4FO5A

Crystal structure of a thioredoxin-like protein (bdi_1100) from parabacteroides distasonis atcc 8503 at 2.02 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
141
structure length
136
Chain Sequence
KLTEGVNPGDLAPRIEFKASFHNQLGRYTLLNFWAAYDAESRARNVQLANEVNKFGPDKIAMCSISMDEKESIFTETVKIDKLDLSTQFHEGLGKESELYKKYDLRKGFKNFLINDEGVIIAANVTPEKLTEILKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords thioredoxin-like protein
publication title Crystal structure of a thioredoxin-like protein (BDI_1100) from Parabacteroides distasonis ATCC 8503 at 2.02 A resolution
rcsb
source organism Parabacteroides distasonis
total genus 38
structure length 136
sequence length 141
ec nomenclature
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13905 Thioredoxin_8 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4fo5A00
4L5LA 3IPZA 3GH6A 5AIXA 1M9BA 1B48A 3CSJA 3US3A 1TRWA 4NWYA 4TR1B 2YZHA 2YWOA 4POKA 3ZIVA 4YQMA 2AV4A 4TOPA 1V40A 4RQXA 5INYA 3GSSA 5EPFA 2V1MA 2PGTA 3UBKA 2VUPA 2KLXA 1ST9A 5EY6A 5DJLA 1V57A 2H30A 5G30A 3ZL5A 5B8AA 4TXOB 5DVBA 6GSUA 4KDXA 2J9HA 2H0IA 4ZL9A 1JZRA 4MH3A 3UVHA 2B7JA 4EDYA 4E8EA 4IS0A 2YP6A 3E3EA 3Q74A 4K7OA 2G0FA 3TJKA 2DBCA 4BA7A 1OC3A 1OC9A 1EZKA 2R2JA 2PMTA 2FWHA 3C8EA 3GFKA 3GHAA 3TKRA 3LEFA 4IGJA 2NDOA 4KSMA 2LRCA 3I69A 4ZB6A 1X5EA 3ZVJA 4I8BA 4MDCA 2F51A 1USBA 2VM2A 1AW9A 1K3LA 4TN8A 2F3MA 1IYIA 1JZWA 2MBSA 5JCUA 2P5RA 1F6MC 2JZSA 4TRXA 3F0IA 4NHWA 4QL7A 4N10A 1LU4A 1AQWA 1OC8A 4PGTA 3DWVA 1OAZA 1XOAA 1M2BA 4TVEA 20GSA 4ZBDA 3GSTA 2H73A 1JHBA 1GUKA 2JZTA 5ELAA 4XIHA 1XPVA 3F6DA 1SK1A 4MJEA 3QOUA 1UVZA 1TU7A 2LTKA 2CQ9A 2XPEA 4N0VA 2GTUA 1GRXA 1KNGA 2TRXA 2VCWA 3NZNA 4EXJA 2H76A 2YV7A 4IVFA 5C00A 3QR6A 4NXIA 1YDKA 2GZPA 1G7EA 1IYHA 2PN8A 2JSZA 1B9YC 1E2YA 2DJJA 3W6GA 2R6KA 3ZLPA 3C1SA 4YAVA 2B5XA 4K6XA 3LYKA 3I6AA 4RI6A 1PQNA 3ERGA 2NPBA 3PH9A 1X5DA 2VLVA 5CRGA 1XVQA 3ME8A 3WGXA 1E6BA 2N5BA 1TK8B 2OE0A 3ZTLA 1TK0B 3HY2A 2MBTA 3GH9A 1X5CA 2GSTA 2PPTA 2B5YA 3ZMLA 1Z7RA 3M1GA 3JCML 2ON7A 1SYXA 3LXZA 3GURA 4FIWA 3GV1A 1Z6MA 5IMVA 1K0MA 4AJ8A 4WBJA 2B1LA 5G2ZA 4ZXGA 3HVSA 1J08A 3G7JA 4MPFA 1EEJA 1MDIA 3MNGA 5JWOB 3HZ4A 1TXXA 3TRXA 3O6TA 