4PUFC

Complex between the salmonella t3ss effector slrp and its human target thioredoxin-1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
112
structure length
112
Chain Sequence
HHHHHGSMVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase SlrP
publication title The structure of the Slrp-Trx1 complex sheds light on the autoinhibition mechanism of the type III secretion system effectors of the NEL family.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Ligase/oxidoreductase
total genus 28
structure length 112
sequence length 112
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4pufC00
18GSA 2H1AA 1KNGA 4WKWA 1SKSB 2VLUA 3TOUA 3F9UA 1J9BA 4MA9A 5E4WA 3PINA 2VL3A 1B8XA 3F6DA 4ECBA 4PGTA 3UMAA 3ZITA 4TW5A 2DSAA 4WXTA 2VCVA 4F9ZA 4I8BA 4ZBAA 1G6WA 4KB3A 3UOMA 1SD9A 2GTUA 1VRSD 3R2QA 4MLYA 2MZCA 4KX4A 1ZYQB 1T7PB 1HYUA 2YJ7A 4MF5A 2EC4A 2E7PA 1SK2A 3KH7A 5HFKA 3GSTA 1GP1A 3WYWA 3TKSE 3TJKA 1YDKA 2ZCTA 4ECCA 3QPMA 3HVVA 1IYHA 4PQ1A 4ULXA 5DQSA 2IPAA 2C0GA 2B7JA 5DALB 5KN3A 3DVWA 4MCUA 1TRUA 4O92A 1PD21 2VIMA 2YWIA 3OR5A 3UBKA 1MTCA 3GURA 1XZOA 2H71A 2YZHA 1V9WA 1JZWA 4ZB8A 3D22A 1R5PA 3QCPA 4OCFA 2IIYA 5IMDA 2WFCA 4MABA 4FYUA 4E8EA 2H74A 1WMJA 2F51A 3DKSA 3L9VA 2QC7A 1XOAA 4E8HA 1EV9A 4IW9A 4JRRA 1V2AA 3KM6A 7GSSA 5IMCA 1TK8B 2OADA 4TRXA 4EO3A 1ACVA 4RQXA 3KH9A 2KP2A 4ZL8A 3CRUA 3M0FA 1UA5A 1FAAA 4KSOA 1E6BA 1X9SB 1DBYA 3U6VA 2VO4A 3E3EA 1QXHA 1YKAA 3G9BA 4G10A 1FW1A 1EEJA 4L0WA 2M46A 10GSA 4Q5FA 2H1GA 2B1LA 3FZ4A 1T3BA 1WE0A 3NZNA 2VCXA 4ZXGA 3H8QA 4L0UA 1GWCA 2VD0A 1QK8A 1G6YA 3KMNA 2VAFA 1I5GA 1V58A 2C4JA 1RW1A 2D2ZA 2BTOT 2CT6A 5H5SA 2C0DA 3KTBA 4NHWA 1OKTA 3L9SA 3VLNA 4HJMA 4NHZA 4XHMA 4IKHA 4P3YB 2BMXA 3FEUA 5A5KA 3BCKA 3FK8A 1XPVA 4BA7A 1KEBA 3UJ1A 4PX1A 1W4VA 3ZTLA 2RLIA 3KEBA 4YAVA 5ECNB 2HSYA 3DXBA 4YQVA 1NSWA 2FLSA 3FR9A 3ISOA 2WB9A 3BJ5A 4NV2A 5DAKB 2X64A 1WWJA 5CAXA 3TKSA 1VF2A 3VK9A 1N2AA 3IK9A 2CQ9A 3GIXA 4XS4B 3MAKA 3P8WA 2R6KA 3VWVA 2C80A 4OO5A 2PU9C 2JL4A 1I9DA 1ABAA 4OWYA 3BBYA 5KN1A 3P2AA 1N8JA 5E59A 3EURA 2DJ0A 1GSSA 2REMA 1CQHA 2R4VA 4FO5A 4KCAA 1PKZA 1GSDA 3LXZA 3FR3A 2I3YA 4KDXA 5F07A 3I9V2 2IMKA 2YV9A 3E0UA 2FGXA 2MMOA 3M3MA 3LWAA 3ZL5A 2DJ1A 1USBA 3IRAA 5ECQB 4MJCA 4I5QA 2R2JA 1Q98A 3F0IA 1SENA 2MBSA 3P7XA 4LMWA 2ON7A 3KIJA 4EKZA 2X8CA 2GSTA 4WF4A 3FR6A 3ZMKA 1T00A 1GTBA 4POLA 2H72A 3GL3A 5JCWA 3GKMA 4YH2A 2I4AA 1YZXA 3ME8A 1FVJA 4L5LA 2LJAA 1MDIA 4IS0A 4MMMA 3TRPA 2XPDA 3IDVA 4ISDA 1WIKA 4JBBA 3NIVA 3U5RE 2R5GA 5IIZA 3O76A 1O8XA 2K8SA 3TRQA 4GRFA 2FUG2 1MEKA 3TJFA 2LJKA 3O6TA 1UVZA 2G0FA 1AQXA 3HZ8A 1G0TA 2IFQA 2HXKA 4KAEA 5AIXA 2B5YA 3EE2A 1YF1A 3O3TA 3KCMA 2H6ZA 3GL5A 1XCCA 1GSFA 12GSA 5LD0A 1WP0A 1U87A 3WGDA 4XIHA 1F37A 2CAIA 3GYKA 4EF0A 1KTEA 1THOA 2E2GA 1X9MB 2DJKA 1BAYA 1QUWA 3FRCA 2ES7A 4IVFA 4DSQA 4TR4A 3C1SA 1Z6NA 5EY6A 2B6MA 1UC7A 2LRNA 1B48A 1B9XC 5ECLB 3F3RA 2H1BA 4IP1A 1K0OA 4N0VA 1MDJA 2H75A 3UIWA 1CQGA 2L57A 4GWRA 5IOWA 3GUSA 5ID2B 5IPGA 4TXOA 1T4YA 2JACA 4IQAA 2FD3A 5CYYA 3GSSA 4AJ6A 3TKRA 1GTAA 4K6XA 4G19A 3UEMA 3ZVJD 8GSSA 17GSA 1XOBA 1YEPA 4KDYA 2GT5A 1OE7A 2FY6A 2V41A 3I6AA 2KHPA 1OC9A 2LKUA 1XWCA 4Z7XA 2J9HA 3M1GA 4BL7A 5DQYA 1FHEA 3PR8A 2P31A 5CO3A 5GSSA 2GZPA 2FHEA 1X0RA 4G2EA 2LEGA 2TRXA 3IXRA 5IO2A 3CRTA 2YWMA 4Q5RA 3G7JA 3FZ9A 5GAPD 4GTUA 1J0FA 1NHOA 2PN8A 1GUMA 4ZBDA 1OAZA 3CSHA 4K7NA 1GH2A 2GDRA 5D96A 2OACA 3HD5A 3HZ4A 2CZ3A 1ZMAA 4PQHA 5IMZA 4XRDA 2K8VA 3M8NA 2HRNA 2AAWA 4JE1A 1SJ6A 4HJ2A 2HRFA 5G30A 2C0EA 3MWHA 1SYRA 2VM2A 2X99A 4OO4A 2C3QA 1XW6A 1EP8A 1DE2A 1M0UA 2I9HA 2XC2A 4EUYA 3QOUA 2B1KA 5B8BA 1QGVA 5JWOB 1ERVA 1O8WA 1JZOA 3W6GA 4DSRA 4GSNA 2GSQA 1X9WB 2O89A 2V6KA 3DD3A 3E9JB 3J7Yb 1YEXA 1XWKA 1WRYA 2P5QA 1V98A 4CHSA 1K0NA 2TIRA 3GX8A 2GLRA 2N5AA 2Z9SA 1GNWA 2C8UA 1M2BA 4CW9A 1XWAA 1OC8A 2B7KA 2NTOA 6GSVA 4TR1A 2HFDA 6GSTA 1K0CA 3BD2A 2WULA 13GSA 1A0FA 2V2GA 4LMVA 2NPBA 4IBPA 2MMAA 4PXOA 3TDGA 3CMIA 1SL2B 4IQ1A 2RUEA 3GH6A 4MJAA 1PMTA 4N0ZA 3FZ5A 2N5FA 5G1LA 5DJLA 1Z6MA 3KTLA 4V2LA 1XW5A 3ZIJA 2FWHA 2WDUA 2RM5A 2FA4A 4GLTA 2K18A 1M2DA 1GRXA 3BCIA 1TW9A 2G2QA 2DC5A 3ERFA 3GKXA 2WJUA 3KZQA 2H76A 3IHQA 4FYCA 5IQYA 1O73A 1GUKA 4Q5QA 4LL4B 3VPTA 2P0GA 4MZCA 4IN0A 3W8SA 3SWLA 3WT2A 1PN9A 3MDKA 2AYTA 1EOGA 1BG5A 1ST9A 5JCGA 2K9FA 3I43A 2CX4A 1F3AA 4ZL9A 4DEJA 1TU7A 3AY8A 3ZLPA 5C04A 4MF7A 1EOHA 3L4NA 2TRCP 3MNGA 4TXOB 4L8EA 3C8EA 2HZEA 5J3RA 5COHA 2FCHA 3H93A 1PL2A 2OBIA 2CA8A 4NAXA 3UVHA 2B5XA 3LYPA 4RI6A 3HKRA 5D9VA 4MP4A 5B8AA 1LJRA 4F0CA 1PSQA 3F6FA 1YQ1A 3I69A 2YWOA 2GS3A 3VWUA 1TJDA 1Z7RA 3IPZA 2GQKA 3UVTA 4O5RA 3APOA 3US3A 1JZDA 2WRTA 4K2DA 3A2WA 3DMLA 2VCQA 5AISA 1K0MA 3D5JA 3QFAC 1GSUA 5LNKe 1SL1B 5IOXA 2L5OA 2GVPA 1Z3EA 1TK5B 1SL0B 5DCHA 5FT3A 1XXUA 3DGQA 1OE8A 1GL8A 3IC4A 3TUEA 3GX0A 5EPFA 3HJMA 1FG4A 3FW2A 3Q6OA 2BJXA 2HSHA 4ACSA 3DEXA 3LGCA 2GQLA 3H79A 3GV1A 1THXA 2H19A 4K0GA 5GZZB 3APSA 4V1Ag 3TKSC 2H6YA 2IMFA 3V1WA 5G31A 2I1UA 1OVNA 4MH2A 2H1DA 2JZTA 2L4QA 3GH9A 5CRWA 4HZ2A 4BPYA 5J4UA 2CX3A 6GSUA 4WR4A 1XWGA 2VUPA 1VGLA 3QMXA 1XVWA 2V6OA 2GZYA 1FB0A 2H0HA 3RHCA 4HQSA 5CP1A 3QDNA 5D9WA 4IP6A 4HOJA 4ECIA 1V57A 5DCGA 1SYXA 4KGIA 4HQZA 5ECMB 2OE3A 4ZBBA 3CSIA 2O87A 1VF1A 2RM6A 1RK4A 1NM3A 1QMVA 4OFNA 1TU8A 2JADA 4DSSA 1F3BA 3P90A 4V1Ap 2XBQA 2YP6A 1TKDB 2CV4A 1RQMA 2YJHA 1KBNA 1WOUA 4KW6A 5F8BA 3RBTA 1K0DA 1AAZA 3F63A 1EWXA 2ALBA 3VI5A 2K6VA 5J9CA 1EGOA 2IWTA 4WBJA 6GSXA 2C3TA 2NDOA 4I97A 4PNGA 2ZNMA 2R37A 4EVMA 2C0FA 2PERA 5J41A 14GSA 2F9SA 4FH8A 3CBUA 1PRXA 2KLXA 2HLSA 1MD4A 1PL1A 5AGYA 4ZL7A 2DJ3A 1O85A 3ED3A 5IMVA 4XCSA 1A8LA 1XBSA 1LU4A 4RQRA 2L5LA 2DIYA 1M2AA 2OE0A 3GMFA 3IBHA 3KGKA 3ZIVA 1A2JA 4ML6A 5EVOA 3GKKA 2KOKA 5HR2A 5KN0A 4K0NA 4TVEA 4YAPA 4AGSA 1TRSA 3EYTA 2WZ9A 3H1NA 2LS5A 3PH9A 1Z5YE 1S3DA 3GN3A 4BWQA 22GSA 2R3XA 3TJBA 2F8AA 3IK7A 2JZRA 1FVKA 1U3IA 3D0ZA 3GRXA 3TCOA 1SK0A 5ECKB 2O7KA 2H73A 3HJOA 5F0GA 4X1UA 4JZQA 1R5AA 4LA1A 3EINA 20GSA 2IJYA 3LSZA 2PMTA 3RAZA 2OA7A 5AN1A 3L78A 2AUVA 4XS6A 4HU9A 1TK0B 2A2SA 2AB6A 1M99A 4GQFA 4HDEA 2GSSA 3TJJA 4GQCA 3LYKA 3F8UA 1XW9A 2M80A 3CTGA 2VD1A 2B3SA 1JFUA 4YQMA 1A2LA 1SU9A 4POBA 1EEMA 3TJGA 1TTZA 3A2XA 4MH3A 1LBKA 1H75A 4XRAA 4K9ZA 1C72A 2YOIA 3HDCA 4JEDA 5DALA 2PBJA 1T4ZA 2H70A 2LV3A 1K0BA 2YNXA 4LL1B 1EV4A 4Q5NA 5D73A 3F4SA 4MDCA 1JLWA 3LJRA 1F2EA 3L9UA 3FY7A 2HT9A 5JWRB 1A2MA 4HU7A 4KA0A 5EL8A 2EIQA 4RI7A 5ENUA 3QAVA 4IJIA 1OYJA 1ERUA 2OKAA 5DBQA 1HD2A 3HA9A 2H66A 1AQWA 1YY7A 4QL7A 4BVYA 3DRNA 2X8HA 1NHYA 4ID0A 5HR3A 4V2MA 1HNCA 3RDWA 3F4RA 2GT6A 5CREA 3ME7A 1YF0A 4FYBA 1J08A 1SK1A 3ZZXA 1GSQA 5A4UA 4EC0A 2E2MA 3C73A 4K7OA 2H30A 2YN1A 3C71A 2ZUPA 1YJ6A 3D6IA 1O81A 4TKYA 3HXSA 1F6MC 3IOSA 2OJLA 2EIOA 5CRHA 4MZBA 3K8NA 4PUAA 4WETA 3GFKA 1X5DA 2AV4A 4WBRD 5F06A 3IAM2 4HEA2 4KUNA 2L6CA 6GSYA 4ECJA 3ZMLA 3ZRDA 3IR4A 16GSA 1Z7PA 3KJYA 5AIVA 1X5CA 4I6XA 2LSTA 4O7HA 4NMUA 5B6MA 3D21A 3F3QA 5J9BA 1VF3A 4G9HA 5D93A 4RUVA 1BJXA 1PKWA 5G1KA 1ZYEA 3TB2A 1QFNA 5H5QA 2LUSA 4ML1A 1EGRA 2CVKA 4PUFC 1HNBA 4KH7A 5DAKA 3IA1A 2XPEA 2O85A 5ECOB 5INYA 1R4WA 1XIYA 3VURA 4TXVA 3FHKA 4F2IA 1FB6A 1VF4A 4XS4A 1T1VA 4WR5A 4DVCA 1U6TA 1TRWA 2IFQB 4IJ3A 3L0HA 2AJQB 4ZB6A 5ELAA 2HYXA 4OFMA 3J7Yk 2IMDA 4BWSA 1GTUA 2VL2A 5CRGA 3A2VA 1MD3A 5J5NA 2EIRA 3FYGA 1GSEA 4N11A 3TOTA 1F9MA 3IV4A 5ECRB 1XVQA 3CSJA 3M9KA 1GNEA 4L5OA 5G5FA 1PGTA 3UBLA 3LQ7A 2HE3A 1ILOA 2CVBA 2PVQA 2JU5A 3EVIA 4BVXA 4EDZA 2PWJA 3APQA 1K3YA 4HZ4A 3EU4A 3GTUA 19GSA 4LLRA 3GKNA 2PGTA 1AW9A 2HNLA 3SBCA 3UARA 2QGVA 3S9FA 3MSZA 2P5RA 4XS1A 2GZZA 2J23A 5IM9A 4J57E 4MZWA 2LQOA 2FWEA 2V32A 4MF6A 4YQUA 4GSTA 3IE3A 4MPFA 3W8JA 4TR3A 3QFBC 5LCZA 1M7TA 1OC9B 1SJZA 2C3NA 5ABRA 1U3AA 2PPTA 3M9JA 3UAPA 1AUCA 1R7HA 2FWFA 2YCDA 4MK3A 1M9AA 3LXTA 2YANA 2NVLA 2VCZA 2F3MA 2JZSA 1Y6EA 2N5BA 6GSSA 2A2RA 5D9TA 4EL1A 5ECHB 3HVXA 5D9XA 3D4TA 4POMA 1OC3A 2DIZA 1EZKA 4MJEA 4ZILA 5CNWA 2QSIA 2VM1A 1TDIA 4H86A 2L59A 3JCML 1Z9HA 1ZGNA 2B5EA 1BYEA 3WD6A 3C7MA 1DUGA 1Q4JA 2FNOA 3HHVA 4O32A 3N9JA 1A23A 1TP9A 2JSYA 2DLXA 4F0BA 4GF0A 1O7UA 1NW2A 2DJJA 5KN2A 3VFIA 5IPHA 5IO0A 5A4WA 2GGTA 4D73A 1QQ2A 3GNJA 2O8VB 1K3LA 1G7EA 5DDLA 5B6NA 5HFGA 2XHFA 4ILFA 4QQ7A 5A4VA 2GSRA 5ID2A 3QR6A 1SKWB 1TI1A 3H4KA 3KXOA 4HI7A 1B4QA 1SD8A 1AIUA 2CVDA 4TR0A 4JU5A 4F03A 4AJ8A 1JLVA 3EMXA 3DVXA 1AQVA 2V1MA 2H0GA 1K3OA 2MMZA 3F4TA 5B7CA 1URMA 4IGJA 4WEYA 11GSA 1YKCA 1AXDA 4QL9A 1FOVA 3QAGA 1ERWA 5ECIB 3TKQA 1HNAA 4IHUA 4TR1B 4NXIA 4POKA 5L71A 4MPGA 4JR6A 1ZCPA 3HVSA 4IELA 3VWXA 4I2TA 2QKEA 1H4OA 4GSSA 1A24A 4V2NA 2LJRA 5HR1A 2H8LA 3WGXA 2NBSA 5FWGA 2X8GA 3Q18A 4NV5A 3N5OA 2XBIA 2L4CA 2MBTA 2H01A 5JCUA 2LQQA 2JSZA 2LNTA 1S3AA 4XTSA 2KP1A 3CYNA 5HQPA 5KEJA 2MYGA 1X5EA 2H0IA 3Q19A 2VLTA 3FKFA 1XFLA 2YWNA 3NOFA 2YPMA 2L6DA 3GTUB 3LORA 1UN2A 1TXXA 3QD9A 1R26A 3ERWA 1A8YA 4TN8A 1M9BA 2CAQA 3BOAA 4F82A 4CDOA 4PNFA 2WCIA 4K8MA 2HZEB 2YZUA 4HUAA 3EC3A 3KP8A 6GSWA 1W89A 3LFLA 1S3CA 3ZYWA 1BQ7A 4ZIJA 3G7YA 2E0QA 5IMAA 3VI7A 4EXJA 3EMPA 4I2UA 1ZL9A 2VOCA 2I81A 5GAND 2A4VA 2VCTA 3DYRA 1GUHA 4KE3A 4EE0A 1GLQA 4OFTA 2H6XA 1GTIA 3TGZA 2OBKA 5JWQB 1EP7A 1WJKA 4ZB9A 2FWGA 1DE1A 5G2ZA 1IYIA 3ZFBA 1ON4A 2LRTA 2WGRA 1HQOA 1PX6A 2PVOC 1AC1A 4AF2A 2IN3A 4TOPA 3KMOA 3A3TA 5DJMA 5ECSA 4X43A 2IMEA 3ZREA 2DMLA 4WF5A 1GSYA 2PUKC 2ON5A 3VWWA 5ELGA 1A0RP 4K1FA 1B9YC 4MJBA 3VPQA 4K7IA 1PQNA 1TRVA 1PA3A 5IMFA 3IAS2 1BEDA 2VCWA 1K0AA 2AHEA 4OMVA 4D73B 3KP9A 1SKRB 1ZOFA 2LTKA 4EDYA 2HZFA 3RHBA 4PURA 3RPPA 2WS2A 3GA4A 3HYPA 1MDKA 4NWYA 1JZRA 4AJ7A 9GSSA 3CXGA 3KD0A 2KUCA 2IL3A 1WPIA 3UL3A 5CRDA 1BX9A 4KNDA 3ZFLA 4GXZA 5HR0A 2DJ2A 1TI3A 2LRCA 3Q74A 1Y25A 2M72A 1TOFA 5ECPB 3EWLA 1GULA 2IMIA 1JHBA 3GHAA 1V40A 2YV7A 2C1YA 5C00A 4HS1A 2LNSA 3G7IA 1G7OA 2MMNA 4DSSB 2VL9A 3HJPA 2VLVA 5GSTA 3HCZA 1GLPA 4J56E 5F05A 2CZ2A 5G5EA 4GCIA 5DVBA 3ERGA 3ZVJA 3RPNA 2FA8A 3CTFA 5HFIA 3DIEA 4X0XA 4KSMA 3LEFA 3TKPA 1PX7A 2F8FA 1ERTA 3QAWA 4N10A 3FZAA 4J2FA 1DSBA 4FIWA 1XWBA 2HI7A 1E2YA 3EU3A 3PGTA 2DBCA 4OCEA 3D4MA 2OE1A 1O6JA 4OD7A 3WGEA 1FO5A 3DWVA 5H5RA 4KDUA 2RUFA 5D8IA 3A5WA 4JR4A 1SJIA 5FHIA 1U88A 4N30A 4NPBA 1B4PA 1OKDA 2DMMA 1ZZYA 3HY2A 4KCEA 4PQIA 1T8EB 3TRXA 2VL2C 1ML6A 2GQMA 2RIIA 3WT1A 3C1RA 3LG6A
