1J08A

Crystal structure of glutaredoxin-like protein from pyrococcus horikoshii
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
225
structure length
225
Chain Sequence
GLISEEDKRIIKEEFFSKMVNPVKLIVFIGKEHCQYCDQLKQLVQELSELTDKLSYEIVDFDTPEGKELAEKYRIDRAPATTITQDGKDFGVRYFGIPAGHEFAAFLEDIVDVSKGDTDLMQDSKEEVSKIDKDVRILIFVTPTCPYCPLAVRMAHKFAIENTKAGKGKILGDMVEAIEYPEWADQYNVMAVPKIVIQVNGEDKVQFEGAYPEKMFLEKLLSALS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glutaredoxin-like protein
publication title Protein disulfide isomerase from hyperthermophile as an additives of refolding of an immunoglobulin-folded protein
rcsb
source organism Pyrococcus horikoshii
molecule tags Isomerase
total genus 80
structure length 225
sequence length 225
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2002-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05768 DUF836 Glutaredoxin-like domain (DUF836)
A PF13192 Thioredoxin_3 Thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1j08A01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1j08A02
9GSSA 2IPAA 3IE3A 1ZOFA 4TR3A 5D8IA 3D0ZA 1M2DA 3LSZA 3ZYWA 3G7YA 5ECPB 2H6ZA 4JEDA 5DCGA 1ZMAA 3ZTLA 1K0NA 2REMA 1TKDB 5ECMB 1T7PB 2C3QA 2HZEA 3ZMLA 4RI6A 4X0XA 2K8VA 3GHAA 1V9WA 4EE0A 1A2MA 1TP9A 3UMAA 1Z6MA 19GSA 1W4VA 2O8VB 4CDOA 3CSHA 1U87A 2P0GA 1M2AA 1MD4A 4I6XA 1EOGA 4G2EA 3FZ5A 3ERFA 1WJKA 1F3AA 4MJBA 5B6MA 2H1DA 5H5RA 2YJHA 3GMFA 3D21A 1WOUA 3HVXA 3KH7A 3IAS2 1XXUA 5HR1A 22GSA 4IP1A 4AF2A 3W8JA 3TRXA 1A24A 1WE0A 4IGJA 3WGEA 2PN8A 3GL3A 2R4VA 3PR8A 1FVJA 3F4RA 1R5PA 3VLNA 1OC8A 4ZL7A 2LKUA 4HDEA 3GKXA 1SD9A 5IQYA 1TJDA 3LFLA 4XS6A 2L59A 4QL9A 5HR0A 4KE3A 4AJ6A 4GCIA 4F9ZA 2DC5A 1UN2A 2RIIA 5F05A 5AISA 4K1FA 3HHVA 4PURA 2CZ2A 5ELGA 2HLSA 2CQ9A 2GSSA 1R7HA 3ISOA 1OKDA 4KCEA 3F8UA 1YKAA 2XHFA 2H72A 2EIOA 2B7JA 4POKA 3O76A 2NBSA 3ZFBA 4MZBA 1VF3A 4XHMA 5H5SA 2O7KA 5G31A 1PL2A 1WPIA 2OA7A 3I9V2 2CAQA 5C04A 4RQXA 3FRCA 3EWLA 1O8WA 3IDVA 1LJRA 5HR3A 2GZZA 1TI3A 3R2QA 3VI7A 4I5QA 4GRFA 1J08A 1UA5A 3CSJA 1V98A 3VURA 4MJAA 2EIQA 3KD0A 1PMTA 2X8GA 4ULXA 2I81A 1T4YA 1C72A 4GLTA 3ZITA 1SL1B 4AJ7A 3RDWA 5FHIA 3WT1A 4TXOB 2QGVA 3D5JA 2H0IA 2G0FA 2GSTA 4OFTA 3MDKA 5C00A 3F63A 3RPNA 3ZMKA 2R6KA 5ABRA 4D73B 4PNGA 1AQVA 4LA1A 4OFMA 2LRTA 4HOJA 1M9AA 1A23A 3H4KA 2PVOC 3L4NA 4K7OA 1K0AA 5KEJA 5G1KA 5AGYA 3QOUA 3GX8A 3TB2A 1GWCA 2LRCA 5EVOA 5AIXA 4WXTA 4HZ4A 3ME7A 2H1GA 1G6WA 2A4VA 5HQPA 2YWOA 3LYPA 6GSVA 4HZ2A 4L5OA 3DEXA 2RUEA 1WRYA 3NZNA 1SL0B 2LRNA 4KDUA 5J5NA 2LJKA 1V57A 4TR1B 1MTCA 4NV2A 3AY8A 3TJGA 3TRPA 1JZOA 4V2MA 2VCTA 1YY7A 2VAFA 2JACA 1DUGA 3HCZA 3QR6A 3LJRA 1X0RA 4I97A 5JCWA 2GSQA 4POMA 1WWJA 2PPTA 1MEKA 1K0OA 4XRDA 2J9HA 4O92A 3KZQA 2CX3A 2DJJA 4BVYA 3VFIA 3P2AA 4BPYA 2VD1A 4BWSA 2B5EA 2F3MA 2IMFA 3KH9A 3HVSA 4WKWA 4IJ3A 3GSSA 2CAIA 4EXJA 2GT5A 3F4TA 2M46A 3EMPA 3FW2A 2O85A 1GSYA 2F8FA 3KGKA 2C3TA 1QUWA 1QGVA 2N5AA 3BJ5A 1AXDA 4MDCA 3IK7A 4XS4A 4GTUA 4Z7XA 2VLTA 5KN2A 2JSZA 4HQZA 3EINA 4P3YB 1A2LA 5CNWA 1YF0A 4YAVA 2E0QA 2JU5A 1OE7A 2KP1A 4GSTA 5DBQA 3IA1A 5ID2B 1ZGNA 3UVTA 3RBTA 2E2GA 2MMAA 5IO0A 3BD2A 3HJPA 1T4ZA 4AJ8A 3FZ9A 2WB9A 3TOTA 2GQMA 4AGSA 3QAGA 2KUCA 1PD21 2LNSA 2GLRA 1S3DA 3FYGA 2DJ2A 4PGTA 4O5RA 3DD3A 3OR5A 3J7Yb 1S3CA 4DSQA 3FK8A 1Z7RA 1N2AA 2LUSA 5F07A 1SL2B 4ISDA 2PUKC 5FWGA 1G7EA 2WGRA 1F3BA 1QFNA 3J7Yk 3FHKA 1M99A 2PU9C 1F2EA 3VPTA 3FR9A 3CTGA 1JZDA 3RHCA 5DQYA 3LWAA 3VWVA 2B1KA 1NSWA 2F51A 2I4AA 3I69A 4G9HA 3KJYA 6GSXA 1Z6NA 1SYXA 2FHEA 2HZFA 1M2BA 4HS1A 3QFAC 3C7MA 1VGLA 1JLVA 2AUVA 4IQAA 2OE1A 5F06A 4TOPA 4BWQA 3HKRA 2CVKA 1I5GA 1USBA 5EY6A 4KSOA 4OWYA 4NHZA 2VOCA 3MWHA 2IMKA 1GL8A 2FWHA 2NPBA 2L57A 1ACVA 3M9JA 3IXRA 5GAND 2XBQA 2DSAA 3EU4A 1PN9A 1ERTA 2AV4A 2I1UA 2AJQB 1AAZA 2HXKA 1VF2A 1BQ7A 2YV7A 2VM1A 4POLA 3E3EA 1CQHA 3JCML 1XOAA 5CYYA 1T1VA 3MSZA 18GSA 4JU5A 2V41A 2IFQA 5H5QA 2QKEA 4KB3A 4FH8A 1JZWA 5CO3A 1XWAA 4MF5A 4EDZA 3ZREA 1K3OA 4MLYA 3Q74A 2DJ1A 3F6DA 2DBCA 1PKWA 4F0CA 2LQOA 4PNFA 3IAM2 4PXOA 2FUG2 3F0IA 4H86A 3GH9A 1PQNA 4MH3A 3P8WA 2FWFA 2M80A 1TDIA 1SK0A 2X99A 2IIYA 5D9XA 1THXA 5G1LA 2ON7A 2GSRA 1TU7A 2HSYA 1GNEA 3ZLPA 2R5GA 2NDOA 3ZIJA 1TI1A 3FZ4A 4IBPA 3L9UA 5G5EA 4Q5FA 1CQGA 1FOVA 1GRXA 2GZYA 5GAPD 2VO4A 5IMDA 2HT9A 1EWXA 6GSUA 1A0FA 5J9CA 2YCDA 1GTUA 2HSHA 1GSEA 2YP6A 4PQHA 5DQSA 3HY2A 1KBNA 1U3AA 5DALB 2ON5A 2C80A 3GNJA 1B9YC 4ML1A 4HUAA 3UVHA 4G10A 3C8EA 2IL3A 2OADA 4JBBA 1S3AA 4V2NA 2OBKA 2AHEA 5J9BA 3HD5A 4IQ1A 3M8NA 4K0GA 4WR4A 2KOKA 2C1YA 1SYRA 3KIJA 2FWGA 3HZ8A 3A5WA 4N0VA 4V2LA 3DYRA 3GH6A 4RUVA 4MPGA 2JZTA 2L6DA 2YPMA 1DE2A 1GP1A 1HYUA 3GTUA 3W8SA 2IMIA 2PWJA 1R5AA 1H75A 1X9WB 1JFUA 4GF0A 1PX6A 1LBKA 1R26A 2MBSA 4WBJA 4F2IA 1FHEA 1SENA 1XWBA 2RUFA 2X8HA 4ZB6A 2P5RA 4ZL9A 3EMXA 5ECSA 3HVVA 4IW9A 1EOHA 1XWCA 4PUFC 2B7KA 2Z9SA 1KTEA 2PVQA 2N5BA 1KNGA 1W89A 4I2UA 2XPEA 4PX1A 1TOFA 5ECHB 3ZVJA 4ZBAA 2YANA 3ERGA 2ZUPA 1OC9A 2WULA 3CTFA 4NHWA 1XOBA 3N5OA 2GZPA 5KN3A 2VLUA 4GWRA 1R4WA 3QPMA 4FYCA 1BEDA 4DSSB 1N8JA 2V1MA 2RM6A 3RHBA 3W6GA 4NPBA 2MMZA 4N10A 4L5LA 2OACA 4L0WA 4OO5A 4HEA2 4MCUA 3TKSA 2H66A 1XBSA 1GTIA 1XFLA 5HFGA 2CT6A 1TU8A 1FAAA 2R3XA 1PGTA 4TXVA 1GSDA 1GULA 3CRTA 2L5LA 4WF4A 2VCXA 4QL7A 5E59A 3RAZA 1VF4A 1HQOA 4MJCA 3GKKA 5G5FA 3VWWA 1B4PA 2H71A 1M0UA 3KMNA 3KXOA 5G30A 1ML6A 3TUEA 3RPPA 1IYHA 1YKCA 2OE3A 3WT2A 1FB0A 2YN1A 3DKSA 5A5KA 1V40A 1MD3A 2XPDA 4XRAA 1Q4JA 4MP4A 3S9FA 5L71A 3U5RE 4WF5A 2WCIA 4IS0A 2VUPA 1JLWA 2C0DA 1EGOA 5B7CA 4XS1A 2CVBA 1B8XA 2H0HA 4WETA 2E7PA 4ECIA 2M72A 3VWXA 2DJKA 3MNGA 2CZ3A 2DIZA 5D9TA 1QXHA 5J41A 3UBKA 3Q18A 2B3SA 3FR6A 1E2YA 1B9XC 4IVFA 3CMIA 3G9BA 3QCPA 2H73A 4ECCA 3EC3A 5DAKB 2P31A 5D9WA 3M1GA 3ED3A 3A2WA 1X5EA 2HFDA 3TJFA 3SBCA 2G2QA 2P5QA 2A2SA 2EC4A 3UOMA 1H4OA 3KP9A 1J0FA 3H1NA 2VCZA 1K0DA 1PX7A 3ZL5A 2X8CA 1Y25A 3LYKA 1GLQA 1HD2A 2LNTA 4OCFA 4O7HA 3LXTA 4ZB8A 1NM3A 2MMOA 3EVIA 2H76A 4IKHA 2OE0A 3TKRA 4FO5A 4FYBA 5J4UA 2NVLA 2KLXA 2C0EA 4MZWA 1XIYA 3D6IA 2IMEA 1YQ1A 2HZEB 4MJEA 5DVBA 2H19A 1HNAA 1OVNA 1M7TA 2BTOT 4NWYA 3D22A 2FY6A 2MZCA 4KGIA 1MDKA 4JR6A 4BVXA 3GSTA 4MABA 3TCOA 12GSA 2VCQA 1JZRA 1PA3A 3D4TA 3IR4A 8GSSA 1V2AA 1OKTA 5J3RA 2LSTA 3DIEA 1XPVA 3GKMA 2FGXA 3KTLA 1GSQA 4HU9A 3CSIA 3L78A 5FT3A 2L6CA 2DMMA 1GH2A 1Y6EA 1K0MA 3IV4A 2R2JA 4GXZA 3KP8A 3UARA 4MPFA 3DVWA 3Q6OA 4PUAA 1THOA 2TRXA 3E0UA 5GSSA 3LXZA 1XW5A 4ECBA 20GSA 1BYEA 5B8BA 4NMUA 3NOFA 1PSQA 5IMAA 3QAVA 5D96A 4ZL8A 2GTUA 2RLIA 3GKNA 2DJ3A 2AYTA 2B6MA 1YEXA 1U6TA 3GURA 1X9SB 2JADA 2HYXA 2LJRA 3DVXA 1U88A 1ERVA 3H79A 1G7OA 2D2ZA 4DEJA 17GSA 6GSWA 3M9KA 4MA9A 4I2TA 1QMVA 3F4SA 3ZFLA 4JZQA 1FW1A 3CRUA 5JCUA 1NW2A 1G6YA 3VPQA 1HNCA 4QQ7A 1M9BA 3I6AA 5CRHA 4BL7A 3FY7A 1Z7PA 1A8LA 4MF7A 2V32A 4K2DA 1SKSB 4K0NA 1O73A 4KX4A 3L0HA 1TK5B 2J23A 1GNWA 2H74A 2CA8A 2GQLA 3ZVJD 2GGTA 2H6XA 2VD0A 5IO2A 1ST9A 2FCHA 4GQFA 1EEJA 3KMOA 1EGRA 2L5OA 1Z5YE 5ECNB 5IOXA 4O32A 3WGXA 1LU4A 3APOA 3EE2A 1WMJA 1YDKA 1ABAA 1ZL9A 4TXOA 5INYA 2VCVA 6GSYA 1FG4A 2X64A 3BCIA 3TKSC 2C8UA 2H6YA 1K3LA 4X43A 3C1RA 3UBLA 3A3TA 5ECQB 5A4UA 4D73A 2CVDA 1EEMA 4NV5A 3TKQA 3DWVA 5IMZA 2HRFA 4WEYA 6GSSA 1XZOA 5ECKB 1AC1A 5HFKA 1EV4A 2OKAA 5LD0A 3IK9A 2LV3A 3QMXA 4ZB9A 2VIMA 1BG5A 3QFBC 4F82A 3KCMA 4KNDA 2HNLA 1EP7A 1KEBA 5CRDA 5ECRB 1SKWB 4ACSA 3WD6A 1RW1A 5D93A 2V6OA 5JWRB 5E4WA 4RQRA 5ELAA 4TRXA 1UC7A 2A2RA 4TR1A 3HJOA 2TRCP 3C1SA 3BOAA 1T00A 2K8SA 3GUSA 1GSUA 4ILFA 3GA4A 1BX9A 2ALBA 3KEBA 4HJMA 3FKFA 1XVWA 4MH2A 2WS2A 4IHUA 4K7IA 4GSNA 5F0GA 1Z9HA 2LTKA 2H75A 5IIZA 2ES7A 1WP0A 1ZCPA 4KCAA 2I9HA 1AQWA 1F37A 4MK3A 5D9VA 4HI7A 4KDXA 5ECLB 2TIRA 2OBIA 10GSA 4GQCA 4OMVA 4FIWA 4J57E 2I3YA 2WRTA 2VL2A 4LMVA 3M3MA 1X5DA 4K9ZA 3WGDA 3GFKA 3BCKA 3IRAA 1GUKA 4IP6A 3P7XA 3TOUA 1A2JA 4IN0A 4EC0A 2H01A 1QK8A 1QQ2A 3LEFA 3GX0A 4ZIJA 3HDCA 2IN3A 4OD7A 5KN0A 1MDIA 4XS4B 11GSA 1PKZA 2PGTA 1TRSA 3CXGA 1TW9A 1XWGA 3HZ4A 3PH9A 4YQMA 5ID2A 1PRXA 1GTBA 1RK4A 2JZSA 5GSTA 4KDYA 2DIYA 4TN8A 3TJJA 5LCZA 1O85A 5JWOB 2PBJA 3ME8A 5CP1A 3TJKA 3ZRDA 3A2VA 3E9JB 2HRNA 2GVPA 3IPZA 3KTBA 2B5XA 3SWLA 2YZUA 2N5FA 5CAXA 2WJUA 1SD8A 4JRRA 4FYUA 4DSRA 1XVQA 3QAWA 1SU9A 2VM2A 1V58A 4X1UA 4TR0A 1URMA 4Q5NA 2YOIA 14GSA 3GN3A 2IWTA 4YH2A 1OE8A 5LNKe 1SK2A 2O89A 4KH7A 2ZCTA 2FNOA 3US3A 3C71A 3H8QA 4KUNA 4EVMA 1YEPA 4N11A 4OO4A 2JSYA 1AQXA 4YAPA 4ZBDA 3VWUA 5COHA 4LLRA 2FWEA 1EP8A 4EKZA 3IBHA 5B8AA 4J2FA 3V1WA 5DDLA 4ID0A 4WBRD 3F9UA 2V6KA 4KA0A 1OC3A 3CYNA 3H93A 4ECJA 1OYJA 2DMLA 2MYGA 2H1BA 1TRWA 1I9DA 2JL4A 2H1AA 2HI7A 4POBA 4RI7A 3GIXA 3I43A 5IMCA 2YZHA 1SK1A 4XTSA 2H8LA 2FA8A 4TW5A 1TTZA 2FA4A 4JE1A 3D4MA 3UL3A 2O87A 2C0FA 4PQIA 2WFCA 3BBYA 3UEMA 3A2XA 5IM9A 2F8AA 2GDRA 2IMDA 4Q5QA 4CW9A 5DJLA 16GSA 5GZZB 3K8NA 1IYIA 1TRVA 1EV9A 1U3IA 2V2GA 1A8YA 4J56E 6GSTA 3ERWA 4LL4B 5EPFA 1X9MB 1VRSD 1UVZA 5CRGA 2VLVA 3GYKA 5G2ZA 2VCWA 4BA7A 1HNBA 2H0GA 1YF1A 5EL8A 4YQUA 2IFQB 3IOSA 4ZILA 5CRWA 2B5YA 2GT6A 3EURA 1BAYA 1ERWA 1O8XA 3HYPA 2C3NA 1X5CA 4EDYA 4KAEA 3Q19A 3EYTA 4NAXA 2QSIA 5B6NA 5A4WA 2EIRA 1YZXA 3LG6A 1RQMA 3APSA 4V1Ap 1JHBA 5A4VA 3MAKA 2LJAA 1DE1A 3FEUA 4L8EA 2LS5A 3PGTA 4ZXGA 3F3RA 1XCCA 2CX4A 4Q5RA 3HJMA 3U6VA 5IMVA 4OFNA 1GSSA 1VF1A 3NIVA 4V1Ag 4N30A 2BJXA 2YNXA 4N0ZA 2K6VA 4OCEA 1FO5A 5DALA 2DLXA 3UIWA 4XIHA 5ECIB 3N9JA 4HJ2A 3O3TA 1GTAA 2K18A 3GRXA 2CV4A 1J9BA 1O7UA 1TK0B 5D73A 1GUMA 3CBUA 3IHQA 1DBYA 4IELA 2HE3A 3L9VA 4F0BA 2PERA 2FLSA 2F9SA 5AN1A 1FVKA 1OAZA 4MMMA 4KW6A 3EU3A 2LEGA 1Q98A 3PINA 5HFIA 2PMTA 4LMWA 3TJBA 1GSFA 1ON4A 2VL2C 3ZIVA 2JZRA 2H30A 4ZBBA 7GSSA 4K6XA 3VI5A 3GTUB 2E2MA 4TR4A 4HU7A 1DSBA 1ZZYA 5ENUA 2GS3A 1TXXA 5DJMA 5IOWA 1ZYEA 3DRNA 1WIKA 2WZ9A 1GLPA 1TK8B 3ZZXA 3LGCA 3APQA 2RM5A 3LORA 2NTOA 1FB6A 4K8MA 1TRUA 1XWKA 4TVEA 1YJ6A 1AW9A 2L4CA 3IC4A 2IJYA 3M0FA 4EUYA 2LQQA 1B48A 1XW6A 5HR2A 3WYWA 2XBIA 1K3YA 4KSMA 4K7NA 5IPHA 1OC9B 2YWNA 5KN1A 2AAWA 5IPGA 4DSSA 4E8EA 1ZYQB 3QD9A 4EL1A 1B4QA 1MDJA 2OJLA 3FZAA 1BJXA 4E8HA 4WR5A 1SJ6A 4NXIA 1O6JA 3TKPA 2AB6A 4EF0A 1E6BA 3G7IA 3VK9A 1T8EB 1GUHA 3F6FA 3L9SA 3DGQA 1AIUA 2FD3A 2KHPA 1SKRB 1F9MA 4JR4A 3O6TA 3UJ1A 2C4JA 1T3BA 4EO3A 5ECOB 1NHYA 4MF6A 4CHSA 4HQSA 3HXSA 4L0UA 4ML6A 5JWQB 3UAPA 4F03A 1XW9A 4I8BA 4TKYA 3QDNA 3GL5A 2GQKA 3KM6A 5F8BA 3TDGA 1PL1A 2DJ0A 2K9FA 3F3QA 2MMNA 2VL9A 2WDUA 2VL3A 1NHOA 2YWMA 1G0TA 3DXBA 5AIVA 4MZCA 2R37A 1SJIA 1K0BA 5IMFA 1SJZA 2ZNMA 1EZKA 2QC7A 4YQVA 1Z3EA 3FR3A 2L4QA 3G7JA 2MBTA 4LL1B 3LQ7A 1AUCA 2YV9A 3TKSE 2YWIA 2XC2A 3TGZA 3HA9A 1O81A 3DMLA 2B1LA 3P90A 4GSSA 5DAKA 4DVCA 3TRQA 1A0RP 5DCHA 2C0GA 1ILOA 2KP2A 4IJIA 3GV1A 3C73A 4G19A 1ERUA 5CREA 1K0CA 5JCGA 1F6MC 13GSA 2YJ7A 2H70A 4XCSA 2BMXA 4PQ1A
