1J08A

Crystal structure of glutaredoxin-like protein from pyrococcus horikoshii
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
225
structure length
225
Chain Sequence
GLISEEDKRIIKEEFFSKMVNPVKLIVFIGKEHCQYCDQLKQLVQELSELTDKLSYEIVDFDTPEGKELAEKYRIDRAPATTITQDGKDFGVRYFGIPAGHEFAAFLEDIVDVSKGDTDLMQDSKEEVSKIDKDVRILIFVTPTCPYCPLAVRMAHKFAIENTKAGKGKILGDMVEAIEYPEWADQYNVMAVPKIVIQVNGEDKVQFEGAYPEKMFLEKLLSALS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords glutaredoxin-like protein
publication title Protein disulfide isomerase from hyperthermophile as an additives of refolding of an immunoglobulin-folded protein
rcsb
source organism Pyrococcus horikoshii
total genus 80
structure length 225
sequence length 225
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2002-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05768 DUF836 Glutaredoxin-like domain (DUF836)
A PF13192 Thioredoxin_3 Thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1j08A01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1j08A02
4IJIA 3BBYA 5ID2A 4ECJA 2JSYA 1E2YA 3HZ4A 3P90A 5ECHB 5F0GA 5CRHA 5CP1A 1K0MA 5ECMB 1CQGA 2N5BA 2YZUA 2YJ7A 4J2FA 4KSOA 2C0EA 2F8AA 3HA9A 5ELGA 5D96A 2LQOA 1V57A 1EOGA 1T00A 3FHKA 1OAZA 2AHEA 1VF1A 2HT9A 1SKRB 2LUSA 5DDLA 2QC7A 3P2AA 2H75A 5JWOB 2GSTA 3BCIA 2OA7A 1FO5A 1YQ1A 2LNTA 4MLYA 1IYIA 3IA1A 3EYTA 3IR4A 2I81A 3ZL5A 3D4MA 1PQNA 5IMZA 1Z7RA 3TOUA 2R4VA 1USBA 2G0FA 1B8XA 4WBRD 4LLRA 2X64A 3DXBA 4MDCA 1S3DA 5D9XA 2B3SA 2CVKA 2LJRA 4NHWA 3GYKA 3Q18A 2K6VA 2YV7A 2GTUA 1ERVA 4E8EA 2N5AA 2JL4A 2R6KA 3CTGA 3L9UA 5G31A 4HOJA 3KM6A 3GA4A 4RQRA 3FZ4A 3D21A 4KGIA 1T3BA 3RHBA 2H6XA 2H0IA 2IMEA 1R4WA 2PGTA 1XBSA 1MEKA 4YH2A 3FZ9A 3ISOA 1G6YA 3GL3A 4HZ4A 3CTFA 2XPEA 4GSTA 3M9JA 1I9DA 3BJ5A 3US3A 4F9ZA 4JBBA 2HZEA 1ZYQB 2O8VB 2M46A 1FW1A 3C73A 3A5WA 2X8GA 3IHQA 4HS1A 2OBIA 5CYYA 2CAQA 3KIJA 1SYXA 5J5NA 2C3TA 4FYCA 5HQPA 1M0UA 1XFLA 3KJYA 2GSRA 3UAPA 5IMVA 3APSA 1B9XC 5H5RA 2XHFA 4BWSA 2H73A 2BMXA 1SL0B 1NHOA 2KOKA 1KEBA 1KBNA 1VRSD 4CW9A 4PURA 2YV9A 4MJCA 1ZL9A 4JRRA 2VIMA 1YDKA 3F6FA 2PVOC 3APQA 4BA7A 2DLXA 1XW6A 3WT2A 1AUCA 3W8JA 3QMXA 4BPYA 4P3YB 5DCGA 1LBKA 4L5OA 4YQMA 1V9WA 3ERGA 2F9SA 1SD8A 4OFMA 4MZWA 1BG5A 1TI3A 4K9ZA 1TRWA 2A2SA 2HRNA 1WJKA 4L0WA 4N11A 2O7KA 9GSSA 4AF2A 2CT6A 1ST9A 1WIKA 1BQ7A 2R3XA 1AXDA 1HD2A 2MBSA 3VPTA 3VURA 5ECKB 3GTUB 1X9MB 2ZCTA 1GSYA 1GTBA 2OE1A 4X1UA 4GF0A 1F2EA 3D0ZA 4ML6A 2E2GA 7GSSA 5JCUA 4XRAA 4NHZA 5CRGA 1EWXA 2GDRA 2K18A 5F05A 1DE1A 2FLSA 2FY6A 5EY6A 1AC1A 1ABAA 4TR0A 1K0NA 4YQVA 5F07A 4TXVA 5JCGA 4MZCA 3GV1A 2B1LA 5CRWA 2OE0A 3ZFLA 1HYUA 4X43A 10GSA 2C3NA 3EVIA 3GSTA 3GH6A 4OD7A 5ECOB 3MSZA 3C1SA 3DRNA 1O85A 4PQ1A 3V1WA 16GSA 1PX6A 4ZILA 2JZTA 2F8FA 1BEDA 4IQAA 2O85A 1XOBA 3QFAC 4RQXA 1S3AA 3FK8A 4V2LA 2YZHA 4FYBA 4PNGA 3APOA 2RUFA 2P31A 4QQ7A 4EDZA 5GZZB 1DSBA 3L0HA 5DAKB 2GZYA 1RK4A 1WMJA 3U6VA 2VM2A 1R5AA 4PGTA 3RBTA 4F0BA 3WT1A 1EV4A 3LYKA 2VAFA 4MF6A 2RUEA 1YKCA 2IJYA 4OCEA 2V32A 4ZBAA 4DSSB 2VCQA 4I8BA 1ACVA 2J9HA 1PL1A 1QMVA 1UN2A 2HI7A 1Z9HA 1ZOFA 2NVLA 2HXKA 3ED3A 2QSIA 3LYPA 2B5EA 3UMAA 2VL2A 2YWNA 4MP4A 5G1KA 2FWEA 1EGRA 5D73A 4EXJA 5G2ZA 3IV4A 5G1LA 4IVFA 2LEGA 3G7YA 2L5OA 5G5EA 1PN9A 1OC9A 4G9HA 1GSQA 3FRCA 4MH2A 4N0ZA 3VWUA 1FOVA 4PNFA 4ZBDA 3EMPA 4IP6A 5ECPB 1ERWA 5GSSA 2FHEA 2FWGA 1AQXA 5J9CA 5D9TA 3UOMA 5ID2B 2YN1A 3GFKA 5D8IA 3KP9A 4TR3A 2VL3A 1K3OA 5KN0A 1DE2A 4XS6A 4JR6A 4KB3A 3QR6A 1MDJA 4NMUA 3Q74A 4HQSA 2YOIA 4F82A 1M2AA 1X9WB 2KP2A 2NBSA 4MPGA 3PH9A 4RI6A 2H1AA 2DIZA 2LRCA 1MD3A 2V2GA 3VI7A 1TTZA 4EO3A 5CAXA 3PGTA 1A0RP 1HNAA 4HI7A 1O81A 1THXA 4KA0A 2A2RA 13GSA 4AJ8A 1NM3A 4XS4A 2B7JA 1W89A 4POKA 5DCHA 5F06A 3TKSC 1SK1A 5A4UA 3TRPA 4LMWA 4TXOA 1AAZA 1SJIA 2WJUA 1LJRA 2PVQA 2IFQA 1PX7A 1O6JA 1F3BA 2LS5A 5IMAA 4RUVA 3Q19A 2C0DA 1WPIA 1OKDA 1TRSA 4WF4A 1OKTA 3TJJA 2CZ2A 3ZITA 2EIQA 3GX8A 3ZMLA 1TJDA 2D2ZA 5HFKA 2KLXA 4D73A 3J7Yk 4IELA 3J7Yb 4NWYA 3F4RA 3ZRDA 5LCZA 1EP8A 3D4TA 3L9SA 4PXOA 4Q5FA 3ZTLA 4IS0A 1GSDA 2YJHA 2L4QA 2VD0A 3UJ1A 2LSTA 4YQUA 3IPZA 2CX4A 4TR1A 1K0OA 3GRXA 3GURA 3HZ8A 5HR0A 2VUPA 4MABA 4XHMA 2LQQA 1V98A 1G7EA 4MF5A 5B8AA 1N2AA 1O8XA 3ZREA 4NV5A 4ECBA 2ON5A 3EMXA 2REMA 5AIXA 2KHPA 3CSHA 5EL8A 2IMKA 2H19A 2HSYA 3F3QA 20GSA 2XBQA 3L4NA 5LD0A 1TW9A 4E8HA 4ID0A 2B5XA 2FA4A 5CO3A 1UC7A 3MDKA 2OJLA 3ZZXA 2FWHA 1HNCA 3C71A 5LNKe 2CAIA 4I5QA 2NTOA 3EWLA 3FZAA 2DMLA 1E6BA 1A23A 1XWAA 3FYGA 3VWVA 4XRDA 1BJXA 3DEXA 1BX9A 3O76A 4TW5A 1X9SB 1YF1A 2HE3A 1TP9A 5DQYA 2LKUA 4ZXGA 2L5LA 2N5FA 5GAPD 1YEXA 3HD5A 3JCML 1O8WA 3LEFA 5D9WA 3HCZA 3TKRA 5ECLB 2HLSA 3TDGA 4AGSA 3F63A 5JWQB 4V2MA 3TRQA 1U88A 4LL1B 4ZB6A 14GSA 3RPPA 1T1VA 3ERFA 4TR4A 5FHIA 4MJAA 1K3LA 2IWTA 4FYUA 2OADA 3VLNA 2H72A 1I5GA 3IDVA 1Z6MA 1QQ2A 3TKPA 1SD9A 3ZIVA 5DQSA 4FH8A 5L71A 4ECCA 4MK3A 2R5GA 6GSTA 2PMTA 3M3MA 1M99A 3TB2A 2ZUPA 4EL1A 1MTCA 4ULXA 3IK9A 2OACA 1WRYA 2LV3A 3DVWA 3TGZA 3AY8A 5D9VA 1MDKA 3ZFBA 1H4OA 1FVKA 1V2AA 2OE3A 1LU4A 2FWFA 2B5YA 1GSFA 4ACSA 2E2MA 3M0FA 1Z7PA 4J57E 4JZQA 5G30A 3I43A 3E3EA 4ZL9A 2FGXA 2AV4A 3DWVA 2JZRA 1K0AA 1ZZYA 5J3RA 4HJMA 1GH2A 4HEA2 1A2MA 3QDNA 4EVMA 2L57A 4LL4B 5H5QA 2H1GA 4IW9A 1X5CA 2DMMA 3RHCA 5IPHA 4WXTA 2C80A 5IQYA 2WULA 3ERWA 1FG4A 2FCHA 2HNLA 5DALA 3MNGA 1AW9A 1XOAA 4OMVA 4N30A 4K7NA 3EURA 3DVXA 4MJEA 4F03A 2KP1A 3GKXA 2MBTA 4JE1A 1XVWA 1OVNA 1Y25A 4TOPA 2LJKA 2GT5A 1PD21 2AAWA 1GULA 5KN3A 4OO4A 4I2TA 3GX0A 3QAWA 3KH7A 1NHYA 2VOCA 3UBLA 1Q4JA 1XWGA 1Z3EA 1GTIA 4ECIA 1BYEA 3DMLA 4K0NA 2VCXA 2VLVA 2WFCA 4OFNA 1ERTA 3H4KA 2LRNA 4GLTA 3FR6A 2GS3A 2GQLA 2DSAA 5IM9A 2AUVA 1U3AA 4I2UA 4GSSA 4G19A 1XWKA 4EF0A 3QAVA 4PUAA 1Z5YE 3ZLPA 2IIYA 5IIZA 4GWRA 1X0RA 2AB6A 2IMFA 3M1GA 4MCUA 3NIVA 4L8EA 4TXOB 2H8LA 4HU7A 5J41A 3O6TA 2IFQB 4L0UA 2GSQA 1JZDA 2WCIA 3G7JA 5G5FA 4WBJA 3LG6A 4Q5RA 3F0IA 3LWAA 4EC0A 2K8SA 1TXXA 2NDOA 3NZNA 3WGXA 17GSA 1J9BA 4K0GA 1SKWB 1VGLA 4YAVA 4KCAA 3L78A 4D73B 2ES7A 3NOFA 6GSYA 4IBPA 1GSEA 1UA5A 1WOUA 3C1RA 1H75A 4ZBBA 2HRFA 1THOA 2AYTA 1UVZA 5AIVA 3KTLA 3H93A 3GN3A 4NPBA 2JACA 1XZOA 1A2JA 3TCOA 3L9VA 1SL2B 3KGKA 1ZYEA 2H70A 2O87A 2DJ3A 1T7PB 1VF2A 1O7UA 3VFIA 5CREA 3UVHA 2GSSA 3GKMA 3MWHA 1AIUA 2M80A 4WEYA 1ZGNA 5KN2A 3G9BA 4ILFA 1GWCA 5IMFA 1WE0A 2H66A 2RLIA 3F6DA 2J23A 1PGTA 2MZCA 1IYHA 3TKSA 3IOSA 1J0FA 3WGDA 2HSHA 4RI7A 4BVYA 2L6DA 2TRCP 3ZVJD 4ZL8A 1GP1A 3EC3A 4N10A 2M72A 1GSSA 1QUWA 3E0UA 4KCEA 4EE0A 1A0FA 4KDXA 4DSRA 2VL2C 4V1Ag 2WS2A 4L5LA 2DJJA 1SJZA 3I9V2 2B7KA 2C3QA 4GCIA 3IAM2 3O3TA 4XCSA 1EEJA 3FR9A 3P7XA 1OE8A 4HU9A 2F3MA 3ZVJA 1Q98A 3TJBA 5ECQB 2B6MA 4O5RA 1GUMA 4I6XA 5ENUA 3H8QA 2WGRA 2VCWA 4IN0A 2V41A 1WP0A 4PX1A 4G10A 3GH9A 5A5KA 2H76A 1TRVA 5J9BA 3CRTA 2DBCA 1OC3A 1EGOA 4FIWA 2R37A 1YEPA 4TRXA 4QL9A 3HHVA 1G7OA 1YJ6A 1MD4A 3F3RA 3TKSE 2WB9A 1YKAA 4J56E 4F0CA 3DYRA 2L4CA 3HJMA 4XIHA 4KH7A 1XCCA 2ALBA 3D6IA 4TVEA 2DIYA 3LXZA 2E7PA 3BCKA 4ZIJA 2DC5A 1YY7A 4XTSA 2PERA 1K3YA 1XVQA 2RM5A 2HZEB 4EDYA 1R26A 2LTKA 4Z7XA 3WGEA 2VL9A 3FKFA 4EKZA 3H79A 2YWOA 3LGCA 1TU7A 5DAKA 4YAPA 1NW2A 1WWJA 2BJXA 2VD1A 1XXUA 1T8EB 2X8HA 2IMDA 1ILOA 1JFUA 2NPBA 3UIWA 3D5JA 2X8CA 2MMZA 2TRXA 3KXOA 5IO2A 2XBIA 1FAAA 3TRXA 2VCVA 1K0BA 4K6XA 1F3AA 2GQKA 2VO4A 1KNGA 4BL7A 2X99A 3KD0A 3LXTA 3CSIA 3DGQA 6GSSA 3HVVA 5ECNB 4CDOA 4XS1A 2LRTA 2A4VA 3KH9A 2XC2A 4ML1A 3IAS2 3HVXA 1OC8A 1U87A 4Q5NA 2O89A 1GL8A 4V1Ap 4NV2A 1SK0A 2GT6A 4LA1A 3RDWA 3TJKA 2BTOT 1V40A 1SK2A 5KN1A 5DALB 2DJ0A 3IK7A 4KDUA 1KTEA 3GHAA 4OO5A 1U3IA 3FY7A 5HFIA 4HQZA 3LFLA 1ML6A 4KAEA 4OFTA 2LNSA 1JHBA 1A8LA 1JZRA 1PSQA 2H6ZA 2EC4A 1GNEA 3D22A 5H5SA 3TJFA 2C0GA 2I9HA 4BWQA 4N0VA 2RIIA 1A24A 2JADA 1CQHA 2QKEA 3ME8A 2K8VA 2H01A 3UBKA 3TUEA 2JSZA 1VF4A 4TKYA 3UVTA 2YNXA 4QL7A 5C00A 4GSNA 2DJ1A 1B9YC 4MPFA 1W4VA 19GSA 5B6NA 3CYNA 3UARA 3EE2A 3KP8A 3VWWA 1FB6A 1TOFA 1XWCA 2CX3A 2EIOA 2FUG2 4K1FA 1EOHA 5B6MA 3UL3A 1TK8B 5E59A 2IMIA 4X0XA 2GGTA 3VK9A 3QD9A 3GMFA 3IC4A 1F6MC 2XPDA 4IJ3A 5FT3A 1AQVA 3A2VA 4DSQA 5DJMA 2IN3A 3HXSA 1GTAA 3GIXA 3HY2A 1SL1B 2C1YA 3KMOA 2MMOA 22GSA 2OBKA 1F9MA 1EZKA 4KUNA 4FO5A 1PMTA 2H71A 1TDIA 3DD3A 3BOAA 2V1MA 3GUSA 4POMA 4WR5A 3VI5A 4NXIA 3PR8A 3KZQA 3LORA 3ZIJA 4DVCA 3R2QA 1TK5B 2VCTA 3TOTA 2ZNMA 2HYXA 3EINA 3P8WA 5IOXA 3N9JA 5HR1A 4K8MA 2GQMA 2H74A 18GSA 1JLWA 3GKKA 3TJGA 2H30A 3HJPA 4F2IA 5B8BA 5GSTA 1Y6EA 3K8NA 3SWLA 1PRXA 4OWYA 1OC9B 2YP6A 2P0GA 5D93A 5INYA 5EVOA 3CXGA 3OR5A 4KDYA 2VCZA 1YZXA 2G2QA 2RM6A 1EP7A 2PWJA 1AQWA 3ME7A 1GNWA 11GSA 1T4YA 6GSXA 5A4VA 1RW1A 1X5EA 1XIYA 2F51A 1R5PA 1T4ZA 1OYJA 1PKWA 5IO0A 2CZ3A 4MMMA 3ZMKA 2KUCA 3HJOA 4POLA 1BAYA 2B1KA 1V58A 5ELAA 1O73A 3CMIA 4V2NA 4KE3A 2VLTA 2EIRA 4MJBA 2PU9C 4POBA 2VM1A 1N8JA 2H1BA 2YWMA 3GSSA 1PL2A 4IKHA 1XW5A 3WYWA 5E4WA 3GL5A 5IMDA 2VLUA 1J08A 4IGJA 3SBCA 1TKDB 4XS4B 4BVXA 1GRXA 1QK8A 2FNOA 3F9UA 4H86A 2YWIA 1XW9A 2P5QA 2C0FA 1SU9A 3HDCA 4ZB9A 4K7OA 5HR3A 4AJ7A 1M9BA 2L59A 3F4SA 4Q5QA 3QPMA 3N5OA 3U5RE 1M9AA 1B4PA 1JZOA 1VF3A 2V6OA 5COHA 1QFNA 4I97A 1TRUA 3LJRA 5KEJA 3GKNA 5IMCA 2PBJA 2GZPA 2CVBA 3VPQA 3W8SA 1GSUA 1XPVA 5ABRA 1PA3A 2P5RA 1FHEA 1SENA 3BD2A 1K0DA 3M8NA 3ZYWA 4CHSA 4JU5A 2YPMA 2H0HA 1X5DA 1FVJA 3I6AA 2H6YA 3KEBA 2I3YA 1A2LA 2MYGA 2JU5A 3QFBC 4GQCA 1URMA 5AISA 4TR1B 3LSZA 3DKSA 5JWRB 2JZSA 4KX4A 3FEUA 4O92A 1EEMA 2WZ9A 3GNJA 1XWBA 3HVSA 4ZB8A 2IL3A 4PQHA 3VWXA 1FB0A 4KW6A 2H0GA 1M2DA 1ZMAA 6GSUA 2PPTA 3KCMA 5B7CA 2LJAA 2GVPA 2OKAA 2TIRA 4ZL7A 5IOWA 5HR2A 5ECSA 1PKZA 4IQ1A 4NAXA 2QGVA 4MH3A 2ON7A 3FZ5A 12GSA 2DJKA 4WF5A 5CNWA 1QGVA 3RAZA 4GTUA 1S3CA 4HJ2A 1EV9A 1TU8A 3W6GA 1NSWA 2CVDA 2C4JA 2HFDA 2R2JA 4TN8A 2MMNA 2K9FA 4G2EA 3C8EA 2MMAA 4KSMA 2L6CA 1GLQA 3IRAA 1F37A 4KNDA 1M2BA 4WR4A 5GAND 1GUHA 3S9FA 3TKQA 4WKWA 4O32A 5F8BA 3HKRA 5ECRB 1HNBA 3CRUA 6GSVA 1SKSB 6GSWA 3GTUA 2PUKC 4OCFA 3H1NA 4GQFA 1B4QA 5AGYA 4GXZA 2FD3A 1B48A 3IXRA 1JLVA 3A2XA 2PN8A 3F8UA 3FR3A 3A3TA 8GSSA 4K7IA 3I69A 5AN1A 3M9KA 1G6WA 1M7TA 4HUAA 4MZBA 5HFGA 4GRFA 3IBHA 4PUFC 1SYRA 3LQ7A 2FA8A 3HYPA 4IHUA 4JEDA 1R7HA 2DJ2A 3QAGA 1ZCPA 1A8YA 3MAKA 1TK0B 1GLPA 3RPNA 3FW2A 1YF0A 5FWGA 2YANA 4JR4A 1U6TA 4MA9A 5JCWA 2HZFA 2AJQB 1DBYA 2V6KA 2CA8A 1RQMA 3EU3A 3QCPA 2YCDA 5ECIB 2I1UA 4IP1A 1TI1A 3QOUA 2I4AA 2H1DA 4HZ2A 1QXHA 4LMVA 5CRDA 2C8UA 2GLRA 1DUGA 4K2DA 4MF7A 3A2WA 3DIEA 3CBUA 3KMNA 3IE3A 2CQ9A 1HQOA 1ERUA 5C04A 5DBQA 3WD6A 4DSSA 1MDIA 1JZWA 1Z6NA 4PQIA 3KTBA 2GZZA 4EUYA 4HDEA 5DVBA 5DJLA 5J4UA 1GTUA 1OE7A 1K0CA 2Z9SA 4ISDA 1ON4A 5IPGA 3PINA 4DEJA 4WETA 2WRTA 3E9JB 2CV4A 3UEMA 3G7IA 1G0TA 3Q6OA 1GUKA 4O7HA 2IPAA 3C7MA 1C72A 3F4TA 1SJ6A 2E0QA 3CSJA 3EU4A 4AJ6A 5EPFA 5A4WA 2WDUA