chains in the Genus database with same CATH superfamily
18GSA 2H1AA 1KNGA 4WKWA 1SKSB 2VLUA 3TOUA 4A5PA 3F9UA 1J9BA 4MA9A 5E4WA 4Z2TA 3PINA 2VL3A 1B8XA 3F6DA 2QA2A 4ECBA 4PGTA 3UMAA 3ZITA 4TW5A 2DSAA 4WXTA 2VCVA 4F9ZA 4I8BA 4ZBAA 1G6WA 4KB3A 3UOMA 1SD9A 2GTUA 1VRSD 3R2QA 4MLYA 2MZCA 4KX4A 1ZYQB 1T7PB 1HYUA 2YJ7A 4MF5A 2EC4A 2E7PA 1SK2A 3KH7A 5HFKA 3GSTA 1GP1A 3WYWA 3TKSE 3TJKA 1YDKA 2ZCTA 4ECCA 3QPMA 3HVVA 2R0GA 1IYHA 4PQ1A 4ULXA 5DQSA 2IPAA 2C0GA 2B7JA 5DALB 5KN3A 3DVWA 4MCUA 2X49A 1TRUA 4O92A 1PD21 2VIMA 2YWIA 3OR5A 3UBKA 5KOXA 1MTCA 3GURA 1XZOA 2H71A 2YZHA 1V9WA 1JZWA 4ZB8A 3D22A 1R5PA 3QCPA 4OCFA 2IIYA 5IMDA 2WFCA 4MABA 4FYUA 4E8EA 2H74A 1WMJA 2F51A 3DKSA 3L9VA 2QC7A 1XOAA 4E8HA 1EV9A 4IW9A 4JRRA 1V2AA 3KM6A 4BVYB 7GSSA 5IMCA 1TK8B 2OADA 4TRXA 4EO3A 1ACVA 4RQXA 3KH9A 2KP2A 4ZL8A 3CRUA 3M0FA 1UA5A 1FAAA 4KSOA 1E6BA 1X9SB 1DBYA 3U6VA 2VO4A 3E3EA 1QXHA 1YKAA 3G9BA 4G10A 1FW1A 1EEJA 4L0WA 2M46A 10GSA 4Q5FA 2H1GA 2B1LA 3FZ4A 1T3BA 1WE0A 3NZNA 2VCXA 4ZXGA 3H8QA 4L0UA 1GWCA 2VD0A 1QK8A 1G6YA 3KMNA 2VAFA 1I5GA 1V58A 2C4JA 1RW1A 2D2ZA 4G0LA 2BTOT 3PPUA 2CT6A 5H5SA 2C0DA 3KTBA 4NHWA 1OKTA 3L9SA 3VLNA 4HJMA 4NHZA 4XHMA 4YKGA 4IKHA 4P3YB 2BMXA 3FEUA 5A5KA 3BCKA 3FK8A 1XPVA 4BA7A 1KEBA 3UJ1A 4PX1A 1W4VA 3ZTLA 2RLIA 3KEBA 4YAVA 5ECNB 2HSYA 3DXBA 4YQVA 1NSWA 2FLSA 3FR9A 4K5SA 3ISOA 2WB9A 3BJ5A 4NV2A 5DAKB 2X64A 1WWJA 5CAXA 3TKSA 1VF2A 3VK9A 1N2AA 3IK9A 2CQ9A 3GIXA 4X4JA 4XS4B 3MAKA 3P8WA 2R6KA 3VWVA 2C80A 4OO5A 4K2XA 2PU9C 2JL4A 1I9DA 1ABAA 4OWYA 3BBYA 5KN1A 3P2AA 1N8JA 5E59A 3EURA 2DJ0A 1GSSA 2REMA 1S3RA 1CQHA 2R4VA 4FO5A 4KCAA 1PKZA 1GSDA 3LXZA 3FR3A 2I3YA 4KDXA 2A2PA 5F07A 3I9V2 2IMKA 4BVXB 2YV9A 3E0UA 2FGXA 2MMOA 3M3MA 3LWAA 3ZL5A 2DJ1A 1USBA 4K5RA 3IRAA 5ECQB 4MJCA 4I5QA 2R2JA 1Q98A 3F0IA 1SENA 2MBSA 3P7XA 4LMWA 2ON7A 3KIJA 4EKZA 2X8CA 2GSTA 4WF4A 3FR6A 3ZMKA 1T00A 1GTBA 4POLA 2DKHA 2H72A 3GL3A 5JCWA 3GKMA 4YH2A 2I4AA 1YZXA 3ME8A 1FVJA 4L5LA 2LJAA 1MDIA 4IS0A 4MMMA 3TRPA 2XPDA 3IDVA 4ISDA 1WIKA 4JBBA 2X4AA 3NIVA 3U5RE 2R5GA 5IIZA 3O76A 4PTSA 1O8XA 2K8SA 3TRQA 4GRFA 2FUG2 1MEKA 3TJFA 2LJKA 3O6TA 1UVZA 2G0FA 1AQXA 2HRKA 3HZ8A 1G0TA 2IFQA 2HXKA 4KAEA 5AIXA 2B5YA 3EE2A 1YF1A 3O3TA 3KCMA 2H6ZA 3GL5A 1XCCA 4CY6A 1GSFA 12GSA 5LD0A 1WP0A 1U87A 3IC8A 3WGDA 4XIHA 1F37A 2CAIA 3GYKA 4EF0A 1KTEA 1THOA 2DKIA 2E2GA 1X9MB 2DJKA 1BAYA 1QUWA 3FRCA 2ES7A 4IVFA 4DSQA 4TR4A 3C1SA 1Z6NA 5EY6A 2B6MA 1UC7A 2LRNA 1B48A 1B9XC 5ECLB 3F3RA 2H1BA 3FMWA 4IP1A 1K0OA 4N0VA 1MDJA 2H75A 3UIWA 1CQGA 2L57A 4GWRA 5IOWA 3GUSA 5ID2B 5IPGA 4TXOA 1T4YA 2JACA 4IQAA 2FD3A 5CYYA 3GSSA 4AJ6A 3TKRA 1GTAA 4K6XA 4G19A 3UEMA 3ZVJD 8GSSA 17GSA 1XOBA 1YEPA 4KDYA 2GT5A 1OE7A 2FY6A 2V41A 3I6AA 2KHPA 1OC9A 2LKUA 1XWCA 4Z7XA 3CQFA 2J9HA 3M1GA 4BL7A 5DQYA 1FHEA 3PR8A 2P31A 5CO3A 5GSSA 2GZPA 2FHEA 1X0RA 2A4HA 4G2EA 2LEGA 2TRXA 3IXRA 5IO2A 3CRTA 2YWMA 4Q5RA 3G7JA 3FZ9A 5GAPD 4GTUA 1J0FA 1NHOA 2PN8A 1GUMA 4ZBDA 1OAZA 3CSHA 4K7NA 1GH2A 2GDRA 5D96A 2OACA 3HD5A 3HZ4A 2CZ3A 1ZMAA 4PQHA 5IMZA 4XRDA 2K8VA 3M8NA 2HRNA 2AAWA 4JE1A 1SJ6A 4HJ2A 2HRFA 5G30A 2C0EA 3MWHA 1SYRA 2VM2A 2X99A 4OO4A 2C3QA 1XW6A 1EP8A 1DE2A 1M0UA 2I9HA 2XC2A 4EUYA 3QOUA 2B1KA 5B8BA 1ZYNA 1QGVA 5JWOB 1ERVA 1O8WA 1JZOA 3W6GA 4DSRA 1PN0A 4GSNA 2GSQA 1X9WB 2O89A 2V6KA 3DD3A 3E9JB 3J7Yb 1YEXA 1XWKA 1WRYA 2P5QA 1V98A 4CHSA 1K0NA 2TIRA 3GX8A 2GLRA 2N5AA 2Z9SA 1GNWA 2C8UA 1M2BA 4CW9A 1XWAA 1OC8A 2B7KA 2NTOA 6GSVA 4TR1A 2HFDA 6GSTA 3A5IA 1K0CA 3BD2A 2WULA 13GSA 1A0FA 2V2GA 4LMVA 2NPBA 4IBPA 2MMAA 4PXOA 3TDGA 3CMIA 1SL2B 4IQ1A 2RUEA 3GH6A 4MJAA 1PMTA 4N0ZA 3FZ5A 2N5FA 5G1LA 5DJLA 1Z6MA 3KTLA 4V2LA 1XW5A 3ZIJA 2FWHA 2WDUA 2RM5A 2FA4A 4GLTA 2K18A 1M2DA 1GRXA 3BCIA 1TW9A 2G2QA 2DC5A 3ERFA 3GKXA 2WJUA 3KZQA 2H76A 3IHQA 4FYCA 4EIQA 5IQYA 1O73A 1GUKA 4Q5QA 4LL4B 3VPTA 2P0GA 4MZCA 4IN0A 3W8SA 3SWLA 3WT2A 1PN9A 1PFOA 3MDKA 2AYTA 1EOGA 1BG5A 1ST9A 5JCGA 2K9FA 3I43A 2CX4A 1F3AA 4ZL9A 4DEJA 1TU7A 3AY8A 3ZLPA 5C04A 4MF7A 1EOHA 3L4NA 2TRCP 3MNGA 4TXOB 4L8EA 3C8EA 2HZEA 5J3RA 5COHA 2FCHA 3H93A 1PL2A 2OBIA 2CA8A 4NAXA 3UVHA 2B5XA 3LYPA 4RI6A 2UZ8A 3HKRA 5D9VA 4MP4A 5B8AA 4KF9A 4FQUA 1LJRA 4F0CA 1PSQA 3F6FA 1YQ1A 3I69A 4Z2RA 1XG8A 2YWOA 2GS3A 3VWUA 1TJDA 1Z7RA 3IPZA 2GQKA 3UVTA 4O5RA 3APOA 3US3A 1JZDA 2WRTA 4K2DA 3A2WA 3DMLA 2VCQA 5AISA 1K0MA 3D5JA 3QFAC 1GSUA 5LNKe 1SL1B 5IOXA 2L5OA 2GVPA 1Z3EA 1TK5B 1SL0B 5DCHA 5FT3A 1XXUA 3DGQA 1OE8A 1GL8A 3IC4A 3TUEA 3GX0A 5EPFA 3HJMA 1FG4A 3FW2A 3Q6OA 2BJXA 2HSHA 4ACSA 3DEXA 3LGCA 2GQLA 3H79A 3GV1A 1THXA 2H19A 4K0GA 5GZZB 3APSA 4V1Ag 3TKSC 2H6YA 2IMFA 3V1WA 5G31A 3HVNA 2I1UA 1OVNA 4MH2A 2H1DA 2JZTA 2L4QA 3GH9A 5CRWA 4HZ2A 4BPYA 5J4UA 2CX3A 4HSCX 6GSUA 4WR4A 1XWGA 2VUPA 1VGLA 3QMXA 1XVWA 2V6OA 2GZYA 1FB0A 2H0HA 3RHCA 4HQSA 5CP1A 3QDNA 5D9WA 4IP6A 3LW9A 4HOJA 4ECIA 1V57A 5DCGA 1SYXA 4KGIA 4HQZA 5ECMB 2OE3A 4ZBBA 3CSIA 2O87A 1VF1A 2RM6A 1RK4A 1NM3A 1QMVA 4OFNA 1TU8A 2JADA 4DSSA 1F3BA 3P90A 4V1Ap 2XBQA 2YP6A 1TKDB 2CV4A 1RQMA 2YJHA 1KBNA 1WOUA 4KW6A 5F8BA 3RBTA 1K0DA 1AAZA 3F63A 1EWXA 2ALBA 3VI5A 2K6VA 5J9CA 1EGOA 2IWTA 4WBJA 6GSXA 2C3TA 2NDOA 4I97A 4PNGA 2ZNMA 2R37A 4EVMA 2C0FA 2PERA 5J41A 14GSA 2F9SA 4FH8A 3CBUA 1PRXA 2KLXA 2HLSA 1MD4A 1PL1A 5AGYA 4ZL7A 2DJ3A 1O85A 3ED3A 5IMVA 4XCSA 1A8LA 1XBSA 1LU4A 4RQRA 2L5LA 2DIYA 1M2AA 2OE0A 3GMFA 3IBHA 3KGKA 3ZIVA 1A2JA 4ML6A 5EVOA 3GKKA 2KOKA 5HR2A 5KN0A 4K0NA 4TVEA 4YAPA 4AGSA 1TRSA 3EYTA 2WZ9A 3H1NA 2LS5A 3PH9A 1Z5YE 1S3DA 1M3JA 3GN3A 4BWQA 1FOHA 22GSA 2R3XA 3TJBA 2F8AA 3IK7A 2JZRA 1FVKA 1U3IA 3D0ZA 3GRXA 3TCOA 1SK0A 5ECKB 2O7KA 2H73A 3HJOA 5F0GA 4X1UA 4JZQA 1R5AA 4LA1A 3EINA 20GSA 2IJYA 3LSZA 2PMTA 3RAZA 2OA7A 5AN1A 3L78A 2AUVA 4XS6A 4HU9A 1TK0B 2A2SA 2AB6A 1M99A 4GQFA 4HDEA 2GSSA 3TJJA 4GQCA 3LYKA 3F8UA 1XW9A 2M80A 3CTGA 2VD1A 2B3SA 1JFUA 4YQMA 1A2LA 1ZYPA 1SU9A 4POBA 1EEMA 3TJGA 1TTZA 3A2XA 4MH3A 1LBKA 1H75A 4XRAA 4K9ZA 1C72A 2YOIA 3HDCA 4JEDA 5DALA 2PBJA 1T4ZA 2H70A 2LV3A 1K0BA 2YNXA 4LL1B 1M3IA 1EV4A 4Q5NA 5D73A 3F4SA 4MDCA 1JLWA 3LJRA 1F2EA 3L9UA 3FY7A 2HT9A 5JWRB 1A2MA 4HU7A 4KA0A 5EL8A 2EIQA 4RI7A 5ENUA 3QAVA 4IJIA 1OYJA 1ERUA 2OKAA 5DBQA 1HD2A 3HA9A 2H66A 4ICYA 1AQWA 1YY7A 4QL7A 4BVYA 3DRNA 2X8HA 1NHYA 4ID0A 5HR3A 4V2MA 1HNCA 3RDWA 3F4RA 2GT6A 5CREA 3ME7A 1YF0A 4FYBA 1J08A 1SK1A 3ZZXA 1GSQA 5A4UA 4EC0A 2E2MA 3C73A 4K7OA 2H30A 2YN1A 3C71A 2ZUPA 1YJ6A 3D6IA 1O81A 4TKYA 3HXSA 1F6MC 3IOSA 2OJLA 2EIOA 5CRHA 4MZBA 3K8NA 4PUAA 4WETA 3GFKA 1X5DA 2AV4A 4WBRD 5F06A 3IAM2 4HEA2 4KUNA 2L6CA 6GSYA 4ECJA 3ZMLA 3ZRDA 3IR4A 16GSA 1Z7PA 3KJYA 5AIVA 1X5CA 4I6XA 2LSTA 4O7HA 4NMUA 5B6MA 3D21A 3F3QA 5J9BA 1VF3A 4G9HA 5D93A 4RUVA 1BJXA 1PKWA 5G1KA 1ZYEA 3TB2A 1QFNA 5H5QA 2LUSA 4ML1A 1EGRA 2CVKA 4PUFC 1HNBA 4KH7A 5DAKA 3IA1A 2XPEA 2O85A 5ECOB 5INYA 1R4WA 1XIYA 3VURA 4TXVA 3FHKA 4F2IA 1FB6A 1VF4A 4XS4A 1T1VA 4WR5A 4DVCA 1U6TA 1TRWA 2IFQB 4IJ3A 3L0HA 2AJQB 4ZB6A 5ELAA 2HYXA 4OFMA 3J7Yk 2IMDA 4BWSA 1GTUA 2VL2A 5CRGA 3A2VA 1MD3A 5J5NA 2EIRA 3FYGA 4G0KA 1GSEA 4N11A 3TOTA 1F9MA 3IV4A 5ECRB 1XVQA 3CSJA 3M9KA 1GNEA 4L5OA 5G5FA 1PGTA 3UBLA 3LQ7A 2HE3A 4MNNA 1ILOA 2CVBA 2PVQA 2JU5A 3EVIA 4BVXA 4EDZA 2PWJA 3APQA 2HRAA 1K3YA 4HZ4A 3EU4A 3GTUA 19GSA 4LLRA 3GKNA 2PGTA 1AW9A 2HNLA 2R0PA 3SBCA 3UARA 2QGVA 3S9FA 3MSZA 2P5RA 4XS1A 2GZZA 2J23A 5IM9A 4J57E 4MZWA 2LQOA 2FWEA 2V32A 4MF6A 4YQUA 4GSTA 3IE3A 4MPFA 3W8JA 4TR3A 5KOWA 3QFBC 5LCZA 1M7TA 1OC9B 1SJZA 2C3NA 5ABRA 1U3AA 2PPTA 3M9JA 3UAPA 4BL7B 1AUCA 1R7HA 2FWFA 2YCDA 4MK3A 3EPTA 1M9AA 3LXTA 2YANA 2NVLA 2VCZA 2F3MA 2JZSA 1Y6EA 2N5BA 6GSSA 2A2RA 5D9TA 4EL1A 5ECHB 3HVXA 5D9XA 3D4TA 4POMA 1OC3A 4YKFA 2DIZA 1EZKA 4MJEA 4ZILA 5CNWA 2QSIA 2VM1A 1TDIA 4H86A 2L59A 3JCML 1Z9HA 1ZGNA 2B5EA 1BYEA 3WD6A 3C7MA 1DUGA 1Q4JA 2FNOA 3HHVA 4O32A 3N9JA 1A23A 1TP9A 2JSYA 2DLXA 4F0BA 4GF0A 1O7UA 1NW2A 2DJJA 5KN2A 4O5UA 3VFIA 5IPHA 5IO0A 5A4WA 2GGTA 4D73A 1QQ2A 3GNJA 2O8VB 1K3LA 1G7EA 5DDLA 5B6NA 5HFGA 2XHFA 4ILFA 4QQ7A 5A4VA 2GSRA 2R0CA 5ID2A 3QR6A 1SKWB 1TI1A 3H4KA 3KXOA 4HI7A 1B4QA 1SD8A 1AIUA 2CVDA 4TR0A 4JU5A 4F03A 4AJ8A 1JLVA 3EMXA 3DVXA 5BRTA 1AQVA 2V1MA 2H0GA 1K3OA 2MMZA 3F4TA 5B7CA 1URMA 4IGJA 4WEYA 11GSA 1YKCA 1AXDA 4QL9A 1FOVA 3QAGA 1ERWA 5ECIB 3TKQA 1HNAA 4IHUA 4TR1B 4NXIA 4POKA 5L71A 5BMUA 4MPGA 4JR6A 1ZCPA 3HVSA 4IELA 3VWXA 4I2TA 2QKEA 1H4OA 4GSSA 1A24A 4V2NA 2LJRA 5HR1A 2H8LA 3WGXA 2NBSA 5FWGA 2X8GA 3Q18A 4NV5A 3N5OA 2XBIA 2L4CA 2MBTA 2H01A 5JCUA 2LQQA 2JSZA 2LNTA 1S3AA 4XTSA 2KP1A 3IHGA 3CYNA 5HQPA 5KEJA 2MYGA 