1M2AA 4HU9A 5DQSA 3RHCA 2PVOC 1J9BA 5AGYA 3IBHA 3EC3A 2TIRA 1NSWA 4EIPA 3G7YA 2K6VA 3PH9A 2FNOA 2FWGA 3MWHA 1VGLA 3BD2A 2GZPA 2O8VB 4WR5A 3UL3A 1UC7A 2GSRA 2VIMA 1TRVA 3PPUA 4ACSA 4GQFA 4ZL7A 3APOA 1S3DA 3D22A 4LLRA 1WE0A 3TKPA 2K8SA 4Z2UA 1GSEA 3TJBA 3IC8A 1QUWA 4XIHA 1M2BA 4JR6A 1PRXA 4ZB6A 4ZL8A 3TJKA 4L0WA 2MMNA 5DVBA 3S9FA 3FR9A 3ZYWA 4YH2A 4I8BA 4JZQA 1K3LA 1XCCA 4G9HA 3VI7A 5FWGA 2LRCA 4QQ7A 2ES7A 4QL7A 2KP2A 5A4VA 4MF5A 4N0VA 2YV7A 2L4QA 4GQCA 4IN0A 2IN3A 4CHSA 3LSZA 4J57E 1PSQA 1OVNA 4V2MA 1BX9A 2H6XA 3FZAA 3QPMA 3L9SA 3LYPA 1A0RP 5AN1A 3FMWA 4WEYA 4H86A 3ZMKA 4KUNA 3D21A 3FHKA 1K0BA 4F82A 5H5RA 3C1SA 4LA1A 4IS0A 3HVVA 6GSYA 2BTOT 4G10A 3ZVJA 3MNGA 2O7KA 3DGQA 3DMLA 2H8LA 4WR4A 5GAND 4YAVA 4JE1A 3GSTA 3KEBA 2YJHA 4IVFA 4RQXA 4KW6A 3RHBA 3EURA 1F37A 1A8YA 1TKDB 5J41A 2TRCP 1XZOA 1O85A 5D93A 1OC8A 3C7MA 4PURA 3VWVA 4OWYA 4O5QA 3L9VA 1NHYA 2DJJA 5INYA 3KIJA 5JCWA 2MMAA 2WZ9A 1X0RA 2R0PA 1X5EA 2A2RA 4WF4A 1M9BA 4KDUA 5BMUA 1O73A 2A4HA 3EU4A 1C72A 2HSHA 2IMFA 3QAWA 4CY8A 4MPGA 1N2AA 3FEUA 1T4ZA 2YNXA 2CVKA 2HYXA 4Z2TA 3M1GA 5B8BA 1H75A 2R6KA 2L57A 4YKGA 3BBYA 5IMVA 3M8NA 3DEXA 1OYJA 1RW1A 3WT1A 1SJZA 3VPTA 2IMEA 3UIWA 1PX6A 1FW1A 2YN1A 4EF0A 19GSA 2AV4A 2GSSA 4RQRA 5BRTA 4DVCA 4MF7A 1GTIA 3I9V2 4ICYA 3P90A 5EL8A 2CA8A 2PERA 2VL3A 2JL4A 5F07A 3L9UA 5FT3A 1EZKA 1OC3A 1FOVA 4GTUA 1G6YA 2YWOA 1K0AA 5HR2A 5KN2A 3F3QA 3E9JB 5D96A 2B5XA 1R4WA 2P5QA 3UVHA 5G1LA 2B1LA 3IAS2 1K0NA 2JZRA 3LEFA 3OR5A 2B5EA 4GLTA 5J9BA 1R5PA 3LWAA 1JZOA 1TU7A 1KNGA 2H1DA 3TGZA 2G2QA 3F4TA 1JZRA 4ECCA 1ERWA 2I9HA 3LORA 2VCVA 5DAKB 4OFTA 3DD3A 4AJ6A 2JZSA 3ME8A 4YAPA 3CYNA 2PUKC 3LQ7A 4KA0A 4FO5A 1TU8A 1WIKA 4RUVA 3N9JA 5LD0A 4DSRA 1WRYA 1LJRA 3AY8A 1DUGA 3A5IA 4I6XA 3DIEA 4K2DA 1M7TA 2ON5A 6GSVA 2PN8A 3C1RA 3EMXA 3HYPA 3CSJA 4MJEA 5A5KA 1WJKA 4AJ7A 4KH7A 1GLQA 1YZXA 2F3MA 3QAGA 2GT5A 4MCUA 1ZZYA 3VWWA 1Z9HA 1GNEA 5JCGA 2LJAA 2YCDA 2XBIA 3GA4A 2H74A 4TXOA 2O89A 3C73A 1ERTA 2MBTA 3RDWA 2C8UA 2H1AA 2ON7A 4DSQA 2DIYA 2DIZA 2NTOA 2R2JA 2R4VA 1Z7RA 3ZTLA 4Z7XA 3UVTA 3BCKA 4WBRD 2H0IA 2JADA 4KCAA 1PQNA 2IL3A 2MMZA 4N0ZA 4K5RA 2QA2A 3TDGA 1XWGA 3EVIA 5CRWA 3WD6A 1XIYA 1GP1A 1M0UA 4FYCA 5CO3A 2C0GA 3Q19A 1SYRA 2BMXA 3IK7A 1ZL9A 4FH8A 1BAYA 1H4OA 3BCIA 2NDOA 1PX7A 1ERVA 4ECJA 2OBKA 1QXHA 3KP8A 5CRGA 1TJDA 5ECOB 2F8FA 4NHWA 2R37A 2YWNA 2K8VA 1YEPA 3ZITA 5IPGA 3IXRA 1MDKA 5ECMB 2GDRA 1BG5A 2H19A 2DBCA 1AW9A 1TW9A 4HOJA 1GUHA 1DE2A 3KJYA 2AB6A 4NWYA 1FB0A 5ECQB 4I97A 3LFLA 5ECLB 1XVWA 2LRNA 4ZIJA 1V57A 1EOHA 2RM6A 4TR4A 5HR3A 2C3QA 3U6VA 3H93A 1UVZA 5JWQB 1O8WA 2P31A 1XWCA 4KSOA 1DE1A 2GS3A 4XS4A 4KX4A 2HZFA 1KBNA 2L5LA 2JU5A 1I9DA 5C00A 3QCPA 2R0CA 1U6TA 3TB2A 1SKSB 4KSMA 1B48A 4NXIA 2DSAA 5IO2A 2FA8A 14GSA 1XOAA 3LJRA 3F3RA 3HDCA 3HZ4A 2B3SA 2H6YA 3TRQA 1FB6A 3DXBA 4V1Ag 2HSYA 4MZCA 1JZDA 5GAPD 4V2NA 5B7CA 4TXOB 2XBQA 4OD7A 2C3TA 4JRRA 1CQGA 4JBBA 3WT2A 3L78A 9GSSA 4EC0A 4CY6A 5F05A 2E0QA 4XRDA 1HNCA 4I5QA 3KM6A 2YV9A 4KDYA 3M3MA 5D73A 3F9UA 4KGIA 3IR4A 3FZ9A 1BJXA 1MTCA 3D4MA 4I2TA 4K1FA 1EGOA 1YKAA 3G7JA 2WGRA 5IO0A 2KHPA 1GSQA 4TRXA 2NPBA 4IBPA 2A2PA 4X0XA 3R3EA 3IV4A 4IKHA 1GL8A 2L6CA 2HRKA 1X5CA 4WETA 4G2EA 1EP7A 2IWTA 4AJ8A 3GX8A 1ML6A 3VPQA 4IHUA 2VCQA 3GIXA 3HY2A 2VUPA 2CT6A 5IMCA 3GSSA 4X1UA 1EEJA 1TTZA 3TJJA 2OA7A 1K0MA 1M9AA 5KN1A 3LG6A 1Y25A 1G7OA 2LSTA 1IYHA 2RUEA 4MJBA 4N30A 4ML6A 4EUYA 4POBA 2GLRA 2GQKA 5ECPB 4HI7A 1K0DA 2FLSA 3ZMLA 2EIQA 5D8IA 1IYIA 3Q18A 1AAZA 3TKSE 5AISA 4A5PA 1TRSA 3F4RA 4MZWA 2E2MA 3L4NA 4MZBA 1K0OA 4G0IA 6GSWA 3O3TA 3VI5A 4LMVA 4EDZA 4K6XA 2M80A 5AIVA 2A4VA 2LJRA 1WP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H75 A;  3FY7 A;  2CAI A;  4XS4 B;  1T4Y A;  1SK1 A;  3HJP A;  4HUA A;  4XRA A;  3TOU A;  3M9J A;  3DYR A;  4ECI A;  5C04 A;  1TK5 B;  2PMT A;  4NMU A;  13GS A;  2HXK A;  1XOB A;  2IPA A;  3Q74 A;  1YY7 A;  2FD3 A;  1T1V A;  2GQM A;  1FVJ A;  3TRP A;  2FWE A;  3GHA A;  2L6D A;  5KEJ A;  3QAV A;  1SD8 A;  4L5L A;  2PU9 C;  4BVX A;  4TVE A;  2WB9 A;  3C71 A;  4EO3 A;  4ZBA A;  5ELA A;  2F8A A;  5DAK A;  5JWO B;  2DJ2 A;  1M2D A;  4K7N A;  2H72 A;  1TRW A;  1LBK A;  1R26 A;  2OE0 A;  3RAZ A;  1A2L A;  3FZ4 A;  2JAC A;  4OFN A;  2DMM A;  5GZZ B;  2LJK A;  5IM9 A;  1GTB A;  2R3X A;  1EGR A;  5ECI B;  5DQY A;  4TR3 A;  1F3B A;  4LMW A;  5DBQ A;  1VF1 A;  4PXO A;  1MD4 A;  4FYU A;  22GS A;  2OBI A;  5G30 A;  1AQW A;  2N5A A;  3WGX A;  2N5F A;  3FRC A;  1GSF A;  2LS5 A;  1Z6M A;  4V1A p;  4ZXG A;  3KH9 A;  1ZCP A;  1J08 A;  2XPD A;  1I5G A;  1TP9 A;  4FIW A;  1GLP A;  1RQM A;  1B9X C;  5E59 A;  4WKW A;  1BQ7 A;  4WF5 A;  5HR0 A;  1Z5Y E;  3DKS A;  1QK8 A;  2X8H A;  2VL9 A;  1TOF A;  2CAQ A;  1SD9 A;  4ZIL A;  1ZMA A;  4KND A;  3ERW A;  3US3 A;  4RI7 A;  1XVQ A;  4AF2 A;  1F2E A;  5A4W A;  3GFK A;  2GTU A;  3ZL5 A;  1YF1 A;  1AQX A;  4V2L A;  2X8C A;  1R5A A;  3N5O A;  4MA9 A;  2RM5 A;  4PQ1 A;  4TR0 A;  1VF3 A;  5ABR A;  5IOW A;  10GS A;  1FO5 A;  2CVB A;  1JFU A;  2WUL A;  2KLX A;  5ECR B;  4EL1 A;  3FYG A;  8GSS A;  2VCW A;  1JLV A;  2HFD A;  1G7E A;  5A4U A;  4IJ3 A;  1OKD A;  1QFN A;  4DSS B;  2WFC A;  1PA3 A;  4HU7 A;  2ZNM A;  1A23 A;  16GS A;  1THO A;  3IPZ A;  4K7I A;  2CX3 A;  1A2J A;  2IIY A;  2QC7 A;  2VOC A;  4JR4 A;  4MP4 A;  3GNJ A;  2LQQ A;  1PGT A;  3NIV A;  5GSS A;  1MDI A;  1BYE A;  2EIR A;  2TRX A;  2YWM A;  4ML1 A;  4MH3 A;  4OO4 A;  2BJX A;  2CVD A;  2PBJ A;  5HFI A;  1NHO A;  3QOU A;  2RII A;  3UBL A;  1FVK A;  1A0F A;  3GV1 A;  1HYU A;  4JU5 A;  3Q6O A;  3GYK A;  3LXT A;  5H5Q A;  2EIO A;  4GSN A;  1YDK A;  2YPM A;  1T00 A;  2E2G A;  5ECH B;  4XS6 A;  5KN3 A;  1A24 A;  5ID2 A;  2VD1 A;  1E2Y A;  2YWI A;  2AAW A;  3F63 A;  2H0H A;  3EYT A;  4K9Z A;  4K7O A;  2H71 A;  3GTU B;  2HZE B;  3TKR A;  12GS A;  1Y6E A;  4OMV A;  4GRF A;  5CP1 A;  1U87 A;  4L5O A;  1EP8 A;  3KMN A;  4MPF A;  3CTF A;  5G1K A;  3QFA C;  4YQU A;  4GF0 A;  4F0B A;  2OAD A;  5D9T A;  2JZT