4PUFC

Complex between the salmonella t3ss effector slrp and its human target thioredoxin-1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
112
structure length
112
Chain Sequence
HHHHHGSMVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/oxidoreductase
molecule keywords E3 ubiquitin-protein ligase SlrP
publication title The structure of the Slrp-Trx1 complex sheds light on the autoinhibition mechanism of the type III secretion system effectors of the NEL family.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 28
structure length 112
sequence length 112
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4pufC00
5J9BA 1G6WA 4KSOA 5B8BA 3APSA 4PUAA 1K0AA 4N30A 4JRRA 3DXBA 5JWQB 5D73A 3SWLA 1KBNA 1MD4A 2CVKA 3TKPA 13GSA 4K9ZA 3IBHA 3F4TA 3QDNA 1Q4JA 1O8WA 4WKWA 3J7Yb 3HVVA 2I1UA 2PGTA 4MF5A 1NHYA 5DJMA 3CTFA 1PMTA 1WWJA 5GAND 1BAYA 1T8EB 5FHIA 4WEYA 3Q18A 1MDKA 2H8LA 3S9FA 5CO3A 1JLWA 2VLTA 1DE1A 2EIRA 4OFMA 5IO2A 3WGXA 2BTOT 2IMEA 3KP9A 4KNDA 2RM6A 4ID0A 2L6DA 3ED3A 4D73B 1I9DA 5JWOB 1Y6EA 4YQUA 2FUG2 4ECCA 1CQGA 3UAPA 3EE2A 2H73A 3TRQA 3RHBA 2FWFA 3EMPA 2R6KA 3CRTA 4I6XA 2FGXA 3UBLA 3IPZA 1DE2A 3IOSA 5IMZA 3W8SA 3ZL5A 4GCIA 4RI6A 2P5RA 3QFBC 5F0GA 5A5KA 3GYKA 3O76A 3GKKA 4K6XA 2PVOC 3EURA 3I6AA 5EL8A 5IOWA 1FW1A 4E8EA 3HA9A 2DC5A 5D8IA 4JE1A 3QR6A 3IK7A 1Q98A 1R4WA 4XRDA 1X9MB 2HRNA 2HXKA 2L59A 1T3BA 4MPFA 2MMOA 4AGSA 2IFQB 1TK5B 1R5AA 5AGYA 3G7YA 4TRXA 5ECRB 4OFNA 5DALB 4HZ2A 1CQHA 2GQKA 4GRFA 5H5RA 4IBPA 4O32A 1BG5A 4N11A 1SL0B 3QAGA 3GUSA 1YKCA 4EXJA 2L5OA 5AISA 14GSA 1M0UA 3UL3A 3L9UA 2G0FA 5HFKA 1GLQA 2FY6A 3VURA 3UBKA 4PXOA 3KMNA 3LG6A 3F9UA 3QAWA 3BJ5A 4NWYA 2XHFA 3EU3A 4EDZA 3F4SA 2DJ1A 5DQYA 2BMXA 2KHPA 5IMDA 3ERGA 1GSUA 3HVXA 1V58A 2YN1A 2CAIA 2H6ZA 2H1BA 1X5DA 1H75A 4ZILA 4NMUA 2I4AA 3P7XA 4DEJA 2E2MA 4F2IA 3H93A 4QL7A 4X43A 1YQ1A 2R2JA 3FW2A 2AV4A 3C1RA 3Q19A 4TVEA 2CAQA 4GSNA 5GSSA 1B4QA 1SKWB 3HYPA 1IYIA 3A2XA 1SYXA 2YOIA 3GL3A 1O7UA 2GTUA 3F6FA 1F37A 1UVZA 4XRAA 1A8YA 2F8AA 4FYCA 4JR6A 2FA4A 3F63A 3PINA 4AJ7A 2DIYA 2MBSA 3LORA 2PPTA 3U6VA 3GFKA 1K3OA 1TW9A 3KM6A 2DJ2A 4X0XA 1EV4A 3IXRA 1PKZA 2XBIA 4X1UA 3L0HA 2LSTA 1GSQA 1VRSD 3LQ7A 4ZB8A 3F0IA 3WD6A 1ERTA 4Q5QA 1PX6A 4K7NA 4MJEA 2XC2A 1AAZA 1A0FA 1A2JA 1B48A 3F4RA 1U3IA 1TTZA 2I81A 2YJ7A 3O3TA 3QCPA 1FO5A 2CQ9A 3KH7A 2A2SA 2OE1A 1BQ7A 5D96A 3IRAA 2VL2C 4ZIJA 4TR3A 1XW6A 1PA3A 1GL8A 5ECPB 3CYNA 1PN9A 1ERVA 2O87A 2R37A 2YNXA 1AXDA 3WGDA 4JEDA 4KH7A 1YY7A 5J3RA 1OE7A 3NIVA 1FAAA 1EEJA 2VAFA 4ECJA 4BL7A 5E59A 2H1AA 4K7OA 1TRVA 1DUGA 1MDJA 3QFAC 4MCUA 1GUHA 4LA1A 2J9HA 2YPMA 1B9YC 3CSHA 2VD0A 2P5QA 2H0HA 4RQRA 1PSQA 2HYXA 5H5QA 1X5CA 1XWKA 3GMFA 2B5XA 3GV1A 1XIYA 4ZBBA 1K0OA 3LYKA 4L5OA 1EWXA 2B7JA 3HVSA 2JZTA 4K7IA 1MEKA 2TRXA 4YQVA 2O89A 4I8BA 3NZNA 3UIWA 3HHVA 4MJBA 3VK9A 2H0IA 3BOAA 2IN3A 4JR4A 2E7PA 1NM3A 3TOUA 2AUVA 4ACSA 1OKTA 4IJIA 4BVYA 2LNTA 5F07A 1TI1A 1LU4A 3OR5A 3E0UA 2H1GA 4BVXA 2FWGA 5IMVA 1A23A 1QMVA 1ZL9A 1SJZA 5DDLA 1JZRA 3PR8A 1K0NA 3C8EA 1JZWA 4IVFA 3EWLA 2QC7A 1U3AA 3ME8A 3RBTA 1FG4A 3ZVJA 3TRXA 3AY8A 2AYTA 3GKNA 3LEFA 2XBQA 2ZCTA 1HYUA 3W6GA 3TJKA 4QL9A 1YDKA 4KUNA 4YH2A 1XW9A 3UARA 4V2MA 3D5JA 2H6YA 4EE0A 4L0UA 3DYRA 3GHAA 2VOCA 1V40A 2LRCA 2JACA 2JZSA 17GSA 4HJMA 2PN8A 11GSA 3EINA 1OVNA 2GSSA 3FY7A 5IMAA 2CVBA 3KZQA 2M72A 3RAZA 5J5NA 2VCWA 6GSSA 4K1FA 3DRNA 2H74A 3ME7A 6GSYA 2E2GA 5HR0A 5F8BA 3H1NA 2C0FA 3ERWA 2C80A 4Q5FA 4MJAA 1XOBA 1XWCA 4FIWA 4OCEA 3FZ9A 3HJPA 4KDYA 4FH8A 4NXIA 2N5AA 1GH2A 1SU9A 3P8WA 1WIKA 2H71A 4ECBA 2IMKA 2F51A 1Z6MA 1GTIA 1M2AA 2N5BA 2V6KA 1SL2B 4V2LA 4GWRA 3ZITA 5C04A 5LNKe 2ALBA 1B4PA 1UN2A 1J08A 6GSVA 2CX4A 3D6IA 2YWMA 3IR4A 2F8FA 4XHMA 2MMZA 1S3DA 1SD9A 3GKXA 2AJQB 4LLRA 1NSWA 2B5EA 3L78A 3I43A 1Z6NA 3GRXA 5GZZB 1SYRA 3HXSA 4I5QA 4AJ6A 4PQ1A 3L4NA 3DD3A 4Z7XA 1GWCA 3A5WA 3C7MA 5G5EA 3V1WA 2XPEA 4PQIA 2PVQA 2L57A 1K0MA 5CNWA 3P90A 5IPGA 4XTSA 2C0EA 4BWSA 1WMJA 1E6BA 1ZOFA 4H86A 4NAXA 2G2QA 2V41A 2VUPA 3HKRA 4JZQA 3TKSC 3EMXA 3APQA 1BX9A 1A2LA 1F3BA 4IKHA 4IGJA 2JL4A 3KMOA 4TR1A 1K0CA 2L4QA 5G1KA 3E9JB 5G1LA 4L8EA 2NDOA 4PNGA 5ENUA 3FEUA 2R4VA 5H5SA 5C00A 6GSTA 1XBSA 4GQFA 2ES7A 1KNGA 1PX7A 1XFLA 2O8VB 1C72A 4ULXA 3DIEA 1ABAA 4QQ7A 1XWGA 2TIRA 1PL1A 3IA1A 1EOGA 2RUEA 1YEXA 4EUYA 5F06A 2CT6A 2YWIA 1FOVA 3EC3A 2YV9A 1XWAA 4PUFC 1B9XC 2HE3A 4WBJA 1T4ZA 2CVDA 3UEMA 2O7KA 1ZGNA 1I5GA 1YZXA 2KLXA 3ZRDA 3H8QA 1YJ6A 1FB6A 1O81A 4MPGA 4MZBA 4PURA 5HFGA 4POLA 1RW1A 3F6DA 3ZREA 4HQZA 20GSA 4HOJA 5J41A 5B6NA 2R5GA 3ZVJD 4HDEA 3MWHA 2FWHA 1GSFA 3GKMA 6GSUA 3C71A 1SK0A 1Z5YE 1GSDA 3VLNA 4EO3A 1WPIA 2IMFA 1A2MA 1QFNA 2H75A 3UJ1A 5IMFA 2N5FA 2OKAA 2WCIA 3TJBA 1XZOA 1X5EA 3TJGA 4Q5RA 2DJJA 5ECOB 2A4VA 2GGTA 4WR4A 2GQMA 4DSSA 3MSZA 3TKRA 2L5LA 3N9JA 19GSA 4PNFA 4MMMA 4MABA 2IL3A 3A2VA 4POMA 4IJ3A 5DCGA 3VWVA 2C8UA 4TR1B 4LMWA 5CRWA 4G19A 3FZ4A 4F0CA 2P0GA 3TGZA 1GLPA 1S3CA 1ML6A 3DKSA 3CXGA 1UA5A 1AW9A 1Z7RA 5ECMB 6GSXA 5DBQA 2YZUA 3HDCA 2OADA 1EP7A 1QUWA 3TKSE 2RM5A 1RQMA 2MBTA 3KJYA 4ZL8A 2LJAA 1FHEA 4MP4A 1O85A 1TU7A 4YAPA 3DWVA 1OC8A 3VI7A 3GTUA 4O7HA 2LKUA 2YWNA 4MF6A 2LUSA 2IPAA 3UVTA 2I3YA 2HNLA 1M7TA 2LNSA 1TP9A 2GSRA 4WXTA 4IELA 2HFDA 1GUMA 3TRPA 2TRCP 2F3MA 3ZMLA 1G6YA 6GSWA 1NW2A 1XVWA 1M9BA 3O6TA 3HZ8A 3IHQA 3GH6A 4V1Ap 1WP0A 2VL9A 3KTBA 1VF2A 8GSSA 4NHZA 2OBIA 5HR1A 4GXZA 3I69A 5CP1A 3UOMA 1GP1A 1XPVA 5DQSA 1F2EA 4PQHA 2I9HA 3G9BA 4HUAA 4XS6A 1O8XA 1F6MC 1EOHA 2H01A 2C3NA 4DSRA 4ZXGA 4MJCA 3SBCA 3LWAA 5AIXA 2V6OA 3M3MA 3JCML 5D93A 2L4CA 2VO4A 3GH9A 4TOPA 3H4KA 5ID2A 2VCTA 3VFIA 4WF4A 1J0FA 2PU9C 2X99A 4OO4A 1MD3A 2WJUA 2F9SA 1W89A 2HZEA 2LS5A 3TDGA 1HD2A 2WZ9A 1TU8A 1PRXA 4CHSA 4KAEA 4IP6A 2KP2A 4NPBA 4EKZA 3GX0A 2HSYA 5CAXA 1ZYQB 3Q6OA 2GSTA 4RUVA 1GSYA 5AN1A 5G30A 1XW5A 3KCMA 1TRWA 2K6VA 1GNWA 3LFLA 2IMIA 4CDOA 3APOA 16GSA 5ECHB 4ISDA 1TJDA 2H0GA 1PD21 2FCHA 1VF3A 2WFCA 3M9JA 4DSSB 5IM9A 1VF1A 22GSA 1K3LA 3BCKA 5ABRA 3D4MA 3BBYA 5CRHA 4V1Ag 1U87A 1GSSA 2HT9A 1B8XA 1F3AA 4KA0A 3F3RA 2DJ0A 4MDCA 2RIIA 1A0RP 4AF2A 3KGKA 3QD9A 1THXA 5D9VA 4EVMA 4KE3A 4HU9A 1U88A 2ON7A 12GSA 3ERFA 4MZCA 5D9TA 1K0BA 4GF0A 4PX1A 2C1YA 3KTLA 3GTUB 2FLSA 4OWYA 1XVQA 2MMAA 1QXHA 5IMCA 4XCSA 1ZYEA 3P2AA 1G7EA 1X9SB 2EIQA 2WRTA 4XIHA 2O85A 4KDXA 1GTUA 2C4JA 4MZWA 3IE3A 4AJ8A 4EF0A 1RK4A 2OA7A 5EPFA 3KEBA 2GZZA 2JU5A 2K8VA 2LQQA 3LJRA 2V32A 3TJJA 2C0GA 4MK3A 3FZ5A 1TKDB 1Y25A 2GVPA 3NOFA 4TR4A 2H6XA 1O6JA 2H30A 2REMA 4HU7A 7GSSA 2VL3A 3IV4A 1UC7A 5FWGA 1BEDA 2NTOA 2GDRA 1Z9HA 3IAS2 1M9AA 4EDYA 4MH3A 2WULA 3KXOA 4O92A 3BCIA 4TN8A 2DBCA 4F0BA 2OE3A 3TCOA 5ID2B 3KIJA 2JADA 2NVLA 5B7CA 3ZFLA 3TB2A 4GSSA 2GT6A 2C3TA 3GSSA 5KN2A 1T7PB 2XPDA 3HJMA 2HZEB 5ECQB 1O73A 2D2ZA 3HZ4A 3DVWA 2YV7A 2YWOA 2AAWA 1XCCA 3HJOA 4ML6A 1ON4A 3I9V2 2M46A 3GNJA 4YAVA 2FNOA 2BJXA 3KP8A 4I2UA 2VM1A 2PMTA 1F9MA 4OCFA 5B6MA 4GQCA 3A3TA 5IPHA 1LBKA 1K3YA 3RPNA 2H66A 1BJXA 4Q5NA 1AIUA 1Z7PA 2DSAA 4ZBAA 2DLXA 4HQSA 5CYYA 3DGQA 1HNCA 1R26A 5KN0A 1ZZYA 2X8HA 2VCZA 4NV2A 4N10A 1ACVA 4LL1B 1VF4A 2YANA 4KGIA 1YEPA 4N0ZA 3WGEA 2V2GA 4J57E 1YF0A 3M8NA 3RPPA 1JZDA 1JLVA 3FKFA 4FYUA 4TW5A 4LL4B 3HD5A 2AB6A 5HFIA 3LXZA 4IN0A 1FVJA 2IWTA 1OYJA 4POKA 3DMLA 3GURA 1A24A 1E2YA 5A4WA 3Q74A 1AUCA 5LD0A 3LYPA 2VLUA 4N0VA 3IK9A 1AQVA 3GIXA 2EC4A 4GSTA 4GLTA 4P3YB 3G7JA 2OACA 3H79A 3LGCA 2QKEA 3FHKA 5A4VA 2CZ2A 3M1GA 2FWEA 2PUKC 3WYWA 5ECIB 2DJ3A 2YCDA 1TRUA 4IQAA 2VD1A 3ZIVA 1TK8B 2WB9A 3LSZA 3J7Yk 4ZBDA 1OE8A 3DVXA 3FK8A 2IMDA 1USBA 4L0WA 2L6CA 5G2ZA 1K0DA 2PERA 4F82A 4HZ4A 3UMAA 1V98A 4WR5A 1PKWA 2LQOA 5J4UA 3M0FA 3ZLPA 3C73A 3G7IA 4POBA 1FB0A 2K18A 4XS1A 4NHWA 2WS2A 1ZMAA 2YP6A 4G2EA 1DBYA 4JBBA 3L9VA 4ZB9A 2RUFA 3FYGA 3RHCA 5HQPA 5F05A 1V2AA 4OO5A 2LTKA 1AQWA 4YQMA 1X0RA 2VL2A 1YF1A 1R7HA 2CX3A 1TI3A 1YKAA 5ELGA 2VCVA 1JFUA 2HLSA 3U5RE 3D4TA 3ZIJA 1T4YA 1X9WB 1V57A 2DMLA 4DVCA 2H70A 1R5PA 2NPBA 5ELAA 2LJKA 3VWWA 1SJ6A 5GSTA 3VWXA 2DMMA 2HSHA 2PWJA 4TXOA 1FVKA 2P31A 3US3A 2HRFA 3MDKA 1T00A 5D9XA 3KD0A 4NV5A 4KDUA 1U6TA 2MYGA 4KB3A 4ZL9A 1KTEA 4BWQA 2B6MA 5DVBA 3WT2A 3CBUA 2QGVA 9GSSA 4ZB6A 3MAKA 3LXTA 5LCZA 3D0ZA 4PGTA 1TXXA 4TR0A 2OJLA 2B1LA 3VI5A 4FO5A 3CMIA 3IDVA 2VIMA 4ZL7A 1EGOA 1EGRA 1HQOA 2H76A 1M2BA 2ZUPA 5JWRB 5IIZA 2H72A 2H1DA 5A4UA 1XXUA 2GLRA 2R3XA 2A2RA 1A8LA 4XS4A 1SJIA 1SK1A 3TOTA 2WDUA 3K8NA 3VPQA 1TOFA 4O5RA 1QGVA 4MA9A 3EU4A 4HJ2A 3QAVA 3FZAA 1S3AA 1PQNA 1QK8A 4IP1A 1V9WA 1OC9A 1ERWA 3L9SA 3QMXA 2HZFA 4G10A 4HS1A 2B1KA 4K8MA 2B3SA 4KX4A 2K8SA 1NHOA 4KCAA 3PGTA 3KH9A 1XOAA 2JSYA 1LJRA 4L5LA 5DJLA 1HNBA 4F9ZA 1AC1A 3HCZA 3EVIA 1MTCA 1EV9A 4IHUA 4ML1A 2MZCA 1DSBA 3IAM2 2DJKA 5B8AA 3IC4A 4DSQA 4KW6A 3GL5A 2B5YA 10GSA 1QQ2A 2LJRA 3ISOA 4KSMA 5JCWA 2KP1A 5J9CA 2LRNA 5HR3A 4RI7A 2X64A 3ZFBA 1PL2A 2X8CA 4MH2A 4WF5A 3TJFA 3FR9A 1EP8A 3CSIA 3F8UA 2X8GA 2GSQA 1EZKA 2GZPA 4V2NA 4OFTA 1G0TA 3R2QA 2CZ3A 2RLIA 5DAKA 2VLVA 4ECIA 1WJKA 5D9WA 1XWBA 2GS3A 1N8JA 5AIVA 4TXOB 4FYBA 2ZNMA 2JSZA 3PH9A 3VPTA 1ERUA 5ECNB 4BA7A 4G9HA 5KN3A 3WT1A 5CREA 1TDIA 5ECKB 3E3EA 2J23A 5DCHA 3ZYWA 2JZRA 4GTUA 2VM2A 4I97A 1T1VA 2EIOA 3DEXA 5INYA 3FR6A 4K0GA 2C0DA 2H19A 4JU5A 5EVOA 3QPMA 1HNAA 3HY2A 3RDWA 1TRSA 1W4VA 2V1MA 4MLYA 1WOUA 1ILOA 4LMVA 3MNGA 1GSEA 1KEBA 3QOUA 1ST9A 18GSA 2LEGA 4HEA2 5CRDA 2M80A 4E8HA 3GX8A 2E0QA 2IJYA 1GULA 5KN1A 1SENA 1GTBA 3ZZXA 4XS4B 2FHEA 4CW9A 1M2DA 1GTAA 1OC3A 3UVHA 1OKDA 5IOXA 4RQXA 2FD3A 3D22A 3TKSA 5FT3A 2PBJA 1J9BA 3GA4A 1BYEA 5EY6A 2VCQA 4K2DA 1OC9B 1M99A 2OE0A 4K0NA 2IIYA 3TKQA 3VWUA 2ON5A 2HI7A 2YZHA 1Z3EA 2C3QA 4OMVA 3CTGA 4WETA 4I2TA 4D73A 1JHBA 4IQ1A 2KUCA 2YJHA 1SL1B 3A2WA 1OAZA 2LV3A 1GRXA 5L71A 2AHEA 4TXVA 1AQXA 5GAPD 5ECSA 2OBKA 3GN3A 3M9KA 5G31A 1TK0B 3N5OA 5HR2A 1ZCPA 2VCXA 1GNEA 2MMNA 4IW9A 2GT5A 4J56E 5G5FA 2LRTA 1EEMA 1PGTA 5CRGA 2FA8A 2CA8A 4OD7A 5E4WA 5JCGA 3GSTA 3BD2A 1GUKA 3W8JA 1SKSB 1H4OA 1JZOA 3C1SA 3CSJA 1VGLA 2IFQA 4MF7A 1IYHA 5DALA 5DAKB 5IQYA 4WBRD 2CV4A 1THOA 1SK2A 5ECLB 1MDIA 2NBSA 2Z9SA 1WE0A 3EYTA 3TUEA 4EC0A 3ZMKA 3D21A 1SD8A 1N2AA 1URMA 5JCUA 4F03A 3CRUA 3F3QA 2DIZA 2KOKA 5KEJA 3FR3A 1G7OA 5COHA 5IO0A 2B7KA 3ZTLA 2GQLA 2K9FA 4HI7A 1WRYA 2GZYA 2QSIA 4EL1A 3FRCA 1SKRB 2WGRA 4KCEA 4BPYA 4J2FA 4TKYA 4ILFA 4IS0A