chains in the Genus database with same CATH superfamily
4EIPA 4IJIA 3BBYA 5ID2A 4ECJA 2JSYA 1E2YA 3HZ4A 3P90A 5ECHB 5F0GA 5CRHA 5CP1A 1K0MA 5ECMB 1CQGA 2N5BA 4X4JA 2YZUA 2YJ7A 4J2FA 4KSOA 2C0EA 2F8AA 3HA9A 5ELGA 5D96A 2LQOA 1V57A 1EOGA 1T00A 3FMWA 3FHKA 1OAZA 2AHEA 1VF1A 2HT9A 1SKRB 2LUSA 5DDLA 2QC7A 3P2AA 2H75A 5JWOB 2GSTA 3BCIA 2OA7A 1FO5A 1YQ1A 4BVXB 2LNTA 4MLYA 1IYIA 3IA1A 3EYTA 3IR4A 2I81A 3ZL5A 3D4MA 4USSA 1PQNA 5IMZA 1Z7RA 3TOUA 2R4VA 1USBA 2G0FA 1B8XA 4WBRD 4LLRA 2X64A 3DXBA 4MDCA 1S3DA 5D9XA 2B3SA 2CVKA 2LJRA 4NHWA 3GYKA 4YKFA 3Q18A 2K6VA 2YV7A 2GTUA 1ERVA 4E8EA 2N5AA 2JL4A 2R6KA 3CTGA 3L9UA 5G31A 4HOJA 3KM6A 3GA4A 4RQRA 3FZ4A 3D21A 4KGIA 1T3BA 3RHBA 2H6XA 2H0IA 2IMEA 1R4WA 2PGTA 1XBSA 1MEKA 2UZ8A 4YH2A 3FZ9A 3ISOA 1G6YA 3GL3A 4HZ4A 3CTFA 2XPEA 4GSTA 3M9JA 1I9DA 4Z2RA 3BJ5A 3US3A 4F9ZA 4JBBA 2HZEA 1ZYQB 2O8VB 2M46A 1FW1A 3C73A 3A5WA 2X8GA 3IHQA 4HS1A 2OBIA 5CYYA 2CAQA 3KIJA 1SYXA 5J5NA 2C3TA 4FYCA 5HQPA 1M0UA 1XFLA 3KJYA 2GSRA 3UAPA 5IMVA 3APSA 1B9XC 5H5RA 2XHFA 4BWSA 2H73A 2BMXA 1SL0B 1NHOA 2KOKA 1KEBA 1KBNA 1VRSD 4CW9A 4PURA 2YV9A 4MJCA 1ZL9A 4JRRA 2VIMA 1YDKA 3F6FA 2PVOC 3APQA 4G0LA 4BA7A 2DLXA 1XW6A 3WT2A 1AUCA 3W8JA 3QMXA 4BPYA 4P3YB 3MIXA 5DCGA 1LBKA 4L5OA 4YQMA 1V9WA 3ERGA 2F9SA 1SD8A 4OFMA 4MZWA 1BG5A 1TI3A 4K9ZA 1TRWA 2A2SA 2HRNA 1WJKA 4L0WA 4N11A 2O7KA 9GSSA 4AF2A 2CT6A 1ST9A 1WIKA 1BQ7A 2R3XA 1AXDA 1HD2A 2MBSA 3VPTA 3VURA 5ECKB 3GTUB 1X9MB 2ZCTA 1GSYA 1GTBA 2OE1A 4X1UA 4GF0A 1F2EA 3D0ZA 4ML6A 2E2GA 7GSSA 5JCUA 4XRAA 4NHZA 5CRGA 1EWXA 5BRTA 2GDRA 2K18A 5F05A 1DE1A 2FLSA 2FY6A 5EY6A 1AC1A 1ABAA 4TR0A 1K0NA 4YQVA 5F07A 4TXVA 5JCGA 4MZCA 3GV1A 2B1LA 5CRWA 2OE0A 3ZFLA 1HYUA 4X43A 10GSA 2C3NA 3EVIA 3GSTA 3GH6A 4OD7A 5ECOB 3MSZA 3C1SA 3DRNA 1O85A 4PQ1A 3V1WA 16GSA 1PX6A 4ZILA 3MYDA 2JZTA 2F8FA 1BEDA 4IQAA 2O85A 1XOBA 3QFAC 4RQXA 1S3AA 3FK8A 4V2LA 2YZHA 4FYBA 4PNGA 3APOA 2RUFA 4QQ7A 2P31A 4EDZA 5GZZB 1DSBA 3L0HA 5DAKB 2GZYA 1RK4A 1WMJA 3U6VA 2VM2A 1R5AA 4PGTA 3RBTA 4F0BA 3WT1A 1EV4A 3LYKA 2VAFA 4MF6A 2RUEA 1YKCA 2IJYA 4OCEA 2V32A 4ZBAA 4DSSB 2VCQA 4I8BA 1ACVA 2J9HA 2X4AA 1PL1A 1QMVA 1UN2A 2HI7A 1Z9HA 1ZOFA 2NVLA 2HXKA 3ED3A 2QSIA 3LYPA 2B5EA 3UMAA 2VL2A 2YWNA 4MP4A 5G1KA 2FWEA 1EGRA 5D73A 4EXJA 5G2ZA 3IV4A 5G1LA 4IVFA 2LEGA 3G7YA 2L5OA 5G5EA 1PN9A 1OC9A 4G9HA 1GSQA 3FRCA 4MH2A 4N0ZA 3VWUA 1FOVA 4PNFA 4ZBDA 3EMPA 4IP6A 5ECPB 1ERWA 5GSSA 2FHEA 2FWGA 1AQXA 5J9CA 5D9TA 3UOMA 5ID2B 2YN1A 3GFKA 5D8IA 3KP9A 4TR3A 2VL3A 1K3OA 5KN0A 1DE2A 4XS6A 4JR6A 4KB3A 3QR6A 1MDJA 4NMUA 3Q74A 4HQSA 2YOIA 4F82A 1M2AA 1X9WB 2KP2A 2NBSA 4MPGA 3PH9A 4RI6A 2H1AA 2DIZA 2LRCA 1MD3A 2V2GA 3VI7A 1TTZA 4EO3A 2HRAA 5CAXA 3PGTA 1A0RP 1HNAA 4HI7A 1O81A 1THXA 4KA0A 2A2RA 13GSA 4AJ8A 1NM3A 4O5UA 4XS4A 2B7JA 1W89A 4POKA 5DCHA 5F06A 3TKSC 1SK1A 5A4UA 3TRPA 4LMWA 4TXOA 1AAZA 1SJIA 2WJUA 1LJRA 2PVQA 2IFQA 1PX7A 1O6JA 1F3BA 2LS5A 5IMAA 4RUVA 2HSMA 3Q19A 2C0DA 4KF9A 1WPIA 1OKDA 1TRSA 4WF4A 1OKTA 3TJJA 2CZ2A 3ZITA 2EIQA 3GX8A 3ZMLA 1TJDA 2D2ZA 5HFKA 2KLXA 4D73A 3J7Yk 4IELA 3J7Yb 4NWYA 3F4RA 3ZRDA 5LCZA 1EP8A 3D4TA 3L9SA 4PXOA 4Q5FA 3ZTLA 4IS0A 1GSDA 2YJHA 2L4QA 2VD0A 3UJ1A 2LSTA 4YQUA 3IPZA 2CX4A 4TR1A 1K0OA 3GRXA 3GURA 3HZ8A 5HR0A 2VUPA 4MABA 4XHMA 3EPTA 2LQQA 1V98A 1G7EA 4MF5A 5B8AA 1N2AA 1O8XA 3ZREA 4NV5A 4ECBA 2ON5A 3EMXA 2REMA 5AIXA 2KHPA 3CSHA 5EL8A 2IMKA 2H19A 2HSYA 3F3QA 20GSA 2XBQA 3L4NA 5LD0A 1M3IA 1TW9A 4E8HA 4ID0A 2DKHA 2B5XA 2FA4A 4K5RA 5CO3A 1UC7A 3MDKA 2OJLA 3ZZXA 2FWHA 1HNCA 3C71A 5LNKe 2CAIA 4I5QA 2NTOA 3EWLA 3FZAA 2DMLA 1E6BA 1A23A 2X49A 1XWAA 3FYGA 3VWVA 4XRDA 1BJXA 2HRKA 3DEXA 1BX9A 3O76A 4TW5A 1X9SB 1YF1A 2HE3A 1TP9A 5DQYA 2LKUA 4ZXGA 2L5LA 2N5FA 5GAPD 1YEXA 3HD5A 3JCML 1S3RA 1O8WA 3LEFA 5D9WA 3HCZA 3TKRA 5ECLB 2HLSA 3TDGA 4AGSA 3F63A 5JWQB 4V2MA 3TRQA 4O5QA 1U88A 4LL1B 4ZB6A 14GSA 3RPPA 1T1VA 3ERFA 4TR4A 5FHIA 4MJAA 1K3LA 2IWTA 4FYUA 2OADA 3VLNA 2H72A 1I5GA 3IDVA 1Z6MA 1QQ2A 3TKPA 1SD9A 3ZIVA 5DQSA 4FH8A 5L71A 4ECCA 4MK3A 2R5GA 6GSTA 2PMTA 3M3MA 1M99A 3TB2A 2ZUPA 4EL1A 1MTCA 4ULXA 3IK9A 2OACA 1WRYA 2LV3A 3DVWA 3TGZA 3AY8A 5D9VA 1MDKA 2A2PA 3ZFBA 1H4OA 1FVKA 1V2AA 2OE3A 1LU4A 2FWFA 2B5YA 1GSFA 4ACSA 2E2MA 3M0FA 1Z7PA 4J57E 4JZQA 5G30A 2R0GA 3I43A 3E3EA 4ZL9A 2FGXA 2AV4A 3DWVA 2JZRA 4Z2TA 2R0PA 1K0AA 1ZZYA 5J3RA 4HJMA 1GH2A 4HEA2 1A2MA 3QDNA 4EVMA 2L57A 4LL4B 5H5QA 2H1GA 4IW9A 1X5CA 2DMMA 3RHCA 5IPHA 4WXTA 2C80A 5IQYA 2WULA 3ERWA 1FG4A 2FCHA 2HNLA 5DALA 3MNGA 1AW9A 1XOAA 4OMVA 4N30A 4K7NA 3EURA 3DVXA 4MJEA 4F03A 2KP1A 3GKXA 2MBTA 4JE1A 1XVWA 1OVNA 1Y25A 4TOPA 2LJKA 2GT5A 1PD21 2AAWA 1GULA 5KN3A 4OO4A 4I2TA 3GX0A 3QAWA 3KH7A 1NHYA 2VOCA 3UBLA 1Q4JA 1XWGA 1Z3EA 1GTIA 4ECIA 1BYEA 3DMLA 4K0NA 2VCXA 2VLVA 2WFCA 4OFNA 1ERTA 3H4KA 2LRNA 4GLTA 3FR6A 2GS3A 2GQLA 2DSAA 5IM9A 2AUVA 1U3AA 4I2UA 4GSSA 4G19A 1XWKA 4EF0A 3QAVA 4PUAA 1Z5YE 3ZLPA 2IIYA 5IIZA 4GWRA 1X0RA 2AB6A 2IMFA 3M1GA 4MCUA 3NIVA 4L8EA 4TXOB 2H8LA 4HU7A 5J41A 3O6TA 2IFQB 4L0UA 2GSQA 1JZDA 2WCIA 3G7JA 5G5FA 4WBJA 3LG6A 4Q5RA 3F0IA 3LWAA 4EC0A 2K8SA 1TXXA 2NDOA 3NZNA 3WGXA 17GSA 1J9BA 4K0GA 1SKWB 1VGLA 4YAVA 4KCAA 3L78A 4D73B 2ES7A 3NOFA 6GSYA 4IBPA 1GSEA 1UA5A 1WOUA 3C1RA 1H75A 4ZBBA 2HRFA 1THOA 2AYTA 1UVZA 5AIVA 4A5PA 3KTLA 3H93A 3GN3A 4NPBA 2JACA 1XZOA 1A2JA 3TCOA 3L9VA 1SL2B 3KGKA 2A4HA 1ZYEA 2H70A 2O87A 2DJ3A 1T7PB 1VF2A 1O7UA 3VFIA 5CREA 3UVHA 2GSSA 3GKMA 3MWHA 1AIUA 2M80A 4WEYA 1ZGNA 5KN2A 3G9BA 2DKIA 4ILFA 1GWCA 5IMFA 1WE0A 2H66A 2RLIA 3F6DA 2J23A 1PGTA 2MZCA 1IYHA 3TKSA 3IOSA 1J0FA 3WGDA 2HSHA 4RI7A 4BVYA 2L6DA 2TRCP 3ZVJD 4ZL8A 1GP1A 3EC3A 4N10A 2M72A 1GSSA 1QUWA 3E0UA 4KCEA 4EE0A 1A0FA 4KDXA 4DSRA 2VL2C 4V1Ag 2WS2A 4L5LA 2DJJA 1SJZA 3I9V2 2B7KA 2C3QA 4GCIA 3IAM2 3O3TA 4XCSA 1EEJA 3FR9A 3P7XA 1OE8A 4HU9A 2F3MA 4MNNA 3ZVJA 1Q98A 3TJBA 5ECQB 2B6MA 4O5RA 1GUMA 4I6XA 5ENUA 3H8QA 2WGRA 3IC8A 2VCWA 4IN0A 2V41A 1WP0A 4PX1A 4CY6A 4G10A 3GH9A 5A5KA 2H76A 1TRVA 5J9BA 3CRTA 2DBCA 4K2XA 1OC3A 1EGOA 4FIWA 2R37A 1YEPA 4TRXA 4QL9A 3HHVA 1G7OA 1YJ6A 1MD4A 3F3RA 3TKSE 4K5SA 2WB9A 1YKAA 4J56E 4F0CA 3DYRA 2L4CA 3HJMA 4XIHA 4KH7A 1XCCA 2ALBA 3D6IA 1ZYPA 4TVEA 2DIYA 3LXZA 2E7PA 3BCKA 4ZIJA 2DC5A 1YY7A 4XTSA 2PERA 1K3YA 1XVQA 2RM5A 2HZEB 4EDYA 1R26A 2LTKA 4Z7XA 3WGEA 2VL9A 3FKFA 4EKZA 3H79A 2YWOA 3LGCA 1TU7A 5DAKA 4YAPA 1NW2A 1WWJA 4HSCX 2BJXA 2VD1A 1XXUA 1T8EB 2X8HA 2IMDA 1ILOA 1JFUA 2NPBA 3UIWA 3D5JA 2X8CA 2MMZA 2TRXA 3KXOA 5IO2A 2XBIA 1FAAA 3TRXA 2VCVA 3A5IA 1K0BA 4K6XA 1F3AA 2GQKA 2VO4A 1KNGA 4FQUA 4BL7A 2X99A 3KD0A 3LXTA 3CSIA 3DGQA 6GSSA 3HVVA 5ECNB 4CDOA 4XS1A 2LRTA 2A4VA 3KH9A 2XC2A 4ML1A 3IAS2 3HVXA 1OC8A 1ZYNA 1U87A 4Q5NA 2O89A 3LW9A 1GL8A 4V1Ap 4NV2A 1SK0A 2GT6A 4LA1A 3RDWA 3TJKA 2BTOT 1V40A 1SK2A 5KN1A 5DALB 2DJ0A 3IK7A 4KDUA 1KTEA 3GHAA 4OO5A 4Z2UA 1U3IA 3FY7A 5HFIA 4HQZA 3LFLA 1ML6A 4KAEA 4OFTA 2LNSA 1JHBA 1A8LA 1JZRA 1PSQA 2H6ZA 2EC4A 1GNEA 1FOHA 3D22A 5H5SA 3TJFA 2C0GA 2I9HA 4BWQA 4N0VA 2RIIA 1A24A 2JADA 1CQHA 2QKEA 3ME8A 2K8VA 2H01A 3UBKA 3TUEA 3R3EA 2JSZA 4TKYA 1VF4A 3UVTA 2YNXA 4QL7A 5C00A 4GSNA 2DJ1A 1B9YC 4MPFA 1W4VA 19GSA 5B6NA 3CYNA 4ICYA 3UARA 4YKGA 3EE2A 3KP8A 3VWWA 1FB6A 1TOFA 1XWCA 2CX3A 2EIOA 2FUG2 4K1FA 1EOHA 5B6MA 3UL3A 1TK8B 5E59A 2IMIA 4X0XA 2GGTA 3VK9A 3QD9A 3GMFA 3IC4A 1F6MC 2XPDA 4IJ3A 5FT3A 1AQVA 3A2VA 4DSQA 5DJMA 2IN3A 3HXSA 1GTAA 3GIXA 3HY2A 1SL1B 2C1YA 3KMOA 2MMOA 2QA2A 22GSA 2OBKA 1F9MA 1EZKA 4KUNA 4FO5A 1PMTA 2H71A 1TDIA 3DD3A 3BOAA 2V1MA 3GUSA 4POMA 4WR5A 5BMUA 3VI5A 4NXIA 3PR8A 3KZQA 3LORA 3ZIJA 4DVCA 3R2QA 1TK5B 2VCTA 3TOTA 2ZNMA 2HYXA 3EINA 3P8WA 5IOXA 3N9JA 5HR1A 4K8MA 2GQMA 2H74A 18GSA 1JLWA 3GKKA 3TJGA 2H30A 3HJPA 4F2IA 3IHGA 5B8BA 5GSTA 1Y6EA 3K8NA 3SWLA 1PRXA 4OWYA 4PTSA 1OC9B 2YP6A 2P0GA 5D93A 5INYA 5EVOA 3CXGA 3OR5A 4KDYA 2VCZA 1YZXA 2G2QA 2RM6A 1EP7A 2PWJA 1AQWA 3ME7A 1GNWA 11GSA 1T4YA 6GSXA 5A4VA 1RW1A 1X5EA 1XIYA 2F51A 1R5PA 3PPUA 1T4ZA 1OYJA 4BVYB 1PKWA 5IO0A 2CZ3A 4MMMA 3ZMKA 2KUCA 3HJOA 4POLA 1BAYA 2B1KA 1V58A 5ELAA 1O73A 3CMIA 4V2NA 4KE3A 2VLTA 2EIRA 4MJBA 2PU9C 4POBA 2VM1A 1N8JA 2H1BA 2YWMA 3GSSA 1PL2A 4IKHA 1XW5A 3WYWA 5E4WA 3GL5A 5IMDA 2VLUA 1J08A 4IGJA 3SBCA 1TKDB 4XS4B 4BVXA 1GRXA 1QK8A 