chains in the Genus database with same CATH superfamily
9GSSA 2IPAA 3IE3A 1ZOFA 4TR3A 5D8IA 3D0ZA 1M2DA 3LSZA 4Z2UA 3ZYWA 3G7YA 5ECPB 2H6ZA 4JEDA 5DCGA 1ZMAA 3ZTLA 1K0NA 2REMA 1TKDB 5ECMB 1T7PB 2C3QA 2HZEA 3ZMLA 4RI6A 4X0XA 2K8VA 3GHAA 1V9WA 4EE0A 1A2MA 1TP9A 3UMAA 1Z6MA 19GSA 1W4VA 2O8VB 4BVXB 4CDOA 3CSHA 1U87A 2P0GA 1M2AA 1MD4A 4I6XA 1EOGA 4G2EA 3FZ5A 3ERFA 1WJKA 1F3AA 4MJBA 5B6MA 2H1DA 5H5RA 2YJHA 3GMFA 3D21A 1WOUA 3HVXA 3KH7A 3IAS2 1XXUA 5HR1A 22GSA 4IP1A 4AF2A 3W8JA 3TRXA 1A24A 1WE0A 4IGJA 3WGEA 2PN8A 3GL3A 4O5QA 2R4VA 3PR8A 1FVJA 3F4RA 1R5PA 3EPTA 3VLNA 1OC8A 4ZL7A 2LKUA 4HDEA 3GKXA 1SD9A 5IQYA 1TJDA 2UZ8A 3LFLA 4XS6A 2L59A 4QL9A 5HR0A 4KE3A 4AJ6A 4GCIA 4F9ZA 2DC5A 1UN2A 2RIIA 5F05A 5AISA 4K1FA 3HHVA 4PURA 2CZ2A 5ELGA 2HLSA 2CQ9A 2GSSA 1R7HA 3ISOA 1OKDA 4KCEA 4YKFA 3F8UA 1YKAA 2XHFA 2H72A 2EIOA 2B7JA 4POKA 3O76A 2NBSA 3ZFBA 4MZBA 1VF3A 4XHMA 5H5SA 2O7KA 5G31A 1PL2A 1WPIA 2OA7A 3I9V2 2CAQA 5C04A 4RQXA 3FRCA 3EWLA 1O8WA 3IDVA 1LJRA 4BL7B 5HR3A 2GZZA 1TI3A 3R2QA 3VI7A 4KF9A 4I5QA 4GRFA 1J08A 1UA5A 3CSJA 1V98A 3VURA 4MJAA 2EIQA 3KD0A 1PMTA 2X8GA 4ULXA 2I81A 1T4YA 1C72A 4GLTA 3ZITA 1SL1B 2HRAA 4AJ7A 3RDWA 5FHIA 3WT1A 4TXOB 2QGVA 3D5JA 2H0IA 2G0FA 2GSTA 4OFTA 3MDKA 5C00A 3F63A 3RPNA 3ZMKA 2R6KA 5ABRA 4D73B 4PNGA 1AQVA 4LA1A 4OFMA 2LRTA 4HOJA 1M9AA 1A23A 1XG8A 3H4KA 1M3IA 2PVOC 3L4NA 4K7OA 1K0AA 5KEJA 5G1KA 5AGYA 3QOUA 3GX8A 3TB2A 1GWCA 2LRCA 5EVOA 5AIXA 4WXTA 4HZ4A 3ME7A 2H1GA 1G6WA 2A4VA 5HQPA 2YWOA 3LYPA 6GSVA 4HZ2A 4L5OA 3DEXA 2RUEA 1WRYA 3NZNA 1SL0B 2LRNA 4KDUA 5J5NA 2R0PA 2LJKA 1V57A 4TR1B 1MTCA 4NV2A 3AY8A 3TJGA 3TRPA 1JZOA 4V2MA 2VCTA 1YY7A 2VAFA 2JACA 1DUGA 3HCZA 3QR6A 3LJRA 1X0RA 4I97A 5JCWA 2GSQA 4POMA 4FQUA 1WWJA 2PPTA 1MEKA 2X49A 1K0OA 4XRDA 2J9HA 4O92A 3KZQA 2CX3A 2DJJA 4BVYA 3VFIA 3P2AA 4BPYA 2VD1A 4BWSA 2B5EA 2F3MA 2IMFA 3KH9A 3HVSA 4WKWA 4IJ3A 3GSSA 2CAIA 4EXJA 2GT5A 3F4TA 2M46A 3EMPA 2X4AA 3FW2A 2DKIA 2O85A 1GSYA 2F8FA 3KGKA 4G0IA 2C3TA 1QUWA 1QGVA 2N5AA 3BJ5A 1AXDA 4MDCA 3IK7A 4XS4A 4GTUA 4Z7XA 2VLTA 5KN2A 2JSZA 4HQZA 3EINA 4P3YB 1A2LA 5CNWA 1YF0A 4YAVA 2R0GA 2E0QA 3IHGA 2JU5A 1OE7A 2KP1A 4GSTA 5DBQA 3IA1A 4MNNA 5ID2B 1ZGNA 3UVTA 3RBTA 4BIKA 2E2GA 2MMAA 5IO0A 3BD2A 3HJPA 1T4ZA 4AJ8A 3FZ9A 2WB9A 3TOTA 2GQMA 4AGSA 3QAGA 2KUCA 1PD21 2LNSA 2GLRA 1S3DA 3FYGA 2DJ2A 4PGTA 4O5RA 3DD3A 3OR5A 3J7Yb 1S3CA 4DSQA 3FK8A 1Z7RA 1N2AA 2LUSA 5F07A 1SL2B 4ISDA 2PUKC 5FWGA 1G7EA 2WGRA 1F3BA 4X4JA 1QFNA 3J7Yk 3FHKA 1M99A 2PU9C 1F2EA 3VPTA 3FR9A 3CTGA 1JZDA 3RHCA 5DQYA 3LWAA 3VWVA 2B1KA 4CY6A 1NSWA 3IC8A 2F51A 4K2XA 2I4AA 3I69A 4G9HA 3KJYA 6GSXA 1Z6NA 1SYXA 2FHEA 2HZFA 1M2BA 4HS1A 3QFAC 3C7MA 1VGLA 1JLVA 2AUVA 4IQAA 2OE1A 5F06A 4TOPA 4BWQA 3HKRA 2CVKA 1I5GA 4G0LA 1USBA 5EY6A 4KSOA 4OWYA 4NHZA 2VOCA 3MWHA 2IMKA 1GL8A 2FWHA 2NPBA 2L57A 1ACVA 3M9JA 3IXRA 5GAND 2XBQA 2DSAA 3EU4A 1PN9A 1ERTA 2AV4A 2I1UA 2AJQB 1AAZA 2HXKA 1VF2A 1BQ7A 2YV7A 2VM1A 4POLA 3E3EA 1CQHA 3JCML 1XOAA 5CYYA 1T1VA 3MSZA 18GSA 4JU5A 2V41A 2IFQA 5H5QA 2QKEA 4KB3A 4FH8A 1JZWA 5CO3A 1XWAA 4MF5A 4EDZA 3ZREA 1K3OA 4MLYA 3Q74A 2DJ1A 3F6DA 2DBCA 1PKWA 4F0CA 2LQOA 4PNFA 3IAM2 4PXOA 2FUG2 3F0IA 4H86A 3GH9A 1PQNA 4MH3A 3P8WA 2FWFA 2M80A 1TDIA 1SK0A 2X99A 2IIYA 5D9XA 1THXA 5G1LA 2ON7A 2GSRA 1TU7A 2HSYA 1GNEA 3ZLPA 2R5GA 2NDOA 3ZIJA 1TI1A 3FZ4A 4IBPA 3L9UA 5G5EA 4Q5FA 1CQGA 1FOVA 1GRXA 2GZYA 5GAPD 2VO4A 5IMDA 2HT9A 1EWXA 6GSUA 1A0FA 5J9CA 2YCDA 1GTUA 2HSHA 1GSEA 2YP6A 4PQHA 5DQSA 3HY2A 1KBNA 1U3AA 5DALB 2ON5A 2C80A 3GNJA 1B9YC 4ML1A 4HUAA 3UVHA 4G10A 3C8EA 2IL3A 2OADA 4JBBA 1S3AA 4V2NA 2OBKA 2AHEA 5J9BA 3HD5A 4IQ1A 3M8NA 4K0GA 4WR4A 2KOKA 2C1YA 1SYRA 3KIJA 2FWGA 3HZ8A 3A5WA 4N0VA 4V2LA 3DYRA 3GH6A 4RUVA 4MPGA 2JZTA 2L6DA 2YPMA 1DE2A 1GP1A 1HYUA 3GTUA 3W8SA 2IMIA 2PWJA 1R5AA 1H75A 5KOWA 1X9WB 1JFUA 4GF0A 1PX6A 1LBKA 1R26A 2MBSA 4EIPA 4WBJA 4F2IA 1FHEA 1SENA 1XWBA 2RUFA 2X8HA 4ZB6A 2P5RA 4ZL9A 3EMXA 5ECSA 3HVVA 4IW9A 1EOHA 1XWCA 4PUFC 2B7KA 2Z9SA 1KTEA 2PVQA 2N5BA 1KNGA 1W89A 4I2UA 2XPEA 4PX1A 1TOFA 5ECHB 3ZVJA 4ZBAA 2YANA 3ERGA 2ZUPA 1OC9A 2WULA 3CTFA 4NHWA 1XOBA 3N5OA 2GZPA 5KN3A 2VLUA 4YKGA 4GWRA 1R4WA 3QPMA 4FYCA 1BEDA 4DSSB 1N8JA 2V1MA 1PFOA 2RM6A 3RHBA 3W6GA 4NPBA 2MMZA 4N10A 4L5LA 2OACA 4L0WA 4OO5A 4HEA2 4MCUA 3TKSA 2H66A 1XBSA 1GTIA 1XFLA 5HFGA 4USSA 2CT6A 1TU8A 1FAAA 2R3XA 1PGTA 4TXVA 1GSDA 1GULA 3CRTA 2L5LA 4WF4A 2VCXA 3PPUA 4QL7A 5E59A 3RAZA 2DKHA 1VF4A 1HQOA 4MJCA 3GKKA 5G5FA 3VWWA 1B4PA 2H71A 1M0UA 3KMNA 3KXOA 5G30A 1ML6A 3TUEA 3RPPA 1IYHA 1YKCA 2OE3A 3WT2A 1FB0A 2YN1A 3DKSA 5A5KA 1V40A 1MD3A 2XPDA 4XRAA 1Q4JA 4MP4A 3S9FA 5L71A 3U5RE 4WF5A 2WCIA 4IS0A 2VUPA 1JLWA 2C0DA 1EGOA 5B7CA 4XS1A 2CVBA 1B8XA 2H0HA 4WETA 2E7PA 4ECIA 2M72A 3VWXA 2DJKA 3MNGA 2CZ3A 2DIZA 5D9TA 1QXHA 4A5PA 5J41A 3UBKA 3Q18A 2B3SA 3FR6A 1E2YA 1B9XC 4IVFA 3CMIA 3G9BA 3QCPA 2H73A 4ECCA 3EC3A 5DAKB 2P31A 5D9WA 3M1GA 3ED3A 3A2WA 1X5EA 1M3JA 2HFDA 3TJFA 3SBCA 2G2QA 2P5QA 2A2SA 2EC4A 3UOMA 1H4OA 3KP9A 1J0FA 3H1NA 2VCZA 1K0DA 1PX7A 3ZL5A 2X8CA 1Y25A 3LYKA 1GLQA 1HD2A 2LNTA 4OCFA 4O7HA 3LXTA 4ZB8A 1NM3A 2MMOA 3EVIA 2H76A 4IKHA 2OE0A 3TKRA 4FO5A 4FYBA 5J4UA 2NVLA 2KLXA 2C0EA 4MZWA 1XIYA 3D6IA 2IMEA 1YQ1A 2HZEB 4MJEA 5DVBA 2H19A 1HNAA 1OVNA 1M7TA 2BTOT 4NWYA 3D22A 2FY6A 2MZCA 4KGIA 1MDKA 4JR6A 4BVXA 3GSTA 4MABA 3TCOA 12GSA 2VCQA 1JZRA 1PA3A 3D4TA 3IR4A 8GSSA 1V2AA 1OKTA 5J3RA 2LSTA 3DIEA 3MYDA 1XPVA 3GKMA 2FGXA 3KTLA 1GSQA 4HU9A 3CSIA 3L78A 5FT3A 2L6CA 2DMMA 1GH2A 1Y6EA 1K0MA 3IV4A 2R2JA 4GXZA 3KP8A 3UARA 4MPFA 3DVWA 3Q6OA 4PUAA 1THOA 2TRXA 3E0UA 5GSSA 3LXZA 1XW5A 4ECBA 20GSA 1BYEA 5B8BA 4NMUA 2QA2A 3NOFA 1PSQA 5IMAA 3QAVA 5D96A 4ZL8A 4EIQA 2GTUA 2RLIA 3GKNA 2DJ3A 2AYTA 2B6MA 1YEXA 1U6TA 2HSMA 3GURA 1X9SB 2JADA 2HYXA 2LJRA 3DVXA 1U88A 1ERVA 3H79A 1G7OA 2D2ZA 2HRKA 4DEJA 17GSA 6GSWA 3M9KA 4MA9A 4I2TA 1QMVA 3F4SA 3ZFLA 4JZQA 1FW1A 3CRUA 5JCUA 1NW2A 4Z2RA 1G6YA 3VPQA 1HNCA 4QQ7A 1M9BA 3I6AA 5CRHA 4BL7A 3FY7A 1Z7PA 1A8LA 4MF7A 2V32A 4K2DA 1SKSB 4K0NA 1O73A 4KX4A 3L0HA 1TK5B 2J23A 1GNWA 2A2PA 2H74A 2CA8A 2GQLA 3ZVJD 2GGTA 2H6XA 2VD0A 5IO2A 1ST9A 2FCHA 4GQFA 1EEJA 3KMOA 1EGRA 2L5OA 1Z5YE 5ECNB 5IOXA 4O32A 3WGXA 1LU4A 3APOA 3EE2A 1WMJA 1YDKA 1ABAA 1ZL9A 4TXOA 5INYA 4ICYA 2VCVA 6GSYA 1FG4A 2X64A 3BCIA 3TKSC 2C8UA 2H6YA 1K3LA 4X43A 4HSCX 3C1RA 3UBLA 3A3TA 5ECQB 5A4UA 4D73A 2CVDA 1EEMA 3HVNA 4NV5A 3TKQA 3DWVA 5IMZA 2HRFA 4WEYA 3LW9A 6GSSA 1XZOA 5ECKB 1AC1A 5HFKA 1EV4A 3CQFA 4O5UA 2OKAA 5LD0A 3IK9A 2LV3A 3QMXA 4ZB9A 2VIMA 1BG5A 3QFBC 1PN0A 4F82A 3KCMA 4KNDA 2HNLA 1EP7A 1KEBA 5CRDA 5ECRB 1SKWB 4ACSA 3WD6A 1RW1A 5D93A 2V6OA 5JWRB 5E4WA 4RQRA 5ELAA 4TRXA 1UC7A 2A2RA 4TR1A 3HJOA 2TRCP 3C1SA 3BOAA 1T00A 2K8SA 3FMWA 3GUSA 1GSUA 4ILFA 3GA4A 1BX9A 2ALBA 3KEBA 4HJMA 3FKFA 1XVWA 4MH2A 2WS2A 4IHUA 4K7IA 4GSNA 5F0GA 1Z9HA 2LTKA 1FOHA 2H75A 5IIZA 2ES7A 1WP0A 1ZCPA 4KCAA 2I9HA 1AQWA 1F37A 4MK3A 5D9VA 4HI7A 4KDXA 5ECLB 4BVYB 2TIRA 2OBIA 10GSA 4GQCA 4OMVA 4FIWA 4J57E 2I3YA 2WRTA 2VL2A 4LMVA 3M3MA 1X5DA 4CY8A 4K9ZA 3WGDA 3GFKA 3BCKA 3IRAA 1GUKA 4IP6A 3P7XA 3TOUA 1A2JA 4IN0A 4EC0A 2H01A 1QK8A 1QQ2A 3LEFA 3GX0A 4ZIJA 3HDCA 2IN3A 4OD7A 5KN0A 1MDIA 4XS4B 11GSA 1PKZA 2PGTA 1TRSA 3CXGA 1TW9A 1XWGA 3HZ4A 3PH9A 4Z2TA 4YQMA 5ID2A 1PRXA 1GTBA 1RK4A 2JZSA 5GSTA 4KDYA 2DIYA 4TN8A 3TJJA 5LCZA 1O85A 5JWOB 2PBJA 3ME8A 5CP1A 3TJKA 3ZRDA 3A2VA 3E9JB 2HRNA 2GVPA 3IPZA 3KTBA 2B5XA 3SWLA 2YZUA 2N5FA 5CAXA 2WJUA 1SD8A 4JRRA 4FYUA 4DSRA 5KOXA 1XVQA 3R3EA 3QAWA 1SU9A 2VM2A 1V58A 4X1UA 4TR0A 1URMA 4Q5NA 2YOIA 14GSA 3GN3A 2IWTA 2R0CA 4YH2A 1OE8A 5LNKe 1SK2A 2O89A 4KH7A 2ZCTA 2FNOA 3US3A 3C71A 3H8QA 4KUNA 4EVMA 1YEPA 4N11A 4OO4A 2JSYA 1AQXA 4YAPA 4ZBDA 3VWUA 5BMUA 5COHA 4LLRA 2FWEA 1EP8A 4EKZA 3IBHA 5B8AA 4J2FA 3V1WA 5DDLA 4ID0A 4WBRD 3F9UA 2V6KA 4KA0A 1OC3A 3CYNA 3H93A 4ECJA 1OYJA 2DMLA 2MYGA 5BRTA 2H1BA 1TRWA 1I9DA 2JL4A 2H1AA 2HI7A 4POBA 4RI7A 3GIXA 3I43A 5IMCA 2YZHA 1SK1A 4XTSA 2H8LA 2FA8A 4TW5A 1TTZA 2FA4A 4JE1A 3D4MA 3UL3A 2O87A 2C0FA 1ZYPA 4PQIA 2WFCA 3BBYA 3UEMA 3A2XA 5IM9A 4PTSA 2F8AA 2GDRA 2IMDA 4Q5QA 4CW9A 5DJLA 16GSA 5GZZB 3K8NA 1IYIA 1TRVA 1EV9A 1U3IA 2V2GA 1A8YA 4J56E 6GSTA 3ERWA 