4PUFC

Complex between the salmonella t3ss effector slrp and its human target thioredoxin-1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
112
structure length
112
Chain Sequence
HHHHHGSMVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase SlrP
publication title The structure of the Slrp-Trx1 complex sheds light on the autoinhibition mechanism of the type III secretion system effectors of the NEL family.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Ligase/oxidoreductase
total genus 28
structure length 112
sequence length 112
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4pufC00
3TB2A 1JZWA 3IV4A 1AQVA 2RM5A 2FCHA 3BJ5A 3ZLPA 3TRPA 2NVLA 2FLSA 3QDNA 3TJGA 3FRCA 3GKNA 4QQ7A 2C8UA 4XS6A 4YQUA 1R4WA 5IO2A 4OD7A 1ABAA 2MMZA 4KNDA 2LV3A 4H86A 2M46A 2YN1A 2IJYA 4XRDA 2BMXA 1XPVA 3ME8A 5A5KA 4EDZA 3P7XA 1K0BA 2C4JA 1ZGNA 4FO5A 4HUAA 1JFUA 4CDOA 1TK5B 17GSA 1THOA 4JR4A 1DE1A 3BBYA 2AYTA 3UL3A 1FVJA 19GSA 1MD3A 1XWGA 1K0OA 1XIYA 2F8FA 2GS3A 3HXSA 4IQ1A 1W89A 5L71A 2VL2A 1AQWA 4OFTA 1R5AA 1HNCA 2H1BA 4GWRA 3H79A 16GSA 3MDKA 1PKZA 1PMTA 2B5XA 5DAKB 1XWKA 5A4UA 1BX9A 5KN1A 3LG6A 1HD2A 2DMMA 3S9FA 5DDLA 1UA5A 3UIWA 3G9BA 5ECQB 2DIYA 3O3TA 2C1YA 3ERWA 2LJAA 2LRCA 4TXOB 5E4WA 2VLVA 4J57E 1XOBA 1DBYA 4GF0A 1V57A 1T3BA 3G7YA 3IAM2 1W4VA 2CAIA 2VM2A 4EUYA 2JADA 1Z3EA 4PGTA 3TOUA 1SJ6A 3KTBA 2GLRA 4F0CA 1BAYA 2PWJA 1TTZA 1ZZYA 5C04A 1MD4A 1K0MA 3C1SA 3FEUA 4ZB8A 1EP7A 4BWQA 2ES7A 4K8MA 4KDUA 18GSA 4MZCA 2I4AA 3GTUB 1OE8A 1Z6MA 2IMEA 1K3OA 1A24A 3RPPA 3DIEA 2J9HA 3VPQA 2WDUA 1PSQA 5IMVA 2ZNMA 3TJBA 2IFQA 4KH7A 4J56E 5IMZA 3TDGA 2G2QA 4PQHA 1ZMAA 3HKRA 4JRRA 4E8EA 2B5EA 4K6XA 1ON4A 2DJ3A 1QK8A 3CRTA 2O89A 6GSTA 4FYUA 1YJ6A 2FWFA 4JBBA 4Q5RA 2PPTA 3FW2A 2I81A 1RW1A 1TP9A 2GZZA 2R5GA 4OO4A 2EIQA 3M0FA 3IC4A 1VF2A 2R3XA 5JWQB 3HA9A 2N5AA 1GTIA 4L5LA 1MDIA 3IK7A 3F8UA 2WGRA 2HE3A 1A0RP 1VF4A 4HI7A 1U3IA 4WXTA 2L5LA 5FHIA 3TGZA 4G9HA 4IS0A 1EV4A 5DCHA 3EYTA 3ME7A 2X99A 1NM3A 3J7Yb 1M0UA 4QL7A 4ZBBA 4N30A 5HFGA 1EOHA 5G5FA 1GRXA 3EU4A 5E59A 4I8BA 2X8HA 3RBTA 2I3YA 3H4KA 1OC9B 2WULA 4GXZA 1QXHA 2YJ7A 4N10A 1TI1A 5ELGA 4TW5A 3IRAA 4GQCA 4FYCA 2E7PA 5ECOB 4DEJA 1TK8B 2V6OA 5B6MA 4DSQA 2CVBA 5ID2A 3ZIJA 3DVXA 2F51A 4D73B 4MF5A 1WRYA 4IBPA 3CTFA 2P5RA 4NXIA 1C72A 3ZL5A 4YQMA 3IK9A 2FWGA 3K8NA 1Y25A 3EE2A 3QD9A 8GSSA 1G6WA 4OO5A 1M9BA 3BCKA 3CYNA 1YQ1A 2V1MA 3AY8A 2AUVA 3W6GA 3GNJA 3IOSA 2C0GA 3D22A 3C7MA 22GSA 2JZSA 1A2JA 3DD3A 3SWLA 2HXKA 2F8AA 1Q4JA 3D0ZA 1BG5A 1YF0A 4HEA2 1T8EB 3UAPA 2L6DA 2GDRA 4BVXA 5FT3A 3HVVA 1M9AA 3EMPA 3GKKA 4POMA 2FNOA 4GQFA 3IA1A 2O85A 4RI7A 3TKSC 3I69A 2DMLA 4MZBA 1FB6A 3GMFA 2L57A 5AGYA 3UEMA 5G1KA 2E0QA 2A4VA 3VPTA 3KJYA 2MYGA 3Q74A 4XS1A 4ECIA 2I1UA 2BJXA 3EURA 2DJ1A 5HFIA 2DJ2A 4ZBAA 2VO4A 1SU9A 1WPIA 3DEXA 6GSUA 1TRWA 1O85A 1N2AA 1FAAA 5ECLB 4WEYA 3L9SA 2GSRA 1ZCPA 1XW5A 2H1GA 3DVWA 3EINA 2LEGA 1THXA 1H4OA 2H0HA 4IJIA 3VWWA 1U3AA 1B8XA 5DAKA 14GSA 3F4SA 1OC3A 4ZXGA 5CAXA 5IIZA 3LJRA 1X5DA 3ZTLA 3VI7A 5DALB 2ON5A 3GX8A 4DSSB 1GWCA 1O81A 5D9TA 3GV1A 4XIHA 3TJKA 3A2WA 3GUSA 1FO5A 4ZL9A 1BQ7A 2HLSA 4X43A 2EIRA 1K0AA 2EIOA 1JLVA 3MWHA 4POLA 3ZVJD 4TXOA 4NV5A 3IPZA 1ACVA 3WGXA 1PRXA 2H30A 1JZOA 3ERFA 3J7Yk 4TVEA 1G6YA 1FG4A 1PN9A 4K7OA 4YAVA 2K8SA 5F07A 12GSA 5CREA 1ILOA 4KSMA 3FZ5A 2GSTA 3KD0A 3P8WA 3GL5A 2XPEA 3Q19A 5B8AA 3H93A 5D96A 3HZ4A 2V32A 1IYIA 3KMOA 4JZQA 2YPMA 4MZWA 4XS4A 1GULA 1LBKA 3A5WA 3ZREA 4KW6A 4NMUA 2PN8A 1Z5YE 4LMWA 2OJLA 5F0GA 2HRNA 2LRNA 2IIYA 4RI6A 4F2IA 2YWMA 3HHVA 4LL1B 3GTUA 4LA1A 5GSTA 1J0FA 3PINA 3HVSA 4RUVA 3ISOA 2YWNA 4QL9A 2IMKA 1WE0A 2FA4A 2LKUA 2KHPA 3HVXA 2HT9A 3UBLA 4BPYA 4P3YB 5GAPD 3KH9A 3NOFA 2HNLA 5B8BA 3LORA 3APQA 1TXXA 4WF5A 5B6NA 2YOIA 4MF6A 1XWAA 1GUMA 2VL3A 3VURA 2PUKC 3GRXA 4KUNA 3I43A 4AJ8A 1GSFA 2IMDA 1GTBA 1DUGA 3BD2A 1ZYEA 2QC7A 4X0XA 1USBA 3C73A 2B7KA 5HQPA 2AV4A 3L9VA 3KIJA 3FZ9A 2DBCA 2C0FA 2PVOC 4JE1A 4IGJA 1T7PB 1TI3A 2JL4A 1H75A 2OBKA 2PBJA 1R7HA 1SYXA 4WKWA 3RPNA 2H0IA 2H01A 4BL7A 3F3QA 3GHAA 2L6CA 1PA3A 1ERTA 4O32A 1AAZA 2E2MA 2FWHA 1EZKA 2NPBA 2RUEA 2VCQA 1FOVA 5CYYA 1O8WA 3VFIA 3GURA 3R2QA 2CA8A 2F9SA 4EKZA 3KXOA 1V2AA 3KP8A 4AJ6A 4ECJA 1OC9A 3FR9A 5IOXA 9GSSA 1G0TA 1OAZA 1QFNA 4F9ZA 1SKRB 4MJCA 2OBIA 2ON7A 2YZUA 1E6BA 2MMNA 4K7NA 3MSZA 2GZYA 3F9UA 5AIXA 2O87A 2IL3A 1JHBA 3FK8A 4MH3A 3IHQA 4TXVA 1TU8A 4N0ZA 2VLTA 4GRFA 4EF0A 1PQNA 2OE3A 4POKA 1GLQA 4MH2A 2VL2C 4TRXA 3IE3A 1GUHA 1G7OA 3H8QA 3KH7A 4OCEA 3P2AA 2VLUA 3ED3A 3G7IA 4RQXA 3DMLA 1HQOA 3O76A 4N0VA 1O73A 2ALBA 4IVFA 3PGTA 2LS5A 2ZCTA 3JCML 4HU7A 4AF2A 1GTAA 1XW6A 5J5NA 6GSWA 1X9WB 4DSRA 1X5CA 1PL2A 5H5QA 5ECMB 1VF3A 3D4TA 3N5OA 3FR3A 2FHEA 1NHOA 1AW9A 1UVZA 4OFMA 3U5RE 4ZL7A 3CSIA 1GLPA 3P90A 4TOPA 3UBKA 1GH2A 1NHYA 2DLXA 1CQGA 1K3YA 2JSZA 1S3AA 1PD21 1GSEA 2CX3A 4K7IA 3VWVA 3M8NA 1EV9A 3FHKA 3TCOA 2GT6A 3C1RA 4L0UA 3IBHA 2GSSA 3HYPA 1YKAA 5IMFA 5J9BA 6GSXA 2RIIA 3QMXA 1BYEA 3UVTA 3QAVA 1M99A 3C71A 2B1LA 1SL0B 2VD1A 4GLTA 3LFLA 2JACA 2TRCP 5FWGA 2J23A 3GSTA 10GSA 2EC4A 4MPFA 4N11A 5DALA 1U6TA 1YEXA 4DSSA 2KP2A 4KB3A 5G1LA 5B7CA 1SJZA 1VF1A 1XCCA 3KM6A 1X5EA 5HR2A 3KMNA 1F37A 5CRHA 4TR3A 2K6VA 1AQXA 4ZL8A 1YF1A 5KEJA 5J3RA 1AIUA 2B5YA 1R26A 4JU5A 1GP1A 2L5OA 2VAFA 2IMFA 2C0EA 3QAGA 1OKDA 4KCEA 2P0GA 4MABA 4O7HA 5J41A 1XZOA 2K18A 3M9KA 5H5RA 4EVMA 2A2RA 3HJMA 4EL1A 3CSJA 1EOGA 2OE0A 1SJIA 2RLIA 2H73A 2DJ0A 2VM1A 1OVNA 1X9MB 4NWYA 5DBQA 3VWUA 3IAS2 2E2GA 4I5QA 1O8XA 3ZMLA 1WOUA 4DVCA 3LXZA 1B9YC 5IMDA 2H76A 2JU5A 1ZOFA 2JZTA 5IMCA 2DSAA 4MA9A 4MPGA 3A2XA 1OKTA 2PVQA 3ERGA 4F82A 5J9CA 4PQ1A 3WYWA 4LLRA 3VI5A 3VWXA 3FR6A 1M2BA 4MK3A 2GT5A 2IFQB 2HSYA 1CQHA 1F3AA 1K0CA 4RQRA 3F4RA 5ENUA 2LQOA 3DGQA 3ZFLA 4KAEA 5DJLA 2VCVA 2C3QA 1SYRA 1A8LA 3QFBC 3LWAA 4V2LA 1JZDA 3KZQA 3LQ7A 2VCWA 5AIVA 4KDYA 1SKWB 4CW9A 4PXOA 4PUFC 5JCUA 1QQ2A 1T4YA 4LL4B 4XCSA 2OADA 3F3RA 4GTUA 5IM9A 3GIXA 3HD5A 4KX4A 2CT6A 5HFKA 1T4ZA 4TR1B 1QMVA 4BWSA 2H70A 4HJMA 1U87A 1QGVA 1URMA 1XOAA 4ZIJA 1NSWA 2XPDA 3L78A 1Y6EA 3ZITA 3BOAA 2P5QA 4ZB9A 3I9V2 3TJFA 5ECHB 4V1Ag 4K9ZA 4L5OA 3G7JA 4MJAA 1MDKA 2O8VB 1GSUA 3CBUA 4HQSA 2LQQA 1JLWA 5H5SA 2X8GA 1KNGA 4PQIA 5HR0A 2FUG2 3IR4A 2DJKA 3Q18A 4G2EA 3TRXA 2YJHA 4PURA 5DQYA 1EEJA 3L4NA 2L4CA 1KBNA 5F05A 1Z7PA 3QAWA 2HYXA 3UVHA 1M2DA 3N9JA 3HY2A 5ECNB 3CTGA 5CRWA 1EP8A 1OYJA 3NIVA 3TOTA 3W8JA 4OCFA 2RUFA 4AGSA 3EMXA 2H1AA 5D9WA 1TU7A 4HZ2A 1HYUA 4MDCA 2GVPA 2CQ9A 3EVIA 3L9UA 3VK9A 4ID0A 1F3BA 2L59A 1F9MA 1U88A 2XBIA 4YAPA 2CVDA 2HZEB 2A2SA 5COHA 3ZZXA 3FYGA 3EC3A 2X8CA 4EDYA 1B9XC 3L0HA 1YY7A 1EEMA 4ILFA 3UJ1A 4EE0A 2GSQA 4K0NA 2Z9SA 2F3MA 4IN0A 1SL1B 1S3DA 5KN3A 2NBSA 6GSSA 2KP1A 1UN2A 4TR0A 3FZAA 2FY6A 5C00A 1F2EA 4I6XA 1YDKA 3RDWA 1MDJA 1SK2A 4I97A 5GAND 2HZFA 2YNXA 1SL2B 1A23A 4EC0A 4ULXA 2KLXA 1SD9A 1BEDA 5AISA 4I2TA 3APOA 5EL8A 4F0BA 4NV2A 1TW9A 4ZB6A 1VGLA 4ZBDA 5G2ZA 2O7KA 5HR1A 2TIRA 1SENA 3GKMA 1A8YA 3TKQA 2H71A 1OE7A 5IQYA 1PX7A 2NDOA 3BCIA 1G7EA 4Q5FA 4ISDA 2YWOA 3I6AA 5EY6A 5IPGA 3UMAA 3HJOA 2LNSA 1GL8A 3E0UA 5G30A 3US3A 4KGIA 3GH6A 2C0DA 1TOFA 1GSDA 1UC7A 2C3TA 2M72A 2R6KA 1AUCA 4KE3A 3CMIA 3DWVA 2DC5A 4E8HA 3TUEA 4I2UA 3QR6A 5IPHA 5DCGA 4FIWA 2M80A 4ML6A 2AHEA 3KCMA 3D6IA 4OFNA 3DKSA 4AJ7A 3HZ8A 2GQMA 4HDEA 4D73A 2LSTA 1WMJA 4HS1A 5IO0A 5JCWA 2H74A 1KTEA 4OMVA 2MMOA 1BJXA 1YEPA 1Z6NA 2CZ3A 2VCXA 4ECCA 2WB9A 4CHSA 2LTKA 5EPFA 1XW9A 20GSA 1A2LA 3F4TA 4LMVA 1GSQA 4OWYA 5F06A 4IELA 5A4VA 3KEBA 4MLYA 2MBTA 2WJUA 2YP6A 3NZNA 2VCZA 5CNWA 4MJBA 3PH9A 1B48A 1ST9A 3F63A 2WCIA 3VLNA 3RHBA 2H66A 1IYHA 3V1WA 4XS4B 4HOJA 4XRAA 3ZFBA 1T1VA 1VRSD 4POBA 4HU9A 2B7JA 2GZPA 1HNBA 3IXRA 4PNGA 5GSSA 1N8JA 3TKSE 2IN3A 5LD0A 4L8EA 5KN0A 4NHZA 1XFLA 2D2ZA 4G19A 2R37A 1EWXA 2CX4A 1K0NA 4EO3A 5G5EA 4TN8A 1J08A 4PX1A 1V98A 1LJRA 2CV4A 4NAXA 2GGTA 5ECRB 1MEKA 2HFDA 4ACSA 2VOCA 1V58A 1FHEA 4MP4A 2GQLA 1FVKA 2PU9C 1TK0B 4JEDA 5IOWA 2GQKA 4K1FA 5F8BA 5D93A 4WBRD 5LNKe 2RM6A 2G0FA 4IW9A 3LYPA 4KDXA 4BA7A 1TRUA 3GN3A 2IPAA 4WBJA 1EGRA 1KEBA 4YQVA 2VL9A 2B6MA 2CVKA 5AN1A 5ECIB 2IWTA 5LCZA 2CAQA 1M2AA 1T00A 2X64A 2YV9A 13GSA 1I5GA 1MTCA 3E3EA 3MAKA 5CRDA 3DYRA 1PX6A 2OACA 3QFAC 4V2NA 1I9DA 4ML1A 4IP6A 3GL3A 3IDVA 2HI7A 3LXTA 4O92A 1RK4A 3EU3A 3ZIVA 4TR1A 4V1Ap 2HRFA 4WETA 1O6JA 2AJQB 2XHFA 3QCPA 3FY7A 3OR5A 3M3MA 2IMIA 3APSA 1ERWA 1XVQA 5KN2A 4ZILA 11GSA 3GSSA 4IKHA 5ABRA 3FKFA 3MNGA 2P31A 5DQSA 5JWRB 2C3NA 5GZZB 4NHWA 1X0RA 5DJMA 2QGVA 2JSYA 3WT1A 3ZRDA 1F6MC 1SD8A 5INYA 4J2FA 5J4UA 4Q5NA 1GNEA 6GSYA 3PR8A 4K0GA 2XC2A 4O5RA 5ELAA 2WZ9A 2FD3A 3GKXA 4G10A 5D73A 4KA0A 3GH9A 2QSIA 3TKSA 4WF4A 1V40A 3LGCA 2YWIA 4TKYA 3U6VA 3WGDA 2LUSA 3D5JA 1ZYQB 1GSYA 1R5PA 2GTUA 4HZ4A 2C80A 1WP0A 1DE2A 1ERUA 3TRQA 1ERVA 5DVBA 1AXDA 6GSVA 4IP1A 2H75A 4JR6A 5ECSA 1A0FA 2WFCA 3GA4A 1ML6A 2FWEA 4XTSA 3ZVJA 5JWOB 1A2MA 2H6XA 1Q98A 4WR5A 1GUKA 2R2JA 2YANA 1B4QA 2JZRA 2FA8A 1Z9HA 2H6YA 5ECPB 2HZEA 1J9BA 3HCZA 2LNTA 2XBQA 2YV7A 5D8IA 2PERA 4K2DA 1PKWA 2KOKA 3F6FA 2LJKA 1E2YA 2V2GA 1SK1A 1WJKA 1FW1A 4PNFA 3M1GA 3CSHA 3CXGA 3ZYWA 1WIKA 2H8LA 3LSZA 3TKPA 2R4VA 4PUAA 2KUCA 1X9SB 1ZL9A 4MMMA 4Q5QA 5EVOA 1B4PA 3UOMA 3F6DA 2B1KA 3GYKA 4X1UA 4KCAA 5G31A 3RHCA 2L4QA 1TRSA 2WS2A 1K3LA 1K0DA 2FGXA 1O7UA 3O6TA 2OKAA 4Z7XA 2PMTA 3KTLA 3QPMA 1V9WA 2WRTA 2H72A 1RQMA 3CRUA 2VCTA 1TRVA 2DIZA 4FH8A 3M9JA 1LU4A 2B3SA 5D9VA 5ECKB 3GFKA 3A2VA 1XBSA 4XHMA 2VIMA 1QUWA 2LRTA 2I9HA 3LEFA 2K9FA 3H1NA 1TDIA 3UARA 3TJJA 1Z7RA 1XXUA 1AC1A 4EXJA 1XWBA 3EWLA 3W8SA 4IQAA 4GSSA 4HQZA 2NTOA 2K8VA 2REMA 4HJ2A 4FYBA 4MF7A 3DXBA 3KP9A 5IMAA 3SBCA 2OA7A 1SKSB 5D9XA 5CRGA 1FB0A 1WWJA 2AB6A 4L0WA 3A3TA 3QOUA 2N5BA 1HNAA 1S3CA 1PL1A 2VUPA 2ZUPA 4V2MA 2MBSA 3KGKA 5ID2B 1YKCA 4WR4A 3C8EA 1OC8A 2H19A 4TR4A 4GSNA 7GSSA 1PGTA 1GSSA 3E9JB 2BTOT 2N5FA 2CZ2A 1YZXA 3F0IA 2H6ZA 3FZ4A 4ECBA 1TJDA 2V41A 4IJ3A 3HJPA 4NPBA 3GX0A 3RAZA 5A4WA 2MZCA 1GNWA 1JZRA 3D4MA 5CO3A 3WT2A 1SK0A 2YCDA 4KSOA 1XVWA 2QKEA 4BVYA 1NW2A 4GSTA 3HDCA 5JCGA 3ZMKA 4YH2A 4IHUA 2LJRA 1DSBA 5CP1A 5HR3A 3TKRA 3LYKA 2DJJA 3Q6OA 2MMAA 2AAWA 3DRNA 2HSHA 3D21A 3WD6A 4MCUA 1GTUA 2VD0A 2V6KA 3WGEA 1TKDB 4MJEA 2H0GA 4F03A 2TRXA 4GCIA 2YZHA 1EGOA 2OE1A 2PGTA 1M7TA 1XWCA 2H1DA