2P31A 3TOTA 1OE8A 6GSWA 5ECSA 4EKZA 3BJ5A 5ENUA 5ECKB 1ZZYA 2FD3A 1FO5A 1M2DA 1M7TA 3MWHA 3VLNA 2DC5A 3IR4A 5IIZA 5ECMB 2M80A 5A4WA 4DSSA 4NPBA 1A0RP 1GTUA 2LQQA 2FNOA 5H5QA 1KEBA 1QUWA 3DYRA 3F63A 3D4MA 3QDNA 4BWQA 3LG6A 4G2EA 3PR8A 3F4TA 1GULA 3RBTA 4XRAA 3G9BA 3A5WA 2CVBA 5CRHA 2AAWA 2B1KA 4EUYA 2HFDA 3LWAA 3TCOA 1WIKA 4X1UA 2PVQA 3W8SA 5KN1A 3FZ4A 5ELGA 1A2MA 1TOFA 4KH7A 5HR0A 1OYJA 4F9ZA 4CHSA 1HYUA 3ZYWA 3TJJA 1XWKA 2E7PA 4MF5A 1M99A 4CDOA 1GL8A 5D8IA 4GCIA 2XC2A 1U3AA 2KP1A 4POMA 4WF4A 3APQA 3HVVA 1NSWA 3DD3A 4AJ6A 2H8LA 5IO2A 3GNJA 2VCXA 3VPTA 5CP1A 1SKSB 2YWMA 2HT9A 2OBKA 2RUFA 5IM9A 2VCQA 5LCZA 1WRYA 2MMZA 1SU9A 3ZVJD 1ILOA 1T8EB 1O81A 2H71A 1GP1A 1T4YA 4X0XA 1K0BA 2L4QA 3KP8A 2IN3A 1WP0A 4I2TA 1YZXA 3K8NA 4K7NA 2IFQB 2YCDA 1ML6A 3F4RA 2DIZA 2KUCA 2H6YA 3IAS2 5IPHA 3E9JB 1XWBA 2QC7A 1ERVA 4HOJA 1BQ7A 1QXHA 1CQGA 3PGTA 2C1YA 2IIYA 4KDYA 5B6MA 2ZCTA 3IC4A 5IOXA 3FR9A 4RQRA 1Y25A 4K1FA 2JZRA 4HJMA 3GX0A 4K0NA 3GKXA 4NV5A 3TKSA 4N11A 1B9XC 4G10A 3G7IA 4EVMA 2NTOA 4RUVA 4IW9A 4WBRD 3H8QA 5E4WA 2V6KA 3FZAA 2A4VA 2GSRA 1TU8A 2J23A 4G9HA 5EVOA 3NIVA 1VRSD 3ZFLA 2ES7A 5KN3A 2XBIA 5B8BA 9GSSA 5EL8A 3P90A 2RLIA 1SL2B 3EMPA 4GXZA 5IMZA 5D9TA 1PN9A 1TRUA 2XBQA 4IJ3A 2L5OA 1FHEA 4OFMA 2DJ2A 5ECIB 5ECRB 4N30A 1YEPA 1GSUA 1A24A 2IMIA 1WOUA 3A2VA 1KTEA 2C0EA 1TJDA 5JWQB 4IQ1A 5ID2B 2OA7A 3TDGA 3U6VA 3A3TA 3EE2A 4I5QA 1U6TA 3M8NA 3MAKA 1Q4JA 3L9VA 2H01A 4QL9A 3N5OA 4OMVA 3DRNA 4MJBA 2YWIA 3QFAC 1GLQA 1TRVA 3TJFA 2EC4A 3M0FA 4ML6A 2KP2A 3KJYA 2WGRA 2P0GA 3GTUB 2NBSA 1ZMAA 3TJBA 2TRCP 4J56E 2RM6A 2VOCA 1S3DA 5IMCA 5KEJA 3ZFBA 1J0FA 4FO5A 2YNXA 2CX3A 1PL1A 3FEUA 14GSA 2EIQA 4MF6A 4GSNA 4F82A 4LMWA 5H5SA 1XBSA 1FVKA 5E59A 4MABA 5FHIA 3D5JA 4Q5QA 1K0CA 2FWEA 3APOA 4J57E 4PUFC 1YKAA 2WRTA 1VF4A 3UBLA 4FYBA 3C7MA 4HEA2 11GSA 2EIRA 3BCIA 4ML1A 1NM3A 3VI7A 2LJKA 4D73B 3S9FA 1K3YA 1PL2A 3QMXA 4QQ7A 2K18A 3VWWA 5CRDA 4J2FA 2H6ZA 1ZL9A 2H1GA 2V32A 2B3SA 1VF2A 1FAAA 2YJ7A 1MDJA 1BG5A 2MMOA 3TB2A 3SWLA 5F8BA 1B4QA 2H0HA 4ZBBA 4ECCA 1GUHA 1JLVA 5G5EA 1K0NA 1TW9A 3Q6OA 2H1BA 3VK9A 3D0ZA 2LS5A 2LJRA 2RM5A 5G1LA 3F3QA 3BCKA 1KBNA 1AQXA 1XXUA 1T3BA 3KXOA 5GAPD 1SJ6A 3KH9A 1N8JA 3WT1A 3IRAA 