1X5EA 2H0IA 3Q19A 2VLTA 3FKFA 1XFLA 2YWNA 3NOFA 2YPMA 2L6DA 3GTUB 3LORA 1UN2A 1TXXA 3QD9A 1R26A 3ERWA 1A8YA 4TN8A 1M9BA 2CAQA 3BOAA 4F82A 4CDOA 4PNFA 2WCIA 4K8MA 2HZEB 2YZUA 4HUAA 3EC3A 3KP8A 6GSWA 1W89A 3LFLA 1S3CA 3MYDA 3ZYWA 1BQ7A 4ZIJA 3G7YA 2E0QA 5IMAA 3VI7A 4EXJA 3EMPA 4I2UA 3MIXA 1ZL9A 2VOCA 2I81A 5GAND 2A4VA 2VCTA 3DYRA 1GUHA 4KE3A 4EE0A 1GLQA 4OFTA 2H6XA 1GTIA 3TGZA 2OBKA 5JWQB 1EP7A 1WJKA 4ZB9A 2FWGA 1DE1A 5G2ZA 1IYIA 3ZFBA 1ON4A 2LRTA 2WGRA 1HQOA 1PX6A 2PVOC 1AC1A 4AF2A 2IN3A 2HSMA 4TOPA 3KMOA 3A3TA 5DJMA 5ECSA 4X43A 2IMEA 3ZREA 2DMLA 4WF5A 1GSYA 2PUKC 2ON5A 3VWWA 5ELGA 1A0RP 4O5QA 4K1FA 1B9YC 4MJBA 3VPQA 4K7IA 1PQNA 1TRVA 1PA3A 5IMFA 3IAS2 1BEDA 2VCWA 1K0AA 2AHEA 4OMVA 4D73B 3KP9A 1SKRB 1ZOFA 2LTKA 4EDYA 2HZFA 3RHBA 4PURA 3RPPA 2WS2A 3GA4A 3HYPA 1MDKA 4NWYA 1JZRA 4AJ7A 4EIPA 9GSSA 4USSA 3CXGA 3KD0A 2KUCA 2IL3A 1WPIA 3UL3A 5CRDA 1BX9A 4KNDA 3ZFLA 4GXZA 5HR0A 2DJ2A 1TI3A 2LRCA 3Q74A 1Y25A 2M72A 1TOFA 5ECPB 3EWLA 1GULA 2IMIA 1JHBA 3R3EA 3GHAA 1V40A 2YV7A 2C1YA 5C00A 4HS1A 2LNSA 3G7IA 1G7OA 2MMNA 4DSSB 2VL9A 3HJPA 2VLVA 5GSTA 3HCZA 1GLPA 4J56E 5F05A 2CZ2A 5G5EA 4GCIA 5DVBA 3ERGA 3ZVJA 3RPNA 2FA8A 3CTFA 5HFIA 3DIEA 4X0XA 4KSMA 3LEFA 4Z2UA 3TKPA 1PX7A 2F8FA 1ERTA 3QAWA 4N10A 3FZAA 4J2FA 2QA1A 1DSBA 4FIWA 1XWBA 2HI7A 1E2YA 3EU3A 3PGTA 2DBCA 4OCEA 3D4MA 2OE1A 1O6JA 4OD7A 3WGEA 1FO5A 3DWVA 5H5RA 4KDUA 2RUFA 4BIKA 5D8IA 3A5WA 4CY8A 4JR4A 1SJIA 5FHIA 1U88A 4N30A 4NPBA 1B4PA 1OKDA 2DMMA 1ZZYA 3HY2A 4KCEA 4PQIA 4G0IA 1T8EB 3TRXA 2VL2C 1ML6A 2GQMA 2RIIA 3WT1A 3C1RA 3LG6A
chains in the Genus database with same CATH topology
18GSA 2H1AA 1KNGA 4WKWA 1SKSB 2VLUA 3TOUA 4A5PA 3F9UA 1J9BA 4MA9A 5E4WA 4Z2TA 3PINA 2VL3A 1B8XA 3F6DA 2QA2A 4ECBA 4PGTA 3UMAA 3ZITA 4TW5A 2DSAA 4WXTA 2VCVA 4F9ZA 4I8BA 4ZBAA 1G6WA 4KB3A 3UOMA 1SD9A 2GTUA 1VRSD 3R2QA 4MLYA 2MZCA 4KX4A 1ZYQB 1T7PB 1HYUA 2YJ7A 4MF5A 2EC4A 2E7PA 1SK2A 3KH7A 5HFKA 3GSTA 1GP1A 3WYWA 3TKSE 3TJKA 1YDKA 2ZCTA 4ECCA 3QPMA 3HVVA 2R0GA 1IYHA 4PQ1A 4ULXA 5DQSA 2IPAA 2C0GA 2B7JA 5DALB 5KN3A 3DVWA 4MCUA 2X49A 1TRUA 4O92A 1PD21 2VIMA 2YWIA 3OR5A 3UBKA 5KOXA 1MTCA 3GURA 1XZOA 2H71A 2YZHA 1V9WA 1JZWA 4ZB8A 3D22A 1R5PA 3QCPA 4OCFA 2IIYA 5IMDA 2WFCA 4MABA 4FYUA 4E8EA 2H74A 1WMJA 2F51A 3DKSA 3L9VA 2QC7A 1XOAA 4E8HA 1EV9A 4IW9A 4JRRA 1V2AA 3KM6A 4BVYB 7GSSA 5IMCA 1TK8B 2OADA 4TRXA 4EO3A 1ACVA 4RQXA 3KH9A 2KP2A 4ZL8A 3CRUA 3M0FA 1UA5A 1FAAA 4KSOA 1E6BA 1X9SB 1DBYA 3U6VA 2VO4A 3E3EA 1QXHA 1YKAA 3G9BA 4G10A 1FW1A 1EEJA 4L0WA 2M46A 10GSA 4Q5FA 2H1GA 2B1LA 3FZ4A 1T3BA 1WE0A 3NZNA 2VCXA 4ZXGA 3H8QA 4L0UA 1GWCA 2VD0A 1QK8A 1G6YA 3KMNA 2VAFA 1I5GA 1V58A 2C4JA 1RW1A 2D2ZA 4G0LA 2BTOT 3PPUA 2CT6A 5H5SA 2C0DA 3KTBA 4NHWA 1OKTA 3L9SA 3VLNA 4HJMA 4NHZA 4XHMA 4YKGA 4IKHA 4P3YB 2BMXA 3FEUA 5A5KA 3BCKA 3FK8A 1XPVA 4BA7A 1KEBA 3UJ1A 4PX1A 1W4VA 3ZTLA 2RLIA 3KEBA 4YAVA 5ECNB 2HSYA 3DXBA 4YQVA 1NSWA 2FLSA 3FR9A 4K5SA 3ISOA 2WB9A 3BJ5A 4NV2A 5DAKB 2X64A 1WWJA 5CAXA 3TKSA 1VF2A 3VK9A 1N2AA 3IK9A 2CQ9A 3GIXA 4X4JA 4XS4B 3MAKA 3P8WA 2R6KA 3VWVA 2C80A 4OO5A 4K2XA 2PU9C 2JL4A 1I9DA 1ABAA 4OWYA 3BBYA 5KN1A 3P2AA 1N8JA 5E59A 3EURA 2DJ0A 1GSSA 2REMA 1CQHA 2R4VA 4FO5A 4KCAA 1PKZA 1GSDA 3LXZA 3FR3A 2I3YA 4KDXA 2A2PA 5F07A 3I9V2 2IMKA 4BVXB 2YV9A 3E0UA 2FGXA 2MMOA 3M3MA 3LWAA 3ZL5A 2DJ1A 1USBA 4K5RA 3IRAA 5ECQB 4MJCA 4I5QA 2R2JA 1Q98A 3F0IA 1SENA 2MBSA 3P7XA 4LMWA 2ON7A 3KIJA 4EKZA 2X8CA 2GSTA 4WF4A 3FR6A 3ZMKA 1T00A 1GTBA 4POLA 2DKHA 2H72A 3GL3A 5JCWA 3GKMA 4YH2A 2I4AA 1YZXA 3ME8A 1FVJA 4L5LA 2LJAA 1MDIA 4IS0A 4MMMA 3TRPA 2XPDA 3IDVA 4ISDA 1WIKA 4JBBA 2X4AA 3NIVA 3U5RE 2R5GA 5IIZA 3O76A 4PTSA 1O8XA 2K8SA 3TRQA 4GRFA 2FUG2 1MEKA 3TJFA 2LJKA 3O6TA 1UVZA 2G0FA 1AQXA 2HRKA 3HZ8A 1G0TA 2IFQA 2HXKA 4KAEA 5AIXA 2B5YA 3EE2A 1YF1A 3O3TA 3KCMA 2H6ZA 3GL5A 1XCCA 4CY6A 1GSFA 12GSA 5LD0A 1WP0A 1U87A 3IC8A 3WGDA 4XIHA 1F37A 2CAIA 3GYKA 4EF0A 1KTEA 1THOA 2DKIA 2E2GA 1X9MB 2DJKA 1BAYA 1QUWA 3FRCA 2ES7A 4IVFA 4DSQA 4TR4A 3C1SA 1Z6NA 5EY6A 2B6MA 1UC7A 2LRNA 1B48A 1B9XC 5ECLB 3F3RA 2H1BA 3FMWA 4IP1A 1K0OA 4N0VA 1MDJA 2H75A 3UIWA 1CQGA 2L57A 4GWRA 5IOWA 3GUSA 5ID2B 5IPGA 4TXOA 1T4YA 2JACA 4IQAA 2FD3A 5CYYA 3GSSA 4AJ6A 3TKRA 1GTAA 4K6XA 4G19A 3UEMA 3ZVJD 8GSSA 17GSA 1XOBA 1YEPA 4KDYA 2GT5A 1OE7A 2FY6A 2V41A 3I6AA 2KHPA 1OC9A 2LKUA 1XWCA 4Z7XA 2J9HA 3M1GA 4BL7A 5DQYA 1FHEA 3PR8A 2P31A 5CO3A 5GSSA 2GZPA 2FHEA 1X0RA 2A4HA 4G2EA 2LEGA 2TRXA 3IXRA 5IO2A 3CRTA 2YWMA 4Q5RA 3G7JA 3FZ9A 5GAPD 4GTUA 1J0FA 1NHOA 2PN8A 1GUMA 4ZBDA 1OAZA 3CSHA 4K7NA 1GH2A 2GDRA 5D96A 2OACA 3HD5A 3HZ4A 2CZ3A 1ZMAA 4PQHA 5IMZA 4XRDA 2K8VA 3M8NA 2HRNA 2AAWA 4JE1A 1SJ6A 4HJ2A 2HRFA 5G30A 2C0EA 3MWHA 1SYRA 2VM2A 2X99A 4OO4A 2C3QA 1XW6A 1EP8A 1DE2A 1M0UA 2I9HA 2XC2A 4EUYA 3QOUA 2B1KA 5B8BA 1ZYNA 1QGVA 5JWOB 1ERVA 1O8WA 1JZOA 3W6GA 4DSRA 1PN0A 4GSNA 2GSQA 1X9WB 2O89A 2V6KA 3DD3A 3E9JB 3J7Yb 1YEXA 1XWKA 1WRYA 2P5QA 1V98A 4CHSA 1K0NA 2TIRA 3GX8A 2GLRA 2N5AA 2Z9SA 1GNWA 2C8UA 1M2BA 4CW9A 1XWAA 1OC8A 2B7KA 2NTOA 6GSVA 4TR1A 2HFDA 6GSTA 3A5IA 1K0CA 3BD2A 2WULA 13GSA 1A0FA 2V2GA 4LMVA 2NPBA 4IBPA 2MMAA 4PXOA 3TDGA 3CMIA 1SL2B 4IQ1A 2RUEA 3GH6A 4MJAA 1PMTA 4N0ZA 3FZ5A 2N5FA 5G1LA 5DJLA 1Z6MA 3KTLA 4V2LA 1XW5A 3ZIJA 2FWHA 2WDUA 2RM5A 2FA4A 4GLTA 2K18A 1M2DA 1GRXA 3BCIA 1TW9A 2G2QA 2DC5A 3ERFA 3GKXA 2WJUA 3KZQA 2H76A 3IHQA 4FYCA 4EIQA 5IQYA 1O73A 1GUKA 4Q5QA 4LL4B 3VPTA 2P0GA 4MZCA 4IN0A 3W8SA 3SWLA 3WT2A 1PN9A 3MDKA 2AYTA 1EOGA 1BG5A 1ST9A 5JCGA 2K9FA 3I43A 2CX4A 1F3AA 4ZL9A 4DEJA 1TU7A 3AY8A 3ZLPA 5C04A 4MF7A 1EOHA 3L4NA 2TRCP 3MNGA 4TXOB 4L8EA 3C8EA 2HZEA 5J3RA 5COHA 2FCHA 3H93A 1PL2A 2OBIA 2CA8A 4NAXA 3UVHA 2B5XA 3LYPA 4RI6A 2UZ8A 3HKRA 5D9VA 4MP4A 5B8AA 4KF9A 4FQUA 1LJRA 4F0CA 1PSQA 3F6FA 1YQ1A 3I69A 4Z2RA 2YWOA 2GS3A 3VWUA 1TJDA 1Z7RA 3IPZA 2GQKA 3UVTA 4O5RA 3APOA 3US3A 1JZDA 2WRTA 4K2DA 3A2WA 3DMLA 2VCQA 5AISA 1K0MA 3D5JA 3QFAC 1GSUA 5LNKe 1SL1B 5IOXA 2L5OA 2GVPA 1Z3EA 1TK5B 1SL0B 5DCHA 5FT3A 1XXUA 3DGQA 1OE8A 1GL8A 3IC4A 3TUEA 3GX0A 5EPFA 3HJMA 1FG4A 3FW2A 3Q6OA 2BJXA 2HSHA 4ACSA 3DEXA 3LGCA 2GQLA 3H79A 3GV1A 1THXA 2H19A 4K0GA 5GZZB 3APSA 4V1Ag 3TKSC 2H6YA 2IMFA 3V1WA 5G31A 2I1UA 1OVNA 4MH2A 2H1DA 2JZTA 2L4QA 3GH9A 5CRWA 4HZ2A 4BPYA 5J4UA 2CX3A 6GSUA 4WR4A 1XWGA 2VUPA 1VGLA 3QMXA 1XVWA 2V6OA 2GZYA 1FB0A 2H0HA 3RHCA 4HQSA 5CP1A 3QDNA 5D9WA 4IP6A 3LW9A 4HOJA 4ECIA 1V57A 5DCGA 1SYXA 4KGIA 4HQZA 5ECMB 2OE3A 4ZBBA 3CSIA 2O87A 1VF1A 2RM6A 1RK4A 1NM3A 1QMVA 4OFNA 1TU8A 2JADA 4DSSA 1F3BA 3P90A 4V1Ap 2XBQA 2YP6A 1TKDB 2CV4A 1RQMA 2YJHA 1KBNA 1WOUA 4KW6A 5F8BA 3RBTA 1K0DA 1AAZA 3F63A 1EWXA 2ALBA 3VI5A 2K6VA 5J9CA 1EGOA 2IWTA 4WBJA 6GSXA 2C3TA 2NDOA 4I97A 4PNGA 2ZNMA 2R37A 4EVMA 2C0FA 2PERA 5J41A 14GSA 2F9SA 4FH8A 3CBUA 1PRXA 2KLXA 2HLSA 1MD4A 1PL1A 5AGYA 4ZL7A 2DJ3A 1O85A 3ED3A 5IMVA 4XCSA 1A8LA 1XBSA 1LU4A 4RQRA 2L5LA 2DIYA 1M2AA 2OE0A 3GMFA 3IBHA 3KGKA 3ZIVA 1A2JA 4ML6A 5EVOA 3GKKA 2KOKA 5HR2A 5KN0A 4K0NA 4TVEA 4YAPA 4AGSA 1TRSA 3EYTA 2WZ9A 3H1NA 2LS5A 3PH9A 1Z5YE 1S3DA 3GN3A 4BWQA 1FOHA 22GSA 2R3XA 3TJBA 2F8AA 3IK7A 2JZRA 1FVKA 1U3IA 3D0ZA 3GRXA 3TCOA 1SK0A 5ECKB 2O7KA 2H73A 3HJOA 5F0GA 4X1UA 4JZQA 1R5AA 4LA1A 3EINA 20GSA 2IJYA 3LSZA 2PMTA 3RAZA 2OA7A 5AN1A 3L78A 2AUVA 4XS6A 4HU9A 1TK0B 2A2SA 2AB6A 1M99A 4GQFA 4HDEA 2GSSA 3TJJA 4GQCA 3LYKA 3F8UA 1XW9A 2M80A 3CTGA 2VD1A 2B3SA 1JFUA 4YQMA 1A2LA 1ZYPA 1SU9A 4POBA 1EEMA 3TJGA 1TTZA 3A2XA 4MH3A 1LBKA 1H75A 4XRAA 4K9ZA 1C72A 2YOIA 3HDCA 4JEDA 5DALA 2PBJA 1T4ZA 2H70A 2LV3A 1K0BA 2YNXA 4LL1B 1EV4A 4Q5NA 5D73A 3F4SA 4MDCA 1JLWA 3LJRA 1F2EA 3L9UA 3FY7A 2HT9A 5JWRB 1A2MA 4HU7A 4KA0A 5EL8A 2EIQA 4RI7A 5ENUA 3QAVA 4IJIA 1OYJA 1ERUA 2OKAA 5DBQA 1HD2A 3HA9A 2H66A 4ICYA 1AQWA 1YY7A 4QL7A 4BVYA 3DRNA 2X8HA 1NHYA 4ID0A 5HR3A 4V2MA 1HNCA 3RDWA 3F4RA 2GT6A 5CREA 3ME7A 1YF0A 4FYBA 1J08A 1SK1A 3ZZXA 1GSQA 5A4UA 4EC0A 2E2MA 3C73A 4K7OA 2H30A 2YN1A 3C71A 2ZUPA 1YJ6A 3D6IA 1O81A 4TKYA 3HXSA 1F6MC 3IOSA 2OJLA 2EIOA 5CRHA 4MZBA 3K8NA 4PUAA 4WETA 3GFKA 1X5DA 2AV4A 4WBRD 5F06A 3IAM2 4HEA2 4KUNA 2L6CA 6GSYA 4ECJA 3ZMLA 3ZRDA 3IR4A 16GSA 1Z7PA 3KJYA 5AIVA 1X5CA 4I6XA 2LSTA 4O7HA 4NMUA 5B6MA 3D21A 3F3QA 5J9BA 1VF3A 4G9HA 5D93A 4RUVA 1BJXA 1PKWA 5G1KA 1ZYEA 3TB2A 1QFNA 5H5QA 2LUSA 4ML1A 1EGRA 2CVKA 4PUFC 1HNBA 4KH7A 5DAKA 3IA1A 2XPEA 2O85A 5ECOB 5INYA 1R4WA 1XIYA 3VURA 4TXVA 3FHKA 4F2IA 1FB6A 1VF4A 4XS4A 1T1VA 4WR5A 4DVCA 1U6TA 1TRWA 2IFQB 4IJ3A 3L0HA 2AJQB 4ZB6A 5ELAA 2HYXA 4OFMA 3J7Yk 2IMDA 4BWSA 1GTUA 2VL2A 5CRGA 3A2VA 1MD3A 5J5NA 2EIRA 3FYGA 4G0KA 1GSEA 4N11A 3TOTA 1F9MA 3IV4A 5ECRB 1XVQA 3CSJA 3M9KA 1GNEA 4L5OA 5G5FA 1PGTA 3UBLA 3LQ7A 2HE3A 4MNNA 1ILOA 2CVBA 2PVQA 2JU5A 3EVIA 4BVXA 4EDZA 2PWJA 3APQA 2HRAA 1K3YA 4HZ4A 3EU4A 3GTUA 19GSA 4LLRA 3GKNA 2PGTA 1AW9A 2HNLA 2R0PA 3SBCA 3UARA 2QGVA 3S9FA 3MSZA 2P5RA 4XS1A 2GZZA 2J23A 5IM9A 4J57E 4MZWA 2LQOA 2FWEA 2V32A 4MF6A 4YQUA 4GSTA 3IE3A 4MPFA 3W8JA 4TR3A 5KOWA 3QFBC 5LCZA 1M7TA 1OC9B 1SJZA 2C3NA 5ABRA 1U3AA 2PPTA 3M9JA 3UAPA 4BL7B 1AUCA 1R7HA 2FWFA 2YCDA 4MK3A 3EPTA 1M9AA 3LXTA 2YANA 2NVLA 2VCZA 2F3MA 2JZSA 1Y6EA 2N5BA 6GSSA 2A2RA 5D9TA 4EL1A 5ECHB 3HVXA 5D9XA 3D4TA 4POMA 1OC3A 4YKFA 2DIZA 1EZKA 4MJEA 4ZILA 5CNWA 2QSIA 2VM1A 1TDIA 4H86A 2L59A 3JCML 1Z9HA 1ZGNA 2B5EA 1BYEA 3WD6A 3C7MA 1DUGA 1Q4JA 2FNOA 3HHVA 4O32A 3N9JA 1A23A 1TP9A 2JSYA 2DLXA 4F0BA 4GF0A 1O7UA 1NW2A 2DJJA 