chains in the Genus database with same CATH superfamily
5J9BA 1G6WA 4KSOA 5B8BA 3APSA 4MNNA 4PUAA 1K0AA 4N30A 4JRRA 3DXBA 5JWQB 5D73A 3SWLA 1KBNA 1MD4A 2CVKA 3TKPA 13GSA 4K9ZA 3IBHA 3F4TA 3QDNA 1Q4JA 1O8WA 4WKWA 3J7Yb 3HVVA 2I1UA 2PGTA 4MF5A 1NHYA 5DJMA 3CTFA 1PMTA 1WWJA 5GAND 1BAYA 2DKIA 1T8EB 5FHIA 4WEYA 3Q18A 1MDKA 2H8LA 3S9FA 5CO3A 1JLWA 2VLTA 1DE1A 2EIRA 4OFMA 5IO2A 3WGXA 2BTOT 2IMEA 3KP9A 4KNDA 2RM6A 4CY8A 4ID0A 2L6DA 3ED3A 4D73B 1I9DA 5JWOB 1Y6EA 4YQUA 2FUG2 4ECCA 1CQGA 3UAPA 3EE2A 2H73A 3TRQA 3RHBA 2FWFA 3EMPA 2R6KA 3CRTA 4I6XA 2FGXA 3UBLA 3IPZA 2HRKA 1DE2A 3IOSA 5IMZA 3W8SA 3ZL5A 4GCIA 4RI6A 2P5RA 3QFBC 5F0GA 5A5KA 3GYKA 3O76A 3GKKA 4K6XA 2PVOC 3EURA 3I6AA 5EL8A 5IOWA 1FW1A 4E8EA 3HA9A 2DC5A 5D8IA 4JE1A 3QR6A 3IK7A 1Q98A 1R4WA 4XRDA 1X9MB 2HRNA 2HXKA 2L59A 1T3BA 4MPFA 2MMOA 4AGSA 2IFQB 1TK5B 1R5AA 5AGYA 3G7YA 4TRXA 5ECRB 4OFNA 5DALB 4HZ2A 1CQHA 2GQKA 4GRFA 5H5RA 4IBPA 4O32A 1BG5A 5BMUA 4N11A 1SL0B 3QAGA 3GUSA 1YKCA 4EXJA 2L5OA 5AISA 14GSA 1M0UA 3UL3A 3L9UA 2G0FA 5HFKA 1GLQA 2FY6A 3VURA 3UBKA 4PXOA 3KMNA 3LG6A 3F9UA 3QAWA 1S3RA 3BJ5A 4NWYA 2XHFA 3EU3A 4EDZA 3F4SA 2DJ1A 5DQYA 2BMXA 2KHPA 5IMDA 3ERGA 1GSUA 3HVXA 1V58A 2YN1A 2CAIA 2H6ZA 2H1BA 1X5DA 1H75A 1XG8A 4ZILA 4NMUA 2I4AA 3P7XA 4DEJA 2E2MA 4F2IA 3H93A 4QL7A 4X43A 1YQ1A 2R2JA 3FW2A 2AV4A 3C1RA 3Q19A 4TVEA 2CAQA 4GSNA 5GSSA 1B4QA 1SKWB 3HYPA 1IYIA 3A2XA 1SYXA 2YOIA 3GL3A 1O7UA 2GTUA 3F6FA 1F37A 1UVZA 4XRAA 1A8YA 2F8AA 4FYCA 4JR6A 2FA4A 3F63A 3PINA 4AJ7A 2DIYA 2MBSA 3LORA 2PPTA 3U6VA 3GFKA 1K3OA 1TW9A 3KM6A 2DJ2A 4X0XA 1EV4A 3IXRA 1PKZA 2XBIA 4X1UA 2QA1A 3L0HA 2LSTA 1GSQA 1VRSD 3LQ7A 4ZB8A 3F0IA 3WD6A 1ERTA 4Q5QA 1PX6A 4Z2TA 4K7NA 4MJEA 2XC2A 1AAZA 1A0FA 4ICYA 1A2JA 3HVNA 1B48A 3F4RA 1U3IA 1TTZA 2I81A 2YJ7A 3O3TA 3QCPA 1FO5A 2CQ9A 3KH7A 2A2SA 2OE1A 1BQ7A 5D96A 3IRAA 2VL2C 4ZIJA 4TR3A 1XW6A 1PA3A 1GL8A 5ECPB 3CYNA 1PN9A 1ERVA 2O87A 2R37A 2YNXA 1AXDA 3WGDA 4JEDA 4KH7A 1YY7A 5J3RA 1OE7A 3NIVA 1FAAA 1EEJA 2VAFA 4ECJA 4BL7A 5E59A 2H1AA 4K7OA 1TRVA 1DUGA 1MDJA 3QFAC 4MCUA 1GUHA 4LA1A 4USSA 2J9HA 2YPMA 1B9YC 3CSHA 1PN0A 2VD0A 2P5QA 2H0HA 4RQRA 1PSQA 2HYXA 5H5QA 1X5CA 1XWKA 4EIQA 3GMFA 2B5XA 3GV1A 1XIYA 4ZBBA 4Z2RA 1K0OA 3LYKA 4L5OA 1EWXA 2B7JA 3HVSA 2JZTA 4K7IA 1MEKA 2TRXA 4YQVA 2O89A 4I8BA 3NZNA 3UIWA 3HHVA 4MJBA 3VK9A 2H0IA 3BOAA 2IN3A 4JR4A 2E7PA 1NM3A 3TOUA 2AUVA 4ACSA 1OKTA 4IJIA 4BVYA 2LNTA 5F07A 1TI1A 1LU4A 3OR5A 3E0UA 2H1GA 4BVXA 3PPUA 2FWGA 5IMVA 1A23A 1QMVA 1ZL9A 1SJZA 5DDLA 1JZRA 3PR8A 1K0NA 3C8EA 2X4AA 1JZWA 4IVFA 3EWLA 2QC7A 1U3AA 3ME8A 3RBTA 1FG4A 3ZVJA 3TRXA 3AY8A 2AYTA 3GKNA 3LEFA 2XBQA 2ZCTA 1HYUA 3W6GA 3TJKA 4QL9A 1YDKA 4KUNA 4YH2A 1XW9A 3UARA 4V2MA 3D5JA 2H6YA 4EE0A 3LW9A 4L0UA 3DYRA 3GHAA 2VOCA 1V40A 2LRCA 2JACA 2JZSA 17GSA 4HJMA 2PN8A 11GSA 3EINA 2R0GA 1OVNA 2GSSA 3FY7A 5IMAA 2CVBA 3KZQA 4O5UA 2M72A 3RAZA 5J5NA 2VCWA 6GSSA 4K1FA 3DRNA 2H74A 3ME7A 6GSYA 4K5RA 2E2GA 5HR0A 5F8BA 3H1NA 2C0FA 3ERWA 2C80A 4Q5FA 4MJAA 1XOBA 1XWCA 4FIWA 4OCEA 3FZ9A 3HJPA 4KDYA 4FH8A 4NXIA 2N5AA 1GH2A 1SU9A 3P8WA 1WIKA 2H71A 4ECBA 2IMKA 2F51A 3IHGA 1Z6MA 1GTIA 1M2AA 2N5BA 2V6KA 1SL2B 4V2LA 4GWRA 3ZITA 5C04A 5LNKe 2ALBA 3MYDA 1B4PA 1UN2A 1J08A 6GSVA 2CX4A 3D6IA 2YWMA 3IR4A 2F8FA 4XHMA 2MMZA 1S3DA 1SD9A 3GKXA 2AJQB 4LLRA 1NSWA 2B5EA 3L78A 3I43A 1Z6NA 3GRXA 5GZZB 1SYRA 3HXSA 4I5QA 4AJ6A 2QA2A 4PQ1A 3L4NA 3DD3A 4BVYB 4Z7XA 1GWCA 4O5QA 3A5WA 3C7MA 5G5EA 3V1WA 2XPEA 4PQIA 4BVXB 2PVQA 2L57A 4EIPA 1K0MA 5CNWA 3P90A 5IPGA 4XTSA 2C0EA 4YKFA 4BWSA 1WMJA 1E6BA 1ZOFA 4H86A 4NAXA 2G2QA 2V41A 2VUPA 3HKRA 4JZQA 3TKSC 3EMXA 3APQA 1BX9A 1A2LA 1F3BA 4IKHA 4IGJA 2JL4A 3KMOA 4TR1A 1K0CA 2L4QA 5G1KA 3E9JB 5G1LA 4L8EA 2NDOA 4PNGA 5ENUA 3FEUA 2R4VA 5H5SA 5C00A 6GSTA 1XBSA 4GQFA 2ES7A 1KNGA 1PX7A 1XFLA 2O8VB 1C72A 4ULXA 3DIEA 1ABAA 4QQ7A 1XWGA 2TIRA 1PL1A 3IA1A 1EOGA 2RUEA 1YEXA 4EUYA 5F06A 4A5PA 2CT6A 2YWIA 1ZYPA 1FOVA 3EC3A 2YV9A 1XWAA 4PUFC 1B9XC 2HE3A 4WBJA 1T4ZA 2CVDA 3UEMA 2O7KA 1ZGNA 1I5GA 1YZXA 2KLXA 3ZRDA 3H8QA 1YJ6A 1FB6A 1O81A 4MPGA 4MZBA 4PURA 5HFGA 4POLA 1RW1A 3F6DA 3ZREA 4HQZA 20GSA 4HOJA 5J41A 5B6NA 2R5GA 3ZVJD 4HDEA 3MWHA 2FWHA 1GSFA 3GKMA 6GSUA 3C71A 1SK0A 1Z5YE 1GSDA 3VLNA 4EO3A 1WPIA 2IMFA 1A2MA 1QFNA 2H75A 3UJ1A 5IMFA 2N5FA 2OKAA 2WCIA 3TJBA 1XZOA 1X5EA 3TJGA 4Q5RA 2DJJA 5ECOB 2A4VA 2GGTA 4WR4A 2GQMA 4DSSA 5BRTA 3MSZA 3TKRA 2L5LA 3N9JA 19GSA 4PNFA 4MMMA 4MABA 2IL3A 3A2VA 4POMA 4IJ3A 5DCGA 3VWVA 2C8UA 4TR1B 4LMWA 5CRWA 4G19A 3FZ4A 4F0CA 2P0GA 3TGZA 1GLPA 2HSMA 1S3CA 1ML6A 3DKSA 3CXGA 4FQUA 1UA5A 1AW9A 1Z7RA 5ECMB 6GSXA 5DBQA 2YZUA 3HDCA 2OADA 1EP7A 1QUWA 3TKSE 2RM5A 1RQMA 2MBTA 3KJYA 4ZL8A 2LJAA 1FHEA 4MP4A 1O85A 1TU7A 4YAPA 3DWVA 1OC8A 3VI7A 3GTUA 4O7HA 2LKUA 2YWNA 4MF6A 2LUSA 2IPAA 3UVTA 2I3YA 2HNLA 1M7TA 2LNSA 1TP9A 2GSRA 4WXTA 2R0PA 4IELA 2HFDA 1GUMA 3TRPA 4K5SA 2TRCP 2F3MA 3ZMLA 1G6YA 6GSWA 1NW2A 1XVWA 1M9BA 3O6TA 3HZ8A 3IHQA 3GH6A 4V1Ap 1WP0A 2VL9A 3KTBA 1VF2A 8GSSA 2HRAA 4NHZA 2OBIA 5HR1A 4GXZA 3I69A 5CP1A 3UOMA 3EPTA 1GP1A 1XPVA 5DQSA 1F2EA 4PQHA 2I9HA 3G9BA 4HUAA 4XS6A 1O8XA 1F6MC 1EOHA 2H01A 2C3NA 4DSRA 4ZXGA 4MJCA 3SBCA 3LWAA 5AIXA 2V6OA 3M3MA 3JCML 5D93A 2L4CA 2VO4A 3GH9A 4TOPA 3H4KA 5ID2A 4X4JA 2VCTA 3VFIA 4PTSA 4WF4A 1J0FA 2PU9C 2X99A 4OO4A 1ZYNA 1MD3A 2WJUA 2F9SA 1W89A 2HZEA 2LS5A 3TDGA 1HD2A 2WZ9A 1TU8A 1PRXA 4CHSA 1PFOA 4KAEA 4IP6A 2KP2A 4NPBA 4EKZA 3GX0A 2HSYA 5CAXA 1ZYQB 3Q6OA 2GSTA 4RUVA 1GSYA 5AN1A 5G30A 1XW5A 3KCMA 1TRWA 2K6VA 1GNWA 3LFLA 2IMIA 4CDOA 3APOA 16GSA 5ECHB 4ISDA 1TJDA 2H0GA 1PD21 2FCHA 1VF3A 2WFCA 3M9JA 4DSSB 5IM9A 1VF1A 22GSA 1K3LA 3BCKA 5ABRA 3D4MA 3BBYA 5CRHA 4V1Ag 1U87A 1GSSA 2HT9A 1B8XA 1F3AA 4KA0A 3F3RA 2DJ0A 1FOHA 4MDCA 2RIIA 1A0RP 4AF2A 3KGKA 3QD9A 1THXA 5D9VA 4EVMA 4KE3A 4HU9A 1U88A 2ON7A 12GSA 3ERFA 4MZCA 5D9TA 1K0BA 5KOXA 4GF0A 4PX1A 2C1YA 3KTLA 3GTUB 2FLSA 4OWYA 1XVQA 2MMAA 1QXHA 5IMCA 4XCSA 1ZYEA 3P2AA 1G7EA 1X9SB 2EIQA 2WRTA 4XIHA 2O85A 4KDXA 1GTUA 2C4JA 4MZWA 3IE3A 4AJ8A 4EF0A 1RK4A 2OA7A 5EPFA 3KEBA 2GZZA 2JU5A 2K8VA 2LQQA 3LJRA 2V32A 3TJJA 2C0GA 4MK3A 3FZ5A 1TKDB 1Y25A 2GVPA 3NOFA 4TR4A 2H6XA 1O6JA 2H30A 2REMA 4HU7A 7GSSA 2VL3A 3IV4A 1UC7A 5FWGA 1BEDA 2NTOA 2GDRA 1Z9HA 3IAS2 1M9AA 4EDYA 4MH3A 2WULA 3KXOA 4O92A 3BCIA 4TN8A 1M3IA 2DBCA 4F0BA 2OE3A 3TCOA 5ID2B 3KIJA 2JADA 2NVLA 5B7CA 4BL7B 3ZFLA 3TB2A 4GSSA 2GT6A 2C3TA 3GSSA 5KN2A 1T7PB 2XPDA 3HJMA 2HZEB 5ECQB 1O73A 2D2ZA 3HZ4A 3DVWA 2YV7A 2YWOA 2AAWA 1XCCA 3HJOA 4ML6A 1ON4A 3I9V2 2M46A 3GNJA 4KF9A 4YAVA 4BIKA 2FNOA 2BJXA 3KP8A 4I2UA 2VM1A 2PMTA 1F9MA 4OCFA 5B6MA 4GQCA 3A3TA 2X49A 1LBKA 5IPHA 1K3YA 3RPNA 2H66A 1BJXA 4Q5NA 1AIUA 1Z7PA 2DSAA 4ZBAA 2DLXA 4HQSA 5CYYA 3DGQA 1HNCA 1R26A 5KN0A 1ZZYA 2X8HA 2VCZA 4NV2A 4N10A 1ACVA 4LL1B 1VF4A 2YANA 4KGIA 1YEPA 4N0ZA 3WGEA 2V2GA 4J57E 1YF0A 3M8NA 3RPPA 1JZDA 1JLVA 3FKFA 4FYUA 4TW5A 4LL4B 3HD5A 2AB6A 5HFIA 3LXZA 4IN0A 1FVJA 2IWTA 1OYJA 4POKA 3DMLA 3GURA 1A24A 1E2YA 5A4WA 3Q74A 1AUCA 5LD0A 3LYPA 2VLUA 4N0VA 3IK9A 1AQVA 3GIXA 2EC4A 4GSTA 4GLTA 4P3YB 3G7JA 2OACA 3H79A 3LGCA 2QKEA 3FHKA 5A4VA 2CZ2A 3M1GA 2FWEA 2PUKC 3WYWA 5ECIB 2DJ3A 2YCDA 1TRUA 4IQAA 2VD1A 3ZIVA 1TK8B 2WB9A 3LSZA 3J7Yk 4ZBDA 4HSCX 1OE8A 3DVXA 3FK8A 2IMDA 1USBA 4L0WA 2L6CA 5G2ZA 1K0DA 2PERA 4F82A 4HZ4A 3UMAA 1V98A 4WR5A 1PKWA 2LQOA 5J4UA 3M0FA 3ZLPA 3C73A 3G7IA 4POBA 1FB0A 2K18A 4XS1A 4NHWA 2WS2A 1ZMAA 2YP6A 4G2EA 1DBYA 4JBBA 3L9VA 4ZB9A 2RUFA 3FYGA 3RHCA 5HQPA 5F05A 1V2AA 4OO5A 2LTKA 1AQWA 1M3JA 4YQMA 1X0RA 2VL2A 1YF1A 1R7HA 2CX3A 1TI3A 1YKAA 5ELGA 2VCVA 1JFUA 2HLSA 3U5RE 3R3EA 3D4TA 3ZIJA 1T4YA 1X9WB 1V57A 2DMLA 4DVCA 2H70A 1R5PA 2NPBA 3A5IA 5ELAA 2LJKA 3VWWA 1SJ6A 5GSTA 3VWXA 2DMMA 2HSHA 2PWJA 4TXOA 1FVKA 2P31A 3US3A 2HRFA 3MDKA 1T00A 5D9XA 3KD0A 4NV5A 4KDUA 1U6TA 2MYGA 4KB3A 4ZL9A 1KTEA 4BWQA 2B6MA 5DVBA 3WT2A 3CBUA 2QGVA 9GSSA 4ZB6A 3MAKA 3LXTA 5LCZA 3D0ZA 4PGTA 1TXXA 4TR0A 2OJLA 2B1LA 3VI5A 4FO5A 3CMIA 3IDVA 2VIMA 4ZL7A 1EGOA 1EGRA 1HQOA 2H76A 1M2BA 2ZUPA 5JWRB 5IIZA 2H72A 2H1DA 5A4UA 1XXUA 2GLRA 2R3XA 2A2RA 1A8LA 4XS4A 1SJIA 1SK1A 3TOTA 2WDUA 3K8NA 3VPQA 1TOFA 5KOWA 4O5RA 1QGVA 4MA9A 3EU4A 4HJ2A 3QAVA 3FZAA 1S3AA 1PQNA 1QK8A 4IP1A 1V9WA 1OC9A 2A2PA 1ERWA 3L9SA 3QMXA 2HZFA 4G10A 4HS1A 2B1KA 4K8MA 2B3SA 4KX4A 2K8SA 1NHOA 4KCAA 3PGTA 3KH9A 1XOAA 2JSYA 2A4HA 1LJRA 4L5LA 5DJLA 1HNBA 4F9ZA 1AC1A 3HCZA 4CY6A 3EVIA 1MTCA 1EV9A 4IHUA 4ML1A 2MZCA 1DSBA 3IAM2 2DJKA 5B8AA 3IC4A 4DSQA 4KW6A 3GL5A 2B5YA 10GSA 1QQ2A 2LJRA 3ISOA 