2FNOA 3F9UA 4H86A 2YWIA 1XW9A 2P5QA 2C0FA 1SU9A 3HDCA 4ZB9A 4K7OA 5HR3A 4AJ7A 1M9BA 2L59A 3F4SA 4Q5QA 3QPMA 3N5OA 3U5RE 1M9AA 1B4PA 1JZOA 1VF3A 2V6OA 5COHA 1QFNA 4I97A 1TRUA 2R0CA 3CQFA 3LJRA 5KEJA 3GKNA 5IMCA 2PBJA 2GZPA 2CVBA 3VPQA 3W8SA 1GSUA 1XPVA 5ABRA 1PA3A 2P5RA 1FHEA 1SENA 3BD2A 1K0DA 3M8NA 3ZYWA 4CHSA 4JU5A 2YPMA 2H0HA 1X5DA 1FVJA 3I6AA 2H6YA 3KEBA 2I3YA 1A2LA 2MYGA 2JU5A 3QFBC 4GQCA 1URMA 5AISA 4TR1B 3LSZA 3DKSA 5JWRB 2JZSA 4KX4A 3FEUA 4O92A 1EEMA 2WZ9A 1XG8A 3GNJA 1XWBA 3HVSA 4ZB8A 2IL3A 4PQHA 3VWXA 1FB0A 4KW6A 2H0GA 1M2DA 1ZMAA 6GSUA 2PPTA 3KCMA 4BL7B 5B7CA 2LJAA 2GVPA 2OKAA 2TIRA 4ZL7A 5IOWA 5HR2A 5ECSA 1PKZA 4IQ1A 4NAXA 2QGVA 4MH3A 2ON7A 3FZ5A 12GSA 2DJKA 4WF5A 5CNWA 1QGVA 3RAZA 4GTUA 1S3CA 4HJ2A 1EV9A 1TU8A 3W6GA 1NSWA 2CVDA 2C4JA 2HFDA 2R2JA 4TN8A 2MMNA 2K9FA 4G2EA 3C8EA 2MMAA 4KSMA 2L6CA 1GLQA 3IRAA 1F37A 4KNDA 1M2BA 4WR4A 5GAND 1GUHA 3S9FA 2QA1A 3TKQA 3HVNA 4WKWA 4O32A 4BIKA 5F8BA 3HKRA 5ECRB 1HNBA 3CRUA 6GSVA 1SKSB 6GSWA 3GTUA 2PUKC 4OCFA 3H1NA 4GQFA 1B4QA 5AGYA 4GXZA 2FD3A 4CY8A 1B48A 3IXRA 1JLVA 3A2XA 2PN8A 3F8UA 1M3JA 3A3TA 3FR3A 8GSSA 4K7IA 3I69A 5AN1A 3M9KA 1G6WA 5KOXA 1M7TA 4HUAA 4MZBA 5HFGA 4GRFA 3IBHA 4PUFC 1SYRA 3LQ7A 2FA8A 3HYPA 4IHUA 4JEDA 4G0IA 1R7HA 5KOWA 2DJ2A 3QAGA 1ZCPA 1A8YA 3MAKA 1TK0B 1GLPA 3RPNA 3FW2A 1YF0A 5FWGA 2YANA 4JR4A 1U6TA 4MA9A 5JCWA 1PN0A 2HZFA 2AJQB 1DBYA 2V6KA 2CA8A 1RQMA 3EU3A 3QCPA 2YCDA 5ECIB 2I1UA 4IP1A 1TI1A 3QOUA 2I4AA 2H1DA 4HZ2A 1QXHA 4LMVA 5CRDA 2C8UA 2GLRA 1DUGA 4K2DA 4MF7A 3A2WA 3DIEA 3CBUA 3KMNA 3IE3A 4EIQA 2CQ9A 1PFOA 1HQOA 1ERUA 5C04A 5DBQA 3WD6A 4DSSA 1MDIA 1JZWA 1Z6NA 4PQIA 3KTBA 2GZZA 4EUYA 4HDEA 5DVBA 5DJLA 5J4UA 1GTUA 1OE7A 1K0CA 2Z9SA 4ISDA 1ON4A 4G0KA 5IPGA 3PINA 4DEJA 4WETA 2WRTA 3E9JB 2CV4A 3UEMA 3G7IA 1G0TA 3Q6OA 1GUKA 4O7HA 2IPAA 3C7MA 1C72A 3F4TA 1SJ6A 2E0QA 3CSJA 3EU4A 4AJ6A 5EPFA 5A4WA 2WDUA
chains in the Genus database with same CATH topology
4EIPA 4IJIA 3BBYA 5ID2A 4ECJA 2JSYA 1E2YA 3HZ4A 3P90A 5ECHB 5F0GA 5CRHA 5CP1A 1K0MA 5ECMB 1CQGA 2N5BA 4X4JA 2YZUA 2YJ7A 4J2FA 4KSOA 2C0EA 2F8AA 3HA9A 5ELGA 5D96A 2LQOA 1V57A 1EOGA 1T00A 3FMWA 3FHKA 1OAZA 2AHEA 1VF1A 2HT9A 1SKRB 2LUSA 5DDLA 2QC7A 3P2AA 2H75A 5JWOB 2GSTA 3BCIA 2OA7A 1FO5A 1YQ1A 4BVXB 2LNTA 4MLYA 1IYIA 3IA1A 3EYTA 3IR4A 2I81A 3ZL5A 3D4MA 4USSA 1PQNA 5IMZA 1Z7RA 3TOUA 2R4VA 1USBA 2G0FA 1B8XA 4WBRD 4LLRA 2X64A 3DXBA 4MDCA 1S3DA 5D9XA 2B3SA 2CVKA 2LJRA 4NHWA 3GYKA 4YKFA 3Q18A 2K6VA 2YV7A 2GTUA 1ERVA 4E8EA 2N5AA 2JL4A 2R6KA 3CTGA 3L9UA 5G31A 4HOJA 3KM6A 3GA4A 4RQRA 3FZ4A 3D21A 4KGIA 1T3BA 3RHBA 2H6XA 2H0IA 2IMEA 1R4WA 2PGTA 1XBSA 1MEKA 2UZ8A 4YH2A 3FZ9A 3ISOA 1G6YA 3GL3A 4HZ4A 3CTFA 2XPEA 4GSTA 3M9JA 1I9DA 4Z2RA 3BJ5A 3US3A 4F9ZA 4JBBA 2HZEA 1ZYQB 2O8VB 2M46A 1FW1A 3C73A 3A5WA 2X8GA 3IHQA 4HS1A 2OBIA 5CYYA 2CAQA 3KIJA 1SYXA 5J5NA 2C3TA 4FYCA 5HQPA 1M0UA 1XFLA 3KJYA 2GSRA 3UAPA 5IMVA 3APSA 1B9XC 5H5RA 2XHFA 4BWSA 2H73A 2BMXA 1SL0B 1NHOA 2KOKA 1KEBA 1KBNA 1VRSD 4CW9A 4PURA 2YV9A 4MJCA 1ZL9A 4JRRA 2VIMA 1YDKA 3F6FA 2PVOC 3APQA 4G0LA 4BA7A 2DLXA 1XW6A 3WT2A 1AUCA 3W8JA 3QMXA 4BPYA 4P3YB 3MIXA 5DCGA 1LBKA 4L5OA 4YQMA 1V9WA 3ERGA 2F9SA 1SD8A 4OFMA 4MZWA 1BG5A 1TI3A 4K9ZA 1TRWA 2A2SA 2HRNA 1WJKA 4L0WA 4N11A 2O7KA 9GSSA 4AF2A 2CT6A 1ST9A 1WIKA 1BQ7A 2R3XA 1AXDA 1HD2A 2MBSA 3VPTA 3VURA 5ECKB 3GTUB 1X9MB 2ZCTA 1GSYA 1GTBA 2OE1A 4X1UA 4GF0A 1F2EA 3D0ZA 4ML6A 2E2GA 7GSSA 5JCUA 4XRAA 4NHZA 5CRGA 1EWXA 5BRTA 2GDRA 2K18A 5F05A 1DE1A 2FLSA 2FY6A 5EY6A 1AC1A 1ABAA 4TR0A 1K0NA 4YQVA 5F07A 4TXVA 5JCGA 4MZCA 3GV1A 2B1LA 5CRWA 2OE0A 3ZFLA 1HYUA 4X43A 10GSA 2C3NA 3EVIA 3GSTA 3GH6A 4OD7A 5ECOB 3MSZA 3C1SA 3DRNA 1O85A 4PQ1A 3V1WA 16GSA 1PX6A 4ZILA 3MYDA 2JZTA 2F8FA 1BEDA 4IQAA 2O85A 1XOBA 3QFAC 4RQXA 1S3AA 3FK8A 4V2LA 2YZHA 4FYBA 4PNGA 3APOA 2RUFA 4QQ7A 2P31A 4EDZA 5GZZB 1DSBA 3L0HA 5DAKB 2GZYA 1RK4A 1WMJA 3U6VA 2VM2A 1R5AA 4PGTA 3RBTA 4F0BA 3WT1A 1EV4A 3LYKA 2VAFA 4MF6A 2RUEA 1YKCA 2IJYA 4OCEA 2V32A 4ZBAA 4DSSB 2VCQA 4I8BA 1ACVA 2J9HA 2X4AA 1PL1A 1QMVA 1UN2A 2HI7A 1Z9HA 1ZOFA 2NVLA 2HXKA 3ED3A 2QSIA 3LYPA 2B5EA 3UMAA 2VL2A 2YWNA 4MP4A 5G1KA 2FWEA 1EGRA 5D73A 4EXJA 5G2ZA 3IV4A 5G1LA 4IVFA 2LEGA 3G7YA 2L5OA 5G5EA 1PN9A 1OC9A 4G9HA 1GSQA 3FRCA 4MH2A 4N0ZA 3VWUA 1FOVA 4PNFA 4ZBDA 3EMPA 4IP6A 5ECPB 1ERWA 5GSSA 2FHEA 2FWGA 1AQXA 5J9CA 5D9TA 3UOMA 5ID2B 2YN1A 3GFKA 5D8IA 3KP9A 4TR3A 2VL3A 1K3OA 5KN0A 1DE2A 4XS6A 4JR6A 4KB3A 3QR6A 1MDJA 4NMUA 3Q74A 4HQSA 2YOIA 4F82A 1M2AA 1X9WB 2KP2A 2NBSA 4MPGA 3PH9A 4RI6A 2H1AA 2DIZA 2LRCA 1MD3A 2V2GA 3VI7A 1TTZA 4EO3A 2HRAA 5CAXA 3PGTA 1A0RP 1HNAA 4HI7A 1O81A 1THXA 4KA0A 2A2RA 13GSA 4AJ8A 1NM3A 4O5UA 4XS4A 2B7JA 1W89A 4POKA 5DCHA 5F06A 3TKSC 1SK1A 5A4UA 3TRPA 4LMWA 4TXOA 1AAZA 1SJIA 2WJUA 1LJRA 2PVQA 2IFQA 1PX7A 1O6JA 1F3BA 2LS5A 5IMAA 4RUVA 2HSMA 3Q19A 2C0DA 4KF9A 1WPIA 1OKDA 1TRSA 4WF4A 1OKTA 3TJJA 2CZ2A 3ZITA 2EIQA 3GX8A 3ZMLA 1TJDA 2D2ZA 5HFKA 2KLXA 4D73A 3J7Yk 4IELA 3J7Yb 4NWYA 3F4RA 3ZRDA 5LCZA 1EP8A 3D4TA 3L9SA 4PXOA 4Q5FA 3ZTLA 4IS0A 1GSDA 2YJHA 2L4QA 2VD0A 3UJ1A 2LSTA 4YQUA 3IPZA 2CX4A 4TR1A 1K0OA 3GRXA 3GURA 3HZ8A 5HR0A 2VUPA 4MABA 4XHMA 3EPTA 2LQQA 1V98A 1G7EA 4MF5A 5B8AA 1N2AA 1O8XA 3ZREA 4NV5A 4ECBA 2ON5A 3EMXA 2REMA 5AIXA 2KHPA 3CSHA 5EL8A 2IMKA 2H19A 2HSYA 3F3QA 20GSA 2XBQA 3L4NA 5LD0A 1TW9A 4E8HA 4ID0A 2DKHA 2B5XA 2FA4A 4K5RA 5CO3A 1UC7A 3MDKA 2OJLA 3ZZXA 2FWHA 1HNCA 3C71A 5LNKe 2CAIA 4I5QA 2NTOA 3EWLA 3FZAA 2DMLA 1E6BA 1A23A 2X49A 1XWAA 3FYGA 3VWVA 4XRDA 1BJXA 2HRKA 3DEXA 1BX9A 3O76A 4TW5A 1X9SB 1YF1A 2HE3A 1TP9A 5DQYA 2LKUA 4ZXGA 2L5LA 2N5FA 5GAPD 1YEXA 3HD5A 3JCML 1O8WA 3LEFA 5D9WA 3HCZA 3TKRA 5ECLB 2HLSA 3TDGA 4AGSA 3F63A 5JWQB 4V2MA 3TRQA 4O5QA 1U88A 4LL1B 4ZB6A 14GSA 3RPPA 1T1VA 3ERFA 4TR4A 5FHIA 4MJAA 1K3LA 2IWTA 4FYUA 2OADA 3VLNA 2H72A 1I5GA 3IDVA 1Z6MA 1QQ2A 3TKPA 1SD9A 3ZIVA 5DQSA 4FH8A 5L71A 4ECCA 4MK3A 2R5GA 6GSTA 2PMTA 3M3MA 1M99A 3TB2A 2ZUPA 4EL1A 1MTCA 4ULXA 3IK9A 2OACA 1WRYA 2LV3A 3DVWA 3TGZA 3AY8A 5D9VA 1MDKA 2A2PA 3ZFBA 1H4OA 1FVKA 1V2AA 2OE3A 1LU4A 2FWFA 2B5YA 1GSFA 4ACSA 2E2MA 3M0FA 1Z7PA 4J57E 4JZQA 5G30A 2R0GA 3I43A 3E3EA 4ZL9A 2FGXA 2AV4A 3DWVA 2JZRA 4Z2TA 2R0PA 1K0AA 1ZZYA 5J3RA 4HJMA 1GH2A 4HEA2 1A2MA 3QDNA 4EVMA 2L57A 4LL4B 5H5QA 2H1GA 4IW9A 1X5CA 2DMMA 3RHCA 5IPHA 4WXTA 2C80A 5IQYA 2WULA 3ERWA 1FG4A 2FCHA 2HNLA 5DALA 3MNGA 1AW9A 1XOAA 4OMVA 4N30A 4K7NA 3EURA 3DVXA 4MJEA 4F03A 2KP1A 3GKXA 2MBTA 4JE1A 1XVWA 1OVNA 1Y25A 4TOPA 2LJKA 2GT5A 1PD21 2AAWA 1GULA 5KN3A 4OO4A 4I2TA 3GX0A 3QAWA 3KH7A 1NHYA 2VOCA 3UBLA 1Q4JA 1XWGA 1Z3EA 1GTIA 4ECIA 1BYEA 3DMLA 4K0NA 2VCXA 2VLVA 2WFCA 4OFNA 1ERTA 3H4KA 2LRNA 4GLTA 3FR6A 2GS3A 2GQLA 2DSAA 5IM9A 2AUVA 1U3AA 4I2UA 4GSSA 4G19A 1XWKA 4EF0A 3QAVA 4PUAA 1Z5YE 3ZLPA 2IIYA 5IIZA 4GWRA 1X0RA 2AB6A 2IMFA 3M1GA 4MCUA 3NIVA 4L8EA 4TXOB 2H8LA 4HU7A 5J41A 3O6TA 2IFQB 4L0UA 2GSQA 1JZDA 2WCIA 3G7JA 5G5FA 4WBJA 3LG6A 4Q5RA 3F0IA 3LWAA 4EC0A 2K8SA 1TXXA 2NDOA 3NZNA 3WGXA 17GSA 1J9BA 4K0GA 1SKWB 1VGLA 4YAVA 4KCAA 3L78A 4D73B 2ES7A 3NOFA 6GSYA 4IBPA 1GSEA 1UA5A 1WOUA 3C1RA 1H75A 4ZBBA 2HRFA 1THOA 2AYTA 1UVZA 5AIVA 4A5PA 3KTLA 3H93A 3GN3A 4NPBA 2JACA 1XZOA 1A2JA 3TCOA 3L9VA 1SL2B 3KGKA 2A4HA 1ZYEA 2H70A 2O87A 2DJ3A 1T7PB 1VF2A 1O7UA 3VFIA 5CREA 3UVHA 2GSSA 3GKMA 3MWHA 1AIUA 2M80A 4WEYA 1ZGNA 5KN2A 3G9BA 2DKIA 4ILFA 1GWCA 5IMFA 1WE0A 2H66A 2RLIA 3F6DA 2J23A 1PGTA 2MZCA 1IYHA 3TKSA 3IOSA 1J0FA 3WGDA 2HSHA 4RI7A 4BVYA 2L6DA 2TRCP 3ZVJD 4ZL8A 1GP1A 3EC3A 4N10A 2M72A 1GSSA 1QUWA 3E0UA 4KCEA 4EE0A 1A0FA 4KDXA 4DSRA 2VL2C 4V1Ag 2WS2A 4L5LA 2DJJA 1SJZA 3I9V2 2B7KA 2C3QA 4GCIA 3IAM2 3O3TA 4XCSA 1EEJA 3FR9A 3P7XA 1OE8A 4HU9A 2F3MA 4MNNA 3ZVJA 1Q98A 3TJBA 5ECQB 2B6MA 4O5RA 1GUMA 4I6XA 5ENUA 3H8QA 2WGRA 3IC8A 2VCWA 4IN0A 2V41A 1WP0A 4PX1A 4CY6A 4G10A 3GH9A 5A5KA 2H76A 1TRVA 5J9BA 3CRTA 2DBCA 4K2XA 1OC3A 1EGOA 4FIWA 2R37A 1YEPA 4TRXA 4QL9A 3HHVA 1G7OA 1YJ6A 1MD4A 3F3RA 3TKSE 4K5SA 2WB9A 1YKAA 4J56E 4F0CA 3DYRA 2L4CA 3HJMA 4XIHA 4KH7A 1XCCA 2ALBA 3D6IA 1ZYPA 4TVEA 2DIYA 3LXZA 2E7PA 3BCKA 4ZIJA 2DC5A 1YY7A 4XTSA 2PERA 1K3YA 1XVQA 2RM5A 2HZEB 4EDYA 1R26A 2LTKA 4Z7XA 3WGEA 2VL9A 3FKFA 4EKZA 3H79A 2YWOA 3LGCA 1TU7A 5DAKA 4YAPA 1NW2A 1WWJA 2BJXA 2VD1A 1XXUA 1T8EB 2X8HA 2IMDA 1ILOA 1JFUA 2NPBA 3UIWA 3D5JA 2X8CA 2MMZA 2TRXA 3KXOA 5IO2A 2XBIA 1FAAA 3TRXA 2VCVA 3A5IA 1K0BA 4K6XA 1F3AA 2GQKA 2VO4A 1KNGA 4FQUA 4BL7A 2X99A 3KD0A 3LXTA 3CSIA 3DGQA 6GSSA 3HVVA 5ECNB 4CDOA 4XS1A 2LRTA 2A4VA 3KH9A 2XC2A 4ML1A 3IAS2 3HVXA 1OC8A 1ZYNA 1U87A 4Q5NA 2O89A 3LW9A 1GL8A 4V1Ap 4NV2A 1SK0A 2GT6A 4LA1A 3RDWA 3TJKA 2BTOT 1V40A 1SK2A 5KN1A 5DALB 2DJ0A 3IK7A 4KDUA 1KTEA 3GHAA 4OO5A 4Z2UA 1U3IA 3FY7A 5HFIA 4HQZA 3LFLA 1ML6A 4KAEA 4OFTA 2LNSA 1JHBA 1A8LA 1JZRA 1PSQA 2H6ZA 2EC4A 1GNEA 1FOHA 3D22A 5H5SA 3TJFA 2C0GA 2I9HA 4BWQA 4N0VA 2RIIA 1A24A 2JADA 1CQHA 2QKEA 3ME8A 2K8VA 2H01A 3UBKA 3TUEA 3R3EA 2JSZA 4TKYA 1VF4A 3UVTA 2YNXA 4QL7A 5C00A 4GSNA 2DJ1A 1B9YC 4MPFA 1W4VA 19GSA 5B6NA 3CYNA 4ICYA 3UARA 4YKGA 3EE2A 3KP8A 3VWWA 1FB6A 1TOFA 1XWCA 2CX3A 2EIOA 2FUG2 4K1FA 1EOHA 5B6MA 3UL3A 1TK8B 5E59A 2IMIA 4X0XA 2GGTA 3VK9A 3QD9A 3GMFA 3IC4A 1F6MC 2XPDA 4IJ3A 5FT3A 1AQVA 3A2VA 4DSQA 5DJMA 2IN3A 3HXSA 1GTAA 3GIXA 3HY2A 1SL1B 2C1YA 3KMOA 2MMOA 2QA2A 22GSA 2OBKA 1F9MA 1EZKA 4KUNA 4FO5A 1PMTA 2H71A 1TDIA 3DD3A 3BOAA 2V1MA 3GUSA 4POMA 4WR5A 5BMUA 3VI5A 4NXIA 3PR8A 3KZQA 3LORA 3ZIJA 4DVCA 3R2QA 