A;  4NV2 A;  1OE8 A;  1V9W A;  2GT6 A;  5CRD A;  2QGV A;  5IMD A;  4K0N A;  1GNW A;  3IK9 A;  2I81 A;  3GKM A;  1GUL A;  20GS A;  3EMP A;  4GSS A;  2B7K A;  1GH2 A;  2VM1 A;  4XS1 A;  3ME7 A;  3IE3 A;  5LNK e;  3D6I A;  2PWJ A;  2H76 A;  4HQZ A;  2AUV A;  2IFQ B;  4L8E A;  3K8N A;  3ZIJ A;  4HJ2 A;  3UAP A;  3TUE A;  2WDU A;  1TXX A;  2CZ2 A;  2PPT A;  1Q98 A;  4ZB9 A;  2B6M A;  4IEL A;  5J5N A;  1MDJ A;  4F9Z A;  4QL9 A;  2HNL A;  1O8X A;  1RK4 A;  1TI1 A;  3TRX A;  5G5E A;  3UMA A;  2NBS A;  3TJF A;  3CSH A;  2OAC A;  3KGK A;  2IJY A;  1A2M A;  3J7Y k;  3UEM A;  4F2I A;  2JSY A;  3MAK A;  1WOU A;  5IQY A;  3ZZX A;  1O7U A;  4YQV A;  1B8X A;  3QR6 A;  3HKR A;  2X8G A;  4O32 A;  2D2Z A;  2WS2 A;  3LXZ A;  4EXJ A;  4O5R A;  4POM A;  3U5R E;  4J56 E;  2C80 A;  4IJI A;  3TKS A;  4X43 A;  3DVX A;  1G6W A;  1WWJ A;  2FCH A;  5G2Z A;  3E3E A;  2FA4 A;  4FYB A;  2HI7 A;  3IDV A;  4XTS A;  1K3O A;  2XC2 A;  2CZ3 A;  1Q4J A;  5ID2 B;  5CYY A;  2I1U A;  2X64 A;  4IW9 A;  4HEA 2;  4GXZ A;  1ZOF A;  3GX0 A;  2LNS A;  1VRS D;  1MD3 A;  2LTK A;  3IC4 A;  5DDL A;  3IHQ A;  2Z9S A;  5CNW A;  2H1B A;  1XXU A;  4HS1 A;  2VD0 A;  2IMD A;  3WGD A;  1Z7P A;  2V2G A;  2VLT A;  1GSS A;  2PVQ A;  1YKC A;  1X9W B;  3O6T A;  3F8U A;  1OC9 B;  1HNA A;  2GVP A;  5EPF A;  1T7P B;  1XBS A;  2OKA A;  1ERU A;  1GSU A;  2C1Y A;  1ILO A;  1W4V A;  3VFI A;  4BPY A;  1GTA A;  2A2S A;  3A2W A;  3I6A A;  3J7Y b;  2L59 A;  3R2Q A;  2VAF A;  2C0D A;  4HQS A;  3WGE A;  2VL2 A;  1U3A A;  1S3A A;  3CRU A;  3RPP A;  3F4S A;  5L71 A;  6GSS A;  3QD9 A;  5ECN B;  3ZVJ D;  2M72 A;  1V58 A;  5HR1 A;  5CRE A;  2IMI A;  3KP9 A;  2L5O A;  2H1G A;  3CSI A;  2DC5 A;  3KCM A;  1BED A;  5HQP A;  4J2F A;  1ZYE A;  2GZY A;  4PX1 A;  4TXV A;  3C8E A;  3EE2 A;  4BVY A;  3BJ5 A;  5J3R A;  3IAM 2;  5DAL A;  1Z3E A;  1GSY A;  2V6O A;  2CV4 A;  3ZIV A;  3KD0 A;  2H30 A;  5J9C A;  1TK8 B;  2YJ7 A;  1UN2 A;  7GSS A;  5IMF A;  2GGT A;  1EV4 A;  2KUC A;  4POL A;  5GST A;  1QGV A;  1ON4 A;  4KAE A;  5G5F A;  2K9F A;  2P0G A;  4G19 A;  1JLW A;  1YF0 A;  3L0H A;  3W8J A;  5COH A;  1TDI A;  1SJ6 A;  1SL1 B;  2E7P A;  2DJ3 A;  1PL2 A;  2WCI A;  4I2U A;  5IIZ A;  3PGT A;  3GL5 A;  2V41 A;  3QFB C;  1OE7 A;  4ZB8 A;  1WPI A;  4D73 B;  3F6D A;  1X9M B;  2MBS A;  1ACV A;  2HRF A;  2WRT A;  3FR6 A;  4IQA A;  4OCE A;  4IGJ A;  5ELG A;  1SL0 B;  1S3C A;  1SK0 A;  1T3B A;  2FUG 2;  2L4C A;  3F6F A;  4PQI A;  2K18 A;  2VCX A;  4N10 A;  4DSS A;  2AHE A;  5AIX A;  4P3Y B;  5IMA A;  1PL1 A;  3BOA A;  2YZH A;  4E8H A;  2H70 A;  4MLY A;  2J9H A;  4HZ4 A;  1MEK A;  3VLN A;  4Q5N A;  4IP6 A;  1HD2 A;  2OE3 A;  2I3Y A;  1AIU A;  5DJM A;  3G7I A;  3HVX A;  3ZFB A;  3RPN A;  3ZRE A;  2M46 A;  2KP1 A;  1SU9 A;  1U3I A;  5F8B A;  6GST A;  5ECK B;  3DVW A;  4E8E A;  3HVS A;  5KN0 A;  1F3A A;  1FG4 A;  2JSZ A;  3EWL A;  2OE1 A;  3FR3 A;  3ZLP A;  1X5D A;  3GKN A;  1PD2 1;  2LV3 A;  1A8L A;  4MJC A;  4ID0 A;  3GTU A;  2C3N A;  2HZE A;  3M0F A;  1SK2 A;  2FWH A;  2V32 A;  2CX4 A;  4XCS A;  4PNF A;  4POK A;  2PGT A;  1ABA A;  2HE3 A;  4BWQ A;  1AC1 A;  5DAL B;  3HJO A;  3A5W A;  1QMV A;  1CQH A;  1XWB A;  5FHI A;  3D0Z A;  3GH6 A;  2GZZ A;  1THX A;  1FHE A;  4K8M A;  2HLS A;  3E0U A;  3SBC A;  4TR1 A;  1G0T A;  3QMX A;  1DBY A;  2H6Z A;  4IP1 A;  5LCZ A;  3NOF A;  1KEB A;  1ZYQ B;  3KTB A;  1XW9 A;  3TKQ A;  5CAX A;  2F51 A;  4BA7 A;  5JWR B;  2FGX A;  4MJA A;  2N5B A;  2ZUP A;  3KTL A;  5E4W A;  4K0G A;  2CQ9 A;  1GSD A;  2XHF A;  1USB A;  4KDX A;  4OO5 A;  2WJU A;  3DRN A;  2IFQ A;  5JCU A;  1AQV A;  4LL4 B;  2YAN A;  4ILF A;  1XWK A;  4RI6 A;  1V98 A;  4AGS A;  4EKZ A;  3SWL A;  1NW2 A;  5H5S A;  1YJ6 A;  1T8E B;  1FAA A;  1WMJ A;  3WYW A;  4MDC A;  5HFG A;  3MDK A;  6GSU A;  3NZN A;  3TOT A;  2DJ0 A;  3CXG A;  2DJ1 A;  3LYK A;  3UJ1 A;  3ISO A;  18GS A;  1F9M A;  3DWV A;  2VO4 A;  1GWC A;  2VCT A;  3RBT A;  3F0I A;  2LEG A;  2VM2 A;  3A3T A;  1TK0 B;  2MYG A;  2YP6 A;  2R5G A;  4HZ2 A;  3P2A A;  4GCI A;  4TKY A;  1V2A A;  5D9W A;  1B4P A;  3D5J A;  3GH9 A;  4OCF A;  3EU3 A;  1VF2 A;  2AJQ B;  5B6N A;  4MH2 A;  4KB3 A;  4PUF C;  1TI3 A;  4BWS A;  4EVM A;  3PR8 A;  3HZ8 A;  4PUA A;  3KMO A;  4NHZ A;  1XPV A;  3I43 A;  4OFM A;  1OAZ A;  4Q5F A;  3TJG A;  6GSX A;  5F0G A;  3KZQ A;  3ED3 A;  4TOP A;  1EOG A;  4ZBD A;  3H4K A;  3CTG A;  1JHB A;  3ZFL A;  1NM3 A;  1XFL A;  4JED A;  3VK9 A;  5J4U A;  3IRA A;  1GUK A;  3FK8 A;  3IOS A;  3PIN A;  4PGT A;  3GMF A;  3CRT A;  4PQH A;  2VCZ A;  3ERG A;  3HCZ A;  4F0C A;  3QDN A;  1OC9 A;  1J0F A;  4Q5Q A;  5DJL A;  3HXS A;  1U88 A;  1YQ1 A;  2DML A;  2C0F A;  2VLV A;  2GSQ A;  1O81 A;  2O87 A;  4TR1 B;  3GUS A;  3VUR A;  3EIN A;  1GTU A;  3VWX A;  3H8Q A;  4EE0 A;  4CDO A;  3GKX A;  2C0E A;  1O6J A;  1K0C A;  5CRH A;  1K3Y A;  4CW9 A;  2B5Y A;  1HQO A;  3HD5 A;  1XWA A;  3MSZ A;  2IMK A;  3M9K A;  1GUM A;  5F06 A;  3ZRD A;  1GRX A;  5HFK A;  1Z6N A;  3UAR A;  5DCG A;  1XW5 A;  4O7H A;  3APS A;  2H66 A;  5EVO A;  2MZC A;  2LKU A;  3GKK A;  2P5R A;  3I69 A;  1SKR B;  2ZCT A;  4Q5R A;  5EY6 A;  4TN8 A;  17GS A;  4WXT A;  2B7J A;  2FWF A;  3APQ A;  4NAX A;  4ZBB A;  2LQO A;  4HDE A;  2RUF A;  1SYX A;  1V40 A;  3HJM A;  4YQM A;  3GL3 A;  3FZ5 A;  2H73 A;  2LUS A;  3VWU A;  2F9S A;  1JZW A;  2VLU A;  1VF4 A;  4XHM A;  3FW2 A;  4WBJ A;  3W8S A;  1N8J A;  3G9B A;  4MF6 A;  4ISD A;  4PNG A;  2LNT A;  2FHE A;  3TCO A;  1F6M C;  4L0U A;  3TKS C;  3GRX A;  2QSI A;  5DCH A;  2O85 A;  2V1M A;  2FY6 A;  3ERF A;  5B8A A;  1E6B A;  4NV5 A;  1M99 A;  5IPH A;  2EC4 A;  3FKF A;  2V6K A;  2H01 A;  4GST A;  3V1W A;  5IOX A;  5IMZ A;  5D9V A;  1ST9 A;  1KTE A;  2REM A;  4D73 A;  4ULX A;  3H1N A;  2XPE A;  4MAB A;  3D4T A;  2KOK A;  5ECS A;  4HJM A;  1B4Q A;  1URM A;  3W6G A;  5B6M A;  3HA9 A;  1PMT A;  3P7X A;  2HRN A;  2AYT A;  1B9Y C;  2NVL A;  1W89 A;  1R7H A;  