chains in the Genus database with same CATH superfamily
3TB2A 1JZWA 3IV4A 1AQVA 2RM5A 2FCHA 3BJ5A 3ZLPA 3TRPA 2NVLA 2FLSA 3QDNA 3TJGA 4G0LA 3FRCA 3GKNA 4QQ7A 2C8UA 4XS6A 4YQUA 1R4WA 5IO2A 4OD7A 1ABAA 2MMZA 4KNDA 2LV3A 4H86A 2M46A 2YN1A 2IJYA 4XRDA 2BMXA 1XPVA 3ME8A 5A5KA 4EDZA 3P7XA 1K0BA 2UZ8A 2C4JA 1ZGNA 4FO5A 4HUAA 1JFUA 4CDOA 1TK5B 17GSA 1THOA 4JR4A 1DE1A 3BBYA 2AYTA 3UL3A 1FVJA 19GSA 1MD3A 1XWGA 1K0OA 1XIYA 2F8FA 2GS3A 3EPTA 3HXSA 4IQ1A 1W89A 5L71A 2VL2A 1AQWA 4OFTA 1R5AA 1HNCA 2H1BA 4GWRA 3H79A 16GSA 3MDKA 1PKZA 1PMTA 2B5XA 5DAKB 1XWKA 2HSMA 5A4UA 1BX9A 2R0CA 3HVNA 5KN1A 3LG6A 2X49A 1HD2A 2DMMA 3S9FA 5DDLA 1UA5A 3UIWA 3G9BA 5ECQB 2DIYA 3O3TA 2C1YA 3ERWA 2LJAA 2LRCA 4TXOB 5E4WA 2VLVA 4J57E 1XOBA 1DBYA 4GF0A 1V57A 1T3BA 3G7YA 3IAM2 1W4VA 2CAIA 2VM2A 4EUYA 2JADA 1FOHA 1Z3EA 4PGTA 3TOUA 1SJ6A 3KTBA 2GLRA 4F0CA 4X4JA 1BAYA 2PWJA 1TTZA 1ZZYA 5C04A 1MD4A 1K0MA 3C1SA 3FEUA 4ZB8A 1EP7A 4BWQA 2ES7A 4K8MA 4KDUA 18GSA 4MZCA 2I4AA 3GTUB 1OE8A 1Z6MA 2IMEA 1K3OA 1A24A 3RPPA 3DIEA 2J9HA 3VPQA 2WDUA 1PSQA 5IMVA 2ZNMA 3TJBA 2IFQA 4KH7A 4J56E 5IMZA 3TDGA 2G2QA 4PQHA 1ZMAA 3HKRA 3MIXA 4JRRA 4E8EA 2B5EA 4K6XA 1ON4A 2DJ3A 1QK8A 3CRTA 2O89A 6GSTA 4FYUA 1YJ6A 2FWFA 4JBBA 4Q5RA 2PPTA 3FW2A 2I81A 1RW1A 1TP9A 2GZZA 2R5GA 4OO4A 2EIQA 3M0FA 3IC4A 1VF2A 2R3XA 5JWQB 3HA9A 2N5AA 1GTIA 4L5LA 1MDIA 3IK7A 3F8UA 2WGRA 2HE3A 1A0RP 1VF4A 4HI7A 1U3IA 4WXTA 2L5LA 4BL7B 4FQUA 5FHIA 3TGZA 3FMWA 4G9HA 4IS0A 1EV4A 5DCHA 3EYTA 3ME7A 2HRKA 2X99A 1NM3A 3J7Yb 1M0UA 4QL7A 4ZBBA 4N30A 5HFGA 1EOHA 5G5FA 1GRXA 3EU4A 5E59A 4I8BA 2X8HA 3RBTA 2I3YA 3H4KA 1OC9B 2WULA 4GXZA 1QXHA 2YJ7A 4N10A 1TI1A 5ELGA 4TW5A 3IRAA 4GQCA 4FYCA 2E7PA 5ECOB 4DEJA 1TK8B 2V6OA 5B6MA 4DSQA 2CVBA 5ID2A 3ZIJA 3DVXA 2F51A 4D73B 4MF5A 1WRYA 4IBPA 3CTFA 2P5RA 4NXIA 1C72A 3ZL5A 4YQMA 3IK9A 2FWGA 3K8NA 1Y25A 3EE2A 3QD9A 8GSSA 1G6WA 4OO5A 1M9BA 3BCKA 3CYNA 2QA2A 1YQ1A 2V1MA 3AY8A 2AUVA 3W6GA 3GNJA 3IOSA 2C0GA 3D22A 3C7MA 22GSA 2JZSA 1A2JA 4KF9A 3DD3A 3SWLA 2HXKA 2F8AA 1Q4JA 3D0ZA 1BG5A 1YF0A 4HEA2 1T8EB 3UAPA 2L6DA 2DKIA 1M3JA 2GDRA 4BVXA 5FT3A 3HVVA 1M9AA 3EMPA 3GKKA 4POMA 2FNOA 4GQFA 3IA1A 4K5SA 2O85A 4RI7A 3TKSC 3I69A 2DMLA 4MZBA 1FB6A 3GMFA 2L57A 5AGYA 3UEMA 5G1KA 2E0QA 2A4VA 3VPTA 3KJYA 2MYGA 3Q74A 4XS1A 4ECIA 2I1UA 2BJXA 3EURA 2DJ1A 5HFIA 2DJ2A 4ZBAA 2VO4A 1SU9A 1WPIA 3DEXA 6GSUA 1TRWA 1O85A 1N2AA 1FAAA 5ECLB 4CY8A 4WEYA 3L9SA 2GSRA 1ZCPA 1XW5A 2H1GA 3DVWA 3EINA 2LEGA 1THXA 1H4OA 2H0HA 4IJIA 3VWWA 1U3AA 1B8XA 5DAKA 14GSA 3F4SA 1OC3A 4ZXGA 5CAXA 5IIZA 3LJRA 1X5DA 3ZTLA 3VI7A 5DALB 2ON5A 3GX8A 4DSSB 1GWCA 1O81A 5D9TA 3GV1A 4XIHA 3TJKA 3A2WA 3GUSA 1FO5A 4ZL9A 1BQ7A 2HLSA 4X43A 2EIRA 1K0AA 2EIOA 3MYDA 1JLVA 3MWHA 4POLA 3ZVJD 4TXOA 4K5RA 3IPZA 4NV5A 1ACVA 3WGXA 1PRXA 2H30A 1JZOA 3ERFA 3J7Yk 4TVEA 1G6YA 1FG4A 1PN9A 4K7OA 4YAVA 2K8SA 5F07A 12GSA 5CREA 1ILOA 4KSMA 3FZ5A 2GSTA 3KD0A 3P8WA 3GL5A 2XPEA 3Q19A 5B8AA 3H93A 5D96A 3HZ4A 2V32A 1IYIA 3KMOA 4JZQA 2YPMA 4MZWA 4XS4A 1GULA 1LBKA 3A5WA 3ZREA 4KW6A 4NMUA 2PN8A 1Z5YE 4LMWA 2OJLA 5F0GA 2HRNA 2LRNA 2IIYA 4RI6A 4F2IA 2YWMA 3HHVA 4LL1B 3GTUA 4Z2TA 4LA1A 5GSTA 1J0FA 3PINA 3HVSA 4RUVA 3ISOA 2YWNA 4QL9A 2IMKA 1WE0A 2FA4A 2LKUA 2KHPA 3HVXA 2HT9A 3UBLA 4BPYA 4P3YB 5GAPD 3KH9A 3NOFA 2HNLA 5B8BA 3LORA 3APQA 1TXXA 4WF5A 5B6NA 2YOIA 4MF6A 1XWAA 1GUMA 2VL3A 4G0IA 3VURA 2PUKC 3GRXA 4KUNA 3I43A 4CY6A 2DKHA 4AJ8A 1GSFA 2IMDA 1GTBA 1DUGA 3BD2A 1ZYEA 2QC7A 4X0XA 1USBA 3C73A 2B7KA 5HQPA 2AV4A 3L9VA 3KIJA 3FZ9A 2DBCA 2C0FA 2PVOC 4JE1A 4IGJA 1T7PB 1TI3A 2JL4A 1H75A 2OBKA 2PBJA 1R7HA 1SYXA 4WKWA 3RPNA 2H0IA 1PFOA 2H01A 4BL7A 3F3QA 3GHAA 2L6CA 1PA3A 1ERTA 4O32A 1AAZA 2E2MA 2FWHA 1EZKA 2NPBA 2RUEA 2VCQA 1FOVA 5CYYA 1O8WA 3VFIA 3GURA 3R2QA 2CA8A 2F9SA 4EKZA 3KXOA 1V2AA 3KP8A 4AJ6A 4ECJA 1OC9A 3FR9A 5IOXA 9GSSA 1G0TA 1OAZA 1QFNA 4F9ZA 3IC8A 1SKRB 4YKGA 4MJCA 2OBIA 2ON7A 2YZUA 1E6BA 2MMNA 4K7NA 3MSZA 2GZYA 3F9UA 5AIXA 2O87A 2IL3A 1JHBA 3FK8A 4MH3A 3IHQA 4TXVA 1TU8A 4N0ZA 2VLTA 4GRFA 4EF0A 1PQNA 2OE3A 4POKA 1GLQA 4MH2A 2VL2C 4TRXA 3IE3A 1GUHA 1G7OA 3H8QA 3KH7A 4OCEA 3P2AA 2VLUA 3ED3A 3G7IA 4RQXA 3DMLA 1HQOA 3O76A 4N0VA 1O73A 2ALBA 4IVFA 3PGTA 2QA1A 2LS5A 2ZCTA 3JCML 4HU7A 5BMUA 4AF2A 1GTAA 1XW6A 5J5NA 6GSWA 1X9WB 4DSRA 1X5CA 1PL2A 5H5QA 5ECMB 1PN0A 1VF3A 3D4TA 3N5OA 3FR3A 2FHEA 1NHOA 1AW9A 1UVZA 4OFMA 3U5RE 4ZL7A 1M3IA 5KOWA 3CSIA 1GLPA 3P90A 4TOPA 3UBKA 1GH2A 1NHYA 2DLXA 1CQGA 1K3YA 1S3RA 2JSZA 1S3AA 1PD21 1GSEA 2CX3A 4K7IA 3VWVA 3M8NA 1ZYPA 1EV9A 3FHKA 3TCOA 2GT6A 3C1RA 4L0UA 3IBHA 2GSSA 3HYPA 1YKAA 5IMFA 5J9BA 6GSXA 2RIIA 3QMXA 1BYEA 2A4HA 3UVTA 3QAVA 1M99A 3C71A 2B1LA 1SL0B 2VD1A 4GLTA 3LFLA 2JACA 2TRCP 5FWGA 2J23A 3GSTA 10GSA 2EC4A 4MPFA 4N11A 5DALA 1U6TA 1YEXA 4DSSA 2KP2A 4KB3A 4ICYA 5G1LA 2HRAA 5B7CA 1SJZA 1VF1A 1XCCA 3KM6A 1X5EA 5HR2A 3KMNA 1F37A 2R0GA 5CRHA 4TR3A 2K6VA 1AQXA 4ZL8A 1YF1A 5KEJA 5J3RA 1AIUA 2B5YA 1R26A 4JU5A 1GP1A 2L5OA 2VAFA 2IMFA 2C0EA 3QAGA 1OKDA 4KCEA 2P0GA 4MABA 4K2XA 4O7HA 5J41A 4O5QA 1XZOA 2K18A 3M9KA 5H5RA 4EVMA 2A2RA 3HJMA 4EL1A 3CSJA 1EOGA 2OE0A 1SJIA 2RLIA 2H73A 2DJ0A 2VM1A 1OVNA 1X9MB 4NWYA 5DBQA 3VWUA 3IAS2 2E2GA 4I5QA 1O8XA 3ZMLA 1WOUA 4DVCA 3LXZA 1B9YC 5IMDA 2H76A 2JU5A 1ZOFA 2JZTA 5IMCA 2DSAA 4MA9A 4MPGA 3A2XA 1OKTA 2PVQA 3ERGA 4F82A 5J9CA 4PQ1A 3WYWA 4LLRA 3VI5A 3VWXA 3FR6A 1M2BA 4MK3A 2GT5A 2IFQB 2HSYA 1CQHA 1F3AA 1K0CA 4RQRA 3F4RA 5ENUA 2LQOA 3DGQA 3ZFLA 4KAEA 5DJLA 2VCVA 2C3QA 1SYRA 1A8LA 3QFBC 4Z2RA 3LWAA 4V2LA 1JZDA 3KZQA 3LQ7A 2VCWA 5AIVA 4KDYA 1SKWB 4CW9A 4HSCX 4PXOA 4PUFC 5JCUA 1QQ2A 1T4YA 4LL4B 4XCSA 2OADA 3F3RA 4GTUA 5IM9A 3GIXA 3HD5A 4KX4A 2CT6A 5HFKA 1T4ZA 4TR1B 1QMVA 4BWSA 2H70A 4HJMA 1U87A 1QGVA 1URMA 1XOAA 4ZIJA 1NSWA 2XPDA 3L78A 1Y6EA 3ZITA 3BOAA 2P5QA 4ZB9A 3I9V2 3TJFA 5BRTA 5ECHB 4V1Ag 4K9ZA 4L5OA 3G7JA 4MJAA 1MDKA 2O8VB 1GSUA 3CBUA 4HQSA 2LQQA 1JLWA 5H5SA 2X8GA 1KNGA 4PQIA 5HR0A 2FUG2 3IR4A 2DJKA 3Q18A 4G2EA 3TRXA 2YJHA 4PURA 5DQYA 1EEJA 3L4NA 2L4CA 1KBNA 5F05A 1Z7PA 3QAWA 2HYXA 3UVHA 1M2DA 3N9JA 3HY2A 5ECNB 1XG8A 3CTGA 5CRWA 1EP8A 1OYJA 2A2PA 3NIVA 3TOTA 3W8JA 4OCFA 2RUFA 4AGSA 3EMXA 2H1AA 5D9WA 4A5PA 1TU7A 4HZ2A 1HYUA 4MDCA 2GVPA 2CQ9A 3EVIA 3L9UA 3VK9A 4ID0A 1F3BA 2L59A 1F9MA 1U88A 2XBIA 4YAPA 2CVDA 2HZEB 2A2SA 5COHA 3ZZXA 3FYGA 3EC3A 2X8CA 4EDYA 1B9XC 3L0HA 1YY7A 1EEMA 4ILFA 3UJ1A 4EE0A 2GSQA 4K0NA 2Z9SA 2F3MA 4IN0A 1SL1B 1S3DA 5KN3A 2NBSA 6GSSA 2KP1A 1UN2A 4TR0A 3FZAA 2FY6A 5C00A 1F2EA 4I6XA 1YDKA 3RDWA 1MDJA 1SK2A 4I97A 5GAND 2HZFA 2YNXA 1SL2B 1A23A 4EC0A 4ULXA 2KLXA 1SD9A 1BEDA 5AISA 4I2TA 3APOA 5EL8A 4F0BA 4NV2A 1TW9A 4ZB6A 4EIQA 1VGLA 4ZBDA 5G2ZA 2O7KA 5HR1A 2TIRA 1SENA 3GKMA 1A8YA 3TKQA 2H71A 1OE7A 5IQYA 1PX7A 2NDOA 3BCIA 1G7EA 4Q5FA 4ISDA 2YWOA 3I6AA 5EY6A 5IPGA 3UMAA 3HJOA 2LNSA 1GL8A 3E0UA 5G30A 3US3A 4KGIA 3GH6A 2C0DA 1TOFA 1GSDA 1UC7A 2C3TA 2M72A 2R6KA 1AUCA 4KE3A 3CMIA 3DWVA 2DC5A 4E8HA 3TUEA 4I2UA 4BIKA 3QR6A 5IPHA 5DCGA 4FIWA 2M80A 4ML6A 2AHEA 3KCMA 3D6IA 3PPUA 4OFNA 3DKSA 4AJ7A 3HZ8A 2GQMA 4HDEA 4D73A 2LSTA 1WMJA 4HS1A 4G0KA 5IO0A 5JCWA 2H74A 1KTEA 4OMVA 2MMOA 1BJXA 1YEPA 1Z6NA 2CZ3A 2VCXA 4ECCA 2WB9A 4CHSA 2LTKA 5EPFA 1XW9A 20GSA 1A2LA 3F4TA 4LMVA 1GSQA 4OWYA 5F06A 4IELA 5A4VA 3KEBA 4MLYA 2MBTA 2WJUA 2YP6A 3NZNA 2VCZA 5CNWA 4MJBA 3PH9A 1B48A 1ST9A 3F63A 2WCIA 3VLNA 3RHBA 3LW9A 2H66A 1IYHA 3V1WA 4XS4B 4HOJA 4XRAA 3ZFBA 1T1VA 4EIPA 1VRSD 4POBA 4HU9A 2B7JA 2GZPA 1HNBA 4BVYB 3IXRA 4PNGA 5GSSA 1N8JA 3TKSE 2IN3A 5LD0A 4L8EA 5KN0A 4NHZA 1XFLA 2D2ZA 4G19A 2R37A 1EWXA 4PTSA 2CX4A 1K0NA 4EO3A 5G5EA 4TN8A 1J08A 4YKFA 4PX1A 1V98A 1LJRA 4USSA 2CV4A 4NAXA 2GGTA 5ECRB 1MEKA 2HFDA 4ACSA 2VOCA 1V58A 1FHEA 4MP4A 2GQLA 1FVKA 2PU9C 1TK0B 4JEDA 4O5UA 5IOWA 2GQKA 4K1FA 5F8BA 5D93A 4WBRD 5LNKe 2RM6A 2G0FA 4IW9A 3LYPA 4KDXA 4BA7A 1TRUA 3GN3A 2IPAA 4WBJA 1EGRA 1KEBA 4YQVA 2VL9A 2B6MA 2CVKA 5AN1A 5ECIB 2IWTA 5LCZA 2CAQA 1M2AA 1T00A 2X64A 2YV9A 13GSA 1I5GA 1MTCA 3E3EA 3MAKA 5CRDA 3DYRA 1PX6A 2OACA 3QFAC 4V2NA 1I9DA 4ML1A 4IP6A 3GL3A 3IDVA 2HI7A 3LXTA 4O92A 1RK4A 3EU3A 3ZIVA 4TR1A 4V1Ap 2HRFA 4WETA 1O6JA 2AJQB 2XHFA 3QCPA 3FY7A 3OR5A 3M3MA 2IMIA 3APSA 1ERWA 1XVQA 5KN2A 4ZILA 11GSA 3GSSA 4IKHA 5ABRA 3FKFA 3MNGA 2P31A 5DQSA 5JWRB 2C3NA 5GZZB 4NHWA 1X0RA 5DJMA 2QGVA 2JSYA 3WT1A 3ZRDA 1F6MC 1SD8A 5INYA 2X4AA 4J2FA 5J4UA 4Q5NA 1GNEA 6GSYA 3PR8A 4K0GA 2XC2A 4O5RA 5ELAA 2WZ9A 2FD3A 3GKXA 4G10A 5D73A 4KA0A 3GH9A 2QSIA 3TKSA 4WF4A 1V40A 3LGCA 2YWIA 4TKYA 3U6VA 3WGDA 2LUSA 3D5JA 1ZYQB 1GSYA 1R5PA 