1TK5B 2VCTA 3TOTA 2ZNMA 2HYXA 3EINA 3P8WA 5IOXA 3N9JA 5HR1A 4K8MA 2GQMA 2H74A 18GSA 1JLWA 3GKKA 3TJGA 2H30A 3HJPA 4F2IA 3IHGA 5B8BA 5GSTA 1Y6EA 3K8NA 3SWLA 1PRXA 4OWYA 4PTSA 1OC9B 2YP6A 2P0GA 5D93A 5INYA 5EVOA 3CXGA 3OR5A 4KDYA 2VCZA 1YZXA 2G2QA 2RM6A 1EP7A 2PWJA 1AQWA 3ME7A 1GNWA 11GSA 1T4YA 6GSXA 5A4VA 1RW1A 1X5EA 1XIYA 2F51A 1R5PA 3PPUA 1T4ZA 1OYJA 4BVYB 1PKWA 5IO0A 2CZ3A 4MMMA 3ZMKA 2KUCA 3HJOA 4POLA 1BAYA 2B1KA 1V58A 5ELAA 1O73A 3CMIA 4V2NA 4KE3A 2VLTA 2EIRA 4MJBA 2PU9C 4POBA 2VM1A 1N8JA 2H1BA 2YWMA 3GSSA 1PL2A 4IKHA 1XW5A 3WYWA 5E4WA 3GL5A 5IMDA 2VLUA 1J08A 4IGJA 3SBCA 1TKDB 4XS4B 4BVXA 1GRXA 1QK8A 2FNOA 3F9UA 4H86A 2YWIA 1XW9A 2P5QA 2C0FA 1SU9A 3HDCA 4ZB9A 4K7OA 5HR3A 4AJ7A 1M9BA 2L59A 3F4SA 4Q5QA 3QPMA 3N5OA 3U5RE 1M9AA 1B4PA 1JZOA 1VF3A 2V6OA 5COHA 1QFNA 4I97A 1TRUA 2R0CA 3LJRA 5KEJA 3GKNA 5IMCA 2PBJA 2GZPA 2CVBA 3VPQA 3W8SA 1GSUA 1XPVA 5ABRA 1PA3A 2P5RA 1FHEA 1SENA 3BD2A 1K0DA 3M8NA 3ZYWA 4CHSA 4JU5A 2YPMA 2H0HA 1X5DA 1FVJA 3I6AA 2H6YA 3KEBA 2I3YA 1A2LA 2MYGA 2JU5A 3QFBC 4GQCA 1URMA 5AISA 4TR1B 3LSZA 3DKSA 5JWRB 2JZSA 4KX4A 3FEUA 4O92A 1EEMA 2WZ9A 3GNJA 1XWBA 3HVSA 4ZB8A 2IL3A 4PQHA 3VWXA 1FB0A 4KW6A 2H0GA 1M2DA 1ZMAA 6GSUA 2PPTA 3KCMA 4BL7B 5B7CA 2LJAA 2GVPA 2OKAA 2TIRA 4ZL7A 5IOWA 5HR2A 5ECSA 1PKZA 4IQ1A 4NAXA 2QGVA 4MH3A 2ON7A 3FZ5A 12GSA 2DJKA 4WF5A 5CNWA 1QGVA 3RAZA 4GTUA 1S3CA 4HJ2A 1EV9A 1TU8A 3W6GA 1NSWA 2CVDA 2C4JA 2HFDA 2R2JA 4TN8A 2MMNA 2K9FA 4G2EA 3C8EA 2MMAA 4KSMA 2L6CA 1GLQA 3IRAA 1F37A 4KNDA 1M2BA 4WR4A 5GAND 1GUHA 3S9FA 2QA1A 3TKQA 4WKWA 4O32A 5F8BA 3HKRA 5ECRB 1HNBA 3CRUA 6GSVA 1SKSB 6GSWA 3GTUA 2PUKC 4OCFA 3H1NA 4GQFA 1B4QA 5AGYA 4GXZA 2FD3A 4CY8A 1B48A 3IXRA 1JLVA 3A2XA 2PN8A 3F8UA 3FR3A 3A3TA 8GSSA 4K7IA 3I69A 5AN1A 3M9KA 1G6WA 5KOXA 1M7TA 4HUAA 4MZBA 5HFGA 4GRFA 3IBHA 4PUFC 1SYRA 3LQ7A 2FA8A 3HYPA 4IHUA 4JEDA 4G0IA 1R7HA 5KOWA 2DJ2A 3QAGA 1ZCPA 1A8YA 3MAKA 1TK0B 1GLPA 3RPNA 3FW2A 1YF0A 5FWGA 2YANA 4JR4A 1U6TA 4MA9A 5JCWA 1PN0A 2HZFA 2AJQB 1DBYA 2V6KA 2CA8A 1RQMA 3EU3A 3QCPA 2YCDA 5ECIB 2I1UA 4IP1A 1TI1A 3QOUA 2I4AA 2H1DA 4HZ2A 1QXHA 4LMVA 5CRDA 2C8UA 2GLRA 1DUGA 4K2DA 4MF7A 3A2WA 3DIEA 3CBUA 3KMNA 3IE3A 4EIQA 2CQ9A 1HQOA 1ERUA 5C04A 5DBQA 3WD6A 4DSSA 1MDIA 1JZWA 1Z6NA 4PQIA 3KTBA 2GZZA 4EUYA 4HDEA 5DVBA 5DJLA 5J4UA 1GTUA 1OE7A 1K0CA 2Z9SA 4ISDA 1ON4A 4G0KA 5IPGA 3PINA 4DEJA 4WETA 2WRTA 3E9JB 2CV4A 3UEMA 3G7IA 1G0TA 3Q6OA 1GUKA 4O7HA 2IPAA 3C7MA 1C72A 3F4TA 1SJ6A 2E0QA 3CSJA 3EU4A 4AJ6A 5EPFA 5A4WA 2WDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJI A;  3BBY A;  5ID2 A;  4ECJ A;  2JSY A;  1E2Y A;  3HZ4 A;  3P90 A;  5ECH B;  5F0G A;  5CRH A;  5CP1 A;  1K0M A;  5ECM B;  1CQG A;  2N5B A;  2YZU A;  2YJ7 A;  4J2F A;  4KSO A;  2C0E A;  2F8A A;  3HA9 A;  5ELG A;  5D96 A;  2LQO A;  1V57 A;  1EOG A;  1T00 A;  3FHK A;  1OAZ A;  2AHE A;  1VF1 A;  2HT9 A;  1SKR B;  2LUS A;  5DDL A;  2QC7 A;  3P2A A;  2H75 A;  5JWO B;  2GST A;  3BCI A;  2OA7 A;  1FO5 A;  1YQ1 A;  2LNT A;  4MLY A;  1IYI A;  3IA1 A;  3EYT A;  3IR4 A;  2I81 A;  3ZL5 A;  3D4M A;  1PQN A;  5IMZ A;  1Z7R A;  3TOU A;  2R4V A;  1USB A;  2G0F A;  1B8X A;  4WBR D;  4LLR A;  2X64 A;  3DXB A;  4MDC A;  1S3D A;  5D9X A;  2B3S A;  2CVK A;  2LJR A;  4NHW A;  3GYK A;  3Q18 A;  2K6V A;  2YV7 A;  2GTU A;  1ERV A;  4E8E A;  2N5A A;  2JL4 A;  2R6K A;  3CTG A;  3L9U A;  5G31 A;  4HOJ A;  3KM6 A;  3GA4 A;  4RQR A;  3FZ4 A;  3D21 A;  4KGI A;  1T3B A;  3RHB A;  2H6X A;  2H0I A;  2IME A;  1R4W A;  2PGT A;  1XBS A;  1MEK A;  4YH2 A;  3FZ9 A;  3ISO A;  1G6Y A;  3GL3 A;  4HZ4 A;  3CTF A;  2XPE A;  4GST A;  3M9J A;  1I9D A;  3BJ5 A;  3US3 A;  4F9Z A;  4JBB A;  2HZE A;  1ZYQ B;  2O8V B;  2M46 A;  1FW1 A;  3C73 A;  3A5W A;  2X8G A;  3IHQ A;  4HS1 A;  2OBI A;  5CYY A;  2CAQ A;  3KIJ A;  1SYX A;  5J5N A;  2C3T A;  4FYC A;  5HQP A;  1M0U A;  1XFL A;  3KJY A;  2GSR A;  3UAP A;  5IMV A;  3APS A;  1B9X C;  5H5R A;  2XHF A;  4BWS A;  2H73 A;  2BMX A;  1SL0 B;  1NHO A;  2KOK A;  1KEB A;  1KBN A;  1VRS D;  4CW9 A;  4PUR A;  2YV9 A;  4MJC A;  1ZL9 A;  4JRR A;  2VIM A;  1YDK A;  3F6F A;  2PVO C;  3APQ A;  4BA7 A;  2DLX A;  1XW6 A;  3WT2 A;  1AUC A;  3W8J A;  3QMX A;  4BPY A;  4P3Y B;  5DCG A;  1LBK A;  4L5O A;  4YQM A;  1V9W A;  3ERG A;  2F9S A;  1SD8 A;  4OFM A;  4MZW A;  1BG5 A;  1TI3 A;  4K9Z A;  1TRW A;  2A2S A;  2HRN A;  1WJK A;  4L0W A;  4N11 A;  2O7K A;  9GSS A;  4AF2 A;  2CT6 A;  1ST9 A;  1WIK A;  1BQ7 A;  2R3X A;  1AXD A;  1HD2 A;  2MBS A;  3VPT A;  3VUR A;  5ECK B;  3GTU B;  1X9M B;  2ZCT A;  1GSY A;  1GTB A;  2OE1 A;  4X1U A;  4GF0 A;  1F2E A;  3D0Z A;  4ML6 A;  2E2G A;  7GSS A;  5JCU A;  4XRA A;  4NHZ A;  5CRG A;  1EWX A;  2GDR A;  2K18 A;  5F05 A;  1DE1 A;  2FLS A;  2FY6 A;  5EY6 A;  1AC1 A;  1ABA A;  4TR0 A;  1K0N A;  4YQV A;  5F07 A;  4TXV A;  5JCG A;  4MZC A;  3GV1 A;  2B1L A;  5CRW A;  2OE0 A;  3ZFL A;  1HYU A;  4X43 A;  10GS A;  2C3N A;  3EVI A;  3GST A;  3GH6 A;  4OD7 A;  5ECO B;  3MSZ A;  3C1S A;  3DRN A;  1O85 A;  4PQ1 A;  3V1W A;  16GS A;  1PX6 A;  4ZIL A;  2JZT A;  2F8F A;  1BED A;  4IQA A;  2O85 A;  1XOB A;  3QFA C;  4RQX A;  1S3A A;  3FK8 A;  4V2L A;  2YZH A;  4FYB A;  4PNG A;  3APO A;  2RUF A;  2P31 A;  4QQ7 A;  4EDZ A;  5GZZ B;  1DSB A;  3L0H A;  5DAK B;  2GZY A;  1RK4 A;  1WMJ A;  3U6V A;  2VM2 A;  1R5A A;  4PGT A;  3RBT A;  4F0B A;  3WT1 A;  1EV4 A;  3LYK A;  2VAF A;  4MF6 A;  2RUE A;  1YKC A;  2IJY A;  4OCE A;  2V32 A;  4ZBA A;  4DSS B;  2VCQ A;  4I8B A;  1ACV A;  2J9H A;  1PL1 A;  1QMV A;  1UN2 A;  2HI7 A;  1Z9H A;  1ZOF A;  2NVL A;  2HXK A;  3ED3 A;  2QSI A;  3LYP A;  2B5E A;  3UMA A;  2VL2 A;  2YWN A;  4MP4 A;  5G1K A;  2FWE A;  1EGR A;  5D73 A;  4EXJ A;  5G2Z A;  3IV4 A;  5G1L A;  4IVF A;  2LEG A;  3G7Y A;  2L5O A;  5G5E A;  1PN9 A;  1OC9 A;  4G9H A;  1GSQ A;  3FRC A;  4MH2 A;  4N0Z A;  3VWU A;  1FOV A;  4PNF A;  4ZBD A;  3EMP A;  4IP6 A;  5ECP B;  1ERW A;  5GSS A;  2FHE A;  2FWG A;  1AQX A;  5J9C A;  5D9T A;  3UOM A;  5ID2 B;  2YN1 A;  3GFK A;  5D8I A;  3KP9 A;  4TR3 A;  2VL3 A;  1K3O A;  5KN0 A;  1DE2 A;  4XS6 A;  4JR6 A;  4KB3 A;  3QR6 A;  1MDJ A;  4NMU A;  3Q74 A;  4HQS A;  2YOI A;  4F82 A;  1M2A A;  1X9W B;  2KP2 A;  2NBS A;  4MPG A;  3PH9 A;  4RI6 A;  2H1A A;  2DIZ A;  2LRC A;  1MD3 A;  2V2G A;  3VI7 A;  1TTZ A;  4EO3 A;  5CAX A;  3PGT A;  1A0R P;  1HNA A;  4HI7 A;  1O81 A;  1THX A;  4KA0 A;  2A2R A;  13GS A;  4AJ8 A;  1NM3 A;  4XS4 A;  2B7J A;  1W89 A;  4POK A;  5DCH A;  5F06 A;  3TKS C;  1SK1 A;  5A4U A;  3TRP A;  4LMW A;  4TXO A;  1AAZ A;  1SJI A;  2WJU A;  1LJR A;  2PVQ A;  2IFQ A;  1PX7 A;  1O6J A;  1F3B A;  2LS5 A;  5IMA A;  4RUV A;  3Q19 A;  2C0D A;  1WPI A;  1OKD A;  1TRS A;  4WF4 A;  1OKT A;  3TJJ A;  2CZ2 A;  3ZIT A;  2EIQ A;  3GX8 A;  3ZML A;  1TJD A;  2D2Z A;  5HFK A;  2KLX A;  4D73 A;  3J7Y k;  4IEL A;  3J7Y b;  4NWY A;  3F4R A;  3ZRD A;  5LCZ A;  1EP8 A;  3D4T A;  3L9S A;  4PXO A;  4Q5F A;  3ZTL A;  4IS0 A;  1GSD A;  2YJH A;  2L4Q A;  2VD0 A;  3UJ1 A;  2LST A;  4YQU A;  3IPZ A;  2CX4 A;  4TR1 A;  1K0O A;  3GRX A;  3GUR A;  3HZ8 A;  5HR0 A;  2VUP A;  4MAB A;  4XHM A;  2LQQ A;  1V98 A;  1G7E A;  4MF5 A;  5B8A A;  1N2A A;  1O8X A;  3ZRE A;  4NV5 A;  4ECB A;  2ON5 A;  3EMX A;  2REM A;  5AIX A;  2KHP A;  3CSH A;  5EL8 A;  2IMK A;  2H19 A;  2HSY A;  3F3Q A;  20GS A;  2XBQ A;  3L4N A;  5LD0 A;  1TW9 A;  4E8H A;  4ID0 A;  2B5X A;  2FA4 A;  5CO3 A;  1UC7 A;  3MDK A;  2OJL A;  3ZZX A;  2FWH A;  1HNC A;  3C71 A;  5LNK e;  2CAI A;  4I5Q A;  2NTO A;  3EWL A;  3FZA A;  2DML A;  1E6B A;  1A23 A;  1XWA A;  3FYG A;  3VWV A;  4XRD A;  1BJX A;  3DEX A;  1BX9 A;  3O76 A;  4TW5 A;  1X9S B;  1YF1 A;  2HE3 A;  1TP9 A;  5DQY A;  2LKU A;  4ZXG A;  2L5L A;  2N5F A;  5GAP D;  1YEX A;  3HD5 A;  3JCM L;  1O8W A;  3LEF A;  5D9W A;  3HCZ A;  3TKR A;  5ECL B;  2HLS A;  3TDG A;  4AGS A;  3F63 A;  5JWQ B;  4V2M A;  3TRQ A;  1U88 A;  4LL1 B;  4ZB6 A;  14GS A;  3RPP A;  1T1V A;  3ERF A;  4TR4 A;  5FHI A;  4MJA A;  1K3L A;  2IWT A;  4FYU A;  2OAD A;  3VLN A;  2H72 A;  1I5G A;  3IDV A;  1Z6M A;  1QQ2 A;  3TKP A;  1SD9 A;  3ZIV A;  5DQS A;  4FH8 A;  5L71 A;  4ECC A;  4MK3 A;  2R5G A;  6GST A;  2PMT A;  3M3M A;  1M99 A;  3TB2 A;  2ZUP A;  4EL1 A;  1MTC A;  4ULX A;  3IK9 A;  2OAC A;  1WRY A;  2LV3 A;  3DVW A;  3TGZ A;  3AY8 A;  5D9V A;  1MDK A;  3ZFB A;  1H4O A;  1FVK A;  1V2A A;  2OE3 A;  1LU4 A;  2FWF A;  2B5Y A;  1GSF A;  4ACS A;  2E2M A;  3M0F A;  1Z7P A;  4J57 E;  4JZQ A;  5G30 A;  3I43 A;  3E3E A;  4ZL9 A;  2FGX A;  2AV4 A;  3DWV A;  2JZR A;  1K0A A;  1ZZY A;  5J3R A;  4HJM A;  1GH2 A;  4HEA 2;  1A2M A;  3QDN A;  4EVM A;  2L57 A;  4LL4 B;  5H5Q A;  2H1G A;  4IW9 A;  1X5C A;  2DMM A;  3RHC A;  5IPH A;  4WXT A;  2C80 A;  5IQY A;  2WUL A;  3ERW A;  1FG4 A;  2FCH A;  2HNL A;  5DAL A;  3MNG A;  1AW9 A;  1XOA A;  4OMV A;  4N30 A;  4K7N A;  3EUR A;  3DVX A;  4MJE A;  4F03 A;  2KP1 A;  3GKX A;  2MBT A;  4JE1 A;  1XVW A;  1OVN A;  1Y25 A;  4TOP A;  2LJK A;  2GT5 A;  1PD2 1;  2AAW A;  1GUL A;  5KN3 A;  4OO4 A;  4I2T A;  3GX0 A;  3QAW A;  3KH7 A;  1NHY A;  2VOC A;  3UBL A;  1Q4J A;  1XWG A;  1Z3E A;  1GTI A;  4ECI A;  1BYE A;  3DML A;  4K0N A;  2VCX A;  2VLV A;  2WFC A;  4OFN A;  1ERT A;  3H4K A;  2LRN A;  4GLT A;  3FR6 A;  2GS3 A;  2GQL A;  2DSA A;  5IM9 A;  2AUV A;  