4LL4B 5EPFA 1X9MB 1VRSD 1UVZA 5CRGA 2VLVA 3GYKA 5G2ZA 2VCWA 4BA7A 1HNBA 2H0GA 1YF1A 2QA1A 5EL8A 4YQUA 2IFQB 3IOSA 4ZILA 5CRWA 2B5YA 2GT6A 3EURA 1BAYA 1ERWA 1O8XA 3HYPA 2C3NA 1X5CA 4EDYA 4KAEA 3Q19A 3EYTA 4NAXA 2QSIA 5B6NA 5A4WA 2EIRA 1YZXA 3LG6A 1RQMA 3APSA 4K5SA 4V1Ap 1JHBA 5A4VA 3MAKA 2LJAA 1DE1A 3FEUA 4L8EA 2LS5A 3PGTA 4ZXGA 3F3RA 1XCCA 2CX4A 4Q5RA 3HJMA 3U6VA 5IMVA 4OFNA 1GSSA 1VF1A 3NIVA 4V1Ag 4N30A 2BJXA 2YNXA 4N0ZA 2K6VA 4OCEA 1FO5A 5DALA 2DLXA 3UIWA 4XIHA 5ECIB 3N9JA 4HJ2A 3O3TA 1GTAA 2K18A 3GRXA 2CV4A 1J9BA 1O7UA 1TK0B 5D73A 1GUMA 3CBUA 3IHQA 1DBYA 4IELA 2HE3A 3L9VA 4F0BA 2PERA 2FLSA 2F9SA 5AN1A 1FVKA 1OAZA 4MMMA 4KW6A 3EU3A 2LEGA 1Q98A 3PINA 5HFIA 2PMTA 4LMWA 3TJBA 1GSFA 1ON4A 2VL2C 3ZIVA 2JZRA 2H30A 4ZBBA 7GSSA 4K6XA 3VI5A 3GTUB 2E2MA 4TR4A 4HU7A 1DSBA 1ZZYA 2GS3A 5ENUA 1TXXA 5DJMA 5IOWA 1ZYEA 3DRNA 1WIKA 2WZ9A 1GLPA 1TK8B 3ZZXA 3LGCA 3APQA 2RM5A 3LORA 2NTOA 1FB6A 4K8MA 1TRUA 2A4HA 1XWKA 4TVEA 1YJ6A 1AW9A 2L4CA 3IC4A 2IJYA 3M0FA 4EUYA 2LQQA 1B48A 1XW6A 1S3RA 5HR2A 3WYWA 2XBIA 1K3YA 4KSMA 4K5RA 4K7NA 5IPHA 1OC9B 2YWNA 5KN1A 2AAWA 5IPGA 4DSSA 4E8EA 1ZYQB 3QD9A 4EL1A 1B4QA 1MDJA 2OJLA 3FZAA 1BJXA 4E8HA 4WR5A 1SJ6A 4G0KA 4NXIA 1O6JA 3TKPA 2AB6A 4EF0A 1E6BA 3G7IA 3VK9A 1T8EB 1GUHA 3F6FA 3L9SA 3DGQA 1AIUA 2FD3A 2KHPA 1SKRB 1F9MA 4JR4A 3O6TA 3UJ1A 2C4JA 3A5IA 1T3BA 3MIXA 4EO3A 5ECOB 1NHYA 4MF6A 4CHSA 4HQSA 3HXSA 4L0UA 4ML6A 5JWQB 3UAPA 4F03A 1XW9A 4I8BA 4TKYA 3QDNA 3GL5A 2GQKA 3KM6A 5F8BA 3TDGA 1PL1A 2DJ0A 2K9FA 3F3QA 2MMNA 2VL9A 2WDUA 2VL3A 1NHOA 2YWMA 1G0TA 3DXBA 5AIVA 4MZCA 2R37A 1SJIA 1K0BA 5IMFA 1SJZA 2ZNMA 1EZKA 2QC7A 4YQVA 1Z3EA 3FR3A 2L4QA 3G7JA 2MBTA 4LL1B 3LQ7A 1AUCA 2YV9A 3TKSE 2YWIA 2XC2A 3TGZA 3HA9A 1O81A 3DMLA 2B1LA 3P90A 4GSSA 5DAKA 4DVCA 3TRQA 1A0RP 5DCHA 2C0GA 1ILOA 2KP2A 4IJIA 3GV1A 3C73A 4G19A 1ERUA 5CREA 1K0CA 5JCGA 1F6MC 13GSA 2YJ7A 2H70A 4XCSA 2BMXA 4PQ1A 1ZYNA
chains in the Genus database with same CATH topology
9GSSA 2IPAA 3IE3A 1ZOFA 4TR3A 5D8IA 3D0ZA 1M2DA 3LSZA 4Z2UA 3ZYWA 3G7YA 5ECPB 2H6ZA 4JEDA 5DCGA 1ZMAA 3ZTLA 1K0NA 2REMA 1TKDB 5ECMB 1T7PB 2C3QA 2HZEA 3ZMLA 4RI6A 4X0XA 2K8VA 3GHAA 1V9WA 4EE0A 1A2MA 1TP9A 3UMAA 1Z6MA 19GSA 1W4VA 2O8VB 4BVXB 4CDOA 3CSHA 1U87A 2P0GA 1M2AA 1MD4A 4I6XA 1EOGA 4G2EA 3FZ5A 3ERFA 1WJKA 1F3AA 4MJBA 5B6MA 2H1DA 5H5RA 2YJHA 3GMFA 3D21A 1WOUA 3HVXA 3KH7A 3IAS2 1XXUA 5HR1A 22GSA 4IP1A 4AF2A 3W8JA 3TRXA 1A24A 1WE0A 4IGJA 3WGEA 2PN8A 3GL3A 4O5QA 2R4VA 3PR8A 1FVJA 3F4RA 1R5PA 3EPTA 3VLNA 1OC8A 4ZL7A 2LKUA 4HDEA 3GKXA 1SD9A 5IQYA 1TJDA 2UZ8A 3LFLA 4XS6A 2L59A 4QL9A 5HR0A 4KE3A 4AJ6A 4GCIA 4F9ZA 2DC5A 1UN2A 2RIIA 5F05A 5AISA 4K1FA 3HHVA 4PURA 2CZ2A 5ELGA 2HLSA 2CQ9A 2GSSA 1R7HA 3ISOA 1OKDA 4KCEA 4YKFA 3F8UA 1YKAA 2XHFA 2H72A 2EIOA 2B7JA 4POKA 3O76A 2NBSA 3ZFBA 4MZBA 1VF3A 4XHMA 5H5SA 2O7KA 5G31A 1PL2A 1WPIA 2OA7A 3I9V2 2CAQA 5C04A 4RQXA 3FRCA 3EWLA 1O8WA 3IDVA 1LJRA 4BL7B 5HR3A 2GZZA 1TI3A 3R2QA 3VI7A 4KF9A 4I5QA 4GRFA 1J08A 1UA5A 3CSJA 1V98A 3VURA 4MJAA 2EIQA 3KD0A 1PMTA 2X8GA 4ULXA 2I81A 1T4YA 1C72A 4GLTA 3ZITA 1SL1B 2HRAA 4AJ7A 3RDWA 5FHIA 3WT1A 4TXOB 2QGVA 3D5JA 2H0IA 2G0FA 2GSTA 4OFTA 3MDKA 5C00A 3F63A 3RPNA 3ZMKA 2R6KA 5ABRA 4D73B 4PNGA 1AQVA 4LA1A 4OFMA 2LRTA 4HOJA 1M9AA 1A23A 3H4KA 2PVOC 3L4NA 4K7OA 1K0AA 5KEJA 5G1KA 5AGYA 3QOUA 3GX8A 3TB2A 1GWCA 2LRCA 5EVOA 5AIXA 4WXTA 4HZ4A 3ME7A 2H1GA 1G6WA 2A4VA 5HQPA 2YWOA 3LYPA 6GSVA 4HZ2A 4L5OA 3DEXA 2RUEA 1WRYA 3NZNA 1SL0B 2LRNA 4KDUA 5J5NA 2R0PA 2LJKA 1V57A 4TR1B 1MTCA 4NV2A 3AY8A 3TJGA 3TRPA 1JZOA 4V2MA 2VCTA 1YY7A 2VAFA 2JACA 1DUGA 3HCZA 3QR6A 3LJRA 1X0RA 4I97A 5JCWA 2GSQA 4POMA 4FQUA 1WWJA 2PPTA 1MEKA 2X49A 1K0OA 4XRDA 2J9HA 4O92A 3KZQA 2CX3A 2DJJA 4BVYA 3VFIA 3P2AA 4BPYA 2VD1A 4BWSA 2B5EA 2F3MA 2IMFA 3KH9A 3HVSA 4WKWA 4IJ3A 3GSSA 2CAIA 4EXJA 2GT5A 3F4TA 2M46A 3EMPA 2X4AA 3FW2A 2DKIA 2O85A 1GSYA 2F8FA 3KGKA 4G0IA 2C3TA 1QUWA 1QGVA 2N5AA 3BJ5A 1AXDA 4MDCA 3IK7A 4XS4A 4GTUA 4Z7XA 2VLTA 5KN2A 2JSZA 4HQZA 3EINA 4P3YB 1A2LA 5CNWA 1YF0A 4YAVA 2R0GA 2E0QA 3IHGA 2JU5A 1OE7A 2KP1A 4GSTA 5DBQA 3IA1A 4MNNA 5ID2B 1ZGNA 3UVTA 3RBTA 2E2GA 2MMAA 5IO0A 3BD2A 3HJPA 1T4ZA 4AJ8A 3FZ9A 2WB9A 3TOTA 2GQMA 4AGSA 3QAGA 2KUCA 1PD21 2LNSA 2GLRA 1S3DA 3FYGA 2DJ2A 4PGTA 4O5RA 3DD3A 3OR5A 3J7Yb 1S3CA 4DSQA 3FK8A 1Z7RA 1N2AA 2LUSA 5F07A 1SL2B 4ISDA 2PUKC 5FWGA 1G7EA 2WGRA 1F3BA 4X4JA 1QFNA 3J7Yk 3FHKA 1M99A 2PU9C 1F2EA 3VPTA 3FR9A 3CTGA 1JZDA 3RHCA 5DQYA 3LWAA 3VWVA 2B1KA 4CY6A 1NSWA 3IC8A 2F51A 4K2XA 2I4AA 3I69A 4G9HA 3KJYA 6GSXA 1Z6NA 1SYXA 2FHEA 2HZFA 1M2BA 4HS1A 3QFAC 3C7MA 1VGLA 1JLVA 2AUVA 4IQAA 2OE1A 5F06A 4TOPA 4BWQA 3HKRA 2CVKA 1I5GA 4G0LA 1USBA 5EY6A 4KSOA 4OWYA 4NHZA 2VOCA 3MWHA 2IMKA 1GL8A 2FWHA 2NPBA 2L57A 1ACVA 3M9JA 3IXRA 5GAND 2XBQA 2DSAA 3EU4A 1PN9A 1ERTA 2AV4A 2I1UA 2AJQB 1AAZA 2HXKA 1VF2A 1BQ7A 2YV7A 2VM1A 4POLA 3E3EA 1CQHA 3JCML 1XOAA 5CYYA 1T1VA 3MSZA 18GSA 4JU5A 2V41A 2IFQA 5H5QA 2QKEA 4KB3A 4FH8A 1JZWA 5CO3A 1XWAA 4MF5A 4EDZA 3ZREA 1K3OA 4MLYA 3Q74A 2DJ1A 3F6DA 2DBCA 1PKWA 4F0CA 2LQOA 4PNFA 3IAM2 4PXOA 2FUG2 3F0IA 4H86A 3GH9A 1PQNA 4MH3A 3P8WA 2FWFA 2M80A 1TDIA 1SK0A 2X99A 2IIYA 5D9XA 1THXA 5G1LA 2ON7A 2GSRA 1TU7A 2HSYA 1GNEA 3ZLPA 2R5GA 2NDOA 3ZIJA 1TI1A 3FZ4A 4IBPA 3L9UA 5G5EA 4Q5FA 1CQGA 1FOVA 1GRXA 2GZYA 5GAPD 2VO4A 5IMDA 2HT9A 1EWXA 6GSUA 1A0FA 5J9CA 2YCDA 1GTUA 2HSHA 1GSEA 2YP6A 4PQHA 5DQSA 3HY2A 1KBNA 1U3AA 5DALB 2ON5A 2C80A 3GNJA 1B9YC 4ML1A 4HUAA 3UVHA 4G10A 3C8EA 2IL3A 2OADA 4JBBA 1S3AA 4V2NA 2OBKA 2AHEA 5J9BA 3HD5A 4IQ1A 3M8NA 4K0GA 4WR4A 2KOKA 2C1YA 1SYRA 3KIJA 2FWGA 3HZ8A 3A5WA 4N0VA 4V2LA 3DYRA 3GH6A 4RUVA 4MPGA 2JZTA 2L6DA 2YPMA 1DE2A 1GP1A 1HYUA 3GTUA 3W8SA 2IMIA 2PWJA 1R5AA 1H75A 5KOWA 1X9WB 1JFUA 4GF0A 1PX6A 1LBKA 1R26A 2MBSA 4EIPA 4WBJA 4F2IA 1FHEA 1SENA 1XWBA 2RUFA 2X8HA 4ZB6A 2P5RA 4ZL9A 3EMXA 5ECSA 3HVVA 4IW9A 1EOHA 1XWCA 4PUFC 2B7KA 2Z9SA 1KTEA 2PVQA 2N5BA 1KNGA 1W89A 4I2UA 2XPEA 4PX1A 1TOFA 5ECHB 3ZVJA 4ZBAA 2YANA 3ERGA 2ZUPA 1OC9A 2WULA 3CTFA 4NHWA 1XOBA 3N5OA 2GZPA 5KN3A 2VLUA 4YKGA 4GWRA 1R4WA 3QPMA 4FYCA 1BEDA 4DSSB 1N8JA 2V1MA 2RM6A 3RHBA 3W6GA 4NPBA 2MMZA 4N10A 4L5LA 2OACA 4L0WA 4OO5A 4HEA2 4MCUA 3TKSA 2H66A 1XBSA 1GTIA 1XFLA 5HFGA 4USSA 2CT6A 1TU8A 1FAAA 2R3XA 1PGTA 4TXVA 1GSDA 1GULA 3CRTA 2L5LA 4WF4A 2VCXA 3PPUA 4QL7A 5E59A 3RAZA 2DKHA 1VF4A 1HQOA 4MJCA 3GKKA 5G5FA 3VWWA 1B4PA 2H71A 1M0UA 3KMNA 3KXOA 5G30A 1ML6A 3TUEA 3RPPA 1IYHA 1YKCA 2OE3A 3WT2A 1FB0A 2YN1A 3DKSA 5A5KA 1V40A 1MD3A 2XPDA 4XRAA 1Q4JA 4MP4A 3S9FA 5L71A 3U5RE 4WF5A 2WCIA 4IS0A 2VUPA 1JLWA 2C0DA 1EGOA 5B7CA 4XS1A 2CVBA 1B8XA 2H0HA 4WETA 2E7PA 4ECIA 2M72A 3VWXA 2DJKA 3MNGA 2CZ3A 2DIZA 5D9TA 1QXHA 4A5PA 5J41A 3UBKA 3Q18A 2B3SA 3FR6A 1E2YA 1B9XC 4IVFA 3CMIA 3G9BA 3QCPA 2H73A 4ECCA 3EC3A 5DAKB 2P31A 5D9WA 3M1GA 3ED3A 3A2WA 1X5EA 2HFDA 3TJFA 3SBCA 2G2QA 2P5QA 2A2SA 2EC4A 3UOMA 1H4OA 3KP9A 1J0FA 3H1NA 2VCZA 1K0DA 1PX7A 3ZL5A 2X8CA 1Y25A 3LYKA 1GLQA 1HD2A 2LNTA 4OCFA 4O7HA 3LXTA 4ZB8A 1NM3A 2MMOA 3EVIA 2H76A 4IKHA 2OE0A 3TKRA 4FO5A 4FYBA 5J4UA 2NVLA 2KLXA 2C0EA 4MZWA 1XIYA 3D6IA 2IMEA 1YQ1A 2HZEB 4MJEA 5DVBA 2H19A 1HNAA 1OVNA 1M7TA 2BTOT 4NWYA 3D22A 2FY6A 2MZCA 4KGIA 1MDKA 4JR6A 4BVXA 3GSTA 4MABA 3TCOA 12GSA 2VCQA 1JZRA 1PA3A 3D4TA 3IR4A 8GSSA 1V2AA 1OKTA 5J3RA 2LSTA 3DIEA 3MYDA 1XPVA 3GKMA 2FGXA 3KTLA 1GSQA 4HU9A 3CSIA 3L78A 5FT3A 2L6CA 2DMMA 1GH2A 1Y6EA 1K0MA 3IV4A 2R2JA 4GXZA 3KP8A 3UARA 4MPFA 3DVWA 3Q6OA 4PUAA 1THOA 2TRXA 3E0UA 5GSSA 3LXZA 1XW5A 4ECBA 20GSA 1BYEA 5B8BA 4NMUA 2QA2A 3NOFA 1PSQA 5IMAA 3QAVA 5D96A 4ZL8A 4EIQA 2GTUA 2RLIA 3GKNA 2DJ3A 2AYTA 2B6MA 1YEXA 1U6TA 2HSMA 3GURA 1X9SB 2JADA 2HYXA 2LJRA 3DVXA 1U88A 1ERVA 3H79A 1G7OA 2D2ZA 2HRKA 4DEJA 17GSA 6GSWA 3M9KA 4MA9A 4I2TA 1QMVA 3F4SA 3ZFLA 4JZQA 1FW1A 3CRUA 5JCUA 1NW2A 4Z2RA 1G6YA 3VPQA 1HNCA 4QQ7A 1M9BA 3I6AA 5CRHA 4BL7A 3FY7A 1Z7PA 1A8LA 4MF7A 2V32A 4K2DA 1SKSB 4K0NA 1O73A 4KX4A 3L0HA 1TK5B 2J23A 1GNWA 2A2PA 2H74A 2CA8A 2GQLA 3ZVJD 2GGTA 2H6XA 2VD0A 5IO2A 1ST9A 2FCHA 4GQFA 1EEJA 3KMOA 1EGRA 2L5OA 1Z5YE 5ECNB 5IOXA 4O32A 3WGXA 1LU4A 3APOA 3EE2A 1WMJA 1YDKA 1ABAA 1ZL9A 4TXOA 5INYA 4ICYA 2VCVA 6GSYA 1FG4A 2X64A 3BCIA 3TKSC 2C8UA 2H6YA 1K3LA 4X43A 3C1RA 3UBLA 3A3TA 5ECQB 5A4UA 4D73A 2CVDA 1EEMA 4NV5A 3TKQA 3DWVA 5IMZA 2HRFA 4WEYA 3LW9A 6GSSA 1XZOA 5ECKB 1AC1A 5HFKA 1EV4A 4O5UA 2OKAA 5LD0A 3IK9A 2LV3A 3QMXA 4ZB9A 2VIMA 1BG5A 3QFBC 1PN0A 4F82A 3KCMA 4KNDA 2HNLA 1EP7A 1KEBA 5CRDA 5ECRB 1SKWB 4ACSA 3WD6A 1RW1A 5D93A 2V6OA 5JWRB 5E4WA 4RQRA 5ELAA 4TRXA 1UC7A 2A2RA 4TR1A 3HJOA 2TRCP 3C1SA 3BOAA 1T00A 2K8SA 3FMWA 3GUSA 1GSUA 4ILFA 3GA4A 1BX9A 2ALBA 3KEBA 4HJMA 3FKFA 1XVWA 4MH2A 2WS2A 4IHUA 4K7IA 4GSNA 5F0GA 1Z9HA 2LTKA 1FOHA 2H75A 5IIZA 2ES7A 1WP0A 1ZCPA 4KCAA 2I9HA 1AQWA 1F37A 4MK3A 5D9VA 4HI7A 4KDXA 5ECLB 4BVYB 2TIRA 2OBIA 10GSA 4GQCA 4OMVA 4FIWA 4J57E 2I3YA 2WRTA 2VL2A 4LMVA 3M3MA 1X5DA 4CY8A 4K9ZA 3WGDA 3GFKA 3BCKA 3IRAA 1GUKA 4IP6A 3P7XA 3TOUA 1A2JA 4IN0A 4EC0A 2H01A 1QK8A 1QQ2A 3LEFA 3GX0A 4ZIJA 3HDCA 2IN3A 4OD7A 5KN0A 1MDIA 4XS4B 11GSA 1PKZA 2PGTA 1TRSA 3CXGA 1TW9A 1XWGA 3HZ4A 3PH9A 4Z2TA 4YQMA 5ID2A 1PRXA 1GTBA 1RK4A 2JZSA 5GSTA 4KDYA 2DIYA 4TN8A 3TJJA 5LCZA 1O85A 5JWOB 2PBJA 3ME8A 5CP1A 3TJKA 3ZRDA 3A2VA 3E9JB 2HRNA 2GVPA 3IPZA 3KTBA 2B5XA 3SWLA 2YZUA 2N5FA 5CAXA 2WJUA 1SD8A 4JRRA 4FYUA 4DSRA 5KOXA 1XVQA 3R3EA 3QAWA 1SU9A 2VM2A 1V58A 4X1UA 4TR0A 1URMA 4Q5NA 2YOIA 14GSA 3GN3A 2IWTA 2R0CA 