2GTUA 4HZ4A 2C80A 1WP0A 1DE2A 1ERUA 3TRQA 1ERVA 5DVBA 1AXDA 6GSVA 4IP1A 2H75A 2R0PA 4JR6A 5ECSA 1A0FA 2WFCA 3GA4A 1ML6A 2FWEA 4XTSA 3ZVJA 1ZYNA 5JWOB 1A2MA 2H6XA 1Q98A 4WR5A 1GUKA 2R2JA 2YANA 1B4QA 2JZRA 2FA8A 1Z9HA 2H6YA 5ECPB 2HZEA 1J9BA 3HCZA 2LNTA 2XBQA 2YV7A 5D8IA 2PERA 4K2DA 1PKWA 2KOKA 3F6FA 2LJKA 1E2YA 2V2GA 1SK1A 1WJKA 1FW1A 4PNFA 3M1GA 3CSHA 3CXGA 3ZYWA 1WIKA 2H8LA 3LSZA 3TKPA 2R4VA 4PUAA 2KUCA 1X9SB 1ZL9A 4MMMA 4Q5QA 5EVOA 1B4PA 3R3EA 3UOMA 3F6DA 2B1KA 3GYKA 4X1UA 4KCAA 5G31A 3RHCA 2L4QA 1TRSA 2WS2A 3A5IA 1K3LA 1K0DA 2FGXA 1O7UA 3O6TA 2OKAA 4Z7XA 2PMTA 3KTLA 3QPMA 1V9WA 2WRTA 2H72A 1RQMA 3CRUA 2VCTA 1TRVA 2DIZA 4FH8A 3M9JA 1LU4A 2B3SA 5D9VA 5ECKB 3GFKA 3A2VA 1XBSA 4XHMA 2VIMA 1QUWA 2LRTA 2I9HA 3LEFA 2K9FA 3H1NA 3IHGA 1TDIA 3UARA 3TJJA 1Z7RA 1XXUA 1AC1A 4EXJA 1XWBA 3EWLA 3W8SA 4IQAA 4GSSA 4HQZA 2NTOA 2K8VA 2REMA 4HJ2A 4FYBA 4MF7A 3DXBA 4Z2UA 3KP9A 5IMAA 3SBCA 3CQFA 2OA7A 1SKSB 5D9XA 5CRGA 1FB0A 1WWJA 2AB6A 4L0WA 3A3TA 3QOUA 2N5BA 1HNAA 1S3CA 1PL1A 2VUPA 2ZUPA 4V2MA 2MBSA 3KGKA 5ID2B 1YKCA 4WR4A 3C8EA 1OC8A 2H19A 4TR4A 4GSNA 7GSSA 5KOXA 1PGTA 1GSSA 3E9JB 2BTOT 2N5FA 4MNNA 2CZ2A 1YZXA 3F0IA 2H6ZA 3FZ4A 4ECBA 1TJDA 2V41A 4IJ3A 3HJPA 4NPBA 3GX0A 3RAZA 5A4WA 2MZCA 1GNWA 1JZRA 3D4MA 5CO3A 3WT2A 1SK0A 2YCDA 4KSOA 1XVWA 2QKEA 4BVYA 1NW2A 4GSTA 3HDCA 5JCGA 3ZMKA 4YH2A 4IHUA 2LJRA 1DSBA 5CP1A 5HR3A 3TKRA 3LYKA 2DJJA 3Q6OA 2MMAA 2AAWA 3DRNA 2HSHA 3D21A 3WD6A 4MCUA 1GTUA 2VD0A 2V6KA 3WGEA 1TKDB 4BVXB 4MJEA 2H0GA 4F03A 2TRXA 4GCIA 2YZHA 1EGOA 2OE1A 2PGTA 1M7TA 1XWCA 2H1DA
chains in the Genus database with same CATH topology
3TB2A 1JZWA 3IV4A 1AQVA 2RM5A 2FCHA 3BJ5A 3ZLPA 3TRPA 2NVLA 2FLSA 3QDNA 3TJGA 4G0LA 3FRCA 3GKNA 4QQ7A 2C8UA 4XS6A 4YQUA 1R4WA 5IO2A 4OD7A 1ABAA 2MMZA 4KNDA 2LV3A 4H86A 2M46A 2YN1A 2IJYA 4XRDA 2BMXA 1XPVA 3ME8A 5A5KA 4EDZA 3P7XA 1K0BA 2UZ8A 2C4JA 1ZGNA 4FO5A 4HUAA 1JFUA 4CDOA 1TK5B 17GSA 1THOA 4JR4A 1DE1A 3BBYA 2AYTA 3UL3A 1FVJA 19GSA 1MD3A 1XWGA 1K0OA 1XIYA 2F8FA 2GS3A 3EPTA 3HXSA 4IQ1A 1W89A 5L71A 2VL2A 1AQWA 4OFTA 1R5AA 1HNCA 2H1BA 4GWRA 3H79A 16GSA 3MDKA 1PKZA 1PMTA 2B5XA 5DAKB 1XWKA 2HSMA 5A4UA 1BX9A 2R0CA 5KN1A 3LG6A 2X49A 1HD2A 2DMMA 3S9FA 5DDLA 1UA5A 3UIWA 3G9BA 5ECQB 2DIYA 3O3TA 2C1YA 3ERWA 2LJAA 2LRCA 4TXOB 5E4WA 2VLVA 4J57E 1XOBA 1DBYA 4GF0A 1V57A 1T3BA 3G7YA 3IAM2 1W4VA 2CAIA 2VM2A 4EUYA 2JADA 1FOHA 1Z3EA 4PGTA 3TOUA 1SJ6A 3KTBA 2GLRA 4F0CA 4X4JA 1BAYA 2PWJA 1TTZA 1ZZYA 5C04A 1MD4A 1K0MA 3C1SA 3FEUA 4ZB8A 1EP7A 4BWQA 2ES7A 4K8MA 4KDUA 18GSA 4MZCA 2I4AA 3GTUB 1OE8A 1Z6MA 2IMEA 1K3OA 1A24A 3RPPA 3DIEA 2J9HA 3VPQA 2WDUA 1PSQA 5IMVA 2ZNMA 3TJBA 2IFQA 4KH7A 4J56E 5IMZA 3TDGA 2G2QA 4PQHA 1ZMAA 3HKRA 3MIXA 4JRRA 4E8EA 2B5EA 4K6XA 1ON4A 2DJ3A 1QK8A 3CRTA 2O89A 6GSTA 4FYUA 1YJ6A 2FWFA 4JBBA 4Q5RA 2PPTA 3FW2A 2I81A 1RW1A 1TP9A 2GZZA 2R5GA 4OO4A 2EIQA 3M0FA 3IC4A 1VF2A 2R3XA 5JWQB 3HA9A 2N5AA 1GTIA 4L5LA 1MDIA 3IK7A 3F8UA 2WGRA 2HE3A 1A0RP 1VF4A 4HI7A 1U3IA 4WXTA 2L5LA 4BL7B 4FQUA 5FHIA 3TGZA 3FMWA 4G9HA 4IS0A 1EV4A 5DCHA 3EYTA 3ME7A 2HRKA 2X99A 1NM3A 3J7Yb 1M0UA 4QL7A 4ZBBA 4N30A 5HFGA 1EOHA 5G5FA 1GRXA 3EU4A 5E59A 4I8BA 2X8HA 3RBTA 2I3YA 3H4KA 1OC9B 2WULA 4GXZA 1QXHA 2YJ7A 4N10A 1TI1A 5ELGA 4TW5A 3IRAA 4GQCA 4FYCA 2E7PA 5ECOB 4DEJA 1TK8B 2V6OA 5B6MA 4DSQA 2CVBA 5ID2A 3ZIJA 3DVXA 2F51A 4D73B 4MF5A 1WRYA 4IBPA 3CTFA 2P5RA 4NXIA 1C72A 3ZL5A 4YQMA 3IK9A 2FWGA 3K8NA 1Y25A 3EE2A 3QD9A 8GSSA 1G6WA 4OO5A 1M9BA 3BCKA 3CYNA 2QA2A 1YQ1A 2V1MA 3AY8A 2AUVA 3W6GA 3GNJA 3IOSA 2C0GA 3D22A 3C7MA 22GSA 2JZSA 1A2JA 4KF9A 3DD3A 3SWLA 2HXKA 2F8AA 1Q4JA 3D0ZA 1BG5A 1YF0A 4HEA2 1T8EB 3UAPA 2L6DA 2DKIA 2GDRA 4BVXA 5FT3A 3HVVA 1M9AA 3EMPA 3GKKA 4POMA 2FNOA 4GQFA 3IA1A 4K5SA 2O85A 4RI7A 3TKSC 3I69A 2DMLA 4MZBA 1FB6A 3GMFA 2L57A 5AGYA 3UEMA 5G1KA 2E0QA 2A4VA 3VPTA 3KJYA 2MYGA 3Q74A 4XS1A 4ECIA 2I1UA 2BJXA 3EURA 2DJ1A 5HFIA 2DJ2A 4ZBAA 2VO4A 1SU9A 1WPIA 3DEXA 6GSUA 1TRWA 1O85A 1N2AA 1FAAA 5ECLB 4CY8A 4WEYA 3L9SA 2GSRA 1ZCPA 1XW5A 2H1GA 3DVWA 3EINA 2LEGA 1THXA 1H4OA 2H0HA 4IJIA 3VWWA 1U3AA 1B8XA 5DAKA 14GSA 3F4SA 1OC3A 4ZXGA 5CAXA 5IIZA 3LJRA 1X5DA 3ZTLA 3VI7A 5DALB 2ON5A 3GX8A 4DSSB 1GWCA 1O81A 5D9TA 3GV1A 4XIHA 3TJKA 3A2WA 3GUSA 1FO5A 4ZL9A 1BQ7A 2HLSA 4X43A 2EIRA 1K0AA 2EIOA 3MYDA 1JLVA 3MWHA 4POLA 3ZVJD 4TXOA 4K5RA 3IPZA 4NV5A 1ACVA 3WGXA 1PRXA 2H30A 1JZOA 3ERFA 3J7Yk 4TVEA 1G6YA 1FG4A 1PN9A 4K7OA 4YAVA 2K8SA 5F07A 12GSA 5CREA 1ILOA 4KSMA 3FZ5A 2GSTA 3KD0A 3P8WA 3GL5A 2XPEA 3Q19A 5B8AA 3H93A 5D96A 3HZ4A 2V32A 1IYIA 3KMOA 4JZQA 2YPMA 4MZWA 4XS4A 1GULA 1LBKA 3A5WA 3ZREA 4KW6A 4NMUA 2PN8A 1Z5YE 4LMWA 2OJLA 5F0GA 2HRNA 2LRNA 2IIYA 4RI6A 4F2IA 2YWMA 3HHVA 4LL1B 3GTUA 4Z2TA 4LA1A 5GSTA 1J0FA 3PINA 3HVSA 4RUVA 3ISOA 2YWNA 4QL9A 2IMKA 1WE0A 2FA4A 2LKUA 2KHPA 3HVXA 2HT9A 3UBLA 4BPYA 4P3YB 5GAPD 3KH9A 3NOFA 2HNLA 5B8BA 3LORA 3APQA 1TXXA 4WF5A 5B6NA 2YOIA 4MF6A 1XWAA 1GUMA 2VL3A 4G0IA 3VURA 2PUKC 3GRXA 4KUNA 3I43A 4CY6A 2DKHA 4AJ8A 1GSFA 2IMDA 1GTBA 1DUGA 3BD2A 1ZYEA 2QC7A 4X0XA 1USBA 3C73A 2B7KA 5HQPA 2AV4A 3L9VA 3KIJA 3FZ9A 2DBCA 2C0FA 2PVOC 4JE1A 4IGJA 1T7PB 1TI3A 2JL4A 1H75A 2OBKA 2PBJA 1R7HA 1SYXA 4WKWA 3RPNA 2H0IA 2H01A 4BL7A 3F3QA 3GHAA 2L6CA 1PA3A 1ERTA 4O32A 1AAZA 2E2MA 2FWHA 1EZKA 2NPBA 2RUEA 2VCQA 1FOVA 5CYYA 1O8WA 3VFIA 3GURA 3R2QA 2CA8A 2F9SA 4EKZA 3KXOA 1V2AA 3KP8A 4AJ6A 4ECJA 1OC9A 3FR9A 5IOXA 9GSSA 1G0TA 1OAZA 1QFNA 4F9ZA 3IC8A 1SKRB 4YKGA 4MJCA 2OBIA 2ON7A 2YZUA 1E6BA 2MMNA 4K7NA 3MSZA 2GZYA 3F9UA 5AIXA 2O87A 2IL3A 1JHBA 3FK8A 4MH3A 3IHQA 4TXVA 1TU8A 4N0ZA 2VLTA 4GRFA 4EF0A 1PQNA 2OE3A 4POKA 1GLQA 4MH2A 2VL2C 4TRXA 3IE3A 1GUHA 1G7OA 3H8QA 3KH7A 4OCEA 3P2AA 2VLUA 3ED3A 3G7IA 4RQXA 3DMLA 1HQOA 3O76A 4N0VA 1O73A 2ALBA 4IVFA 3PGTA 2QA1A 2LS5A 2ZCTA 3JCML 4HU7A 5BMUA 4AF2A 1GTAA 1XW6A 5J5NA 6GSWA 1X9WB 4DSRA 1X5CA 1PL2A 5H5QA 5ECMB 1PN0A 1VF3A 3D4TA 3N5OA 3FR3A 2FHEA 1NHOA 1AW9A 1UVZA 4OFMA 3U5RE 4ZL7A 5KOWA 3CSIA 1GLPA 3P90A 4TOPA 3UBKA 1GH2A 1NHYA 2DLXA 1CQGA 1K3YA 2JSZA 1S3AA 1PD21 1GSEA 2CX3A 4K7IA 3VWVA 3M8NA 1ZYPA 1EV9A 3FHKA 3TCOA 2GT6A 3C1RA 4L0UA 3IBHA 2GSSA 3HYPA 1YKAA 5IMFA 5J9BA 6GSXA 2RIIA 3QMXA 1BYEA 2A4HA 3UVTA 3QAVA 1M99A 3C71A 2B1LA 1SL0B 2VD1A 4GLTA 3LFLA 2JACA 2TRCP 5FWGA 2J23A 3GSTA 10GSA 2EC4A 4MPFA 4N11A 5DALA 1U6TA 1YEXA 4DSSA 2KP2A 4KB3A 4ICYA 5G1LA 2HRAA 5B7CA 1SJZA 1VF1A 1XCCA 3KM6A 1X5EA 5HR2A 3KMNA 1F37A 2R0GA 5CRHA 4TR3A 2K6VA 1AQXA 4ZL8A 1YF1A 5KEJA 5J3RA 1AIUA 2B5YA 1R26A 4JU5A 1GP1A 2L5OA 2VAFA 2IMFA 2C0EA 3QAGA 1OKDA 4KCEA 2P0GA 4MABA 4K2XA 4O7HA 5J41A 4O5QA 1XZOA 2K18A 3M9KA 5H5RA 4EVMA 2A2RA 3HJMA 4EL1A 3CSJA 1EOGA 2OE0A 1SJIA 2RLIA 2H73A 2DJ0A 2VM1A 1OVNA 1X9MB 4NWYA 5DBQA 3VWUA 3IAS2 2E2GA 4I5QA 1O8XA 3ZMLA 1WOUA 4DVCA 3LXZA 1B9YC 5IMDA 2H76A 2JU5A 1ZOFA 2JZTA 5IMCA 2DSAA 4MA9A 4MPGA 3A2XA 1OKTA 2PVQA 3ERGA 4F82A 5J9CA 4PQ1A 3WYWA 4LLRA 3VI5A 3VWXA 3FR6A 1M2BA 4MK3A 2GT5A 2IFQB 2HSYA 1CQHA 1F3AA 1K0CA 4RQRA 3F4RA 5ENUA 2LQOA 3DGQA 3ZFLA 4KAEA 5DJLA 2VCVA 2C3QA 1SYRA 1A8LA 3QFBC 4Z2RA 3LWAA 4V2LA 1JZDA 3KZQA 3LQ7A 2VCWA 5AIVA 4KDYA 1SKWB 4CW9A 4PXOA 4PUFC 5JCUA 1QQ2A 1T4YA 4LL4B 4XCSA 2OADA 3F3RA 4GTUA 5IM9A 3GIXA 3HD5A 4KX4A 2CT6A 5HFKA 1T4ZA 4TR1B 1QMVA 4BWSA 2H70A 4HJMA 1U87A 1QGVA 1URMA 1XOAA 4ZIJA 1NSWA 2XPDA 3L78A 1Y6EA 3ZITA 3BOAA 2P5QA 4ZB9A 3I9V2 3TJFA 5BRTA 5ECHB 4V1Ag 4K9ZA 4L5OA 3G7JA 4MJAA 1MDKA 2O8VB 1GSUA 3CBUA 4HQSA 2LQQA 1JLWA 5H5SA 2X8GA 1KNGA 4PQIA 5HR0A 2FUG2 3IR4A 2DJKA 3Q18A 4G2EA 3TRXA 2YJHA 4PURA 5DQYA 1EEJA 3L4NA 2L4CA 1KBNA 5F05A 1Z7PA 3QAWA 2HYXA 3UVHA 1M2DA 3N9JA 3HY2A 5ECNB 3CTGA 5CRWA 1EP8A 1OYJA 2A2PA 3NIVA 3TOTA 3W8JA 4OCFA 2RUFA 4AGSA 3EMXA 2H1AA 5D9WA 4A5PA 1TU7A 4HZ2A 1HYUA 4MDCA 2GVPA 2CQ9A 3EVIA 3L9UA 3VK9A 4ID0A 1F3BA 2L59A 1F9MA 1U88A 2XBIA 4YAPA 2CVDA 2HZEB 2A2SA 5COHA 3ZZXA 3FYGA 3EC3A 2X8CA 4EDYA 1B9XC 3L0HA 1YY7A 1EEMA 4ILFA 3UJ1A 4EE0A 2GSQA 4K0NA 2Z9SA 2F3MA 4IN0A 1SL1B 1S3DA 5KN3A 2NBSA 6GSSA 2KP1A 1UN2A 4TR0A 3FZAA 2FY6A 5C00A 1F2EA 4I6XA 1YDKA 3RDWA 1MDJA 1SK2A 4I97A 5GAND 2HZFA 2YNXA 1SL2B 1A23A 4EC0A 4ULXA 2KLXA 1SD9A 1BEDA 5AISA 4I2TA 3APOA 5EL8A 4F0BA 4NV2A 1TW9A 4ZB6A 4EIQA 1VGLA 4ZBDA 5G2ZA 2O7KA 5HR1A 2TIRA 1SENA 3GKMA 1A8YA 3TKQA 2H71A 1OE7A 5IQYA 1PX7A 2NDOA 3BCIA 1G7EA 4Q5FA 4ISDA 2YWOA 3I6AA 5EY6A 5IPGA 3UMAA 3HJOA 2LNSA 1GL8A 3E0UA 5G30A 3US3A 4KGIA 3GH6A 2C0DA 1TOFA 1GSDA 1UC7A 2C3TA 2M72A 2R6KA 1AUCA 4KE3A 3CMIA 3DWVA 2DC5A 4E8HA 3TUEA 4I2UA 3QR6A 5IPHA 5DCGA 4FIWA 2M80A 4ML6A 2AHEA 3KCMA 3D6IA 3PPUA 4OFNA 3DKSA 4AJ7A 3HZ8A 2GQMA 4HDEA 4D73A 2LSTA 1WMJA 4HS1A 4G0KA 5IO0A 5JCWA 2H74A 1KTEA 4OMVA 2MMOA 1BJXA 1YEPA 1Z6NA 2CZ3A 2VCXA 4ECCA 2WB9A 4CHSA 2LTKA 5EPFA 1XW9A 20GSA 1A2LA 3F4TA 4LMVA 1GSQA 4OWYA 5F06A 4IELA 5A4VA 3KEBA 4MLYA 2MBTA 2WJUA 2YP6A 3NZNA 2VCZA 5CNWA 4MJBA 3PH9A 1B48A 1ST9A 3F63A 2WCIA 3VLNA 3RHBA 3LW9A 2H66A 1IYHA 3V1WA 4XS4B 4HOJA 4XRAA 3ZFBA 1T1VA 4EIPA 1VRSD 4POBA 4HU9A 2B7JA 2GZPA 1HNBA 4BVYB 3IXRA 4PNGA 5GSSA 1N8JA 3TKSE 2IN3A 5LD0A 4L8EA 5KN0A 4NHZA 1XFLA 2D2ZA 4G19A 2R37A 1EWXA 4PTSA 2CX4A 1K0NA 4EO3A 5G5EA 4TN8A 1J08A 4YKFA 4PX1A 1V98A 1LJRA 4USSA 2CV4A 4NAXA 2GGTA 5ECRB 1MEKA 2HFDA 4ACSA 2VOCA 1V58A 1FHEA 4MP4A 2GQLA 1FVKA 2PU9C 1TK0B 4JEDA 4O5UA 5IOWA 2GQKA 4K1FA 5F8BA 5D93A 4WBRD 5LNKe 2RM6A 2G0FA 4IW9A 3LYPA 4KDXA 4BA7A 1TRUA 3GN3A 2IPAA 4WBJA 1EGRA 1KEBA 