5KN2A 4O5UA 3VFIA 5IPHA 5IO0A 5A4WA 2GGTA 4D73A 1QQ2A 3GNJA 2O8VB 1K3LA 1G7EA 5DDLA 5B6NA 5HFGA 2XHFA 4ILFA 4QQ7A 5A4VA 2GSRA 2R0CA 5ID2A 3QR6A 1SKWB 1TI1A 3H4KA 3KXOA 4HI7A 1B4QA 1SD8A 1AIUA 2CVDA 4TR0A 4JU5A 4F03A 4AJ8A 1JLVA 3EMXA 3DVXA 5BRTA 1AQVA 2V1MA 2H0GA 1K3OA 2MMZA 3F4TA 5B7CA 1URMA 4IGJA 4WEYA 11GSA 1YKCA 1AXDA 4QL9A 1FOVA 3QAGA 1ERWA 5ECIB 3TKQA 1HNAA 4IHUA 4TR1B 4NXIA 4POKA 5L71A 5BMUA 4MPGA 4JR6A 1ZCPA 3HVSA 4IELA 3VWXA 4I2TA 2QKEA 1H4OA 4GSSA 1A24A 4V2NA 2LJRA 5HR1A 2H8LA 3WGXA 2NBSA 5FWGA 2X8GA 3Q18A 4NV5A 3N5OA 2XBIA 2L4CA 2MBTA 2H01A 5JCUA 2LQQA 2JSZA 2LNTA 1S3AA 4XTSA 2KP1A 3IHGA 3CYNA 5HQPA 5KEJA 2MYGA 1X5EA 2H0IA 3Q19A 2VLTA 3FKFA 1XFLA 2YWNA 3NOFA 2YPMA 2L6DA 3GTUB 3LORA 1UN2A 1TXXA 3QD9A 1R26A 3ERWA 1A8YA 4TN8A 1M9BA 2CAQA 3BOAA 4F82A 4CDOA 4PNFA 2WCIA 4K8MA 2HZEB 2YZUA 4HUAA 3EC3A 3KP8A 6GSWA 1W89A 3LFLA 1S3CA 3MYDA 3ZYWA 1BQ7A 4ZIJA 3G7YA 2E0QA 5IMAA 3VI7A 4EXJA 3EMPA 4I2UA 3MIXA 1ZL9A 2VOCA 2I81A 5GAND 2A4VA 2VCTA 3DYRA 1GUHA 4KE3A 4EE0A 1GLQA 4OFTA 2H6XA 1GTIA 3TGZA 2OBKA 5JWQB 1EP7A 1WJKA 4ZB9A 2FWGA 1DE1A 5G2ZA 1IYIA 3ZFBA 1ON4A 2LRTA 2WGRA 1HQOA 1PX6A 2PVOC 1AC1A 4AF2A 2IN3A 2HSMA 4TOPA 3KMOA 3A3TA 5DJMA 5ECSA 4X43A 2IMEA 3ZREA 2DMLA 4WF5A 1GSYA 2PUKC 2ON5A 3VWWA 5ELGA 1A0RP 4O5QA 4K1FA 1B9YC 4MJBA 3VPQA 4K7IA 1PQNA 1TRVA 1PA3A 5IMFA 3IAS2 1BEDA 2VCWA 1K0AA 2AHEA 4OMVA 4D73B 3KP9A 1SKRB 1ZOFA 2LTKA 4EDYA 2HZFA 3RHBA 4PURA 3RPPA 2WS2A 3GA4A 3HYPA 1MDKA 4NWYA 1JZRA 4AJ7A 4EIPA 9GSSA 4USSA 3CXGA 3KD0A 2KUCA 2IL3A 1WPIA 3UL3A 5CRDA 1BX9A 4KNDA 3ZFLA 4GXZA 5HR0A 2DJ2A 1TI3A 2LRCA 3Q74A 1Y25A 2M72A 1TOFA 5ECPB 3EWLA 1GULA 2IMIA 1JHBA 3R3EA 3GHAA 1V40A 2YV7A 2C1YA 5C00A 4HS1A 2LNSA 3G7IA 1G7OA 2MMNA 4DSSB 2VL9A 3HJPA 2VLVA 5GSTA 3HCZA 1GLPA 4J56E 5F05A 2CZ2A 5G5EA 4GCIA 5DVBA 3ERGA 3ZVJA 3RPNA 2FA8A 3CTFA 5HFIA 3DIEA 4X0XA 4KSMA 3LEFA 4Z2UA 3TKPA 1PX7A 2F8FA 1ERTA 3QAWA 4N10A 3FZAA 4J2FA 2QA1A 1DSBA 4FIWA 1XWBA 2HI7A 1E2YA 3EU3A 3PGTA 2DBCA 4OCEA 3D4MA 2OE1A 1O6JA 4OD7A 3WGEA 1FO5A 3DWVA 5H5RA 4KDUA 2RUFA 5D8IA 3A5WA 4CY8A 4JR4A 1SJIA 5FHIA 1U88A 4N30A 4NPBA 1B4PA 1OKDA 2DMMA 1ZZYA 3HY2A 4KCEA 4PQIA 4G0IA 1T8EB 3TRXA 2VL2C 1ML6A 2GQMA 2RIIA 3WT1A 3C1RA 3LG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 18GS A;  2H1A A;  1KNG A;  4WKW A;  1SKS B;  2VLU A;  3TOU A;  3F9U A;  1J9B A;  4MA9 A;  5E4W A;  3PIN A;  2VL3 A;  1B8X A;  3F6D A;  4ECB A;  4PGT A;  3UMA A;  3ZIT A;  4TW5 A;  2DSA A;  4WXT A;  2VCV A;  4F9Z A;  4I8B A;  4ZBA A;  1G6W A;  4KB3 A;  3UOM A;  1SD9 A;  2GTU A;  1VRS D;  3R2Q A;  4MLY A;  2MZC A;  4KX4 A;  1ZYQ B;  1T7P B;  1HYU A;  2YJ7 A;  4MF5 A;  2EC4 A;  2E7P A;  1SK2 A;  3KH7 A;  5HFK A;  3GST A;  1GP1 A;  3WYW A;  3TKS E;  3TJK A;  1YDK A;  2ZCT A;  4ECC A;  3QPM A;  3HVV A;  1IYH A;  4PQ1 A;  4ULX A;  5DQS A;  2IPA A;  2C0G A;  2B7J A;  5DAL B;  5KN3 A;  3DVW A;  4MCU A;  1TRU A;  4O92 A;  1PD2 1;  2VIM A;  2YWI A;  3OR5 A;  3UBK A;  1MTC A;  3GUR A;  1XZO A;  2H71 A;  2YZH A;  1V9W A;  1JZW A;  4ZB8 A;  3D22 A;  1R5P A;  3QCP A;  4OCF A;  2IIY A;  5IMD A;  2WFC A;  4MAB A;  4FYU A;  4E8E A;  2H74 A;  1WMJ A;  2F51 A;  3DKS A;  3L9V A;  2QC7 A;  1XOA A;  4E8H A;  1EV9 A;  4IW9 A;  4JRR A;  1V2A A;  3KM6 A;  7GSS A;  5IMC A;  1TK8 B;  2OAD A;  4TRX A;  4EO3 A;  1ACV A;  4RQX A;  3KH9 A;  2KP2 A;  4ZL8 A;  3CRU A;  3M0F A;  1UA5 A;  1FAA A;  4KSO A;  1E6B A;  1X9S B;  1DBY A;  3U6V A;  2VO4 A;  3E3E A;  1QXH A;  1YKA A;  3G9B A;  4G10 A;  1FW1 A;  1EEJ A;  4L0W A;  2M46 A;  10GS A;  4Q5F A;  2H1G A;  2B1L A;  3FZ4 A;  1T3B A;  1WE0 A;  3NZN A;  2VCX A;  4ZXG A;  3H8Q A;  4L0U A;  1GWC A;  2VD0 A;  1QK8 A;  1G6Y A;  3KMN A;  2VAF A;  1I5G A;  1V58 A;  2C4J A;  1RW1 A;  2D2Z A;  2BTO T;  2CT6 A;  5H5S A;  2C0D A;  3KTB A;  4NHW A;  1OKT A;  3L9S A;  3VLN A;  4HJM A;  4NHZ A;  4XHM A;  4IKH A;  4P3Y B;  2BMX A;  3FEU A;  5A5K A;  3BCK A;  3FK8 A;  1XPV A;  4BA7 A;  1KEB A;  3UJ1 A;  4PX1 A;  1W4V A;  3ZTL A;  2RLI A;  3KEB A;  4YAV A;  5ECN B;  2HSY A;  3DXB A;  4YQV A;  1NSW A;  2FLS A;  3FR9 A;  3ISO A;  2WB9 A;  3BJ5 A;  4NV2 A;  5DAK B;  2X64 A;  1WWJ A;  5CAX A;  3TKS A;  1VF2 A;  3VK9 A;  1N2A A;  3IK9 A;  2CQ9 A;  3GIX A;  4XS4 B;  3MAK A;  3P8W A;  2R6K A;  3VWV A;  2C80 A;  4OO5 A;  2PU9 C;  2JL4 A;  1I9D A;  1ABA A;  4OWY A;  3BBY A;  5KN1 A;  3P2A A;  1N8J A;  5E59 A;  3EUR A;  2DJ0 A;  1GSS A;  2REM A;  1CQH A;  2R4V A;  4FO5 A;  4KCA A;  1PKZ A;  1GSD A;  3LXZ A;  3FR3 A;  2I3Y A;  4KDX A;  5F07 A;  3I9V 2;  2IMK A;  2YV9 A;  3E0U A;  2FGX A;  2MMO A;  3M3M A;  3LWA A;  3ZL5 A;  2DJ1 A;  1USB A;  3IRA A;  5ECQ B;  4MJC A;  4I5Q A;  2R2J A;  1Q98 A;  3F0I A;  1SEN A;  2MBS A;  3P7X A;  4LMW A;  2ON7 A;  3KIJ A;  4EKZ A;  2X8C A;  2GST A;  4WF4 A;  3FR6 A;  3ZMK A;  1T00 A;  1GTB A;  4POL A;  2H72 A;  3GL3 A;  5JCW A;  3GKM A;  4YH2 A;  2I4A A;  1YZX A;  3ME8 A;  1FVJ A;  4L5L A;  2LJA A;  1MDI A;  4IS0 A;  4MMM A;  3TRP A;  2XPD A;  3IDV A;  4ISD A;  1WIK A;  4JBB A;  3NIV A;  3U5R E;  2R5G A;  5IIZ A;  3O76 A;  1O8X A;  2K8S A;  3TRQ A;  4GRF A;  2FUG 2;  1MEK A;  3TJF A;  2LJK A;  3O6T A;  1UVZ A;  2G0F A;  1AQX A;  3HZ8 A;  1G0T A;  2IFQ A;  2HXK A;  4KAE A;  5AIX A;  2B5Y A;  3EE2 A;  1YF1 A;  3O3T A;  3KCM A;  2H6Z A;  3GL5 A;  1XCC A;  1GSF A;  12GS A;  5LD0 A;  1WP0 A;  1U87 A;  3WGD A;  4XIH A;  1F37 A;  2CAI A;  3GYK A;  4EF0 A;  1KTE A;  1THO A;  2E2G A;  1X9M B;  2DJK A;  1BAY A;  1QUW A;  3FRC A;  2ES7 A;  4IVF A;  4DSQ A;  4TR4 A;  3C1S A;  1Z6N A;  5EY6 A;  2B6M A;  1UC7 A;  2LRN A;  1B48 A;  1B9X C;  5ECL B;  3F3R A;  2H1B A;  4IP1 A;  1K0O A;  4N0V A;  1MDJ A;  2H75 A;  3UIW A;  1CQG A;  2L57 A;  4GWR A;  5IOW A;  3GUS A;  5ID2 B;  5IPG A;  4TXO A;  1T4Y A;  2JAC A;  4IQA A;  2FD3 A;  5CYY A;  3GSS A;  4AJ6 A;  3TKR A;  1GTA A;  4K6X A;  4G19 A;  3UEM A;  3ZVJ D;  8GSS A;  17GS A;  1XOB A;  1YEP A;  4KDY A;  2GT5 A;  1OE7 A;  2FY6 A;  2V41 A;  3I6A A;  2KHP A;  1OC9 A;  2LKU A;  1XWC A;  4Z7X A;  2J9H A;  3M1G A;  4BL7 A;  5DQY A;  1FHE A;  3PR8 A;  2P31 A;  5CO3 A;  5GSS A;  2GZP A;  2FHE A;  1X0R A;  4G2E A;  2LEG A;  2TRX A;  3IXR A;  5IO2 A;  3CRT A;  2YWM A;  4Q5R A;  3G7J A;  3FZ9 A;  5GAP D;  4GTU A;  1J0F A;  1NHO A;  2PN8 A;  1GUM A;  4ZBD A;  1OAZ A;  3CSH A;  4K7N A;  1GH2 A;  2GDR A;  5D96 A;  2OAC A;  3HD5 A;  3HZ4 A;  2CZ3 A;  1ZMA A;  4PQH A;  5IMZ A;  4XRD A;  2K8V A;  3M8N A;  2HRN A;  2AAW A;  4JE1 A;  1SJ6 A;  4HJ2 A;  2HRF A;  5G30 A;  2C0E A;  3MWH A;  1SYR A;  2VM2 A;  2X99 A;  4OO4 A;  2C3Q A;  1XW6 A;  1EP8 A;  1DE2 A;  1M0U A;  2I9H A;  2XC2 A;  4EUY A;  3QOU A;  2B1K A;  5B8B A;  1QGV A;  5JWO B;  1ERV A;  1O8W A;  1JZO A;  3W6G A;  4DSR A;  4GSN A;  2GSQ A;  1X9W B;  2O89 A;  2V6K A;  3DD3 A;  3E9J B;  3J7Y b;  1YEX A;  1XWK A;  1WRY A;  2P5Q A;  1V98 A;  4CHS A;  1K0N A;  2TIR A;  3GX8 A;  2GLR A;  2N5A A;  2Z9S A;  1GNW A;  2C8U A;  1M2B A;  4CW9 A;  1XWA A;  1OC8 A;  2B7K A;  2NTO A;  6GSV A;  4TR1 A;  2HFD A;  6GST A;  1K0C A;  3BD2 A;  2WUL A;  13GS A;  1A0F A;  2V2G A;  4LMV A;  2NPB A;  4IBP A;  2MMA A;  4PXO A;  3TDG A;  3CMI A;  1SL2 B;  4IQ1 A;  2RUE A;  3GH6 A;  4MJA A;  1PMT A;  4N0Z A;  3FZ5 A;  2N5F A;  5G1L A;  5DJL A;  1Z6M A;  3KTL A;  4V2L A;  1XW5 A;  3ZIJ A;  2FWH A;  2WDU A;  2RM5 A;  2FA4 A;  4GLT A;  2K18 A;  1M2D A;  1GRX A;  3BCI A;  1TW9 A;  2G2Q A;  2DC5 A;  3ERF A;  3GKX A;  2WJU A;  3KZQ A;  2H76 A;  3IHQ A;  4FYC A;  5IQY A;  1O73 A;  1GUK A;  4Q5Q A;  4LL4 B;  3VPT A;  2P0G A;  4MZC A;  4IN0 A;  3W8S A;  3SWL A;  3WT2 A;  1PN9 A;  3MDK A;  2AYT A;  1EOG A;  1BG5 A;  1ST9 A;  5JCG A;  2K9F A;  3I43 A;  2CX4 A;  1F3A A;  4ZL9 A;  4DEJ A;  1TU7 A;  3AY8 A;  3ZLP A;  5C04 A;  4MF7 A;  1EOH A;  3L4N A;  2TRC P;  3MNG A;  4TXO B;  4L8E A;  3C8E A;  2HZE A;  5J3R A;  5COH A;  2FCH A;  3H93 A;  1PL2 A;  2OBI A;  2CA8 A;  4NAX A;  3UVH A;  2B5X A;  3LYP A;  4RI6 A;  3HKR A;  5D9V A;  4MP4 A;  5B8A A;  1LJR A;  4F0C A;  1PSQ A;  3F6F A;  1YQ1 A;  3I69 A;  2YWO A;  2GS3 A;  3VWU A;  1TJD A;  1Z7R A;  3IPZ A;  2GQK A;  3UVT A;  4O5R A;  3APO A;  3US3 A;  1JZD A;  2WRT A;  4K2D A;  3A2W A;  3DML A;  2VCQ A;  5AIS A;  1K0M A;  3D5J A;  3QFA C;  1GSU A;  5LNK e;  1SL1 B;  5IOX A;  2L5O A;  2GVP A;  1Z3E A;  1TK5 B;  1SL0 B;  5DCH A;  5FT3 A;  1XXU A;  3DGQ A;  1OE8 A;  1GL8 A;  3IC4 A;  3TUE A;  3GX0 A;  5EPF A;  3HJM A;  1FG4 A;  3FW2 A;  3Q6O A;  2BJX A;  2HSH A;  4ACS A;  3DEX A;  3LGC A;  2GQL A;  3H79 A;  3GV1 A;  1THX A;  2H19 A;  4K0G A;  5GZZ B;  3APS A;  4V1A g;  3TKS C;  2H6Y A;  2IMF A;  3V1W A;  5G31 A;  2I1U A;  1OVN A;  4MH2 A;  2H1D A;  2JZT A;  2L4Q A;  3GH9 A;  5CRW A;  4HZ2 A;  4BPY A;  5J4U A;  2CX3 A;  6GSU A;  4WR4 A;  1XWG A;  2VUP A;  1VGL A;  3QMX A;  1XVW A;  2V6O A;  2GZY A;  1FB0 A;  2H0H A;  3RHC A;  4HQS A;  5CP1 A;  3QDN A;  5D9W A;  4IP6 A;  4HOJ A;  4ECI A;  1V57 A;  5DCG A;  1SYX A;  4KGI A;  4HQZ A;  5ECM B;  2OE3 A;  4ZBB A;  3CSI A;  2O87 A;  1VF1 A;  2RM6 A;  1RK4 A;  1NM3 A;  1QMV A;  4OFN A;  1TU8 A;  2JAD A;  4DSS A;  1F3B A;  3P90 A;  4V1A p;  2XBQ A;  2YP6 A;  1TKD B;  2CV4 A;  1RQM A;  2YJH A;  1KBN A;  1WOU A;  4KW6 A;  