4KSMA 5JCWA 2KP1A 5J9CA 2LRNA 5HR3A 4RI7A 2X64A 3ZFBA 1PL2A 2X8CA 4MH2A 4WF5A 3TJFA 3FR9A 1EP8A 3CSIA 3F8UA 2X8GA 4G0KA 2GSQA 1EZKA 2GZPA 4V2NA 4OFTA 1G0TA 3R2QA 2CZ3A 2RLIA 5DAKA 2VLVA 4ECIA 2DKHA 1WJKA 5D9WA 1XWBA 2GS3A 1N8JA 5AIVA 4TXOB 4FYBA 2ZNMA 2JSZA 3PH9A 3VPTA 1ERUA 5ECNB 4BA7A 4G9HA 5KN3A 3WT1A 5CREA 1TDIA 5ECKB 3E3EA 2J23A 5DCHA 3ZYWA 2JZRA 4GTUA 2VM2A 4I97A 1T1VA 2EIOA 3DEXA 5INYA 3FR6A 4K0GA 4G0IA 4YKGA 2C0DA 2H19A 4JU5A 5EVOA 3QPMA 1HNAA 3HY2A 3RDWA 1TRSA 1W4VA 2V1MA 4MLYA 1WOUA 1ILOA 4LMVA 3MNGA 1GSEA 1KEBA 4G0LA 3QOUA 1ST9A 18GSA 2LEGA 4HEA2 5CRDA 2M80A 4E8HA 3GX8A 2E0QA 2IJYA 1GULA 5KN1A 1SENA 1GTBA 3ZZXA 4XS4B 4Z2UA 2FHEA 4CW9A 1M2DA 1GTAA 1OC3A 3UVHA 1OKDA 5IOXA 4RQXA 2FD3A 3D22A 3TKSA 5FT3A 2PBJA 3MIXA 1J9BA 3GA4A 1BYEA 5EY6A 2VCQA 4K2DA 1OC9B 1M99A 2OE0A 4K0NA 2IIYA 3TKQA 3VWUA 2ON5A 2HI7A 2YZHA 1Z3EA 2C3QA 4OMVA 3CTGA 4WETA 4I2TA 4D73A 1JHBA 4IQ1A 2KUCA 2YJHA 1SL1B 3A2WA 3IC8A 1OAZA 2LV3A 1GRXA 5L71A 2AHEA 4TXVA 1AQXA 5GAPD 5ECSA 2OBKA 3GN3A 3M9KA 5G31A 1TK0B 3N5OA 5HR2A 1ZCPA 2VCXA 1GNEA 2MMNA 4IW9A 2GT5A 4J56E 5G5FA 2LRTA 1EEMA 1PGTA 5CRGA 3CQFA 2FA8A 2CA8A 4OD7A 3FMWA 5E4WA 5JCGA 2R0CA 3GSTA 3BD2A 1GUKA 3W8JA 1SKSB 1H4OA 1JZOA 3C1SA 3CSJA 1VGLA 2IFQA 4MF7A 1IYHA 5DALA 5DAKB 5IQYA 4WBRD 2CV4A 1THOA 1SK2A 2UZ8A 5ECLB 1MDIA 2NBSA 2Z9SA 1WE0A 3EYTA 3TUEA 4EC0A 3ZMKA 3D21A 1SD8A 1N2AA 1URMA 5JCUA 4F03A 3CRUA 3F3QA 2DIZA 2KOKA 5KEJA 3FR3A 1G7OA 5COHA 5IO0A 2B7KA 3ZTLA 2GQLA 2K9FA 4HI7A 1WRYA 2GZYA 2QSIA 4EL1A 3FRCA 1SKRB 2WGRA 4KCEA 4BPYA 4J2FA 4TKYA 4K2XA 4ILFA 4IS0A
chains in the Genus database with same CATH topology
5J9BA 1G6WA 4KSOA 5B8BA 3APSA 4MNNA 4PUAA 1K0AA 4N30A 4JRRA 3DXBA 5JWQB 5D73A 3SWLA 1KBNA 1MD4A 2CVKA 3TKPA 13GSA 4K9ZA 3IBHA 3F4TA 3QDNA 1Q4JA 1O8WA 4WKWA 3J7Yb 3HVVA 2I1UA 2PGTA 4MF5A 1NHYA 5DJMA 3CTFA 1PMTA 1WWJA 5GAND 1BAYA 2DKIA 1T8EB 5FHIA 4WEYA 3Q18A 1MDKA 2H8LA 3S9FA 5CO3A 1JLWA 2VLTA 1DE1A 2EIRA 4OFMA 5IO2A 3WGXA 2BTOT 2IMEA 3KP9A 4KNDA 2RM6A 4CY8A 4ID0A 2L6DA 3ED3A 4D73B 1I9DA 5JWOB 1Y6EA 4YQUA 2FUG2 4ECCA 1CQGA 3UAPA 3EE2A 2H73A 3TRQA 3RHBA 2FWFA 3EMPA 2R6KA 3CRTA 4I6XA 2FGXA 3UBLA 3IPZA 2HRKA 1DE2A 3IOSA 5IMZA 3W8SA 3ZL5A 4GCIA 4RI6A 2P5RA 3QFBC 5F0GA 5A5KA 3GYKA 3O76A 3GKKA 4K6XA 2PVOC 3EURA 3I6AA 5EL8A 5IOWA 1FW1A 4E8EA 3HA9A 2DC5A 5D8IA 4JE1A 3QR6A 3IK7A 1Q98A 1R4WA 4XRDA 1X9MB 2HRNA 2HXKA 2L59A 1T3BA 4MPFA 2MMOA 4AGSA 2IFQB 1TK5B 1R5AA 5AGYA 3G7YA 4TRXA 5ECRB 4OFNA 5DALB 4HZ2A 1CQHA 2GQKA 4GRFA 5H5RA 4IBPA 4O32A 1BG5A 5BMUA 4N11A 1SL0B 3QAGA 3GUSA 1YKCA 4EXJA 2L5OA 5AISA 14GSA 1M0UA 3UL3A 3L9UA 2G0FA 5HFKA 1GLQA 2FY6A 3VURA 3UBKA 4PXOA 3KMNA 3LG6A 3F9UA 3QAWA 3BJ5A 4NWYA 2XHFA 3EU3A 4EDZA 3F4SA 2DJ1A 5DQYA 2BMXA 2KHPA 5IMDA 3ERGA 1GSUA 3HVXA 1V58A 2YN1A 2CAIA 2H6ZA 2H1BA 1X5DA 1H75A 4ZILA 4NMUA 2I4AA 3P7XA 4DEJA 2E2MA 4F2IA 3H93A 4QL7A 4X43A 1YQ1A 2R2JA 3FW2A 2AV4A 3C1RA 3Q19A 4TVEA 2CAQA 4GSNA 5GSSA 1B4QA 1SKWB 3HYPA 1IYIA 3A2XA 1SYXA 2YOIA 3GL3A 1O7UA 2GTUA 3F6FA 1F37A 1UVZA 4XRAA 1A8YA 2F8AA 4FYCA 4JR6A 2FA4A 3F63A 3PINA 4AJ7A 2DIYA 2MBSA 3LORA 2PPTA 3U6VA 3GFKA 1K3OA 1TW9A 3KM6A 2DJ2A 4X0XA 1EV4A 3IXRA 1PKZA 2XBIA 4X1UA 2QA1A 3L0HA 2LSTA 1GSQA 1VRSD 3LQ7A 4ZB8A 3F0IA 3WD6A 1ERTA 4Q5QA 1PX6A 4Z2TA 4K7NA 4MJEA 2XC2A 1AAZA 1A0FA 4ICYA 1A2JA 1B48A 3F4RA 1U3IA 1TTZA 2I81A 2YJ7A 3O3TA 3QCPA 1FO5A 2CQ9A 3KH7A 2A2SA 2OE1A 1BQ7A 5D96A 3IRAA 2VL2C 4ZIJA 4TR3A 1XW6A 1PA3A 1GL8A 5ECPB 3CYNA 1PN9A 1ERVA 2O87A 2R37A 2YNXA 1AXDA 3WGDA 4JEDA 4KH7A 1YY7A 5J3RA 1OE7A 3NIVA 1FAAA 1EEJA 2VAFA 4ECJA 4BL7A 5E59A 2H1AA 4K7OA 1TRVA 1DUGA 1MDJA 3QFAC 4MCUA 1GUHA 4LA1A 4USSA 2J9HA 2YPMA 1B9YC 3CSHA 1PN0A 2VD0A 2P5QA 2H0HA 4RQRA 1PSQA 2HYXA 5H5QA 1X5CA 1XWKA 4EIQA 3GMFA 2B5XA 3GV1A 1XIYA 4ZBBA 4Z2RA 1K0OA 3LYKA 4L5OA 1EWXA 2B7JA 3HVSA 2JZTA 4K7IA 1MEKA 2TRXA 4YQVA 2O89A 4I8BA 3NZNA 3UIWA 3HHVA 4MJBA 3VK9A 2H0IA 3BOAA 2IN3A 4JR4A 2E7PA 1NM3A 3TOUA 2AUVA 4ACSA 1OKTA 4IJIA 4BVYA 2LNTA 5F07A 1TI1A 1LU4A 3OR5A 3E0UA 2H1GA 4BVXA 3PPUA 2FWGA 5IMVA 1A23A 1QMVA 1ZL9A 1SJZA 5DDLA 1JZRA 3PR8A 1K0NA 3C8EA 2X4AA 1JZWA 4IVFA 3EWLA 2QC7A 1U3AA 3ME8A 3RBTA 1FG4A 3ZVJA 3TRXA 3AY8A 2AYTA 3GKNA 3LEFA 2XBQA 2ZCTA 1HYUA 3W6GA 3TJKA 4QL9A 1YDKA 4KUNA 4YH2A 1XW9A 3UARA 4V2MA 3D5JA 2H6YA 4EE0A 3LW9A 4L0UA 3DYRA 3GHAA 2VOCA 1V40A 2LRCA 2JACA 2JZSA 17GSA 4HJMA 2PN8A 11GSA 3EINA 2R0GA 1OVNA 2GSSA 3FY7A 5IMAA 2CVBA 3KZQA 4O5UA 2M72A 3RAZA 5J5NA 2VCWA 6GSSA 4K1FA 3DRNA 2H74A 3ME7A 6GSYA 4K5RA 2E2GA 5HR0A 5F8BA 3H1NA 2C0FA 3ERWA 2C80A 4Q5FA 4MJAA 1XOBA 1XWCA 4FIWA 4OCEA 3FZ9A 3HJPA 4KDYA 4FH8A 4NXIA 2N5AA 1GH2A 1SU9A 3P8WA 1WIKA 2H71A 4ECBA 2IMKA 2F51A 3IHGA 1Z6MA 1GTIA 1M2AA 2N5BA 2V6KA 1SL2B 4V2LA 4GWRA 3ZITA 5C04A 5LNKe 2ALBA 3MYDA 1B4PA 1UN2A 1J08A 6GSVA 2CX4A 3D6IA 2YWMA 3IR4A 2F8FA 4XHMA 2MMZA 1S3DA 1SD9A 3GKXA 2AJQB 4LLRA 1NSWA 2B5EA 3L78A 3I43A 1Z6NA 3GRXA 5GZZB 1SYRA 3HXSA 4I5QA 4AJ6A 2QA2A 4PQ1A 3L4NA 3DD3A 4BVYB 4Z7XA 1GWCA 4O5QA 3A5WA 3C7MA 5G5EA 3V1WA 2XPEA 4PQIA 4BVXB 2PVQA 2L57A 4EIPA 1K0MA 5CNWA 3P90A 5IPGA 4XTSA 2C0EA 4YKFA 4BWSA 1WMJA 1E6BA 1ZOFA 4H86A 4NAXA 2G2QA 2V41A 2VUPA 3HKRA 4JZQA 3TKSC 3EMXA 3APQA 1BX9A 1A2LA 1F3BA 4IKHA 4IGJA 2JL4A 3KMOA 4TR1A 1K0CA 2L4QA 5G1KA 3E9JB 5G1LA 4L8EA 2NDOA 4PNGA 5ENUA 3FEUA 2R4VA 5H5SA 5C00A 6GSTA 1XBSA 4GQFA 2ES7A 1KNGA 1PX7A 1XFLA 2O8VB 1C72A 4ULXA 3DIEA 1ABAA 4QQ7A 1XWGA 2TIRA 1PL1A 3IA1A 1EOGA 2RUEA 1YEXA 4EUYA 5F06A 4A5PA 2CT6A 2YWIA 1ZYPA 1FOVA 3EC3A 2YV9A 1XWAA 4PUFC 1B9XC 2HE3A 4WBJA 1T4ZA 2CVDA 3UEMA 2O7KA 1ZGNA 1I5GA 1YZXA 2KLXA 3ZRDA 3H8QA 1YJ6A 1FB6A 1O81A 4MPGA 4MZBA 4PURA 5HFGA 4POLA 1RW1A 3F6DA 3ZREA 4HQZA 20GSA 4HOJA 5J41A 5B6NA 2R5GA 3ZVJD 4HDEA 3MWHA 2FWHA 1GSFA 3GKMA 6GSUA 3C71A 1SK0A 1Z5YE 1GSDA 3VLNA 4EO3A 1WPIA 2IMFA 1A2MA 1QFNA 2H75A 3UJ1A 5IMFA 2N5FA 2OKAA 2WCIA 3TJBA 1XZOA 1X5EA 3TJGA 4Q5RA 2DJJA 5ECOB 2A4VA 2GGTA 4WR4A 2GQMA 4DSSA 5BRTA 3MSZA 3TKRA 2L5LA 3N9JA 19GSA 4PNFA 4MMMA 4MABA 2IL3A 3A2VA 4POMA 4IJ3A 5DCGA 3VWVA 2C8UA 4TR1B 4LMWA 5CRWA 4G19A 3FZ4A 4F0CA 2P0GA 3TGZA 1GLPA 2HSMA 1S3CA 1ML6A 3DKSA 3CXGA 4FQUA 1UA5A 1AW9A 1Z7RA 5ECMB 6GSXA 5DBQA 2YZUA 3HDCA 2OADA 1EP7A 1QUWA 3TKSE 2RM5A 1RQMA 2MBTA 3KJYA 4ZL8A 2LJAA 1FHEA 4MP4A 1O85A 1TU7A 4YAPA 3DWVA 1OC8A 3VI7A 3GTUA 4O7HA 2LKUA 2YWNA 4MF6A 2LUSA 2IPAA 3UVTA 2I3YA 2HNLA 1M7TA 2LNSA 1TP9A 2GSRA 4WXTA 2R0PA 4IELA 2HFDA 1GUMA 3TRPA 4K5SA 2TRCP 2F3MA 3ZMLA 1G6YA 6GSWA 1NW2A 1XVWA 1M9BA 3O6TA 3HZ8A 3IHQA 3GH6A 4V1Ap 1WP0A 2VL9A 3KTBA 1VF2A 8GSSA 2HRAA 4NHZA 2OBIA 5HR1A 4GXZA 3I69A 5CP1A 3UOMA 3EPTA 1GP1A 1XPVA 5DQSA 1F2EA 4PQHA 2I9HA 3G9BA 4HUAA 4XS6A 1O8XA 1F6MC 1EOHA 2H01A 2C3NA 4DSRA 4ZXGA 4MJCA 3SBCA 3LWAA 5AIXA 2V6OA 3M3MA 3JCML 5D93A 2L4CA 2VO4A 3GH9A 4TOPA 3H4KA 5ID2A 4X4JA 2VCTA 3VFIA 4PTSA 4WF4A 1J0FA 2PU9C 2X99A 4OO4A 1ZYNA 1MD3A 2WJUA 2F9SA 1W89A 2HZEA 2LS5A 3TDGA 1HD2A 2WZ9A 1TU8A 1PRXA 4CHSA 4KAEA 4IP6A 2KP2A 4NPBA 4EKZA 3GX0A 2HSYA 5CAXA 1ZYQB 3Q6OA 2GSTA 4RUVA 1GSYA 5AN1A 5G30A 1XW5A 3KCMA 1TRWA 2K6VA 1GNWA 3LFLA 2IMIA 4CDOA 3APOA 16GSA 5ECHB 4ISDA 1TJDA 2H0GA 1PD21 2FCHA 1VF3A 2WFCA 3M9JA 4DSSB 5IM9A 1VF1A 22GSA 1K3LA 3BCKA 5ABRA 3D4MA 3BBYA 5CRHA 4V1Ag 1U87A 1GSSA 2HT9A 1B8XA 1F3AA 4KA0A 3F3RA 2DJ0A 1FOHA 4MDCA 2RIIA 1A0RP 4AF2A 3KGKA 3QD9A 1THXA 5D9VA 4EVMA 4KE3A 4HU9A 1U88A 2ON7A 12GSA 3ERFA 4MZCA 5D9TA 1K0BA 5KOXA 4GF0A 4PX1A 2C1YA 3KTLA 3GTUB 2FLSA 4OWYA 1XVQA 2MMAA 1QXHA 5IMCA 4XCSA 1ZYEA 3P2AA 1G7EA 1X9SB 2EIQA 2WRTA 4XIHA 2O85A 4KDXA 1GTUA 2C4JA 4MZWA 3IE3A 4AJ8A 4EF0A 1RK4A 2OA7A 5EPFA 3KEBA 2GZZA 2JU5A 2K8VA 2LQQA 3LJRA 2V32A 3TJJA 2C0GA 4MK3A 3FZ5A 1TKDB 1Y25A 2GVPA 3NOFA 4TR4A 2H6XA 1O6JA 2H30A 2REMA 4HU7A 7GSSA 2VL3A 3IV4A 1UC7A 5FWGA 1BEDA 2NTOA 2GDRA 1Z9HA 3IAS2 1M9AA 4EDYA 4MH3A 2WULA 3KXOA 4O92A 3BCIA 4TN8A 2DBCA 4F0BA 2OE3A 3TCOA 5ID2B 3KIJA 2JADA 2NVLA 5B7CA 4BL7B 3ZFLA 3TB2A 4GSSA 2GT6A 2C3TA 3GSSA 5KN2A 1T7PB 2XPDA 3HJMA 2HZEB 5ECQB 1O73A 2D2ZA 3HZ4A 3DVWA 2YV7A 2YWOA 2AAWA 1XCCA 3HJOA 4ML6A 1ON4A 3I9V2 2M46A 3GNJA 4KF9A 4YAVA 2FNOA 2BJXA 3KP8A 4I2UA 2VM1A 2PMTA 1F9MA 4OCFA 5B6MA 4GQCA 3A3TA 2X49A 1LBKA 5IPHA 1K3YA 3RPNA 2H66A 1BJXA 4Q5NA 1AIUA 1Z7PA 2DSAA 4ZBAA 2DLXA 4HQSA 5CYYA 3DGQA 1HNCA 1R26A 5KN0A 1ZZYA 2X8HA 2VCZA 4NV2A 4N10A 1ACVA 4LL1B 1VF4A 2YANA 4KGIA 1YEPA 4N0ZA 3WGEA 2V2GA 4J57E 1YF0A 3M8NA 3RPPA 1JZDA 1JLVA 3FKFA 4FYUA 4TW5A 4LL4B 3HD5A 2AB6A 5HFIA 3LXZA 4IN0A 1FVJA 2IWTA 1OYJA 4POKA 3DMLA 3GURA 1A24A 1E2YA 5A4WA 3Q74A 1AUCA 5LD0A 3LYPA 2VLUA 4N0VA 3IK9A 1AQVA 3GIXA 2EC4A 4GSTA 4GLTA 4P3YB 3G7JA 2OACA 3H79A 3LGCA 2QKEA 3FHKA 5A4VA 2CZ2A 3M1GA 2FWEA 2PUKC 3WYWA 5ECIB 2DJ3A 2YCDA 1TRUA 4IQAA 2VD1A 3ZIVA 1TK8B 2WB9A 3LSZA 3J7Yk 4ZBDA 1OE8A 3DVXA 3FK8A 2IMDA 1USBA 4L0WA 2L6CA 5G2ZA 1K0DA 2PERA 4F82A 4HZ4A 3UMAA 1V98A 4WR5A 1PKWA 2LQOA 5J4UA 3M0FA 3ZLPA 3C73A 3G7IA 4POBA 1FB0A 2K18A 4XS1A 4NHWA 2WS2A 1ZMAA 2YP6A 4G2EA 1DBYA 4JBBA 3L9VA 4ZB9A 2RUFA 3FYGA 3RHCA 5HQPA 5F05A 1V2AA 4OO5A 2LTKA 1AQWA 4YQMA 1X0RA 2VL2A 1YF1A 1R7HA 2CX3A 1TI3A 1YKAA 5ELGA 2VCVA 1JFUA 2HLSA 3U5RE 3R3EA 3D4TA 3ZIJA 1T4YA 1X9WB 1V57A 2DMLA 4DVCA 2H70A 1R5PA 2NPBA 3A5IA 5ELAA 2LJKA 3VWWA 1SJ6A 5GSTA 3VWXA 2DMMA 2HSHA 2PWJA 4TXOA 1FVKA 2P31A 3US3A 2HRFA 3MDKA 1T00A 5D9XA 3KD0A 4NV5A 4KDUA 1U6TA 2MYGA 4KB3A 4ZL9A 1KTEA 4BWQA 2B6MA 5DVBA 