1U3A A;  4I2U A;  4GSS A;  4G19 A;  1XWK A;  4EF0 A;  3QAV A;  4PUA A;  1Z5Y E;  3ZLP A;  2IIY A;  5IIZ A;  4GWR A;  1X0R A;  2AB6 A;  2IMF A;  3M1G A;  4MCU A;  3NIV A;  4L8E A;  4TXO B;  2H8L A;  4HU7 A;  5J41 A;  3O6T A;  2IFQ B;  4L0U A;  2GSQ A;  1JZD A;  2WCI A;  3G7J A;  5G5F A;  4WBJ A;  3LG6 A;  4Q5R A;  3F0I A;  3LWA A;  4EC0 A;  2K8S A;  1TXX A;  2NDO A;  3NZN A;  3WGX A;  17GS A;  1J9B A;  4K0G A;  1SKW B;  1VGL A;  4YAV A;  4KCA A;  3L78 A;  4D73 B;  2ES7 A;  3NOF A;  6GSY A;  4IBP A;  1GSE A;  1UA5 A;  1WOU A;  3C1R A;  1H75 A;  4ZBB A;  2HRF A;  1THO A;  2AYT A;  1UVZ A;  5AIV A;  3KTL A;  3H93 A;  3GN3 A;  4NPB A;  2JAC A;  1XZO A;  1A2J A;  3TCO A;  3L9V A;  1SL2 B;  3KGK A;  1ZYE A;  2H70 A;  2O87 A;  2DJ3 A;  1T7P B;  1VF2 A;  1O7U A;  3VFI A;  5CRE A;  3UVH A;  2GSS A;  3GKM A;  3MWH A;  1AIU A;  2M80 A;  4WEY A;  1ZGN A;  5KN2 A;  3G9B A;  4ILF A;  1GWC A;  5IMF A;  1WE0 A;  2H66 A;  2RLI A;  3F6D A;  2J23 A;  1PGT A;  2MZC A;  1IYH A;  3TKS A;  3IOS A;  1J0F A;  3WGD A;  2HSH A;  4RI7 A;  4BVY A;  2L6D A;  2TRC P;  3ZVJ D;  4ZL8 A;  1GP1 A;  3EC3 A;  4N10 A;  2M72 A;  1GSS A;  1QUW A;  3E0U A;  4KCE A;  4EE0 A;  1A0F A;  4KDX A;  4DSR A;  2VL2 C;  4V1A g;  2WS2 A;  4L5L A;  2DJJ A;  1SJZ A;  3I9V 2;  2B7K A;  2C3Q A;  4GCI A;  3IAM 2;  3O3T A;  4XCS A;  1EEJ A;  3FR9 A;  3P7X A;  1OE8 A;  4HU9 A;  2F3M A;  3ZVJ A;  1Q98 A;  3TJB A;  5ECQ B;  2B6M A;  4O5R A;  1GUM A;  4I6X A;  5ENU A;  3H8Q A;  2WGR A;  2VCW A;  4IN0 A;  2V41 A;  1WP0 A;  4PX1 A;  4G10 A;  3GH9 A;  5A5K A;  2H76 A;  1TRV A;  5J9B A;  3CRT A;  2DBC A;  1OC3 A;  1EGO A;  4FIW A;  2R37 A;  1YEP A;  4TRX A;  4QL9 A;  3HHV A;  1G7O A;  1YJ6 A;  1MD4 A;  3F3R A;  3TKS E;  2WB9 A;  1YKA A;  4J56 E;  4F0C A;  3DYR A;  2L4C A;  3HJM A;  4XIH A;  4KH7 A;  1XCC A;  2ALB A;  3D6I A;  4TVE A;  2DIY A;  3LXZ A;  2E7P A;  3BCK A;  4ZIJ A;  2DC5 A;  1YY7 A;  4XTS A;  2PER A;  1K3Y A;  1XVQ A;  2RM5 A;  2HZE B;  4EDY A;  1R26 A;  2LTK A;  4Z7X A;  3WGE A;  2VL9 A;  3FKF A;  4EKZ A;  3H79 A;  2YWO A;  3LGC A;  1TU7 A;  5DAK A;  4YAP A;  1NW2 A;  1WWJ A;  2BJX A;  2VD1 A;  1XXU A;  1T8E B;  2X8H A;  2IMD A;  1ILO A;  1JFU A;  2NPB A;  3UIW A;  3D5J A;  2X8C A;  2MMZ A;  2TRX A;  3KXO A;  5IO2 A;  2XBI A;  1FAA A;  3TRX A;  2VCV A;  1K0B A;  4K6X A;  1F3A A;  2GQK A;  2VO4 A;  1KNG A;  4BL7 A;  2X99 A;  3KD0 A;  3LXT A;  3CSI A;  3DGQ A;  6GSS A;  3HVV A;  5ECN B;  4CDO A;  4XS1 A;  2LRT A;  2A4V A;  3KH9 A;  2XC2 A;  4ML1 A;  3IAS 2;  3HVX A;  1OC8 A;  1U87 A;  4Q5N A;  2O89 A;  1GL8 A;  4V1A p;  4NV2 A;  1SK0 A;  2GT6 A;  4LA1 A;  3RDW A;  3TJK A;  2BTO T;  1V40 A;  1SK2 A;  5KN1 A;  5DAL B;  2DJ0 A;  3IK7 A;  4KDU A;  1KTE A;  3GHA A;  4OO5 A;  1U3I A;  3FY7 A;  5HFI A;  4HQZ A;  3LFL A;  1ML6 A;  4KAE A;  4OFT A;  2LNS A;  1JHB A;  1A8L A;  1JZR A;  1PSQ A;  2H6Z A;  2EC4 A;  1GNE A;  3D22 A;  5H5S A;  3TJF A;  2C0G A;  2I9H A;  4BWQ A;  4N0V A;  2RII A;  1A24 A;  2JAD A;  1CQH A;  2QKE A;  3ME8 A;  2K8V A;  2H01 A;  3UBK A;  3TUE A;  2JSZ A;  1VF4 A;  4TKY A;  3UVT A;  2YNX A;  4QL7 A;  5C00 A;  4GSN A;  2DJ1 A;  1B9Y C;  4MPF A;  1W4V A;  19GS A;  5B6N A;  3CYN A;  3UAR A;  3EE2 A;  3KP8 A;  3VWW A;  1FB6 A;  1TOF A;  1XWC A;  2CX3 A;  2EIO A;  2FUG 2;  4K1F A;  1EOH A;  5B6M A;  3UL3 A;  1TK8 B;  5E59 A;  2IMI A;  4X0X A;  2GGT A;  3VK9 A;  3QD9 A;  3GMF A;  3IC4 A;  1F6M C;  2XPD A;  4IJ3 A;  5FT3 A;  1AQV A;  3A2V A;  4DSQ A;  5DJM A;  2IN3 A;  3HXS A;  1GTA A;  3GIX A;  3HY2 A;  1SL1 B;  2C1Y A;  3KMO A;  2MMO A;  22GS A;  2OBK A;  1F9M A;  1EZK A;  4KUN A;  4FO5 A;  1PMT A;  2H71 A;  1TDI A;  3DD3 A;  3BOA A;  2V1M A;  3GUS A;  4POM A;  4WR5 A;  3VI5 A;  4NXI A;  3PR8 A;  3KZQ A;  3LOR A;  3ZIJ A;  4DVC A;  3R2Q A;  1TK5 B;  2VCT A;  3TOT A;  2ZNM A;  2HYX A;  3EIN A;  3P8W A;  5IOX A;  3N9J A;  5HR1 A;  4K8M A;  2GQM A;  2H74 A;  18GS A;  1JLW A;  3GKK A;  3TJG A;  2H30 A;  3HJP A;  4F2I A;  5B8B A;  5GST A;  1Y6E A;  3K8N A;  3SWL A;  1PRX A;  4OWY A;  1OC9 B;  2YP6 A;  2P0G A;  5D93 A;  5INY A;  5EVO A;  3CXG A;  3OR5 A;  4KDY A;  2VCZ A;  1YZX A;  2G2Q A;  2RM6 A;  1EP7 A;  2PWJ A;  1AQW A;  3ME7 A;  1GNW A;  11GS A;  1T4Y A;  6GSX A;  5A4V A;  1RW1 A;  1X5E A;  1XIY A;  2F51 A;  1R5P A;  1T4Z A;  1OYJ A;  1PKW A;  5IO0 A;  2CZ3 A;  4MMM A;  3ZMK A;  2KUC A;  3HJO A;  4POL A;  1BAY A;  2B1K A;  1V58 A;  5ELA A;  1O73 A;  3CMI A;  4V2N A;  4KE3 A;  2VLT A;  2EIR A;  4MJB A;  2PU9 C;  4POB A;  2VM1 A;  1N8J A;  2H1B A;  2YWM A;  3GSS A;  1PL2 A;  4IKH A;  1XW5 A;  3WYW A;  5E4W A;  3GL5 A;  5IMD A;  2VLU A;  1J08 A;  4IGJ A;  3SBC A;  1TKD B;  4XS4 B;  4BVX A;  1GRX A;  1QK8 A;  2FNO A;  3F9U A;  4H86 A;  2YWI A;  1XW9 A;  2P5Q A;  2C0F A;  1SU9 A;  3HDC A;  4ZB9 A;  4K7O A;  5HR3 A;  4AJ7 A;  1M9B A;  2L59 A;  3F4S A;  4Q5Q A;  3QPM A;  3N5O A;  3U5R E;  1M9A A;  1B4P A;  1JZO A;  1VF3 A;  2V6O A;  5COH A;  1QFN A;  4I97 A;  1TRU A;  3LJR A;  5KEJ A;  3GKN A;  5IMC A;  2PBJ A;  2GZP A;  2CVB A;  3VPQ A;  3W8S A;  1GSU A;  1XPV A;  5ABR A;  1PA3 A;  2P5R A;  1FHE A;  1SEN A;  3BD2 A;  1K0D A;  3M8N A;  3ZYW A;  4CHS A;  4JU5 A;  2YPM A;  2H0H A;  1X5D A;  1FVJ A;  3I6A A;  2H6Y A;  3KEB A;  2I3Y A;  1A2L A;  2MYG A;  2JU5 A;  3QFB C;  4GQC A;  1URM A;  5AIS A;  4TR1 B;  3LSZ A;  3DKS A;  5JWR B;  2JZS A;  4KX4 A;  3FEU A;  4O92 A;  1EEM A;  2WZ9 A;  3GNJ A;  1XWB A;  3HVS A;  4ZB8 A;  2IL3 A;  4PQH A;  3VWX A;  1FB0 A;  4KW6 A;  2H0G A;  1M2D A;  1ZMA A;  6GSU A;  2PPT A;  3KCM A;  5B7C A;  2LJA A;  2GVP A;  2OKA A;  2TIR A;  4ZL7 A;  5IOW A;  5HR2 A;  5ECS A;  1PKZ A;  4IQ1 A;  4NAX A;  2QGV A;  4MH3 A;  2ON7 A;  3FZ5 A;  12GS A;  2DJK A;  4WF5 A;  5CNW A;  1QGV A;  3RAZ A;  4GTU A;  1S3C A;  4HJ2 A;  1EV9 A;  1TU8 A;  3W6G A;  1NSW A;  2CVD A;  2C4J A;  2HFD A;  2R2J A;  4TN8 A;  2MMN A;  2K9F A;  4G2E A;  3C8E A;  2MMA A;  4KSM A;  2L6C A;  1GLQ A;  3IRA A;  1F37 A;  4KND A;  1M2B A;  4WR4 A;  5GAN D;  1GUH A;  3S9F A;  3TKQ A;  4WKW A;  4O32 A;  5F8B A;  3HKR A;  5ECR B;  1HNB A;  3CRU A;  6GSV A;  1SKS B;  6GSW A;  3GTU A;  2PUK C;  4OCF A;  3H1N A;  4GQF A;  1B4Q A;  5AGY A;  4GXZ A;  2FD3 A;  1B48 A;  3IXR A;  1JLV A;  3A2X A;  2PN8 A;  3F8U A;  3FR3 A;  3A3T A;  8GSS A;  4K7I A;  3I69 A;  5AN1 A;  3M9K A;  1G6W A;  1M7T A;  4HUA A;  4MZB A;  5HFG A;  4GRF A;  3IBH A;  4PUF C;  1SYR A;  3LQ7 A;  2FA8 A;  3HYP A;  4IHU A;  4JED A;  1R7H A;  2DJ2 A;  3QAG A;  1ZCP A;  1A8Y A;  3MAK A;  1TK0 B;  1GLP A;  3RPN A;  3FW2 A;  1YF0 A;  5FWG A;  2YAN A;  4JR4 A;  1U6T A;  4MA9 A;  5JCW A;  2HZF A;  2AJQ B;  1DBY A;  2V6K A;  2CA8 A;  1RQM A;  3EU3 A;  3QCP A;  2YCD A;  5ECI B;  2I1U A;  4IP1 A;  1TI1 A;  3QOU A;  2I4A A;  2H1D A;  4HZ2 A;  1QXH A;  4LMV A;  5CRD A;  2C8U A;  2GLR A;  1DUG A;  4K2D A;  4MF7 A;  3A2W A;  3DIE A;  3CBU A;  3KMN A;  3IE3 A;  2CQ9 A;  1HQO A;  1ERU A;  5C04 A;  5DBQ A;  3WD6 A;  4DSS A;  1MDI A;  1JZW A;  1Z6N A;  4PQI A;  3KTB A;  2GZZ A;  4EUY A;  4HDE A;  5DVB A;  5DJL A;  5J4U A;  1GTU A;  1OE7 A;  1K0C A;  2Z9S A;  4ISD A;  1ON4 A;  5IPG A;  3PIN A;  4DEJ A;  4WET A;  2WRT A;  3E9J B;  2CV4 A;  3UEM A;  3G7I A;  1G0T A;  3Q6O A;  1GUK A;  4O7H A;  2IPA A;  3C7M A;  1C72 A;  3F4T A;  1SJ6 A;  2E0Q A;  3CSJ A;  3EU4 A;  4AJ6 A;  5EPF A;  5A4W A;  2WDU A; 
#chains in the Genus database with same CATH topology
 4EIP A;  4IJI A;  3BBY A;  5ID2 A;  4ECJ A;  2JSY A;  1E2Y A;  3HZ4 A;  3P90 A;  5ECH B;  5F0G A;  5CRH A;  5CP1 A;  1K0M A;  5ECM B;  1CQG A;  2N5B A;  4X4J A;  2YZU A;  2YJ7 A;  4J2F A;  4KSO A;  2C0E A;  2F8A A;  3HA9 A;  5ELG A;  5D96 A;  2LQO A;  1V57 A;  1EOG A;  1T00 A;  3FMW A;  3FHK A;  1OAZ A;  2AHE A;  1VF1 A;  2HT9 A;  1SKR B;  2LUS A;  5DDL A;  2QC7 A;  3P2A A;  2H75 A;  5JWO B;  2GST A;  3BCI A;  2OA7 A;  1FO5 A;  1YQ1 A;  4BVX B;  2LNT A;  4MLY A;  1IYI A;  3IA1 A;  3EYT A;  3IR4 A;  2I81 A;  3ZL5 A;  3D4M A;  4USS A;  1PQN A;  5IMZ A;  1Z7R A;  3TOU A;  2R4V A;  1USB A;  2G0F A;  1B8X A;  4WBR D;  4LLR A;  2X64 A;  3DXB A;  4MDC A;  1S3D A;  5D9X A;  2B3S A;  2CVK A;  2LJR A;  4NHW A;  3GYK A;  4YKF A;  3Q18 A;  2K6V A;  2YV7 A;  2GTU A;  1ERV A;  4E8E A;  2N5A A;  2JL4 A;  2R6K A;  3CTG A;  3L9U A;  5G31 A;  4HOJ A;  3KM6 A;  3GA4 A;  4RQR A;  3FZ4 A;  3D21 A;  4KGI A;  1T3B A;  3RHB A;  2H6X A;  2H0I A;  2IME A;  1R4W A;  2PGT A;  1XBS A;  1MEK A;  2UZ8 A;  4YH2 A;  3FZ9 A;  3ISO A;  1G6Y A;  3GL3 A;  4HZ4 A;  3CTF A;  2XPE A;  4GST A;  3M9J A;  1I9D A;  4Z2R A;  3BJ5 A;  3US3 A;  4F9Z A;  4JBB A;  2HZE A;  1ZYQ B;  2O8V B;  2M46 A;  1FW1 A;  3C73 A;  3A5W A;  2X8G A;  3IHQ A;  4HS1 A;  2OBI A;  5CYY A;  2CAQ A;  3KIJ A;  1SYX A;  5J5N A;  2C3T A;  4FYC A;  5HQP A;  1M0U A;  1XFL A;  3KJY A;  2GSR A;  3UAP A;  5IMV A;  3APS A;  1B9X C;  5H5R A;  2XHF A;  4BWS A;  2H73 A;  2BMX A;  1SL0 B;  1NHO A;  2KOK A;  1KEB A;  1KBN A;  1VRS D;  4CW9 A;  4PUR A;  2YV9 A;  4MJC A;  1ZL9 A;  4JRR A;  2VIM A;  1YDK A;  3F6F A;  2PVO C;  3APQ A;  4G0L A;  4BA7 A;  2DLX A;  1XW6 A;  3WT2 A;  1AUC A;  3W8J A;  3QMX A;  4BPY A;  4P3Y B;  3MIX A;  5DCG A;  1LBK A;  4L5O A;  4YQM A;  1V9W A;  3ERG A;  2F9S A;  1SD8 