2C4J A;  4KE3 A;  4ZL9 A;  2YOI A;  4GWR A;  1PKZ A;  4O92 A;  1XW6 A;  1HNB A;  4EDY A;  1OKT A;  3LGC A;  3O76 A;  3UOM A;  5G31 A;  3H79 A;  4NPB A;  3KH7 A;  3UBK A;  1DSB A;  2RLI A;  1PKW A;  3GN3 A;  1ZGN A;  1SL2 B;  2VL2 C;  2OJL A;  2MMO A;  2B1K A;  3HHV A;  3CMI A;  1YEX A;  1SEN A;  3CBU A;  1UA5 A;  2LRT A;  1SJI A;  3GUR A;  1LU4 A;  2HT9 A;  4ECB A;  11GS A;  1AXD A;  4BL7 A;  4TW5 A;  1SKW B;  1EWX A;  2I4A A;  3IA1 A;  4N11 A;  1AUC A;  2H0G A;  2X99 A;  1EEM A;  2DJK A;  3P8W A;  4F03 A;  2J23 A;  4MMM A;  4IQ1 A;  2DLX A;  4KCE A;  4DEJ A;  5D9X A;  1PN9 A;  2G0F A;  2YZU A;  1TRU A;  1X9S B;  1EV9 A;  3JCM L;  4MK3 A;  2GQL A;  2QKE A;  2ALB A;  2GST A;  4LL1 B;  1QQ2 A;  3A2X A;  3KXO A;  3A2V A;  5ENU A;  1M2A A;  4HU9 A;  5DQS A;  3RHC A;  2PVO C;  1J9B A;  5AGY A;  3IBH A;  3EC3 A;  2TIR A;  1NSW A;  3G7Y A;  2K6V A;  3PH9 A;  2FNO A;  2FWG A;  3MWH A;  1VGL A;  3BD2 A;  2GZP A;  2O8V B;  4WR5 A;  3UL3 A;  1UC7 A;  2GSR A;  2VIM A;  1TRV A;  4ACS A;  4ZL7 A;  4GQF A;  3APO A;  1S3D A;  3D22 A;  4LLR A;  1WE0 A;  3TKP A;  2K8S A;  1GSE A;  3TJB A;  1QUW A;  4XIH A;  1M2B A;  4JR6 A;  1PRX A;  4ZB6 A;  4ZL8 A;  3TJK A;  4L0W A;  2MMN A;  5DVB A;  3S9F A;  3FR9 A;  3ZYW A;  4YH2 A;  4I8B A;  4JZQ A;  1K3L A;  1XCC A;  4G9H A;  3VI7 A;  5FWG A;  2LRC A;  4QQ7 A;  2ES7 A;  4QL7 A;  2KP2 A;  5A4V A;  4MF5 A;  4N0V A;  2YV7 A;  2L4Q A;  4GQC A;  4IN0 A;  2IN3 A;  4CHS A;  3LSZ A;  4J57 E;  1PSQ A;  1OVN A;  4V2M A;  1BX9 A;  2H6X A;  3FZA A;  3QPM A;  3L9S A;  3LYP A;  1A0R P;  5AN1 A;  4WEY A;  4H86 A;  3ZMK A;  4KUN A;  3D21 A;  3FHK A;  1K0B A;  4F82 A;  5H5R A;  3C1S A;  4LA1 A;  4IS0 A;  3HVV A;  6GSY A;  2BTO T;  4G10 A;  3ZVJ A;  3MNG A;  2O7K A;  3DGQ A;  3DML A;  2H8L A;  4WR4 A;  5GAN D;  4YAV A;  4JE1 A;  3GST A;  3KEB A;  2YJH A;  4IVF A;  4RQX A;  4KW6 A;  3RHB A;  3EUR A;  1F37 A;  1A8Y A;  1TKD B;  5J41 A;  2TRC P;  1XZO A;  1O85 A;  5D93 A;  1OC8 A;  3C7M A;  4PUR A;  3VWV A;  4OWY A;  3L9V A;  1NHY A;  2DJJ A;  5INY A;  3KIJ A;  5JCW A;  2MMA A;  2WZ9 A;  1X0R A;  1X5E A;  2A2R A;  4WF4 A;  1M9B A;  4KDU A;  1O73 A;  3EU4 A;  1C72 A;  2HSH A;  2IMF A;  3QAW A;  4MPG A;  1N2A A;  3FEU A;  1T4Z A;  2YNX A;  2CVK A;  2HYX A;  5B8B A;  3M1G A;  1H75 A;  2R6K A;  2L57 A;  3BBY A;  5IMV A;  3M8N A;  3DEX A;  1OYJ A;  1RW1 A;  3WT1 A;  1SJZ A;  3VPT A;  2IME A;  3UIW A;  1PX6 A;  1FW1 A;  2YN1 A;  4EF0 A;  19GS A;  2AV4 A;  2GSS A;  4RQR A;  4DVC A;  4MF7 A;  1GTI A;  3I9V 2;  3P90 A;  5EL8 A;  2CA8 A;  2PER A;  2VL3 A;  2JL4 A;  5F07 A;  3L9U A;  5FT3 A;  1EZK A;  1OC3 A;  1FOV A;  4GTU A;  1G6Y A;  2YWO A;  1K0A A;  5HR2 A;  5KN2 A;  3F3Q A;  3E9J B;  5D96 A;  2B5X A;  1R4W A;  2P5Q A;  3UVH A;  5G1L A;  2B1L A;  3IAS 2;  1K0N A;  2JZR A;  3LEF A;  3OR5 A;  2B5E A;  4GLT A;  5J9B A;  1R5P A;  3LWA A;  1JZO A;  1TU7 A;  1KNG A;  2H1D A;  3TGZ A;  2G2Q A;  3F4T A;  1JZR A;  4ECC A;  1ERW A;  2I9H A;  3LOR A;  2VCV A;  5DAK B;  4OFT A;  3DD3 A;  4AJ6 A;  2JZS A;  3ME8 A;  4YAP A;  3CYN A;  2PUK C;  3LQ7 A;  4KA0 A;  4FO5 A;  1TU8 A;  1WIK A;  4RUV A;  3N9J A;  5LD0 A;  4DSR A;  1WRY A;  1LJR A;  3AY8 A;  1DUG A;  4I6X A;  3DIE A;  4K2D A;  1M7T A;  2ON5 A;  6GSV A;  2PN8 A;  3C1R A;  3EMX A;  3HYP A;  3CSJ A;  4MJE A;  5A5K A;  1WJK A;  4AJ7 A;  4KH7 A;  1GLQ A;  1YZX A;  2F3M A;  3QAG A;  2GT5 A;  4MCU A;  1ZZY A;  3VWW A;  1Z9H A;  1GNE A;  5JCG A;  2LJA A;  2YCD A;  2XBI A;  3GA4 A;  2H74 A;  4TXO A;  2O89 A;  3C73 A;  1ERT A;  2MBT A;  3RDW A;  2C8U A;  2H1A A;  2ON7 A;  4DSQ A;  2DIY A;  2DIZ A;  2NTO A;  2R2J A;  2R4V A;  1Z7R A;  3ZTL A;  4Z7X A;  3UVT A;  3BCK A;  4WBR D;  2H0I A;  2JAD A;  4KCA A;  1PQN A;  2IL3 A;  2MMZ A;  4N0Z A;  3TDG A;  1XWG A;  3EVI A;  5CRW A;  3WD6 A;  1XIY A;  1GP1 A;  1M0U A;  4FYC A;  5CO3 A;  2C0G A;  3Q19 A;  1SYR A;  2BMX A;  3IK7 A;  1ZL9 A;  4FH8 A;  1BAY A;  1H4O A;  3BCI A;  2NDO A;  1PX7 A;  1ERV A;  4ECJ A;  2OBK A;  1QXH A;  3KP8 A;  5CRG A;  1TJD A;  5ECO B;  2F8F A;  4NHW A;  2R37 A;  2YWN A;  2K8V A;  1YEP A;  3ZIT A;  5IPG A;  3IXR A;  1MDK A;  5ECM B;  2GDR A;  1BG5 A;  2H19 A;  2DBC A;  1AW9 A;  1TW9 A;  4HOJ A;  1GUH A;  1DE2 A;  3KJY A;  2AB6 A;  4NWY A;  1FB0 A;  5ECQ B;  4I97 A;  3LFL A;  5ECL B;  1XVW A;  2LRN A;  4ZIJ A;  1V57 A;  1EOH A;  2RM6 A;  4TR4 A;  5HR3 A;  2C3Q A;  3U6V A;  3H93 A;  1UVZ A;  5JWQ B;  1O8W A;  2P31 A;  1XWC A;  4KSO A;  1DE1 A;  2GS3 A;  4XS4 A;  4KX4 A;  2HZF A;  1KBN A;  2L5L A;  2JU5 A;  1I9D A;  5C00 A;  3QCP A;  1U6T A;  3TB2 A;  1SKS B;  4KSM A;  1B48 A;  4NXI A;  2DSA A;  5IO2 A;  2FA8 A;  14GS A;  1XOA A;  3LJR A;  3F3R A;  3HDC A;  3HZ4 A;  2B3S A;  2H6Y A;  3TRQ A;  1FB6 A;  3DXB A;  4V1A g;  2HSY A;  4MZC A;  1JZD A;  5GAP D;  4V2N A;  5B7C A;  4TXO B;  2XBQ A;  4OD7 A;  2C3T A;  4JRR A;  1CQG A;  4JBB A;  3WT2 A;  3L78 A;  9GSS A;  4EC0 A;  5F05 A;  2E0Q A;  4XRD A;  1HNC A;  4I5Q A;  3KM6 A;  2YV9 A;  4KDY A;  3M3M A;  5D73 A;  3F9U A;  4KGI A;  3IR4 A;  3FZ9 A;  1BJX A;  1MTC A;  3D4M A;  4I2T A;  4K1F A;  1EGO A;  1YKA A;  3G7J A;  2WGR A;  5IO0 A;  2KHP A;  1GSQ A;  4TRX A;  2NPB A;  4IBP A;  4X0X A;  3IV4 A;  4IKH A;  1GL8 A;  2L6C A;  1X5C A;  4WET A;  4G2E A;  1EP7 A;  2IWT A;  4AJ8 A;  3GX8 A;  1ML6 A;  3VPQ A;  4IHU A;  2VCQ A;  3GIX A;  3HY2 A;  2VUP A;  2CT6 A;  5IMC A;  3GSS A;  4X1U A;  1EEJ A;  1TTZ A;  3TJJ A;  2OA7 A;  1K0M A;  1M9A A;  5KN1 A;  3LG6 A;  1Y25 A;  1G7O A;  2LST A;  1IYH A;  2RUE A;  4MJB A;  4N30 A;  4ML6 A;  4EUY A;  4POB A;  2GLR A;  2GQK A;  5ECP B;  4HI7 A;  1K0D A;  2FLS A;  3ZML A;  2EIQ A;  5D8I A;  1IYI A;  3Q18 A;  1AAZ A;  3TKS E;  5AIS A;  1TRS A;  3F4R A;  4MZW A;  2E2M A;  3L4N A;  4MZB A;  1K0O A;  6GSW A;  3O3T A;  3VI5 A;  4LMV A;  4EDZ A;  4K6X A;  2M80 A;  5AIV A;  2A4V A;  2LJR A;  1WP0 A; 