4YQVA 2VL9A 2B6MA 2CVKA 5AN1A 5ECIB 2IWTA 5LCZA 2CAQA 1M2AA 1T00A 2X64A 2YV9A 13GSA 1I5GA 1MTCA 3E3EA 3MAKA 5CRDA 3DYRA 1PX6A 2OACA 3QFAC 4V2NA 1I9DA 4ML1A 4IP6A 3GL3A 3IDVA 2HI7A 3LXTA 4O92A 1RK4A 3EU3A 3ZIVA 4TR1A 4V1Ap 2HRFA 4WETA 1O6JA 2AJQB 2XHFA 3QCPA 3FY7A 3OR5A 3M3MA 2IMIA 3APSA 1ERWA 1XVQA 5KN2A 4ZILA 11GSA 3GSSA 4IKHA 5ABRA 3FKFA 3MNGA 2P31A 5DQSA 5JWRB 2C3NA 5GZZB 4NHWA 1X0RA 5DJMA 2QGVA 2JSYA 3WT1A 3ZRDA 1F6MC 1SD8A 5INYA 2X4AA 4J2FA 5J4UA 4Q5NA 1GNEA 6GSYA 3PR8A 4K0GA 2XC2A 4O5RA 5ELAA 2WZ9A 2FD3A 3GKXA 4G10A 5D73A 4KA0A 3GH9A 2QSIA 3TKSA 4WF4A 1V40A 3LGCA 2YWIA 4TKYA 3U6VA 3WGDA 2LUSA 3D5JA 1ZYQB 1GSYA 1R5PA 2GTUA 4HZ4A 2C80A 1WP0A 1DE2A 1ERUA 3TRQA 1ERVA 5DVBA 1AXDA 6GSVA 4IP1A 2H75A 2R0PA 4JR6A 5ECSA 1A0FA 2WFCA 3GA4A 1ML6A 2FWEA 4XTSA 3ZVJA 1ZYNA 5JWOB 1A2MA 2H6XA 1Q98A 4WR5A 1GUKA 2R2JA 2YANA 1B4QA 2JZRA 2FA8A 1Z9HA 2H6YA 5ECPB 2HZEA 1J9BA 3HCZA 2LNTA 2XBQA 2YV7A 5D8IA 2PERA 4K2DA 1PKWA 2KOKA 3F6FA 2LJKA 1E2YA 2V2GA 1SK1A 1WJKA 1FW1A 4PNFA 3M1GA 3CSHA 3CXGA 3ZYWA 1WIKA 2H8LA 3LSZA 3TKPA 2R4VA 4PUAA 2KUCA 1X9SB 1ZL9A 4MMMA 4Q5QA 5EVOA 1B4PA 3R3EA 3UOMA 3F6DA 2B1KA 3GYKA 4X1UA 4KCAA 5G31A 3RHCA 2L4QA 1TRSA 2WS2A 3A5IA 1K3LA 1K0DA 2FGXA 1O7UA 3O6TA 2OKAA 4Z7XA 2PMTA 3KTLA 3QPMA 1V9WA 2WRTA 2H72A 1RQMA 3CRUA 2VCTA 1TRVA 2DIZA 4FH8A 3M9JA 1LU4A 2B3SA 5D9VA 5ECKB 3GFKA 3A2VA 1XBSA 4XHMA 2VIMA 1QUWA 2LRTA 2I9HA 3LEFA 2K9FA 3H1NA 3IHGA 1TDIA 3UARA 3TJJA 1Z7RA 1XXUA 1AC1A 4EXJA 1XWBA 3EWLA 3W8SA 4IQAA 4GSSA 4HQZA 2NTOA 2K8VA 2REMA 4HJ2A 4FYBA 4MF7A 3DXBA 4Z2UA 3KP9A 5IMAA 3SBCA 2OA7A 1SKSB 5D9XA 5CRGA 1FB0A 1WWJA 2AB6A 4L0WA 3A3TA 3QOUA 2N5BA 1HNAA 1S3CA 1PL1A 2VUPA 2ZUPA 4V2MA 2MBSA 3KGKA 5ID2B 1YKCA 4WR4A 3C8EA 1OC8A 2H19A 4TR4A 4GSNA 7GSSA 5KOXA 1PGTA 1GSSA 3E9JB 2BTOT 2N5FA 4MNNA 2CZ2A 1YZXA 3F0IA 2H6ZA 3FZ4A 4ECBA 1TJDA 2V41A 4IJ3A 3HJPA 4NPBA 3GX0A 3RAZA 5A4WA 2MZCA 1GNWA 1JZRA 3D4MA 5CO3A 3WT2A 1SK0A 2YCDA 4KSOA 1XVWA 2QKEA 4BVYA 1NW2A 4GSTA 3HDCA 5JCGA 3ZMKA 4YH2A 4IHUA 2LJRA 1DSBA 5CP1A 5HR3A 3TKRA 3LYKA 2DJJA 3Q6OA 2MMAA 2AAWA 3DRNA 2HSHA 3D21A 3WD6A 4MCUA 1GTUA 2VD0A 2V6KA 3WGEA 1TKDB 4BVXB 4MJEA 2H0GA 4F03A 2TRXA 4GCIA 2YZHA 1EGOA 2OE1A 2PGTA 1M7TA 1XWCA 2H1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TB2 A;  1JZW A;  3IV4 A;  1AQV A;  2RM5 A;  2FCH A;  3BJ5 A;  3ZLP A;  3TRP A;  2NVL A;  2FLS A;  3QDN A;  3TJG A;  3FRC A;  3GKN A;  4QQ7 A;  2C8U A;  4XS6 A;  4YQU A;  1R4W A;  5IO2 A;  4OD7 A;  1ABA A;  2MMZ A;  4KND A;  2LV3 A;  4H86 A;  2M46 A;  2YN1 A;  2IJY A;  4XRD A;  2BMX A;  1XPV A;  3ME8 A;  5A5K A;  4EDZ A;  3P7X A;  1K0B A;  2C4J A;  1ZGN A;  4FO5 A;  4HUA A;  1JFU A;  4CDO A;  1TK5 B;  17GS A;  1THO A;  4JR4 A;  1DE1 A;  3BBY A;  2AYT A;  3UL3 A;  1FVJ A;  19GS A;  1MD3 A;  1XWG A;  1K0O A;  1XIY A;  2F8F A;  2GS3 A;  3HXS A;  4IQ1 A;  1W89 A;  5L71 A;  2VL2 A;  1AQW A;  4OFT A;  1R5A A;  1HNC A;  2H1B A;  4GWR A;  3H79 A;  16GS A;  3MDK A;  1PKZ A;  1PMT A;  2B5X A;  5DAK B;  1XWK A;  5A4U A;  1BX9 A;  5KN1 A;  3LG6 A;  1HD2 A;  2DMM A;  3S9F A;  5DDL A;  1UA5 A;  3UIW A;  3G9B A;  5ECQ B;  2DIY A;  3O3T A;  2C1Y A;  3ERW A;  2LJA A;  2LRC A;  4TXO B;  5E4W A;  2VLV A;  4J57 E;  1XOB A;  1DBY A;  4GF0 A;  1V57 A;  1T3B A;  3G7Y A;  3IAM 2;  1W4V A;  2CAI A;  2VM2 A;  4EUY A;  2JAD A;  1Z3E A;  4PGT A;  3TOU A;  1SJ6 A;  3KTB A;  2GLR A;  4F0C A;  1BAY A;  2PWJ A;  1TTZ A;  1ZZY A;  5C04 A;  1MD4 A;  1K0M A;  3C1S A;  3FEU A;  4ZB8 A;  1EP7 A;  4BWQ A;  2ES7 A;  4K8M A;  4KDU A;  18GS A;  4MZC A;  2I4A A;  3GTU B;  1OE8 A;  1Z6M A;  2IME A;  1K3O A;  1A24 A;  3RPP A;  3DIE A;  2J9H A;  3VPQ A;  2WDU A;  1PSQ A;  5IMV A;  2ZNM A;  3TJB A;  2IFQ A;  4KH7 A;  4J56 E;  5IMZ A;  3TDG A;  2G2Q A;  4PQH A;  1ZMA A;  3HKR A;  4JRR A;  4E8E A;  2B5E A;  4K6X A;  1ON4 A;  2DJ3 A;  1QK8 A;  3CRT A;  2O89 A;  6GST A;  4FYU A;  1YJ6 A;  2FWF A;  4JBB A;  4Q5R A;  2PPT A;  3FW2 A;  2I81 A;  1RW1 A;  1TP9 A;  2GZZ A;  2R5G A;  4OO4 A;  2EIQ A;  3M0F A;  3IC4 A;  1VF2 A;  2R3X A;  5JWQ B;  3HA9 A;  2N5A A;  1GTI A;  4L5L A;  1MDI A;  3IK7 A;  3F8U A;  2WGR A;  2HE3 A;  1A0R P;  1VF4 A;  4HI7 A;  1U3I A;  4WXT A;  2L5L A;  5FHI A;  3TGZ A;  4G9H A;  4IS0 A;  1EV4 A;  5DCH A;  3EYT A;  3ME7 A;  2X99 A;  1NM3 A;  3J7Y b;  1M0U A;  4QL7 A;  4ZBB A;  4N30 A;  5HFG A;  1EOH A;  5G5F A;  1GRX A;  3EU4 A;  5E59 A;  4I8B A;  2X8H A;  3RBT A;  2I3Y A;  3H4K A;  1OC9 B;  2WUL A;  4GXZ A;  1QXH A;  2YJ7 A;  4N10 A;  1TI1 A;  5ELG A;  4TW5 A;  3IRA A;  4GQC A;  4FYC A;  2E7P A;  5ECO B;  4DEJ A;  1TK8 B;  2V6O A;  5B6M A;  4DSQ A;  2CVB A;  5ID2 A;  3ZIJ A;  3DVX A;  2F51 A;  4D73 B;  4MF5 A;  1WRY A;  4IBP A;  3CTF A;  2P5R A;  4NXI A;  1C72 A;  3ZL5 A;  4YQM A;  3IK9 A;  2FWG A;  3K8N A;  1Y25 A;  3EE2 A;  3QD9 A;  8GSS A;  1G6W A;  4OO5 A;  1M9B A;  3BCK A;  3CYN A;  1YQ1 A;  2V1M A;  3AY8 A;  2AUV A;  3W6G A;  3GNJ A;  3IOS A;  2C0G A;  3D22 A;  3C7M A;  22GS A;  2JZS A;  1A2J A;  3DD3 A;  3SWL A;  2HXK A;  2F8A A;  1Q4J A;  3D0Z A;  1BG5 A;  1YF0 A;  4HEA 2;  1T8E B;  3UAP A;  2L6D A;  2GDR A;  4BVX A;  5FT3 A;  3HVV A;  1M9A A;  3EMP A;  3GKK A;  4POM A;  2FNO A;  4GQF A;  3IA1 A;  2O85 A;  4RI7 A;  3TKS C;  3I69 A;  2DML A;  4MZB A;  1FB6 A;  3GMF A;  2L57 A;  5AGY A;  3UEM A;  5G1K A;  2E0Q A;  2A4V A;  3VPT A;  3KJY A;  2MYG A;  3Q74 A;  4XS1 A;  4ECI A;  2I1U A;  2BJX A;  3EUR A;  2DJ1 A;  5HFI A;  2DJ2 A;  4ZBA A;  2VO4 A;  1SU9 A;  1WPI A;  3DEX A;  6GSU A;  1TRW A;  1O85 A;  1N2A A;  1FAA A;  5ECL B;  4WEY A;  3L9S A;  2GSR A;  1ZCP A;  1XW5 A;  2H1G A;  3DVW A;  3EIN A;  2LEG A;  1THX A;  1H4O A;  2H0H A;  4IJI A;  3VWW A;  1U3A A;  1B8X A;  5DAK A;  14GS A;  3F4S A;  1OC3 A;  4ZXG A;  5CAX A;  5IIZ A;  3LJR A;  1X5D A;  3ZTL A;  3VI7 A;  5DAL B;  2ON5 A;  3GX8 A;  4DSS B;  1GWC A;  1O81 A;  5D9T A;  3GV1 A;  4XIH A;  3TJK A;  3A2W A;  3GUS A;  1FO5 A;  4ZL9 A;  1BQ7 A;  2HLS A;  4X43 A;  2EIR A;  1K0A A;  2EIO A;  1JLV A;  3MWH A;  4POL A;  3ZVJ D;  4TXO A;  4NV5 A;  3IPZ A;  1ACV A;  3WGX A;  1PRX A;  2H30 A;  1JZO A;  3ERF A;  3J7Y k;  4TVE A;  1G6Y A;  1FG4 A;  1PN9 A;  4K7O A;  4YAV A;  2K8S A;  5F07 A;  12GS A;  5CRE A;  1ILO A;  4KSM A;  3FZ5 A;  2GST A;  3KD0 A;  3P8W A;  3GL5 A;  2XPE A;  3Q19 A;  5B8A A;  3H93 A;  5D96 A;  3HZ4 A;  2V32 A;  1IYI A;  3KMO A;  4JZQ A;  2YPM A;  4MZW A;  4XS4 A;  1GUL A;  1LBK A;  3A5W A;  3ZRE A;  4KW6 A;  4NMU A;  2PN8 A;  1Z5Y E;  4LMW A;  2OJL A;  5F0G A;  2HRN A;  2LRN A;  2IIY A;  4RI6 A;  4F2I A;  2YWM A;  3HHV A;  4LL1 B;  3GTU A;  4LA1 A;  5GST A;  1J0F A;  3PIN A;  3HVS A;  4RUV A;  3ISO A;  2YWN A;  4QL9 A;  2IMK A;  1WE0 A;  2FA4 A;  2LKU A;  2KHP A;  3HVX A;  2HT9 A;  3UBL A;  4BPY A;  4P3Y B;  5GAP D;  3KH9 A;  3NOF A;  2HNL A;  5B8B A;  3LOR A;  3APQ A;  1TXX A;  4WF5 A;  5B6N A;  2YOI A;  4MF6 A;  1XWA A;  1GUM A;  2VL3 A;  3VUR A;  2PUK C;  3GRX A;  4KUN A;  3I43 A;  4AJ8 A;  1GSF A;  2IMD A;  1GTB A;  1DUG A;  3BD2 A;  1ZYE A;  2QC7 A;  4X0X A;  1USB A;  3C73 A;  2B7K A;  5HQP A;  2AV4 A;  3L9V A;  3KIJ A;  3FZ9 A;  2DBC A;  2C0F A;  2PVO C;  4JE1 A;  4IGJ A;  1T7P B;  1TI3 A;  2JL4 A;  1H75 A;  2OBK A;  2PBJ A;  1R7H A;  1SYX A;  4WKW A;  3RPN A;  2H0I A;  2H01 A;  4BL7 A;  3F3Q A;  3GHA A;  2L6C A;  1PA3 A;  1ERT A;  4O32 A;  1AAZ A;  2E2M A;  2FWH A;  1EZK A;  2NPB A;  2RUE A;  2VCQ A;  1FOV A;  5CYY A;  1O8W A;  3VFI A;  3GUR A;  3R2Q A;  2CA8 A;  2F9S A;  4EKZ A;  3KXO A;  1V2A A;  3KP8 A;  4AJ6 A;  4ECJ A;  1OC9 A;  3FR9 A;  5IOX A;  9GSS A;  1G0T A;  1OAZ A;  1QFN A;  4F9Z A;  1SKR B;  4MJC A;  2OBI A;  2ON7 A;  2YZU A;  1E6B A;  2MMN A;  4K7N A;  3MSZ A;  2GZY A;  3F9U A;  5AIX A;  2O87 A;  2IL3 A;  1JHB A;  3FK8 A;  4MH3 A;  3IHQ A;  4TXV A;  1TU8 A;  4N0Z A;  2VLT A;  4GRF A;  4EF0 A;  1PQN A;  2OE3 A;  4POK A;  1GLQ A;  4MH2 A;  2VL2 C;  4TRX A;  3IE3 A;  1GUH A;  1G7O A;  3H8Q A;  3KH7 A;  4OCE A;  3P2A A;  2VLU A;  3ED3 A;  3G7I A;  4RQX A;  3DML A;  1HQO A;  3O76 A;  4N0V A;  1O73 A;  2ALB A;  4IVF A;  3PGT A;  2LS5 A;  2ZCT A;  3JCM L;  4HU7 A;  4AF2 A;  1GTA A;  1XW6 A;  5J5N A;  6GSW A;  1X9W B;  4DSR A;  1X5C A;  1PL2 A;  5H5Q A;  5ECM B;  1VF3 A;  3D4T A;  3N5O A;  3FR3 A;  2FHE A;  1NHO A;  1AW9 A;  1UVZ A;  4OFM A;  3U5R E;  4ZL7 A;  3CSI A;  1GLP A;  3P90 A;  4TOP A;  3UBK A;  1GH2 A;  1NHY A;  2DLX A;  1CQG A;  1K3Y A;  2JSZ A;  1S3A A;  1PD2 1;  1GSE A;  2CX3 A;  4K7I A;  3VWV A;  3M8N A;  1EV9 A;  3FHK A;  3TCO A;  2GT6 A;  3C1R A;  4L0U A;  3IBH A;  2GSS A;  3HYP A;  1YKA A;  5IMF A;  5J9B A;  6GSX A;  2RII A;  3QMX A;  1BYE A;  3UVT A;  3QAV A;  1M99 A;  3C71 A;  2B1L A;  1SL0 B;  2VD1 A;  4GLT A;  3LFL A;  2JAC A;  2TRC P;  5FWG A;  2J23 A;  3GST A;  10GS A;  2EC4 A;  4MPF A;  4N11 A;  5DAL A;  1U6T A;  1YEX A;  4DSS A;  2KP2 A;  4KB3 A;  5G1L A;  5B7C A;  1SJZ A;  1VF1 A;  1XCC A;  3KM6 A;  1X5E A;  5HR2 A;  3KMN A;  1F37 A;  5CRH A;  4TR3 A;  2K6V A;  1AQX A;  4ZL8 A;  1YF1 A;  5KEJ A;  5J3R A;  1AIU A;  2B5Y A;  1R26 A;  4JU5 A;  1GP1 A;  2L5O A;  2VAF A;  2IMF A;  2C0E A;  3QAG A;  1OKD A;  4KCE A;  2P0G A;  4MAB A;  4O7H A;  5J41 A;  1XZO A;  2K18 A;  3M9K A;  