A;  4OFM A;  4MZW A;  1BG5 A;  1TI3 A;  4K9Z A;  1TRW A;  2A2S A;  2HRN A;  1WJK A;  4L0W A;  4N11 A;  2O7K A;  9GSS A;  4AF2 A;  2CT6 A;  1ST9 A;  1WIK A;  1BQ7 A;  2R3X A;  1AXD A;  1HD2 A;  2MBS A;  3VPT A;  3VUR A;  5ECK B;  3GTU B;  1X9M B;  2ZCT A;  1GSY A;  1GTB A;  2OE1 A;  4X1U A;  4GF0 A;  1F2E A;  3D0Z A;  4ML6 A;  2E2G A;  7GSS A;  5JCU A;  4XRA A;  4NHZ A;  5CRG A;  1EWX A;  5BRT A;  2GDR A;  2K18 A;  5F05 A;  1DE1 A;  2FLS A;  2FY6 A;  5EY6 A;  1AC1 A;  1ABA A;  4TR0 A;  1K0N A;  4YQV A;  5F07 A;  4TXV A;  5JCG A;  4MZC A;  3GV1 A;  2B1L A;  5CRW A;  2OE0 A;  3ZFL A;  1HYU A;  4X43 A;  10GS A;  2C3N A;  3EVI A;  3GST A;  3GH6 A;  4OD7 A;  5ECO B;  3MSZ A;  3C1S A;  3DRN A;  1O85 A;  4PQ1 A;  3V1W A;  16GS A;  1PX6 A;  4ZIL A;  3MYD A;  2JZT A;  2F8F A;  1BED A;  4IQA A;  2O85 A;  1XOB A;  3QFA C;  4RQX A;  1S3A A;  3FK8 A;  4V2L A;  2YZH A;  4FYB A;  4PNG A;  3APO A;  2RUF A;  4QQ7 A;  2P31 A;  4EDZ A;  5GZZ B;  1DSB A;  3L0H A;  5DAK B;  2GZY A;  1RK4 A;  1WMJ A;  3U6V A;  2VM2 A;  1R5A A;  4PGT A;  3RBT A;  4F0B A;  3WT1 A;  1EV4 A;  3LYK A;  2VAF A;  4MF6 A;  2RUE A;  1YKC A;  2IJY A;  4OCE A;  2V32 A;  4ZBA A;  4DSS B;  2VCQ A;  4I8B A;  1ACV A;  2J9H A;  2X4A A;  1PL1 A;  1QMV A;  1UN2 A;  2HI7 A;  1Z9H A;  1ZOF A;  2NVL A;  2HXK A;  3ED3 A;  2QSI A;  3LYP A;  2B5E A;  3UMA A;  2VL2 A;  2YWN A;  4MP4 A;  5G1K A;  2FWE A;  1EGR A;  5D73 A;  4EXJ A;  5G2Z A;  3IV4 A;  5G1L A;  4IVF A;  2LEG A;  3G7Y A;  2L5O A;  5G5E A;  1PN9 A;  1OC9 A;  4G9H A;  1GSQ A;  3FRC A;  4MH2 A;  4N0Z A;  3VWU A;  1FOV A;  4PNF A;  4ZBD A;  3EMP A;  4IP6 A;  5ECP B;  1ERW A;  5GSS A;  2FHE A;  2FWG A;  1AQX A;  5J9C A;  5D9T A;  3UOM A;  5ID2 B;  2YN1 A;  3GFK A;  5D8I A;  3KP9 A;  4TR3 A;  2VL3 A;  1K3O A;  5KN0 A;  1DE2 A;  4XS6 A;  4JR6 A;  4KB3 A;  3QR6 A;  1MDJ A;  4NMU A;  3Q74 A;  4HQS A;  2YOI A;  4F82 A;  1M2A A;  1X9W B;  2KP2 A;  2NBS A;  4MPG A;  3PH9 A;  4RI6 A;  2H1A A;  2DIZ A;  2LRC A;  1MD3 A;  2V2G A;  3VI7 A;  1TTZ A;  4EO3 A;  2HRA A;  5CAX A;  3PGT A;  1A0R P;  1HNA A;  4HI7 A;  1O81 A;  1THX A;  4KA0 A;  2A2R A;  13GS A;  4AJ8 A;  1NM3 A;  4O5U A;  4XS4 A;  2B7J A;  1W89 A;  4POK A;  5DCH A;  5F06 A;  3TKS C;  1SK1 A;  5A4U A;  3TRP A;  4LMW A;  4TXO A;  1AAZ A;  1SJI A;  2WJU A;  1LJR A;  2PVQ A;  2IFQ A;  1PX7 A;  1O6J A;  1F3B A;  2LS5 A;  5IMA A;  4RUV A;  2HSM A;  3Q19 A;  2C0D A;  4KF9 A;  1WPI A;  1OKD A;  1TRS A;  4WF4 A;  1OKT A;  3TJJ A;  2CZ2 A;  3ZIT A;  2EIQ A;  3GX8 A;  3ZML A;  1TJD A;  2D2Z A;  5HFK A;  2KLX A;  4D73 A;  3J7Y k;  4IEL A;  3J7Y b;  4NWY A;  3F4R A;  3ZRD A;  5LCZ A;  1EP8 A;  3D4T A;  3L9S A;  4PXO A;  4Q5F A;  3ZTL A;  4IS0 A;  1GSD A;  2YJH A;  2L4Q A;  2VD0 A;  3UJ1 A;  2LST A;  4YQU A;  3IPZ A;  2CX4 A;  4TR1 A;  1K0O A;  3GRX A;  3GUR A;  3HZ8 A;  5HR0 A;  2VUP A;  4MAB A;  4XHM A;  3EPT A;  2LQQ A;  1V98 A;  1G7E A;  4MF5 A;  5B8A A;  1N2A A;  1O8X A;  3ZRE A;  4NV5 A;  4ECB A;  2ON5 A;  3EMX A;  2REM A;  5AIX A;  2KHP A;  3CSH A;  5EL8 A;  2IMK A;  2H19 A;  2HSY A;  3F3Q A;  20GS A;  2XBQ A;  3L4N A;  5LD0 A;  1M3I A;  1TW9 A;  4E8H A;  4ID0 A;  2DKH A;  2B5X A;  2FA4 A;  4K5R A;  5CO3 A;  1UC7 A;  3MDK A;  2OJL A;  3ZZX A;  2FWH A;  1HNC A;  3C71 A;  5LNK e;  2CAI A;  4I5Q A;  2NTO A;  3EWL A;  3FZA A;  2DML A;  1E6B A;  1A23 A;  2X49 A;  1XWA A;  3FYG A;  3VWV A;  4XRD A;  1BJX A;  2HRK A;  3DEX A;  1BX9 A;  3O76 A;  4TW5 A;  1X9S B;  1YF1 A;  2HE3 A;  1TP9 A;  5DQY A;  2LKU A;  4ZXG A;  2L5L A;  2N5F A;  5GAP D;  1YEX A;  3HD5 A;  3JCM L;  1S3R A;  1O8W A;  3LEF A;  5D9W A;  3HCZ A;  3TKR A;  5ECL B;  2HLS A;  3TDG A;  4AGS A;  3F63 A;  5JWQ B;  4V2M A;  3TRQ A;  4O5Q A;  1U88 A;  4LL1 B;  4ZB6 A;  14GS A;  3RPP A;  1T1V A;  3ERF A;  4TR4 A;  5FHI A;  4MJA A;  1K3L A;  2IWT A;  4FYU A;  2OAD A;  3VLN A;  2H72 A;  1I5G A;  3IDV A;  1Z6M A;  1QQ2 A;  3TKP A;  1SD9 A;  3ZIV A;  5DQS A;  4FH8 A;  5L71 A;  4ECC A;  4MK3 A;  2R5G A;  6GST A;  2PMT A;  3M3M A;  1M99 A;  3TB2 A;  2ZUP A;  4EL1 A;  1MTC A;  4ULX A;  3IK9 A;  2OAC A;  1WRY A;  2LV3 A;  3DVW A;  3TGZ A;  3AY8 A;  5D9V A;  1MDK A;  2A2P A;  3ZFB A;  1H4O A;  1FVK A;  1V2A A;  2OE3 A;  1LU4 A;  2FWF A;  2B5Y A;  1GSF A;  4ACS A;  2E2M A;  3M0F A;  1Z7P A;  4J57 E;  4JZQ A;  5G30 A;  2R0G A;  3I43 A;  3E3E A;  4ZL9 A;  2FGX A;  2AV4 A;  3DWV A;  2JZR A;  4Z2T A;  2R0P A;  1K0A A;  1ZZY A;  5J3R A;  4HJM A;  1GH2 A;  4HEA 2;  1A2M A;  3QDN A;  4EVM A;  2L57 A;  4LL4 B;  5H5Q A;  2H1G A;  4IW9 A;  1X5C A;  2DMM A;  3RHC A;  5IPH A;  4WXT A;  2C80 A;  5IQY A;  2WUL A;  3ERW A;  1FG4 A;  2FCH A;  2HNL A;  5DAL A;  3MNG A;  1AW9 A;  1XOA A;  4OMV A;  4N30 A;  4K7N A;  3EUR A;  3DVX A;  4MJE A;  4F03 A;  2KP1 A;  3GKX A;  2MBT A;  4JE1 A;  1XVW A;  1OVN A;  1Y25 A;  4TOP A;  2LJK A;  2GT5 A;  1PD2 1;  2AAW A;  1GUL A;  5KN3 A;  4OO4 A;  4I2T A;  3GX0 A;  3QAW A;  3KH7 A;  1NHY A;  2VOC A;  3UBL A;  1Q4J A;  1XWG A;  1Z3E A;  1GTI A;  4ECI A;  1BYE A;  3DML A;  4K0N A;  2VCX A;  2VLV A;  2WFC A;  4OFN A;  1ERT A;  3H4K A;  2LRN A;  4GLT A;  3FR6 A;  2GS3 A;  2GQL A;  2DSA A;  5IM9 A;  2AUV A;  1U3A A;  4I2U A;  4GSS A;  4G19 A;  1XWK A;  4EF0 A;  3QAV A;  4PUA A;  1Z5Y E;  3ZLP A;  2IIY A;  5IIZ A;  4GWR A;  1X0R A;  2AB6 A;  2IMF A;  3M1G A;  4MCU A;  3NIV A;  4L8E A;  4TXO B;  2H8L A;  4HU7 A;  5J41 A;  3O6T A;  2IFQ B;  4L0U A;  2GSQ A;  1JZD A;  2WCI A;  3G7J A;  5G5F A;  4WBJ A;  3LG6 A;  4Q5R A;  3F0I A;  3LWA A;  4EC0 A;  2K8S A;  1TXX A;  2NDO A;  3NZN A;  3WGX A;  17GS A;  1J9B A;  4K0G A;  1SKW B;  1VGL A;  4YAV A;  4KCA A;  3L78 A;  4D73 B;  2ES7 A;  3NOF A;  6GSY A;  4IBP A;  1GSE A;  1UA5 A;  1WOU A;  3C1R A;  1H75 A;  4ZBB A;  2HRF A;  1THO A;  2AYT A;  1UVZ A;  5AIV A;  4A5P A;  3KTL A;  3H93 A;  3GN3 A;  4NPB A;  2JAC A;  1XZO A;  1A2J A;  3TCO A;  3L9V A;  1SL2 B;  3KGK A;  2A4H A;  1ZYE A;  2H70 A;  2O87 A;  2DJ3 A;  1T7P B;  1VF2 A;  1O7U A;  3VFI A;  5CRE A;  3UVH A;  2GSS A;  3GKM A;  3MWH A;  1AIU A;  2M80 A;  4WEY A;  1ZGN A;  5KN2 A;  3G9B A;  2DKI A;  4ILF A;  1GWC A;  5IMF A;  1WE0 A;  2H66 A;  2RLI A;  3F6D A;  2J23 A;  1PGT A;  2MZC A;  1IYH A;  3TKS A;  3IOS A;  1J0F A;  3WGD A;  2HSH A;  4RI7 A;  4BVY A;  2L6D A;  2TRC P;  3ZVJ D;  4ZL8 A;  1GP1 A;  3EC3 A;  4N10 A;  2M72 A;  1GSS A;  1QUW A;  3E0U A;  4KCE A;  4EE0 A;  1A0F A;  4KDX A;  4DSR A;  2VL2 C;  4V1A g;  2WS2 A;  4L5L A;  2DJJ A;  1SJZ A;  3I9V 2;  2B7K A;  2C3Q A;  4GCI A;  3IAM 2;  3O3T A;  4XCS A;  1EEJ A;  3FR9 A;  3P7X A;  1OE8 A;  4HU9 A;  2F3M A;  4MNN A;  3ZVJ A;  1Q98 A;  3TJB A;  5ECQ B;  2B6M A;  4O5R A;  1GUM A;  4I6X A;  5ENU A;  3H8Q A;  2WGR A;  3IC8 A;  2VCW A;  4IN0 A;  2V41 A;  1WP0 A;  4PX1 A;  4CY6 A;  4G10 A;  3GH9 A;  5A5K A;  2H76 A;  1TRV A;  5J9B A;  3CRT A;  2DBC A;  4K2X A;  1OC3 A;  1EGO A;  4FIW A;  2R37 A;  1YEP A;  4TRX A;  4QL9 A;  3HHV A;  1G7O A;  1YJ6 A;  1MD4 A;  3F3R A;  3TKS E;  4K5S A;  2WB9 A;  1YKA A;  4J56 E;  4F0C A;  3DYR A;  2L4C A;  3HJM A;  4XIH A;  4KH7 A;  1XCC A;  2ALB A;  3D6I A;  1ZYP A;  4TVE A;  2DIY A;  3LXZ A;  2E7P A;  3BCK A;  4ZIJ A;  2DC5 A;  1YY7 A;  4XTS A;  2PER A;  1K3Y A;  1XVQ A;  2RM5 A;  2HZE B;  4EDY A;  1R26 A;  2LTK A;  4Z7X A;  3WGE A;  2VL9 A;  3FKF A;  4EKZ A;  3H79 A;  2YWO A;  3LGC A;  1TU7 A;  5DAK A;  4YAP A;  1NW2 A;  1WWJ A;  4HSC X;  2BJX A;  2VD1 A;  1XXU A;  1T8E B;  2X8H A;  2IMD A;  1ILO A;  1JFU A;  2NPB A;  3UIW A;  3D5J A;  2X8C A;  2MMZ A;  2TRX A;  3KXO A;  5IO2 A;  2XBI A;  1FAA A;  3TRX A;  2VCV A;  3A5I A;  1K0B A;  4K6X A;  1F3A A;  2GQK A;  2VO4 A;  1KNG A;  4FQU A;  4BL7 A;  2X99 A;  3KD0 A;  3LXT A;  3CSI A;  3DGQ A;  6GSS A;  3HVV A;  5ECN B;  4CDO A;  4XS1 A;  2LRT A;  2A4V A;  3KH9 A;  2XC2 A;  4ML1 A;  3IAS 2;  3HVX A;  1OC8 A;  1ZYN A;  1U87 A;  4Q5N A;  2O89 A;  3LW9 A;  1GL8 A;  4V1A p;  4NV2 A;  1SK0 A;  2GT6 A;  4LA1 A;  3RDW A;  3TJK A;  2BTO T;  1V40 A;  1SK2 A;  5KN1 A;  5DAL B;  2DJ0 A;  3IK7 A;  4KDU A;  1KTE A;  3GHA A;  4OO5 A;  4Z2U A;  1U3I A;  3FY7 A;  5HFI A;  4HQZ A;  3LFL A;  1ML6 A;  4KAE A;  4OFT A;  2LNS A;  1JHB A;  1A8L A;  1JZR A;  1PSQ A;  2H6Z A;  2EC4 A;  1GNE A;  1FOH A;  3D22 A;  5H5S A;  3TJF A;  2C0G A;  2I9H A;  4BWQ A;  4N0V A;  2RII A;  1A24 A;  2JAD A;  1CQH A;  2QKE A;  3ME8 A;  2K8V A;  2H01 A;  3UBK A;  3TUE A;  3R3E A;  2JSZ A;  4TKY A;  1VF4 A;  3UVT A;  2YNX A;  4QL7 A;  5C00 A;  4GSN A;  2DJ1 A;  1B9Y C;  4MPF A;  1W4V A;  19GS A;  5B6N A;  3CYN A;  4ICY A;  3UAR A;  4YKG A;  3EE2 A;  3KP8 A;  3VWW A;  1FB6 A;  1TOF A;  1XWC A;  2CX3 A;  2EIO A;  2FUG 2;  4K1F A;  1EOH A;  5B6M A;  3UL3 A;  1TK8 B;  5E59 A;  2IMI A;  4X0X A;  2GGT A;  3VK9 A;  3QD9 A;  3GMF A;  3IC4 A;  1F6M C;  2XPD A;  4IJ3 A;  5FT3 A;  1AQV A;  3A2V A;  4DSQ A;  5DJM A;  2IN3 A;  3HXS A;  1GTA A;  3GIX A;  3HY2 A;  1SL1 B;  2C1Y A;  3KMO A;  2MMO A;  2QA2 A;  22GS A;  2OBK A;  1F9M A;  1EZK A;  4KUN A;  4FO5 A;  1PMT A;  2H71 A;  1TDI A;  3DD3 A;  3BOA A;  2V1M A;  3GUS A;  4POM A;  4WR5 A;  5BMU A;  3VI5 A;  4NXI A;  3PR8 A;  3KZQ A;  3LOR A;  3ZIJ A;  4DVC A;  3R2Q A;  1TK5 B;  2VCT A;  3TOT A;  2ZNM A;  2HYX A;  3EIN A;  