4YH2A 1OE8A 5LNKe 1SK2A 2O89A 4KH7A 2ZCTA 2FNOA 3US3A 3C71A 3H8QA 4KUNA 4EVMA 1YEPA 4N11A 4OO4A 2JSYA 1AQXA 4YAPA 4ZBDA 3VWUA 5BMUA 5COHA 4LLRA 2FWEA 1EP8A 4EKZA 3IBHA 5B8AA 4J2FA 3V1WA 5DDLA 4ID0A 4WBRD 3F9UA 2V6KA 4KA0A 1OC3A 3CYNA 3H93A 4ECJA 1OYJA 2DMLA 2MYGA 5BRTA 2H1BA 1TRWA 1I9DA 2JL4A 2H1AA 2HI7A 4POBA 4RI7A 3GIXA 3I43A 5IMCA 2YZHA 1SK1A 4XTSA 2H8LA 2FA8A 4TW5A 1TTZA 2FA4A 4JE1A 3D4MA 3UL3A 2O87A 2C0FA 1ZYPA 4PQIA 2WFCA 3BBYA 3UEMA 3A2XA 5IM9A 4PTSA 2F8AA 2GDRA 2IMDA 4Q5QA 4CW9A 5DJLA 16GSA 5GZZB 3K8NA 1IYIA 1TRVA 1EV9A 1U3IA 2V2GA 1A8YA 4J56E 6GSTA 3ERWA 4LL4B 5EPFA 1X9MB 1VRSD 1UVZA 5CRGA 2VLVA 3GYKA 5G2ZA 2VCWA 4BA7A 1HNBA 2H0GA 1YF1A 2QA1A 5EL8A 4YQUA 2IFQB 3IOSA 4ZILA 5CRWA 2B5YA 2GT6A 3EURA 1BAYA 1ERWA 1O8XA 3HYPA 2C3NA 1X5CA 4EDYA 4KAEA 3Q19A 3EYTA 4NAXA 2QSIA 5B6NA 5A4WA 2EIRA 1YZXA 3LG6A 1RQMA 3APSA 4K5SA 4V1Ap 1JHBA 5A4VA 3MAKA 2LJAA 1DE1A 3FEUA 4L8EA 2LS5A 3PGTA 4ZXGA 3F3RA 1XCCA 2CX4A 4Q5RA 3HJMA 3U6VA 5IMVA 4OFNA 1GSSA 1VF1A 3NIVA 4V1Ag 4N30A 2BJXA 2YNXA 4N0ZA 2K6VA 4OCEA 1FO5A 5DALA 2DLXA 3UIWA 4XIHA 5ECIB 3N9JA 4HJ2A 3O3TA 1GTAA 2K18A 3GRXA 2CV4A 1J9BA 1O7UA 1TK0B 5D73A 1GUMA 3CBUA 3IHQA 1DBYA 4IELA 2HE3A 3L9VA 4F0BA 2PERA 2FLSA 2F9SA 5AN1A 1FVKA 1OAZA 4MMMA 4KW6A 3EU3A 2LEGA 1Q98A 3PINA 5HFIA 2PMTA 4LMWA 3TJBA 1GSFA 1ON4A 2VL2C 3ZIVA 2JZRA 2H30A 4ZBBA 7GSSA 4K6XA 3VI5A 3GTUB 2E2MA 4TR4A 4HU7A 1DSBA 1ZZYA 2GS3A 5ENUA 1TXXA 5DJMA 5IOWA 1ZYEA 3DRNA 1WIKA 2WZ9A 1GLPA 1TK8B 3ZZXA 3LGCA 3APQA 2RM5A 3LORA 2NTOA 1FB6A 4K8MA 1TRUA 2A4HA 1XWKA 4TVEA 1YJ6A 1AW9A 2L4CA 3IC4A 2IJYA 3M0FA 4EUYA 2LQQA 1B48A 1XW6A 5HR2A 3WYWA 2XBIA 1K3YA 4KSMA 4K5RA 4K7NA 5IPHA 1OC9B 2YWNA 5KN1A 2AAWA 5IPGA 4DSSA 4E8EA 1ZYQB 3QD9A 4EL1A 1B4QA 1MDJA 2OJLA 3FZAA 1BJXA 4E8HA 4WR5A 1SJ6A 4G0KA 4NXIA 1O6JA 3TKPA 2AB6A 4EF0A 1E6BA 3G7IA 3VK9A 1T8EB 1GUHA 3F6FA 3L9SA 3DGQA 1AIUA 2FD3A 2KHPA 1SKRB 1F9MA 4JR4A 3O6TA 3UJ1A 2C4JA 3A5IA 1T3BA 3MIXA 4EO3A 5ECOB 1NHYA 4MF6A 4CHSA 4HQSA 3HXSA 4L0UA 4ML6A 5JWQB 3UAPA 4F03A 1XW9A 4I8BA 4TKYA 3QDNA 3GL5A 2GQKA 3KM6A 5F8BA 3TDGA 1PL1A 2DJ0A 2K9FA 3F3QA 2MMNA 2VL9A 2WDUA 2VL3A 1NHOA 2YWMA 1G0TA 3DXBA 5AIVA 4MZCA 2R37A 1SJIA 1K0BA 5IMFA 1SJZA 2ZNMA 1EZKA 2QC7A 4YQVA 1Z3EA 3FR3A 2L4QA 3G7JA 2MBTA 4LL1B 3LQ7A 1AUCA 2YV9A 3TKSE 2YWIA 2XC2A 3TGZA 3HA9A 1O81A 3DMLA 2B1LA 3P90A 4GSSA 5DAKA 4DVCA 3TRQA 1A0RP 5DCHA 2C0GA 1ILOA 2KP2A 4IJIA 3GV1A 3C73A 4G19A 1ERUA 5CREA 1K0CA 5JCGA 1F6MC 13GSA 2YJ7A 2H70A 4XCSA 2BMXA 4PQ1A 1ZYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 9GSS A;  2IPA A;  3IE3 A;  1ZOF A;  4TR3 A;  5D8I A;  3D0Z A;  1M2D A;  3LSZ A;  3ZYW A;  3G7Y A;  5ECP B;  2H6Z A;  4JED A;  5DCG A;  1ZMA A;  3ZTL A;  1K0N A;  2REM A;  1TKD B;  5ECM B;  1T7P B;  2C3Q A;  2HZE A;  3ZML A;  4RI6 A;  4X0X A;  2K8V A;  3GHA A;  1V9W A;  4EE0 A;  1A2M A;  1TP9 A;  3UMA A;  1Z6M A;  19GS A;  1W4V A;  2O8V B;  4CDO A;  3CSH A;  1U87 A;  2P0G A;  1M2A A;  1MD4 A;  4I6X A;  1EOG A;  4G2E A;  3FZ5 A;  3ERF A;  1WJK A;  1F3A A;  4MJB A;  5B6M A;  2H1D A;  5H5R A;  2YJH A;  3GMF A;  3D21 A;  1WOU A;  3HVX A;  3KH7 A;  3IAS 2;  1XXU A;  5HR1 A;  22GS A;  4IP1 A;  4AF2 A;  3W8J A;  3TRX A;  1A24 A;  1WE0 A;  4IGJ A;  3WGE A;  2PN8 A;  3GL3 A;  2R4V A;  3PR8 A;  1FVJ A;  3F4R A;  1R5P A;  3VLN A;  1OC8 A;  4ZL7 A;  2LKU A;  4HDE A;  3GKX A;  1SD9 A;  5IQY A;  1TJD A;  3LFL A;  4XS6 A;  2L59 A;  4QL9 A;  5HR0 A;  4KE3 A;  4AJ6 A;  4GCI A;  4F9Z A;  2DC5 A;  1UN2 A;  2RII A;  5F05 A;  5AIS A;  4K1F A;  3HHV A;  4PUR A;  2CZ2 A;  5ELG A;  2HLS A;  2CQ9 A;  2GSS A;  1R7H A;  3ISO A;  1OKD A;  4KCE A;  3F8U A;  1YKA A;  2XHF A;  2H72 A;  2EIO A;  2B7J A;  4POK A;  3O76 A;  2NBS A;  3ZFB A;  4MZB A;  1VF3 A;  4XHM A;  5H5S A;  2O7K A;  5G31 A;  1PL2 A;  1WPI A;  2OA7 A;  3I9V 2;  2CAQ A;  5C04 A;  4RQX A;  3FRC A;  3EWL A;  1O8W A;  3IDV A;  1LJR A;  5HR3 A;  2GZZ A;  1TI3 A;  3R2Q A;  3VI7 A;  4I5Q A;  4GRF A;  1J08 A;  1UA5 A;  3CSJ A;  1V98 A;  3VUR A;  4MJA A;  2EIQ A;  3KD0 A;  1PMT A;  2X8G A;  4ULX A;  2I81 A;  1T4Y A;  1C72 A;  4GLT A;  3ZIT A;  1SL1 B;  4AJ7 A;  3RDW A;  5FHI A;  3WT1 A;  4TXO B;  2QGV A;  3D5J A;  2H0I A;  2G0F A;  2GST A;  4OFT A;  3MDK A;  5C00 A;  3F63 A;  3RPN A;  3ZMK A;  2R6K A;  5ABR A;  4D73 B;  4PNG A;  1AQV A;  4LA1 A;  4OFM A;  2LRT A;  4HOJ A;  1M9A A;  1A23 A;  3H4K A;  2PVO C;  3L4N A;  4K7O A;  1K0A A;  5KEJ A;  5G1K A;  5AGY A;  3QOU A;  3GX8 A;  3TB2 A;  1GWC A;  2LRC A;  5EVO A;  5AIX A;  4WXT A;  4HZ4 A;  3ME7 A;  2H1G A;  1G6W A;  2A4V A;  5HQP A;  2YWO A;  3LYP A;  6GSV A;  4HZ2 A;  4L5O A;  3DEX A;  2RUE A;  1WRY A;  3NZN A;  1SL0 B;  2LRN A;  4KDU A;  5J5N A;  2LJK A;  1V57 A;  4TR1 B;  1MTC A;  4NV2 A;  3AY8 A;  3TJG A;  3TRP A;  1JZO A;  4V2M A;  2VCT A;  1YY7 A;  2VAF A;  2JAC A;  1DUG A;  3HCZ A;  3QR6 A;  3LJR A;  1X0R A;  4I97 A;  5JCW A;  2GSQ A;  4POM A;  1WWJ A;  2PPT A;  1MEK A;  1K0O A;  4XRD A;  2J9H A;  4O92 A;  3KZQ A;  2CX3 A;  2DJJ A;  4BVY A;  3VFI A;  3P2A A;  4BPY A;  2VD1 A;  4BWS A;  2B5E A;  2F3M A;  2IMF A;  3KH9 A;  3HVS A;  4WKW A;  4IJ3 A;  3GSS A;  2CAI A;  4EXJ A;  2GT5 A;  3F4T A;  2M46 A;  3EMP A;  3FW2 A;  2O85 A;  1GSY A;  2F8F A;  3KGK A;  2C3T A;  1QUW A;  1QGV A;  2N5A A;  3BJ5 A;  1AXD A;  4MDC A;  3IK7 A;  4XS4 A;  4GTU A;  4Z7X A;  2VLT A;  5KN2 A;  2JSZ A;  4HQZ A;  3EIN A;  4P3Y B;  1A2L A;  5CNW A;  1YF0 A;  4YAV A;  2E0Q A;  2JU5 A;  1OE7 A;  2KP1 A;  4GST A;  5DBQ A;  3IA1 A;  5ID2 B;  1ZGN A;  3UVT A;  3RBT A;  2E2G A;  2MMA A;  5IO0 A;  3BD2 A;  3HJP A;  1T4Z A;  4AJ8 A;  3FZ9 A;  2WB9 A;  3TOT A;  2GQM A;  4AGS A;  3QAG A;  2KUC A;  1PD2 1;  2LNS A;  2GLR A;  1S3D A;  3FYG A;  2DJ2 A;  4PGT A;  4O5R A;  3DD3 A;  3OR5 A;  3J7Y b;  1S3C A;  4DSQ A;  3FK8 A;  1Z7R A;  1N2A A;  2LUS A;  5F07 A;  1SL2 B;  4ISD A;  2PUK C;  5FWG A;  1G7E A;  2WGR A;  1F3B A;  1QFN A;  3J7Y k;  3FHK A;  1M99 A;  2PU9 C;  1F2E A;  3VPT A;  3FR9 A;  3CTG A;  1JZD A;  3RHC A;  5DQY A;  3LWA A;  3VWV A;  2B1K A;  1NSW A;  2F51 A;  2I4A A;  3I69 A;  4G9H A;  3KJY A;  6GSX A;  1Z6N A;  1SYX A;  2FHE A;  2HZF A;  1M2B A;  4HS1 A;  3QFA C;  3C7M A;  1VGL A;  1JLV A;  2AUV A;  4IQA A;  2OE1 A;  5F06 A;  4TOP A;  4BWQ A;  3HKR A;  2CVK A;  1I5G A;  1USB A;  5EY6 A;  4KSO A;  4OWY A;  4NHZ A;  2VOC A;  3MWH A;  2IMK A;  1GL8 A;  2FWH A;  2NPB A;  2L57 A;  1ACV A;  3M9J A;  3IXR A;  5GAN D;  2XBQ A;  2DSA A;  3EU4 A;  1PN9 A;  1ERT A;  2AV4 A;  2I1U A;  2AJQ B;  1AAZ A;  2HXK A;  1VF2 A;  1BQ7 A;  2YV7 A;  2VM1 A;  4POL A;  3E3E A;  1CQH A;  3JCM L;  1XOA A;  5CYY A;  1T1V A;  3MSZ A;  18GS A;  4JU5 A;  2V41 A;  2IFQ A;  5H5Q A;  2QKE A;  4KB3 A;  4FH8 A;  1JZW A;  5CO3 A;  1XWA A;  4MF5 A;  4EDZ A;  3ZRE A;  1K3O A;  4MLY A;  3Q74 A;  2DJ1 A;  3F6D A;  2DBC A;  1PKW A;  4F0C A;  2LQO A;  4PNF A;  3IAM 2;  4PXO A;  2FUG 2;  3F0I A;  4H86 A;  3GH9 A;  1PQN A;  4MH3 A;  3P8W A;  2FWF A;  2M80 A;  1TDI A;  1SK0 A;  2X99 A;  2IIY A;  5D9X A;  1THX A;  5G1L A;  2ON7 A;  2GSR A;  1TU7 A;  2HSY A;  1GNE A;  3ZLP A;  2R5G A;  2NDO A;  3ZIJ A;  1TI1 A;  3FZ4 A;  4IBP A;  3L9U A;  5G5E A;  4Q5F A;  1CQG A;  1FOV A;  1GRX A;  2GZY A;  5GAP D;  2VO4 A;  5IMD A;  2HT9 A;  1EWX A;  6GSU A;  1A0F A;  5J9C A;  2YCD A;  1GTU A;  2HSH A;  1GSE A;  2YP6 A;  4PQH A;  5DQS A;  3HY2 A;  1KBN A;  1U3A A;  5DAL B;  2ON5 A;  2C80 A;  3GNJ A;  1B9Y C;  4ML1 A;  4HUA A;  3UVH A;  4G10 A;  3C8E A;  2IL3 A;  2OAD A;  4JBB A;  1S3A A;  4V2N A;  2OBK A;  2AHE A;  5J9B A;  3HD5 A;  4IQ1 A;  3M8N A;  4K0G A;  4WR4 A;  2KOK A;  2C1Y A;  1SYR A;  3KIJ A;  2FWG A;  3HZ8 A;  3A5W A;  4N0V A;  4V2L A;  3DYR A;  3GH6 A;  4RUV A;  4MPG A;  2JZT A;  2L6D A;  2YPM A;  1DE2 A;  1GP1 A;  1HYU A;  3GTU A;  3W8S A;  2IMI A;  2PWJ A;  1R5A A;  1H75 A;  1X9W B;  1JFU A;  4GF0 A;  1PX6 A;  1LBK A;  1R26 A;  2MBS A;  4WBJ A;  4F2I A;  1FHE A;  1SEN A;  1XWB A;  2RUF A;  2X8H A;  4ZB6 A;  2P5R A;  4ZL9 A;  3EMX A;  5ECS A;  3HVV A;  4IW9 A;  1EOH A;  1XWC A;  4PUF C;  2B7K A;  2Z9S A;  1KTE A;  2PVQ A;  2N5B A;  1KNG A;  1W89 A;  4I2U A;  2XPE A;  4PX1 A;  1TOF A;  5ECH B;  3ZVJ A;  4ZBA A;  2YAN A;  3ERG A;  2ZUP A;  1OC9 A;  2WUL A;  3CTF A;  4NHW A;  1XOB A;  3N5O A;  2GZP A;  5KN3 A;  2VLU A;  4GWR A;  1R4W A;  3QPM A;  4FYC A;  1BED A;  4DSS B;  1N8J A;  2V1M A;  2RM6 A;  3RHB A;  3W6G A;  4NPB A;  2MMZ A;  4N10 A;  4L5L A;  2OAC A;  4L0W A;  4OO5 A;  4HEA 2;  4MCU A;  3TKS A;  2H66 A;  1XBS A;  1GTI A;  1XFL A;  5HFG A;  2CT6 A;  1TU8 A;  1FAA A;  2R3X A;  1PGT A;  4TXV A;  1GSD A;  1GUL A;  3CRT A;  2L5L A;  4WF4 A;  2VCX A;  4QL7 A;  5E59 A;  3RAZ A;  1VF4 A;  1HQO A;  4MJC A;  3GKK A;  5G5F A;  3VWW A;  1B4P A;  2H71 A;  1M0U A;  3KMN A;  3KXO A;  5G30 A;  1ML6 A;  3TUE A;  3RPP A;  1IYH A;  1YKC A;  2OE3 A;  3WT2 A;  1FB0 A;  2YN1 A;  3DKS A;  5A5K A;  1V40 A;  1MD3 A;  2XPD A;  4XRA A;  1Q4J A;  4MP4 A;  3S9F A;  5L71 A;  3U5R E;  4WF5 A;  2WCI A;  4IS0 A;  2VUP A;  1JLW A;  2C0D A;  1EGO A;  5B7C A;  4XS1 A;  2CVB A;  1B8X A;  2H0H A;  4WET A;  2E7P A;  4ECI A;  2M72 A;  3VWX A;  2DJK A;  3MNG A;  2CZ3 A;  2DIZ A;  5D9T A;  1QXH A;  5J41 A;  3UBK A;  3Q18 A;  2B3S A;  3FR6 A;  1E2Y A;  1B9X C;  4IVF A;  