5H5R A;  4EVM A;  2A2R A;  3HJM A;  4EL1 A;  3CSJ A;  1EOG A;  2OE0 A;  1SJI A;  2RLI A;  2H73 A;  2DJ0 A;  2VM1 A;  1OVN A;  1X9M B;  4NWY A;  5DBQ A;  3VWU A;  3IAS 2;  2E2G A;  4I5Q A;  1O8X A;  3ZML A;  1WOU A;  4DVC A;  3LXZ A;  1B9Y C;  5IMD A;  2H76 A;  2JU5 A;  1ZOF A;  2JZT A;  5IMC A;  2DSA A;  4MA9 A;  4MPG A;  3A2X A;  1OKT A;  2PVQ A;  3ERG A;  4F82 A;  5J9C A;  4PQ1 A;  3WYW A;  4LLR A;  3VI5 A;  3VWX A;  3FR6 A;  1M2B A;  4MK3 A;  2GT5 A;  2IFQ B;  2HSY A;  1CQH A;  1F3A A;  1K0C A;  4RQR A;  3F4R A;  5ENU A;  2LQO A;  3DGQ A;  3ZFL A;  4KAE A;  5DJL A;  2VCV A;  2C3Q A;  1SYR A;  1A8L A;  3QFB C;  3LWA A;  4V2L A;  1JZD A;  3KZQ A;  3LQ7 A;  2VCW A;  5AIV A;  4KDY A;  1SKW B;  4CW9 A;  4PXO A;  4PUF C;  5JCU A;  1QQ2 A;  1T4Y A;  4LL4 B;  4XCS A;  2OAD A;  3F3R A;  4GTU A;  5IM9 A;  3GIX A;  3HD5 A;  4KX4 A;  2CT6 A;  5HFK A;  1T4Z A;  4TR1 B;  1QMV A;  4BWS A;  2H70 A;  4HJM A;  1U87 A;  1QGV A;  1URM A;  1XOA A;  4ZIJ A;  1NSW A;  2XPD A;  3L78 A;  1Y6E A;  3ZIT A;  3BOA A;  2P5Q A;  4ZB9 A;  3I9V 2;  3TJF A;  5ECH B;  4V1A g;  4K9Z A;  4L5O A;  3G7J A;  4MJA A;  1MDK A;  2O8V B;  1GSU A;  3CBU A;  4HQS A;  2LQQ A;  1JLW A;  5H5S A;  2X8G A;  1KNG A;  4PQI A;  5HR0 A;  2FUG 2;  3IR4 A;  2DJK A;  3Q18 A;  4G2E A;  3TRX A;  2YJH A;  4PUR A;  5DQY A;  1EEJ A;  3L4N A;  2L4C A;  1KBN A;  5F05 A;  1Z7P A;  3QAW A;  2HYX A;  3UVH A;  1M2D A;  3N9J A;  3HY2 A;  5ECN B;  3CTG A;  5CRW A;  1EP8 A;  1OYJ A;  3NIV A;  3TOT A;  3W8J A;  4OCF A;  2RUF A;  4AGS A;  3EMX A;  2H1A A;  5D9W A;  1TU7 A;  4HZ2 A;  1HYU A;  4MDC A;  2GVP A;  2CQ9 A;  3EVI A;  3L9U A;  3VK9 A;  4ID0 A;  1F3B A;  2L59 A;  1F9M A;  1U88 A;  2XBI A;  4YAP A;  2CVD A;  2HZE B;  2A2S A;  5COH A;  3ZZX A;  3FYG A;  3EC3 A;  2X8C A;  4EDY A;  1B9X C;  3L0H A;  1YY7 A;  1EEM A;  4ILF A;  3UJ1 A;  4EE0 A;  2GSQ A;  4K0N A;  2Z9S A;  2F3M A;  4IN0 A;  1SL1 B;  1S3D A;  5KN3 A;  2NBS A;  6GSS A;  2KP1 A;  1UN2 A;  4TR0 A;  3FZA A;  2FY6 A;  5C00 A;  1F2E A;  4I6X A;  1YDK A;  3RDW A;  1MDJ A;  1SK2 A;  4I97 A;  5GAN D;  2HZF A;  2YNX A;  1SL2 B;  1A23 A;  4EC0 A;  4ULX A;  2KLX A;  1SD9 A;  1BED A;  5AIS A;  4I2T A;  3APO A;  5EL8 A;  4F0B A;  4NV2 A;  1TW9 A;  4ZB6 A;  1VGL A;  4ZBD A;  5G2Z A;  2O7K A;  5HR1 A;  2TIR A;  1SEN A;  3GKM A;  1A8Y A;  3TKQ A;  2H71 A;  1OE7 A;  5IQY A;  1PX7 A;  2NDO A;  3BCI A;  1G7E A;  4Q5F A;  4ISD A;  2YWO A;  3I6A A;  5EY6 A;  5IPG A;  3UMA A;  3HJO A;  2LNS A;  1GL8 A;  3E0U A;  5G30 A;  3US3 A;  4KGI A;  3GH6 A;  2C0D A;  1TOF A;  1GSD A;  1UC7 A;  2C3T A;  2M72 A;  2R6K A;  1AUC A;  4KE3 A;  3CMI A;  3DWV A;  2DC5 A;  4E8H A;  3TUE A;  4I2U A;  3QR6 A;  5IPH A;  5DCG A;  4FIW A;  2M80 A;  4ML6 A;  2AHE A;  3KCM A;  3D6I A;  4OFN A;  3DKS A;  4AJ7 A;  3HZ8 A;  2GQM A;  4HDE A;  4D73 A;  2LST A;  1WMJ A;  4HS1 A;  5IO0 A;  5JCW A;  2H74 A;  1KTE A;  4OMV A;  2MMO A;  1BJX A;  1YEP A;  1Z6N A;  2CZ3 A;  2VCX A;  4ECC A;  2WB9 A;  4CHS A;  2LTK A;  5EPF A;  1XW9 A;  20GS A;  1A2L A;  3F4T A;  4LMV A;  1GSQ A;  4OWY A;  5F06 A;  4IEL A;  5A4V A;  3KEB A;  4MLY A;  2MBT A;  2WJU A;  2YP6 A;  3NZN A;  2VCZ A;  5CNW A;  4MJB A;  3PH9 A;  1B48 A;  1ST9 A;  3F63 A;  2WCI A;  3VLN A;  3RHB A;  2H66 A;  1IYH A;  3V1W A;  4XS4 B;  4HOJ A;  4XRA A;  3ZFB A;  1T1V A;  1VRS D;  4POB A;  4HU9 A;  2B7J A;  2GZP A;  1HNB A;  3IXR A;  4PNG A;  5GSS A;  1N8J A;  3TKS E;  2IN3 A;  5LD0 A;  4L8E A;  5KN0 A;  4NHZ A;  1XFL A;  2D2Z A;  4G19 A;  2R37 A;  1EWX A;  2CX4 A;  1K0N A;  4EO3 A;  5G5E A;  4TN8 A;  1J08 A;  4PX1 A;  1V98 A;  1LJR A;  2CV4 A;  4NAX A;  2GGT A;  5ECR B;  1MEK A;  2HFD A;  4ACS A;  2VOC A;  1V58 A;  1FHE A;  4MP4 A;  2GQL A;  1FVK A;  2PU9 C;  1TK0 B;  4JED A;  5IOW A;  2GQK A;  4K1F A;  5F8B A;  5D93 A;  4WBR D;  5LNK e;  2RM6 A;  2G0F A;  4IW9 A;  3LYP A;  4KDX A;  4BA7 A;  1TRU A;  3GN3 A;  2IPA A;  4WBJ A;  1EGR A;  1KEB A;  4YQV A;  2VL9 A;  2B6M A;  2CVK A;  5AN1 A;  5ECI B;  2IWT A;  5LCZ A;  2CAQ A;  1M2A A;  1T00 A;  2X64 A;  2YV9 A;  13GS A;  1I5G A;  1MTC A;  3E3E A;  3MAK A;  5CRD A;  3DYR A;  1PX6 A;  2OAC A;  3QFA C;  4V2N A;  1I9D A;  4ML1 A;  4IP6 A;  3GL3 A;  3IDV A;  2HI7 A;  3LXT A;  4O92 A;  1RK4 A;  3EU3 A;  3ZIV A;  4TR1 A;  4V1A p;  2HRF A;  4WET A;  1O6J A;  2AJQ B;  2XHF A;  3QCP A;  3FY7 A;  3OR5 A;  3M3M A;  2IMI A;  3APS A;  1ERW A;  1XVQ A;  5KN2 A;  4ZIL A;  11GS A;  3GSS A;  4IKH A;  5ABR A;  3FKF A;  3MNG A;  2P31 A;  5DQS A;  5JWR B;  2C3N A;  5GZZ B;  4NHW A;  1X0R A;  5DJM A;  2QGV A;  2JSY A;  3WT1 A;  3ZRD A;  1F6M C;  1SD8 A;  5INY A;  4J2F A;  5J4U A;  4Q5N A;  1GNE A;  6GSY A;  3PR8 A;  4K0G A;  2XC2 A;  4O5R A;  5ELA A;  2WZ9 A;  2FD3 A;  3GKX A;  4G10 A;  5D73 A;  4KA0 A;  3GH9 A;  2QSI A;  3TKS A;  4WF4 A;  1V40 A;  3LGC A;  2YWI A;  4TKY A;  3U6V A;  3WGD A;  2LUS A;  3D5J A;  1ZYQ B;  1GSY A;  1R5P A;  2GTU A;  4HZ4 A;  2C80 A;  1WP0 A;  1DE2 A;  1ERU A;  3TRQ A;  1ERV A;  5DVB A;  1AXD A;  6GSV A;  4IP1 A;  2H75 A;  4JR6 A;  5ECS A;  1A0F A;  2WFC A;  3GA4 A;  1ML6 A;  2FWE A;  4XTS A;  3ZVJ A;  5JWO B;  1A2M A;  2H6X A;  1Q98 A;  4WR5 A;  1GUK A;  2R2J A;  2YAN A;  1B4Q A;  2JZR A;  2FA8 A;  1Z9H A;  2H6Y A;  5ECP B;  2HZE A;  1J9B A;  3HCZ A;  2LNT A;  2XBQ A;  2YV7 A;  5D8I A;  2PER A;  4K2D A;  1PKW A;  2KOK A;  3F6F A;  2LJK A;  1E2Y A;  2V2G A;  1SK1 A;  1WJK A;  1FW1 A;  4PNF A;  3M1G A;  3CSH A;  3CXG A;  3ZYW A;  1WIK A;  2H8L A;  3LSZ A;  3TKP A;  2R4V A;  4PUA A;  2KUC A;  1X9S B;  1ZL9 A;  4MMM A;  4Q5Q A;  5EVO A;  1B4P A;  3UOM A;  3F6D A;  2B1K A;  3GYK A;  4X1U A;  4KCA A;  5G31 A;  3RHC A;  2L4Q A;  1TRS A;  2WS2 A;  1K3L A;  1K0D A;  2FGX A;  1O7U A;  3O6T A;  2OKA A;  4Z7X A;  2PMT A;  3KTL A;  3QPM A;  1V9W A;  2WRT A;  2H72 A;  1RQM A;  3CRU A;  2VCT A;  1TRV A;  2DIZ A;  4FH8 A;  3M9J A;  1LU4 A;  2B3S A;  5D9V A;  5ECK B;  3GFK A;  3A2V A;  1XBS A;  4XHM A;  2VIM A;  1QUW A;  2LRT A;  2I9H A;  3LEF A;  2K9F A;  3H1N A;  1TDI A;  3UAR A;  3TJJ A;  1Z7R A;  1XXU A;  1AC1 A;  4EXJ A;  1XWB A;  3EWL A;  3W8S A;  4IQA A;  4GSS A;  4HQZ A;  2NTO A;  2K8V A;  2REM A;  4HJ2 A;  4FYB A;  4MF7 A;  3DXB A;  3KP9 A;  5IMA A;  3SBC A;  2OA7 A;  1SKS B;  5D9X A;  5CRG A;  1FB0 A;  1WWJ A;  2AB6 A;  4L0W A;  3A3T A;  3QOU A;  2N5B A;  1HNA A;  1S3C A;  1PL1 A;  2VUP A;  2ZUP A;  4V2M A;  2MBS A;  3KGK A;  5ID2 B;  1YKC A;  4WR4 A;  3C8E A;  1OC8 A;  2H19 A;  4TR4 A;  4GSN A;  7GSS A;  1PGT A;  1GSS A;  3E9J B;  2BTO T;  2N5F A;  2CZ2 A;  1YZX A;  3F0I A;  2H6Z A;  3FZ4 A;  4ECB A;  1TJD A;  2V41 A;  4IJ3 A;  3HJP A;  4NPB A;  3GX0 A;  3RAZ A;  5A4W A;  2MZC A;  1GNW A;  1JZR A;  3D4M A;  5CO3 A;  3WT2 A;  1SK0 A;  2YCD A;  4KSO A;  1XVW A;  2QKE A;  4BVY A;  1NW2 A;  4GST A;  3HDC A;  5JCG A;  3ZMK A;  4YH2 A;  4IHU A;  2LJR A;  1DSB A;  5CP1 A;  5HR3 A;  3TKR A;  3LYK A;  2DJJ A;  3Q6O A;  2MMA A;  2AAW A;  3DRN A;  2HSH A;  3D21 A;  3WD6 A;  4MCU A;  1GTU A;  2VD0 A;  2V6K A;  3WGE A;  1TKD B;  4MJE A;  2H0G A;  4F03 A;  2TRX A;  4GCI A;  2YZH A;  1EGO A;  2OE1 A;  2PGT A;  1M7T A;  1XWC A;  2H1D A; 
#chains in the Genus database with same CATH topology
 3TB2 A;  1JZW A;  3IV4 A;  1AQV A;  2RM5 A;  2FCH A;  3BJ5 A;  3ZLP A;  3TRP A;  2NVL A;  2FLS A;  3QDN A;  3TJG A;  4G0L A;  3FRC A;  3GKN A;  4QQ7 A;  2C8U A;  4XS6 A;  4YQU A;  1R4W A;  5IO2 A;  4OD7 A;  1ABA A;  2MMZ A;  4KND A;  2LV3 A;  4H86 A;  2M46 A;  2YN1 A;  2IJY A;  4XRD A;  2BMX A;  1XPV A;  3ME8 A;  5A5K A;  4EDZ A;  3P7X A;  1K0B A;  2UZ8 A;  2C4J A;  1ZGN A;  4FO5 A;  4HUA A;  1JFU A;  4CDO A;  1TK5 B;  17GS A;  1THO A;  4JR4 A;  1DE1 A;  3BBY A;  2AYT A;  3UL3 A;  1FVJ A;  19GS A;  1MD3 A;  1XWG A;  1K0O A;  1XIY A;  2F8F A;  2GS3 A;  3EPT A;  3HXS A;  4IQ1 A;  1W89 A;  5L71 A;  2VL2 A;  1AQW A;  4OFT A;  1R5A A;  1HNC A;  2H1B A;  4GWR A;  3H79 A;  16GS A;  3MDK A;  1PKZ A;  1PMT A;  2B5X A;  5DAK B;  1XWK A;  2HSM A;  5A4U A;  1BX9 A;  2R0C A;  3HVN A;  5KN1 A;  3LG6 A;  2X49 A;  1HD2 A;  2DMM A;  3S9F A;  5DDL A;  1UA5 A;  3UIW A;  3G9B A;  5ECQ B;  2DIY A;  3O3T A;  2C1Y A;  3ERW A;  2LJA A;  2LRC A;  4TXO B;  5E4W A;  2VLV A;  4J57 E;  1XOB A;  1DBY A;  4GF0 A;  1V57 A;  1T3B A;  3G7Y A;  3IAM 2;  1W4V A;  2CAI A;  2VM2 A;  4EUY A;  2JAD A;  1FOH A;  1Z3E A;  4PGT A;  3TOU A;  1SJ6 A;  3KTB A;  2GLR A;  4F0C A;  4X4J A;  1BAY A;  2PWJ A;  1TTZ A;  1ZZY A;  5C04 A;  1MD4 A;  1K0M A;  3C1S A;  3FEU A;  4ZB8 A;  1EP7 A;  4BWQ A;  2ES7 A;  4K8M A;  4KDU A;  18GS A;  4MZC A;  2I4A A;  3GTU B;  1OE8 A;  1Z6M A;  2IME A;  1K3O A;  1A24 A;  3RPP A;  3DIE A;  2J9H A;  3VPQ A;  2WDU A;  1PSQ A;  5IMV A;  2ZNM A;  3TJB A;  2IFQ A;  4KH7 A;  4J56 E;  5IMZ A;  3TDG A;  2G2Q A;  4PQH A;  1ZMA A;  3HKR A;  3MIX A;  4JRR A;  4E8E A;  2B5E A;  4K6X A;  1ON4 A;  2DJ3 A;  1QK8 A;  3CRT A;  2O89 A;  6GST A;  4FYU A;  1YJ6 A;  2FWF A;  4JBB A;  4Q5R A;  2PPT A;  3FW2 A;  2I81 A;  1RW1 A;  1TP9 A;  2GZZ A;  2R5G A;  4OO4 A;  2EIQ A;  3M0F A;  3IC4 A;  1VF2 A;  2R3X A;  5JWQ B;  3HA9 A;  2N5A A;  1GTI A;  4L5L A;  1MDI A;  3IK7 A;  3F8U A;  2WGR A;  2HE3 A;  1A0R