5F8B A;  3RBT A;  1K0D A;  1AAZ A;  3F63 A;  1EWX A;  2ALB A;  3VI5 A;  2K6V A;  5J9C A;  1EGO A;  2IWT A;  4WBJ A;  6GSX A;  2C3T A;  2NDO A;  4I97 A;  4PNG A;  2ZNM A;  2R37 A;  4EVM A;  2C0F A;  2PER A;  5J41 A;  14GS A;  2F9S A;  4FH8 A;  3CBU A;  1PRX A;  2KLX A;  2HLS A;  1MD4 A;  1PL1 A;  5AGY A;  4ZL7 A;  2DJ3 A;  1O85 A;  3ED3 A;  5IMV A;  4XCS A;  1A8L A;  1XBS A;  1LU4 A;  4RQR A;  2L5L A;  2DIY A;  1M2A A;  2OE0 A;  3GMF A;  3IBH A;  3KGK A;  3ZIV A;  1A2J A;  4ML6 A;  5EVO A;  3GKK A;  2KOK A;  5HR2 A;  5KN0 A;  4K0N A;  4TVE A;  4YAP A;  4AGS A;  1TRS A;  3EYT A;  2WZ9 A;  3H1N A;  2LS5 A;  3PH9 A;  1Z5Y E;  1S3D A;  3GN3 A;  4BWQ A;  22GS A;  2R3X A;  3TJB A;  2F8A A;  3IK7 A;  2JZR A;  1FVK A;  1U3I A;  3D0Z A;  3GRX A;  3TCO A;  1SK0 A;  5ECK B;  2O7K A;  2H73 A;  3HJO A;  5F0G A;  4X1U A;  4JZQ A;  1R5A A;  4LA1 A;  3EIN A;  20GS A;  2IJY A;  3LSZ A;  2PMT A;  3RAZ A;  2OA7 A;  5AN1 A;  3L78 A;  2AUV A;  4XS6 A;  4HU9 A;  1TK0 B;  2A2S A;  2AB6 A;  1M99 A;  4GQF A;  4HDE A;  2GSS A;  3TJJ A;  4GQC A;  3LYK A;  3F8U A;  1XW9 A;  2M80 A;  3CTG A;  2VD1 A;  2B3S A;  1JFU A;  4YQM A;  1A2L A;  1SU9 A;  4POB A;  1EEM A;  3TJG A;  1TTZ A;  3A2X A;  4MH3 A;  1LBK A;  1H75 A;  4XRA A;  4K9Z A;  1C72 A;  2YOI A;  3HDC A;  4JED A;  5DAL A;  2PBJ A;  1T4Z A;  2H70 A;  2LV3 A;  1K0B A;  2YNX A;  4LL1 B;  1EV4 A;  4Q5N A;  5D73 A;  3F4S A;  4MDC A;  1JLW A;  3LJR A;  1F2E A;  3L9U A;  3FY7 A;  2HT9 A;  5JWR B;  1A2M A;  4HU7 A;  4KA0 A;  5EL8 A;  2EIQ A;  4RI7 A;  5ENU A;  3QAV A;  4IJI A;  1OYJ A;  1ERU A;  2OKA A;  5DBQ A;  1HD2 A;  3HA9 A;  2H66 A;  1AQW A;  1YY7 A;  4QL7 A;  4BVY A;  3DRN A;  2X8H A;  1NHY A;  4ID0 A;  5HR3 A;  4V2M A;  1HNC A;  3RDW A;  3F4R A;  2GT6 A;  5CRE A;  3ME7 A;  1YF0 A;  4FYB A;  1J08 A;  1SK1 A;  3ZZX A;  1GSQ A;  5A4U A;  4EC0 A;  2E2M A;  3C73 A;  4K7O A;  2H30 A;  2YN1 A;  3C71 A;  2ZUP A;  1YJ6 A;  3D6I A;  1O81 A;  4TKY A;  3HXS A;  1F6M C;  3IOS A;  2OJL A;  2EIO A;  5CRH A;  4MZB A;  3K8N A;  4PUA A;  4WET A;  3GFK A;  1X5D A;  2AV4 A;  4WBR D;  5F06 A;  3IAM 2;  4HEA 2;  4KUN A;  2L6C A;  6GSY A;  4ECJ A;  3ZML A;  3ZRD A;  3IR4 A;  16GS A;  1Z7P A;  3KJY A;  5AIV A;  1X5C A;  4I6X A;  2LST A;  4O7H A;  4NMU A;  5B6M A;  3D21 A;  3F3Q A;  5J9B A;  1VF3 A;  4G9H A;  5D93 A;  4RUV A;  1BJX A;  1PKW A;  5G1K A;  1ZYE A;  3TB2 A;  1QFN A;  5H5Q A;  2LUS A;  4ML1 A;  1EGR A;  2CVK A;  4PUF C;  1HNB A;  4KH7 A;  5DAK A;  3IA1 A;  2XPE A;  2O85 A;  5ECO B;  5INY A;  1R4W A;  1XIY A;  3VUR A;  4TXV A;  3FHK A;  4F2I A;  1FB6 A;  1VF4 A;  4XS4 A;  1T1V A;  4WR5 A;  4DVC A;  1U6T A;  1TRW A;  2IFQ B;  4IJ3 A;  3L0H A;  2AJQ B;  4ZB6 A;  5ELA A;  2HYX A;  4OFM A;  3J7Y k;  2IMD A;  4BWS A;  1GTU A;  2VL2 A;  5CRG A;  3A2V A;  1MD3 A;  5J5N A;  2EIR A;  3FYG A;  1GSE A;  4N11 A;  3TOT A;  1F9M A;  3IV4 A;  5ECR B;  1XVQ A;  3CSJ A;  3M9K A;  1GNE A;  4L5O A;  5G5F A;  1PGT A;  3UBL A;  3LQ7 A;  2HE3 A;  1ILO A;  2CVB A;  2PVQ A;  2JU5 A;  3EVI A;  4BVX A;  4EDZ A;  2PWJ A;  3APQ A;  1K3Y A;  4HZ4 A;  3EU4 A;  3GTU A;  19GS A;  4LLR A;  3GKN A;  2PGT A;  1AW9 A;  2HNL A;  3SBC A;  3UAR A;  2QGV A;  3S9F A;  3MSZ A;  2P5R A;  4XS1 A;  2GZZ A;  2J23 A;  5IM9 A;  4J57 E;  4MZW A;  2LQO A;  2FWE A;  2V32 A;  4MF6 A;  4YQU A;  4GST A;  3IE3 A;  4MPF A;  3W8J A;  4TR3 A;  3QFB C;  5LCZ A;  1M7T A;  1OC9 B;  1SJZ A;  2C3N A;  5ABR A;  1U3A A;  2PPT A;  3M9J A;  3UAP A;  1AUC A;  1R7H A;  2FWF A;  2YCD A;  4MK3 A;  1M9A A;  3LXT A;  2YAN A;  2NVL A;  2VCZ A;  2F3M A;  2JZS A;  1Y6E A;  2N5B A;  6GSS A;  2A2R A;  5D9T A;  4EL1 A;  5ECH B;  3HVX A;  5D9X A;  3D4T A;  4POM A;  1OC3 A;  2DIZ A;  1EZK A;  4MJE A;  4ZIL A;  5CNW A;  2QSI A;  2VM1 A;  1TDI A;  4H86 A;  2L59 A;  3JCM L;  1Z9H A;  1ZGN A;  2B5E A;  1BYE A;  3WD6 A;  3C7M A;  1DUG A;  1Q4J A;  2FNO A;  3HHV A;  4O32 A;  3N9J A;  1A23 A;  1TP9 A;  2JSY A;  2DLX A;  4F0B A;  4GF0 A;  1O7U A;  1NW2 A;  2DJJ A;  5KN2 A;  3VFI A;  5IPH A;  5IO0 A;  5A4W A;  2GGT A;  4D73 A;  1QQ2 A;  3GNJ A;  2O8V B;  1K3L A;  1G7E A;  5DDL A;  5B6N A;  5HFG A;  2XHF A;  4ILF A;  4QQ7 A;  5A4V A;  2GSR A;  5ID2 A;  3QR6 A;  1SKW B;  1TI1 A;  3H4K A;  3KXO A;  4HI7 A;  1B4Q A;  1SD8 A;  1AIU A;  2CVD A;  4TR0 A;  4JU5 A;  4F03 A;  4AJ8 A;  1JLV A;  3EMX A;  3DVX A;  1AQV A;  2V1M A;  2H0G A;  1K3O A;  2MMZ A;  3F4T A;  5B7C A;  1URM A;  4IGJ A;  4WEY A;  11GS A;  1YKC A;  1AXD A;  4QL9 A;  1FOV A;  3QAG A;  1ERW A;  5ECI B;  3TKQ A;  1HNA A;  4IHU A;  4TR1 B;  4NXI A;  4POK A;  5L71 A;  4MPG A;  4JR6 A;  1ZCP A;  3HVS A;  4IEL A;  3VWX A;  4I2T A;  2QKE A;  1H4O A;  4GSS A;  1A24 A;  4V2N A;  2LJR A;  5HR1 A;  2H8L A;  3WGX A;  2NBS A;  5FWG A;  2X8G A;  3Q18 A;  4NV5 A;  3N5O A;  2XBI A;  2L4C A;  2MBT A;  2H01 A;  5JCU A;  2LQQ A;  2JSZ A;  2LNT A;  1S3A A;  4XTS A;  2KP1 A;  3CYN A;  5HQP A;  5KEJ A;  2MYG A;  1X5E A;  2H0I A;  3Q19 A;  2VLT A;  3FKF A;  1XFL A;  2YWN A;  3NOF A;  2YPM A;  2L6D A;  3GTU B;  3LOR A;  1UN2 A;  1TXX A;  3QD9 A;  1R26 A;  3ERW A;  1A8Y A;  4TN8 A;  1M9B A;  2CAQ A;  3BOA A;  4F82 A;  4CDO A;  4PNF A;  2WCI A;  4K8M A;  2HZE B;  2YZU A;  4HUA A;  3EC3 A;  3KP8 A;  6GSW A;  1W89 A;  3LFL A;  1S3C A;  3ZYW A;  1BQ7 A;  4ZIJ A;  3G7Y A;  2E0Q A;  5IMA A;  3VI7 A;  4EXJ A;  3EMP A;  4I2U A;  1ZL9 A;  2VOC A;  2I81 A;  5GAN D;  2A4V A;  2VCT A;  3DYR A;  1GUH A;  4KE3 A;  4EE0 A;  1GLQ A;  4OFT A;  2H6X A;  1GTI A;  3TGZ A;  2OBK A;  5JWQ B;  1EP7 A;  1WJK A;  4ZB9 A;  2FWG A;  1DE1 A;  5G2Z A;  1IYI A;  3ZFB A;  1ON4 A;  2LRT A;  2WGR A;  1HQO A;  1PX6 A;  2PVO C;  1AC1 A;  4AF2 A;  2IN3 A;  4TOP A;  3KMO A;  3A3T A;  5DJM A;  5ECS A;  4X43 A;  2IME A;  3ZRE A;  2DML A;  4WF5 A;  1GSY A;  2PUK C;  2ON5 A;  3VWW A;  5ELG A;  1A0R P;  4K1F A;  1B9Y C;  4MJB A;  3VPQ A;  4K7I A;  1PQN A;  1TRV A;  1PA3 A;  5IMF A;  3IAS 2;  1BED A;  2VCW A;  1K0A A;  2AHE A;  4OMV A;  4D73 B;  3KP9 A;  1SKR B;  1ZOF A;  2LTK A;  4EDY A;  2HZF A;  3RHB A;  4PUR A;  3RPP A;  2WS2 A;  3GA4 A;  3HYP A;  1MDK A;  4NWY A;  1JZR A;  4AJ7 A;  9GSS A;  3CXG A;  3KD0 A;  2KUC A;  2IL3 A;  1WPI A;  3UL3 A;  5CRD A;  1BX9 A;  4KND A;  3ZFL A;  4GXZ A;  5HR0 A;  2DJ2 A;  1TI3 A;  2LRC A;  3Q74 A;  1Y25 A;  2M72 A;  1TOF A;  5ECP B;  3EWL A;  1GUL A;  2IMI A;  1JHB A;  3GHA A;  1V40 A;  2YV7 A;  2C1Y A;  5C00 A;  4HS1 A;  2LNS A;  3G7I A;  1G7O A;  2MMN A;  4DSS B;  2VL9 A;  3HJP A;  2VLV A;  5GST A;  3HCZ A;  1GLP A;  4J56 E;  5F05 A;  2CZ2 A;  5G5E A;  4GCI A;  5DVB A;  3ERG A;  3ZVJ A;  3RPN A;  2FA8 A;  3CTF A;  5HFI A;  3DIE A;  4X0X A;  4KSM A;  3LEF A;  3TKP A;  1PX7 A;  2F8F A;  1ERT A;  3QAW A;  4N10 A;  3FZA A;  4J2F A;  1DSB A;  4FIW A;  1XWB A;  2HI7 A;  1E2Y A;  3EU3 A;  3PGT A;  2DBC A;  4OCE A;  3D4M A;  2OE1 A;  1O6J A;  4OD7 A;  3WGE A;  1FO5 A;  3DWV A;  5H5R A;  4KDU A;  2RUF A;  5D8I A;  3A5W A;  4JR4 A;  1SJI A;  5FHI A;  1U88 A;  4N30 A;  4NPB A;  1B4P A;  1OKD A;  2DMM A;  1ZZY A;  3HY2 A;  4KCE A;  4PQI A;  1T8E B;  3TRX A;  2VL2 C;  1ML6 A;  2GQM A;  2RII A;  3WT1 A;  3C1R A;  3LG6 A; 
#chains in the Genus database with same CATH topology
 18GS A;  2H1A A;  1KNG A;  4WKW A;  1SKS B;  2VLU A;  3TOU A;  4A5P A;  3F9U A;  1J9B A;  4MA9 A;  5E4W A;  4Z2T A;  3PIN A;  2VL3 A;  1B8X A;  3F6D A;  2QA2 A;  4ECB A;  4PGT A;  3UMA A;  3ZIT A;  4TW5 A;  2DSA A;  4WXT A;  2VCV A;  4F9Z A;  4I8B A;  4ZBA A;  1G6W A;  4KB3 A;  3UOM A;  1SD9 A;  2GTU A;  1VRS D;  3R2Q A;  4MLY A;  2MZC A;  4KX4 A;  1ZYQ B;  1T7P B;  1HYU A;  2YJ7 A;  4MF5 A;  2EC4 A;  2E7P A;  1SK2 A;  3KH7 A;  5HFK A;  3GST A;  1GP1 A;  3WYW A;  3TKS E;  3TJK A;  1YDK A;  2ZCT A;  4ECC A;  3QPM A;  3HVV A;  2R0G A;  1IYH A;  4PQ1 A;  4ULX A;  5DQS A;  2IPA A;  2C0G A;  2B7J A;  5DAL B;  5KN3 A;  3DVW A;  4MCU A;  2X49 A;  1TRU A;  4O92 A;  1PD2 1;  2VIM A;  2YWI A;  3OR5 A;  3UBK A;  5KOX A;  1MTC A;  3GUR A;  1XZO A;  2H71 A;  2YZH A;  1V9W A;  1JZW A;  4ZB8 A;  3D22 A;  1R5P A;  3QCP A;  4OCF A;  2IIY A;  5IMD A;  2WFC A;  4MAB A;  4FYU A;  4E8E A;  2H74 A;  1WMJ A;  2F51 A;  3DKS A;  3L9V A;  2QC7 A;  1XOA A;  4E8H A;  1EV9 A;  4IW9 A;  4JRR A;  1V2A A;  3KM6 A;  4BVY B;  7GSS A;  5IMC A;  1TK8 B;  2OAD A;  4TRX A;  4EO3 A;  1ACV A;  4RQX A;  3KH9 A;  2KP2 A;  4ZL8 A;  3CRU A;  3M0F A;  1UA5 A;  1FAA A;  4KSO A;  1E6B A;  1X9S B;  1DBY A;  3U6V A;  2VO4 A;  3E3E A;  1QXH A;  1YKA A;  3G9B A;  4G10 A;  1FW1 A;  1EEJ A;  4L0W A;  2M46 A;  10GS A;  4Q5F A;  2H1G A;  2B1L A;  3FZ4 A;  1T3B A;  1WE0 A;  3NZN A;  2VCX A;  4ZXG A;  3H8Q A;  4L0U A;  1GWC A;  2VD0 A;  1QK8 A;  1G6Y A;  3KMN A;  2VAF A;  1I5G A;  1V58 A;  2C4J A;  1RW1 A;  2D2Z A;  4G0L A;  2BTO T;  3PPU A;  2CT6 A;  5H5S A;  2C0D A;  3KTB A;  4NHW A;  1OKT A;  3L9S A;  3VLN A;  4HJM A;  4NHZ A;  4XHM A;  4YKG A;  4IKH A;  4P3Y B;  2BMX A;  3FEU A;  5A5K A;  3BCK A;  3FK8 A;  1XPV A;  4BA7 A;  1KEB A;  3UJ1 A;  4PX1 A;  1W4V A;  3ZTL A;  2RLI A;  3KEB A;  4YAV A;  5ECN B;  2HSY A;  3DXB A;  4YQV A;  1NSW A;  2FLS A;  3FR9 A;  4K5S A;  3ISO A;  2WB9 A;  3BJ5 A;  4NV2 A;  5DAK B;  2X64 