#chains in the Genus database with same CATH topology
 2H75 A;  3FY7 A;  2CAI A;  4XS4 B;  1T4Y A;  1SK1 A;  3HJP A;  4HUA A;  4XRA A;  3TOU A;  3M9J A;  3DYR A;  4ECI A;  2X49 A;  5C04 A;  1TK5 B;  2PMT A;  4NMU A;  13GS A;  2HXK A;  1XOB A;  2IPA A;  3Q74 A;  1YY7 A;  2FD3 A;  1T1V A;  2GQM A;  1FVJ A;  3TRP A;  2FWE A;  3GHA A;  2L6D A;  5KEJ A;  3QAV A;  1SD8 A;  4L5L A;  2PU9 C;  4BVX A;  4TVE A;  2WB9 A;  3C71 A;  4EO3 A;  4USS A;  4ZBA A;  5ELA A;  2F8A A;  5DAK A;  5JWO B;  2DJ2 A;  1M2D A;  4K7N A;  2H72 A;  1TRW A;  1LBK A;  1R26 A;  2OE0 A;  3RAZ A;  1A2L A;  4KF9 A;  3FZ4 A;  2JAC A;  4OFN A;  2DMM A;  5GZZ B;  2LJK A;  5IM9 A;  1GTB A;  2R3X A;  1EGR A;  5ECI B;  5DQY A;  2R0G A;  4TR3 A;  1F3B A;  4LMW A;  4K5S A;  5DBQ A;  1VF1 A;  4PXO A;  1MD4 A;  4FYU A;  22GS A;  2OBI A;  5G30 A;  1AQW A;  2N5A A;  3WGX A;  2N5F A;  3FRC A;  1GSF A;  2LS5 A;  1Z6M A;  4V1A p;  4ZXG A;  3KH9 A;  1ZCP A;  1J08 A;  2XPD A;  1I5G A;  1TP9 A;  4FIW A;  1GLP A;  1RQM A;  1B9X C;  5E59 A;  4WKW A;  1BQ7 A;  4WF5 A;  5HR0 A;  1Z5Y E;  3DKS A;  1QK8 A;  2X8H A;  2VL9 A;  1TOF A;  2CAQ A;  1SD9 A;  4ZIL A;  3MIX A;  1ZMA A;  4KND A;  3ERW A;  3US3 A;  4RI7 A;  1XVQ A;  4AF2 A;  1F2E A;  5A4W A;  3GFK A;  2GTU A;  3ZL5 A;  1YF1 A;  1AQX A;  4V2L A;  2X8C A;  1R5A A;  3N5O A;  4MA9 A;  2RM5 A;  4PQ1 A;  4TR0 A;  1VF3 A;  5ABR A;  5IOW A;  10GS A;  1FO5 A;  2CVB A;  1JFU A;  2WUL A;  2KLX A;  5ECR B;  4EL1 A;  3FYG A;  8GSS A;  2VCW A;  1JLV A;  2HFD A;  1G7E A;  5A4U A;  4IJ3 A;  4PTS A;  1OKD A;  1QFN A;  4DSS B;  2WFC A;  1PA3 A;  4HU7 A;  2ZNM A;  1A23 A;  16GS A;  1THO A;  3IPZ A;  4K7I A;  2CX3 A;  1A2J A;  2IIY A;  2QC7 A;  2VOC A;  4JR4 A;  4MP4 A;  3LW9 A;  3GNJ A;  4BVX B;  2LQQ A;  1PGT A;  3NIV A;  2DKI A;  5GSS A;  1MDI A;  1BYE A;  2EIR A;  2TRX A;  2YWM A;  1M3J A;  4ML1 A;  4MH3 A;  4OO4 A;  2BJX A;  2CVD A;  2PBJ A;  5HFI A;  1NHO A;  3QOU A;  2RII A;  3UBL A;  1FVK A;  1A0F A;  3GV1 A;  3EPT A;  1HYU A;  4JU5 A;  3Q6O A;  1FOH A;  3GYK A;  3LXT A;  5H5Q A;  2EIO A;  4GSN A;  1YDK A;  2YPM A;  1T00 A;  2E2G A;  5ECH B;  4XS6 A;  5KN3 A;  1A24 A;  5ID2 A;  2VD1 A;  1E2Y A;  2YWI A;  2AAW A;  3F63 A;  2H0H A;  3EYT A;  4K9Z A;  4K7O A;  2H71 A;  3GTU B;  2HZE B;  3TKR A;  12GS A;  1Y6E A;  4OMV A;  4GRF A;  5CP1 A;  1U87 A;  4L5O A;  1EP8 A;  3KMN A;  4MPF A;  3CTF A;  5G1K A;  3QFA C;  4YQU A;  4GF0 A;  4F0B A;  2OAD A;  5D9T A;  2JZT A;  4NV2 A;  1OE8 A;  1V9W A;  4G0L A;  2GT6 A;  5CRD A;  2QGV A;  5IMD A;  4K0N A;  1GNW A;  3IK9 A;  2I81 A;  3GKM A;  1GUL A;  20GS A;  3EMP A;  4GSS A;  2B7K A;  1GH2 A;  2VM1 A;  4XS1 A;  3ME7 A;  3IE3 A;  5LNK e;  3D6I A;  2PWJ A;  2H76 A;  4HQZ A;  2AUV A;  2IFQ B;  4L8E A;  3K8N A;  3ZIJ A;  4HJ2 A;  3UAP A;  3TUE A;  2WDU A;  1TXX A;  2CZ2 A;  2PPT A;  1Q98 A;  4ZB9 A;  2B6M A;  4IEL A;  5J5N A;  1MDJ A;  4F9Z A;  4QL9 A;  2HNL A;  1O8X A;  1RK4 A;  1TI1 A;  3TRX A;  2QA1 A;  5G5E A;  3UMA A;  2NBS A;  3TJF A;  3CSH A;  2OAC A;  3KGK A;  2IJY A;  1A2M A;  4HSC X;  3J7Y k;  3UEM A;  4F2I A;  2JSY A;  3MAK A;  1WOU A;  5IQY A;  3ZZX A;  1O7U A;  4YQV A;  1B8X A;  3QR6 A;  3HKR A;  2X8G A;  4O32 A;  2D2Z A;  2WS2 A;  3LXZ A;  4EXJ A;  4X4J A;  4O5R A;  4POM A;  3U5R E;  4J56 E;  1ZYP A;  2C80 A;  4IJI A;  3TKS A;  4X43 A;  3DVX A;  1S3R A;  1G6W A;  1WWJ A;  2FCH A;  5G2Z A;  3E3E A;  2FA4 A;  4FYB A;  2HI7 A;  3IDV A;  4XTS A;  1K3O A;  2XC2 A;  2CZ3 A;  1Q4J A;  5ID2 B;  5CYY A;  2I1U A;  2X64 A;  4IW9 A;  4MNN A;  2X4A A;  4HEA 2;  4GXZ A;  1ZOF A;  3GX0 A;  2LNS A;  1VRS D;  1MD3 A;  2LTK A;  3IC4 A;  5DDL A;  3IHQ A;  2Z9S A;  5CNW A;  2H1B A;  1XXU A;  4HS1 A;  2VD0 A;  2IMD A;  3WGD A;  1Z7P A;  2V2G A;  2VLT A;  1GSS A;  2PVQ A;  1YKC A;  1X9W B;  3O6T A;  3F8U A;  1OC9 B;  1HNA A;  2GVP A;  5EPF A;  1T7P B;  1XBS A;  2OKA A;  1ERU A;  1GSU A;  2C1Y A;  1ILO A;  1W4V A;  3VFI A;  4BPY A;  1GTA A;  2A2S A;  3A2W A;  3I6A A;  3J7Y b;  2L59 A;  3R2Q A;  2VAF A;  2C0D A;  4HQS A;  3WGE A;  2VL2 A;  1U3A A;  1S3A A;  4FQU A;  3CRU A;  3RPP A;  3F4S A;  5L71 A;  6GSS A;  3QD9 A;  5ECN B;  3ZVJ D;  2M72 A;  1V58 A;  5HR1 A;  5CRE A;  2IMI A;  3KP9 A;  2L5O A;  4O5U A;  2H1G A;  3CSI A;  2DC5 A;  3KCM A;  1BED A;  5HQP A;  4J2F A;  1ZYE A;  2GZY A;  4PX1 A;  4TXV A;  3C8E A;  3EE2 A;  4BVY A;  3BJ5 A;  5J3R A;  3IAM 2;  5DAL A;  1PN0 A;  1Z3E A;  1GSY A;  2V6O A;  2CV4 A;  3ZIV A;  3KD0 A;  2H30 A;  5J9C A;  1TK8 B;  2YJ7 A;  1UN2 A;  7GSS A;  5IMF A;  2GGT A;  1EV4 A;  2KUC A;  4POL A;  5GST A;  1QGV A;  1ON4 A;  4KAE A;  5G5F A;  2K9F A;  2P0G A;  4G19 A;  1JLW A;  1YF0 A;  3L0H A;  3W8J A;  5COH A;  1TDI A;  1SJ6 A;  1SL1 B;  2E7P A;  2DJ3 A;  1PL2 A;  2WCI A;  4I2U A;  5IIZ A;  3PGT A;  3GL5 A;  2V41 A;  3QFB C;  1OE7 A;  4ZB8 A;  1WPI A;  4D73 B;  3F6D A;  1X9M B;  2MBS A;  1ACV A;  2HRF A;  2WRT A;  3FR6 A;  4IQA A;  4OCE A;  4IGJ A;  5ELG A;  1SL0 B;  1S3C A;  1SK0 A;  1T3B A;  2FUG 2;  2L4C A;  3F6F A;  4PQI A;  2K18 A;  2VCX A;  4N10 A;  4DSS A;  2AHE A;  5AIX A;  4P3Y B;  5IMA A;  1PL1 A;  3BOA A;  2YZH A;  4E8H A;  2H70 A;  4MLY A;  2J9H A;  4HZ4 A;  1MEK A;  4G0K A;  3VLN A;  4Q5N A;  4IP6 A;  1HD2 A;  2OE3 A;  2I3Y A;  1AIU A;  5DJM A;  3G7I A;  3HVX A;  3ZFB A;  3RPN A;  3ZRE A;  3IHG A;  2M46 A;  2KP1 A;  1SU9 A;  4YKF A;  1U3I A;  5F8B A;  6GST A;  5ECK B;  3DVW A;  4E8E A;  3HVS A;  5KN0 A;  1F3A A;  1FG4 A;  2JSZ A;  3EWL A;  2OE1 A;  4BL7 B;  3FR3 A;  3ZLP A;  1X5D A;  3GKN A;  1PD2 1;  2LV3 A;  1A8L A;  4MJC A;  4ID0 A;  3GTU A;  2C3N A;  2HZE A;  3M0F A;  1SK2 A;  2FWH A;  2V32 A;  2CX4 A;  4XCS A;  4PNF A;  4POK A;  2PGT A;  1ABA A;  4BVY B;  2HE3 A;  4BWQ A;  1AC1 A;  5DAL B;  3HJO A;  3A5W A;  1QMV A;  1CQH A;  1XWB A;  5FHI A;  4Z2R A;  3D0Z A;  3GH6 A;  2GZZ A;  1THX A;  1FHE A;  4K8M A;  2HLS A;  3E0U A;  3SBC A;  4TR1 A;  1G0T A;  3QMX A;  