3WT2A 3CBUA 2QGVA 9GSSA 4ZB6A 3MAKA 3LXTA 5LCZA 3D0ZA 4PGTA 1TXXA 4TR0A 2OJLA 2B1LA 3VI5A 4FO5A 3CMIA 3IDVA 2VIMA 4ZL7A 1EGOA 1EGRA 1HQOA 2H76A 1M2BA 2ZUPA 5JWRB 5IIZA 2H72A 2H1DA 5A4UA 1XXUA 2GLRA 2R3XA 2A2RA 1A8LA 4XS4A 1SJIA 1SK1A 3TOTA 2WDUA 3K8NA 3VPQA 1TOFA 5KOWA 4O5RA 1QGVA 4MA9A 3EU4A 4HJ2A 3QAVA 3FZAA 1S3AA 1PQNA 1QK8A 4IP1A 1V9WA 1OC9A 2A2PA 1ERWA 3L9SA 3QMXA 2HZFA 4G10A 4HS1A 2B1KA 4K8MA 2B3SA 4KX4A 2K8SA 1NHOA 4KCAA 3PGTA 3KH9A 1XOAA 2JSYA 2A4HA 1LJRA 4L5LA 5DJLA 1HNBA 4F9ZA 1AC1A 3HCZA 4CY6A 3EVIA 1MTCA 1EV9A 4IHUA 4ML1A 2MZCA 1DSBA 3IAM2 2DJKA 5B8AA 3IC4A 4DSQA 4KW6A 3GL5A 2B5YA 10GSA 1QQ2A 2LJRA 3ISOA 4KSMA 5JCWA 2KP1A 5J9CA 2LRNA 5HR3A 4RI7A 2X64A 3ZFBA 1PL2A 2X8CA 4MH2A 4WF5A 3TJFA 3FR9A 1EP8A 3CSIA 3F8UA 2X8GA 4G0KA 2GSQA 1EZKA 2GZPA 4V2NA 4OFTA 1G0TA 3R2QA 2CZ3A 2RLIA 5DAKA 2VLVA 4ECIA 2DKHA 1WJKA 5D9WA 1XWBA 2GS3A 1N8JA 5AIVA 4TXOB 4FYBA 2ZNMA 2JSZA 3PH9A 3VPTA 1ERUA 5ECNB 4BA7A 4G9HA 5KN3A 3WT1A 5CREA 1TDIA 5ECKB 3E3EA 2J23A 5DCHA 3ZYWA 2JZRA 4GTUA 2VM2A 4I97A 1T1VA 2EIOA 3DEXA 5INYA 3FR6A 4K0GA 4G0IA 4YKGA 2C0DA 2H19A 4JU5A 5EVOA 3QPMA 1HNAA 3HY2A 3RDWA 1TRSA 1W4VA 2V1MA 4MLYA 1WOUA 1ILOA 4LMVA 3MNGA 1GSEA 1KEBA 4G0LA 3QOUA 1ST9A 18GSA 2LEGA 4HEA2 5CRDA 2M80A 4E8HA 3GX8A 2E0QA 2IJYA 1GULA 5KN1A 1SENA 1GTBA 3ZZXA 4XS4B 4Z2UA 2FHEA 4CW9A 1M2DA 1GTAA 1OC3A 3UVHA 1OKDA 5IOXA 4RQXA 2FD3A 3D22A 3TKSA 5FT3A 2PBJA 3MIXA 1J9BA 3GA4A 1BYEA 5EY6A 2VCQA 4K2DA 1OC9B 1M99A 2OE0A 4K0NA 2IIYA 3TKQA 3VWUA 2ON5A 2HI7A 2YZHA 1Z3EA 2C3QA 4OMVA 3CTGA 4WETA 4I2TA 4D73A 1JHBA 4IQ1A 2KUCA 2YJHA 1SL1B 3A2WA 3IC8A 1OAZA 2LV3A 1GRXA 5L71A 2AHEA 4TXVA 1AQXA 5GAPD 5ECSA 2OBKA 3GN3A 3M9KA 5G31A 1TK0B 3N5OA 5HR2A 1ZCPA 2VCXA 1GNEA 2MMNA 4IW9A 2GT5A 4J56E 5G5FA 2LRTA 1EEMA 1PGTA 5CRGA 2FA8A 2CA8A 4OD7A 3FMWA 5E4WA 5JCGA 2R0CA 3GSTA 3BD2A 1GUKA 3W8JA 1SKSB 1H4OA 1JZOA 3C1SA 3CSJA 1VGLA 2IFQA 4MF7A 1IYHA 5DALA 5DAKB 5IQYA 4WBRD 2CV4A 1THOA 1SK2A 2UZ8A 5ECLB 1MDIA 2NBSA 2Z9SA 1WE0A 3EYTA 3TUEA 4EC0A 3ZMKA 3D21A 1SD8A 1N2AA 1URMA 5JCUA 4F03A 3CRUA 3F3QA 2DIZA 2KOKA 5KEJA 3FR3A 1G7OA 5COHA 5IO0A 2B7KA 3ZTLA 2GQLA 2K9FA 4HI7A 1WRYA 2GZYA 2QSIA 4EL1A 3FRCA 1SKRB 2WGRA 4KCEA 4BPYA 4J2FA 4TKYA 4K2XA 4ILFA 4IS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J9B A;  1G6W A;  4KSO A;  5B8B A;  3APS A;  4PUA A;  1K0A A;  4N30 A;  4JRR A;  3DXB A;  5JWQ B;  5D73 A;  3SWL A;  1KBN A;  1MD4 A;  2CVK A;  3TKP A;  13GS A;  4K9Z A;  3IBH A;  3F4T A;  3QDN A;  1Q4J A;  1O8W A;  4WKW A;  3J7Y b;  3HVV A;  2I1U A;  2PGT A;  4MF5 A;  1NHY A;  5DJM A;  3CTF A;  1PMT A;  1WWJ A;  5GAN D;  1BAY A;  1T8E B;  5FHI A;  4WEY A;  3Q18 A;  1MDK A;  2H8L A;  3S9F A;  5CO3 A;  1JLW A;  2VLT A;  1DE1 A;  2EIR A;  4OFM A;  5IO2 A;  3WGX A;  2BTO T;  2IME A;  3KP9 A;  4KND A;  2RM6 A;  4ID0 A;  2L6D A;  3ED3 A;  4D73 B;  1I9D A;  5JWO B;  1Y6E A;  4YQU A;  2FUG 2;  4ECC A;  1CQG A;  3UAP A;  3EE2 A;  2H73 A;  3TRQ A;  3RHB A;  2FWF A;  3EMP A;  2R6K A;  3CRT A;  4I6X A;  2FGX A;  3UBL A;  3IPZ A;  1DE2 A;  3IOS A;  5IMZ A;  3W8S A;  3ZL5 A;  4GCI A;  4RI6 A;  2P5R A;  3QFB C;  5F0G A;  5A5K A;  3GYK A;  3O76 A;  3GKK A;  4K6X A;  2PVO C;  3EUR A;  3I6A A;  5EL8 A;  5IOW A;  1FW1 A;  4E8E A;  3HA9 A;  2DC5 A;  5D8I A;  4JE1 A;  3QR6 A;  3IK7 A;  1Q98 A;  1R4W A;  4XRD A;  1X9M B;  2HRN A;  2HXK A;  2L59 A;  1T3B A;  4MPF A;  2MMO A;  4AGS A;  2IFQ B;  1TK5 B;  1R5A A;  5AGY A;  3G7Y A;  4TRX A;  5ECR B;  4OFN A;  5DAL B;  4HZ2 A;  1CQH A;  2GQK A;  4GRF A;  5H5R A;  4IBP A;  4O32 A;  1BG5 A;  4N11 A;  1SL0 B;  3QAG A;  3GUS A;  1YKC A;  4EXJ A;  2L5O A;  5AIS A;  14GS A;  1M0U A;  3UL3 A;  3L9U A;  2G0F A;  5HFK A;  1GLQ A;  2FY6 A;  3VUR A;  3UBK A;  4PXO A;  3KMN A;  3LG6 A;  3F9U A;  3QAW A;  3BJ5 A;  4NWY A;  2XHF A;  3EU3 A;  4EDZ A;  3F4S A;  2DJ1 A;  5DQY A;  2BMX A;  2KHP A;  5IMD A;  3ERG A;  1GSU A;  3HVX A;  1V58 A;  2YN1 A;  2CAI A;  2H6Z A;  2H1B A;  1X5D A;  1H75 A;  4ZIL A;  4NMU A;  2I4A A;  3P7X A;  4DEJ A;  2E2M A;  4F2I A;  3H93 A;  4QL7 A;  4X43 A;  1YQ1 A;  2R2J A;  3FW2 A;  2AV4 A;  3C1R A;  3Q19 A;  4TVE A;  2CAQ A;  4GSN A;  5GSS A;  1B4Q A;  1SKW B;  3HYP A;  1IYI A;  3A2X A;  1SYX A;  2YOI A;  3GL3 A;  1O7U A;  2GTU A;  3F6F A;  1F37 A;  1UVZ A;  4XRA A;  1A8Y A;  2F8A A;  4FYC A;  4JR6 A;  2FA4 A;  3F63 A;  3PIN A;  4AJ7 A;  2DIY A;  2MBS A;  3LOR A;  2PPT A;  3U6V A;  3GFK A;  1K3O A;  1TW9 A;  3KM6 A;  2DJ2 A;  4X0X A;  1EV4 A;  3IXR A;  1PKZ A;  2XBI A;  4X1U A;  3L0H A;  2LST A;  1GSQ A;  1VRS D;  3LQ7 A;  4ZB8 A;  3F0I A;  3WD6 A;  1ERT A;  4Q5Q A;  1PX6 A;  4K7N A;  4MJE A;  2XC2 A;  1AAZ A;  1A0F A;  1A2J A;  1B48 A;  3F4R A;  1U3I A;  1TTZ A;  2I81 A;  2YJ7 A;  3O3T A;  3QCP A;  1FO5 A;  2CQ9 A;  3KH7 A;  2A2S A;  2OE1 A;  1BQ7 A;  5D96 A;  3IRA A;  2VL2 C;  4ZIJ A;  4TR3 A;  1XW6 A;  1PA3 A;  1GL8 A;  5ECP B;  3CYN A;  1PN9 A;  1ERV A;  2O87 A;  2R37 A;  2YNX A;  1AXD A;  3WGD A;  4JED A;  4KH7 A;  1YY7 A;  5J3R A;  1OE7 A;  3NIV A;  1FAA A;  1EEJ A;  2VAF A;  4ECJ A;  4BL7 A;  5E59 A;  2H1A A;  4K7O A;  1TRV A;  1DUG A;  1MDJ A;  3QFA C;  4MCU A;  1GUH A;  4LA1 A;  2J9H A;  2YPM A;  1B9Y C;  3CSH A;  2VD0 A;  2P5Q A;  2H0H A;  4RQR A;  1PSQ A;  2HYX A;  5H5Q A;  1X5C A;  1XWK A;  3GMF A;  2B5X A;  3GV1 A;  1XIY A;  4ZBB A;  1K0O A;  3LYK A;  4L5O A;  1EWX A;  2B7J A;  3HVS A;  2JZT A;  4K7I A;  1MEK A;  2TRX A;  4YQV A;  2O89 A;  4I8B A;  3NZN A;  3UIW A;  3HHV A;  4MJB A;  3VK9 A;  2H0I A;  3BOA A;  2IN3 A;  4JR4 A;  2E7P A;  1NM3 A;  3TOU A;  2AUV A;  4ACS A;  1OKT A;  4IJI A;  4BVY A;  2LNT A;  5F07 A;  1TI1 A;  1LU4 A;  3OR5 A;  3E0U A;  2H1G A;  4BVX A;  2FWG A;  5IMV A;  1A23 A;  1QMV A;  1ZL9 A;  1SJZ A;  5DDL A;  1JZR A;  3PR8 A;  1K0N A;  3C8E A;  1JZW A;  4IVF A;  3EWL A;  2QC7 A;  1U3A A;  3ME8 A;  3RBT A;  1FG4 A;  3ZVJ A;  3TRX A;  3AY8 A;  2AYT A;  3GKN A;  3LEF A;  2XBQ A;  2ZCT A;  1HYU A;  3W6G A;  3TJK A;  4QL9 A;  1YDK A;  4KUN A;  4YH2 A;  1XW9 A;  3UAR A;  4V2M A;  3D5J A;  2H6Y A;  4EE0 A;  4L0U A;  3DYR A;  3GHA A;  2VOC A;  1V40 A;  2LRC A;  2JAC A;  2JZS A;  17GS A;  4HJM A;  2PN8 A;  11GS A;  3EIN A;  1OVN A;  2GSS A;  3FY7 A;  5IMA A;  2CVB A;  3KZQ A;  2M72 A;  3RAZ A;  5J5N A;  2VCW A;  6GSS A;  4K1F A;  3DRN A;  2H74 A;  3ME7 A;  6GSY A;  2E2G A;  5HR0 A;  5F8B A;  3H1N A;  2C0F A;  3ERW A;  2C80 A;  4Q5F A;  4MJA A;  1XOB A;  1XWC A;  4FIW A;  4OCE A;  3FZ9 A;  3HJP A;  4KDY A;  4FH8 A;  4NXI A;  2N5A A;  1GH2 A;  1SU9 A;  3P8W A;  1WIK A;  2H71 A;  4ECB A;  2IMK A;  2F51 A;  1Z6M A;  1GTI A;  1M2A A;  2N5B A;  2V6K A;  1SL2 B;  4V2L A;  4GWR A;  3ZIT A;  5C04 A;  5LNK e;  2ALB A;  1B4P A;  1UN2 A;  1J08 A;  6GSV A;  2CX4 A;  3D6I A;  2YWM A;  3IR4 A;  2F8F A;  4XHM A;  2MMZ A;  1S3D A;  1SD9 A;  3GKX A;  2AJQ B;  4LLR A;  1NSW A;  2B5E A;  3L78 A;  3I43 A;  1Z6N A;  3GRX A;  5GZZ B;  1SYR A;  3HXS A;  4I5Q A;  4AJ6 A;  4PQ1 A;  3L4N A;  3DD3 A;  4Z7X A;  1GWC A;  3A5W A;  3C7M A;  5G5E A;  3V1W A;  2XPE A;  4PQI A;  2PVQ A;  2L57 A;  1K0M A;  5CNW A;  3P90 A;  5IPG A;  4XTS A;  2C0E A;  4BWS A;  1WMJ A;  1E6B A;  1ZOF A;  4H86 A;  4NAX A;  2G2Q A;  2V41 A;  2VUP A;  3HKR A;  4JZQ A;  3TKS C;  3EMX A;  3APQ A;  1BX9 A;  1A2L A;  1F3B A;  4IKH A;  4IGJ A;  2JL4 A;  3KMO A;  4TR1 A;  1K0C A;  2L4Q A;  5G1K A;  3E9J B;  5G1L A;  4L8E A;  2NDO A;  4PNG A;  5ENU A;  3FEU A;  2R4V A;  5H5S A;  5C00 A;  6GST A;  1XBS A;  4GQF A;  2ES7 A;  1KNG A;  1PX7 A;  1XFL A;  2O8V B;  1C72 A;  4ULX A;  3DIE A;  1ABA A;  4QQ7 A;  1XWG A;  2TIR A;  1PL1 A;  3IA1 A;  1EOG A;  2RUE A;  1YEX A;  4EUY A;  5F06 A;  2CT6 A;  2YWI A;  1FOV A;  3EC3 A;  2YV9 A;  1XWA A;  4PUF C;  1B9X C;  2HE3 A;  4WBJ A;  1T4Z A;  2CVD A;  3UEM A;  2O7K A;  1ZGN A;  1I5G A;  1YZX A;  2KLX A;  3ZRD A;  3H8Q A;  1YJ6 A;  1FB6 A;  1O81 A;  4MPG A;  4MZB A;  4PUR A;  5HFG A;  4POL A;  1RW1 A;  3F6D A;  3ZRE A;  4HQZ A;  20GS A;  4HOJ A;  5J41 A;  5B6N A;  2R5G A;  3ZVJ D;  4HDE A;  3MWH A;  2FWH A;  1GSF A;  3GKM A;  6GSU A;  3C71 A;  1SK0 A;  1Z5Y E;  1GSD A;  3VLN A;  4EO3 A;  1WPI A;  2IMF A;  1A2M A;  1QFN A;  2H75 A;  3UJ1 A;  5IMF A;  2N5F A;  2OKA A;  2WCI A;  3TJB A;  1XZO A;  1X5E A;  3TJG A;  4Q5R A;  2DJJ A;  5ECO B;  2A4V A;  2GGT A;  4WR4 A;  2GQM A;  4DSS A;  3MSZ A;  3TKR A;  2L5L A;  3N9J A;  19GS A;  4PNF A;  4MMM A;  4MAB A;  2IL3 A;  3A2V A;  4POM A;  4IJ3 A;  5DCG A;  3VWV A;  2C8U A;  4TR1 B;  4LMW A;  5CRW A;  4G19 A;  3FZ4 A;  4F0C A;  2P0G A;  3TGZ A;  1GLP A;  1S3C A;  1ML6 A;  3DKS A;  3CXG A;  1UA5 A;  1AW9 A;  1Z7R A;  5ECM B;  6GSX A;  5DBQ A;  2YZU A;  3HDC A;  2OAD A;  1EP7 A;  1QUW A;  3TKS E;  2RM5 A;  1RQM A;  2MBT A;  3KJY A;  4ZL8 A;  2LJA A;  1FHE A;  4MP4 A;  1O85 A;  1TU7 A;  4YAP A;  3DWV A;  1OC8 A;  3VI7 A;  3GTU A;  4O7H A;  2LKU A;  2YWN A;  4MF6 A;  2LUS A;  2IPA A;  3UVT A;  2I3Y A;  2HNL A;  1M7T A;  2LNS A;  1TP9 A;  2GSR A;  4WXT A;  4IEL A;  2HFD A;  1GUM A;  3TRP A;  2TRC P;  2F3M A;  3ZML A;  1G6Y A;  6GSW A;  1NW2 A;  1XVW A;  1M9B A;  3O6T A;  3HZ8 A;  3IHQ A;  3GH6 A;  4V1A p;  1WP0 A;  2VL9 A;  3KTB A;  1VF2 A;  8GSS A;  4NHZ A;  2OBI A;  5HR1 