A;  1WWJ A;  5CAX A;  3TKS A;  1VF2 A;  3VK9 A;  1N2A A;  3IK9 A;  2CQ9 A;  3GIX A;  4X4J A;  4XS4 B;  3MAK A;  3P8W A;  2R6K A;  3VWV A;  2C80 A;  4OO5 A;  4K2X A;  2PU9 C;  2JL4 A;  1I9D A;  1ABA A;  4OWY A;  3BBY A;  5KN1 A;  3P2A A;  1N8J A;  5E59 A;  3EUR A;  2DJ0 A;  1GSS A;  2REM A;  1S3R A;  1CQH A;  2R4V A;  4FO5 A;  4KCA A;  1PKZ A;  1GSD A;  3LXZ A;  3FR3 A;  2I3Y A;  4KDX A;  2A2P A;  5F07 A;  3I9V 2;  2IMK A;  4BVX B;  2YV9 A;  3E0U A;  2FGX A;  2MMO A;  3M3M A;  3LWA A;  3ZL5 A;  2DJ1 A;  1USB A;  4K5R A;  3IRA A;  5ECQ B;  4MJC A;  4I5Q A;  2R2J A;  1Q98 A;  3F0I A;  1SEN A;  2MBS A;  3P7X A;  4LMW A;  2ON7 A;  3KIJ A;  4EKZ A;  2X8C A;  2GST A;  4WF4 A;  3FR6 A;  3ZMK A;  1T00 A;  1GTB A;  4POL A;  2DKH A;  2H72 A;  3GL3 A;  5JCW A;  3GKM A;  4YH2 A;  2I4A A;  1YZX A;  3ME8 A;  1FVJ A;  4L5L A;  2LJA A;  1MDI A;  4IS0 A;  4MMM A;  3TRP A;  2XPD A;  3IDV A;  4ISD A;  1WIK A;  4JBB A;  2X4A A;  3NIV A;  3U5R E;  2R5G A;  5IIZ A;  3O76 A;  4PTS A;  1O8X A;  2K8S A;  3TRQ A;  4GRF A;  2FUG 2;  1MEK A;  3TJF A;  2LJK A;  3O6T A;  1UVZ A;  2G0F A;  1AQX A;  2HRK A;  3HZ8 A;  1G0T A;  2IFQ A;  2HXK A;  4KAE A;  5AIX A;  2B5Y A;  3EE2 A;  1YF1 A;  3O3T A;  3KCM A;  2H6Z A;  3GL5 A;  1XCC A;  4CY6 A;  1GSF A;  12GS A;  5LD0 A;  1WP0 A;  1U87 A;  3IC8 A;  3WGD A;  4XIH A;  1F37 A;  2CAI A;  3GYK A;  4EF0 A;  1KTE A;  1THO A;  2DKI A;  2E2G A;  1X9M B;  2DJK A;  1BAY A;  1QUW A;  3FRC A;  2ES7 A;  4IVF A;  4DSQ A;  4TR4 A;  3C1S A;  1Z6N A;  5EY6 A;  2B6M A;  1UC7 A;  2LRN A;  1B48 A;  1B9X C;  5ECL B;  3F3R A;  2H1B A;  3FMW A;  4IP1 A;  1K0O A;  4N0V A;  1MDJ A;  2H75 A;  3UIW A;  1CQG A;  2L57 A;  4GWR A;  5IOW A;  3GUS A;  5ID2 B;  5IPG A;  4TXO A;  1T4Y A;  2JAC A;  4IQA A;  2FD3 A;  5CYY A;  3GSS A;  4AJ6 A;  3TKR A;  1GTA A;  4K6X A;  4G19 A;  3UEM A;  3ZVJ D;  8GSS A;  17GS A;  1XOB A;  1YEP A;  4KDY A;  2GT5 A;  1OE7 A;  2FY6 A;  2V41 A;  3I6A A;  2KHP A;  1OC9 A;  2LKU A;  1XWC A;  4Z7X A;  3CQF A;  2J9H A;  3M1G A;  4BL7 A;  5DQY A;  1FHE A;  3PR8 A;  2P31 A;  5CO3 A;  5GSS A;  2GZP A;  2FHE A;  1X0R A;  2A4H A;  4G2E A;  2LEG A;  2TRX A;  3IXR A;  5IO2 A;  3CRT A;  2YWM A;  4Q5R A;  3G7J A;  3FZ9 A;  5GAP D;  4GTU A;  1J0F A;  1NHO A;  2PN8 A;  1GUM A;  4ZBD A;  1OAZ A;  3CSH A;  4K7N A;  1GH2 A;  2GDR A;  5D96 A;  2OAC A;  3HD5 A;  3HZ4 A;  2CZ3 A;  1ZMA A;  4PQH A;  5IMZ A;  4XRD A;  2K8V A;  3M8N A;  2HRN A;  2AAW A;  4JE1 A;  1SJ6 A;  4HJ2 A;  2HRF A;  5G30 A;  2C0E A;  3MWH A;  1SYR A;  2VM2 A;  2X99 A;  4OO4 A;  2C3Q A;  1XW6 A;  1EP8 A;  1DE2 A;  1M0U A;  2I9H A;  2XC2 A;  4EUY A;  3QOU A;  2B1K A;  5B8B A;  1ZYN A;  1QGV A;  5JWO B;  1ERV A;  1O8W A;  1JZO A;  3W6G A;  4DSR A;  1PN0 A;  4GSN A;  2GSQ A;  1X9W B;  2O89 A;  2V6K A;  3DD3 A;  3E9J B;  3J7Y b;  1YEX A;  1XWK A;  1WRY A;  2P5Q A;  1V98 A;  4CHS A;  1K0N A;  2TIR A;  3GX8 A;  2GLR A;  2N5A A;  2Z9S A;  1GNW A;  2C8U A;  1M2B A;  4CW9 A;  1XWA A;  1OC8 A;  2B7K A;  2NTO A;  6GSV A;  4TR1 A;  2HFD A;  6GST A;  3A5I A;  1K0C A;  3BD2 A;  2WUL A;  13GS A;  1A0F A;  2V2G A;  4LMV A;  2NPB A;  4IBP A;  2MMA A;  4PXO A;  3TDG A;  3CMI A;  1SL2 B;  4IQ1 A;  2RUE A;  3GH6 A;  4MJA A;  1PMT A;  4N0Z A;  3FZ5 A;  2N5F A;  5G1L A;  5DJL A;  1Z6M A;  3KTL A;  4V2L A;  1XW5 A;  3ZIJ A;  2FWH A;  2WDU A;  2RM5 A;  2FA4 A;  4GLT A;  2K18 A;  1M2D A;  1GRX A;  3BCI A;  1TW9 A;  2G2Q A;  2DC5 A;  3ERF A;  3GKX A;  2WJU A;  3KZQ A;  2H76 A;  3IHQ A;  4FYC A;  4EIQ A;  5IQY A;  1O73 A;  1GUK A;  4Q5Q A;  4LL4 B;  3VPT A;  2P0G A;  4MZC A;  4IN0 A;  3W8S A;  3SWL A;  3WT2 A;  1PN9 A;  1PFO A;  3MDK A;  2AYT A;  1EOG A;  1BG5 A;  1ST9 A;  5JCG A;  2K9F A;  3I43 A;  2CX4 A;  1F3A A;  4ZL9 A;  4DEJ A;  1TU7 A;  3AY8 A;  3ZLP A;  5C04 A;  4MF7 A;  1EOH A;  3L4N A;  2TRC P;  3MNG A;  4TXO B;  4L8E A;  3C8E A;  2HZE A;  5J3R A;  5COH A;  2FCH A;  3H93 A;  1PL2 A;  2OBI A;  2CA8 A;  4NAX A;  3UVH A;  2B5X A;  3LYP A;  4RI6 A;  2UZ8 A;  3HKR A;  5D9V A;  4MP4 A;  5B8A A;  4KF9 A;  4FQU A;  1LJR A;  4F0C A;  1PSQ A;  3F6F A;  1YQ1 A;  3I69 A;  4Z2R A;  1XG8 A;  2YWO A;  2GS3 A;  3VWU A;  1TJD A;  1Z7R A;  3IPZ A;  2GQK A;  3UVT A;  4O5R A;  3APO A;  3US3 A;  1JZD A;  2WRT A;  4K2D A;  3A2W A;  3DML A;  2VCQ A;  5AIS A;  1K0M A;  3D5J A;  3QFA C;  1GSU A;  5LNK e;  1SL1 B;  5IOX A;  2L5O A;  2GVP A;  1Z3E A;  1TK5 B;  1SL0 B;  5DCH A;  5FT3 A;  1XXU A;  3DGQ A;  1OE8 A;  1GL8 A;  3IC4 A;  3TUE A;  3GX0 A;  5EPF A;  3HJM A;  1FG4 A;  3FW2 A;  3Q6O A;  2BJX A;  2HSH A;  4ACS A;  3DEX A;  3LGC A;  2GQL A;  3H79 A;  3GV1 A;  1THX A;  2H19 A;  4K0G A;  5GZZ B;  3APS A;  4V1A g;  3TKS C;  2H6Y A;  2IMF A;  3V1W A;  5G31 A;  3HVN A;  2I1U A;  1OVN A;  4MH2 A;  2H1D A;  2JZT A;  2L4Q A;  3GH9 A;  5CRW A;  4HZ2 A;  4BPY A;  5J4U A;  2CX3 A;  4HSC X;  6GSU A;  4WR4 A;  1XWG A;  2VUP A;  1VGL A;  3QMX A;  1XVW A;  2V6O A;  2GZY A;  1FB0 A;  2H0H A;  3RHC A;  4HQS A;  5CP1 A;  3QDN A;  5D9W A;  4IP6 A;  3LW9 A;  4HOJ A;  4ECI A;  1V57 A;  5DCG A;  1SYX A;  4KGI A;  4HQZ A;  5ECM B;  2OE3 A;  4ZBB A;  3CSI A;  2O87 A;  1VF1 A;  2RM6 A;  1RK4 A;  1NM3 A;  1QMV A;  4OFN A;  1TU8 A;  2JAD A;  4DSS A;  1F3B A;  3P90 A;  4V1A p;  2XBQ A;  2YP6 A;  1TKD B;  2CV4 A;  1RQM A;  2YJH A;  1KBN A;  1WOU A;  4KW6 A;  5F8B A;  3RBT A;  1K0D A;  1AAZ A;  3F63 A;  1EWX A;  2ALB A;  3VI5 A;  2K6V A;  5J9C A;  1EGO A;  2IWT A;  4WBJ A;  6GSX A;  2C3T A;  2NDO A;  4I97 A;  4PNG A;  2ZNM A;  2R37 A;  4EVM A;  2C0F A;  2PER A;  5J41 A;  14GS A;  2F9S A;  4FH8 A;  3CBU A;  1PRX A;  2KLX A;  2HLS A;  1MD4 A;  1PL1 A;  5AGY A;  4ZL7 A;  2DJ3 A;  1O85 A;  3ED3 A;  5IMV A;  4XCS A;  1A8L A;  1XBS A;  1LU4 A;  4RQR A;  2L5L A;  2DIY A;  1M2A A;  2OE0 A;  3GMF A;  3IBH A;  3KGK A;  3ZIV A;  1A2J A;  4ML6 A;  5EVO A;  3GKK A;  2KOK A;  5HR2 A;  5KN0 A;  4K0N A;  4TVE A;  4YAP A;  4AGS A;  1TRS A;  3EYT A;  2WZ9 A;  3H1N A;  2LS5 A;  3PH9 A;  1Z5Y E;  1S3D A;  1M3J A;  3GN3 A;  4BWQ A;  1FOH A;  22GS A;  2R3X A;  3TJB A;  2F8A A;  3IK7 A;  2JZR A;  1FVK A;  1U3I A;  3D0Z A;  3GRX A;  3TCO A;  1SK0 A;  5ECK B;  2O7K A;  2H73 A;  3HJO A;  5F0G A;  4X1U A;  4JZQ A;  1R5A A;  4LA1 A;  3EIN A;  20GS A;  2IJY A;  3LSZ A;  2PMT A;  3RAZ A;  2OA7 A;  5AN1 A;  3L78 A;  2AUV A;  4XS6 A;  4HU9 A;  1TK0 B;  2A2S A;  2AB6 A;  1M99 A;  4GQF A;  4HDE A;  2GSS A;  3TJJ A;  4GQC A;  3LYK A;  3F8U A;  1XW9 A;  2M80 A;  3CTG A;  2VD1 A;  2B3S A;  1JFU A;  4YQM A;  1A2L A;  1ZYP A;  1SU9 A;  4POB A;  1EEM A;  3TJG A;  1TTZ A;  3A2X A;  4MH3 A;  1LBK A;  1H75 A;  4XRA A;  4K9Z A;  1C72 A;  2YOI A;  3HDC A;  4JED A;  5DAL A;  2PBJ A;  1T4Z A;  2H70 A;  2LV3 A;  1K0B A;  2YNX A;  4LL1 B;  1M3I A;  1EV4 A;  4Q5N A;  5D73 A;  3F4S A;  4MDC A;  1JLW A;  3LJR A;  1F2E A;  3L9U A;  3FY7 A;  2HT9 A;  5JWR B;  1A2M A;  4HU7 A;  4KA0 A;  5EL8 A;  2EIQ A;  4RI7 A;  5ENU A;  3QAV A;  4IJI A;  1OYJ A;  1ERU A;  2OKA A;  5DBQ A;  1HD2 A;  3HA9 A;  2H66 A;  4ICY A;  1AQW A;  1YY7 A;  4QL7 A;  4BVY A;  3DRN A;  2X8H A;  1NHY A;  4ID0 A;  5HR3 A;  4V2M A;  1HNC A;  3RDW A;  3F4R A;  2GT6 A;  5CRE A;  3ME7 A;  1YF0 A;  4FYB A;  1J08 A;  1SK1 A;  3ZZX A;  1GSQ A;  5A4U A;  4EC0 A;  2E2M A;  3C73 A;  4K7O A;  2H30 A;  2YN1 A;  3C71 A;  2ZUP A;  1YJ6 A;  3D6I A;  1O81 A;  4TKY A;  3HXS A;  1F6M C;  3IOS A;  2OJL A;  2EIO A;  5CRH A;  4MZB A;  3K8N A;  4PUA A;  4WET A;  3GFK A;  1X5D A;  2AV4 A;  4WBR D;  5F06 A;  3IAM 2;  4HEA 2;  4KUN A;  2L6C A;  6GSY A;  4ECJ A;  3ZML A;  3ZRD A;  3IR4 A;  16GS A;  1Z7P A;  3KJY A;  5AIV A;  1X5C A;  4I6X A;  2LST A;  4O7H A;  4NMU A;  5B6M A;  3D21 A;  3F3Q A;  5J9B A;  1VF3 A;  4G9H A;  5D93 A;  4RUV A;  1BJX A;  1PKW A;  5G1K A;  1ZYE A;  3TB2 A;  1QFN A;  5H5Q A;  2LUS A;  4ML1 A;  1EGR A;  2CVK A;  4PUF C;  1HNB A;  4KH7 A;  5DAK A;  3IA1 A;  2XPE A;  2O85 A;  5ECO B;  5INY A;  1R4W A;  1XIY A;  3VUR A;  4TXV A;  3FHK A;  4F2I A;  1FB6 A;  1VF4 A;  4XS4 A;  1T1V A;  4WR5 A;  4DVC A;  1U6T A;  1TRW A;  2IFQ B;  4IJ3 A;  3L0H A;  2AJQ B;  4ZB6 A;  5ELA A;  2HYX A;  4OFM A;  3J7Y k;  2IMD A;  4BWS A;  1GTU A;  2VL2 A;  5CRG A;  3A2V A;  1MD3 A;  5J5N A;  2EIR A;  3FYG A;  4G0K A;  1GSE A;  4N11 A;  3TOT A;  1F9M A;  3IV4 A;  5ECR B;  1XVQ A;  3CSJ A;  3M9K A;  1GNE A;  4L5O A;  5G5F A;  1PGT A;  3UBL A;  3LQ7 A;  2HE3 A;  4MNN A;  1ILO A;  2CVB A;  2PVQ A;  2JU5 A;  3EVI A;  4BVX A;  4EDZ A;  2PWJ A;  3APQ A;  2HRA A;  1K3Y A;  4HZ4 A;  3EU4 A;  3GTU A;  19GS A;  4LLR A;  3GKN A;  2PGT A;  1AW9 A;  2HNL A;  2R0P A;  3SBC A;  3UAR A;  2QGV A;  3S9F A;  3MSZ A;  2P5R A;  4XS1 A;  2GZZ A;  2J23 A;  5IM9 A;  4J57 E;  4MZW A;  2LQO A;  2FWE A;  2V32 A;  4MF6 A;  4YQU A;  4GST A;  3IE3 A;  4MPF A;  3W8J A;  4TR3 A;  5KOW A;  3QFB C;  5LCZ A;  1M7T A;  1OC9 B;  1SJZ A;  2C3N A;  5ABR A;  1U3A A;  2PPT A;  3M9J A;  3UAP A;  4BL7 B;  1AUC A;  1R7H A;  2FWF A;  2YCD A;  4MK3 A;  3EPT A;  1M9A A;  3LXT A;  2YAN A;  2NVL A;  2VCZ A;  2F3M A;  2JZS A;  1Y6E A;  2N5B A;  6GSS A;  2A2R A;  5D9T A;  4EL1 A;  5ECH B;  3HVX A;  5D9X A;  3D4T A;  4POM A;  1OC3 A;  4YKF A;  2DIZ A;  