3CMI A;  3G9B A;  3QCP A;  2H73 A;  4ECC A;  3EC3 A;  5DAK B;  2P31 A;  5D9W A;  3M1G A;  3ED3 A;  3A2W A;  1X5E A;  2HFD A;  3TJF A;  3SBC A;  2G2Q A;  2P5Q A;  2A2S A;  2EC4 A;  3UOM A;  1H4O A;  3KP9 A;  1J0F A;  3H1N A;  2VCZ A;  1K0D A;  1PX7 A;  3ZL5 A;  2X8C A;  1Y25 A;  3LYK A;  1GLQ A;  1HD2 A;  2LNT A;  4OCF A;  4O7H A;  3LXT A;  4ZB8 A;  1NM3 A;  2MMO A;  3EVI A;  2H76 A;  4IKH A;  2OE0 A;  3TKR A;  4FO5 A;  4FYB A;  5J4U A;  2NVL A;  2KLX A;  2C0E A;  4MZW A;  1XIY A;  3D6I A;  2IME A;  1YQ1 A;  2HZE B;  4MJE A;  5DVB A;  2H19 A;  1HNA A;  1OVN A;  1M7T A;  2BTO T;  4NWY A;  3D22 A;  2FY6 A;  2MZC A;  4KGI A;  1MDK A;  4JR6 A;  4BVX A;  3GST A;  4MAB A;  3TCO A;  12GS A;  2VCQ A;  1JZR A;  1PA3 A;  3D4T A;  3IR4 A;  8GSS A;  1V2A A;  1OKT A;  5J3R A;  2LST A;  3DIE A;  1XPV A;  3GKM A;  2FGX A;  3KTL A;  1GSQ A;  4HU9 A;  3CSI A;  3L78 A;  5FT3 A;  2L6C A;  2DMM A;  1GH2 A;  1Y6E A;  1K0M A;  3IV4 A;  2R2J A;  4GXZ A;  3KP8 A;  3UAR A;  4MPF A;  3DVW A;  3Q6O A;  4PUA A;  1THO A;  2TRX A;  3E0U A;  5GSS A;  3LXZ A;  1XW5 A;  4ECB A;  20GS A;  1BYE A;  5B8B A;  4NMU A;  3NOF A;  1PSQ A;  5IMA A;  3QAV A;  5D96 A;  4ZL8 A;  2GTU A;  2RLI A;  3GKN A;  2DJ3 A;  2AYT A;  2B6M A;  1YEX A;  1U6T A;  3GUR A;  1X9S B;  2JAD A;  2HYX A;  2LJR A;  3DVX A;  1U88 A;  1ERV A;  3H79 A;  1G7O A;  2D2Z A;  4DEJ A;  17GS A;  6GSW A;  3M9K A;  4MA9 A;  4I2T A;  1QMV A;  3F4S A;  3ZFL A;  4JZQ A;  1FW1 A;  3CRU A;  5JCU A;  1NW2 A;  1G6Y A;  3VPQ A;  1HNC A;  4QQ7 A;  1M9B A;  3I6A A;  5CRH A;  4BL7 A;  3FY7 A;  1Z7P A;  1A8L A;  4MF7 A;  2V32 A;  4K2D A;  1SKS B;  4K0N A;  1O73 A;  4KX4 A;  3L0H A;  1TK5 B;  2J23 A;  1GNW A;  2H74 A;  2CA8 A;  2GQL A;  3ZVJ D;  2GGT A;  2H6X A;  2VD0 A;  5IO2 A;  1ST9 A;  2FCH A;  4GQF A;  1EEJ A;  3KMO A;  1EGR A;  2L5O A;  1Z5Y E;  5ECN B;  5IOX A;  4O32 A;  3WGX A;  1LU4 A;  3APO A;  3EE2 A;  1WMJ A;  1YDK A;  1ABA A;  1ZL9 A;  4TXO A;  5INY A;  2VCV A;  6GSY A;  1FG4 A;  2X64 A;  3BCI A;  3TKS C;  2C8U A;  2H6Y A;  1K3L A;  4X43 A;  3C1R A;  3UBL A;  3A3T A;  5ECQ B;  5A4U A;  4D73 A;  2CVD A;  1EEM A;  4NV5 A;  3TKQ A;  3DWV A;  5IMZ A;  2HRF A;  4WEY A;  6GSS A;  1XZO A;  5ECK B;  1AC1 A;  5HFK A;  1EV4 A;  2OKA A;  5LD0 A;  3IK9 A;  2LV3 A;  3QMX A;  4ZB9 A;  2VIM A;  1BG5 A;  3QFB C;  4F82 A;  3KCM A;  4KND A;  2HNL A;  1EP7 A;  1KEB A;  5CRD A;  5ECR B;  1SKW B;  4ACS A;  3WD6 A;  1RW1 A;  5D93 A;  2V6O A;  5JWR B;  5E4W A;  4RQR A;  5ELA A;  4TRX A;  1UC7 A;  2A2R A;  4TR1 A;  3HJO A;  2TRC P;  3C1S A;  3BOA A;  1T00 A;  2K8S A;  3GUS A;  1GSU A;  4ILF A;  3GA4 A;  1BX9 A;  2ALB A;  3KEB A;  4HJM A;  3FKF A;  1XVW A;  4MH2 A;  2WS2 A;  4IHU A;  4K7I A;  4GSN A;  5F0G A;  1Z9H A;  2LTK A;  2H75 A;  5IIZ A;  2ES7 A;  1WP0 A;  1ZCP A;  4KCA A;  2I9H A;  1AQW A;  1F37 A;  4MK3 A;  5D9V A;  4HI7 A;  4KDX A;  5ECL B;  2TIR A;  2OBI A;  10GS A;  4GQC A;  4OMV A;  4FIW A;  4J57 E;  2I3Y A;  2WRT A;  2VL2 A;  4LMV A;  3M3M A;  1X5D A;  4K9Z A;  3WGD A;  3GFK A;  3BCK A;  3IRA A;  1GUK A;  4IP6 A;  3P7X A;  3TOU A;  1A2J A;  4IN0 A;  4EC0 A;  2H01 A;  1QK8 A;  1QQ2 A;  3LEF A;  3GX0 A;  4ZIJ A;  3HDC A;  2IN3 A;  4OD7 A;  5KN0 A;  1MDI A;  4XS4 B;  11GS A;  1PKZ A;  2PGT A;  1TRS A;  3CXG A;  1TW9 A;  1XWG A;  3HZ4 A;  3PH9 A;  4YQM A;  5ID2 A;  1PRX A;  1GTB A;  1RK4 A;  2JZS A;  5GST A;  4KDY A;  2DIY A;  4TN8 A;  3TJJ A;  5LCZ A;  1O85 A;  5JWO B;  2PBJ A;  3ME8 A;  5CP1 A;  3TJK A;  3ZRD A;  3A2V A;  3E9J B;  2HRN A;  2GVP A;  3IPZ A;  3KTB A;  2B5X A;  3SWL A;  2YZU A;  2N5F A;  5CAX A;  2WJU A;  1SD8 A;  4JRR A;  4FYU A;  4DSR A;  1XVQ A;  3QAW A;  1SU9 A;  2VM2 A;  1V58 A;  4X1U A;  4TR0 A;  1URM A;  4Q5N A;  2YOI A;  14GS A;  3GN3 A;  2IWT A;  4YH2 A;  1OE8 A;  5LNK e;  1SK2 A;  2O89 A;  4KH7 A;  2ZCT A;  2FNO A;  3US3 A;  3C71 A;  3H8Q A;  4KUN A;  4EVM A;  1YEP A;  4N11 A;  4OO4 A;  2JSY A;  1AQX A;  4YAP A;  4ZBD A;  3VWU A;  5COH A;  4LLR A;  2FWE A;  1EP8 A;  4EKZ A;  3IBH A;  5B8A A;  4J2F A;  3V1W A;  5DDL A;  4ID0 A;  4WBR D;  3F9U A;  2V6K A;  4KA0 A;  1OC3 A;  3CYN A;  3H93 A;  4ECJ A;  1OYJ A;  2DML A;  2MYG A;  2H1B A;  1TRW A;  1I9D A;  2JL4 A;  2H1A A;  2HI7 A;  4POB A;  4RI7 A;  3GIX A;  3I43 A;  5IMC A;  2YZH A;  1SK1 A;  4XTS A;  2H8L A;  2FA8 A;  4TW5 A;  1TTZ A;  2FA4 A;  4JE1 A;  3D4M A;  3UL3 A;  2O87 A;  2C0F A;  4PQI A;  2WFC A;  3BBY A;  3UEM A;  3A2X A;  5IM9 A;  2F8A A;  2GDR A;  2IMD A;  4Q5Q A;  4CW9 A;  5DJL A;  16GS A;  5GZZ B;  3K8N A;  1IYI A;  1TRV A;  1EV9 A;  1U3I A;  2V2G A;  1A8Y A;  4J56 E;  6GST A;  3ERW A;  4LL4 B;  5EPF A;  1X9M B;  1VRS D;  1UVZ A;  5CRG A;  2VLV A;  3GYK A;  5G2Z A;  2VCW A;  4BA7 A;  1HNB A;  2H0G A;  1YF1 A;  5EL8 A;  4YQU A;  2IFQ B;  3IOS A;  4ZIL A;  5CRW A;  2B5Y A;  2GT6 A;  3EUR A;  1BAY A;  1ERW A;  1O8X A;  3HYP A;  2C3N A;  1X5C A;  4EDY A;  4KAE A;  3Q19 A;  3EYT A;  4NAX A;  2QSI A;  5B6N A;  5A4W A;  2EIR A;  1YZX A;  3LG6 A;  1RQM A;  3APS A;  4V1A p;  1JHB A;  5A4V A;  3MAK A;  2LJA A;  1DE1 A;  3FEU A;  4L8E A;  2LS5 A;  3PGT A;  4ZXG A;  3F3R A;  1XCC A;  2CX4 A;  4Q5R A;  3HJM A;  3U6V A;  5IMV A;  4OFN A;  1GSS A;  1VF1 A;  3NIV A;  4V1A g;  4N30 A;  2BJX A;  2YNX A;  4N0Z A;  2K6V A;  4OCE A;  1FO5 A;  5DAL A;  2DLX A;  3UIW A;  4XIH A;  5ECI B;  3N9J A;  4HJ2 A;  3O3T A;  1GTA A;  2K18 A;  3GRX A;  2CV4 A;  1J9B A;  1O7U A;  1TK0 B;  5D73 A;  1GUM A;  3CBU A;  3IHQ A;  1DBY A;  4IEL A;  2HE3 A;  3L9V A;  4F0B A;  2PER A;  2FLS A;  2F9S A;  5AN1 A;  1FVK A;  1OAZ A;  4MMM A;  4KW6 A;  3EU3 A;  2LEG A;  1Q98 A;  3PIN A;  5HFI A;  2PMT A;  4LMW A;  3TJB A;  1GSF A;  1ON4 A;  2VL2 C;  3ZIV A;  2JZR A;  2H30 A;  4ZBB A;  7GSS A;  4K6X A;  3VI5 A;  3GTU B;  2E2M A;  4TR4 A;  4HU7 A;  1DSB A;  1ZZY A;  5ENU A;  2GS3 A;  1TXX A;  5DJM A;  5IOW A;  1ZYE A;  3DRN A;  1WIK A;  2WZ9 A;  1GLP A;  1TK8 B;  3ZZX A;  3LGC A;  3APQ A;  2RM5 A;  3LOR A;  2NTO A;  1FB6 A;  4K8M A;  1TRU A;  1XWK A;  4TVE A;  1YJ6 A;  1AW9 A;  2L4C A;  3IC4 A;  2IJY A;  3M0F A;  4EUY A;  2LQQ A;  1B48 A;  1XW6 A;  5HR2 A;  3WYW A;  2XBI A;  1K3Y A;  4KSM A;  4K7N A;  5IPH A;  1OC9 B;  2YWN A;  5KN1 A;  2AAW A;  5IPG A;  4DSS A;  4E8E A;  1ZYQ B;  3QD9 A;  4EL1 A;  1B4Q A;  1MDJ A;  2OJL A;  3FZA A;  1BJX A;  4E8H A;  4WR5 A;  1SJ6 A;  4NXI A;  1O6J A;  3TKP A;  2AB6 A;  4EF0 A;  1E6B A;  3G7I A;  3VK9 A;  1T8E B;  1GUH A;  3F6F A;  3L9S A;  3DGQ A;  1AIU A;  2FD3 A;  2KHP A;  1SKR B;  1F9M A;  4JR4 A;  3O6T A;  3UJ1 A;  2C4J A;  1T3B A;  4EO3 A;  5ECO B;  1NHY A;  4MF6 A;  4CHS A;  4HQS A;  3HXS A;  4L0U A;  4ML6 A;  5JWQ B;  3UAP A;  4F03 A;  1XW9 A;  4I8B A;  4TKY A;  3QDN A;  3GL5 A;  2GQK A;  3KM6 A;  5F8B A;  3TDG A;  1PL1 A;  2DJ0 A;  2K9F A;  3F3Q A;  2MMN A;  2VL9 A;  2WDU A;  2VL3 A;  1NHO A;  2YWM A;  1G0T A;  3DXB A;  5AIV A;  4MZC A;  2R37 A;  1SJI A;  1K0B A;  5IMF A;  1SJZ A;  2ZNM A;  1EZK A;  2QC7 A;  4YQV A;  1Z3E A;  3FR3 A;  2L4Q A;  3G7J A;  2MBT A;  4LL1 B;  3LQ7 A;  1AUC A;  2YV9 A;  3TKS E;  2YWI A;  2XC2 A;  3TGZ A;  3HA9 A;  1O81 A;  3DML A;  2B1L A;  3P90 A;  4GSS A;  5DAK A;  4DVC A;  3TRQ A;  1A0R P;  5DCH A;  2C0G A;  1ILO A;  2KP2 A;  4IJI A;  3GV1 A;  3C73 A;  4G19 A;  1ERU A;  5CRE A;  1K0C A;  5JCG A;  1F6M C;  13GS A;  2YJ7 A;  2H70 A;  4XCS A;  2BMX A;  4PQ1 A; 
#chains in the Genus database with same CATH topology
 9GSS A;  2IPA A;  3IE3 A;  1ZOF A;  4TR3 A;  5D8I A;  3D0Z A;  1M2D A;  3LSZ A;  4Z2U A;  3ZYW A;  3G7Y A;  5ECP B;  2H6Z A;  4JED A;  5DCG A;  1ZMA A;  3ZTL A;  1K0N A;  2REM A;  1TKD B;  5ECM B;  1T7P B;  2C3Q A;  2HZE A;  3ZML A;  4RI6 A;  4X0X A;  2K8V A;  3GHA A;  1V9W A;  4EE0 A;  1A2M A;  1TP9 A;  3UMA A;  1Z6M A;  19GS A;  1W4V A;  2O8V B;  4BVX B;  4CDO A;  3CSH A;  1U87 A;  2P0G A;  1M2A A;  1MD4 A;  4I6X A;  1EOG A;  4G2E A;  3FZ5 A;  3ERF A;  1WJK A;  1F3A A;  4MJB A;  5B6M A;  2H1D A;  5H5R A;  2YJH A;  3GMF A;  3D21 A;  1WOU A;  3HVX A;  3KH7 A;  3IAS 2;  1XXU A;  5HR1 A;  22GS A;  4IP1 A;  4AF2 A;  3W8J A;  3TRX A;  1A24 A;  1WE0 A;  4IGJ A;  3WGE A;  2PN8 A;  3GL3 A;  4O5Q A;  2R4V A;  3PR8 A;  1FVJ A;  3F4R A;  1R5P A;  3EPT A;  3VLN A;  1OC8 A;  4ZL7 A;  2LKU A;  4HDE A;  3GKX A;  1SD9 A;  5IQY A;  1TJD A;  2UZ8 A;  3LFL A;  4XS6 A;  2L59 A;  4QL9 A;  5HR0 A;  4KE3 A;  4AJ6 A;  4GCI A;  4F9Z A;  2DC5 A;  1UN2 A;  2RII A;  5F05 A;  5AIS A;  4K1F A;  3HHV A;  4PUR A;  2CZ2 A;  5ELG A;  2HLS A;  2CQ9 A;  2GSS A;  1R7H A;  3ISO A;  1OKD A;  4KCE A;  4YKF A;  3F8U A;  1YKA A;  2XHF A;  2H72 A;  2EIO A;  2B7J A;  4POK A;  3O76 A;  2NBS A;  3ZFB A;  4MZB A;  1VF3 A;  4XHM A;  5H5S A;  2O7K A;  5G31 A;  1PL2 A;  1WPI A;  2OA7 A;  3I9V 2;  2CAQ A;  5C04 A;  4RQX A;  3FRC A;  3EWL A;  1O8W A;  3IDV A;  1LJR A;  4BL7 B;  5HR3 A;  2GZZ A;  1TI3 A;  3R2Q A;  3VI7 A;  4KF9 A;  4I5Q A;  4GRF A;  1J08 A;  1UA5 A;  3CSJ A;  1V98 A;  3VUR A;  4MJA A;  2EIQ A;  3KD0 A;  1PMT A;  2X8G A;  4ULX A;  2I81 A;  1T4Y A;  1C72 A;  4GLT A;  3ZIT A;  1SL1 B;  2HRA A;  4AJ7 A;  3RDW A;  5FHI A;  3WT1 A;  4TXO B;  2QGV A;  3D5J A;  2H0I A;  2G0F A;  2GST A;  4OFT A;  3MDK A;  5C00 A;  3F63 A;  3RPN A;  3ZMK A;  2R6K