A;  4GXZ A;  3I69 A;  5CP1 A;  3UOM A;  1GP1 A;  1XPV A;  5DQS A;  1F2E A;  4PQH A;  2I9H A;  3G9B A;  4HUA A;  4XS6 A;  1O8X A;  1F6M C;  1EOH A;  2H01 A;  2C3N A;  4DSR A;  4ZXG A;  4MJC A;  3SBC A;  3LWA A;  5AIX A;  2V6O A;  3M3M A;  3JCM L;  5D93 A;  2L4C A;  2VO4 A;  3GH9 A;  4TOP A;  3H4K A;  5ID2 A;  2VCT A;  3VFI A;  4WF4 A;  1J0F A;  2PU9 C;  2X99 A;  4OO4 A;  1MD3 A;  2WJU A;  2F9S A;  1W89 A;  2HZE A;  2LS5 A;  3TDG A;  1HD2 A;  2WZ9 A;  1TU8 A;  1PRX A;  4CHS A;  4KAE A;  4IP6 A;  2KP2 A;  4NPB A;  4EKZ A;  3GX0 A;  2HSY A;  5CAX A;  1ZYQ B;  3Q6O A;  2GST A;  4RUV A;  1GSY A;  5AN1 A;  5G30 A;  1XW5 A;  3KCM A;  1TRW A;  2K6V A;  1GNW A;  3LFL A;  2IMI A;  4CDO A;  3APO A;  16GS A;  5ECH B;  4ISD A;  1TJD A;  2H0G A;  1PD2 1;  2FCH A;  1VF3 A;  2WFC A;  3M9J A;  4DSS B;  5IM9 A;  1VF1 A;  22GS A;  1K3L A;  3BCK A;  5ABR A;  3D4M A;  3BBY A;  5CRH A;  4V1A g;  1U87 A;  1GSS A;  2HT9 A;  1B8X A;  1F3A A;  4KA0 A;  3F3R A;  2DJ0 A;  4MDC A;  2RII A;  1A0R P;  4AF2 A;  3KGK A;  3QD9 A;  1THX A;  5D9V A;  4EVM A;  4KE3 A;  4HU9 A;  1U88 A;  2ON7 A;  12GS A;  3ERF A;  4MZC A;  5D9T A;  1K0B A;  4GF0 A;  4PX1 A;  2C1Y A;  3KTL A;  3GTU B;  2FLS A;  4OWY A;  1XVQ A;  2MMA A;  1QXH A;  5IMC A;  4XCS A;  1ZYE A;  3P2A A;  1G7E A;  1X9S B;  2EIQ A;  2WRT A;  4XIH A;  2O85 A;  4KDX A;  1GTU A;  2C4J A;  4MZW A;  3IE3 A;  4AJ8 A;  4EF0 A;  1RK4 A;  2OA7 A;  5EPF A;  3KEB A;  2GZZ A;  2JU5 A;  2K8V A;  2LQQ A;  3LJR A;  2V32 A;  3TJJ A;  2C0G A;  4MK3 A;  3FZ5 A;  1TKD B;  1Y25 A;  2GVP A;  3NOF A;  4TR4 A;  2H6X A;  1O6J A;  2H30 A;  2REM A;  4HU7 A;  7GSS A;  2VL3 A;  3IV4 A;  1UC7 A;  5FWG A;  1BED A;  2NTO A;  2GDR A;  1Z9H A;  3IAS 2;  1M9A A;  4EDY A;  4MH3 A;  2WUL A;  3KXO A;  4O92 A;  3BCI A;  4TN8 A;  2DBC A;  4F0B A;  2OE3 A;  3TCO A;  5ID2 B;  3KIJ A;  2JAD A;  2NVL A;  5B7C A;  3ZFL A;  3TB2 A;  4GSS A;  2GT6 A;  2C3T A;  3GSS A;  5KN2 A;  1T7P B;  2XPD A;  3HJM A;  2HZE B;  5ECQ B;  1O73 A;  2D2Z A;  3HZ4 A;  3DVW A;  2YV7 A;  2YWO A;  2AAW A;  1XCC A;  3HJO A;  4ML6 A;  1ON4 A;  3I9V 2;  2M46 A;  3GNJ A;  4YAV A;  2FNO A;  2BJX A;  3KP8 A;  4I2U A;  2VM1 A;  2PMT A;  1F9M A;  4OCF A;  5B6M A;  4GQC A;  3A3T A;  5IPH A;  1LBK A;  1K3Y A;  3RPN A;  2H66 A;  1BJX A;  4Q5N A;  1AIU A;  1Z7P A;  2DSA A;  4ZBA A;  2DLX A;  4HQS A;  5CYY A;  3DGQ A;  1HNC A;  1R26 A;  5KN0 A;  1ZZY A;  2X8H A;  2VCZ A;  4NV2 A;  4N10 A;  1ACV A;  4LL1 B;  1VF4 A;  2YAN A;  4KGI A;  1YEP A;  4N0Z A;  3WGE A;  2V2G A;  4J57 E;  1YF0 A;  3M8N A;  3RPP A;  1JZD A;  1JLV A;  3FKF A;  4FYU A;  4TW5 A;  4LL4 B;  3HD5 A;  2AB6 A;  5HFI A;  3LXZ A;  4IN0 A;  1FVJ A;  2IWT A;  1OYJ A;  4POK A;  3DML A;  3GUR A;  1A24 A;  1E2Y A;  5A4W A;  3Q74 A;  1AUC A;  5LD0 A;  3LYP A;  2VLU A;  4N0V A;  3IK9 A;  1AQV A;  3GIX A;  2EC4 A;  4GST A;  4GLT A;  4P3Y B;  3G7J A;  2OAC A;  3H79 A;  3LGC A;  2QKE A;  3FHK A;  5A4V A;  2CZ2 A;  3M1G A;  2FWE A;  2PUK C;  3WYW A;  5ECI B;  2DJ3 A;  2YCD A;  1TRU A;  4IQA A;  2VD1 A;  3ZIV A;  1TK8 B;  2WB9 A;  3LSZ A;  3J7Y k;  4ZBD A;  1OE8 A;  3DVX A;  3FK8 A;  2IMD A;  1USB A;  4L0W A;  2L6C A;  5G2Z A;  1K0D A;  2PER A;  4F82 A;  4HZ4 A;  3UMA A;  1V98 A;  4WR5 A;  1PKW A;  2LQO A;  5J4U A;  3M0F A;  3ZLP A;  3C73 A;  3G7I A;  4POB A;  1FB0 A;  2K18 A;  4XS1 A;  4NHW A;  2WS2 A;  1ZMA A;  2YP6 A;  4G2E A;  1DBY A;  4JBB A;  3L9V A;  4ZB9 A;  2RUF A;  3FYG A;  3RHC A;  5HQP A;  5F05 A;  1V2A A;  4OO5 A;  2LTK A;  1AQW A;  4YQM A;  1X0R A;  2VL2 A;  1YF1 A;  1R7H A;  2CX3 A;  1TI3 A;  1YKA A;  5ELG A;  2VCV A;  1JFU A;  2HLS A;  3U5R E;  3D4T A;  3ZIJ A;  1T4Y A;  1X9W B;  1V57 A;  2DML A;  4DVC A;  2H70 A;  1R5P A;  2NPB A;  5ELA A;  2LJK A;  3VWW A;  1SJ6 A;  5GST A;  3VWX A;  2DMM A;  2HSH A;  2PWJ A;  4TXO A;  1FVK A;  2P31 A;  3US3 A;  2HRF A;  3MDK A;  1T00 A;  5D9X A;  3KD0 A;  4NV5 A;  4KDU A;  1U6T A;  2MYG A;  4KB3 A;  4ZL9 A;  1KTE A;  4BWQ A;  2B6M A;  5DVB A;  3WT2 A;  3CBU A;  2QGV A;  9GSS A;  4ZB6 A;  3MAK A;  3LXT A;  5LCZ A;  3D0Z A;  4PGT A;  1TXX A;  4TR0 A;  2OJL A;  2B1L A;  3VI5 A;  4FO5 A;  3CMI A;  3IDV A;  2VIM A;  4ZL7 A;  1EGO A;  1EGR A;  1HQO A;  2H76 A;  1M2B A;  2ZUP A;  5JWR B;  5IIZ A;  2H72 A;  2H1D A;  5A4U A;  1XXU A;  2GLR A;  2R3X A;  2A2R A;  1A8L A;  4XS4 A;  1SJI A;  1SK1 A;  3TOT A;  2WDU A;  3K8N A;  3VPQ A;  1TOF A;  4O5R A;  1QGV A;  4MA9 A;  3EU4 A;  4HJ2 A;  3QAV A;  3FZA A;  1S3A A;  1PQN A;  1QK8 A;  4IP1 A;  1V9W A;  1OC9 A;  1ERW A;  3L9S A;  3QMX A;  2HZF A;  4G10 A;  4HS1 A;  2B1K A;  4K8M A;  2B3S A;  4KX4 A;  2K8S A;  1NHO A;  4KCA A;  3PGT A;  3KH9 A;  1XOA A;  2JSY A;  1LJR A;  4L5L A;  5DJL A;  1HNB A;  4F9Z A;  1AC1 A;  3HCZ A;  3EVI A;  1MTC A;  1EV9 A;  4IHU A;  4ML1 A;  2MZC A;  1DSB A;  3IAM 2;  2DJK A;  5B8A A;  3IC4 A;  4DSQ A;  4KW6 A;  3GL5 A;  2B5Y A;  10GS A;  1QQ2 A;  2LJR A;  3ISO A;  4KSM A;  5JCW A;  2KP1 A;  5J9C A;  2LRN A;  5HR3 A;  4RI7 A;  2X64 A;  3ZFB A;  1PL2 A;  2X8C A;  4MH2 A;  4WF5 A;  3TJF A;  3FR9 A;  1EP8 A;  3CSI A;  3F8U A;  2X8G A;  2GSQ A;  1EZK A;  2GZP A;  4V2N A;  4OFT A;  1G0T A;  3R2Q A;  2CZ3 A;  2RLI A;  5DAK A;  2VLV A;  4ECI A;  1WJK A;  5D9W A;  1XWB A;  2GS3 A;  1N8J A;  5AIV A;  4TXO B;  4FYB A;  2ZNM A;  2JSZ A;  3PH9 A;  3VPT A;  1ERU A;  5ECN B;  4BA7 A;  4G9H A;  5KN3 A;  3WT1 A;  5CRE A;  1TDI A;  5ECK B;  3E3E A;  2J23 A;  5DCH A;  3ZYW A;  2JZR A;  4GTU A;  2VM2 A;  4I97 A;  1T1V A;  2EIO A;  3DEX A;  5INY A;  3FR6 A;  4K0G A;  2C0D A;  2H19 A;  4JU5 A;  5EVO A;  3QPM A;  1HNA A;  3HY2 A;  3RDW A;  1TRS A;  1W4V A;  2V1M A;  4MLY A;  1WOU A;  1ILO A;  4LMV A;  3MNG A;  1GSE A;  1KEB A;  3QOU A;  1ST9 A;  18GS A;  2LEG A;  4HEA 2;  5CRD A;  2M80 A;  4E8H A;  3GX8 A;  2E0Q A;  2IJY A;  1GUL A;  5KN1 A;  1SEN A;  1GTB A;  3ZZX A;  4XS4 B;  2FHE A;  4CW9 A;  1M2D A;  1GTA A;  1OC3 A;  3UVH A;  1OKD A;  5IOX A;  4RQX A;  2FD3 A;  3D22 A;  3TKS A;  5FT3 A;  2PBJ A;  1J9B A;  3GA4 A;  1BYE A;  5EY6 A;  2VCQ A;  4K2D A;  1OC9 B;  1M99 A;  2OE0 A;  4K0N A;  2IIY A;  3TKQ A;  3VWU A;  2ON5 A;  2HI7 A;  2YZH A;  1Z3E A;  2C3Q A;  4OMV A;  3CTG A;  4WET A;  4I2T A;  4D73 A;  1JHB A;  4IQ1 A;  2KUC A;  2YJH A;  1SL1 B;  3A2W A;  1OAZ A;  2LV3 A;  1GRX A;  5L71 A;  2AHE A;  4TXV A;  1AQX A;  5GAP D;  5ECS A;  2OBK A;  3GN3 A;  3M9K A;  5G31 A;  1TK0 B;  3N5O A;  5HR2 A;  1ZCP A;  2VCX A;  1GNE A;  2MMN A;  4IW9 A;  2GT5 A;  4J56 E;  5G5F A;  2LRT A;  1EEM A;  1PGT A;  5CRG A;  2FA8 A;  2CA8 A;  4OD7 A;  5E4W A;  5JCG A;  3GST A;  3BD2 A;  1GUK A;  3W8J A;  1SKS B;  1H4O A;  1JZO A;  3C1S A;  3CSJ A;  1VGL A;  2IFQ A;  4MF7 A;  1IYH A;  5DAL A;  5DAK B;  5IQY A;  4WBR D;  2CV4 A;  1THO A;  1SK2 A;  5ECL B;  1MDI A;  2NBS A;  2Z9S A;  1WE0 A;  3EYT A;  3TUE A;  4EC0 A;  3ZMK A;  3D21 A;  1SD8 A;  1N2A A;  1URM A;  5JCU A;  4F03 A;  3CRU A;  3F3Q A;  2DIZ A;  2KOK A;  5KEJ A;  3FR3 A;  1G7O A;  5COH A;  5IO0 A;  2B7K A;  3ZTL A;  2GQL A;  2K9F A;  4HI7 A;  1WRY A;  2GZY A;  2QSI A;  4EL1 A;  3FRC A;  1SKR B;  2WGR A;  4KCE A;  4BPY A;  4J2F A;  4TKY A;  4ILF A;  4IS0 A; 
#chains in the Genus database with same CATH topology
 5J9B A;  1G6W A;  4KSO A;  5B8B A;  3APS A;  4MNN A;  4PUA A;  1K0A A;  4N30 A;  4JRR A;  3DXB A;  5JWQ B;  5D73 A;  3SWL A;  1KBN A;  1MD4 A;  2CVK A;  3TKP A;  13GS A;  4K9Z A;  3IBH A;  3F4T A;  3QDN A;  1Q4J A;  1O8W A;  4WKW A;  3J7Y b;  3HVV A;  2I1U A;  2PGT A;  4MF5 A;  1NHY A;  5DJM A;  3CTF A;  1PMT A;  1WWJ A;  5GAN D;  1BAY A;  2DKI A;  1T8E B;  5FHI A;  4WEY A;  3Q18 A;  1MDK A;  2H8L A;  3S9F A;  5CO3 A;  1JLW A;  2VLT A;  1DE1 A;  2EIR A;  4OFM A;  5IO2 A;  3WGX A;  2BTO T;  2IME A;  3KP9 A;  4KND A;  2RM6 A;  4CY8 A;  4ID0 A;  2L6D A;  3ED3 A;  4D73 B;  1I9D A;  5JWO B;  1Y6E A;  4YQU A;  2FUG 2;  4ECC A;  1CQG A;  3UAP A;  3EE2 A;  2H73 A;  3TRQ A;  3RHB A;  2FWF A;  3EMP A;  2R6K A;  3CRT A;  4I6X A;  2FGX A;  3UBL A;  3IPZ A;  2HRK A;  1DE2 A;  3IOS A;  5IMZ A;  3W8S A;  3ZL5 A;  4GCI A;  4RI6 A;  2P5R A;  3QFB C;  5F0G A;  5A5K A;  3GYK A;  3O76 A;  3GKK A;  4K6X A;  2PVO C;  3EUR A;  3I6A A;  5EL8 A;  5IOW A;  1FW1 A;  4E8E A;  3HA9 A;  2DC5 A;  5D8I A;  4JE1 A;  3QR6 A;  3IK7 A;  1Q98 A;  1R4W A;  4XRD A;  1X9M B;  2HRN A;  2HXK A;  2L59 A;  1T3B A;  4MPF A;  2MMO A;  4AGS A;  2IFQ B;  1TK5 B;  1R5A A;  5AGY A;  3G7Y A;  4TRX A;  5ECR B;  4OFN A;  5DAL B;  4HZ2 A;  1CQH A;  2GQK A;  4GRF A;  5H5R A;  4IBP A;  4O32 A;  1BG5 A;  5BMU A;  4N11 A;  1SL0 B;  3QAG A;  3GUS A;  1YKC A;  4EXJ A;  2L5O A;  5AIS A;  14GS A;  1M0U A;  3UL3 A;  3L9U A;  2G0F A;  5HFK A;  1GLQ A;  2FY6 A;  3VUR A;  3UBK A;  4PXO A;  3KMN A;  3LG6 A;  3F9U A;  3QAW A;  1S3R A;  3BJ5 A;  4NWY A;  2XHF A;  3EU3 A;  4EDZ A;  3F4S A;  2DJ1 A;  5DQY A;  2BMX A;  2KHP A;  5IMD A;  3ERG A;  1GSU A;  3HVX A;  1V58 A;  2YN1 A;  2CAI A;  2H6Z A;  2H1B A;  1X5D A;  1H75 A;  1XG8 A;  4ZIL A;  4NMU A;  2I4A A;  3P7X A;  4DEJ A;  2E2M A;  4F2I A;  3H93 A;  4QL7 A;  4X43 A;  1YQ1 A;  2R2J A;  3FW2 A;  2AV4 A;  3C1R A;  3Q19 A;  4TVE A;  2CAQ A;  4GSN A;  5GSS A;  1B4Q A;  1SKW