1EZK A;  4MJE A;  4ZIL A;  5CNW A;  2QSI A;  2VM1 A;  1TDI A;  4H86 A;  2L59 A;  3JCM L;  1Z9H A;  1ZGN A;  2B5E A;  1BYE A;  3WD6 A;  3C7M A;  1DUG A;  1Q4J A;  2FNO A;  3HHV A;  4O32 A;  3N9J A;  1A23 A;  1TP9 A;  2JSY A;  2DLX A;  4F0B A;  4GF0 A;  1O7U A;  1NW2 A;  2DJJ A;  5KN2 A;  4O5U A;  3VFI A;  5IPH A;  5IO0 A;  5A4W A;  2GGT A;  4D73 A;  1QQ2 A;  3GNJ A;  2O8V B;  1K3L A;  1G7E A;  5DDL A;  5B6N A;  5HFG A;  2XHF A;  4ILF A;  4QQ7 A;  5A4V A;  2GSR A;  2R0C A;  5ID2 A;  3QR6 A;  1SKW B;  1TI1 A;  3H4K A;  3KXO A;  4HI7 A;  1B4Q A;  1SD8 A;  1AIU A;  2CVD A;  4TR0 A;  4JU5 A;  4F03 A;  4AJ8 A;  1JLV A;  3EMX A;  3DVX A;  5BRT A;  1AQV A;  2V1M A;  2H0G A;  1K3O A;  2MMZ A;  3F4T A;  5B7C A;  1URM A;  4IGJ A;  4WEY A;  11GS A;  1YKC A;  1AXD A;  4QL9 A;  1FOV A;  3QAG A;  1ERW A;  5ECI B;  3TKQ A;  1HNA A;  4IHU A;  4TR1 B;  4NXI A;  4POK A;  5L71 A;  5BMU A;  4MPG A;  4JR6 A;  1ZCP A;  3HVS A;  4IEL A;  3VWX A;  4I2T A;  2QKE A;  1H4O A;  4GSS A;  1A24 A;  4V2N A;  2LJR A;  5HR1 A;  2H8L A;  3WGX A;  2NBS A;  5FWG A;  2X8G A;  3Q18 A;  4NV5 A;  3N5O A;  2XBI A;  2L4C A;  2MBT A;  2H01 A;  5JCU A;  2LQQ A;  2JSZ A;  2LNT A;  1S3A A;  4XTS A;  2KP1 A;  3IHG A;  3CYN A;  5HQP A;  5KEJ A;  2MYG A;  1X5E A;  2H0I A;  3Q19 A;  2VLT A;  3FKF A;  1XFL A;  2YWN A;  3NOF A;  2YPM A;  2L6D A;  3GTU B;  3LOR A;  1UN2 A;  1TXX A;  3QD9 A;  1R26 A;  3ERW A;  1A8Y A;  4TN8 A;  1M9B A;  2CAQ A;  3BOA A;  4F82 A;  4CDO A;  4PNF A;  2WCI A;  4K8M A;  2HZE B;  2YZU A;  4HUA A;  3EC3 A;  3KP8 A;  6GSW A;  1W89 A;  3LFL A;  1S3C A;  3MYD A;  3ZYW A;  1BQ7 A;  4ZIJ A;  3G7Y A;  2E0Q A;  5IMA A;  3VI7 A;  4EXJ A;  3EMP A;  4I2U A;  3MIX A;  1ZL9 A;  2VOC A;  2I81 A;  5GAN D;  2A4V A;  2VCT A;  3DYR A;  1GUH A;  4KE3 A;  4EE0 A;  1GLQ A;  4OFT A;  2H6X A;  1GTI A;  3TGZ A;  2OBK A;  5JWQ B;  1EP7 A;  1WJK A;  4ZB9 A;  2FWG A;  1DE1 A;  5G2Z A;  1IYI A;  3ZFB A;  1ON4 A;  2LRT A;  2WGR A;  1HQO A;  1PX6 A;  2PVO C;  1AC1 A;  4AF2 A;  2IN3 A;  2HSM A;  4TOP A;  3KMO A;  3A3T A;  5DJM A;  5ECS A;  4X43 A;  2IME A;  3ZRE A;  2DML A;  4WF5 A;  1GSY A;  2PUK C;  2ON5 A;  3VWW A;  5ELG A;  1A0R P;  4O5Q A;  4K1F A;  1B9Y C;  4MJB A;  3VPQ A;  4K7I A;  1PQN A;  1TRV A;  1PA3 A;  5IMF A;  3IAS 2;  1BED A;  2VCW A;  1K0A A;  2AHE A;  4OMV A;  4D73 B;  3KP9 A;  1SKR B;  1ZOF A;  2LTK A;  4EDY A;  2HZF A;  3RHB A;  4PUR A;  3RPP A;  2WS2 A;  3GA4 A;  3HYP A;  1MDK A;  4NWY A;  1JZR A;  4AJ7 A;  4EIP A;  9GSS A;  4USS A;  3CXG A;  3KD0 A;  2KUC A;  2IL3 A;  1WPI A;  3UL3 A;  5CRD A;  1BX9 A;  4KND A;  3ZFL A;  4GXZ A;  5HR0 A;  2DJ2 A;  1TI3 A;  2LRC A;  3Q74 A;  1Y25 A;  2M72 A;  1TOF A;  5ECP B;  3EWL A;  1GUL A;  2IMI A;  1JHB A;  3R3E A;  3GHA A;  1V40 A;  2YV7 A;  2C1Y A;  5C00 A;  4HS1 A;  2LNS A;  3G7I A;  1G7O A;  2MMN A;  4DSS B;  2VL9 A;  3HJP A;  2VLV A;  5GST A;  3HCZ A;  1GLP A;  4J56 E;  5F05 A;  2CZ2 A;  5G5E A;  4GCI A;  5DVB A;  3ERG A;  3ZVJ A;  3RPN A;  2FA8 A;  3CTF A;  5HFI A;  3DIE A;  4X0X A;  4KSM A;  3LEF A;  4Z2U A;  3TKP A;  1PX7 A;  2F8F A;  1ERT A;  3QAW A;  4N10 A;  3FZA A;  4J2F A;  2QA1 A;  1DSB A;  4FIW A;  1XWB A;  2HI7 A;  1E2Y A;  3EU3 A;  3PGT A;  2DBC A;  4OCE A;  3D4M A;  2OE1 A;  1O6J A;  4OD7 A;  3WGE A;  1FO5 A;  3DWV A;  5H5R A;  4KDU A;  2RUF A;  4BIK A;  5D8I A;  3A5W A;  4CY8 A;  4JR4 A;  1SJI A;  5FHI A;  1U88 A;  4N30 A;  4NPB A;  1B4P A;  1OKD A;  2DMM A;  1ZZY A;  3HY2 A;  4KCE A;  4PQI A;  4G0I A;  1T8E B;  3TRX A;  2VL2 C;  1ML6 A;  2GQM A;  2RII A;  3WT1 A;  3C1R A;  3LG6 A; 
#chains in the Genus database with same CATH homology
 18GS A;  2H1A A;  1KNG A;  4WKW A;  1SKS B;  2VLU A;  3TOU A;  4A5P A;  3F9U A;  1J9B A;  4MA9 A;  5E4W A;  4Z2T A;  3PIN A;  2VL3 A;  1B8X A;  3F6D A;  2QA2 A;  4ECB A;  4PGT A;  3UMA A;  3ZIT A;  4TW5 A;  2DSA A;  4WXT A;  2VCV A;  4F9Z A;  4I8B A;  4ZBA A;  1G6W A;  4KB3 A;  3UOM A;  1SD9 A;  2GTU A;  1VRS D;  3R2Q A;  4MLY A;  2MZC A;  4KX4 A;  1ZYQ B;  1T7P B;  1HYU A;  2YJ7 A;  4MF5 A;  2EC4 A;  2E7P A;  1SK2 A;  3KH7 A;  5HFK A;  3GST A;  1GP1 A;  3WYW A;  3TKS E;  3TJK A;  1YDK A;  2ZCT A;  4ECC A;  3QPM A;  3HVV A;  2R0G A;  1IYH A;  4PQ1 A;  4ULX A;  5DQS A;  2IPA A;  2C0G A;  2B7J A;  5DAL B;  5KN3 A;  3DVW A;  4MCU A;  2X49 A;  1TRU A;  4O92 A;  1PD2 1;  2VIM A;  2YWI A;  3OR5 A;  3UBK A;  5KOX A;  1MTC A;  3GUR A;  1XZO A;  2H71 A;  2YZH A;  1V9W A;  1JZW A;  4ZB8 A;  3D22 A;  1R5P A;  3QCP A;  4OCF A;  2IIY A;  5IMD A;  2WFC A;  4MAB A;  4FYU A;  4E8E A;  2H74 A;  1WMJ A;  2F51 A;  3DKS A;  3L9V A;  2QC7 A;  1XOA A;  4E8H A;  1EV9 A;  4IW9 A;  4JRR A;  1V2A A;  3KM6 A;  4BVY B;  7GSS A;  5IMC A;  1TK8 B;  2OAD A;  4TRX A;  4EO3 A;  1ACV A;  4RQX A;  3KH9 A;  2KP2 A;  4ZL8 A;  3CRU A;  3M0F A;  1UA5 A;  1FAA A;  4KSO A;  1E6B A;  1X9S B;  1DBY A;  3U6V A;  2VO4 A;  3E3E A;  1QXH A;  1YKA A;  3G9B A;  4G10 A;  1FW1 A;  1EEJ A;  4L0W A;  2M46 A;  10GS A;  4Q5F A;  2H1G A;  2B1L A;  3FZ4 A;  1T3B A;  1WE0 A;  3NZN A;  2VCX A;  4ZXG A;  3H8Q A;  4L0U A;  1GWC A;  2VD0 A;  1QK8 A;  1G6Y A;  3KMN A;  2VAF A;  1I5G A;  1V58 A;  2C4J A;  1RW1 A;  2D2Z A;  4G0L A;  2BTO T;  3PPU A;  2CT6 A;  5H5S A;  2C0D A;  3KTB A;  4NHW A;  1OKT A;  3L9S A;  3VLN A;  4HJM A;  4NHZ A;  4XHM A;  4YKG A;  4IKH A;  4P3Y B;  2BMX A;  3FEU A;  5A5K A;  3BCK A;  3FK8 A;  1XPV A;  4BA7 A;  1KEB A;  3UJ1 A;  4PX1 A;  1W4V A;  3ZTL A;  2RLI A;  3KEB A;  4YAV A;  5ECN B;  2HSY A;  3DXB A;  4YQV A;  1NSW A;  2FLS A;  3FR9 A;  4K5S A;  3ISO A;  2WB9 A;  3BJ5 A;  4NV2 A;  5DAK B;  2X64 A;  1WWJ A;  5CAX A;  3TKS A;  1VF2 A;  3VK9 A;  1N2A A;  3IK9 A;  2CQ9 A;  3GIX A;  4X4J A;  4XS4 B;  3MAK A;  3P8W A;  2R6K A;  3VWV A;  2C80 A;  4OO5 A;  4K2X A;  2PU9 C;  2JL4 A;  1I9D A;  1ABA A;  4OWY A;  3BBY A;  5KN1 A;  3P2A A;  1N8J A;  5E59 A;  3EUR A;  2DJ0 A;  1GSS A;  2REM A;  1CQH A;  2R4V A;  4FO5 A;  4KCA A;  1PKZ A;  1GSD A;  3LXZ A;  3FR3 A;  2I3Y A;  4KDX A;  2A2P A;  5F07 A;  3I9V 2;  2IMK A;  4BVX B;  2YV9 A;  3E0U A;  2FGX A;  2MMO A;  3M3M A;  3LWA A;  3ZL5 A;  2DJ1 A;  1USB A;  4K5R A;  3IRA A;  5ECQ B;  4MJC A;  4I5Q A;  2R2J A;  1Q98 A;  3F0I A;  1SEN A;  2MBS A;  3P7X A;  4LMW A;  2ON7 A;  3KIJ A;  4EKZ A;  2X8C A;  2GST A;  4WF4 A;  3FR6 A;  3ZMK A;  1T00 A;  1GTB A;  4POL A;  2DKH A;  2H72 A;  3GL3 A;  5JCW A;  3GKM A;  4YH2 A;  2I4A A;  1YZX A;  3ME8 A;  1FVJ A;  4L5L A;  2LJA A;  1MDI A;  4IS0 A;  4MMM A;  3TRP A;  2XPD A;  3IDV A;  4ISD A;  1WIK A;  4JBB A;  2X4A A;  3NIV A;  3U5R E;  2R5G A;  5IIZ A;  3O76 A;  4PTS A;  1O8X A;  2K8S A;  3TRQ A;  4GRF A;  2FUG 2;  1MEK A;  3TJF A;  2LJK A;  3O6T A;  1UVZ A;  2G0F A;  1AQX A;  2HRK A;  3HZ8 A;  1G0T A;  2IFQ A;  2HXK A;  4KAE A;  5AIX A;  2B5Y A;  3EE2 A;  1YF1 A;  3O3T A;  3KCM A;  2H6Z A;  3GL5 A;  1XCC A;  4CY6 A;  1GSF A;  12GS A;  5LD0 A;  1WP0 A;  1U87 A;  3IC8 A;  3WGD A;  4XIH A;  1F37 A;  2CAI A;  3GYK A;  4EF0 A;  1KTE A;  1THO A;  2DKI A;  2E2G A;  1X9M B;  2DJK A;  1BAY A;  1QUW A;  3FRC A;  2ES7 A;  4IVF A;  4DSQ A;  4TR4 A;  3C1S A;  1Z6N A;  5EY6 A;  2B6M A;  1UC7 A;  2LRN A;  1B48 A;  1B9X C;  5ECL B;  3F3R A;  2H1B A;  3FMW A;  4IP1 A;  1K0O A;  4N0V A;  1MDJ A;  2H75 A;  3UIW A;  1CQG A;  2L57 A;  4GWR A;  5IOW A;  3GUS A;  5ID2 B;  5IPG A;  4TXO A;  1T4Y A;  2JAC A;  4IQA A;  2FD3 A;  5CYY A;  3GSS A;  4AJ6 A;  3TKR A;  1GTA A;  4K6X A;  4G19 A;  3UEM A;  3ZVJ D;  8GSS A;  17GS A;  1XOB A;  1YEP A;  4KDY A;  2GT5 A;  1OE7 A;  2FY6 A;  2V41 A;  3I6A A;  2KHP A;  1OC9 A;  2LKU A;  1XWC A;  4Z7X A;  2J9H A;  3M1G A;  4BL7 A;  5DQY A;  1FHE A;  3PR8 A;  2P31 A;  5CO3 A;  5GSS A;  2GZP A;  2FHE A;  1X0R A;  2A4H A;  4G2E A;  2LEG A;  2TRX A;  3IXR A;  5IO2 A;  3CRT A;  2YWM A;  4Q5R A;  3G7J A;  3FZ9 A;  5GAP D;  4GTU A;  1J0F A;  1NHO A;  2PN8 A;  1GUM A;  4ZBD A;  1OAZ A;  3CSH A;  4K7N A;  1GH2 A;  2GDR A;  5D96 A;  2OAC A;  3HD5 A;  3HZ4 A;  2CZ3 A;  1ZMA A;  4PQH A;  5IMZ A;  4XRD A;  2K8V A;  3M8N A;  2HRN A;  2AAW A;  4JE1 A;  1SJ6 A;  4HJ2 A;  2HRF A;  5G30 A;  2C0E A;  3MWH A;  1SYR A;  2VM2 A;  2X99 A;  4OO4 A;  2C3Q A;  1XW6 A;  1EP8 A;  1DE2 A;  1M0U A;  2I9H A;  2XC2 A;  4EUY A;  3QOU A;  2B1K A;  5B8B A;  1ZYN A;  1QGV A;  5JWO B;  1ERV A;  1O8W A;  1JZO A;  3W6G A;  4DSR A;  1PN0 A;  4GSN A;  2GSQ A;  1X9W B;  2O89 A;  2V6K A;  3DD3 A;  3E9J B;  3J7Y b;  1YEX A;  1XWK A;  1WRY A;  2P5Q A;  1V98 A;  4CHS A;  1K0N A;  2TIR A;  3GX8 A;  2GLR A;  2N5A A;  2Z9S A;  1GNW A;  2C8U A;  1M2B A;  4CW9 A;  1XWA A;  1OC8 A;  2B7K A;  2NTO A;  6GSV A;  4TR1 A;  2HFD A;  6GST A;  3A5I A;  1K0C A;  3BD2 A;  2WUL A;  13GS A;  1A0F A;  2V2G A;  4LMV A;  2NPB A;  4IBP A;  2MMA A;  4PXO A;  3TDG A;  3CMI A;  1SL2 B;  4IQ1 A;  2RUE A;  3GH6 A;  4MJA A;  1PMT A;  4N0Z A;  3FZ5 A;  2N5F A;  5G1L A;  5DJL A;  1Z6M A;  3KTL A;  4V2L A;  1XW5 A;  3ZIJ A;  2FWH A;  2WDU A;  2RM5 A;  2FA4 A;  4GLT A;  2K18 A;  1M2D A;  1GRX A;  3BCI A;  1TW9 A;  2G2Q A;  2DC5 A;  3ERF A;  3GKX A;  2WJU A;  3KZQ A;  2H76 A;  3IHQ A;  4FYC A;  4EIQ A;  5IQY A;  1O73 A;  1GUK A;  4Q5Q A;  4LL4 B;  3VPT A;  