A;  5ABR A;  4D73 B;  4PNG A;  1AQV A;  4LA1 A;  4OFM A;  2LRT A;  4HOJ A;  1M9A A;  1A23 A;  1XG8 A;  3H4K A;  1M3I A;  2PVO C;  3L4N A;  4K7O A;  1K0A A;  5KEJ A;  5G1K A;  5AGY A;  3QOU A;  3GX8 A;  3TB2 A;  1GWC A;  2LRC A;  5EVO A;  5AIX A;  4WXT A;  4HZ4 A;  3ME7 A;  2H1G A;  1G6W A;  2A4V A;  5HQP A;  2YWO A;  3LYP A;  6GSV A;  4HZ2 A;  4L5O A;  3DEX A;  2RUE A;  1WRY A;  3NZN A;  1SL0 B;  2LRN A;  4KDU A;  5J5N A;  2R0P A;  2LJK A;  1V57 A;  4TR1 B;  1MTC A;  4NV2 A;  3AY8 A;  3TJG A;  3TRP A;  1JZO A;  4V2M A;  2VCT A;  1YY7 A;  2VAF A;  2JAC A;  1DUG A;  3HCZ A;  3QR6 A;  3LJR A;  1X0R A;  4I97 A;  5JCW A;  2GSQ A;  4POM A;  4FQU A;  1WWJ A;  2PPT A;  1MEK A;  2X49 A;  1K0O A;  4XRD A;  2J9H A;  4O92 A;  3KZQ A;  2CX3 A;  2DJJ A;  4BVY A;  3VFI A;  3P2A A;  4BPY A;  2VD1 A;  4BWS A;  2B5E A;  2F3M A;  2IMF A;  3KH9 A;  3HVS A;  4WKW A;  4IJ3 A;  3GSS A;  2CAI A;  4EXJ A;  2GT5 A;  3F4T A;  2M46 A;  3EMP A;  2X4A A;  3FW2 A;  2DKI A;  2O85 A;  1GSY A;  2F8F A;  3KGK A;  4G0I A;  2C3T A;  1QUW A;  1QGV A;  2N5A A;  3BJ5 A;  1AXD A;  4MDC A;  3IK7 A;  4XS4 A;  4GTU A;  4Z7X A;  2VLT A;  5KN2 A;  2JSZ A;  4HQZ A;  3EIN A;  4P3Y B;  1A2L A;  5CNW A;  1YF0 A;  4YAV A;  2R0G A;  2E0Q A;  3IHG A;  2JU5 A;  1OE7 A;  2KP1 A;  4GST A;  5DBQ A;  3IA1 A;  4MNN A;  5ID2 B;  1ZGN A;  3UVT A;  3RBT A;  4BIK A;  2E2G A;  2MMA A;  5IO0 A;  3BD2 A;  3HJP A;  1T4Z A;  4AJ8 A;  3FZ9 A;  2WB9 A;  3TOT A;  2GQM A;  4AGS A;  3QAG A;  2KUC A;  1PD2 1;  2LNS A;  2GLR A;  1S3D A;  3FYG A;  2DJ2 A;  4PGT A;  4O5R A;  3DD3 A;  3OR5 A;  3J7Y b;  1S3C A;  4DSQ A;  3FK8 A;  1Z7R A;  1N2A A;  2LUS A;  5F07 A;  1SL2 B;  4ISD A;  2PUK C;  5FWG A;  1G7E A;  2WGR A;  1F3B A;  4X4J A;  1QFN A;  3J7Y k;  3FHK A;  1M99 A;  2PU9 C;  1F2E A;  3VPT A;  3FR9 A;  3CTG A;  1JZD A;  3RHC A;  5DQY A;  3LWA A;  3VWV A;  2B1K A;  4CY6 A;  1NSW A;  3IC8 A;  2F51 A;  4K2X A;  2I4A A;  3I69 A;  4G9H A;  3KJY A;  6GSX A;  1Z6N A;  1SYX A;  2FHE A;  2HZF A;  1M2B A;  4HS1 A;  3QFA C;  3C7M A;  1VGL A;  1JLV A;  2AUV A;  4IQA A;  2OE1 A;  5F06 A;  4TOP A;  4BWQ A;  3HKR A;  2CVK A;  1I5G A;  4G0L A;  1USB A;  5EY6 A;  4KSO A;  4OWY A;  4NHZ A;  2VOC A;  3MWH A;  2IMK A;  1GL8 A;  2FWH A;  2NPB A;  2L57 A;  1ACV A;  3M9J A;  3IXR A;  5GAN D;  2XBQ A;  2DSA A;  3EU4 A;  1PN9 A;  1ERT A;  2AV4 A;  2I1U A;  2AJQ B;  1AAZ A;  2HXK A;  1VF2 A;  1BQ7 A;  2YV7 A;  2VM1 A;  4POL A;  3E3E A;  1CQH A;  3JCM L;  1XOA A;  5CYY A;  1T1V A;  3MSZ A;  18GS A;  4JU5 A;  2V41 A;  2IFQ A;  5H5Q A;  2QKE A;  4KB3 A;  4FH8 A;  1JZW A;  5CO3 A;  1XWA A;  4MF5 A;  4EDZ A;  3ZRE A;  1K3O A;  4MLY A;  3Q74 A;  2DJ1 A;  3F6D A;  2DBC A;  1PKW A;  4F0C A;  2LQO A;  4PNF A;  3IAM 2;  4PXO A;  2FUG 2;  3F0I A;  4H86 A;  3GH9 A;  1PQN A;  4MH3 A;  3P8W A;  2FWF A;  2M80 A;  1TDI A;  1SK0 A;  2X99 A;  2IIY A;  5D9X A;  1THX A;  5G1L A;  2ON7 A;  2GSR A;  1TU7 A;  2HSY A;  1GNE A;  3ZLP A;  2R5G A;  2NDO A;  3ZIJ A;  1TI1 A;  3FZ4 A;  4IBP A;  3L9U A;  5G5E A;  4Q5F A;  1CQG A;  1FOV A;  1GRX A;  2GZY A;  5GAP D;  2VO4 A;  5IMD A;  2HT9 A;  1EWX A;  6GSU A;  1A0F A;  5J9C A;  2YCD A;  1GTU A;  2HSH A;  1GSE A;  2YP6 A;  4PQH A;  5DQS A;  3HY2 A;  1KBN A;  1U3A A;  5DAL B;  2ON5 A;  2C80 A;  3GNJ A;  1B9Y C;  4ML1 A;  4HUA A;  3UVH A;  4G10 A;  3C8E A;  2IL3 A;  2OAD A;  4JBB A;  1S3A A;  4V2N A;  2OBK A;  2AHE A;  5J9B A;  3HD5 A;  4IQ1 A;  3M8N A;  4K0G A;  4WR4 A;  2KOK A;  2C1Y A;  1SYR A;  3KIJ A;  2FWG A;  3HZ8 A;  3A5W A;  4N0V A;  4V2L A;  3DYR A;  3GH6 A;  4RUV A;  4MPG A;  2JZT A;  2L6D A;  2YPM A;  1DE2 A;  1GP1 A;  1HYU A;  3GTU A;  3W8S A;  2IMI A;  2PWJ A;  1R5A A;  1H75 A;  5KOW A;  1X9W B;  1JFU A;  4GF0 A;  1PX6 A;  1LBK A;  1R26 A;  2MBS A;  4EIP A;  4WBJ A;  4F2I A;  1FHE A;  1SEN A;  1XWB A;  2RUF A;  2X8H A;  4ZB6 A;  2P5R A;  4ZL9 A;  3EMX A;  5ECS A;  3HVV A;  4IW9 A;  1EOH A;  1XWC A;  4PUF C;  2B7K A;  2Z9S A;  1KTE A;  2PVQ A;  2N5B A;  1KNG A;  1W89 A;  4I2U A;  2XPE A;  4PX1 A;  1TOF A;  5ECH B;  3ZVJ A;  4ZBA A;  2YAN A;  3ERG A;  2ZUP A;  1OC9 A;  2WUL A;  3CTF A;  4NHW A;  1XOB A;  3N5O A;  2GZP A;  5KN3 A;  2VLU A;  4YKG A;  4GWR A;  1R4W A;  3QPM A;  4FYC A;  1BED A;  4DSS B;  1N8J A;  2V1M A;  1PFO A;  2RM6 A;  3RHB A;  3W6G A;  4NPB A;  2MMZ A;  4N10 A;  4L5L A;  2OAC A;  4L0W A;  4OO5 A;  4HEA 2;  4MCU A;  3TKS A;  2H66 A;  1XBS A;  1GTI A;  1XFL A;  5HFG A;  4USS A;  2CT6 A;  1TU8 A;  1FAA A;  2R3X A;  1PGT A;  4TXV A;  1GSD A;  1GUL A;  3CRT A;  2L5L A;  4WF4 A;  2VCX A;  3PPU A;  4QL7 A;  5E59 A;  3RAZ A;  2DKH A;  1VF4 A;  1HQO A;  4MJC A;  3GKK A;  5G5F A;  3VWW A;  1B4P A;  2H71 A;  1M0U A;  3KMN A;  3KXO A;  5G30 A;  1ML6 A;  3TUE A;  3RPP A;  1IYH A;  1YKC A;  2OE3 A;  3WT2 A;  1FB0 A;  2YN1 A;  3DKS A;  5A5K A;  1V40 A;  1MD3 A;  2XPD A;  4XRA A;  1Q4J A;  4MP4 A;  3S9F A;  5L71 A;  3U5R E;  4WF5 A;  2WCI A;  4IS0 A;  2VUP A;  1JLW A;  2C0D A;  1EGO A;  5B7C A;  4XS1 A;  2CVB A;  1B8X A;  2H0H A;  4WET A;  2E7P A;  4ECI A;  2M72 A;  3VWX A;  2DJK A;  3MNG A;  2CZ3 A;  2DIZ A;  5D9T A;  1QXH A;  4A5P A;  5J41 A;  3UBK A;  3Q18 A;  2B3S A;  3FR6 A;  1E2Y A;  1B9X C;  4IVF A;  3CMI A;  3G9B A;  3QCP A;  2H73 A;  4ECC A;  3EC3 A;  5DAK B;  2P31 A;  5D9W A;  3M1G A;  3ED3 A;  3A2W A;  1X5E A;  1M3J A;  2HFD A;  3TJF A;  3SBC A;  2G2Q A;  2P5Q A;  2A2S A;  2EC4 A;  3UOM A;  1H4O A;  3KP9 A;  1J0F A;  3H1N A;  2VCZ A;  1K0D A;  1PX7 A;  3ZL5 A;  2X8C A;  1Y25 A;  3LYK A;  1GLQ A;  1HD2 A;  2LNT A;  4OCF A;  4O7H A;  3LXT A;  4ZB8 A;  1NM3 A;  2MMO A;  3EVI A;  2H76 A;  4IKH A;  2OE0 A;  3TKR A;  4FO5 A;  4FYB A;  5J4U A;  2NVL A;  2KLX A;  2C0E A;  4MZW A;  1XIY A;  3D6I A;  2IME A;  1YQ1 A;  2HZE B;  4MJE A;  5DVB A;  2H19 A;  1HNA A;  1OVN A;  1M7T A;  2BTO T;  4NWY A;  3D22 A;  2FY6 A;  2MZC A;  4KGI A;  1MDK A;  4JR6 A;  4BVX A;  3GST A;  4MAB A;  3TCO A;  12GS A;  2VCQ A;  1JZR A;  1PA3 A;  3D4T A;  3IR4 A;  8GSS A;  1V2A A;  1OKT A;  5J3R A;  2LST A;  3DIE A;  3MYD A;  1XPV A;  3GKM A;  2FGX A;  3KTL A;  1GSQ A;  4HU9 A;  3CSI A;  3L78 A;  5FT3 A;  2L6C A;  2DMM A;  1GH2 A;  1Y6E A;  1K0M A;  3IV4 A;  2R2J A;  4GXZ A;  3KP8 A;  3UAR A;  4MPF A;  3DVW A;  3Q6O A;  4PUA A;  1THO A;  2TRX A;  3E0U A;  5GSS A;  3LXZ A;  1XW5 A;  4ECB A;  20GS A;  1BYE A;  5B8B A;  4NMU A;  2QA2 A;  3NOF A;  1PSQ A;  5IMA A;  3QAV A;  5D96 A;  4ZL8 A;  4EIQ A;  2GTU A;  2RLI A;  3GKN A;  2DJ3 A;  2AYT A;  2B6M A;  1YEX A;  1U6T A;  2HSM A;  3GUR A;  1X9S B;  2JAD A;  2HYX A;  2LJR A;  3DVX A;  1U88 A;  1ERV A;  3H79 A;  1G7O A;  2D2Z A;  2HRK A;  4DEJ A;  17GS A;  6GSW A;  3M9K A;  4MA9 A;  4I2T A;  1QMV A;  3F4S A;  3ZFL A;  4JZQ A;  1FW1 A;  3CRU A;  5JCU A;  1NW2 A;  4Z2R A;  1G6Y A;  3VPQ A;  1HNC A;  4QQ7 A;  1M9B A;  3I6A A;  5CRH A;  4BL7 A;  3FY7 A;  1Z7P A;  1A8L A;  4MF7 A;  2V32 A;  4K2D A;  1SKS B;  4K0N A;  1O73 A;  4KX4 A;  3L0H A;  1TK5 B;  2J23 A;  1GNW A;  2A2P A;  2H74 A;  2CA8 A;  2GQL A;  3ZVJ D;  2GGT A;  2H6X A;  2VD0 A;  5IO2 A;  1ST9 A;  2FCH A;  4GQF A;  1EEJ A;  3KMO A;  1EGR A;  2L5O A;  1Z5Y E;  5ECN B;  5IOX A;  4O32 A;  3WGX A;  1LU4 A;  3APO A;  3EE2 A;  1WMJ A;  1YDK A;  1ABA A;  1ZL9 A;  4TXO A;  5INY A;  4ICY A;  2VCV A;  6GSY A;  1FG4 A;  2X64 A;  3BCI A;  3TKS C;  2C8U A;  2H6Y A;  1K3L A;  4X43 A;  4HSC X;  3C1R A;  3UBL A;  3A3T A;  5ECQ B;  5A4U A;  4D73 A;  2CVD A;  1EEM A;  3HVN A;  4NV5 A;  3TKQ A;  3DWV A;  5IMZ A;  2HRF A;  4WEY A;  3LW9 A;  6GSS A;  1XZO A;  5ECK B;  1AC1 A;  5HFK A;  1EV4 A;  3CQF A;  4O5U A;  2OKA A;  5LD0 A;  3IK9 A;  2LV3 A;  3QMX A;  4ZB9 A;  2VIM A;  1BG5 A;  3QFB C;  1PN0 A;  4F82 A;  3KCM A;  4KND A;  2HNL A;  1EP7 A;  1KEB A;  5CRD A;  5ECR B;  1SKW B;  4ACS A;  3WD6 A;  1RW1 A;  5D93 A;  2V6O A;  5JWR B;  5E4W A;  4RQR A;  5ELA A;  4TRX A;  1UC7 A;  2A2R A;  4TR1 A;  3HJO A;  2TRC P;  3C1S A;  3BOA A;  1T00 A;  2K8S A;  3FMW A;  3GUS A;  1GSU A;  4ILF A;  3GA4 A;  1BX9 A;  2ALB A;  3KEB A;  4HJM A;  3FKF A;  1XVW A;  4MH2 A;  2WS2 A;  4IHU A;  4K7I A;  4GSN A;  5F0G A;  1Z9H A;  2LTK A;  1FOH A;  2H75 A;  5IIZ A;  2ES7 A;  1WP0 A;  1ZCP A;  4KCA A;  2I9H A;  1AQW A;  1F37 A;  4MK3 A;  5D9V A;  4HI7 A;  4KDX A;  5ECL B;  4BVY B;  2TIR A;  2OBI A;  10GS A;  4GQC A;  4OMV A;  4FIW A;  4J57 E;  2I3Y A;  2WRT A;  2VL2 A;  4LMV A;  3M3M A;  1X5D A;  4CY8 A;  4K9Z A;  3WGD A;  3GFK A;  3BCK A;  3IRA A;  1GUK A;  4IP6 A;  3P7X A;  3TOU A;  1A2J A;  4IN0 A;  4EC0 A;  2H01 A;  1QK8 A;  1QQ2 A;  3LEF A;  3GX0 A;  4ZIJ A;  3HDC A;  2IN3 A;  4OD7 A;  5KN0 A;  1MDI A;  4XS4 B;  11GS A;  1PKZ A;  2PGT A;  1TRS A;  3CXG A;  1TW9 A;  1XWG A;  3HZ4 A;  3PH9 A;  4Z2T A;  4YQM A;  5ID2 A;  1PRX A;  1GTB A;  1RK4 A;  2JZS A;  5GST A;  4KDY A;  2DIY A;  4TN8 A;  3TJJ A;  5LCZ A;  1O85 A;  5JWO B;  2PBJ A;  3ME8 A;  5CP1 A;  3TJK A;  3ZRD A;  3A2V A;  3E9J B;  2HRN A;  2GVP A;  3IPZ A;  3KTB A;  2B5X A;  3SWL A;  2YZU A;  2N5F A;  5CAX A;  2WJU A;  1SD8 A;  4JRR A;  4FYU A;  4DSR A;  5KOX A;  1XVQ A;  3R3E A;  3QAW A;  1SU9 A;  2VM2 A;  1V58 A;  4X1U A;  4TR0 A;  1URM A;  4Q5N A;  2YOI A;  14GS A;  3GN3 A;  2IWT A;  2R0C A;  4YH2 A;  1OE8 