1DBY A;  2H6Z A;  4IP1 A;  5LCZ A;  3NOF A;  1KEB A;  1ZYQ B;  3KTB A;  1XW9 A;  3TKQ A;  5CAX A;  2F51 A;  4BA7 A;  5JWR B;  2FGX A;  4MJA A;  2N5B A;  2ZUP A;  3KTL A;  5E4W A;  4K0G A;  2CQ9 A;  1GSD A;  2XHF A;  1USB A;  4KDX A;  4OO5 A;  2WJU A;  3DRN A;  2IFQ A;  2HRA A;  5JCU A;  1AQV A;  4LL4 B;  2YAN A;  4ILF A;  1XWK A;  5KOX A;  4RI6 A;  1V98 A;  4AGS A;  4EKZ A;  3SWL A;  1NW2 A;  5H5S A;  1YJ6 A;  1T8E B;  1FAA A;  1WMJ A;  3WYW A;  4MDC A;  5HFG A;  3MDK A;  6GSU A;  3NZN A;  3TOT A;  2DJ0 A;  3CXG A;  2DJ1 A;  3LYK A;  3UJ1 A;  3ISO A;  18GS A;  1F9M A;  3DWV A;  2VO4 A;  1GWC A;  2VCT A;  3RBT A;  3F0I A;  2LEG A;  2VM2 A;  3A3T A;  1TK0 B;  2MYG A;  2YP6 A;  2R5G A;  4HZ2 A;  3P2A A;  4GCI A;  4TKY A;  1V2A A;  5D9W A;  1B4P A;  3D5J A;  3GH9 A;  4OCF A;  3EU3 A;  1VF2 A;  2AJQ B;  5B6N A;  4MH2 A;  4KB3 A;  4PUF C;  1TI3 A;  4BWS A;  4EVM A;  3PR8 A;  3HZ8 A;  4PUA A;  3KMO A;  4NHZ A;  1XPV A;  3I43 A;  4OFM A;  1OAZ A;  4Q5F A;  3TJG A;  6GSX A;  5F0G A;  3KZQ A;  3ED3 A;  3MYD A;  4TOP A;  1EOG A;  4ZBD A;  3H4K A;  3CTG A;  1JHB A;  3ZFL A;  1NM3 A;  1XFL A;  4JED A;  3VK9 A;  5J4U A;  3IRA A;  1GUK A;  3FK8 A;  3IOS A;  3PIN A;  4PGT A;  3GMF A;  3CRT A;  4PQH A;  2VCZ A;  3ERG A;  3HCZ A;  4F0C A;  3QDN A;  1OC9 A;  1J0F A;  4Q5Q A;  2UZ8 A;  5DJL A;  3HXS A;  1U88 A;  1YQ1 A;  2DML A;  2C0F A;  2VLV A;  2GSQ A;  1O81 A;  2O87 A;  4TR1 B;  3GUS A;  3VUR A;  3EIN A;  1GTU A;  3VWX A;  3H8Q A;  4EE0 A;  4CDO A;  3GKX A;  2C0E A;  4K2X A;  1O6J A;  1K0C A;  5CRH A;  1K3Y A;  4CW9 A;  1ZYN A;  2B5Y A;  1HQO A;  3HD5 A;  1XWA A;  3MSZ A;  2IMK A;  3M9K A;  1GUM A;  5F06 A;  3ZRD A;  1GRX A;  5HFK A;  1Z6N A;  3UAR A;  5DCG A;  1XW5 A;  4O7H A;  3APS A;  2H66 A;  5EVO A;  2MZC A;  2LKU A;  4EIQ A;  3GKK A;  2P5R A;  3I69 A;  1SKR B;  2ZCT A;  4Q5R A;  5EY6 A;  4TN8 A;  17GS A;  4WXT A;  2B7J A;  2FWF A;  3APQ A;  4NAX A;  4ZBB A;  2LQO A;  4HDE A;  2RUF A;  1SYX A;  1V40 A;  3HJM A;  4YQM A;  3GL3 A;  3FZ5 A;  2H73 A;  2LUS A;  3VWU A;  2F9S A;  1JZW A;  2VLU A;  1VF4 A;  4XHM A;  3FW2 A;  4WBJ A;  3W8S A;  1N8J A;  3G9B A;  4MF6 A;  4ISD A;  4PNG A;  2LNT A;  2FHE A;  3TCO A;  1F6M C;  4L0U A;  3TKS C;  3GRX A;  2QSI A;  5DCH A;  2O85 A;  2V1M A;  2FY6 A;  3ERF A;  5B8A A;  1E6B A;  4NV5 A;  1M99 A;  5IPH A;  2EC4 A;  3FKF A;  2V6K A;  2H01 A;  4GST A;  3V1W A;  5IOX A;  5IMZ A;  5D9V A;  1ST9 A;  1KTE A;  2REM A;  4D73 A;  4ULX A;  3H1N A;  2XPE A;  4MAB A;  3D4T A;  2KOK A;  5ECS A;  4HJM A;  1B4Q A;  1URM A;  3W6G A;  5B6M A;  3HA9 A;  1PMT A;  3P7X A;  2HRN A;  2AYT A;  1B9Y C;  2NVL A;  1W89 A;  1R7H A;  2C4J A;  4KE3 A;  4ZL9 A;  2YOI A;  4GWR A;  1XG8 A;  1PKZ A;  4O92 A;  1XW6 A;  1HNB A;  4EDY A;  1OKT A;  2DKH A;  3LGC A;  3O76 A;  3UOM A;  5G31 A;  3H79 A;  4NPB A;  3KH7 A;  3UBK A;  1DSB A;  2HSM A;  2RLI A;  1PKW A;  3GN3 A;  1ZGN A;  1SL2 B;  2VL2 C;  2OJL A;  2MMO A;  5KOW A;  2B1K A;  3HHV A;  3CMI A;  1YEX A;  1SEN A;  3CBU A;  1UA5 A;  2LRT A;  1SJI A;  3GUR A;  1LU4 A;  2HT9 A;  4ECB A;  11GS A;  1AXD A;  4BL7 A;  4TW5 A;  1SKW B;  1EWX A;  2I4A A;  3IA1 A;  4N11 A;  1AUC A;  2H0G A;  2X99 A;  1EEM A;  2DJK A;  3P8W A;  4F03 A;  2J23 A;  4MMM A;  4IQ1 A;  2DLX A;  4KCE A;  4DEJ A;  5D9X A;  1PN9 A;  2G0F A;  2YZU A;  1TRU A;  1X9S B;  1EV9 A;  3JCM L;  4MK3 A;  2GQL A;  2QKE A;  2ALB A;  2GST A;  4LL1 B;  1QQ2 A;  3A2X A;  3KXO A;  3A2V A;  5ENU A;  1M2A A;  4HU9 A;  5DQS A;  3RHC A;  2PVO C;  1J9B A;  5AGY A;  3IBH A;  3EC3 A;  2TIR A;  1NSW A;  4EIP A;  3G7Y A;  2K6V A;  3PH9 A;  2FNO A;  2FWG A;  3MWH A;  1VGL A;  3BD2 A;  2GZP A;  2O8V B;  4WR5 A;  3UL3 A;  1UC7 A;  2GSR A;  2VIM A;  1TRV A;  3PPU A;  4ACS A;  4GQF A;  4ZL7 A;  3APO A;  1S3D A;  3D22 A;  4LLR A;  1WE0 A;  3TKP A;  2K8S A;  4Z2U A;  1GSE A;  3TJB A;  3IC8 A;  1QUW A;  4XIH A;  1M2B A;  4JR6 A;  1PRX A;  4ZB6 A;  4ZL8 A;  1M3I A;  4L0W A;  3TJK A;  2MMN A;  5DVB A;  3S9F A;  3FR9 A;  3ZYW A;  4YH2 A;  4I8B A;  4JZQ A;  1K3L A;  1XCC A;  4G9H A;  3VI7 A;  5FWG A;  2LRC A;  4QQ7 A;  2ES7 A;  4QL7 A;  2KP2 A;  5A4V A;  4MF5 A;  4N0V A;  2YV7 A;  2L4Q A;  4GQC A;  4IN0 A;  2IN3 A;  4CHS A;  3LSZ A;  4J57 E;  1PSQ A;  1OVN A;  4V2M A;  1BX9 A;  2H6X A;  3FZA A;  3QPM A;  3L9S A;  3LYP A;  1A0R P;  5AN1 A;  3FMW A;  4WEY A;  4H86 A;  3ZMK A;  4KUN A;  3D21 A;  3FHK A;  1K0B A;  4F82 A;  5H5R A;  3C1S A;  4LA1 A;  4IS0 A;  3HVV A;  6GSY A;  2BTO T;  4G10 A;  3ZVJ A;  3MNG A;  2O7K A;  3DGQ A;  3DML A;  2H8L A;  4WR4 A;  5GAN D;  4YAV A;  4JE1 A;  3GST A;  3KEB A;  2YJH A;  4IVF A;  4RQX A;  4KW6 A;  3RHB A;  3EUR A;  1F37 A;  1A8Y A;  1TKD B;  5J41 A;  2TRC P;  1XZO A;  1O85 A;  5D93 A;  1OC8 A;  3C7M A;  4PUR A;  3VWV A;  4OWY A;  4O5Q A;  3L9V A;  1NHY A;  2DJJ A;  5INY A;  3KIJ A;  5JCW A;  2MMA A;  2WZ9 A;  1X0R A;  2R0P A;  1X5E A;  2A2R A;  4WF4 A;  1M9B A;  4KDU A;  5BMU A;  1O73 A;  2A4H A;  3EU4 A;  1C72 A;  2HSH A;  2IMF A;  3QAW A;  4CY8 A;  4MPG A;  1N2A A;  3FEU A;  1T4Z A;  2YNX A;  2CVK A;  2HYX A;  4Z2T A;  3M1G A;  5B8B A;  1H75 A;  2R6K A;  2L57 A;  4YKG A;  3BBY A;  5IMV A;  3M8N A;  3DEX A;  1OYJ A;  1RW1 A;  3WT1 A;  1SJZ A;  3VPT A;  2IME A;  3UIW A;  1PX6 A;  1FW1 A;  2YN1 A;  4EF0 A;  19GS A;  2AV4 A;  2GSS A;  4RQR A;  3CQF A;  5BRT A;  4DVC A;  4MF7 A;  1GTI A;  3I9V 2;  4ICY A;  3P90 A;  5EL8 A;  2CA8 A;  2PER A;  2VL3 A;  2JL4 A;  5F07 A;  3L9U A;  5FT3 A;  1EZK A;  1OC3 A;  1FOV A;  4GTU A;  1G6Y A;  2YWO A;  1K0A A;  5HR2 A;  5KN2 A;  3F3Q A;  3E9J B;  5D96 A;  2B5X A;  1R4W A;  2P5Q A;  3UVH A;  5G1L A;  4BIK A;  2B1L A;  3IAS 2;  1K0N A;  2JZR A;  3LEF A;  3OR5 A;  2B5E A;  4GLT A;  5J9B A;  1R5P A;  3LWA A;  1JZO A;  1TU7 A;  1KNG A;  2H1D A;  3TGZ A;  2G2Q A;  3F4T A;  1JZR A;  4ECC A;  1ERW A;  2I9H A;  3LOR A;  2VCV A;  5DAK B;  4OFT A;  3DD3 A;  4AJ6 