P;  1VF4 A;  4HI7 A;  1U3I A;  4WXT A;  2L5L A;  4BL7 B;  4FQU A;  5FHI A;  3TGZ A;  3FMW A;  4G9H A;  4IS0 A;  1EV4 A;  5DCH A;  3EYT A;  3ME7 A;  2HRK A;  2X99 A;  1NM3 A;  3J7Y b;  1M0U A;  4QL7 A;  4ZBB A;  4N30 A;  5HFG A;  1EOH A;  5G5F A;  1GRX A;  3EU4 A;  5E59 A;  4I8B A;  2X8H A;  3RBT A;  2I3Y A;  3H4K A;  1OC9 B;  2WUL A;  4GXZ A;  1QXH A;  2YJ7 A;  4N10 A;  1TI1 A;  5ELG A;  4TW5 A;  3IRA A;  4GQC A;  4FYC A;  2E7P A;  5ECO B;  4DEJ A;  1TK8 B;  2V6O A;  5B6M A;  4DSQ A;  2CVB A;  5ID2 A;  3ZIJ A;  3DVX A;  2F51 A;  4D73 B;  4MF5 A;  1WRY A;  4IBP A;  3CTF A;  2P5R A;  4NXI A;  1C72 A;  3ZL5 A;  4YQM A;  3IK9 A;  2FWG A;  3K8N A;  1Y25 A;  3EE2 A;  3QD9 A;  8GSS A;  1G6W A;  4OO5 A;  1M9B A;  3BCK A;  3CYN A;  2QA2 A;  1YQ1 A;  2V1M A;  3AY8 A;  2AUV A;  3W6G A;  3GNJ A;  3IOS A;  2C0G A;  3D22 A;  3C7M A;  22GS A;  2JZS A;  1A2J A;  4KF9 A;  3DD3 A;  3SWL A;  2HXK A;  2F8A A;  1Q4J A;  3D0Z A;  1BG5 A;  1YF0 A;  4HEA 2;  1T8E B;  3UAP A;  2L6D A;  2DKI A;  1M3J A;  2GDR A;  4BVX A;  5FT3 A;  3HVV A;  1M9A A;  3EMP A;  3GKK A;  4POM A;  2FNO A;  4GQF A;  3IA1 A;  4K5S A;  2O85 A;  4RI7 A;  3TKS C;  3I69 A;  2DML A;  4MZB A;  1FB6 A;  3GMF A;  2L57 A;  5AGY A;  3UEM A;  5G1K A;  2E0Q A;  2A4V A;  3VPT A;  3KJY A;  2MYG A;  3Q74 A;  4XS1 A;  4ECI A;  2I1U A;  2BJX A;  3EUR A;  2DJ1 A;  5HFI A;  2DJ2 A;  4ZBA A;  2VO4 A;  1SU9 A;  1WPI A;  3DEX A;  6GSU A;  1TRW A;  1O85 A;  1N2A A;  1FAA A;  5ECL B;  4CY8 A;  4WEY A;  3L9S A;  2GSR A;  1ZCP A;  1XW5 A;  2H1G A;  3DVW A;  3EIN A;  2LEG A;  1THX A;  1H4O A;  2H0H A;  4IJI A;  3VWW A;  1U3A A;  1B8X A;  5DAK A;  14GS A;  3F4S A;  1OC3 A;  4ZXG A;  5CAX A;  5IIZ A;  3LJR A;  1X5D A;  3ZTL A;  3VI7 A;  5DAL B;  2ON5 A;  3GX8 A;  4DSS B;  1GWC A;  1O81 A;  5D9T A;  3GV1 A;  4XIH A;  3TJK A;  3A2W A;  3GUS A;  1FO5 A;  4ZL9 A;  1BQ7 A;  2HLS A;  4X43 A;  2EIR A;  1K0A A;  2EIO A;  3MYD A;  1JLV A;  3MWH A;  4POL A;  3ZVJ D;  4TXO A;  4K5R A;  3IPZ A;  4NV5 A;  1ACV A;  3WGX A;  1PRX A;  2H30 A;  1JZO A;  3ERF A;  3J7Y k;  4TVE A;  1G6Y A;  1FG4 A;  1PN9 A;  4K7O A;  4YAV A;  2K8S A;  5F07 A;  12GS A;  5CRE A;  1ILO A;  4KSM A;  3FZ5 A;  2GST A;  3KD0 A;  3P8W A;  3GL5 A;  2XPE A;  3Q19 A;  5B8A A;  3H93 A;  5D96 A;  3HZ4 A;  2V32 A;  1IYI A;  3KMO A;  4JZQ A;  2YPM A;  4MZW A;  4XS4 A;  1GUL A;  1LBK A;  3A5W A;  3ZRE A;  4KW6 A;  4NMU A;  2PN8 A;  1Z5Y E;  4LMW A;  2OJL A;  5F0G A;  2HRN A;  2LRN A;  2IIY A;  4RI6 A;  4F2I A;  2YWM A;  3HHV A;  4LL1 B;  3GTU A;  4Z2T A;  4LA1 A;  5GST A;  1J0F A;  3PIN A;  3HVS A;  4RUV A;  3ISO A;  2YWN A;  4QL9 A;  2IMK A;  1WE0 A;  2FA4 A;  2LKU A;  2KHP A;  3HVX A;  2HT9 A;  3UBL A;  4BPY A;  4P3Y B;  5GAP D;  3KH9 A;  3NOF A;  2HNL A;  5B8B A;  3LOR A;  3APQ A;  1TXX A;  4WF5 A;  5B6N A;  2YOI A;  4MF6 A;  1XWA A;  1GUM A;  2VL3 A;  4G0I A;  3VUR A;  2PUK C;  3GRX A;  4KUN A;  3I43 A;  4CY6 A;  2DKH A;  4AJ8 A;  1GSF A;  2IMD A;  1GTB A;  1DUG A;  3BD2 A;  1ZYE A;  2QC7 A;  4X0X A;  1USB A;  3C73 A;  2B7K A;  5HQP A;  2AV4 A;  3L9V A;  3KIJ A;  3FZ9 A;  2DBC A;  2C0F A;  2PVO C;  4JE1 A;  4IGJ A;  1T7P B;  1TI3 A;  2JL4 A;  1H75 A;  2OBK A;  2PBJ A;  1R7H A;  1SYX A;  4WKW A;  3RPN A;  2H0I A;  1PFO A;  2H01 A;  4BL7 A;  3F3Q A;  3GHA A;  2L6C A;  1PA3 A;  1ERT A;  4O32 A;  1AAZ A;  2E2M A;  2FWH A;  1EZK A;  2NPB A;  2RUE A;  2VCQ A;  1FOV A;  5CYY A;  1O8W A;  3VFI A;  3GUR A;  3R2Q A;  2CA8 A;  2F9S A;  4EKZ A;  3KXO A;  1V2A A;  3KP8 A;  4AJ6 A;  4ECJ A;  1OC9 A;  3FR9 A;  5IOX A;  9GSS A;  1G0T A;  1OAZ A;  1QFN A;  4F9Z A;  3IC8 A;  1SKR B;  4YKG A;  4MJC A;  2OBI A;  2ON7 A;  2YZU A;  1E6B A;  2MMN A;  4K7N A;  3MSZ A;  2GZY A;  3F9U A;  5AIX A;  2O87 A;  2IL3 A;  1JHB A;  3FK8 A;  4MH3 A;  3IHQ A;  4TXV A;  1TU8 A;  4N0Z A;  2VLT A;  4GRF A;  4EF0 A;  1PQN A;  2OE3 A;  4POK A;  1GLQ A;  4MH2 A;  2VL2 C;  4TRX A;  3IE3 A;  1GUH A;  1G7O A;  3H8Q A;  3KH7 A;  4OCE A;  3P2A A;  2VLU A;  3ED3 A;  3G7I A;  4RQX A;  3DML A;  1HQO A;  3O76 A;  4N0V A;  1O73 A;  2ALB A;  4IVF A;  3PGT A;  2QA1 A;  2LS5 A;  2ZCT A;  3JCM L;  4HU7 A;  5BMU A;  4AF2 A;  1GTA A;  1XW6 A;  5J5N A;  6GSW A;  1X9W B;  4DSR A;  1X5C A;  1PL2 A;  5H5Q A;  5ECM B;  1PN0 A;  1VF3 A;  3D4T A;  3N5O A;  3FR3 A;  2FHE A;  1NHO A;  1AW9 A;  1UVZ A;  4OFM A;  3U5R E;  4ZL7 A;  1M3I A;  5KOW A;  3CSI A;  1GLP A;  3P90 A;  4TOP A;  3UBK A;  1GH2 A;  1NHY A;  2DLX A;  1CQG A;  1K3Y A;  1S3R A;  2JSZ A;  1S3A A;  1PD2 1;  1GSE A;  2CX3 A;  4K7I A;  3VWV A;  3M8N A;  1ZYP A;  1EV9 A;  3FHK A;  3TCO A;  2GT6 A;  3C1R A;  4L0U A;  3IBH A;  2GSS A;  3HYP A;  1YKA A;  5IMF A;  5J9B A;  6GSX A;  2RII A;  3QMX A;  1BYE A;  2A4H A;  3UVT A;  3QAV A;  1M99 A;  3C71 A;  2B1L A;  1SL0 B;  2VD1 A;  4GLT A;  3LFL A;  2JAC A;  2TRC P;  5FWG A;  2J23 A;  3GST A;  10GS A;  2EC4 A;  4MPF A;  4N11 A;  5DAL A;  1U6T A;  1YEX A;  4DSS A;  2KP2 A;  4KB3 A;  4ICY A;  5G1L A;  2HRA A;  5B7C A;  1SJZ A;  1VF1 A;  1XCC A;  3KM6 A;  1X5E A;  5HR2 A;  3KMN A;  1F37 A;  2R0G A;  5CRH A;  4TR3 A;  2K6V A;  1AQX A;  4ZL8 A;  1YF1 A;  5KEJ A;  5J3R A;  1AIU A;  2B5Y A;  1R26 A;  4JU5 A;  1GP1 A;  2L5O A;  2VAF A;  2IMF A;  2C0E A;  3QAG A;  1OKD A;  4KCE A;  2P0G A;  4MAB A;  4K2X A;  4O7H A;  5J41 A;  4O5Q A;  1XZO A;  2K18 A;  3M9K A;  5H5R A;  4EVM A;  2A2R A;  3HJM A;  4EL1 A;  3CSJ A;  1EOG A;  2OE0 A;  1SJI A;  2RLI A;  2H73 A;  2DJ0 A;  2VM1 A;  1OVN A;  1X9M B;  4NWY A;  5DBQ A;  3VWU A;  3IAS 2;  2E2G A;  4I5Q A;  1O8X A;  3ZML A;  1WOU A;  4DVC A;  3LXZ A;  1B9Y C;  5IMD A;  2H76 A;  2JU5 A;  1ZOF A;  2JZT A;  5IMC A;  2DSA A;  4MA9 A;  4MPG A;  3A2X A;  1OKT A;  2PVQ A;  3ERG A;  4F82 A;  5J9C A;  4PQ1 A;  3WYW A;  4LLR A;  3VI5 A;  3VWX A;  3FR6 A;  1M2B A;  4MK3 A;  2GT5 A;  2IFQ B;  2HSY A;  1CQH A;  1F3A A;  1K0C A;  4RQR A;  3F4R A;  5ENU A;  2LQO A;  3DGQ A;  3ZFL A;  4KAE A;  5DJL A;  2VCV A;  2C3Q A;  1SYR A;  1A8L A;  3QFB C;  4Z2R A;  3LWA A;  4V2L A;  1JZD A;  3KZQ A;  3LQ7 A;  2VCW A;  5AIV A;  4KDY A;  1SKW B;  4CW9 A;  4HSC X;  4PXO A;  4PUF C;  5JCU A;  1QQ2 A;  1T4Y A;  4LL4 B;  4XCS A;  2OAD A;  3F3R A;  4GTU A;  5IM9 A;  3GIX A;  3HD5 A;  4KX4 A;  2CT6 A;  5HFK A;  1T4Z A;  4TR1 B;  1QMV A;  4BWS A;  2H70 A;  4HJM A;  1U87 A;  1QGV A;  1URM A;  1XOA A;  4ZIJ A;  1NSW A;  2XPD A;  3L78 A;  1Y6E A;  3ZIT A;  3BOA A;  2P5Q A;  4ZB9 A;  3I9V 2;  3TJF A;  5BRT A;  5ECH B;  4V1A g;  4K9Z A;  4L5O A;  3G7J A;  4MJA A;  1MDK A;  2O8V B;  1GSU A;  3CBU A;  4HQS A;  2LQQ A;  1JLW A;  5H5S A;  2X8G A;  1KNG A;  4PQI A;  5HR0 A;  2FUG 2;  3IR4 A;  2DJK A;  3Q18 A;  4G2E A;  3TRX A;  2YJH A;  4PUR A;  5DQY A;  1EEJ A;  3L4N A;  2L4C A;  1KBN A;  5F05 A;  1Z7P A;  3QAW A;  2HYX A;  3UVH A;  1M2D A;  3N9J A;  3HY2 A;  5ECN B;  1XG8 A;  3CTG A;  5CRW A;  1EP8 A;  1OYJ A;  2A2P A;  3NIV A;  3TOT A;  3W8J A;  4OCF A;  2RUF A;  4AGS A;  3EMX A;  2H1A A;  5D9W A;  4A5P A;  1TU7 A;  4HZ2 A;  1HYU A;  4MDC A;  2GVP A;  2CQ9 A;  3EVI A;  3L9U A;  3VK9 A;  4ID0 A;  1F3B A;  2L59 A;  1F9M A;  1U88 A;  2XBI A;  4YAP A;  2CVD A;  2HZE B;  2A2S A;  5COH A;  3ZZX A;  3FYG A;  3EC3 A;  2X8C A;  4EDY A;  1B9X C;  3L0H A;  1YY7 A;  1EEM A;  4ILF A;  3UJ1 A;  4EE0 A;  2GSQ A;  4K0N A;  2Z9S A;  2F3M A;  4IN0 A;  1SL1 B;  1S3D A;  5KN3 A;  2NBS A;  6GSS A;  2KP1 A;  1UN2 A;  4TR0 A;  3FZA A;  2FY6 A;  5C00 A;  1F2E A;  4I6X A;  1YDK A;  3RDW A;  1MDJ A;  1SK2 A;  4I97 A;  5GAN D;  2HZF A;  2YNX A;  1SL2 B;  1A23 A;  4EC0 A;  4ULX A;  2KLX A;  1SD9 A;  1BED A;  5AIS A;  4I2T A;  3APO A;  5EL8 A;  4F0B A;  4NV2 A;  1TW9 A;  4ZB6 A;  4EIQ A;  1VGL A;  4ZBD A;  5G2Z A;  2O7K A;  5HR1 A;  2TIR A;  1SEN A;  3GKM A;  1A8Y A;  3TKQ A;  2H71 A;  1OE7 A;  5IQY A;  1PX7 A;  2NDO A;  3BCI A;  1G7E A;  4Q5F A;  4ISD A;  2YWO A;  3I6A A;  5EY6 A;  5IPG A;  3UMA A;  3HJO A;  2LNS A;  1GL8 A;  3E0U A;  5G30 A;  3US3 A;  4KGI A;  3GH6 A;  2C0D A;  1TOF A;  1GSD A;  1UC7 A;  2C3T A;  2M72 A;  2R6K A;  1AUC A;  4KE3 A;  3CMI A;  3DWV A;  2DC5 A;  4E8H A;  3TUE A;  4I2U A;  4BIK A;  3QR6 A;  5IPH A;  5DCG A;  4FIW A;  2M80 A;  4ML6 A;  2AHE A;  3KCM A;  3D6I A;  3PPU A;  4OFN A;  3DKS A;  4AJ7 A;  3HZ8 A;  2GQM A;  4HDE A;  4D73 A;  2LST A;  1WMJ A;  4HS1 A;  4G0K A;  5IO0 A;  5JCW A;  2H74 A;  1KTE A;  4OMV A;  2MMO A;  1BJX A;  1YEP A;  1Z6N A;  2CZ3 A;  2VCX A;  4ECC A;  2WB9 A;  4CHS A;  2LTK A;  5EPF A;  1XW9 A;  20GS A;  1A2L A;  3F4T A;  4LMV A;  1GSQ A;  4OWY A;  5F06 A;  4IEL A;  5A4V A;  3KEB A;  4MLY A;  2MBT A;  2WJU A;  2YP6 A;  3NZN A;  2VCZ A;  5CNW A;  4MJB A;  3PH9 A;  1B48 A;  1ST9 A;  3F63 A;  2WCI A;  3VLN A;  3RHB A;  3LW9 A;  2H66 A;  1IYH A;  3V1W A;  4XS4 B;  4HOJ A;  4XRA A;  3ZFB A;  1T1V A;  4EIP A;  1VRS D;  4POB A;  4HU9 A;  2B7J A;  2GZP A;  1HNB A;  4BVY B;  3IXR A;  4PNG A;  5GSS A;  1N8J A;  3TKS E;  2IN3 A;  5LD0 A;  4L8E A;  5KN0 A;  4NHZ A;  1XFL A;  2D2Z A;  4G19 A;  2R37 A;  1EWX A;  4PTS A;  2CX4 A;  1K0N A;  4EO3 A;  5G5E A;  4TN8 A;  1J08 A;  4YKF A;  4PX1 A;  1V98 A;  1LJR A;  4USS A;  2CV4 A;  4NAX A;  2GGT A;  5ECR B;  1MEK A;  2HFD