A;  5LNK e;  1SK2 A;  2O89 A;  4KH7 A;  2ZCT A;  2FNO A;  3US3 A;  3C71 A;  3H8Q A;  4KUN A;  4EVM A;  1YEP A;  4N11 A;  4OO4 A;  2JSY A;  1AQX A;  4YAP A;  4ZBD A;  3VWU A;  5BMU A;  5COH A;  4LLR A;  2FWE A;  1EP8 A;  4EKZ A;  3IBH A;  5B8A A;  4J2F A;  3V1W A;  5DDL A;  4ID0 A;  4WBR D;  3F9U A;  2V6K A;  4KA0 A;  1OC3 A;  3CYN A;  3H93 A;  4ECJ A;  1OYJ A;  2DML A;  2MYG A;  5BRT A;  2H1B A;  1TRW A;  1I9D A;  2JL4 A;  2H1A A;  2HI7 A;  4POB A;  4RI7 A;  3GIX A;  3I43 A;  5IMC A;  2YZH A;  1SK1 A;  4XTS A;  2H8L A;  2FA8 A;  4TW5 A;  1TTZ A;  2FA4 A;  4JE1 A;  3D4M A;  3UL3 A;  2O87 A;  2C0F A;  1ZYP A;  4PQI A;  2WFC A;  3BBY A;  3UEM A;  3A2X A;  5IM9 A;  4PTS A;  2F8A A;  2GDR A;  2IMD A;  4Q5Q A;  4CW9 A;  5DJL A;  16GS A;  5GZZ B;  3K8N A;  1IYI A;  1TRV A;  1EV9 A;  1U3I A;  2V2G A;  1A8Y A;  4J56 E;  6GST A;  3ERW A;  4LL4 B;  5EPF A;  1X9M B;  1VRS D;  1UVZ A;  5CRG A;  2VLV A;  3GYK A;  5G2Z A;  2VCW A;  4BA7 A;  1HNB A;  2H0G A;  1YF1 A;  2QA1 A;  5EL8 A;  4YQU A;  2IFQ B;  3IOS A;  4ZIL A;  5CRW A;  2B5Y A;  2GT6 A;  3EUR A;  1BAY A;  1ERW A;  1O8X A;  3HYP A;  2C3N A;  1X5C A;  4EDY A;  4KAE A;  3Q19 A;  3EYT A;  4NAX A;  2QSI A;  5B6N A;  5A4W A;  2EIR A;  1YZX A;  3LG6 A;  1RQM A;  3APS A;  4K5S A;  4V1A p;  1JHB A;  5A4V A;  3MAK A;  2LJA A;  1DE1 A;  3FEU A;  4L8E A;  2LS5 A;  3PGT A;  4ZXG A;  3F3R A;  1XCC A;  2CX4 A;  4Q5R A;  3HJM A;  3U6V A;  5IMV A;  4OFN A;  1GSS A;  1VF1 A;  3NIV A;  4V1A g;  4N30 A;  2BJX A;  2YNX A;  4N0Z A;  2K6V A;  4OCE A;  1FO5 A;  5DAL A;  2DLX A;  3UIW A;  4XIH A;  5ECI B;  3N9J A;  4HJ2 A;  3O3T A;  1GTA A;  2K18 A;  3GRX A;  2CV4 A;  1J9B A;  1O7U A;  1TK0 B;  5D73 A;  1GUM A;  3CBU A;  3IHQ A;  1DBY A;  4IEL A;  2HE3 A;  3L9V A;  4F0B A;  2PER A;  2FLS A;  2F9S A;  5AN1 A;  1FVK A;  1OAZ A;  4MMM A;  4KW6 A;  3EU3 A;  2LEG A;  1Q98 A;  3PIN A;  5HFI A;  2PMT A;  4LMW A;  3TJB A;  1GSF A;  1ON4 A;  2VL2 C;  3ZIV A;  2JZR A;  2H30 A;  4ZBB A;  7GSS A;  4K6X A;  3VI5 A;  3GTU B;  2E2M A;  4TR4 A;  4HU7 A;  1DSB A;  1ZZY A;  2GS3 A;  5ENU A;  1TXX A;  5DJM A;  5IOW A;  1ZYE A;  3DRN A;  1WIK A;  2WZ9 A;  1GLP A;  1TK8 B;  3ZZX A;  3LGC A;  3APQ A;  2RM5 A;  3LOR A;  2NTO A;  1FB6 A;  4K8M A;  1TRU A;  2A4H A;  1XWK A;  4TVE A;  1YJ6 A;  1AW9 A;  2L4C A;  3IC4 A;  2IJY A;  3M0F A;  4EUY A;  2LQQ A;  1B48 A;  1XW6 A;  1S3R A;  5HR2 A;  3WYW A;  2XBI A;  1K3Y A;  4KSM A;  4K5R A;  4K7N A;  5IPH A;  1OC9 B;  2YWN A;  5KN1 A;  2AAW A;  5IPG A;  4DSS A;  4E8E A;  1ZYQ B;  3QD9 A;  4EL1 A;  1B4Q A;  1MDJ A;  2OJL A;  3FZA A;  1BJX A;  4E8H A;  4WR5 A;  1SJ6 A;  4G0K A;  4NXI A;  1O6J A;  3TKP A;  2AB6 A;  4EF0 A;  1E6B A;  3G7I A;  3VK9 A;  1T8E B;  1GUH A;  3F6F A;  3L9S A;  3DGQ A;  1AIU A;  2FD3 A;  2KHP A;  1SKR B;  1F9M A;  4JR4 A;  3O6T A;  3UJ1 A;  2C4J A;  3A5I A;  1T3B A;  3MIX A;  4EO3 A;  5ECO B;  1NHY A;  4MF6 A;  4CHS A;  4HQS A;  3HXS A;  4L0U A;  4ML6 A;  5JWQ B;  3UAP A;  4F03 A;  1XW9 A;  4I8B A;  4TKY A;  3QDN A;  3GL5 A;  2GQK A;  3KM6 A;  5F8B A;  3TDG A;  1PL1 A;  2DJ0 A;  2K9F A;  3F3Q A;  2MMN A;  2VL9 A;  2WDU A;  2VL3 A;  1NHO A;  2YWM A;  1G0T A;  3DXB A;  5AIV A;  4MZC A;  2R37 A;  1SJI A;  1K0B A;  5IMF A;  1SJZ A;  2ZNM A;  1EZK A;  2QC7 A;  4YQV A;  1Z3E A;  3FR3 A;  2L4Q A;  3G7J A;  2MBT A;  4LL1 B;  3LQ7 A;  1AUC A;  2YV9 A;  3TKS E;  2YWI A;  2XC2 A;  3TGZ A;  3HA9 A;  1O81 A;  3DML A;  2B1L A;  3P90 A;  4GSS A;  5DAK A;  4DVC A;  3TRQ A;  1A0R P;  5DCH A;  2C0G A;  1ILO A;  2KP2 A;  4IJI A;  3GV1 A;  3C73 A;  4G19 A;  1ERU A;  5CRE A;  1K0C A;  5JCG A;  1F6M C;  13GS A;  2YJ7 A;  2H70 A;  4XCS A;  2BMX A;  4PQ1 A;  1ZYN A; 
#chains in the Genus database with same CATH homology
 9GSS A;  2IPA A;  3IE3 A;  1ZOF A;  4TR3 A;  5D8I A;  3D0Z A;  1M2D A;  3LSZ A;  4Z2U A;  3ZYW A;  3G7Y A;  5ECP B;  2H6Z A;  4JED A;  5DCG A;  1ZMA A;  3ZTL A;  1K0N A;  2REM A;  1TKD B;  5ECM B;  1T7P B;  2C3Q A;  2HZE A;  3ZML A;  4RI6 A;  4X0X A;  2K8V A;  3GHA A;  1V9W A;  4EE0 A;  1A2M A;  1TP9 A;  3UMA A;  1Z6M A;  19GS A;  1W4V A;  2O8V B;  4BVX B;  4CDO A;  3CSH A;  1U87 A;  2P0G A;  1M2A A;  1MD4 A;  4I6X A;  1EOG A;  4G2E A;  3FZ5 A;  3ERF A;  1WJK A;  1F3A A;  4MJB A;  5B6M A;  2H1D A;  5H5R A;  2YJH A;  3GMF A;  3D21 A;  1WOU A;  3HVX A;  3KH7 A;  3IAS 2;  1XXU A;  5HR1 A;  22GS A;  4IP1 A;  4AF2 A;  3W8J A;  3TRX A;  1A24 A;  1WE0 A;  4IGJ A;  3WGE A;  2PN8 A;  3GL3 A;  4O5Q A;  2R4V A;  3PR8 A;  1FVJ A;  3F4R A;  1R5P A;  3EPT A;  3VLN A;  1OC8 A;  4ZL7 A;  2LKU A;  4HDE A;  3GKX A;  1SD9 A;  5IQY A;  1TJD A;  2UZ8 A;  3LFL A;  4XS6 A;  2L59 A;  4QL9 A;  5HR0 A;  4KE3 A;  4AJ6 A;  4GCI A;  4F9Z A;  2DC5 A;  1UN2 A;  2RII A;  5F05 A;  5AIS A;  4K1F A;  3HHV A;  4PUR A;  2CZ2 A;  5ELG A;  2HLS A;  2CQ9 A;  2GSS A;  1R7H A;  3ISO A;  1OKD A;  4KCE A;  4YKF A;  3F8U A;  1YKA A;  2XHF A;  2H72 A;  2EIO A;  2B7J A;  4POK A;  3O76 A;  2NBS A;  3ZFB A;  4MZB A;  1VF3 A;  4XHM A;  5H5S A;  2O7K A;  5G31 A;  1PL2 A;  1WPI A;  2OA7 A;  3I9V 2;  2CAQ A;  5C04 A;  4RQX A;  3FRC A;  3EWL A;  1O8W A;  3IDV A;  1LJR A;  4BL7 B;  5HR3 A;  2GZZ A;  1TI3 A;  3R2Q A;  3VI7 A;  4KF9 A;  4I5Q A;  4GRF A;  1J08 A;  1UA5 A;  3CSJ A;  1V98 A;  3VUR A;  4MJA A;  2EIQ A;  3KD0 A;  1PMT A;  2X8G A;  4ULX A;  2I81 A;  1T4Y A;  1C72 A;  4GLT A;  3ZIT A;  1SL1 B;  2HRA A;  4AJ7 A;  3RDW A;  5FHI A;  3WT1 A;  4TXO B;  2QGV A;  3D5J A;  2H0I A;  2G0F A;  2GST A;  4OFT A;  3MDK A;  5C00 A;  3F63 A;  3RPN A;  3ZMK A;  2R6K A;  5ABR A;  4D73 B;  4PNG A;  1AQV A;  4LA1 A;  4OFM A;  2LRT A;  4HOJ A;  1M9A A;  1A23 A;  3H4K A;  2PVO C;  3L4N A;  4K7O A;  1K0A A;  5KEJ A;  5G1K A;  5AGY A;  3QOU A;  3GX8 A;  3TB2 A;  1GWC A;  2LRC A;  5EVO A;  5AIX A;  4WXT A;  4HZ4 A;  3ME7 A;  2H1G A;  1G6W A;  2A4V A;  5HQP A;  2YWO A;  3LYP A;  6GSV A;  4HZ2 A;  4L5O A;  3DEX A;  2RUE A;  1WRY A;  3NZN A;  1SL0 B;  2LRN A;  4KDU A;  5J5N A;  2R0P A;  2LJK A;  1V57 A;  4TR1 B;  1MTC A;  4NV2 A;  3AY8 A;  3TJG A;  3TRP A;  1JZO A;  4V2M A;  2VCT A;  1YY7 A;  2VAF A;  2JAC A;  1DUG A;  3HCZ A;  3QR6 A;  3LJR A;  1X0R A;  4I97 A;  5JCW A;  2GSQ A;  4POM A;  4FQU A;  1WWJ A;  2PPT A;  1MEK A;  2X49 A;  1K0O A;  4XRD A;  2J9H A;  4O92 A;  3KZQ A;  2CX3 A;  2DJJ A;  4BVY A;  3VFI A;  3P2A A;  4BPY A;  2VD1 A;  4BWS A;  2B5E A;  2F3M A;  2IMF A;  3KH9 A;  3HVS A;  4WKW A;  4IJ3 A;  3GSS A;  2CAI A;  4EXJ A;  2GT5 A;  3F4T A;  2M46 A;  3EMP A;  2X4A A;  3FW2 A;  2DKI A;  2O85 A;  1GSY A;  2F8F A;  3KGK A;  4G0I A;  2C3T A;  1QUW A;  1QGV A;  2N5A A;  3BJ5 A;  1AXD A;  4MDC A;  3IK7 A;  4XS4 A;  4GTU A;  4Z7X A;  2VLT A;  5KN2 A;  2JSZ A;  4HQZ A;  3EIN A;  4P3Y B;  1A2L A;  5CNW A;  1YF0 A;  4YAV A;  2R0G A;  2E0Q A;  3IHG A;  2JU5 A;  1OE7 A;  2KP1 A;  4GST A;  5DBQ A;  3IA1 A;  4MNN A;  5ID2 B;  1ZGN A;  3UVT A;  3RBT A;  2E2G A;  2MMA A;  5IO0 A;  3BD2 A;  3HJP A;  1T4Z A;  4AJ8 A;  3FZ9 A;  2WB9 A;  3TOT A;  2GQM A;  4AGS A;  3QAG A;  2KUC A;  1PD2 1;  2LNS A;  2GLR A;  1S3D A;  3FYG A;  2DJ2 A;  4PGT A;  4O5R A;  3DD3 A;  3OR5 A;  3J7Y b;  1S3C A;  4DSQ A;  3FK8 A;  1Z7R A;  1N2A A;  2LUS A;  5F07 A;  1SL2 B;  4ISD A;  2PUK C;  5FWG A;  1G7E A;  2WGR A;  1F3B A;  4X4J A;  1QFN A;  3J7Y k;  3FHK A;  1M99 A;  2PU9 C;  1F2E A;  3VPT A;  3FR9 A;  3CTG A;  1JZD A;  3RHC A;  5DQY A;  3LWA A;  3VWV A;  2B1K A;  4CY6 A;  1NSW A;  3IC8 A;  2F51 A;  4K2X A;  2I4A A;  3I69 A;  4G9H A;  3KJY A;  6GSX A;  1Z6N A;  1SYX A;  2FHE A;  2HZF A;  1M2B A;  4HS1 A;  3QFA C;  3C7M A;  1VGL A;  1JLV A;  2AUV A;  4IQA A;  2OE1 A;  5F06 A;  4TOP A;  4BWQ A;  3HKR A;  2CVK A;  1I5G A;  4G0L A;  1USB A;  5EY6 A;  4KSO A;  4OWY A;  4NHZ A;  2VOC A;  3MWH A;  2IMK A;  1GL8 A;  2FWH A;  2NPB A;  2L57 A;  1ACV A;  3M9J A;  3IXR A;  5GAN D;  2XBQ A;  2DSA A;  3EU4 A;  1PN9 A;  1ERT A;  2AV4 A;  2I1U A;  2AJQ B;  1AAZ A;  2HXK A;  1VF2 A;  1BQ7 A;  2YV7 A;  2VM1 A;  4POL A;  3E3E A;  1CQH A;  3JCM L;  1XOA A;  5CYY A;  1T1V A;  3MSZ A;  18GS A;  4JU5 A;  2V41 A;  2IFQ A;  5H5Q A;  2QKE A;  4KB3 A;  4FH8 A;  1JZW A;  5CO3 A;  1XWA A;  4MF5 A;  4EDZ A;  3ZRE A;  1K3O A;  4MLY A;  3Q74 A;  2DJ1 A;  3F6D A;  2DBC A;  1PKW A;  4F0C A;  2LQO A;  4PNF A;  3IAM 2;  4PXO A;  2FUG 2;  3F0I A;  4H86 A;  3GH9 A;  1PQN A;  4MH3 A;  3P8W A;  2FWF A;  2M80 A;  1TDI A;  1SK0 A;  2X99 A;  2IIY A;  5D9X A;  1THX A;  5G1L A;  2ON7 A;  2GSR A;  1TU7 A;  2HSY A;  1GNE A;  3ZLP A;  2R5G A;  2NDO A;  3ZIJ A;  1TI1 A;  3FZ4 A;  4IBP A;  3L9U A;  5G5E A;  4Q5F A;  1CQG A;  1FOV A;  1GRX A;  2GZY A;  5GAP D;  2VO4 A;  5IMD A;  2HT9 A;  1EWX A;  6GSU A;  1A0F A;  5J9C A;  2YCD A;  1GTU A;  2HSH A;  1GSE A;  2YP6 A;  4PQH A;  5DQS A;  3HY2 A;  1KBN A;  1U3A A;  5DAL B;  2ON5 A;  2C80 A;  3GNJ A;  1B9Y C;  4ML1 A;  4HUA A;  3UVH A;  4G10 A;  3C8E A;  2IL3 A;  2OAD A;  4JBB A;  1S3A A;  4V2N A;  2OBK A;  2AHE A;  5J9B A;  3HD5 A;  4IQ1 A;  3M8N A;  4K0G A;  4WR4 A;  2KOK A;  2C1Y A;  1SYR A;  3KIJ A;  2FWG A;  3HZ8 A;  3A5W A;  4N0V A;  4V2L A;  3DYR A;  3GH6 A;  4RUV A;  4MPG A;  2JZT A;  2L6D A;  2YPM A;  1DE2 A;  1GP1 A;  1HYU A;  3GTU A;  3W8S A;  2IMI A;  2PWJ A;  1R5A A;  