3P8W A;  5IOX A;  3N9J A;  5HR1 A;  4K8M A;  2GQM A;  2H74 A;  18GS A;  1JLW A;  3GKK A;  3TJG A;  2H30 A;  3HJP A;  4F2I A;  3IHG A;  5B8B A;  5GST A;  1Y6E A;  3K8N A;  3SWL A;  1PRX A;  4OWY A;  4PTS A;  1OC9 B;  2YP6 A;  2P0G A;  5D93 A;  5INY A;  5EVO A;  3CXG A;  3OR5 A;  4KDY A;  2VCZ A;  1YZX A;  2G2Q A;  2RM6 A;  1EP7 A;  2PWJ A;  1AQW A;  3ME7 A;  1GNW A;  11GS A;  1T4Y A;  6GSX A;  5A4V A;  1RW1 A;  1X5E A;  1XIY A;  2F51 A;  1R5P A;  3PPU A;  1T4Z A;  1OYJ A;  4BVY B;  1PKW A;  5IO0 A;  2CZ3 A;  4MMM A;  3ZMK A;  2KUC A;  3HJO A;  4POL A;  1BAY A;  2B1K A;  1V58 A;  5ELA A;  1O73 A;  3CMI A;  4V2N A;  4KE3 A;  2VLT A;  2EIR A;  4MJB A;  2PU9 C;  4POB A;  2VM1 A;  1N8J A;  2H1B A;  2YWM A;  3GSS A;  1PL2 A;  4IKH A;  1XW5 A;  3WYW A;  5E4W A;  3GL5 A;  5IMD A;  2VLU A;  1J08 A;  4IGJ A;  3SBC A;  1TKD B;  4XS4 B;  4BVX A;  1GRX A;  1QK8 A;  2FNO A;  3F9U A;  4H86 A;  2YWI A;  1XW9 A;  2P5Q A;  2C0F A;  1SU9 A;  3HDC A;  4ZB9 A;  4K7O A;  5HR3 A;  4AJ7 A;  1M9B A;  2L59 A;  3F4S A;  4Q5Q A;  3QPM A;  3N5O A;  3U5R E;  1M9A A;  1B4P A;  1JZO A;  1VF3 A;  2V6O A;  5COH A;  1QFN A;  4I97 A;  1TRU A;  2R0C A;  3CQF A;  3LJR A;  5KEJ A;  3GKN A;  5IMC A;  2PBJ A;  2GZP A;  2CVB A;  3VPQ A;  3W8S A;  1GSU A;  1XPV A;  5ABR A;  1PA3 A;  2P5R A;  1FHE A;  1SEN A;  3BD2 A;  1K0D A;  3M8N A;  3ZYW A;  4CHS A;  4JU5 A;  2YPM A;  2H0H A;  1X5D A;  1FVJ A;  3I6A A;  2H6Y A;  3KEB A;  2I3Y A;  1A2L A;  2MYG A;  2JU5 A;  3QFB C;  4GQC A;  1URM A;  5AIS A;  4TR1 B;  3LSZ A;  3DKS A;  5JWR B;  2JZS A;  4KX4 A;  3FEU A;  4O92 A;  1EEM A;  2WZ9 A;  1XG8 A;  3GNJ A;  1XWB A;  3HVS A;  4ZB8 A;  2IL3 A;  4PQH A;  3VWX A;  1FB0 A;  4KW6 A;  2H0G A;  1M2D A;  1ZMA A;  6GSU A;  2PPT A;  3KCM A;  4BL7 B;  5B7C A;  2LJA A;  2GVP A;  2OKA A;  2TIR A;  4ZL7 A;  5IOW A;  5HR2 A;  5ECS A;  1PKZ A;  4IQ1 A;  4NAX A;  2QGV A;  4MH3 A;  2ON7 A;  3FZ5 A;  12GS A;  2DJK A;  4WF5 A;  5CNW A;  1QGV A;  3RAZ A;  4GTU A;  1S3C A;  4HJ2 A;  1EV9 A;  1TU8 A;  3W6G A;  1NSW A;  2CVD A;  2C4J A;  2HFD A;  2R2J A;  4TN8 A;  2MMN A;  2K9F A;  4G2E A;  3C8E A;  2MMA A;  4KSM A;  2L6C A;  1GLQ A;  3IRA A;  1F37 A;  4KND A;  1M2B A;  4WR4 A;  5GAN D;  1GUH A;  3S9F A;  2QA1 A;  3TKQ A;  3HVN A;  4WKW A;  4O32 A;  4BIK A;  5F8B A;  3HKR A;  5ECR B;  1HNB A;  3CRU A;  6GSV A;  1SKS B;  6GSW A;  3GTU A;  2PUK C;  4OCF A;  3H1N A;  4GQF A;  1B4Q A;  5AGY A;  4GXZ A;  2FD3 A;  4CY8 A;  1B48 A;  3IXR A;  1JLV A;  3A2X A;  2PN8 A;  3F8U A;  1M3J A;  3A3T A;  3FR3 A;  8GSS A;  4K7I A;  3I69 A;  5AN1 A;  3M9K A;  1G6W A;  5KOX A;  1M7T A;  4HUA A;  4MZB A;  5HFG A;  4GRF A;  3IBH A;  4PUF C;  1SYR A;  3LQ7 A;  2FA8 A;  3HYP A;  4IHU A;  4JED A;  4G0I A;  1R7H A;  5KOW A;  2DJ2 A;  3QAG A;  1ZCP A;  1A8Y A;  3MAK A;  1TK0 B;  1GLP A;  3RPN A;  3FW2 A;  1YF0 A;  5FWG A;  2YAN A;  4JR4 A;  1U6T A;  4MA9 A;  5JCW A;  1PN0 A;  2HZF A;  2AJQ B;  1DBY A;  2V6K A;  2CA8 A;  1RQM A;  3EU3 A;  3QCP A;  2YCD A;  5ECI B;  2I1U A;  4IP1 A;  1TI1 A;  3QOU A;  2I4A A;  2H1D A;  4HZ2 A;  1QXH A;  4LMV A;  5CRD A;  2C8U A;  2GLR A;  1DUG A;  4K2D A;  4MF7 A;  3A2W A;  3DIE A;  3CBU A;  3KMN A;  3IE3 A;  4EIQ A;  2CQ9 A;  1PFO A;  1HQO A;  1ERU A;  5C04 A;  5DBQ A;  3WD6 A;  4DSS A;  1MDI A;  1JZW A;  1Z6N A;  4PQI A;  3KTB A;  2GZZ A;  4EUY A;  4HDE A;  5DVB A;  5DJL A;  5J4U A;  1GTU A;  1OE7 A;  1K0C A;  2Z9S A;  4ISD A;  1ON4 A;  4G0K A;  5IPG A;  3PIN A;  4DEJ A;  4WET A;  2WRT A;  3E9J B;  2CV4 A;  3UEM A;  3G7I A;  1G0T A;  3Q6O A;  1GUK A;  4O7H A;  2IPA A;  3C7M A;  1C72 A;  3F4T A;  1SJ6 A;  2E0Q A;  3CSJ A;  3EU4 A;  4AJ6 A;  5EPF A;  5A4W A;  2WDU A; 
#chains in the Genus database with same CATH homology
 4EIP A;  4IJI A;  3BBY A;  5ID2 A;  4ECJ A;  2JSY A;  1E2Y A;  3HZ4 A;  3P90 A;  5ECH B;  5F0G A;  5CRH A;  5CP1 A;  1K0M A;  5ECM B;  1CQG A;  2N5B A;  4X4J A;  2YZU A;  2YJ7 A;  4J2F A;  4KSO A;  2C0E A;  2F8A A;  3HA9 A;  5ELG A;  5D96 A;  2LQO A;  1V57 A;  1EOG A;  1T00 A;  3FMW A;  3FHK A;  1OAZ A;  2AHE A;  1VF1 A;  2HT9 A;  1SKR B;  2LUS A;  5DDL A;  2QC7 A;  3P2A A;  2H75 A;  5JWO B;  2GST A;  3BCI A;  2OA7 A;  1FO5 A;  1YQ1 A;  4BVX B;  2LNT A;  4MLY A;  1IYI A;  3IA1 A;  3EYT A;  3IR4 A;  2I81 A;  3ZL5 A;  3D4M A;  4USS A;  1PQN A;  5IMZ A;  1Z7R A;  3TOU A;  2R4V A;  1USB A;  2G0F A;  1B8X A;  4WBR D;  4LLR A;  2X64 A;  3DXB A;  4MDC A;  1S3D A;  5D9X A;  2B3S A;  2CVK A;  2LJR A;  4NHW A;  3GYK A;  4YKF A;  3Q18 A;  2K6V A;  2YV7 A;  2GTU A;  1ERV A;  4E8E A;  2N5A A;  2JL4 A;  2R6K A;  3CTG A;  3L9U A;  5G31 A;  4HOJ A;  3KM6 A;  3GA4 A;  4RQR A;  3FZ4 A;  3D21 A;  4KGI A;  1T3B A;  3RHB A;  2H6X A;  2H0I A;  2IME A;  1R4W A;  2PGT A;  1XBS A;  1MEK A;  2UZ8 A;  4YH2 A;  3FZ9 A;  3ISO A;  1G6Y A;  3GL3 A;  4HZ4 A;  3CTF A;  2XPE A;  4GST A;  3M9J A;  1I9D A;  4Z2R A;  3BJ5 A;  3US3 A;  4F9Z A;  4JBB A;  2HZE A;  1ZYQ B;  2O8V B;  2M46 A;  1FW1 A;  3C73 A;  3A5W A;  2X8G A;  3IHQ A;  4HS1 A;  2OBI A;  5CYY A;  2CAQ A;  3KIJ A;  1SYX A;  5J5N A;  2C3T A;  4FYC A;  5HQP A;  1M0U A;  1XFL A;  3KJY A;  2GSR A;  3UAP A;  5IMV A;  3APS A;  1B9X C;  5H5R A;  2XHF A;  4BWS A;  2H73 A;  2BMX A;  1SL0 B;  1NHO A;  2KOK A;  1KEB A;  1KBN A;  1VRS D;  4CW9 A;  4PUR A;  2YV9 A;  4MJC A;  1ZL9 A;  4JRR A;  2VIM A;  1YDK A;  3F6F A;  2PVO C;  3APQ A;  4G0L A;  4BA7 A;  2DLX A;  1XW6 A;  3WT2 A;  1AUC A;  3W8J A;  3QMX A;  4BPY A;  4P3Y B;  3MIX A;  5DCG A;  1LBK A;  4L5O A;  4YQM A;  1V9W A;  3ERG A;  2F9S A;  1SD8 A;  4OFM A;  4MZW A;  1BG5 A;  1TI3 A;  4K9Z A;  1TRW A;  2A2S A;  2HRN A;  1WJK A;  4L0W A;  4N11 A;  2O7K A;  9GSS A;  4AF2 A;  2CT6 A;  1ST9 A;  1WIK A;  1BQ7 A;  2R3X A;  1AXD A;  1HD2 A;  2MBS A;  3VPT A;  3VUR A;  5ECK B;  3GTU B;  1X9M B;  2ZCT A;  1GSY A;  1GTB A;  2OE1 A;  4X1U A;  4GF0 A;  1F2E A;  3D0Z A;  4ML6 A;  2E2G A;  7GSS A;  5JCU A;  4XRA A;  4NHZ A;  5CRG A;  1EWX A;  5BRT A;  2GDR A;  2K18 A;  5F05 A;  1DE1 A;  2FLS A;  2FY6 A;  5EY6 A;  1AC1 A;  1ABA A;  4TR0 A;  1K0N A;  4YQV A;  5F07 A;  4TXV A;  5JCG A;  4MZC A;  3GV1 A;  2B1L A;  5CRW A;  2OE0 A;  3ZFL A;  1HYU A;  4X43 A;  10GS A;  2C3N A;  3EVI A;  3GST A;  3GH6 A;  4OD7 A;  5ECO B;  3MSZ A;  3C1S A;  3DRN A;  1O85 A;  4PQ1 A;  3V1W A;  16GS A;  1PX6 A;  4ZIL A;  3MYD A;  2JZT A;  2F8F A;  1BED A;  4IQA A;  2O85 A;  1XOB A;  3QFA C;  4RQX A;  1S3A A;  3FK8 A;  4V2L A;  2YZH A;  4FYB A;  4PNG A;  3APO A;  2RUF A;  4QQ7 A;  2P31 A;  4EDZ A;  5GZZ B;  1DSB A;  3L0H A;  5DAK B;  2GZY A;  1RK4 A;  1WMJ A;  3U6V A;  2VM2 A;  1R5A A;  4PGT A;  3RBT A;  4F0B A;  3WT1 A;  1EV4 A;  3LYK A;  2VAF A;  4MF6 A;  2RUE A;  1YKC A;  2IJY A;  4OCE A;  2V32 A;  4ZBA A;  4DSS B;  2VCQ A;  4I8B A;  1ACV A;  2J9H A;  2X4A A;  1PL1 A;  1QMV A;  1UN2 A;  2HI7 A;  1Z9H A;  1ZOF A;  2NVL A;  2HXK A;  3ED3 A;  2QSI A;  3LYP A;  2B5E A;  3UMA A;  2VL2 A;  2YWN A;  4MP4 A;  5G1K A;  2FWE A;  1EGR A;  5D73 A;  4EXJ A;  5G2Z A;  3IV4 A;  5G1L A;  4IVF A;  2LEG A;  3G7Y A;  2L5O A;  5G5E A;  1PN9 A;  1OC9 A;  4G9H A;  1GSQ A;  3FRC A;  4MH2 A;  4N0Z A;  3VWU A;  1FOV A;  4PNF A;  4ZBD A;  3EMP A;  4IP6 A;  5ECP B;  1ERW A;  5GSS A;  2FHE A;  2FWG A;  1AQX A;  5J9C A;  5D9T A;  3UOM A;  5ID2 B;  2YN1 A;  3GFK A;  5D8I A;  3KP9 A;  4TR3 A;  2VL3 A;  1K3O A;  5KN0 A;  1DE2 A;  4XS6 A;  4JR6 A;  4KB3 A;  3QR6 A;  1MDJ A;  4NMU A;  3Q74 A;  4HQS A;  2YOI A;  4F82 A;  1M2A A;  1X9W B;  2KP2 A;  2NBS A;  4MPG A;  3PH9 A;  4RI6 A;  2H1A A;  2DIZ A;  2LRC A;  1MD3 A;  2V2G A;  3VI7 A;  1TTZ A;  4EO3 A;  2HRA A;  5CAX A;  3PGT A;  1A0R P;  1HNA A;  4HI7 A;  1O81 A;  1THX A;  4KA0 A;  2A2R A;  13GS A;  4AJ8 A;  1NM3 A;  4O5U A;  4XS4 A;  2B7J A;  1W89 A;  4POK A;  5DCH A;  5F06 A;  3TKS C;  1SK1 A;  5A4U A;  3TRP A;  4LMW A;  4TXO A;  1AAZ A;  1SJI A;  2WJU A;  1LJR A;  2PVQ A;  2IFQ A;  1PX7 A;  1O6J A;  1F3B A;  2LS5 A;  5IMA A;  4RUV A;  2HSM A;  3Q19 A;  2C0D A;  4KF9 A;  1WPI A;  1OKD A;  1TRS A;  4WF4 A;  1OKT A;  3TJJ A;  2CZ2 A;  3ZIT A;  2EIQ A;  3GX8 A;  3ZML A;  1TJD A;  2D2Z A;  5HFK A;  2KLX A;  4D73 A;  3J7Y k;  4IEL A;  3J7Y b;  4NWY A;  3F4R A;  3ZRD A;  5LCZ A;  1EP8 A;  3D4T A;  3L9S A;  4PXO A;  4Q5F A;  3ZTL A;  4IS0 A;  1GSD A;  2YJH A;  2L4Q A;  2VD0 A;  3UJ1 A;  2LST A;  4YQU A;  3IPZ A;  2CX4 A;  4TR1 A;  1K0O A;  3GRX A;  3GUR A;  3HZ8 A;  5HR0 A;  2VUP A;  4MAB A;  4XHM A;  3EPT A;  2LQQ A;  1V98 A;  1G7E A;  4MF5 A;  5B8A A;  1N2A A;  1O8X A;  3ZRE A;  4NV5 A;  4ECB A;  2ON5 A;  3EMX A;  2REM A;  5AIX A;  2KHP A;  3CSH A;  5EL8 A;  2IMK A;  2H19 A;  2HSY A;  3F3Q A;  20GS A;  2XBQ A;  3L4N A;  5LD0 A;  1TW9 A;  4E8H A;  4ID0 A;  2DKH A;  2B5X A;  2FA4 A;  4K5R A;  5CO3 A;  1UC7 A;  3MDK A;  2OJL A;  3ZZX A;  2FWH A;  1HNC A;  3C71 A;  5LNK e;  2CAI A;  4I5Q A;  2NTO A;  3EWL A;  3FZA A;  2DML A;  1E6B A;  1A23 A;  2X49 A;  1XWA A;  3FYG A;  3VWV A;  4XRD A;  1BJX A;  2HRK A;  3DEX A;  1BX9 A;  3O76 A;  4TW5 A;  1X9S B;  1YF1 A;  2HE3 A;  1TP9 A;  5DQY A;  2LKU A;  4ZXG A;  2L5L A;  2N5F A;  5GAP D;  1YEX A;  3HD5 A;  3JCM L;  1O8W A;  3LEF A;  5D9W A;  3HCZ A;  3TKR A;  5ECL B;  2HLS A;  3TDG A;  4AGS A;  