A;  2JZS A;  3ME8 A;  4YAP A;  3CYN A;  2PUK C;  3LQ7 A;  4KA0 A;  4FO5 A;  1TU8 A;  1WIK A;  4RUV A;  3N9J A;  5LD0 A;  4DSR A;  1WRY A;  1LJR A;  3AY8 A;  1DUG A;  3A5I A;  4I6X A;  3DIE A;  4K2D A;  1M7T A;  2ON5 A;  6GSV A;  2PN8 A;  3C1R A;  3EMX A;  3HYP A;  3CSJ A;  4MJE A;  5A5K A;  1WJK A;  4AJ7 A;  4KH7 A;  1GLQ A;  1YZX A;  2F3M A;  3QAG A;  2GT5 A;  4MCU A;  1ZZY A;  3VWW A;  1Z9H A;  1GNE A;  5JCG A;  2LJA A;  2YCD A;  2XBI A;  3GA4 A;  2H74 A;  4TXO A;  2O89 A;  3C73 A;  1ERT A;  2MBT A;  3RDW A;  2C8U A;  2H1A A;  2ON7 A;  4DSQ A;  2DIY A;  2DIZ A;  2NTO A;  2R2J A;  2R4V A;  1Z7R A;  3ZTL A;  4Z7X A;  3UVT A;  3BCK A;  4WBR D;  2H0I A;  2JAD A;  4KCA A;  1PQN A;  2IL3 A;  2MMZ A;  4N0Z A;  4K5R A;  2QA2 A;  3TDG A;  1XWG A;  3EVI A;  5CRW A;  3WD6 A;  1XIY A;  1GP1 A;  1M0U A;  4FYC A;  5CO3 A;  2C0G A;  3Q19 A;  1SYR A;  2BMX A;  3IK7 A;  1ZL9 A;  4FH8 A;  1BAY A;  1H4O A;  3BCI A;  2NDO A;  1PX7 A;  1ERV A;  4ECJ A;  2OBK A;  1QXH A;  3KP8 A;  5CRG A;  1TJD A;  5ECO B;  2F8F A;  4NHW A;  2R37 A;  2YWN A;  2K8V A;  1YEP A;  3ZIT A;  5IPG A;  3IXR A;  1MDK A;  3HVN A;  5ECM B;  2GDR A;  1BG5 A;  2H19 A;  2DBC A;  1AW9 A;  1TW9 A;  4HOJ A;  1GUH A;  1DE2 A;  3KJY A;  2AB6 A;  4NWY A;  1FB0 A;  5ECQ B;  4I97 A;  3LFL A;  5ECL B;  1XVW A;  2LRN A;  4ZIJ A;  1V57 A;  1EOH A;  2RM6 A;  4TR4 A;  5HR3 A;  2C3Q A;  3U6V A;  3H93 A;  1UVZ A;  5JWQ B;  1O8W A;  2P31 A;  1XWC A;  4KSO A;  1DE1 A;  2GS3 A;  4XS4 A;  4KX4 A;  2HZF A;  1KBN A;  2L5L A;  2JU5 A;  1I9D A;  5C00 A;  3QCP A;  2R0C A;  1U6T A;  3TB2 A;  1SKS B;  4KSM A;  1B48 A;  4NXI A;  2DSA A;  5IO2 A;  2FA8 A;  14GS A;  1XOA A;  3LJR A;  3F3R A;  3HDC A;  3HZ4 A;  2B3S A;  2H6Y A;  3TRQ A;  1FB6 A;  1PFO A;  3DXB A;  4V1A g;  2HSY A;  4MZC A;  1JZD A;  5GAP D;  4V2N A;  5B7C A;  4TXO B;  2XBQ A;  4OD7 A;  2C3T A;  4JRR A;  1CQG A;  4JBB A;  3WT2 A;  3L78 A;  9GSS A;  4EC0 A;  4CY6 A;  5F05 A;  2E0Q A;  4XRD A;  1HNC A;  4I5Q A;  3KM6 A;  2YV9 A;  4KDY A;  3M3M A;  5D73 A;  3F9U A;  4KGI A;  3IR4 A;  3FZ9 A;  1BJX A;  1MTC A;  3D4M A;  4I2T A;  4K1F A;  1EGO A;  1YKA A;  3G7J A;  2WGR A;  5IO0 A;  2KHP A;  1GSQ A;  4TRX A;  2NPB A;  4IBP A;  2A2P A;  4X0X A;  3R3E A;  3IV4 A;  4IKH A;  1GL8 A;  2L6C A;  2HRK A;  1X5C A;  4WET A;  4G2E A;  1EP7 A;  2IWT A;  4AJ8 A;  3GX8 A;  1ML6 A;  3VPQ A;  4IHU A;  2VCQ A;  3GIX A;  3HY2 A;  2VUP A;  2CT6 A;  5IMC A;  3GSS A;  4X1U A;  1EEJ A;  1TTZ A;  3TJJ A;  2OA7 A;  1K0M A;  1M9A A;  5KN1 A;  3LG6 A;  1Y25 A;  1G7O A;  2LST A;  1IYH A;  2RUE A;  4MJB A;  4N30 A;  4ML6 A;  4EUY A;  4POB A;  2GLR A;  2GQK A;  5ECP B;  4HI7 A;  1K0D A;  2FLS A;  3ZML A;  2EIQ A;  5D8I A;  1IYI A;  3Q18 A;  1AAZ A;  3TKS E;  5AIS A;  4A5P A;  1TRS A;  3F4R A;  4MZW A;  2E2M A;  3L4N A;  4MZB A;  1K0O A;  4G0I A;  6GSW A;  3O3T A;  3VI5 A;  4LMV A;  4EDZ A;  4K6X A;  2M80 A;  5AIV A;  2A4V A;  2LJR A;  1WP0 A; 
#chains in the Genus database with same CATH homology
 2H75 A;  3FY7 A;  2CAI A;  4XS4 B;  1T4Y A;  1SK1 A;  3HJP A;  4HUA A;  4XRA A;  3TOU A;  3M9J A;  3DYR A;  4ECI A;  2X49 A;  5C04 A;  1TK5 B;  2PMT A;  4NMU A;  13GS A;  2HXK A;  1XOB A;  2IPA A;  3Q74 A;  1YY7 A;  2FD3 A;  1T1V A;  2GQM A;  1FVJ A;  3TRP A;  2FWE A;  3GHA A;  2L6D A;  5KEJ A;  3QAV A;  1SD8 A;  4L5L A;  2PU9 C;  4BVX A;  4TVE A;  2WB9 A;  3C71 A;  4EO3 A;  4USS A;  4ZBA A;  5ELA A;  2F8A A;  5DAK A;  5JWO B;  2DJ2 A;  1M2D A;  4K7N A;  2H72 A;  1TRW A;  1LBK A;  1R26 A;  2OE0 A;  3RAZ A;  1A2L A;  4KF9 A;  3FZ4 A;  2JAC A;  4OFN A;  2DMM A;  5GZZ B;  2LJK A;  5IM9 A;  1GTB A;  2R3X A;  1EGR A;  5ECI B;  5DQY A;  2R0G A;  4TR3 A;  1F3B A;  4LMW A;  4K5S A;  5DBQ A;  1VF1 A;  4PXO A;  1MD4 A;  4FYU A;  22GS A;  2OBI A;  5G30 A;  1AQW A;  2N5A A;  3WGX A;  2N5F A;  3FRC A;  1GSF A;  2LS5 A;  1Z6M A;  4V1A p;  4ZXG A;  3KH9 A;  1ZCP A;  1J08 A;  2XPD A;  1I5G A;  1TP9 A;  4FIW A;  1GLP A;  1RQM A;  1B9X C;  5E59 A;  4WKW A;  1BQ7 A;  4WF5 A;  5HR0 A;  1Z5Y E;  3DKS A;  1QK8 A;  2X8H A;  2VL9 A;  1TOF A;  2CAQ A;  1SD9 A;  4ZIL A;  3MIX A;  1ZMA A;  4KND A;  3ERW A;  3US3 A;  4RI7 A;  1XVQ A;  4AF2 A;  1F2E A;  5A4W A;  3GFK A;  2GTU A;  3ZL5 A;  1YF1 A;  1AQX A;  4V2L A;  2X8C A;  1R5A A;  3N5O A;  4MA9 A;  2RM5 A;  4PQ1 A;  4TR0 A;  1VF3 A;  5ABR A;  5IOW A;  10GS A;  1FO5 A;  2CVB A;  1JFU A;  2WUL A;  2KLX A;  5ECR B;  4EL1 A;  3FYG A;  8GSS A;  2VCW A;  1JLV A;  2HFD A;  1G7E A;  5A4U A;  4IJ3 A;  4PTS A;  1OKD A;  1QFN A;  4DSS B;  2WFC A;  1PA3 A;  4HU7 A;  2ZNM A;  1A23 A;  16GS A;  1THO A;  3IPZ A;  4K7I A;  2CX3 A;  1A2J A;  2IIY A;  2QC7 A;  2VOC A;  4JR4 A;  4MP4 A;  3LW9 A;  3GNJ A;  4BVX B;  2LQQ A;  1PGT A;  3NIV A;  2DKI A;  5GSS A;  1MDI A;  1BYE A;  2EIR A;  2TRX A;  2YWM A;  4ML1 A;  4MH3 A;  4OO4 A;  2BJX A;  2CVD A;  2PBJ A;  5HFI A;  1NHO A;  3QOU A;  2RII A;  3UBL A;  1FVK A;  1A0F A;  3GV1 A;  3EPT A;  1HYU A;  4JU5 A;  3Q6O A;  1FOH A;  3GYK A;  3LXT A;  5H5Q A;  2EIO A;  4GSN A;  1YDK A;  2YPM A;  1T00 A;  2E2G A;  5ECH B;  4XS6 A;  5KN3 A;  1A24 A;  5ID2 A;  2VD1 A;  1E2Y A;  2YWI A;  2AAW A;  3F63 A;  2H0H A;  3EYT A;  4K9Z A;  4K7O A;  2H71 A;  3GTU B;  2HZE B;  3TKR A;  12GS A;  1Y6E A;  4OMV A;  4GRF A;  5CP1 A;  1U87 A;  4L5O A;  1EP8 A;  3KMN A;  4MPF A;  3CTF A;  5G1K A;  3QFA C;  4YQU A;  4GF0 A;  4F0B A;  2OAD A;  5D9T A;  2JZT A;  4NV2 A;  1OE8 A;  1V9W A;  4G0L A;  2GT6 A;  5CRD A;  2QGV A;  5IMD A;  4K0N A;  1GNW A;  3IK9 A;  2I81 A;  3GKM A;  1GUL A;  20GS A;  3EMP A;  4GSS A;  2B7K A;  1GH2 A;  2VM1 A;  4XS1 A;  3ME7 A;  3IE3 A;  5LNK e;  3D6I A;  2PWJ A;  2H76 A;  4HQZ A;  2AUV A;  2IFQ B;  4L8E A;  3K8N A;  3ZIJ A;  4HJ2 A;  3UAP A;  3TUE A;  2WDU A;  1TXX A;  2CZ2 A;  2PPT A;  1Q98 A;  4ZB9 A;  2B6M A;  4IEL A;  5J5N A;  1MDJ A;  4F9Z A;  4QL9 A;  2HNL A;  1O8X A;  1RK4 A;  1TI1 