A;  4ACS A;  2VOC A;  1V58 A;  1FHE A;  4MP4 A;  2GQL A;  1FVK A;  2PU9 C;  1TK0 B;  4JED A;  4O5U A;  5IOW A;  2GQK A;  4K1F A;  5F8B A;  5D93 A;  4WBR D;  5LNK e;  2RM6 A;  2G0F A;  4IW9 A;  3LYP A;  4KDX A;  4BA7 A;  1TRU A;  3GN3 A;  2IPA A;  4WBJ A;  1EGR A;  1KEB A;  4YQV A;  2VL9 A;  2B6M A;  2CVK A;  5AN1 A;  5ECI B;  2IWT A;  5LCZ A;  2CAQ A;  1M2A A;  1T00 A;  2X64 A;  2YV9 A;  13GS A;  1I5G A;  1MTC A;  3E3E A;  3MAK A;  5CRD A;  3DYR A;  1PX6 A;  2OAC A;  3QFA C;  4V2N A;  1I9D A;  4ML1 A;  4IP6 A;  3GL3 A;  3IDV A;  2HI7 A;  3LXT A;  4O92 A;  1RK4 A;  3EU3 A;  3ZIV A;  4TR1 A;  4V1A p;  2HRF A;  4WET A;  1O6J A;  2AJQ B;  2XHF A;  3QCP A;  3FY7 A;  3OR5 A;  3M3M A;  2IMI A;  3APS A;  1ERW A;  1XVQ A;  5KN2 A;  4ZIL A;  11GS A;  3GSS A;  4IKH A;  5ABR A;  3FKF A;  3MNG A;  2P31 A;  5DQS A;  5JWR B;  2C3N A;  5GZZ B;  4NHW A;  1X0R A;  5DJM A;  2QGV A;  2JSY A;  3WT1 A;  3ZRD A;  1F6M C;  1SD8 A;  5INY A;  2X4A A;  4J2F A;  5J4U A;  4Q5N A;  1GNE A;  6GSY A;  3PR8 A;  4K0G A;  2XC2 A;  4O5R A;  5ELA A;  2WZ9 A;  2FD3 A;  3GKX A;  4G10 A;  5D73 A;  4KA0 A;  3GH9 A;  2QSI A;  3TKS A;  4WF4 A;  1V40 A;  3LGC A;  2YWI A;  4TKY A;  3U6V A;  3WGD A;  2LUS A;  3D5J A;  1ZYQ B;  1GSY A;  1R5P A;  2GTU A;  4HZ4 A;  2C80 A;  1WP0 A;  1DE2 A;  1ERU A;  3TRQ A;  1ERV A;  5DVB A;  1AXD A;  6GSV A;  4IP1 A;  2H75 A;  2R0P A;  4JR6 A;  5ECS A;  1A0F A;  2WFC A;  3GA4 A;  1ML6 A;  2FWE A;  4XTS A;  3ZVJ A;  1ZYN A;  5JWO B;  1A2M A;  2H6X A;  1Q98 A;  4WR5 A;  1GUK A;  2R2J A;  2YAN A;  1B4Q A;  2JZR A;  2FA8 A;  1Z9H A;  2H6Y A;  5ECP B;  2HZE A;  1J9B A;  3HCZ A;  2LNT A;  2XBQ A;  2YV7 A;  5D8I A;  2PER A;  4K2D A;  1PKW A;  2KOK A;  3F6F A;  2LJK A;  1E2Y A;  2V2G A;  1SK1 A;  1WJK A;  1FW1 A;  4PNF A;  3M1G A;  3CSH A;  3CXG A;  3ZYW A;  1WIK A;  2H8L A;  3LSZ A;  3TKP A;  2R4V A;  4PUA A;  2KUC A;  1X9S B;  1ZL9 A;  4MMM A;  4Q5Q A;  5EVO A;  1B4P A;  3R3E A;  3UOM A;  3F6D A;  2B1K A;  3GYK A;  4X1U A;  4KCA A;  5G31 A;  3RHC A;  2L4Q A;  1TRS A;  2WS2 A;  3A5I A;  1K3L A;  1K0D A;  2FGX A;  1O7U A;  3O6T A;  2OKA A;  4Z7X A;  2PMT A;  3KTL A;  3QPM A;  1V9W A;  2WRT A;  2H72 A;  1RQM A;  3CRU A;  2VCT A;  1TRV A;  2DIZ A;  4FH8 A;  3M9J A;  1LU4 A;  2B3S A;  5D9V A;  5ECK B;  3GFK A;  3A2V A;  1XBS A;  4XHM A;  2VIM A;  1QUW A;  2LRT A;  2I9H A;  3LEF A;  2K9F A;  3H1N A;  3IHG A;  1TDI A;  3UAR A;  3TJJ A;  1Z7R A;  1XXU A;  1AC1 A;  4EXJ A;  1XWB A;  3EWL A;  3W8S A;  4IQA A;  4GSS A;  4HQZ A;  2NTO A;  2K8V A;  2REM A;  4HJ2 A;  4FYB A;  4MF7 A;  3DXB A;  4Z2U A;  3KP9 A;  5IMA A;  3SBC A;  3CQF A;  2OA7 A;  1SKS B;  5D9X A;  5CRG A;  1FB0 A;  1WWJ A;  2AB6 A;  4L0W A;  3A3T A;  3QOU A;  2N5B A;  1HNA A;  1S3C A;  1PL1 A;  2VUP A;  2ZUP A;  4V2M A;  2MBS A;  3KGK A;  5ID2 B;  1YKC A;  4WR4 A;  3C8E A;  1OC8 A;  2H19 A;  4TR4 A;  4GSN A;  7GSS A;  5KOX A;  1PGT A;  1GSS A;  3E9J B;  2BTO T;  2N5F A;  4MNN A;  2CZ2 A;  1YZX A;  3F0I A;  2H6Z A;  3FZ4 A;  4ECB A;  1TJD A;  2V41 A;  4IJ3 A;  3HJP A;  4NPB A;  3GX0 A;  3RAZ A;  5A4W A;  2MZC A;  1GNW A;  1JZR A;  3D4M A;  5CO3 A;  3WT2 A;  1SK0 A;  2YCD A;  4KSO A;  1XVW A;  2QKE A;  4BVY A;  1NW2 A;  4GST A;  3HDC A;  5JCG A;  3ZMK A;  4YH2 A;  4IHU A;  2LJR A;  1DSB A;  5CP1 A;  5HR3 A;  3TKR A;  3LYK A;  2DJJ A;  3Q6O A;  2MMA A;  2AAW A;  3DRN A;  2HSH A;  3D21 A;  3WD6 A;  4MCU A;  1GTU A;  2VD0 A;  2V6K A;  3WGE A;  1TKD B;  4BVX B;  4MJE A;  2H0G A;  4F03 A;  2TRX A;  4GCI A;  2YZH A;  1EGO A;  2OE1 A;  2PGT A;  1M7T A;  1XWC A;  2H1D A; 
#chains in the Genus database with same CATH homology
 3TB2 A;  1JZW A;  3IV4 A;  1AQV A;  2RM5 A;  2FCH A;  3BJ5 A;  3ZLP A;  3TRP A;  2NVL A;  2FLS A;  3QDN A;  3TJG A;  4G0L A;  3FRC A;  3GKN A;  4QQ7 A;  2C8U A;  4XS6 A;  4YQU A;  1R4W A;  5IO2 A;  4OD7 A;  1ABA A;  2MMZ A;  4KND A;  2LV3 A;  4H86 A;  2M46 A;  2YN1 A;  2IJY A;  4XRD A;  2BMX A;  1XPV A;  3ME8 A;  5A5K A;  4EDZ A;  3P7X A;  1K0B A;  2UZ8 A;  2C4J A;  1ZGN A;  4FO5 A;  4HUA A;  1JFU A;  4CDO A;  1TK5 B;  17GS A;  1THO A;  4JR4 A;  1DE1 A;  3BBY A;  2AYT A;  3UL3 A;  1FVJ A;  19GS A;  1MD3 A;  1XWG A;  1K0O A;  1XIY A;  2F8F A;  2GS3 A;  3EPT A;  3HXS A;  4IQ1 A;  1W89 A;  5L71 A;  2VL2 A;  1AQW A;  4OFT A;  1R5A A;  1HNC A;  2H1B A;  4GWR A;  3H79 A;  16GS A;  3MDK A;  1PKZ A;  1PMT A;  2B5X A;  5DAK B;  1XWK A;  2HSM A;  5A4U A;  1BX9 A;  2R0C A;  5KN1 A;  3LG6 A;  2X49 A;  1HD2 A;  2DMM A;  3S9F A;  5DDL A;  1UA5 A;  3UIW A;  3G9B A;  5ECQ B;  2DIY A;  3O3T A;  2C1Y A;  3ERW A;  2LJA A;  2LRC A;  4TXO B;  5E4W A;  2VLV A;  4J57 E;  1XOB A;  1DBY A;  4GF0 A;  1V57 A;  1T3B A;  3G7Y A;  3IAM 2;  1W4V A;  2CAI A;  2VM2 A;  4EUY A;  2JAD A;  1FOH A;  1Z3E A;  4PGT A;  3TOU A;  1SJ6 A;  3KTB A;  2GLR A;  4F0C A;  4X4J A;  1BAY A;  2PWJ A;  1TTZ A;  1ZZY A;  5C04 A;  1MD4 A;  1K0M A;  3C1S A;  3FEU A;  4ZB8 A;  1EP7 A;  4BWQ A;  2ES7 A;  4K8M A;  4KDU A;  18GS A;  4MZC A;  2I4A A;  3GTU B;  1OE8 A;  1Z6M A;  2IME A;  1K3O A;  1A24 A;  3RPP A;  3DIE A;  2J9H A;  3VPQ A;  2WDU A;  1PSQ A;  5IMV A;  2ZNM A;  3TJB A;  2IFQ A;  4KH7 A;  4J56 E;  5IMZ A;  3TDG A;  2G2Q A;  4PQH A;  1ZMA A;  3HKR A;  3MIX A;  4JRR A;  4E8E A;  2B5E A;  4K6X A;  1ON4 A;  2DJ3 A;  1QK8 A;  3CRT A;  2O89 A;  6GST A;  4FYU A;  1YJ6 A;  2FWF A;  4JBB A;  4Q5R A;  2PPT A;  3FW2 A;  2I81 A;  1RW1 A;  1TP9 A;  2GZZ A;  2R5G A;  4OO4 A;  2EIQ A;  3M0F A;  3IC4 A;  1VF2 A;  2R3X A;  5JWQ B;  3HA9 A;  2N5A A;  1GTI A;  4L5L A;  1MDI A;  3IK7 A;  3F8U A;  2WGR A;  2HE3 A;  1A0R P;  1VF4 A;  4HI7 A;  1U3I A;  4WXT A;  2L5L A;  4BL7 B;  4FQU A;  5FHI A;  3TGZ A;  3FMW A;  4G9H A;  4IS0 A;  1EV4 A;  5DCH A;  3EYT A;  3ME7 A;  2HRK A;  2X99 A;  1NM3 A;  3J7Y b;  1M0U A;  4QL7 A;  4ZBB A;  4N30 A;  5HFG A;  1EOH A;  5G5F A;  1GRX A;  3EU4 A;  5E59 A;  4I8B A;  2X8H A;  3RBT A;  2I3Y A;  3H4K A;  1OC9 B;  2WUL A;  4GXZ A;  1QXH A;  2YJ7 A;  4N10 A;  1TI1 A;  5ELG A;  4TW5 A;  3IRA A;  4GQC A;  4FYC A;  2E7P A;  5ECO B;  4DEJ A;  1TK8 B;  2V6O A;  5B6M A;  4DSQ A;  2CVB A;  5ID2 A;  3ZIJ A;  3DVX A;  2F51 A;  4D73 B;  4MF5 A;  1WRY A;  4IBP A;  3CTF A;  2P5R A;  4NXI A;  1C72 A;  3ZL5 A;  4YQM A;  3IK9 A;  2FWG A;  3K8N A;  1Y25 A;  3EE2 A;  3QD9 A;  8GSS A;  1G6W A;  4OO5 A;  1M9B A;  3BCK A;  3CYN A;  2QA2 A;  1YQ1 A;  2V1M A;  3AY8 A;  2AUV A;  3W6G A;  3GNJ A;  3IOS A;  2C0G A;  3D22 A;  3C7M A;  22GS A;  2JZS A;  1A2J A;  4KF9 A;  3DD3 A;  3SWL A;  2HXK A;  2F8A A;  1Q4J A;  3D0Z A;  1BG5 A;  1YF0 A;  4HEA 2;  1T8E B;  3UAP A;  2L6D A;  2DKI A;  2GDR A;  4BVX A;  5FT3 A;  3HVV A;  1M9A A;  3EMP A;  3GKK A;  4POM A;  2FNO A;  4GQF A;  3IA1 A;  4K5S A;  2O85 A;  4RI7 A;  3TKS C;  3I69 A;  2DML A;  4MZB A;  1FB6 A;  3GMF A;  2L57 A;  5AGY A;  3UEM A;  5G1K A;  2E0Q A;  2A4V A;  3VPT A;  3KJY A;  2MYG A;  3Q74 A;  4XS1 A;  4ECI A;  2I1U A;  2BJX A;  3EUR A;  2DJ1 A;  5HFI A;  2DJ2 A;  4ZBA A;  2VO4 A;  1SU9 A;  1WPI A;  3DEX A;  6GSU A;  1TRW A;  1O85 A;  1N2A A;  1FAA A;  5ECL B;  4CY8 A;  4WEY A;  3L9S A;  2GSR A;  1ZCP A;  1XW5 A;  2H1G A;  3DVW A;  3EIN A;  2LEG A;  1THX A;  1H4O A;  2H0H A;  4IJI A;  3VWW A;  1U3A A;  1B8X A;  5DAK A;  14GS A;  3F4S A;  1OC3 A;  4ZXG A;  5CAX A;  5IIZ A;  3LJR A;  1X5D A;  3ZTL A;  3VI7 A;  5DAL B;  2ON5 A;  3GX8 A;  4DSS B;  1GWC A;  1O81 A;  5D9T A;  3GV1 A;  4XIH A;  3TJK A;  3A2W A;  3GUS A;  1FO5 A;  4ZL9 A;  1BQ7 A;  2HLS A;  4X43 A;  2EIR A;  1K0A A;  2EIO A;  3MYD A;  1JLV A;  3MWH A;  4POL A;  3ZVJ D;  4TXO A;  4K5R A;  3IPZ A;  4NV5 A;  1ACV A;  3WGX A;  1PRX A;  2H30 A;  1JZO A;  3ERF A;  3J7Y k;  4TVE A;  1G6Y A;  1FG4 A;  1PN9 A;  4K7O A;  4YAV A;  2K8S A;  5F07 A;  12GS A;  5CRE A;  1ILO A;  4KSM A;  3FZ5 A;  2GST A;  3KD0 A;  3P8W A;  3GL5 A;  2XPE A;  3Q19 A;  5B8A A;  3H93 A;  5D96 A;  3HZ4 A;  2V32 A;  1IYI A;  3KMO A;  4JZQ A;  2YPM A;  4MZW A;  4XS4 A;  1GUL A;  1LBK A;  3A5W A;  3ZRE A;  4KW6 A;  4NMU A;  2PN8 A;  1Z5Y E;  4LMW A;  2OJL A;  5F0G A;  2HRN A;  2LRN A;  2IIY A;  4RI6 A;  4F2I A;  2YWM A;  3HHV A;  4LL1 B;  3GTU A;  4Z2T A;  4LA1 A;  5GST A;  1J0F A;  3PIN A;  3HVS A;  4RUV A;  3ISO A;  2YWN A;  4QL9 A;  2IMK A;  1WE0 A;  2FA4 A;  2LKU A;  2KHP A;  3HVX A;  2HT9 A;  3UBL A;  4BPY A;  4P3Y B;  5GAP D;  3KH9 A;  3NOF A;  2HNL A;  5B8B A;  3LOR A;  3APQ A;  1TXX A;  4WF5 A;  5B6N A;  2YOI A;  4MF6 A;  1XWA A;  1GUM A;  2VL3 A;  4G0I A;  3VUR A;  2PUK C;  3GRX A;  4KUN A;  3I43 A;  4CY6 A;  2DKH A;  4AJ8 A;  1GSF A;  2IMD A;  1GTB A;  1DUG A;  3BD2 A;  1ZYE A;  2QC7 A;  4X0X A;  1USB A;  3C73 A;  2B7K A;  5HQP A;  2AV4 A;  3L9V A;  3KIJ A;  3FZ9 A;  2DBC A;  2C0F A;  2PVO C;  4JE1 A;  4IGJ A;  1T7P B;  1TI3 A;  2JL4 A;  1H75 A;  2OBK A;  2PBJ A;  1R7H A;  1SYX A;  4WKW A;  3RPN A;  2H0I A;  2H01 A;  4BL7 A;  3F3Q A;  3GHA A;  2L6C A;  1PA3 A;  1ERT A;  4O32 A;  1AAZ A;  2E2M A;  2FWH A;  1EZK A;  2NPB A;  2RUE A;  2VCQ A;  1FOV A;  5CYY A;  1O8W A;  3VFI A;  3GUR A;  3R2Q A;  2CA8 A;  2F9S A;  4EKZ A;  3KXO A;  1V2A A;  3KP8 A;  4AJ6 A;  4ECJ A;  1OC9 A;  3FR9 A;  5IOX A;  9GSS A;  1G0T A;  