3F63 A;  5JWQ B;  4V2M A;  3TRQ A;  4O5Q A;  1U88 A;  4LL1 B;  4ZB6 A;  14GS A;  3RPP A;  1T1V A;  3ERF A;  4TR4 A;  5FHI A;  4MJA A;  1K3L A;  2IWT A;  4FYU A;  2OAD A;  3VLN A;  2H72 A;  1I5G A;  3IDV A;  1Z6M A;  1QQ2 A;  3TKP A;  1SD9 A;  3ZIV A;  5DQS A;  4FH8 A;  5L71 A;  4ECC A;  4MK3 A;  2R5G A;  6GST A;  2PMT A;  3M3M A;  1M99 A;  3TB2 A;  2ZUP A;  4EL1 A;  1MTC A;  4ULX A;  3IK9 A;  2OAC A;  1WRY A;  2LV3 A;  3DVW A;  3TGZ A;  3AY8 A;  5D9V A;  1MDK A;  2A2P A;  3ZFB A;  1H4O A;  1FVK A;  1V2A A;  2OE3 A;  1LU4 A;  2FWF A;  2B5Y A;  1GSF A;  4ACS A;  2E2M A;  3M0F A;  1Z7P A;  4J57 E;  4JZQ A;  5G30 A;  2R0G A;  3I43 A;  3E3E A;  4ZL9 A;  2FGX A;  2AV4 A;  3DWV A;  2JZR A;  4Z2T A;  2R0P A;  1K0A A;  1ZZY A;  5J3R A;  4HJM A;  1GH2 A;  4HEA 2;  1A2M A;  3QDN A;  4EVM A;  2L57 A;  4LL4 B;  5H5Q A;  2H1G A;  4IW9 A;  1X5C A;  2DMM A;  3RHC A;  5IPH A;  4WXT A;  2C80 A;  5IQY A;  2WUL A;  3ERW A;  1FG4 A;  2FCH A;  2HNL A;  5DAL A;  3MNG A;  1AW9 A;  1XOA A;  4OMV A;  4N30 A;  4K7N A;  3EUR A;  3DVX A;  4MJE A;  4F03 A;  2KP1 A;  3GKX A;  2MBT A;  4JE1 A;  1XVW A;  1OVN A;  1Y25 A;  4TOP A;  2LJK A;  2GT5 A;  1PD2 1;  2AAW A;  1GUL A;  5KN3 A;  4OO4 A;  4I2T A;  3GX0 A;  3QAW A;  3KH7 A;  1NHY A;  2VOC A;  3UBL A;  1Q4J A;  1XWG A;  1Z3E A;  1GTI A;  4ECI A;  1BYE A;  3DML A;  4K0N A;  2VCX A;  2VLV A;  2WFC A;  4OFN A;  1ERT A;  3H4K A;  2LRN A;  4GLT A;  3FR6 A;  2GS3 A;  2GQL A;  2DSA A;  5IM9 A;  2AUV A;  1U3A A;  4I2U A;  4GSS A;  4G19 A;  1XWK A;  4EF0 A;  3QAV A;  4PUA A;  1Z5Y E;  3ZLP A;  2IIY A;  5IIZ A;  4GWR A;  1X0R A;  2AB6 A;  2IMF A;  3M1G A;  4MCU A;  3NIV A;  4L8E A;  4TXO B;  2H8L A;  4HU7 A;  5J41 A;  3O6T A;  2IFQ B;  4L0U A;  2GSQ A;  1JZD A;  2WCI A;  3G7J A;  5G5F A;  4WBJ A;  3LG6 A;  4Q5R A;  3F0I A;  3LWA A;  4EC0 A;  2K8S A;  1TXX A;  2NDO A;  3NZN A;  3WGX A;  17GS A;  1J9B A;  4K0G A;  1SKW B;  1VGL A;  4YAV A;  4KCA A;  3L78 A;  4D73 B;  2ES7 A;  3NOF A;  6GSY A;  4IBP A;  1GSE A;  1UA5 A;  1WOU A;  3C1R A;  1H75 A;  4ZBB A;  2HRF A;  1THO A;  2AYT A;  1UVZ A;  5AIV A;  4A5P A;  3KTL A;  3H93 A;  3GN3 A;  4NPB A;  2JAC A;  1XZO A;  1A2J A;  3TCO A;  3L9V A;  1SL2 B;  3KGK A;  2A4H A;  1ZYE A;  2H70 A;  2O87 A;  2DJ3 A;  1T7P B;  1VF2 A;  1O7U A;  3VFI A;  5CRE A;  3UVH A;  2GSS A;  3GKM A;  3MWH A;  1AIU A;  2M80 A;  4WEY A;  1ZGN A;  5KN2 A;  3G9B A;  2DKI A;  4ILF A;  1GWC A;  5IMF A;  1WE0 A;  2H66 A;  2RLI A;  3F6D A;  2J23 A;  1PGT A;  2MZC A;  1IYH A;  3TKS A;  3IOS A;  1J0F A;  3WGD A;  2HSH A;  4RI7 A;  4BVY A;  2L6D A;  2TRC P;  3ZVJ D;  4ZL8 A;  1GP1 A;  3EC3 A;  4N10 A;  2M72 A;  1GSS A;  1QUW A;  3E0U A;  4KCE A;  4EE0 A;  1A0F A;  4KDX A;  4DSR A;  2VL2 C;  4V1A g;  2WS2 A;  4L5L A;  2DJJ A;  1SJZ A;  3I9V 2;  2B7K A;  2C3Q A;  4GCI A;  3IAM 2;  3O3T A;  4XCS A;  1EEJ A;  3FR9 A;  3P7X A;  1OE8 A;  4HU9 A;  2F3M A;  4MNN A;  3ZVJ A;  1Q98 A;  3TJB A;  5ECQ B;  2B6M A;  4O5R A;  1GUM A;  4I6X A;  5ENU A;  3H8Q A;  2WGR A;  3IC8 A;  2VCW A;  4IN0 A;  2V41 A;  1WP0 A;  4PX1 A;  4CY6 A;  4G10 A;  3GH9 A;  5A5K A;  2H76 A;  1TRV A;  5J9B A;  3CRT A;  2DBC A;  4K2X A;  1OC3 A;  1EGO A;  4FIW A;  2R37 A;  1YEP A;  4TRX A;  4QL9 A;  3HHV A;  1G7O A;  1YJ6 A;  1MD4 A;  3F3R A;  3TKS E;  4K5S A;  2WB9 A;  1YKA A;  4J56 E;  4F0C A;  3DYR A;  2L4C A;  3HJM A;  4XIH A;  4KH7 A;  1XCC A;  2ALB A;  3D6I A;  1ZYP A;  4TVE A;  2DIY A;  3LXZ A;  2E7P A;  3BCK A;  4ZIJ A;  2DC5 A;  1YY7 A;  4XTS A;  2PER A;  1K3Y A;  1XVQ A;  2RM5 A;  2HZE B;  4EDY A;  1R26 A;  2LTK A;  4Z7X A;  3WGE A;  2VL9 A;  3FKF A;  4EKZ A;  3H79 A;  2YWO A;  3LGC A;  1TU7 A;  5DAK A;  4YAP A;  1NW2 A;  1WWJ A;  2BJX A;  2VD1 A;  1XXU A;  1T8E B;  2X8H A;  2IMD A;  1ILO A;  1JFU A;  2NPB A;  3UIW A;  3D5J A;  2X8C A;  2MMZ A;  2TRX A;  3KXO A;  5IO2 A;  2XBI A;  1FAA A;  3TRX A;  2VCV A;  3A5I A;  1K0B A;  4K6X A;  1F3A A;  2GQK A;  2VO4 A;  1KNG A;  4FQU A;  4BL7 A;  2X99 A;  3KD0 A;  3LXT A;  3CSI A;  3DGQ A;  6GSS A;  3HVV A;  5ECN B;  4CDO A;  4XS1 A;  2LRT A;  2A4V A;  3KH9 A;  2XC2 A;  4ML1 A;  3IAS 2;  3HVX A;  1OC8 A;  1ZYN A;  1U87 A;  4Q5N A;  2O89 A;  3LW9 A;  1GL8 A;  4V1A p;  4NV2 A;  1SK0 A;  2GT6 A;  4LA1 A;  3RDW A;  3TJK A;  2BTO T;  1V40 A;  1SK2 A;  5KN1 A;  5DAL B;  2DJ0 A;  3IK7 A;  4KDU A;  1KTE A;  3GHA A;  4OO5 A;  4Z2U A;  1U3I A;  3FY7 A;  5HFI A;  4HQZ A;  3LFL A;  1ML6 A;  4KAE A;  4OFT A;  2LNS A;  1JHB A;  1A8L A;  1JZR A;  1PSQ A;  2H6Z A;  2EC4 A;  1GNE A;  1FOH A;  3D22 A;  5H5S A;  3TJF A;  2C0G A;  2I9H A;  4BWQ A;  4N0V A;  2RII A;  1A24 A;  2JAD A;  1CQH A;  2QKE A;  3ME8 A;  2K8V A;  2H01 A;  3UBK A;  3TUE A;  3R3E A;  2JSZ A;  4TKY A;  1VF4 A;  3UVT A;  2YNX A;  4QL7 A;  5C00 A;  4GSN A;  2DJ1 A;  1B9Y C;  4MPF A;  1W4V A;  19GS A;  5B6N A;  3CYN A;  4ICY A;  3UAR A;  4YKG A;  3EE2 A;  3KP8 A;  3VWW A;  1FB6 A;  1TOF A;  1XWC A;  2CX3 A;  2EIO A;  2FUG 2;  4K1F A;  1EOH A;  5B6M A;  3UL3 A;  1TK8 B;  5E59 A;  2IMI A;  4X0X A;  2GGT A;  3VK9 A;  3QD9 A;  3GMF A;  3IC4 A;  1F6M C;  2XPD A;  4IJ3 A;  5FT3 A;  1AQV A;  3A2V A;  4DSQ A;  5DJM A;  2IN3 A;  3HXS A;  1GTA A;  3GIX A;  3HY2 A;  1SL1 B;  2C1Y A;  3KMO A;  2MMO A;  2QA2 A;  22GS A;  2OBK A;  1F9M A;  1EZK A;  4KUN A;  4FO5 A;  1PMT A;  2H71 A;  1TDI A;  3DD3 A;  3BOA A;  2V1M A;  3GUS A;  4POM A;  4WR5 A;  5BMU A;  3VI5 A;  4NXI A;  3PR8 A;  3KZQ A;  3LOR A;  3ZIJ A;  4DVC A;  3R2Q A;  1TK5 B;  2VCT A;  3TOT A;  2ZNM A;  2HYX A;  3EIN A;  3P8W A;  5IOX A;  3N9J A;  5HR1 A;  4K8M A;  2GQM A;  2H74 A;  18GS A;  1JLW A;  3GKK A;  3TJG A;  2H30 A;  3HJP A;  4F2I A;  3IHG A;  5B8B A;  5GST A;  1Y6E A;  3K8N A;  3SWL A;  1PRX A;  4OWY A;  4PTS A;  1OC9 B;  2YP6 A;  2P0G A;  5D93 A;  5INY A;  5EVO A;  3CXG A;  3OR5 A;  4KDY A;  2VCZ A;  1YZX A;  2G2Q A;  2RM6 A;  1EP7 A;  2PWJ A;  1AQW A;  3ME7 A;  1GNW A;  11GS A;  1T4Y A;  6GSX A;  5A4V A;  1RW1 A;  1X5E A;  1XIY A;  2F51 A;  1R5P A;  3PPU A;  1T4Z A;  1OYJ A;  4BVY B;  1PKW A;  5IO0 A;  2CZ3 A;  4MMM A;  3ZMK A;  2KUC A;  3HJO A;  4POL A;  1BAY A;  2B1K A;  1V58 A;  5ELA A;  1O73 A;  3CMI A;  4V2N A;  4KE3 A;  2VLT A;  2EIR A;  4MJB A;  2PU9 C;  4POB A;  2VM1 A;  1N8J A;  2H1B A;  2YWM A;  3GSS A;  1PL2 A;  4IKH A;  1XW5 A;  3WYW A;  5E4W A;  3GL5 A;  5IMD A;  2VLU A;  1J08 A;  4IGJ A;  3SBC A;  1TKD B;  4XS4 B;  4BVX A;  1GRX A;  1QK8 A;  2FNO A;  3F9U A;  4H86 A;  2YWI A;  1XW9 A;  2P5Q A;  2C0F A;  1SU9 A;  3HDC A;  4ZB9 A;  4K7O A;  5HR3 A;  4AJ7 A;  1M9B A;  2L59 A;  3F4S A;  4Q5Q A;  3QPM A;  3N5O A;  3U5R E;  1M9A A;  1B4P A;  1JZO A;  1VF3 A;  2V6O A;  5COH A;  1QFN A;  4I97 A;  1TRU A;  2R0C A;  3LJR A;  5KEJ A;  3GKN A;  5IMC A;  2PBJ A;  2GZP A;  2CVB A;  3VPQ A;  3W8S A;  1GSU A;  1XPV A;  5ABR A;  1PA3 A;  2P5R A;  1FHE A;  1SEN A;  3BD2 A;  1K0D A;  3M8N A;  3ZYW A;  4CHS A;  4JU5 A;  2YPM A;  2H0H A;  1X5D A;  1FVJ A;  3I6A A;  2H6Y A;  3KEB A;  2I3Y A;  1A2L A;  2MYG A;  2JU5 A;  3QFB C;  4GQC A;  1URM A;  5AIS A;  4TR1 B;  3LSZ A;  3DKS A;  5JWR B;  2JZS A;  4KX4 A;  3FEU A;  4O92 A;  1EEM A;  2WZ9 A;  3GNJ A;  1XWB A;  3HVS A;  4ZB8 A;  2IL3 A;  4PQH A;  3VWX A;  1FB0 A;  4KW6 A;  2H0G A;  1M2D A;  1ZMA A;  6GSU A;  2PPT A;  3KCM A;  4BL7 B;  5B7C A;  2LJA A;  2GVP A;  2OKA A;  2TIR A;  4ZL7 A;  5IOW A;  5HR2 A;  5ECS A;  1PKZ A;  4IQ1 A;  4NAX A;  2QGV A;  4MH3 A;  2ON7 A;  3FZ5 A;  12GS A;  2DJK A;  4WF5 A;  5CNW A;  1QGV A;  3RAZ A;  4GTU A;  1S3C A;  4HJ2 A;  1EV9 A;  1TU8 A;  3W6G A;  1NSW A;  2CVD A;  2C4J A;  2HFD A;  2R2J A;  4TN8 A;  2MMN A;  2K9F A;  4G2E A;  3C8E A;  2MMA A;  4KSM A;  2L6C A;  1GLQ A;  3IRA A;  1F37 A;  4KND A;  1M2B A;  4WR4 A;  5GAN D;  1GUH A;  3S9F A;  2QA1 A;  3TKQ A;  4WKW A;  4O32 A;  5F8B A;  3HKR A;  5ECR B;  1HNB A;  3CRU A;  6GSV A;  1SKS B;  6GSW A;  3GTU A;  2PUK C;  4OCF A;  3H1N A;  4GQF A;  1B4Q A;  5AGY A;  4GXZ A;  2FD3 A;  4CY8 A;  1B48 A;  3IXR A;  1JLV A;  3A2X A;  2PN8 A;  3F8U A;  3FR3 A;  3A3T A;  8GSS A;  4K7I A;  3I69 A;  5AN1 A;  3M9K A;  1G6W A;  5KOX A;  1M7T A;  4HUA A;  4MZB A;  5HFG A;  4GRF A;  3IBH A;  4PUF C;  1SYR A;  3LQ7 A;  2FA8 A;  3HYP A;  4IHU A;  4JED A;  4G0I A;  1R7H A;  5KOW A;  2DJ2 A;  3QAG A;  1ZCP A;  1A8Y A;  3MAK A;  1TK0 B;  1GLP A;  3RPN A;  3FW2 A;  1YF0 A;  5FWG A;  2YAN A;  4JR4 A;  1U6T A;  4MA9 A;  5JCW A;  1PN0 A;  2HZF A;  2AJQ B;  1DBY A;  2V6K A;  2CA8 A;  1RQM A;  3EU3 A;  3QCP A;  2YCD A;  5ECI B;  2I1U A;  4IP1 A;  1TI1 A;  3QOU A;  2I4A A;  2H1D A;  4HZ2 A;  1QXH A;  4LMV A;  5CRD A;  2C8U A;  2GLR A;  1DUG A;  4K2D A;  4MF7 A;  3A2W A;  3DIE A;  3CBU A;  3KMN A;  3IE3 A;  4EIQ A;  2CQ9 A;  1HQO A;  1ERU A;  5C04 A;  5DBQ A;  3WD6 A;  4DSS A;  1MDI A;  1JZW A;  1Z6N A;  4PQI A;  3KTB A;  2GZZ A;  4EUY A;  4HDE A;  5DVB A;  5DJL A;  5J4U A;  1GTU A;  1OE7 A;  1K0C A;  2Z9S A;  4ISD A;  1ON4 A;  4G0K A;  5IPG A;  3PIN A;  4DEJ A;  4WET A;  2WRT A;  3E9J B;  2CV4 A;  3UEM A;  3G7I A;  1G0T A;  3Q6O A;  1GUK A;  4O7H A;  2IPA A;  3C7M A;  1C72 A;  3F4T A;  1SJ6 A;  2E0Q A;  3CSJ A;  3EU4 A;  4AJ6 A;  5EPF A;  5A4W A;  2WDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...