B;  3HYP A;  1IYI A;  3A2X A;  1SYX A;  2YOI A;  3GL3 A;  1O7U A;  2GTU A;  3F6F A;  1F37 A;  1UVZ A;  4XRA A;  1A8Y A;  2F8A A;  4FYC A;  4JR6 A;  2FA4 A;  3F63 A;  3PIN A;  4AJ7 A;  2DIY A;  2MBS A;  3LOR A;  2PPT A;  3U6V A;  3GFK A;  1K3O A;  1TW9 A;  3KM6 A;  2DJ2 A;  4X0X A;  1EV4 A;  3IXR A;  1PKZ A;  2XBI A;  4X1U A;  2QA1 A;  3L0H A;  2LST A;  1GSQ A;  1VRS D;  3LQ7 A;  4ZB8 A;  3F0I A;  3WD6 A;  1ERT A;  4Q5Q A;  1PX6 A;  4Z2T A;  4K7N A;  4MJE A;  2XC2 A;  1AAZ A;  1A0F A;  4ICY A;  1A2J A;  3HVN A;  1B48 A;  3F4R A;  1U3I A;  1TTZ A;  2I81 A;  2YJ7 A;  3O3T A;  3QCP A;  1FO5 A;  2CQ9 A;  3KH7 A;  2A2S A;  2OE1 A;  1BQ7 A;  5D96 A;  3IRA A;  2VL2 C;  4ZIJ A;  4TR3 A;  1XW6 A;  1PA3 A;  1GL8 A;  5ECP B;  3CYN A;  1PN9 A;  1ERV A;  2O87 A;  2R37 A;  2YNX A;  1AXD A;  3WGD A;  4JED A;  4KH7 A;  1YY7 A;  5J3R A;  1OE7 A;  3NIV A;  1FAA A;  1EEJ A;  2VAF A;  4ECJ A;  4BL7 A;  5E59 A;  2H1A A;  4K7O A;  1TRV A;  1DUG A;  1MDJ A;  3QFA C;  4MCU A;  1GUH A;  4LA1 A;  4USS A;  2J9H A;  2YPM A;  1B9Y C;  3CSH A;  1PN0 A;  2VD0 A;  2P5Q A;  2H0H A;  4RQR A;  1PSQ A;  2HYX A;  5H5Q A;  1X5C A;  1XWK A;  4EIQ A;  3GMF A;  2B5X A;  3GV1 A;  1XIY A;  4ZBB A;  4Z2R A;  1K0O A;  3LYK A;  4L5O A;  1EWX A;  2B7J A;  3HVS A;  2JZT A;  4K7I A;  1MEK A;  2TRX A;  4YQV A;  2O89 A;  4I8B A;  3NZN A;  3UIW A;  3HHV A;  4MJB A;  3VK9 A;  2H0I A;  3BOA A;  2IN3 A;  4JR4 A;  2E7P A;  1NM3 A;  3TOU A;  2AUV A;  4ACS A;  1OKT A;  4IJI A;  4BVY A;  2LNT A;  5F07 A;  1TI1 A;  1LU4 A;  3OR5 A;  3E0U A;  2H1G A;  4BVX A;  3PPU A;  2FWG A;  5IMV A;  1A23 A;  1QMV A;  1ZL9 A;  1SJZ A;  5DDL A;  1JZR A;  3PR8 A;  1K0N A;  3C8E A;  2X4A A;  1JZW A;  4IVF A;  3EWL A;  2QC7 A;  1U3A A;  3ME8 A;  3RBT A;  1FG4 A;  3ZVJ A;  3TRX A;  3AY8 A;  2AYT A;  3GKN A;  3LEF A;  2XBQ A;  2ZCT A;  1HYU A;  3W6G A;  3TJK A;  4QL9 A;  1YDK A;  4KUN A;  4YH2 A;  1XW9 A;  3UAR A;  4V2M A;  3D5J A;  2H6Y A;  4EE0 A;  3LW9 A;  4L0U A;  3DYR A;  3GHA A;  2VOC A;  1V40 A;  2LRC A;  2JAC A;  2JZS A;  17GS A;  4HJM A;  2PN8 A;  11GS A;  3EIN A;  2R0G A;  1OVN A;  2GSS A;  3FY7 A;  5IMA A;  2CVB A;  3KZQ A;  4O5U A;  2M72 A;  3RAZ A;  5J5N A;  2VCW A;  6GSS A;  4K1F A;  3DRN A;  2H74 A;  3ME7 A;  6GSY A;  4K5R A;  2E2G A;  5HR0 A;  5F8B A;  3H1N A;  2C0F A;  3ERW A;  2C80 A;  4Q5F A;  4MJA A;  1XOB A;  1XWC A;  4FIW A;  4OCE A;  3FZ9 A;  3HJP A;  4KDY A;  4FH8 A;  4NXI A;  2N5A A;  1GH2 A;  1SU9 A;  3P8W A;  1WIK A;  2H71 A;  4ECB A;  2IMK A;  2F51 A;  3IHG A;  1Z6M A;  1GTI A;  1M2A A;  2N5B A;  2V6K A;  1SL2 B;  4V2L A;  4GWR A;  3ZIT A;  5C04 A;  5LNK e;  2ALB A;  3MYD A;  1B4P A;  1UN2 A;  1J08 A;  6GSV A;  2CX4 A;  3D6I A;  2YWM A;  3IR4 A;  2F8F A;  4XHM A;  2MMZ A;  1S3D A;  1SD9 A;  3GKX A;  2AJQ B;  4LLR A;  1NSW A;  2B5E A;  3L78 A;  3I43 A;  1Z6N A;  3GRX A;  5GZZ B;  1SYR A;  3HXS A;  4I5Q A;  4AJ6 A;  2QA2 A;  4PQ1 A;  3L4N A;  3DD3 A;  4BVY B;  4Z7X A;  1GWC A;  4O5Q A;  3A5W A;  3C7M A;  5G5E A;  3V1W A;  2XPE A;  4PQI A;  4BVX B;  2PVQ A;  2L57 A;  4EIP A;  1K0M A;  5CNW A;  3P90 A;  5IPG A;  4XTS A;  2C0E A;  4YKF A;  4BWS A;  1WMJ A;  1E6B A;  1ZOF A;  4H86 A;  4NAX A;  2G2Q A;  2V41 A;  2VUP A;  3HKR A;  4JZQ A;  3TKS C;  3EMX A;  3APQ A;  1BX9 A;  1A2L A;  1F3B A;  4IKH A;  4IGJ A;  2JL4 A;  3KMO A;  4TR1 A;  1K0C A;  2L4Q A;  5G1K A;  3E9J B;  5G1L A;  4L8E A;  2NDO A;  4PNG A;  5ENU A;  3FEU A;  2R4V A;  5H5S A;  5C00 A;  6GST A;  1XBS A;  4GQF A;  2ES7 A;  1KNG A;  1PX7 A;  1XFL A;  2O8V B;  1C72 A;  4ULX A;  3DIE A;  1ABA A;  4QQ7 A;  1XWG A;  2TIR A;  1PL1 A;  3IA1 A;  1EOG A;  2RUE A;  1YEX A;  4EUY A;  5F06 A;  4A5P A;  2CT6 A;  2YWI A;  1ZYP A;  1FOV A;  3EC3 A;  2YV9 A;  1XWA A;  4PUF C;  1B9X C;  2HE3 A;  4WBJ A;  1T4Z A;  2CVD A;  3UEM A;  2O7K A;  1ZGN A;  1I5G A;  1YZX A;  2KLX A;  3ZRD A;  3H8Q A;  1YJ6 A;  1FB6 A;  1O81 A;  4MPG A;  4MZB A;  4PUR A;  5HFG A;  4POL A;  1RW1 A;  3F6D A;  3ZRE A;  4HQZ A;  20GS A;  4HOJ A;  5J41 A;  5B6N A;  2R5G A;  3ZVJ D;  4HDE A;  3MWH A;  2FWH A;  1GSF A;  3GKM A;  6GSU A;  3C71 A;  1SK0 A;  1Z5Y E;  1GSD A;  3VLN A;  4EO3 A;  1WPI A;  2IMF A;  1A2M A;  1QFN A;  2H75 A;  3UJ1 A;  5IMF A;  2N5F A;  2OKA A;  2WCI A;  3TJB A;  1XZO A;  1X5E A;  3TJG A;  4Q5R A;  2DJJ A;  5ECO B;  2A4V A;  2GGT A;  4WR4 A;  2GQM A;  4DSS A;  5BRT A;  3MSZ A;  3TKR A;  2L5L A;  3N9J A;  19GS A;  4PNF A;  4MMM A;  4MAB A;  2IL3 A;  3A2V A;  4POM A;  4IJ3 A;  5DCG A;  3VWV A;  2C8U A;  4TR1 B;  4LMW A;  5CRW A;  4G19 A;  3FZ4 A;  4F0C A;  2P0G A;  3TGZ A;  1GLP A;  2HSM A;  1S3C A;  1ML6 A;  3DKS A;  3CXG A;  4FQU A;  1UA5 A;  1AW9 A;  1Z7R A;  5ECM B;  6GSX A;  5DBQ A;  2YZU A;  3HDC A;  2OAD A;  1EP7 A;  1QUW A;  3TKS E;  2RM5 A;  1RQM A;  2MBT A;  3KJY A;  4ZL8 A;  2LJA A;  1FHE A;  4MP4 A;  1O85 A;  1TU7 A;  4YAP A;  3DWV A;  1OC8 A;  3VI7 A;  3GTU A;  4O7H A;  2LKU A;  2YWN A;  4MF6 A;  2LUS A;  2IPA A;  3UVT A;  2I3Y A;  2HNL A;  1M7T A;  2LNS A;  1TP9 A;  2GSR A;  4WXT A;  2R0P A;  4IEL A;  2HFD A;  1GUM A;  3TRP A;  4K5S A;  2TRC P;  2F3M A;  3ZML A;  1G6Y A;  6GSW A;  1NW2 A;  1XVW A;  1M9B A;  3O6T A;  3HZ8 A;  3IHQ A;  3GH6 A;  4V1A p;  1WP0 A;  2VL9 A;  3KTB A;  1VF2 A;  8GSS A;  2HRA A;  4NHZ A;  2OBI A;  5HR1 A;  4GXZ A;  3I69 A;  5CP1 A;  3UOM A;  3EPT A;  1GP1 A;  1XPV A;  5DQS A;  1F2E A;  4PQH A;  2I9H A;  3G9B A;  4HUA A;  4XS6 A;  1O8X A;  1F6M C;  1EOH A;  2H01 A;  2C3N A;  4DSR A;  4ZXG A;  4MJC A;  3SBC A;  3LWA A;  5AIX A;  2V6O A;  3M3M A;  3JCM L;  5D93 A;  2L4C A;  2VO4 A;  3GH9 A;  4TOP A;  3H4K A;  5ID2 A;  4X4J A;  2VCT A;  3VFI A;  4PTS A;  4WF4 A;  1J0F A;  2PU9 C;  2X99 A;  4OO4 A;  1ZYN A;  1MD3 A;  2WJU A;  2F9S A;  1W89 A;  2HZE A;  2LS5 A;  3TDG A;  1HD2 A;  2WZ9 A;  1TU8 A;  1PRX A;  4CHS A;  1PFO A;  4KAE A;  4IP6 A;  2KP2 A;  4NPB A;  4EKZ A;  3GX0 A;  2HSY A;  5CAX A;  1ZYQ B;  3Q6O A;  2GST A;  4RUV A;  1GSY A;  5AN1 A;  5G30 A;  1XW5 A;  3KCM A;  1TRW A;  2K6V A;  1GNW A;  3LFL A;  2IMI A;  4CDO A;  3APO A;  16GS A;  5ECH B;  4ISD A;  1TJD A;  2H0G A;  1PD2 1;  2FCH A;  1VF3 A;  2WFC A;  3M9J A;  4DSS B;  5IM9 A;  1VF1 A;  22GS A;  1K3L A;  3BCK A;  5ABR A;  3D4M A;  3BBY A;  5CRH A;  4V1A g;  1U87 A;  1GSS A;  2HT9 A;  1B8X A;  1F3A A;  4KA0 A;  3F3R A;  2DJ0 A;  1FOH A;  4MDC A;  2RII A;  1A0R P;  4AF2 A;  3KGK A;  3QD9 A;  1THX A;  5D9V A;  4EVM A;  4KE3 A;  4HU9 A;  1U88 A;  2ON7 A;  12GS A;  3ERF A;  4MZC A;  5D9T A;  1K0B A;  5KOX A;  4GF0 A;  4PX1 A;  2C1Y A;  3KTL A;  3GTU B;  2FLS A;  4OWY A;  1XVQ A;  2MMA A;  1QXH A;  5IMC A;  4XCS A;  1ZYE A;  3P2A A;  1G7E A;  1X9S B;  2EIQ A;  2WRT A;  4XIH A;  2O85 A;  4KDX A;  1GTU A;  2C4J A;  4MZW A;  3IE3 A;  4AJ8 A;  4EF0 A;  1RK4 A;  2OA7 A;  5EPF A;  3KEB A;  2GZZ A;  2JU5 A;  2K8V A;  2LQQ A;  3LJR A;  2V32 A;  3TJJ A;  2C0G A;  4MK3 A;  3FZ5 A;  1TKD B;  1Y25 A;  2GVP A;  3NOF A;  4TR4 A;  2H6X A;  1O6J A;  2H30 A;  2REM A;  4HU7 A;  7GSS A;  2VL3 A;  3IV4 A;  1UC7 A;  5FWG A;  1BED A;  2NTO A;  2GDR A;  1Z9H A;  3IAS 2;  1M9A A;  4EDY A;  4MH3 A;  2WUL A;  3KXO A;  4O92 A;  3BCI A;  4TN8 A;  1M3I A;  2DBC A;  4F0B A;  2OE3 A;  3TCO A;  5ID2 B;  3KIJ A;  2JAD A;  2NVL A;  5B7C A;  4BL7 B;  3ZFL A;  3TB2 A;  4GSS A;  2GT6 A;  2C3T A;  3GSS A;  5KN2 A;  1T7P B;  2XPD A;  3HJM A;  2HZE B;  5ECQ B;  1O73 A;  2D2Z A;  3HZ4 A;  3DVW A;  2YV7 A;  2YWO A;  2AAW A;  1XCC A;  3HJO A;  4ML6 A;  1ON4 A;  3I9V 2;  2M46 A;  3GNJ A;  4KF9 A;  4YAV A;  4BIK A;  2FNO A;  2BJX A;  3KP8 A;  4I2U A;  2VM1 A;  2PMT A;  1F9M A;  4OCF A;  5B6M A;  4GQC A;  3A3T A;  2X49 A;  1LBK A;  5IPH A;  1K3Y A;  3RPN A;  2H66 A;  1BJX A;  4Q5N A;  1AIU A;  1Z7P A;  2DSA A;  4ZBA A;  2DLX A;  4HQS A;  5CYY A;  3DGQ A;  1HNC A;  1R26 A;  5KN0 A;  1ZZY A;  2X8H A;  2VCZ A;  4NV2 A;  4N10 A;  1ACV A;  4LL1 B;  1VF4 A;  2YAN A;  4KGI A;  1YEP A;  4N0Z A;  3WGE A;  2V2G A;  4J57 E;  1YF0 A;  3M8N A;  3RPP A;  1JZD A;  1JLV A;  3FKF A;  4FYU A;  4TW5 A;  4LL4 B;  3HD5 A;  2AB6 A;  5HFI A;  3LXZ A;  4IN0 A;  1FVJ A;  2IWT A;  1OYJ A;  4POK A;  3DML A;  3GUR A;  1A24 A;  1E2Y A;  5A4W A;  3Q74 A;  1AUC A;  5LD0 A;  3LYP A;  2VLU A;  4N0V A;  3IK9 A;  1AQV A;  3GIX A;  2EC4 A;  4GST A;  4GLT A;  4P3Y B;  3G7J A;  2OAC A;  3H79 A;  3LGC A;  2QKE A;  3FHK A;  5A4V A;  2CZ2 A;  3M1G A;  2FWE A;  2PUK C;  3WYW A;  5ECI B;  2DJ3 A;  2YCD A;  1TRU A;  4IQA A;  2VD1 A;  3ZIV A;  1TK8 B;  2WB9 A;  3LSZ A;  3J7Y k;  4ZBD A;  4HSC X;  1OE8 A;  3DVX A;  3FK8 A;  2IMD A;  1USB A;  4L0W A;  2L6C A;  5G2Z A;  1K0D A;  2PER A;  4F82 A;  4HZ4 A;  3UMA A;  1V98 A;  4WR5 A;  1PKW A;  2LQO A;  5J4U A;  3M0F A;  3ZLP A;  3C73 A;  3G7I A;  4POB A;  1FB0 A;  2K18 A;  4XS1 A;  4NHW A;  2WS2 A;  1ZMA A;  2YP6 A;  4G2E A;  1DBY A;  4JBB A;  3L9V A;  4ZB9 A;  2RUF A;  3FYG A;  3RHC A;  5HQP A;  5F05 A;  1V2A A;  4OO5 A;  2LTK A;  1AQW A;  1M3J A;  4YQM A;  1X0R A;  2VL2 A;  1YF1 A;  1R7H A;  2CX3 A;  1TI3 A;  1YKA A;  5ELG A;  2VCV A;  1JFU A;  2HLS A;  3U5R E;  3R3E A;  3D4T A;  3ZIJ A;  1T4Y A;  1X9W B;  1V57 A;  2DML A;  4DVC A;  2H70 A;  1R5P A;  2NPB