1OAZ A;  1QFN A;  4F9Z A;  3IC8 A;  1SKR B;  4YKG A;  4MJC A;  2OBI A;  2ON7 A;  2YZU A;  1E6B A;  2MMN A;  4K7N A;  3MSZ A;  2GZY A;  3F9U A;  5AIX A;  2O87 A;  2IL3 A;  1JHB A;  3FK8 A;  4MH3 A;  3IHQ A;  4TXV A;  1TU8 A;  4N0Z A;  2VLT A;  4GRF A;  4EF0 A;  1PQN A;  2OE3 A;  4POK A;  1GLQ A;  4MH2 A;  2VL2 C;  4TRX A;  3IE3 A;  1GUH A;  1G7O A;  3H8Q A;  3KH7 A;  4OCE A;  3P2A A;  2VLU A;  3ED3 A;  3G7I A;  4RQX A;  3DML A;  1HQO A;  3O76 A;  4N0V A;  1O73 A;  2ALB A;  4IVF A;  3PGT A;  2QA1 A;  2LS5 A;  2ZCT A;  3JCM L;  4HU7 A;  5BMU A;  4AF2 A;  1GTA A;  1XW6 A;  5J5N A;  6GSW A;  1X9W B;  4DSR A;  1X5C A;  1PL2 A;  5H5Q A;  5ECM B;  1PN0 A;  1VF3 A;  3D4T A;  3N5O A;  3FR3 A;  2FHE A;  1NHO A;  1AW9 A;  1UVZ A;  4OFM A;  3U5R E;  4ZL7 A;  5KOW A;  3CSI A;  1GLP A;  3P90 A;  4TOP A;  3UBK A;  1GH2 A;  1NHY A;  2DLX A;  1CQG A;  1K3Y A;  2JSZ A;  1S3A A;  1PD2 1;  1GSE A;  2CX3 A;  4K7I A;  3VWV A;  3M8N A;  1ZYP A;  1EV9 A;  3FHK A;  3TCO A;  2GT6 A;  3C1R A;  4L0U A;  3IBH A;  2GSS A;  3HYP A;  1YKA A;  5IMF A;  5J9B A;  6GSX A;  2RII A;  3QMX A;  1BYE A;  2A4H A;  3UVT A;  3QAV A;  1M99 A;  3C71 A;  2B1L A;  1SL0 B;  2VD1 A;  4GLT A;  3LFL A;  2JAC A;  2TRC P;  5FWG A;  2J23 A;  3GST A;  10GS A;  2EC4 A;  4MPF A;  4N11 A;  5DAL A;  1U6T A;  1YEX A;  4DSS A;  2KP2 A;  4KB3 A;  4ICY A;  5G1L A;  2HRA A;  5B7C A;  1SJZ A;  1VF1 A;  1XCC A;  3KM6 A;  1X5E A;  5HR2 A;  3KMN A;  1F37 A;  2R0G A;  5CRH A;  4TR3 A;  2K6V A;  1AQX A;  4ZL8 A;  1YF1 A;  5KEJ A;  5J3R A;  1AIU A;  2B5Y A;  1R26 A;  4JU5 A;  1GP1 A;  2L5O A;  2VAF A;  2IMF A;  2C0E A;  3QAG A;  1OKD A;  4KCE A;  2P0G A;  4MAB A;  4K2X A;  4O7H A;  5J41 A;  4O5Q A;  1XZO A;  2K18 A;  3M9K A;  5H5R A;  4EVM A;  2A2R A;  3HJM A;  4EL1 A;  3CSJ A;  1EOG A;  2OE0 A;  1SJI A;  2RLI A;  2H73 A;  2DJ0 A;  2VM1 A;  1OVN A;  1X9M B;  4NWY A;  5DBQ A;  3VWU A;  3IAS 2;  2E2G A;  4I5Q A;  1O8X A;  3ZML A;  1WOU A;  4DVC A;  3LXZ A;  1B9Y C;  5IMD A;  2H76 A;  2JU5 A;  1ZOF A;  2JZT A;  5IMC A;  2DSA A;  4MA9 A;  4MPG A;  3A2X A;  1OKT A;  2PVQ A;  3ERG A;  4F82 A;  5J9C A;  4PQ1 A;  3WYW A;  4LLR A;  3VI5 A;  3VWX A;  3FR6 A;  1M2B A;  4MK3 A;  2GT5 A;  2IFQ B;  2HSY A;  1CQH A;  1F3A A;  1K0C A;  4RQR A;  3F4R A;  5ENU A;  2LQO A;  3DGQ A;  3ZFL A;  4KAE A;  5DJL A;  2VCV A;  2C3Q A;  1SYR A;  1A8L A;  3QFB C;  4Z2R A;  3LWA A;  4V2L A;  1JZD A;  3KZQ A;  3LQ7 A;  2VCW A;  5AIV A;  4KDY A;  1SKW B;  4CW9 A;  4PXO A;  4PUF C;  5JCU A;  1QQ2 A;  1T4Y A;  4LL4 B;  4XCS A;  2OAD A;  3F3R A;  4GTU A;  5IM9 A;  3GIX A;  3HD5 A;  4KX4 A;  2CT6 A;  5HFK A;  1T4Z A;  4TR1 B;  1QMV A;  4BWS A;  2H70 A;  4HJM A;  1U87 A;  1QGV A;  1URM A;  1XOA A;  4ZIJ A;  1NSW A;  2XPD A;  3L78 A;  1Y6E A;  3ZIT A;  3BOA A;  2P5Q A;  4ZB9 A;  3I9V 2;  3TJF A;  5BRT A;  5ECH B;  4V1A g;  4K9Z A;  4L5O A;  3G7J A;  4MJA A;  1MDK A;  2O8V B;  1GSU A;  3CBU A;  4HQS A;  2LQQ A;  1JLW A;  5H5S A;  2X8G A;  1KNG A;  4PQI A;  5HR0 A;  2FUG 2;  3IR4 A;  2DJK A;  3Q18 A;  4G2E A;  3TRX A;  2YJH A;  4PUR A;  5DQY A;  1EEJ A;  3L4N A;  2L4C A;  1KBN A;  5F05 A;  1Z7P A;  3QAW A;  2HYX A;  3UVH A;  1M2D A;  3N9J A;  3HY2 A;  5ECN B;  3CTG A;  5CRW A;  1EP8 A;  1OYJ A;  2A2P A;  3NIV A;  3TOT A;  3W8J A;  4OCF A;  2RUF A;  4AGS A;  3EMX A;  2H1A A;  5D9W A;  4A5P A;  1TU7 A;  4HZ2 A;  1HYU A;  4MDC A;  2GVP A;  2CQ9 A;  3EVI A;  3L9U A;  3VK9 A;  4ID0 A;  1F3B A;  2L59 A;  1F9M A;  1U88 A;  2XBI A;  4YAP A;  2CVD A;  2HZE B;  2A2S A;  5COH A;  3ZZX A;  3FYG A;  3EC3 A;  2X8C A;  4EDY A;  1B9X C;  3L0H A;  1YY7 A;  1EEM A;  4ILF A;  3UJ1 A;  4EE0 A;  2GSQ A;  4K0N A;  2Z9S A;  2F3M A;  4IN0 A;  1SL1 B;  1S3D A;  5KN3 A;  2NBS A;  6GSS A;  2KP1 A;  1UN2 A;  4TR0 A;  3FZA A;  2FY6 A;  5C00 A;  1F2E A;  4I6X A;  1YDK A;  3RDW A;  1MDJ A;  1SK2 A;  4I97 A;  5GAN D;  2HZF A;  2YNX A;  1SL2 B;  1A23 A;  4EC0 A;  4ULX A;  2KLX A;  1SD9 A;  1BED A;  5AIS A;  4I2T A;  3APO A;  5EL8 A;  4F0B A;  4NV2 A;  1TW9 A;  4ZB6 A;  4EIQ A;  1VGL A;  4ZBD A;  5G2Z A;  2O7K A;  5HR1 A;  2TIR A;  1SEN A;  3GKM A;  1A8Y A;  3TKQ A;  2H71 A;  1OE7 A;  5IQY A;  1PX7 A;  2NDO A;  3BCI A;  1G7E A;  4Q5F A;  4ISD A;  2YWO A;  3I6A A;  5EY6 A;  5IPG A;  3UMA A;  3HJO A;  2LNS A;  1GL8 A;  3E0U A;  5G30 A;  3US3 A;  4KGI A;  3GH6 A;  2C0D A;  1TOF A;  1GSD A;  1UC7 A;  2C3T A;  2M72 A;  2R6K A;  1AUC A;  4KE3 A;  3CMI A;  3DWV A;  2DC5 A;  4E8H A;  3TUE A;  4I2U A;  3QR6 A;  5IPH A;  5DCG A;  4FIW A;  2M80 A;  4ML6 A;  2AHE A;  3KCM A;  3D6I A;  3PPU A;  4OFN A;  3DKS A;  4AJ7 A;  3HZ8 A;  2GQM A;  4HDE A;  4D73 A;  2LST A;  1WMJ A;  4HS1 A;  4G0K A;  5IO0 A;  5JCW A;  2H74 A;  1KTE A;  4OMV A;  2MMO A;  1BJX A;  1YEP A;  1Z6N A;  2CZ3 A;  2VCX A;  4ECC A;  2WB9 A;  4CHS A;  2LTK A;  5EPF A;  1XW9 A;  20GS A;  1A2L A;  3F4T A;  4LMV A;  1GSQ A;  4OWY A;  5F06 A;  4IEL A;  5A4V A;  3KEB A;  4MLY A;  2MBT A;  2WJU A;  2YP6 A;  3NZN A;  2VCZ A;  5CNW A;  4MJB A;  3PH9 A;  1B48 A;  1ST9 A;  3F63 A;  2WCI A;  3VLN A;  3RHB A;  3LW9 A;  2H66 A;  1IYH A;  3V1W A;  4XS4 B;  4HOJ A;  4XRA A;  3ZFB A;  1T1V A;  4EIP A;  1VRS D;  4POB A;  4HU9 A;  2B7J A;  2GZP A;  1HNB A;  4BVY B;  3IXR A;  4PNG A;  5GSS A;  1N8J A;  3TKS E;  2IN3 A;  5LD0 A;  4L8E A;  5KN0 A;  4NHZ A;  1XFL A;  2D2Z A;  4G19 A;  2R37 A;  1EWX A;  4PTS A;  2CX4 A;  1K0N A;  4EO3 A;  5G5E A;  4TN8 A;  1J08 A;  4YKF A;  4PX1 A;  1V98 A;  1LJR A;  4USS A;  2CV4 A;  4NAX A;  2GGT A;  5ECR B;  1MEK A;  2HFD A;  4ACS A;  2VOC A;  1V58 A;  1FHE A;  4MP4 A;  2GQL A;  1FVK A;  2PU9 C;  1TK0 B;  4JED A;  4O5U A;  5IOW A;  2GQK A;  4K1F A;  5F8B A;  5D93 A;  4WBR D;  5LNK e;  2RM6 A;  2G0F A;  4IW9 A;  3LYP A;  4KDX A;  4BA7 A;  1TRU A;  3GN3 A;  2IPA A;  4WBJ A;  1EGR A;  1KEB A;  4YQV A;  2VL9 A;  2B6M A;  2CVK A;  5AN1 A;  5ECI B;  2IWT A;  5LCZ A;  2CAQ A;  1M2A A;  1T00 A;  2X64 A;  2YV9 A;  13GS A;  1I5G A;  1MTC A;  3E3E A;  3MAK A;  5CRD A;  3DYR A;  1PX6 A;  2OAC A;  3QFA C;  4V2N A;  1I9D A;  4ML1 A;  4IP6 A;  3GL3 A;  3IDV A;  2HI7 A;  3LXT A;  4O92 A;  1RK4 A;  3EU3 A;  3ZIV A;  4TR1 A;  4V1A p;  2HRF A;  4WET A;  1O6J A;  2AJQ B;  2XHF A;  3QCP A;  3FY7 A;  3OR5 A;  3M3M A;  2IMI A;  3APS A;  1ERW A;  1XVQ A;  5KN2 A;  4ZIL A;  11GS A;  3GSS A;  4IKH A;  5ABR A;  3FKF A;  3MNG A;  2P31 A;  5DQS A;  5JWR B;  2C3N A;  5GZZ B;  4NHW A;  1X0R A;  5DJM A;  2QGV A;  2JSY A;  3WT1 A;  3ZRD A;  1F6M C;  1SD8 A;  5INY A;  2X4A A;  4J2F A;  5J4U A;  4Q5N A;  1GNE A;  6GSY A;  3PR8 A;  4K0G A;  2XC2 A;  4O5R A;  5ELA A;  2WZ9 A;  2FD3 A;  3GKX A;  4G10 A;  5D73 A;  4KA0 A;  3GH9 A;  2QSI A;  3TKS A;  4WF4 A;  1V40 A;  3LGC A;  2YWI A;  4TKY A;  3U6V A;  3WGD A;  2LUS A;  3D5J A;  1ZYQ B;  1GSY A;  1R5P A;  2GTU A;  4HZ4 A;  2C80 A;  1WP0 A;  1DE2 A;  1ERU A;  3TRQ A;  1ERV A;  5DVB A;  1AXD A;  6GSV A;  4IP1 A;  2H75 A;  2R0P A;  4JR6 A;  5ECS A;  1A0F A;  2WFC A;  3GA4 A;  1ML6 A;  2FWE A;  4XTS A;  3ZVJ A;  1ZYN A;  5JWO B;  1A2M A;  2H6X A;  1Q98 A;  4WR5 A;  1GUK A;  2R2J A;  2YAN A;  1B4Q A;  2JZR A;  2FA8 A;  1Z9H A;  2H6Y A;  5ECP B;  2HZE A;  1J9B A;  3HCZ A;  2LNT A;  2XBQ A;  2YV7 A;  5D8I A;  2PER A;  4K2D A;  1PKW A;  2KOK A;  3F6F A;  2LJK A;  1E2Y A;  2V2G A;  1SK1 A;  1WJK A;  1FW1 A;  4PNF A;  3M1G A;  3CSH A;  3CXG A;  3ZYW A;  1WIK A;  2H8L A;  3LSZ A;  3TKP A;  2R4V A;  4PUA A;  2KUC A;  1X9S B;  1ZL9 A;  4MMM A;  4Q5Q A;  5EVO A;  1B4P A;  3R3E A;  3UOM A;  3F6D A;  2B1K A;  3GYK A;  4X1U A;  4KCA A;  5G31 A;  3RHC A;  2L4Q A;  1TRS A;  2WS2 A;  3A5I A;  1K3L A;  1K0D A;  2FGX A;  1O7U A;  3O6T A;  2OKA A;  4Z7X A;  2PMT A;  3KTL A;  3QPM A;  1V9W A;  2WRT A;  2H72 A;  1RQM A;  3CRU A;  2VCT A;  1TRV A;  2DIZ A;  4FH8 A;  3M9J A;  1LU4 A;  2B3S A;  5D9V A;  5ECK B;  3GFK A;  3A2V A;  1XBS A;  4XHM A;  2VIM A;  1QUW A;  2LRT A;  2I9H A;  3LEF A;  2K9F A;  3H1N A;  3IHG A;  1TDI A;  3UAR A;  3TJJ A;  1Z7R A;  1XXU A;  1AC1 A;  4EXJ A;  1XWB A;  3EWL A;  3W8S A;  4IQA A;  4GSS A;  4HQZ A;  2NTO A;  2K8V A;  2REM A;  4HJ2 A;  4FYB A;  4MF7 A;  3DXB A;  4Z2U A;  3KP9 A;  5IMA A;  3SBC A;  2OA7 A;  1SKS B;  5D9X A;  5CRG A;  1FB0 A;  1WWJ A;  2AB6 A;  4L0W A;  3A3T A;  3QOU A;  2N5B A;  1HNA A;  1S3C A;  1PL1 A;  2VUP A;  2ZUP A;  4V2M A;  2MBS A;  3KGK A;  5ID2 B;  1YKC A;  4WR4 A;  3C8E A;  1OC8 A;  2H19 A;  4TR4 A;  4GSN A;  7GSS A;  5KOX A;  1PGT A;  1GSS A;  3E9J B;  2BTO T;  2N5F A;  4MNN A;  2CZ2 A;  1YZX A;  3F0I A;  2H6Z A;  3FZ4 A;  4ECB A;  1TJD A;  2V41 A;  4IJ3 A;  3HJP A;  4NPB A;  3GX0 A;  3RAZ A;  5A4W A;  2MZC A;  1GNW A;  1JZR A;  3D4M A;  5CO3 A;  3WT2 A;  1SK0 A;  2YCD A;  4KSO A;  1XVW A;  2QKE A;  4BVY A;  1NW2 A;  4GST A;  3HDC A;  5JCG A;  3ZMK A;  4YH2 A;  4IHU A;  2LJR A;  1DSB A;  5CP1 A;  5HR3 A;  3TKR A;  3LYK A;  2DJJ A;  3Q6O A;  2MMA A;  2AAW A;  3DRN A;  2HSH A;  3D21 A;  3WD6 A;  4MCU A;  1GTU A;  2VD0 A;  2V6K A;  3WGE A;  1TKD B;  4BVX B;  4MJE A;  2H0G A;  4F03 A;  2TRX A;  4GCI A;  2YZH A;  1EGO A;  2OE1 A;  2PGT A;  1M7T A;  1XWC A;  2H1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...