A;  3TRX A;  2QA1 A;  5G5E A;  3UMA A;  2NBS A;  3TJF A;  3CSH A;  2OAC A;  3KGK A;  2IJY A;  1A2M A;  3J7Y k;  3UEM A;  4F2I A;  2JSY A;  3MAK A;  1WOU A;  5IQY A;  3ZZX A;  1O7U A;  4YQV A;  1B8X A;  3QR6 A;  3HKR A;  2X8G A;  4O32 A;  2D2Z A;  2WS2 A;  3LXZ A;  4EXJ A;  4X4J A;  4O5R A;  4POM A;  3U5R E;  4J56 E;  1ZYP A;  2C80 A;  4IJI A;  3TKS A;  4X43 A;  3DVX A;  1G6W A;  1WWJ A;  2FCH A;  5G2Z A;  3E3E A;  2FA4 A;  4FYB A;  2HI7 A;  3IDV A;  4XTS A;  1K3O A;  2XC2 A;  2CZ3 A;  1Q4J A;  5ID2 B;  5CYY A;  2I1U A;  2X64 A;  4IW9 A;  4MNN A;  2X4A A;  4HEA 2;  4GXZ A;  1ZOF A;  3GX0 A;  2LNS A;  1VRS D;  1MD3 A;  2LTK A;  3IC4 A;  5DDL A;  3IHQ A;  2Z9S A;  5CNW A;  2H1B A;  1XXU A;  4HS1 A;  2VD0 A;  2IMD A;  3WGD A;  1Z7P A;  2V2G A;  2VLT A;  1GSS A;  2PVQ A;  1YKC A;  1X9W B;  3O6T A;  3F8U A;  1OC9 B;  1HNA A;  2GVP A;  5EPF A;  1T7P B;  1XBS A;  2OKA A;  1ERU A;  1GSU A;  2C1Y A;  1ILO A;  1W4V A;  3VFI A;  4BPY A;  1GTA A;  2A2S A;  3A2W A;  3I6A A;  3J7Y b;  2L59 A;  3R2Q A;  2VAF A;  2C0D A;  4HQS A;  3WGE A;  2VL2 A;  1U3A A;  1S3A A;  4FQU A;  3CRU A;  3RPP A;  3F4S A;  5L71 A;  6GSS A;  3QD9 A;  5ECN B;  3ZVJ D;  2M72 A;  1V58 A;  5HR1 A;  5CRE A;  2IMI A;  3KP9 A;  2L5O A;  4O5U A;  2H1G A;  3CSI A;  2DC5 A;  3KCM A;  1BED A;  5HQP A;  4J2F A;  1ZYE A;  2GZY A;  4PX1 A;  4TXV A;  3C8E A;  3EE2 A;  4BVY A;  3BJ5 A;  5J3R A;  3IAM 2;  5DAL A;  1PN0 A;  1Z3E A;  1GSY A;  2V6O A;  2CV4 A;  3ZIV A;  3KD0 A;  2H30 A;  5J9C A;  1TK8 B;  2YJ7 A;  1UN2 A;  7GSS A;  5IMF A;  2GGT A;  1EV4 A;  2KUC A;  4POL A;  5GST A;  1QGV A;  1ON4 A;  4KAE A;  5G5F A;  2K9F A;  2P0G A;  4G19 A;  1JLW A;  1YF0 A;  3L0H A;  3W8J A;  5COH A;  1TDI A;  1SJ6 A;  1SL1 B;  2E7P A;  2DJ3 A;  1PL2 A;  2WCI A;  4I2U A;  5IIZ A;  3PGT A;  3GL5 A;  2V41 A;  3QFB C;  1OE7 A;  4ZB8 A;  1WPI A;  4D73 B;  3F6D A;  1X9M B;  2MBS A;  1ACV A;  2HRF A;  2WRT A;  3FR6 A;  4IQA A;  4OCE A;  4IGJ A;  5ELG A;  1SL0 B;  1S3C A;  1SK0 A;  1T3B A;  2FUG 2;  2L4C A;  3F6F A;  4PQI A;  2K18 A;  2VCX A;  4N10 A;  4DSS A;  2AHE A;  5AIX A;  4P3Y B;  5IMA A;  1PL1 A;  3BOA A;  2YZH A;  4E8H A;  2H70 A;  4MLY A;  2J9H A;  4HZ4 A;  1MEK A;  4G0K A;  3VLN A;  4Q5N A;  4IP6 A;  1HD2 A;  2OE3 A;  2I3Y A;  1AIU A;  5DJM A;  3G7I A;  3HVX A;  3ZFB A;  3RPN A;  3ZRE A;  3IHG A;  2M46 A;  2KP1 A;  1SU9 A;  4YKF A;  1U3I A;  5F8B A;  6GST A;  5ECK B;  3DVW A;  4E8E A;  3HVS A;  5KN0 A;  1F3A A;  1FG4 A;  2JSZ A;  3EWL A;  2OE1 A;  4BL7 B;  3FR3 A;  3ZLP A;  1X5D A;  3GKN A;  1PD2 1;  2LV3 A;  1A8L A;  4MJC A;  4ID0 A;  3GTU A;  2C3N A;  2HZE A;  3M0F A;  1SK2 A;  2FWH A;  2V32 A;  2CX4 A;  4XCS A;  4PNF A;  4POK A;  2PGT A;  1ABA A;  4BVY B;  2HE3 A;  4BWQ A;  1AC1 A;  5DAL B;  3HJO A;  3A5W A;  1QMV A;  1CQH A;  1XWB A;  5FHI A;  4Z2R A;  3D0Z A;  3GH6 A;  2GZZ A;  1THX A;  1FHE A;  4K8M A;  2HLS A;  3E0U A;  3SBC A;  4TR1 A;  1G0T A;  3QMX A;  1DBY A;  2H6Z A;  4IP1 A;  5LCZ A;  3NOF A;  1KEB A;  1ZYQ B;  3KTB A;  1XW9 A;  3TKQ A;  5CAX A;  2F51 A;  4BA7 A;  5JWR B;  2FGX A;  4MJA A;  2N5B A;  2ZUP A;  3KTL A;  5E4W A;  4K0G A;  2CQ9 A;  1GSD A;  2XHF A;  1USB A;  4KDX A;  4OO5 A;  2WJU A;  3DRN A;  2IFQ A;  2HRA A;  5JCU A;  1AQV A;  4LL4 B;  2YAN A;  4ILF A;  1XWK A;  5KOX A;  4RI6 A;  1V98 A;  4AGS A;  4EKZ A;  3SWL A;  1NW2 A;  5H5S A;  1YJ6 A;  1T8E B;  1FAA A;  1WMJ A;  3WYW A;  4MDC A;  5HFG A;  3MDK A;  6GSU A;  3NZN A;  3TOT A;  2DJ0 A;  3CXG A;  2DJ1 A;  3LYK A;  3UJ1 A;  3ISO A;  18GS A;  1F9M A;  3DWV A;  2VO4 A;  1GWC A;  2VCT A;  3RBT A;  3F0I A;  2LEG A;  2VM2 A;  3A3T A;  1TK0 B;  2MYG A;  2YP6 A;  2R5G A;  4HZ2 A;  3P2A A;  4GCI A;  4TKY A;  1V2A A;  5D9W A;  1B4P A;  3D5J A;  3GH9 A;  4OCF A;  3EU3 A;  1VF2 A;  2AJQ B;  5B6N A;  4MH2 A;  4KB3 A;  4PUF C;  1TI3 A;  4BWS A;  4EVM A;  3PR8 A;  3HZ8 A;  4PUA A;  3KMO A;  4NHZ A;  1XPV A;  3I43 A;  4OFM A;  1OAZ A;  4Q5F A;  3TJG A;  6GSX A;  5F0G A;  3KZQ A;  3ED3 A;  3MYD A;  4TOP A;  1EOG A;  4ZBD A;  3H4K A;  3CTG A;  1JHB A;  3ZFL A;  1NM3 A;  1XFL A;  4JED A;  3VK9 A;  5J4U A;  3IRA A;  1GUK A;  3FK8 A;  3IOS A;  3PIN A;  4PGT A;  3GMF A;  3CRT A;  4PQH A;  2VCZ A;  3ERG A;  3HCZ A;  4F0C A;  3QDN A;  1OC9 A;  1J0F A;  4Q5Q A;  2UZ8 A;  5DJL A;  3HXS A;  1U88 A;  1YQ1 A;  2DML A;  2C0F A;  2VLV A;  2GSQ A;  1O81 A;  2O87 A;  4TR1 B;  3GUS A;  3VUR A;  3EIN A;  1GTU A;  3VWX A;  3H8Q A;  4EE0 A;  4CDO A;  3GKX A;  2C0E A;  4K2X A;  1O6J A;  1K0C A;  5CRH A;  1K3Y A;  4CW9 A;  1ZYN A;  2B5Y A;  1HQO A;  3HD5 A;  1XWA A;  3MSZ A;  2IMK A;  3M9K A;  1GUM A;  5F06 A;  3ZRD A;  1GRX A;  5HFK A;  1Z6N A;  3UAR A;  5DCG A;  1XW5 A;  4O7H A;  3APS A;  2H66 A;  5EVO A;  2MZC A;  2LKU A;  4EIQ A;  3GKK A;  2P5R A;  3I69 A;  1SKR B;  2ZCT A;  4Q5R A;  5EY6 A;  4TN8 A;  17GS A;  4WXT A;  2B7J A;  2FWF A;  3APQ A;  4NAX A;  4ZBB A;  2LQO A;  4HDE A;  2RUF A;  1SYX A;  1V40 A;  3HJM A;  4YQM A;  3GL3 A;  3FZ5 A;  2H73 A;  2LUS A;  3VWU A;  2F9S A;  1JZW A;  2VLU A;  1VF4 A;  4XHM A;  3FW2 A;  4WBJ A;  3W8S A;  1N8J A;  3G9B A;  4MF6 A;  4ISD A;  4PNG A;  2LNT A;  2FHE A;  3TCO A;  1F6M C;  4L0U A;  3TKS C;  3GRX A;  2QSI A;  5DCH A;  2O85 A;  2V1M A;  2FY6 A;  3ERF A;  5B8A A;  1E6B A;  4NV5 A;  1M99 A;  5IPH A;  2EC4 A;  3FKF A;  2V6K A;  2H01 A;  4GST A;  3V1W A;  5IOX A;  5IMZ A;  5D9V A;  1ST9 A;  1KTE A;  2REM A;  4D73 A;  4ULX A;  3H1N A;  2XPE A;  4MAB A;  3D4T A;  2KOK A;  5ECS A;  4HJM A;  1B4Q A;  1URM A;  3W6G A;  5B6M A;  3HA9 A;  1PMT A;  3P7X A;  2HRN A;  2AYT A;  1B9Y C;  2NVL A;  1W89 A;  1R7H A;  2C4J A;  4KE3 A;  4ZL9 A;  2YOI A;  4GWR A;  1PKZ A;  4O92 A;  1XW6 A;  1HNB A;  4EDY A;  1OKT A;  2DKH A;  3LGC A;  3O76 A;  3UOM A;  5G31 A;  3H79 A;  4NPB A;  3KH7 A;  3UBK A;  1DSB A;  2HSM A;  2RLI A;  1PKW A;  3GN3 A;  1ZGN A;  1SL2 B;  2VL2 C;  2OJL A;  2MMO A;  