A;  3A5I A;  5ELA A;  2LJK A;  3VWW A;  1SJ6 A;  5GST A;  3VWX A;  2DMM A;  2HSH A;  2PWJ A;  4TXO A;  1FVK A;  2P31 A;  3US3 A;  2HRF A;  3MDK A;  1T00 A;  5D9X A;  3KD0 A;  4NV5 A;  4KDU A;  1U6T A;  2MYG A;  4KB3 A;  4ZL9 A;  1KTE A;  4BWQ A;  2B6M A;  5DVB A;  3WT2 A;  3CBU A;  2QGV A;  9GSS A;  4ZB6 A;  3MAK A;  3LXT A;  5LCZ A;  3D0Z A;  4PGT A;  1TXX A;  4TR0 A;  2OJL A;  2B1L A;  3VI5 A;  4FO5 A;  3CMI A;  3IDV A;  2VIM A;  4ZL7 A;  1EGO A;  1EGR A;  1HQO A;  2H76 A;  1M2B A;  2ZUP A;  5JWR B;  5IIZ A;  2H72 A;  2H1D A;  5A4U A;  1XXU A;  2GLR A;  2R3X A;  2A2R A;  1A8L A;  4XS4 A;  1SJI A;  1SK1 A;  3TOT A;  2WDU A;  3K8N A;  3VPQ A;  1TOF A;  5KOW A;  4O5R A;  1QGV A;  4MA9 A;  3EU4 A;  4HJ2 A;  3QAV A;  3FZA A;  1S3A A;  1PQN A;  1QK8 A;  4IP1 A;  1V9W A;  1OC9 A;  2A2P A;  1ERW A;  3L9S A;  3QMX A;  2HZF A;  4G10 A;  4HS1 A;  2B1K A;  4K8M A;  2B3S A;  4KX4 A;  2K8S A;  1NHO A;  4KCA A;  3PGT A;  3KH9 A;  1XOA A;  2JSY A;  2A4H A;  1LJR A;  4L5L A;  5DJL A;  1HNB A;  4F9Z A;  1AC1 A;  3HCZ A;  4CY6 A;  3EVI A;  1MTC A;  1EV9 A;  4IHU A;  4ML1 A;  2MZC A;  1DSB A;  3IAM 2;  2DJK A;  5B8A A;  3IC4 A;  4DSQ A;  4KW6 A;  3GL5 A;  2B5Y A;  10GS A;  1QQ2 A;  2LJR A;  3ISO A;  4KSM A;  5JCW A;  2KP1 A;  5J9C A;  2LRN A;  5HR3 A;  4RI7 A;  2X64 A;  3ZFB A;  1PL2 A;  2X8C A;  4MH2 A;  4WF5 A;  3TJF A;  3FR9 A;  1EP8 A;  3CSI A;  3F8U A;  2X8G A;  4G0K A;  2GSQ A;  1EZK A;  2GZP A;  4V2N A;  4OFT A;  1G0T A;  3R2Q A;  2CZ3 A;  2RLI A;  5DAK A;  2VLV A;  4ECI A;  2DKH A;  1WJK A;  5D9W A;  1XWB A;  2GS3 A;  1N8J A;  5AIV A;  4TXO B;  4FYB A;  2ZNM A;  2JSZ A;  3PH9 A;  3VPT A;  1ERU A;  5ECN B;  4BA7 A;  4G9H A;  5KN3 A;  3WT1 A;  5CRE A;  1TDI A;  5ECK B;  3E3E A;  2J23 A;  5DCH A;  3ZYW A;  2JZR A;  4GTU A;  2VM2 A;  4I97 A;  1T1V A;  2EIO A;  3DEX A;  5INY A;  3FR6 A;  4K0G A;  4G0I A;  4YKG A;  2C0D A;  2H19 A;  4JU5 A;  5EVO A;  3QPM A;  1HNA A;  3HY2 A;  3RDW A;  1TRS A;  1W4V A;  2V1M A;  4MLY A;  1WOU A;  1ILO A;  4LMV A;  3MNG A;  1GSE A;  1KEB A;  4G0L A;  3QOU A;  1ST9 A;  18GS A;  2LEG A;  4HEA 2;  5CRD A;  2M80 A;  4E8H A;  3GX8 A;  2E0Q A;  2IJY A;  1GUL A;  5KN1 A;  1SEN A;  1GTB A;  3ZZX A;  4XS4 B;  4Z2U A;  2FHE A;  4CW9 A;  1M2D A;  1GTA A;  1OC3 A;  3UVH A;  1OKD A;  5IOX A;  4RQX A;  2FD3 A;  3D22 A;  3TKS A;  5FT3 A;  2PBJ A;  3MIX A;  1J9B A;  3GA4 A;  1BYE A;  5EY6 A;  2VCQ A;  4K2D A;  1OC9 B;  1M99 A;  2OE0 A;  4K0N A;  2IIY A;  3TKQ A;  3VWU A;  2ON5 A;  2HI7 A;  2YZH A;  1Z3E A;  2C3Q A;  4OMV A;  3CTG A;  4WET A;  4I2T A;  4D73 A;  1JHB A;  4IQ1 A;  2KUC A;  2YJH A;  1SL1 B;  3A2W A;  3IC8 A;  1OAZ A;  2LV3 A;  1GRX A;  5L71 A;  2AHE A;  4TXV A;  1AQX A;  5GAP D;  5ECS A;  2OBK A;  3GN3 A;  3M9K A;  5G31 A;  1TK0 B;  3N5O A;  5HR2 A;  1ZCP A;  2VCX A;  1GNE A;  2MMN A;  4IW9 A;  2GT5 A;  4J56 E;  5G5F A;  2LRT A;  1EEM A;  1PGT A;  5CRG A;  3CQF A;  2FA8 A;  2CA8 A;  4OD7 A;  3FMW A;  5E4W A;  5JCG A;  2R0C A;  3GST A;  3BD2 A;  1GUK A;  3W8J A;  1SKS B;  1H4O A;  1JZO A;  3C1S A;  3CSJ A;  1VGL A;  2IFQ A;  4MF7 A;  1IYH A;  5DAL A;  5DAK B;  5IQY A;  4WBR D;  2CV4 A;  1THO A;  1SK2 A;  2UZ8 A;  5ECL B;  1MDI A;  2NBS A;  2Z9S A;  1WE0 A;  3EYT A;  3TUE A;  4EC0 A;  3ZMK A;  3D21 A;  1SD8 A;  1N2A A;  1URM A;  5JCU A;  4F03 A;  3CRU A;  3F3Q A;  2DIZ A;  2KOK A;  5KEJ A;  3FR3 A;  1G7O A;  5COH A;  5IO0 A;  2B7K A;  3ZTL A;  2GQL A;  2K9F A;  4HI7 A;  1WRY A;  2GZY A;  2QSI A;  4EL1 A;  3FRC A;  1SKR B;  2WGR A;  4KCE A;  4BPY A;  4J2F A;  4TKY A;  4K2X A;  4ILF A;  4IS0 A; 
#chains in the Genus database with same CATH homology
 5J9B A;  1G6W A;  4KSO A;  5B8B A;  3APS A;  4MNN A;  4PUA A;  1K0A A;  4N30 A;  4JRR A;  3DXB A;  5JWQ B;  5D73 A;  3SWL A;  1KBN A;  1MD4 A;  2CVK A;  3TKP A;  13GS A;  4K9Z A;  3IBH A;  3F4T A;  3QDN A;  1Q4J A;  1O8W A;  4WKW A;  3J7Y b;  3HVV A;  2I1U A;  2PGT A;  4MF5 A;  1NHY A;  5DJM A;  3CTF A;  1PMT A;  1WWJ A;  5GAN D;  1BAY A;  2DKI A;  1T8E B;  5FHI A;  4WEY A;  3Q18 A;  1MDK A;  2H8L A;  3S9F A;  5CO3 A;  1JLW A;  2VLT A;  1DE1 A;  2EIR A;  4OFM A;  5IO2 A;  3WGX A;  2BTO T;  2IME A;  3KP9 A;  4KND A;  2RM6 A;  4CY8 A;  4ID0 A;  2L6D A;  3ED3 A;  4D73 B;  1I9D A;  5JWO B;  1Y6E A;  4YQU A;  2FUG 2;  4ECC A;  1CQG A;  3UAP A;  3EE2 A;  2H73 A;  3TRQ A;  3RHB A;  2FWF A;  3EMP A;  2R6K A;  3CRT A;  4I6X A;  2FGX A;  3UBL A;  3IPZ A;  2HRK A;  1DE2 A;  3IOS A;  5IMZ A;  3W8S A;  3ZL5 A;  4GCI A;  4RI6 A;  2P5R A;  3QFB C;  5F0G A;  5A5K A;  3GYK A;  3O76 A;  3GKK A;  4K6X A;  2PVO C;  3EUR A;  3I6A A;  5EL8 A;  5IOW A;  1FW1 A;  4E8E A;  3HA9 A;  2DC5 A;  5D8I A;  4JE1 A;  3QR6 A;  3IK7 A;  1Q98 A;  1R4W A;  4XRD A;  1X9M B;  2HRN A;  2HXK A;  2L59 A;  1T3B A;  4MPF A;  2MMO A;  4AGS A;  2IFQ B;  1TK5 B;  1R5A A;  5AGY A;  3G7Y A;  4TRX A;  5ECR B;  4OFN A;  5DAL B;  4HZ2 A;  1CQH A;  2GQK A;  4GRF A;  5H5R A;  4IBP A;  4O32 A;  1BG5 A;  5BMU A;  4N11 A;  1SL0 B;  3QAG A;  3GUS A;  1YKC A;  4EXJ A;  2L5O A;  5AIS A;  14GS A;  1M0U A;  3UL3 A;  3L9U A;  2G0F A;  5HFK A;  1GLQ A;  2FY6 A;  3VUR A;  3UBK A;  4PXO A;  3KMN A;  3LG6 A;  3F9U A;  3QAW A;  3BJ5 A;  4NWY A;  2XHF A;  3EU3 A;  4EDZ A;  3F4S A;  2DJ1 A;  5DQY A;  2BMX A;  2KHP A;  5IMD A;  3ERG A;  1GSU A;  3HVX A;  1V58 A;  2YN1 A;  2CAI A;  2H6Z A;  2H1B A;  1X5D A;  1H75 A;  4ZIL A;  4NMU A;  2I4A A;  3P7X A;  4DEJ A;  2E2M A;  4F2I A;  3H93 A;  4QL7 A;  4X43 A;  1YQ1 A;  2R2J A;  3FW2 A;  2AV4 A;  3C1R A;  3Q19 A;  4TVE A;  2CAQ A;  4GSN A;  5GSS A;  1B4Q A;  1SKW B;  3HYP A;  1IYI A;  3A2X A;  1SYX A;  2YOI A;  3GL3 A;  1O7U A;  2GTU A;  3F6F A;  1F37 A;  1UVZ A;  4XRA A;  1A8Y A;  2F8A A;  4FYC A;  4JR6 A;  2FA4 A;  3F63 A;  3PIN A;  4AJ7 A;  2DIY A;  2MBS A;  3LOR A;  2PPT A;  3U6V A;  3GFK A;  1K3O A;  1TW9 A;  3KM6 A;  2DJ2 A;  4X0X A;  1EV4 A;  3IXR A;  1PKZ A;  2XBI A;  4X1U A;  2QA1 A;  3L0H A;  2LST A;  1GSQ A;  1VRS D;  3LQ7 A;  4ZB8 A;  3F0I A;  3WD6 A;  1ERT A;  4Q5Q A;  1PX6 A;  4Z2T A;  4K7N A;  4MJE A;  2XC2 A;  1AAZ A;  1A0F A;  4ICY A;  1A2J A;  1B48 A;  3F4R A;  1U3I A;  1TTZ A;  2I81 A;  2YJ7 A;  3O3T A;  3QCP A;  1FO5 A;  2CQ9 A;  3KH7 A;  2A2S A;  2OE1 A;  1BQ7 A;  5D96 A;  3IRA A;  2VL2 C;  4ZIJ A;  4TR3 A;  1XW6 A;  1PA3 A;  1GL8 A;  5ECP B;  3CYN A;  1PN9 A;  1ERV A;  2O87 A;  2R37 A;  2YNX A;  1AXD A;  3WGD A;  4JED A;  4KH7 A;  1YY7 A;  5J3R A;  1OE7 A;  3NIV A;  1FAA A;  1EEJ A;  2VAF A;  4ECJ A;  4BL7 A;  5E59 A;  2H1A A;  4K7O A;  1TRV A;  1DUG A;  1MDJ A;  3QFA C;  4MCU A;  1GUH A;  4LA1 A;  4USS A;  2J9H A;  2YPM A;  1B9Y C;  3CSH A;  1PN0 A;  2VD0 A;  2P5Q A;  2H0H A;  4RQR A;  1PSQ A;  2HYX A;  5H5Q A;  1X5C A;  1XWK A;  4EIQ A;  3GMF A;  2B5X A;  3GV1 A;  1XIY A;  4ZBB A;  4Z2R A;  1K0O A;  3LYK A;  4L5O A;  1EWX A;  2B7J A;  3HVS A;  2JZT A;  4K7I A;  1MEK A;  2TRX A;  4YQV A;  2O89 A;  4I8B A;  3NZN A;  3UIW A;  3HHV A;  4MJB A;  3VK9 A;  2H0I A;  3BOA A;  2IN3 A;  4JR4 A;  2E7P A;  1NM3 A;  3TOU A;  2AUV A;  4ACS A;  1OKT A;  4IJI A;  4BVY A;  2LNT A;  5F07 A;  1TI1 A;  1LU4 A;  3OR5 A;  3E0U A;  2H1G A;  4BVX A;  3PPU A;  2FWG A;  5IMV A;  1A23 A;  1QMV A;  1ZL9 A;  1SJZ A;  5DDL A;  1JZR A;  3PR8 A;  1K0N A;  3C8E A;  2X4A A;  1JZW A;  4IVF A;  3EWL A;  2QC7 A;  1U3A A;  3ME8 A;  3RBT A;  1FG4 A;  3ZVJ A;  3TRX A;  3AY8 A;  2AYT A;  3GKN A;  3LEF A;  2XBQ A;  2ZCT A;  1HYU A;  3W6G A;  3TJK A;  4QL9 A;  1YDK A;  4KUN A;  4YH2 A;  1XW9 A;  3UAR A;  4V2M A;  3D5J A;  2H6Y A;  4EE0 A;  3LW9 A;  4L0U A;  3DYR A;  3GHA A;  2VOC A;  1V40 A;  2LRC A;  2JAC A;  2JZS A;  17GS A;  4HJM A;  2PN8 A;  11GS A;  3EIN A;  2R0G A;  1OVN A;  2GSS A;  3FY7 A;  5IMA A;  2CVB A;  3KZQ A;  4O5U A;  2M72 A;  3RAZ A;  5J5N A;  2VCW A;  6GSS A;  4K1F A;  3DRN A;  2H74 A;  3ME7 A;  6GSY A;  4K5R A;  2E2G A;  5HR0 A;  5F8B A;  3H1N A;  2C0F A;  3ERW A;  2C80 A;  4Q5F A;  4MJA A;  1XOB A;  1XWC A;  4FIW A;  4OCE A;  3FZ9 A;  3HJP A;  4KDY A;  4FH8 A;  4NXI A;  2N5A A;  1GH2 A;  1SU9 A;  3P8W A;  1WIK A;  2H71 A;  4ECB A;  2IMK A;  2F51 A;  3IHG A;  1Z6M A;  1GTI A;  1M2A A;  2N5B A;  2V6K A;  1SL2 B;  4V2L A;  4GWR A;  3ZIT A;  5C04 A;  5LNK e;  2ALB A;  3MYD A;  1B4P A;  1UN2 A;  1J08 A;  6GSV A;  2CX4 A;  3D6I A;  2YWM A;  3IR4 A;  2F8F A;  4XHM A;  2MMZ A;  1S3D A;  1SD9 A;  3GKX A;  2AJQ B;  4LLR A;  1NSW A;  2B5E A;  3L78 A;  3I43 A;  1Z6N A;  3GRX A;  5GZZ B;  1SYR A;  3HXS A;  4I5Q A;  4AJ6 A;  2QA2 A;  4PQ1 A;  3L4N A;  3DD3 A;  4BVY B;  4Z7X A;  1GWC A;  4O5Q A;  3A5W A;  3C7M A;  5G5E A;  3V1W A;  2XPE A;  4PQI A;  4BVX B;  2PVQ A;  2L57 A;  4EIP A;  1K0M A;  5CNW A;  3P90 A;  5IPG A;  4XTS A;  2C0E A;  4YKF A;  4BWS A;  1WMJ A;  1E6B A;  1ZOF A;  4H86 A;  4NAX A;  2G2Q A;  2V41 A;  2VUP A;  3HKR A;  4JZQ A;  3TKS C;  3EMX A;  3APQ A;  1BX9 A;  1A2L A;  1F3B A;  4IKH A;  4IGJ A;  2JL4 A;  3KMO A;  4TR1 A;  1K0C A;  2L4Q A;  5G1K A;  3E9J B;  5G1L A;  4L8E A;  2NDO A;  4PNG A;  5ENU A;  3FEU A;  2R4V A;  5H5S A;  5C00 A;  6GST A;  1XBS A;  4GQF A;  2ES7 A;  1KNG A;  1PX7 A;  1XFL A;  2O8V B;  1C72 A;  4ULX A;  3DIE A;  1ABA A;  4QQ7 