1H75 A;  5KOW A;  1X9W B;  1JFU A;  4GF0 A;  1PX6 A;  1LBK A;  1R26 A;  2MBS A;  4EIP A;  4WBJ A;  4F2I A;  1FHE A;  1SEN A;  1XWB A;  2RUF A;  2X8H A;  4ZB6 A;  2P5R A;  4ZL9 A;  3EMX A;  5ECS A;  3HVV A;  4IW9 A;  1EOH A;  1XWC A;  4PUF C;  2B7K A;  2Z9S A;  1KTE A;  2PVQ A;  2N5B A;  1KNG A;  1W89 A;  4I2U A;  2XPE A;  4PX1 A;  1TOF A;  5ECH B;  3ZVJ A;  4ZBA A;  2YAN A;  3ERG A;  2ZUP A;  1OC9 A;  2WUL A;  3CTF A;  4NHW A;  1XOB A;  3N5O A;  2GZP A;  5KN3 A;  2VLU A;  4YKG A;  4GWR A;  1R4W A;  3QPM A;  4FYC A;  1BED A;  4DSS B;  1N8J A;  2V1M A;  2RM6 A;  3RHB A;  3W6G A;  4NPB A;  2MMZ A;  4N10 A;  4L5L A;  2OAC A;  4L0W A;  4OO5 A;  4HEA 2;  4MCU A;  3TKS A;  2H66 A;  1XBS A;  1GTI A;  1XFL A;  5HFG A;  4USS A;  2CT6 A;  1TU8 A;  1FAA A;  2R3X A;  1PGT A;  4TXV A;  1GSD A;  1GUL A;  3CRT A;  2L5L A;  4WF4 A;  2VCX A;  3PPU A;  4QL7 A;  5E59 A;  3RAZ A;  2DKH A;  1VF4 A;  1HQO A;  4MJC A;  3GKK A;  5G5F A;  3VWW A;  1B4P A;  2H71 A;  1M0U A;  3KMN A;  3KXO A;  5G30 A;  1ML6 A;  3TUE A;  3RPP A;  1IYH A;  1YKC A;  2OE3 A;  3WT2 A;  1FB0 A;  2YN1 A;  3DKS A;  5A5K A;  1V40 A;  1MD3 A;  2XPD A;  4XRA A;  1Q4J A;  4MP4 A;  3S9F A;  5L71 A;  3U5R E;  4WF5 A;  2WCI A;  4IS0 A;  2VUP A;  1JLW A;  2C0D A;  1EGO A;  5B7C A;  4XS1 A;  2CVB A;  1B8X A;  2H0H A;  4WET A;  2E7P A;  4ECI A;  2M72 A;  3VWX A;  2DJK A;  3MNG A;  2CZ3 A;  2DIZ A;  5D9T A;  1QXH A;  4A5P A;  5J41 A;  3UBK A;  3Q18 A;  2B3S A;  3FR6 A;  1E2Y A;  1B9X C;  4IVF A;  3CMI A;  3G9B A;  3QCP A;  2H73 A;  4ECC A;  3EC3 A;  5DAK B;  2P31 A;  5D9W A;  3M1G A;  3ED3 A;  3A2W A;  1X5E A;  2HFD A;  3TJF A;  3SBC A;  2G2Q A;  2P5Q A;  2A2S A;  2EC4 A;  3UOM A;  1H4O A;  3KP9 A;  1J0F A;  3H1N A;  2VCZ A;  1K0D A;  1PX7 A;  3ZL5 A;  2X8C A;  1Y25 A;  3LYK A;  1GLQ A;  1HD2 A;  2LNT A;  4OCF A;  4O7H A;  3LXT A;  4ZB8 A;  1NM3 A;  2MMO A;  3EVI A;  2H76 A;  4IKH A;  2OE0 A;  3TKR A;  4FO5 A;  4FYB A;  5J4U A;  2NVL A;  2KLX A;  2C0E A;  4MZW A;  1XIY A;  3D6I A;  2IME A;  1YQ1 A;  2HZE B;  4MJE A;  5DVB A;  2H19 A;  1HNA A;  1OVN A;  1M7T A;  2BTO T;  4NWY A;  3D22 A;  2FY6 A;  2MZC A;  4KGI A;  1MDK A;  4JR6 A;  4BVX A;  3GST A;  4MAB A;  3TCO A;  12GS A;  2VCQ A;  1JZR A;  1PA3 A;  3D4T A;  3IR4 A;  8GSS A;  1V2A A;  1OKT A;  5J3R A;  2LST A;  3DIE A;  3MYD A;  1XPV A;  3GKM A;  2FGX A;  3KTL A;  1GSQ A;  4HU9 A;  3CSI A;  3L78 A;  5FT3 A;  2L6C A;  2DMM A;  1GH2 A;  1Y6E A;  1K0M A;  3IV4 A;  2R2J A;  4GXZ A;  3KP8 A;  3UAR A;  4MPF A;  3DVW A;  3Q6O A;  4PUA A;  1THO A;  2TRX A;  3E0U A;  5GSS A;  3LXZ A;  1XW5 A;  4ECB A;  20GS A;  1BYE A;  5B8B A;  4NMU A;  2QA2 A;  3NOF A;  1PSQ A;  5IMA A;  3QAV A;  5D96 A;  4ZL8 A;  4EIQ A;  2GTU A;  2RLI A;  3GKN A;  2DJ3 A;  2AYT A;  2B6M A;  1YEX A;  1U6T A;  2HSM A;  3GUR A;  1X9S B;  2JAD A;  2HYX A;  2LJR A;  3DVX A;  1U88 A;  1ERV A;  3H79 A;  1G7O A;  2D2Z A;  2HRK A;  4DEJ A;  17GS A;  6GSW A;  3M9K A;  4MA9 A;  4I2T A;  1QMV A;  3F4S A;  3ZFL A;  4JZQ A;  1FW1 A;  3CRU A;  5JCU A;  1NW2 A;  4Z2R A;  1G6Y A;  3VPQ A;  1HNC A;  4QQ7 A;  1M9B A;  3I6A A;  5CRH A;  4BL7 A;  3FY7 A;  1Z7P A;  1A8L A;  4MF7 A;  2V32 A;  4K2D A;  1SKS B;  4K0N A;  1O73 A;  4KX4 A;  3L0H A;  1TK5 B;  2J23 A;  1GNW A;  2A2P A;  2H74 A;  2CA8 A;  2GQL A;  3ZVJ D;  2GGT A;  2H6X A;  2VD0 A;  5IO2 A;  1ST9 A;  2FCH A;  4GQF A;  1EEJ A;  3KMO A;  1EGR A;  2L5O A;  1Z5Y E;  5ECN B;  5IOX A;  4O32 A;  3WGX A;  1LU4 A;  3APO A;  3EE2 A;  1WMJ A;  1YDK A;  1ABA A;  1ZL9 A;  4TXO A;  5INY A;  4ICY A;  2VCV A;  6GSY A;  1FG4 A;  2X64 A;  3BCI A;  3TKS C;  2C8U A;  2H6Y A;  1K3L A;  4X43 A;  3C1R A;  3UBL A;  3A3T A;  5ECQ B;  5A4U A;  4D73 A;  2CVD A;  1EEM A;  4NV5 A;  3TKQ A;  3DWV A;  5IMZ A;  2HRF A;  4WEY A;  3LW9 A;  6GSS A;  1XZO A;  5ECK B;  1AC1 A;  5HFK A;  1EV4 A;  4O5U A;  2OKA A;  5LD0 A;  3IK9 A;  2LV3 A;  3QMX A;  4ZB9 A;  2VIM A;  1BG5 A;  3QFB C;  1PN0 A;  4F82 A;  3KCM A;  4KND A;  2HNL A;  1EP7 A;  1KEB A;  5CRD A;  5ECR B;  1SKW B;  4ACS A;  3WD6 A;  1RW1 A;  5D93 A;  2V6O A;  5JWR B;  5E4W A;  4RQR A;  5ELA A;  4TRX A;  1UC7 A;  2A2R A;  4TR1 A;  3HJO A;  2TRC P;  3C1S A;  3BOA A;  1T00 A;  2K8S A;  3FMW A;  3GUS A;  1GSU A;  4ILF A;  3GA4 A;  1BX9 A;  2ALB A;  3KEB A;  4HJM A;  3FKF A;  1XVW A;  4MH2 A;  2WS2 A;  4IHU A;  4K7I A;  4GSN A;  5F0G A;  1Z9H A;  2LTK A;  1FOH A;  2H75 A;  5IIZ A;  2ES7 A;  1WP0 A;  1ZCP A;  4KCA A;  2I9H A;  1AQW A;  1F37 A;  4MK3 A;  5D9V A;  4HI7 A;  4KDX A;  5ECL B;  4BVY B;  2TIR A;  2OBI A;  10GS A;  4GQC A;  4OMV A;  4FIW A;  4J57 E;  2I3Y A;  2WRT A;  2VL2 A;  4LMV A;  3M3M A;  1X5D A;  4CY8 A;  4K9Z A;  3WGD A;  3GFK A;  3BCK A;  3IRA A;  1GUK A;  4IP6 A;  3P7X A;  3TOU A;  1A2J A;  4IN0 A;  4EC0 A;  2H01 A;  1QK8 A;  1QQ2 A;  3LEF A;  3GX0 A;  4ZIJ A;  3HDC A;  2IN3 A;  4OD7 A;  5KN0 A;  1MDI A;  4XS4 B;  11GS A;  1PKZ A;  2PGT A;  1TRS A;  3CXG A;  1TW9 A;  1XWG A;  3HZ4 A;  3PH9 A;  4Z2T A;  4YQM A;  5ID2 A;  1PRX A;  1GTB A;  1RK4 A;  2JZS A;  5GST A;  4KDY A;  2DIY A;  4TN8 A;  3TJJ A;  5LCZ A;  1O85 A;  5JWO B;  2PBJ A;  3ME8 A;  5CP1 A;  3TJK A;  3ZRD A;  3A2V A;  3E9J B;  2HRN A;  2GVP A;  3IPZ A;  3KTB A;  2B5X A;  3SWL A;  2YZU A;  2N5F A;  5CAX A;  2WJU A;  1SD8 A;  4JRR A;  4FYU A;  4DSR A;  5KOX A;  1XVQ A;  3R3E A;  3QAW A;  1SU9 A;  2VM2 A;  1V58 A;  4X1U A;  4TR0 A;  1URM A;  4Q5N A;  2YOI A;  14GS A;  3GN3 A;  2IWT A;  2R0C A;  4YH2 A;  1OE8 A;  5LNK e;  1SK2 A;  2O89 A;  4KH7 A;  2ZCT A;  2FNO A;  3US3 A;  3C71 A;  3H8Q A;  4KUN A;  4EVM A;  1YEP A;  4N11 A;  4OO4 A;  2JSY A;  1AQX A;  4YAP A;  4ZBD A;  3VWU A;  5BMU A;  5COH A;  4LLR A;  2FWE A;  1EP8 A;  4EKZ A;  3IBH A;  5B8A A;  4J2F A;  3V1W A;  5DDL A;  4ID0 A;  4WBR D;  3F9U A;  2V6K A;  4KA0 A;  1OC3 A;  3CYN A;  3H93 A;  4ECJ A;  1OYJ A;  2DML A;  2MYG A;  5BRT A;  2H1B A;  1TRW A;  1I9D A;  2JL4 A;  2H1A A;  2HI7 A;  4POB A;  4RI7 A;  3GIX A;  3I43 A;  5IMC A;  2YZH A;  1SK1 A;  4XTS A;  2H8L A;  2FA8 A;  4TW5 A;  1TTZ A;  2FA4 A;  4JE1 A;  3D4M A;  3UL3 A;  2O87 A;  2C0F A;  1ZYP A;  4PQI A;  2WFC A;  3BBY A;  3UEM A;  3A2X A;  5IM9 A;  4PTS A;  2F8A A;  2GDR A;  2IMD A;  4Q5Q A;  4CW9 A;  5DJL A;  16GS A;  5GZZ B;  3K8N A;  1IYI A;  1TRV A;  1EV9 A;  1U3I A;  2V2G A;  1A8Y A;  4J56 E;  6GST A;  3ERW A;  4LL4 B;  5EPF A;  1X9M B;  1VRS D;  1UVZ A;  5CRG A;  2VLV A;  3GYK A;  5G2Z A;  2VCW A;  4BA7 A;  1HNB A;  2H0G A;  1YF1 A;  2QA1 A;  5EL8 A;  4YQU A;  2IFQ B;  3IOS A;  4ZIL A;  5CRW A;  2B5Y A;  2GT6 A;  3EUR A;  1BAY A;  1ERW A;  1O8X A;  3HYP A;  2C3N A;  1X5C A;  4EDY A;  4KAE A;  3Q19 A;  3EYT A;  4NAX A;  2QSI A;  5B6N A;  5A4W A;  2EIR A;  1YZX A;  3LG6 A;  1RQM A;  3APS A;  4K5S A;  4V1A p;  1JHB A;  5A4V A;  3MAK A;  2LJA A;  1DE1 A;  3FEU A;  4L8E A;  2LS5 A;  3PGT A;  4ZXG A;  3F3R A;  1XCC A;  2CX4 A;  4Q5R A;  3HJM A;  3U6V A;  5IMV A;  4OFN A;  1GSS A;  1VF1 A;  3NIV A;  4V1A g;  4N30 A;  2BJX A;  2YNX A;  4N0Z A;  2K6V A;  4OCE A;  1FO5 A;  5DAL A;  2DLX A;  3UIW A;  4XIH A;  5ECI B;  3N9J A;  4HJ2 A;  3O3T A;  1GTA A;  2K18 A;  3GRX A;  2CV4 A;  1J9B A;  1O7U A;  1TK0 B;  5D73 A;  1GUM A;  3CBU A;  3IHQ A;  1DBY A;  4IEL A;  2HE3 A;  3L9V A;  4F0B A;  2PER A;  2FLS A;  2F9S A;  5AN1 A;  1FVK A;  1OAZ A;  4MMM A;  4KW6 A;  3EU3 A;  2LEG A;  1Q98 A;  3PIN A;  5HFI A;  2PMT A;  4LMW A;  3TJB A;  1GSF A;  1ON4 A;  2VL2 C;  3ZIV A;  2JZR A;  2H30 A;  4ZBB A;  7GSS A;  4K6X A;  3VI5 A;  3GTU B;  2E2M A;  4TR4 A;  4HU7 A;  1DSB A;  1ZZY A;  2GS3 A;  5ENU A;  1TXX A;  5DJM A;  5IOW A;  1ZYE A;  3DRN A;  1WIK A;  2WZ9 A;  1GLP A;  1TK8 B;  3ZZX A;  3LGC A;  3APQ A;  2RM5 A;  3LOR A;  2NTO A;  1FB6 A;  4K8M A;  1TRU A;  2A4H A;  1XWK A;  4TVE A;  1YJ6 A;  1AW9 A;  2L4C A;  3IC4 A;  2IJY A;  3M0F A;  4EUY A;  2LQQ A;  1B48 A;  1XW6 A;  5HR2 A;  3WYW A;  2XBI A;  1K3Y A;  4KSM A;  4K5R A;  4K7N A;  5IPH A;  1OC9 B;  2YWN A;  5KN1 A;  2AAW A;  5IPG A;  4DSS A;  4E8E A;  1ZYQ B;  3QD9 A;  4EL1 A;  1B4Q A;  1MDJ A;  2OJL A;  3FZA A;  1BJX A;  4E8H A;  4WR5 A;  1SJ6 A;  4G0K A;  4NXI A;  1O6J A;  3TKP A;  2AB6 A;  4EF0 A;  1E6B A;  3G7I A;  3VK9 A;  1T8E B;  1GUH A;  3F6F A;  3L9S A;  3DGQ A;  1AIU A;  2FD3 A;  2KHP A;  1SKR B;  1F9M A;  4JR4 A;  3O6T A;  3UJ1 A;  2C4J A;  3A5I A;  1T3B A;  3MIX A;  4EO3 A;  5ECO B;  1NHY A;  4MF6 A;  4CHS A;  4HQS A;  3HXS A;  4L0U A;  4ML6 A;  5JWQ B;  3UAP A;  4F03 A;  1XW9 A;  4I8B A;  4TKY A;  3QDN A;  3GL5 A;  2GQK A;  3KM6 A;  5F8B A;  3TDG A;  1PL1 A;  2DJ0 A;  2K9F A;  3F3Q A;  2MMN A;  2VL9 A;  2WDU A;  2VL3 A;  1NHO A;  2YWM A;  1G0T A;  3DXB A;  5AIV A;  4MZC A;  2R37 A;  1SJI A;  1K0B A;  5IMF A;  1SJZ A;  2ZNM A;  1EZK A;  2QC7 A;  4YQV A;  1Z3E A;  3FR3 A;  2L4Q A;  3G7J A;  2MBT A;  4LL1 B;  3LQ7 A;  1AUC A;  2YV9 A;  3TKS E;  2YWI A;  2XC2 A;  3TGZ A;  3HA9 A;  1O81 A;  3DML A;  2B1L A;  3P90 A;  4GSS A;  5DAK A;  4DVC A;  3TRQ A;  1A0R P;  5DCH A;  2C0G A;  1ILO A;  2KP2 A;  4IJI A;  3GV1 A;  3C73 A;  4G19 A;  1ERU A;  5CRE A;  1K0C A;  5JCG A;  1F6M C;  13GS A;  2YJ7 A;  2H70 A;  4XCS A;  2BMX A;  4PQ1 A;  1ZYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...