2P0G A;  4MZC A;  4IN0 A;  3W8S A;  3SWL A;  3WT2 A;  1PN9 A;  3MDK A;  2AYT A;  1EOG A;  1BG5 A;  1ST9 A;  5JCG A;  2K9F A;  3I43 A;  2CX4 A;  1F3A A;  4ZL9 A;  4DEJ A;  1TU7 A;  3AY8 A;  3ZLP A;  5C04 A;  4MF7 A;  1EOH A;  3L4N A;  2TRC P;  3MNG A;  4TXO B;  4L8E A;  3C8E A;  2HZE A;  5J3R A;  5COH A;  2FCH A;  3H93 A;  1PL2 A;  2OBI A;  2CA8 A;  4NAX A;  3UVH A;  2B5X A;  3LYP A;  4RI6 A;  2UZ8 A;  3HKR A;  5D9V A;  4MP4 A;  5B8A A;  4KF9 A;  4FQU A;  1LJR A;  4F0C A;  1PSQ A;  3F6F A;  1YQ1 A;  3I69 A;  4Z2R A;  2YWO A;  2GS3 A;  3VWU A;  1TJD A;  1Z7R A;  3IPZ A;  2GQK A;  3UVT A;  4O5R A;  3APO A;  3US3 A;  1JZD A;  2WRT A;  4K2D A;  3A2W A;  3DML A;  2VCQ A;  5AIS A;  1K0M A;  3D5J A;  3QFA C;  1GSU A;  5LNK e;  1SL1 B;  5IOX A;  2L5O A;  2GVP A;  1Z3E A;  1TK5 B;  1SL0 B;  5DCH A;  5FT3 A;  1XXU A;  3DGQ A;  1OE8 A;  1GL8 A;  3IC4 A;  3TUE A;  3GX0 A;  5EPF A;  3HJM A;  1FG4 A;  3FW2 A;  3Q6O A;  2BJX A;  2HSH A;  4ACS A;  3DEX A;  3LGC A;  2GQL A;  3H79 A;  3GV1 A;  1THX A;  2H19 A;  4K0G A;  5GZZ B;  3APS A;  4V1A g;  3TKS C;  2H6Y A;  2IMF A;  3V1W A;  5G31 A;  2I1U A;  1OVN A;  4MH2 A;  2H1D A;  2JZT A;  2L4Q A;  3GH9 A;  5CRW A;  4HZ2 A;  4BPY A;  5J4U A;  2CX3 A;  6GSU A;  4WR4 A;  1XWG A;  2VUP A;  1VGL A;  3QMX A;  1XVW A;  2V6O A;  2GZY A;  1FB0 A;  2H0H A;  3RHC A;  4HQS A;  5CP1 A;  3QDN A;  5D9W A;  4IP6 A;  3LW9 A;  4HOJ A;  4ECI A;  1V57 A;  5DCG A;  1SYX A;  4KGI A;  4HQZ A;  5ECM B;  2OE3 A;  4ZBB A;  3CSI A;  2O87 A;  1VF1 A;  2RM6 A;  1RK4 A;  1NM3 A;  1QMV A;  4OFN A;  1TU8 A;  2JAD A;  4DSS A;  1F3B A;  3P90 A;  4V1A p;  2XBQ A;  2YP6 A;  1TKD B;  2CV4 A;  1RQM A;  2YJH A;  1KBN A;  1WOU A;  4KW6 A;  5F8B A;  3RBT A;  1K0D A;  1AAZ A;  3F63 A;  1EWX A;  2ALB A;  3VI5 A;  2K6V A;  5J9C A;  1EGO A;  2IWT A;  4WBJ A;  6GSX A;  2C3T A;  2NDO A;  4I97 A;  4PNG A;  2ZNM A;  2R37 A;  4EVM A;  2C0F A;  2PER A;  5J41 A;  14GS A;  2F9S A;  4FH8 A;  3CBU A;  1PRX A;  2KLX A;  2HLS A;  1MD4 A;  1PL1 A;  5AGY A;  4ZL7 A;  2DJ3 A;  1O85 A;  3ED3 A;  5IMV A;  4XCS A;  1A8L A;  1XBS A;  1LU4 A;  4RQR A;  2L5L A;  2DIY A;  1M2A A;  2OE0 A;  3GMF A;  3IBH A;  3KGK A;  3ZIV A;  1A2J A;  4ML6 A;  5EVO A;  3GKK A;  2KOK A;  5HR2 A;  5KN0 A;  4K0N A;  4TVE A;  4YAP A;  4AGS A;  1TRS A;  3EYT A;  2WZ9 A;  3H1N A;  2LS5 A;  3PH9 A;  1Z5Y E;  1S3D A;  3GN3 A;  4BWQ A;  1FOH A;  22GS A;  2R3X A;  3TJB A;  2F8A A;  3IK7 A;  2JZR A;  1FVK A;  1U3I A;  3D0Z A;  3GRX A;  3TCO A;  1SK0 A;  5ECK B;  2O7K A;  2H73 A;  3HJO A;  5F0G A;  4X1U A;  4JZQ A;  1R5A A;  4LA1 A;  3EIN A;  20GS A;  2IJY A;  3LSZ A;  2PMT A;  3RAZ A;  2OA7 A;  5AN1 A;  3L78 A;  2AUV A;  4XS6 A;  4HU9 A;  1TK0 B;  2A2S A;  2AB6 A;  1M99 A;  4GQF A;  4HDE A;  2GSS A;  3TJJ A;  4GQC A;  3LYK A;  3F8U A;  1XW9 A;  2M80 A;  3CTG A;  2VD1 A;  2B3S A;  1JFU A;  4YQM A;  1A2L A;  1ZYP A;  1SU9 A;  4POB A;  1EEM A;  3TJG A;  1TTZ A;  3A2X A;  4MH3 A;  1LBK A;  1H75 A;  4XRA A;  4K9Z A;  1C72 A;  2YOI A;  3HDC A;  4JED A;  5DAL A;  2PBJ A;  1T4Z A;  2H70 A;  2LV3 A;  1K0B A;  2YNX A;  4LL1 B;  1EV4 A;  4Q5N A;  5D73 A;  3F4S A;  4MDC A;  1JLW A;  3LJR A;  1F2E A;  3L9U A;  3FY7 A;  2HT9 A;  5JWR B;  1A2M A;  4HU7 A;  4KA0 A;  5EL8 A;  2EIQ A;  4RI7 A;  5ENU A;  3QAV A;  4IJI A;  1OYJ A;  1ERU A;  2OKA A;  5DBQ A;  1HD2 A;  3HA9 A;  2H66 A;  4ICY A;  1AQW A;  1YY7 A;  4QL7 A;  4BVY A;  3DRN A;  2X8H A;  1NHY A;  4ID0 A;  5HR3 A;  4V2M A;  1HNC A;  3RDW A;  3F4R A;  2GT6 A;  5CRE A;  3ME7 A;  1YF0 A;  4FYB A;  1J08 A;  1SK1 A;  3ZZX A;  1GSQ A;  5A4U A;  4EC0 A;  2E2M A;  3C73 A;  4K7O A;  2H30 A;  2YN1 A;  3C71 A;  2ZUP A;  1YJ6 A;  3D6I A;  1O81 A;  4TKY A;  3HXS A;  1F6M C;  3IOS A;  2OJL A;  2EIO A;  5CRH A;  4MZB A;  3K8N A;  4PUA A;  4WET A;  3GFK A;  1X5D A;  2AV4 A;  4WBR D;  5F06 A;  3IAM 2;  4HEA 2;  4KUN A;  2L6C A;  6GSY A;  4ECJ A;  3ZML A;  3ZRD A;  3IR4 A;  16GS A;  1Z7P A;  3KJY A;  5AIV A;  1X5C A;  4I6X A;  2LST A;  4O7H A;  4NMU A;  5B6M A;  3D21 A;  3F3Q A;  5J9B A;  1VF3 A;  4G9H A;  5D93 A;  4RUV A;  1BJX A;  1PKW A;  5G1K A;  1ZYE A;  3TB2 A;  1QFN A;  5H5Q A;  2LUS A;  4ML1 A;  1EGR A;  2CVK A;  4PUF C;  1HNB A;  4KH7 A;  5DAK A;  3IA1 A;  2XPE A;  2O85 A;  5ECO B;  5INY A;  1R4W A;  1XIY A;  3VUR A;  4TXV A;  3FHK A;  4F2I A;  1FB6 A;  1VF4 A;  4XS4 A;  1T1V A;  4WR5 A;  4DVC A;  1U6T A;  1TRW A;  2IFQ B;  4IJ3 A;  3L0H A;  2AJQ B;  4ZB6 A;  5ELA A;  2HYX A;  4OFM A;  3J7Y k;  2IMD A;  4BWS A;  1GTU A;  2VL2 A;  5CRG A;  3A2V A;  1MD3 A;  5J5N A;  2EIR A;  3FYG A;  4G0K A;  1GSE A;  4N11 A;  3TOT A;  1F9M A;  3IV4 A;  5ECR B;  1XVQ A;  3CSJ A;  3M9K A;  1GNE A;  4L5O A;  5G5F A;  1PGT A;  3UBL A;  3LQ7 A;  2HE3 A;  4MNN A;  1ILO A;  2CVB A;  2PVQ A;  2JU5 A;  3EVI A;  4BVX A;  4EDZ A;  2PWJ A;  3APQ A;  2HRA A;  1K3Y A;  4HZ4 A;  3EU4 A;  3GTU A;  19GS A;  4LLR A;  3GKN A;  2PGT A;  1AW9 A;  2HNL A;  2R0P A;  3SBC A;  3UAR A;  2QGV A;  3S9F A;  3MSZ A;  2P5R A;  4XS1 A;  2GZZ A;  2J23 A;  5IM9 A;  4J57 E;  4MZW A;  2LQO A;  2FWE A;  2V32 A;  4MF6 A;  4YQU A;  4GST A;  3IE3 A;  4MPF A;  3W8J A;  4TR3 A;  5KOW A;  3QFB C;  5LCZ A;  1M7T A;  1OC9 B;  1SJZ A;  2C3N A;  5ABR A;  1U3A A;  2PPT A;  3M9J A;  3UAP A;  4BL7 B;  1AUC A;  1R7H A;  2FWF A;  2YCD A;  4MK3 A;  3EPT A;  1M9A A;  3LXT A;  2YAN A;  2NVL A;  2VCZ A;  2F3M A;  2JZS A;  1Y6E A;  2N5B A;  6GSS A;  2A2R A;  5D9T A;  4EL1 A;  5ECH B;  3HVX A;  5D9X A;  3D4T A;  4POM A;  1OC3 A;  4YKF A;  2DIZ A;  1EZK A;  4MJE A;  4ZIL A;  5CNW A;  2QSI A;  2VM1 A;  1TDI A;  4H86 A;  2L59 A;  3JCM L;  1Z9H A;  1ZGN A;  2B5E A;  1BYE A;  3WD6 A;  3C7M A;  1DUG A;  1Q4J A;  2FNO A;  3HHV A;  4O32 A;  3N9J A;  1A23 A;  1TP9 A;  2JSY A;  2DLX A;  4F0B A;  4GF0 A;  1O7U A;  1NW2 A;  2DJJ A;  5KN2 A;  4O5U A;  3VFI A;  5IPH A;  5IO0 A;  5A4W A;  2GGT A;  4D73 A;  1QQ2 A;  3GNJ A;  2O8V B;  1K3L A;  1G7E A;  5DDL A;  5B6N A;  5HFG A;  2XHF A;  4ILF A;  4QQ7 A;  5A4V A;  2GSR A;  2R0C A;  5ID2 A;  3QR6 A;  1SKW B;  1TI1 A;  3H4K A;  3KXO A;  4HI7 A;  1B4Q A;  1SD8 A;  1AIU A;  2CVD A;  4TR0 A;  4JU5 A;  4F03 A;  4AJ8 A;  1JLV A;  3EMX A;  3DVX A;  5BRT A;  1AQV A;  2V1M A;  2H0G A;  1K3O A;  2MMZ A;  3F4T A;  5B7C A;  1URM A;  4IGJ A;  4WEY A;  11GS A;  1YKC A;  1AXD A;  4QL9 A;  1FOV A;  3QAG A;  1ERW A;  5ECI B;  3TKQ A;  1HNA A;  4IHU A;  4TR1 B;  4NXI A;  4POK A;  5L71 A;  5BMU A;  4MPG A;  4JR6 A;  1ZCP A;  3HVS A;  4IEL A;  3VWX A;  4I2T A;  2QKE A;  1H4O A;  4GSS A;  1A24 A;  4V2N A;  2LJR A;  5HR1 A;  2H8L A;  3WGX A;  2NBS A;  5FWG A;  2X8G A;  3Q18 A;  4NV5 A;  3N5O A;  2XBI A;  2L4C A;  2MBT A;  2H01 A;  5JCU A;  2LQQ A;  2JSZ A;  2LNT A;  1S3A A;  4XTS A;  2KP1 A;  3IHG A;  3CYN A;  5HQP A;  5KEJ A;  2MYG A;  1X5E A;  2H0I A;  3Q19 A;  2VLT A;  3FKF A;  1XFL A;  2YWN A;  3NOF A;  2YPM A;  2L6D A;  3GTU B;  3LOR A;  1UN2 A;  1TXX A;  3QD9 A;  1R26 A;  3ERW A;  1A8Y A;  4TN8 A;  1M9B A;  2CAQ A;  3BOA A;  4F82 A;  4CDO A;  4PNF A;  2WCI A;  4K8M A;  2HZE B;  2YZU A;  4HUA A;  3EC3 A;  3KP8 A;  6GSW A;  1W89 A;  3LFL A;  1S3C A;  3MYD A;  3ZYW A;  1BQ7 A;  4ZIJ A;  3G7Y A;  2E0Q A;  5IMA A;  3VI7 A;  4EXJ A;  3EMP A;  4I2U A;  3MIX A;  1ZL9 A;  2VOC A;  2I81 A;  5GAN D;  2A4V A;  2VCT A;  3DYR A;  1GUH A;  4KE3 A;  4EE0 A;  1GLQ A;  4OFT A;  2H6X A;  1GTI A;  3TGZ A;  2OBK A;  5JWQ B;  1EP7 A;  1WJK A;  4ZB9 A;  2FWG A;  1DE1 A;  5G2Z A;  1IYI A;  3ZFB A;  1ON4 A;  2LRT A;  2WGR A;  1HQO A;  1PX6 A;  2PVO C;  1AC1 A;  4AF2 A;  2IN3 A;  2HSM A;  4TOP A;  3KMO A;  3A3T A;  5DJM A;  5ECS A;  4X43 A;  2IME A;  3ZRE A;  2DML A;  4WF5 A;  1GSY A;  2PUK C;  2ON5 A;  3VWW A;  5ELG A;  1A0R P;  4O5Q A;  4K1F A;  1B9Y C;  4MJB A;  3VPQ A;  4K7I A;  1PQN A;  1TRV A;  1PA3 A;  5IMF A;  3IAS 2;  1BED A;  2VCW A;  1K0A A;  2AHE A;  4OMV A;  4D73 B;  3KP9 A;  1SKR B;  1ZOF A;  2LTK A;  4EDY A;  2HZF A;  3RHB A;  4PUR A;  3RPP A;  2WS2 A;  3GA4 A;  3HYP A;  1MDK A;  4NWY A;  1JZR A;  4AJ7 A;  4EIP A;  9GSS A;  4USS A;  3CXG A;  3KD0 A;  2KUC A;  2IL3 A;  1WPI A;  3UL3 A;  5CRD A;  1BX9 A;  4KND A;  3ZFL A;  4GXZ A;  5HR0 A;  2DJ2 A;  1TI3 A;  2LRC A;  3Q74 A;  1Y25 A;  2M72 A;  1TOF A;  5ECP B;  3EWL A;  1GUL A;  2IMI A;  1JHB A;  3R3E A;  3GHA A;  1V40 A;  2YV7 A;  2C1Y A;  5C00 A;  4HS1 A;  2LNS A;  3G7I A;  1G7O A;  2MMN A;  4DSS B;  2VL9 A;  3HJP A;  2VLV A;  5GST A;  3HCZ A;  1GLP A;  4J56 E;  5F05 A;  2CZ2 A;  5G5E A;  4GCI A;  5DVB A;  3ERG A;  3ZVJ A;  3RPN A;  2FA8 A;  3CTF A;  5HFI A;  3DIE A;  4X0X A;  4KSM A;  3LEF A;  4Z2U A;  3TKP A;  1PX7 A;  2F8F A;  1ERT A;  3QAW A;  4N10 A;  3FZA A;  4J2F A;  2QA1 A;  1DSB A;  4FIW A;  1XWB A;  2HI7 A;  1E2Y A;  3EU3 A;  3PGT A;  2DBC A;  4OCE A;  3D4M A;  2OE1 A;  1O6J A;  4OD7 A;  3WGE A;  1FO5 A;  3DWV A;  5H5R A;  4KDU A;  2RUF A;  5D8I A;  3A5W A;  4CY8 A;  4JR4 A;  1SJI A;  5FHI A;  1U88 A;  4N30 A;  4NPB A;  1B4P A;  1OKD A;  2DMM A;  1ZZY A;  3HY2 A;  4KCE A;  4PQI A;  4G0I A;  1T8E B;  3TRX A;  2VL2 C;  1ML6 A;  2GQM A;  2RII A;  3WT1 A;  3C1R A;  3LG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...