5KOW A;  2B1K A;  3HHV A;  3CMI A;  1YEX A;  1SEN A;  3CBU A;  1UA5 A;  2LRT A;  1SJI A;  3GUR A;  1LU4 A;  2HT9 A;  4ECB A;  11GS A;  1AXD A;  4BL7 A;  4TW5 A;  1SKW B;  1EWX A;  2I4A A;  3IA1 A;  4N11 A;  1AUC A;  2H0G A;  2X99 A;  1EEM A;  2DJK A;  3P8W A;  4F03 A;  2J23 A;  4MMM A;  4IQ1 A;  2DLX A;  4KCE A;  4DEJ A;  5D9X A;  1PN9 A;  2G0F A;  2YZU A;  1TRU A;  1X9S B;  1EV9 A;  3JCM L;  4MK3 A;  2GQL A;  2QKE A;  2ALB A;  2GST A;  4LL1 B;  1QQ2 A;  3A2X A;  3KXO A;  3A2V A;  5ENU A;  1M2A A;  4HU9 A;  5DQS A;  3RHC A;  2PVO C;  1J9B A;  5AGY A;  3IBH A;  3EC3 A;  2TIR A;  1NSW A;  4EIP A;  3G7Y A;  2K6V A;  3PH9 A;  2FNO A;  2FWG A;  3MWH A;  1VGL A;  3BD2 A;  2GZP A;  2O8V B;  4WR5 A;  3UL3 A;  1UC7 A;  2GSR A;  2VIM A;  1TRV A;  3PPU A;  4ACS A;  4GQF A;  4ZL7 A;  3APO A;  1S3D A;  3D22 A;  4LLR A;  1WE0 A;  3TKP A;  2K8S A;  4Z2U A;  1GSE A;  3TJB A;  3IC8 A;  1QUW A;  4XIH A;  1M2B A;  4JR6 A;  1PRX A;  4ZB6 A;  4ZL8 A;  3TJK A;  4L0W A;  2MMN A;  5DVB A;  3S9F A;  3FR9 A;  3ZYW A;  4YH2 A;  4I8B A;  4JZQ A;  1K3L A;  1XCC A;  4G9H A;  3VI7 A;  5FWG A;  2LRC A;  4QQ7 A;  2ES7 A;  4QL7 A;  2KP2 A;  5A4V A;  4MF5 A;  4N0V A;  2YV7 A;  2L4Q A;  4GQC A;  4IN0 A;  2IN3 A;  4CHS A;  3LSZ A;  4J57 E;  1PSQ A;  1OVN A;  4V2M A;  1BX9 A;  2H6X A;  3FZA A;  3QPM A;  3L9S A;  3LYP A;  1A0R P;  5AN1 A;  3FMW A;  4WEY A;  4H86 A;  3ZMK A;  4KUN A;  3D21 A;  3FHK A;  1K0B A;  4F82 A;  5H5R A;  3C1S A;  4LA1 A;  4IS0 A;  3HVV A;  6GSY A;  2BTO T;  4G10 A;  3ZVJ A;  3MNG A;  2O7K A;  3DGQ A;  3DML A;  2H8L A;  4WR4 A;  5GAN D;  4YAV A;  4JE1 A;  3GST A;  3KEB A;  2YJH A;  4IVF A;  4RQX A;  4KW6 A;  3RHB A;  3EUR A;  1F37 A;  1A8Y A;  1TKD B;  5J41 A;  2TRC P;  1XZO A;  1O85 A;  5D93 A;  1OC8 A;  3C7M A;  4PUR A;  3VWV A;  4OWY A;  4O5Q A;  3L9V A;  1NHY A;  2DJJ A;  5INY A;  3KIJ A;  5JCW A;  2MMA A;  2WZ9 A;  1X0R A;  2R0P A;  1X5E A;  2A2R A;  4WF4 A;  1M9B A;  4KDU A;  5BMU A;  1O73 A;  2A4H A;  3EU4 A;  1C72 A;  2HSH A;  2IMF A;  3QAW A;  4CY8 A;  4MPG A;  1N2A A;  3FEU A;  1T4Z A;  2YNX A;  2CVK A;  2HYX A;  4Z2T A;  3M1G A;  5B8B A;  1H75 A;  2R6K A;  2L57 A;  4YKG A;  3BBY A;  5IMV A;  3M8N A;  3DEX A;  1OYJ A;  1RW1 A;  3WT1 A;  1SJZ A;  3VPT A;  2IME A;  3UIW A;  1PX6 A;  1FW1 A;  2YN1 A;  4EF0 A;  19GS A;  2AV4 A;  2GSS A;  4RQR A;  5BRT A;  4DVC A;  4MF7 A;  1GTI A;  3I9V 2;  4ICY A;  3P90 A;  5EL8 A;  2CA8 A;  2PER A;  2VL3 A;  2JL4 A;  5F07 A;  3L9U A;  5FT3 A;  1EZK A;  1OC3 A;  1FOV A;  4GTU A;  1G6Y A;  2YWO A;  1K0A A;  5HR2 A;  5KN2 A;  3F3Q A;  3E9J B;  5D96 A;  2B5X A;  1R4W A;  2P5Q A;  3UVH A;  5G1L A;  2B1L A;  3IAS 2;  1K0N A;  2JZR A;  3LEF A;  3OR5 A;  2B5E A;  4GLT A;  5J9B A;  1R5P A;  3LWA A;  1JZO A;  1TU7 A;  1KNG A;  2H1D A;  3TGZ A;  2G2Q A;  3F4T A;  1JZR A;  4ECC A;  1ERW A;  2I9H A;  3LOR A;  2VCV A;  5DAK B;  4OFT A;  3DD3 A;  4AJ6 A;  2JZS A;  3ME8 A;  4YAP A;  3CYN A;  2PUK C;  3LQ7 A;  4KA0 A;  4FO5 A;  1TU8 A;  1WIK A;  4RUV A;  3N9J A;  5LD0 A;  4DSR A;  1WRY A;  1LJR A;  3AY8 A;  1DUG A;  3A5I A;  4I6X A;  3DIE A;  4K2D A;  1M7T A;  2ON5 A;  6GSV A;  2PN8 A;  3C1R A;  3EMX A;  3HYP A;  3CSJ A;  4MJE A;  5A5K A;  1WJK A;  4AJ7 A;  4KH7 A;  1GLQ A;  1YZX A;  2F3M A;  3QAG A;  2GT5 A;  4MCU A;  1ZZY A;  3VWW A;  1Z9H A;  1GNE A;  5JCG A;  2LJA A;  2YCD A;  2XBI A;  3GA4 A;  2H74 A;  4TXO A;  2O89 A;  3C73 A;  1ERT A;  2MBT A;  3RDW A;  2C8U A;  2H1A A;  2ON7 A;  4DSQ A;  2DIY A;  2DIZ A;  2NTO A;  2R2J A;  2R4V A;  1Z7R A;  3ZTL A;  4Z7X A;  3UVT A;  3BCK A;  4WBR D;  2H0I A;  2JAD A;  4KCA A;  1PQN A;  2IL3 A;  2MMZ A;  4N0Z A;  4K5R A;  2QA2 A;  3TDG A;  1XWG A;  3EVI A;  5CRW A;  3WD6 A;  1XIY A;  1GP1 A;  1M0U A;  4FYC A;  5CO3 A;  2C0G A;  3Q19 A;  1SYR A;  2BMX A;  3IK7 A;  1ZL9 A;  4FH8 A;  1BAY A;  1H4O A;  3BCI A;  2NDO A;  1PX7 A;  1ERV A;  4ECJ A;  2OBK A;  1QXH A;  3KP8 A;  5CRG A;  1TJD A;  5ECO B;  2F8F A;  4NHW A;  2R37 A;  2YWN A;  2K8V A;  1YEP A;  3ZIT A;  5IPG A;  3IXR A;  1MDK A;  5ECM B;  2GDR A;  1BG5 A;  2H19 A;  2DBC A;  1AW9 A;  1TW9 A;  4HOJ A;  1GUH A;  1DE2 A;  3KJY A;  2AB6 A;  4NWY A;  1FB0 A;  5ECQ B;  4I97 A;  3LFL A;  5ECL B;  1XVW A;  2LRN A;  4ZIJ A;  1V57 A;  1EOH A;  2RM6 A;  4TR4 A;  5HR3 A;  2C3Q A;  3U6V A;  3H93 A;  1UVZ A;  5JWQ B;  1O8W A;  2P31 A;  1XWC A;  4KSO A;  1DE1 A;  2GS3 A;  4XS4 A;  4KX4 A;  2HZF A;  1KBN A;  2L5L A;  2JU5 A;  1I9D A;  5C00 A;  3QCP A;  2R0C A;  1U6T A;  3TB2 A;  1SKS B;  4KSM A;  1B48 A;  4NXI A;  2DSA A;  5IO2 A;  2FA8 A;  14GS A;  1XOA A;  3LJR A;  3F3R A;  3HDC A;  3HZ4 A;  2B3S A;  2H6Y A;  3TRQ A;  1FB6 A;  3DXB A;  4V1A g;  2HSY A;  4MZC A;  1JZD A;  5GAP D;  4V2N A;  5B7C A;  4TXO B;  2XBQ A;  4OD7 A;  2C3T A;  4JRR A;  1CQG A;  4JBB A;  3WT2 A;  3L78 A;  9GSS A;  4EC0 A;  4CY6 A;  5F05 A;  2E0Q A;  4XRD A;  1HNC A;  4I5Q A;  3KM6 A;  2YV9 A;  4KDY A;  3M3M A;  5D73 A;  3F9U A;  4KGI A;  3IR4 A;  3FZ9 A;  1BJX A;  1MTC A;  3D4M A;  4I2T A;  4K1F A;  1EGO A;  1YKA A;  3G7J A;  2WGR A;  5IO0 A;  2KHP A;  1GSQ A;  4TRX A;  2NPB A;  4IBP A;  2A2P A;  4X0X A;  3R3E A;  3IV4 A;  4IKH A;  1GL8 A;  2L6C A;  2HRK A;  1X5C A;  4WET A;  4G2E A;  1EP7 A;  2IWT A;  4AJ8 A;  3GX8 A;  1ML6 A;  3VPQ A;  4IHU A;  2VCQ A;  3GIX A;  3HY2 A;  2VUP A;  2CT6 A;  5IMC A;  3GSS A;  4X1U A;  1EEJ A;  1TTZ A;  3TJJ A;  2OA7 A;  1K0M A;  1M9A A;  5KN1 A;  3LG6 A;  1Y25 A;  1G7O A;  2LST A;  1IYH A;  2RUE A;  4MJB A;  4N30 A;  4ML6 A;  4EUY A;  4POB A;  2GLR A;  2GQK A;  5ECP B;  4HI7 A;  1K0D A;  2FLS A;  3ZML A;  2EIQ A;  5D8I A;  1IYI A;  3Q18 A;  1AAZ A;  3TKS E;  5AIS A;  4A5P A;  1TRS A;  3F4R A;  4MZW A;  2E2M A;  3L4N A;  4MZB A;  1K0O A;  4G0I A;  6GSW A;  3O3T A;  3VI5 A;  4LMV A;  4EDZ A;  4K6X A;  2M80 A;  5AIV A;  2A4V A;  2LJR A;  1WP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...