A;  1XWG A;  2TIR A;  1PL1 A;  3IA1 A;  1EOG A;  2RUE A;  1YEX A;  4EUY A;  5F06 A;  4A5P A;  2CT6 A;  2YWI A;  1ZYP A;  1FOV A;  3EC3 A;  2YV9 A;  1XWA A;  4PUF C;  1B9X C;  2HE3 A;  4WBJ A;  1T4Z A;  2CVD A;  3UEM A;  2O7K A;  1ZGN A;  1I5G A;  1YZX A;  2KLX A;  3ZRD A;  3H8Q A;  1YJ6 A;  1FB6 A;  1O81 A;  4MPG A;  4MZB A;  4PUR A;  5HFG A;  4POL A;  1RW1 A;  3F6D A;  3ZRE A;  4HQZ A;  20GS A;  4HOJ A;  5J41 A;  5B6N A;  2R5G A;  3ZVJ D;  4HDE A;  3MWH A;  2FWH A;  1GSF A;  3GKM A;  6GSU A;  3C71 A;  1SK0 A;  1Z5Y E;  1GSD A;  3VLN A;  4EO3 A;  1WPI A;  2IMF A;  1A2M A;  1QFN A;  2H75 A;  3UJ1 A;  5IMF A;  2N5F A;  2OKA A;  2WCI A;  3TJB A;  1XZO A;  1X5E A;  3TJG A;  4Q5R A;  2DJJ A;  5ECO B;  2A4V A;  2GGT A;  4WR4 A;  2GQM A;  4DSS A;  5BRT A;  3MSZ A;  3TKR A;  2L5L A;  3N9J A;  19GS A;  4PNF A;  4MMM A;  4MAB A;  2IL3 A;  3A2V A;  4POM A;  4IJ3 A;  5DCG A;  3VWV A;  2C8U A;  4TR1 B;  4LMW A;  5CRW A;  4G19 A;  3FZ4 A;  4F0C A;  2P0G A;  3TGZ A;  1GLP A;  2HSM A;  1S3C A;  1ML6 A;  3DKS A;  3CXG A;  4FQU A;  1UA5 A;  1AW9 A;  1Z7R A;  5ECM B;  6GSX A;  5DBQ A;  2YZU A;  3HDC A;  2OAD A;  1EP7 A;  1QUW A;  3TKS E;  2RM5 A;  1RQM A;  2MBT A;  3KJY A;  4ZL8 A;  2LJA A;  1FHE A;  4MP4 A;  1O85 A;  1TU7 A;  4YAP A;  3DWV A;  1OC8 A;  3VI7 A;  3GTU A;  4O7H A;  2LKU A;  2YWN A;  4MF6 A;  2LUS A;  2IPA A;  3UVT A;  2I3Y A;  2HNL A;  1M7T A;  2LNS A;  1TP9 A;  2GSR A;  4WXT A;  2R0P A;  4IEL A;  2HFD A;  1GUM A;  3TRP A;  4K5S A;  2TRC P;  2F3M A;  3ZML A;  1G6Y A;  6GSW A;  1NW2 A;  1XVW A;  1M9B A;  3O6T A;  3HZ8 A;  3IHQ A;  3GH6 A;  4V1A p;  1WP0 A;  2VL9 A;  3KTB A;  1VF2 A;  8GSS A;  2HRA A;  4NHZ A;  2OBI A;  5HR1 A;  4GXZ A;  3I69 A;  5CP1 A;  3UOM A;  3EPT A;  1GP1 A;  1XPV A;  5DQS A;  1F2E A;  4PQH A;  2I9H A;  3G9B A;  4HUA A;  4XS6 A;  1O8X A;  1F6M C;  1EOH A;  2H01 A;  2C3N A;  4DSR A;  4ZXG A;  4MJC A;  3SBC A;  3LWA A;  5AIX A;  2V6O A;  3M3M A;  3JCM L;  5D93 A;  2L4C A;  2VO4 A;  3GH9 A;  4TOP A;  3H4K A;  5ID2 A;  4X4J A;  2VCT A;  3VFI A;  4PTS A;  4WF4 A;  1J0F A;  2PU9 C;  2X99 A;  4OO4 A;  1ZYN A;  1MD3 A;  2WJU A;  2F9S A;  1W89 A;  2HZE A;  2LS5 A;  3TDG A;  1HD2 A;  2WZ9 A;  1TU8 A;  1PRX A;  4CHS A;  4KAE A;  4IP6 A;  2KP2 A;  4NPB A;  4EKZ A;  3GX0 A;  2HSY A;  5CAX A;  1ZYQ B;  3Q6O A;  2GST A;  4RUV A;  1GSY A;  5AN1 A;  5G30 A;  1XW5 A;  3KCM A;  1TRW A;  2K6V A;  1GNW A;  3LFL A;  2IMI A;  4CDO A;  3APO A;  16GS A;  5ECH B;  4ISD A;  1TJD A;  2H0G A;  1PD2 1;  2FCH A;  1VF3 A;  2WFC A;  3M9J A;  4DSS B;  5IM9 A;  1VF1 A;  22GS A;  1K3L A;  3BCK A;  5ABR A;  3D4M A;  3BBY A;  5CRH A;  4V1A g;  1U87 A;  1GSS A;  2HT9 A;  1B8X A;  1F3A A;  4KA0 A;  3F3R A;  2DJ0 A;  1FOH A;  4MDC A;  2RII A;  1A0R P;  4AF2 A;  3KGK A;  3QD9 A;  1THX A;  5D9V A;  4EVM A;  4KE3 A;  4HU9 A;  1U88 A;  2ON7 A;  12GS A;  3ERF A;  4MZC A;  5D9T A;  1K0B A;  5KOX A;  4GF0 A;  4PX1 A;  2C1Y A;  3KTL A;  3GTU B;  2FLS A;  4OWY A;  1XVQ A;  2MMA A;  1QXH A;  5IMC A;  4XCS A;  1ZYE A;  3P2A A;  1G7E A;  1X9S B;  2EIQ A;  2WRT A;  4XIH A;  2O85 A;  4KDX A;  1GTU A;  2C4J A;  4MZW A;  3IE3 A;  4AJ8 A;  4EF0 A;  1RK4 A;  2OA7 A;  5EPF A;  3KEB A;  2GZZ A;  2JU5 A;  2K8V A;  2LQQ A;  3LJR A;  2V32 A;  3TJJ A;  2C0G A;  4MK3 A;  3FZ5 A;  1TKD B;  1Y25 A;  2GVP A;  3NOF A;  4TR4 A;  2H6X A;  1O6J A;  2H30 A;  2REM A;  4HU7 A;  7GSS A;  2VL3 A;  3IV4 A;  1UC7 A;  5FWG A;  1BED A;  2NTO A;  2GDR A;  1Z9H A;  3IAS 2;  1M9A A;  4EDY A;  4MH3 A;  2WUL A;  3KXO A;  4O92 A;  3BCI A;  4TN8 A;  2DBC A;  4F0B A;  2OE3 A;  3TCO A;  5ID2 B;  3KIJ A;  2JAD A;  2NVL A;  5B7C A;  4BL7 B;  3ZFL A;  3TB2 A;  4GSS A;  2GT6 A;  2C3T A;  3GSS A;  5KN2 A;  1T7P B;  2XPD A;  3HJM A;  2HZE B;  5ECQ B;  1O73 A;  2D2Z A;  3HZ4 A;  3DVW A;  2YV7 A;  2YWO A;  2AAW A;  1XCC A;  3HJO A;  4ML6 A;  1ON4 A;  3I9V 2;  2M46 A;  3GNJ A;  4KF9 A;  4YAV A;  2FNO A;  2BJX A;  3KP8 A;  4I2U A;  2VM1 A;  2PMT A;  1F9M A;  4OCF A;  5B6M A;  4GQC A;  3A3T A;  2X49 A;  1LBK A;  5IPH A;  1K3Y A;  3RPN A;  2H66 A;  1BJX A;  4Q5N A;  1AIU A;  1Z7P A;  2DSA A;  4ZBA A;  2DLX A;  4HQS A;  5CYY A;  3DGQ A;  1HNC A;  1R26 A;  5KN0 A;  1ZZY A;  2X8H A;  2VCZ A;  4NV2 A;  4N10 A;  1ACV A;  4LL1 B;  1VF4 A;  2YAN A;  4KGI A;  1YEP A;  4N0Z A;  3WGE A;  2V2G A;  4J57 E;  1YF0 A;  3M8N A;  3RPP A;  1JZD A;  1JLV A;  3FKF A;  4FYU A;  4TW5 A;  4LL4 B;  3HD5 A;  2AB6 A;  5HFI A;  3LXZ A;  4IN0 A;  1FVJ A;  2IWT A;  1OYJ A;  4POK A;  3DML A;  3GUR A;  1A24 A;  1E2Y A;  5A4W A;  3Q74 A;  1AUC A;  5LD0 A;  3LYP A;  2VLU A;  4N0V A;  3IK9 A;  1AQV A;  3GIX A;  2EC4 A;  4GST A;  4GLT A;  4P3Y B;  3G7J A;  2OAC A;  3H79 A;  3LGC A;  2QKE A;  3FHK A;  5A4V A;  2CZ2 A;  3M1G A;  2FWE A;  2PUK C;  3WYW A;  5ECI B;  2DJ3 A;  2YCD A;  1TRU A;  4IQA A;  2VD1 A;  3ZIV A;  1TK8 B;  2WB9 A;  3LSZ A;  3J7Y k;  4ZBD A;  1OE8 A;  3DVX A;  3FK8 A;  2IMD A;  1USB A;  4L0W A;  2L6C A;  5G2Z A;  1K0D A;  2PER A;  4F82 A;  4HZ4 A;  3UMA A;  1V98 A;  4WR5 A;  1PKW A;  2LQO A;  5J4U A;  3M0F A;  3ZLP A;  3C73 A;  3G7I A;  4POB A;  1FB0 A;  2K18 A;  4XS1 A;  4NHW A;  2WS2 A;  1ZMA A;  2YP6 A;  4G2E A;  1DBY A;  4JBB A;  3L9V A;  4ZB9 A;  2RUF A;  3FYG A;  3RHC A;  5HQP A;  5F05 A;  1V2A A;  4OO5 A;  2LTK A;  1AQW A;  4YQM A;  1X0R A;  2VL2 A;  1YF1 A;  1R7H A;  2CX3 A;  1TI3 A;  1YKA A;  5ELG A;  2VCV A;  1JFU A;  2HLS A;  3U5R E;  3R3E A;  3D4T A;  3ZIJ A;  1T4Y A;  1X9W B;  1V57 A;  2DML A;  4DVC A;  2H70 A;  1R5P A;  2NPB A;  3A5I A;  5ELA A;  2LJK A;  3VWW A;  1SJ6 A;  5GST A;  3VWX A;  2DMM A;  2HSH A;  2PWJ A;  4TXO A;  1FVK A;  2P31 A;  3US3 A;  2HRF A;  3MDK A;  1T00 A;  5D9X A;  3KD0 A;  4NV5 A;  4KDU A;  1U6T A;  2MYG A;  4KB3 A;  4ZL9 A;  1KTE A;  4BWQ A;  2B6M A;  5DVB A;  3WT2 A;  3CBU A;  2QGV A;  9GSS A;  4ZB6 A;  3MAK A;  3LXT A;  5LCZ A;  3D0Z A;  4PGT A;  1TXX A;  4TR0 A;  2OJL A;  2B1L A;  3VI5 A;  4FO5 A;  3CMI A;  3IDV A;  2VIM A;  4ZL7 A;  1EGO A;  1EGR A;  1HQO A;  2H76 A;  1M2B A;  2ZUP A;  5JWR B;  5IIZ A;  2H72 A;  2H1D A;  5A4U A;  1XXU A;  2GLR A;  2R3X A;  2A2R A;  1A8L A;  4XS4 A;  1SJI A;  1SK1 A;  3TOT A;  2WDU A;  3K8N A;  3VPQ A;  1TOF A;  5KOW A;  4O5R A;  1QGV A;  4MA9 A;  3EU4 A;  4HJ2 A;  3QAV A;  3FZA A;  1S3A A;  1PQN A;  1QK8 A;  4IP1 A;  1V9W A;  1OC9 A;  2A2P A;  1ERW A;  3L9S A;  3QMX A;  2HZF A;  4G10 A;  4HS1 A;  2B1K A;  4K8M A;  2B3S A;  4KX4 A;  2K8S A;  1NHO A;  4KCA A;  3PGT A;  3KH9 A;  1XOA A;  2JSY A;  2A4H A;  1LJR A;  4L5L A;  5DJL A;  1HNB A;  4F9Z A;  1AC1 A;  3HCZ A;  4CY6 A;  3EVI A;  1MTC A;  1EV9 A;  4IHU A;  4ML1 A;  2MZC A;  1DSB A;  3IAM 2;  2DJK A;  5B8A A;  3IC4 A;  4DSQ A;  4KW6 A;  3GL5 A;  2B5Y A;  10GS A;  1QQ2 A;  2LJR A;  3ISO A;  4KSM A;  5JCW A;  2KP1 A;  5J9C A;  2LRN A;  5HR3 A;  4RI7 A;  2X64 A;  3ZFB A;  1PL2 A;  2X8C A;  4MH2 A;  4WF5 A;  3TJF A;  3FR9 A;  1EP8 A;  3CSI A;  3F8U A;  2X8G A;  4G0K A;  2GSQ A;  1EZK A;  2GZP A;  4V2N A;  4OFT A;  1G0T A;  3R2Q A;  2CZ3 A;  2RLI A;  5DAK A;  2VLV A;  4ECI A;  2DKH A;  1WJK A;  5D9W A;  1XWB A;  2GS3 A;  1N8J A;  5AIV A;  4TXO B;  4FYB A;  2ZNM A;  2JSZ A;  3PH9 A;  3VPT A;  1ERU A;  5ECN B;  4BA7 A;  4G9H A;  5KN3 A;  3WT1 A;  5CRE A;  1TDI A;  5ECK B;  3E3E A;  2J23 A;  5DCH A;  3ZYW A;  2JZR A;  4GTU A;  2VM2 A;  4I97 A;  1T1V A;  2EIO A;  3DEX A;  5INY A;  3FR6 A;  4K0G A;  4G0I A;  4YKG A;  2C0D A;  2H19 A;  4JU5 A;  5EVO A;  3QPM A;  1HNA A;  3HY2 A;  3RDW A;  1TRS A;  1W4V A;  2V1M A;  4MLY A;  1WOU A;  1ILO A;  4LMV A;  3MNG A;  1GSE A;  1KEB A;  4G0L A;  3QOU A;  1ST9 A;  18GS A;  2LEG A;  4HEA 2;  5CRD A;  2M80 A;  4E8H A;  3GX8 A;  2E0Q A;  2IJY A;  1GUL A;  5KN1 A;  1SEN A;  1GTB A;  3ZZX A;  4XS4 B;  4Z2U A;  2FHE A;  4CW9 A;  1M2D A;  1GTA A;  1OC3 A;  3UVH A;  1OKD A;  5IOX A;  4RQX A;  2FD3 A;  3D22 A;  3TKS A;  5FT3 A;  2PBJ A;  3MIX A;  1J9B A;  3GA4 A;  1BYE A;  5EY6 A;  2VCQ A;  4K2D A;  1OC9 B;  1M99 A;  2OE0 A;  4K0N A;  2IIY A;  3TKQ A;  3VWU A;  2ON5 A;  2HI7 A;  2YZH A;  1Z3E A;  2C3Q A;  4OMV A;  3CTG A;  4WET A;  4I2T A;  4D73 A;  1JHB A;  4IQ1 A;  2KUC A;  2YJH A;  1SL1 B;  3A2W A;  3IC8 A;  1OAZ A;  2LV3 A;  1GRX A;  5L71 A;  2AHE A;  4TXV A;  1AQX A;  5GAP D;  5ECS A;  2OBK A;  3GN3 A;  3M9K A;  5G31 A;  1TK0 B;  3N5O A;  5HR2 A;  1ZCP A;  2VCX A;  1GNE A;  2MMN A;  4IW9 A;  2GT5 A;  4J56 E;  5G5F A;  2LRT A;  1EEM A;  1PGT A;  5CRG A;  2FA8 A;  2CA8 A;  4OD7 A;  3FMW A;  5E4W A;  5JCG A;  2R0C A;  3GST A;  3BD2 A;  1GUK A;  3W8J A;  1SKS B;  1H4O A;  1JZO A;  3C1S A;  3CSJ A;  1VGL A;  2IFQ A;  4MF7 A;  1IYH A;  5DAL A;  5DAK B;  5IQY A;  4WBR D;  2CV4 A;  1THO A;  1SK2 A;  2UZ8 A;  5ECL B;  1MDI A;  2NBS A;  2Z9S A;  1WE0 A;  3EYT A;  3TUE A;  4EC0 A;  3ZMK A;  3D21 A;  1SD8 A;  1N2A A;  1URM A;  5JCU A;  4F03 A;  3CRU A;  3F3Q A;  2DIZ A;  2KOK A;  5KEJ A;  3FR3 A;  1G7O A;  5COH A;  5IO0 A;  2B7K A;  3ZTL A;  2GQL A;  2K9F A;  4HI7 A;  1WRY A;  2GZY A;  2QSI A;  4EL1 A;  3FRC A;  1SKR B;  2WGR A;  4KCE A;  4BPY A;  4J2F A;  4TKY A;  4K2X A;  4ILF A;  4IS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...