1TRSA 2QGVA 4MLYA 1GSFA 1X9MB 4L0UA 4ILFA 2HZEA 3QAWA 1TKDB 2L6DA 2OBIA 2B6MA 4MZCA 1R5AA 1PX7A 5IO0A 3J7Yb 4TR1A 4V2MA 3U5RE 3F3RA 2O89A 4P3YB 3G7YA 3IV4A 2AHEA 2A2SA 3ZMKA 2FGXA 3VI5A 2VL9A 2VM1A 10GSA 17GSA 4MCUA 2QSIA 1Q98A 3L0HA 3BD2A 4I97A 2I3YA 5CNWA 1RQMA 4GF0A 2FCHA 1AC1A 3RHCA 3WYWA 1S3AA 2HE3A 1MTCA 4FYCA 2KHPA 2ALBA 2O85A 4TXOA 3C1RA 2LSTA 2LJAA 3TGZA 2F8FA 3FRCA 3V1WA 2I4AA 2DJ1A 1DSBA 1FB6A 3OR5A 13GSA 2VL2C 2XHFA 3CYNA 3SBCA 5J4UA 4LL4B 2R4VA 2HI7A 2R5GA 3ZRDA 3TUEA 1HD2A 2B7KA 2LRNA 2AUVA 5C04A 5IQYA 5GSSA 5J41A 2BTOT 3KTLA 4JZQA 5HR2A 4O5RA 5LD0A 2WZ9A 2C3QA 3R2QA 2I81A 1EGRA 5F0GA 2FWGA 1ERWA 3L9UA 2FY6A 6GSXA 1XW6A 2RUEA 4LMVA 5ECLB 1Z7PA 3EWLA 4DSSB 6GSSA 2VIMA 2H75A 2CZ3A 4XHMA 4AJ7A 4DEJA 7GSSA 1TDIA 1GUMA 4BWSA 1GNEA 3KMNA 1FVJA 3Q19A 4HJ2A 1T1VA 1OE7A 2VLTA 5D96A 4WEYA 4G19A 1ON4A 2CVKA 2H72A 2GT6A 1CQHA 4NV2A 1M2AA 3TKSC 3QFBC 1R26A 1K0AA 3M9JA 1AIUA 2HYXA 4EC0A 2WS2A 3UAPA 4F03A 3FKFA 2H74A 4E8HA 2K9FA 4MPGA 1WWJA 4K9ZA 4WKWA 2YWNA 4KNDA 2CAIA 2CVDA 4FYUA 3NOFA 4GRFA 1THXA 3DEXA 3CBUA 4YQVA 1OKTA 1MD4A 3TKQA 1UC7A 2HZFA 1V58A 2N5AA 3TKPA 4MJAA 5IMAA 2C0DA 4ISDA 3KTBA 2MMNA 1EEMA 5A5KA 5HQPA 1FB0A 1EP8A 2HXKA 3ISOA 2LNTA 5G1KA 3EC3A 2IPAA 3F6FA 5A4VA 5B7CA 1TI1A 2ZUPA 5DALB 5H5RA 4KW6A 5HFGA 1H4OA 2DJ0A 4F2IA 3DVXA 1THOA 2L6CA 1W89A 3FK8A 3PINA 3L78A 4XS4B 4IQAA 2AJQB 2BMXA 3CXGA 3CRUA 1AAZA 3HD5A 2GLRA 4HI7A 4IKHA 1LJRA 3HKRA 1DE1A 1OKDA 1BX9A 2MZCA 5DAKA 2OACA 1SD9A 4X43A 2I9HA 4O92A 4K2DA 1JZDA 1ACVA 12GSA 1V9WA 2YJHA 5J5NA 3VWXA 2DMLA 4YAPA 2YZUA 3A2XA 1BEDA 3UMAA 5CYYA 3LYPA 4KX4A 4JR6A 3W8JA 4ID0A 3MSZA 4ZB9A 4XTSA 1ZOFA 3ME7A 4BPYA 1Z5YE 3HZ8A 3VFIA 4OO4A 2L57A 2ON5A 1F9MA 3HCZA 3DIEA 1I5GA 2GQLA 3IXRA 5HR1A 2LRTA 3CMIA 4XCSA 2LV3A 2AYTA 1ERUA 1PKZA 1A0FA 4L0WA 2V6OA 3O76A 1EGOA 1B4PA 2WJUA 4FH8A 1GSDA 3UJ1A 5F07A 3VWUA 2PUKC 2ZNMA 1A23A 3LORA 3IA1A 2CT6A 1O6JA 3QD9A 4HS1A 2OKAA 3FZ5A 1MEKA 2IMFA 4WR4A 2DJ3A 4POLA 4TXVA 5G31A 1URMA 19GSA 1VF3A 4HU9A 3IAM2 4JE1A 2H70A 3HXSA 4KDUA 3UVTA 4MP4A 3EYTA 3CTGA 3QCPA 2V2GA 3UEMA 4ZL8A 2IMEA 4KUNA 1HNCA 3AY8A 1XZOA 2LKUA 2PU9C 2IWTA 1GTIA 4HDEA 4ACSA 1X9WB 3L9SA 1T00A 2YV9A 2VD0A 1XCCA 5JWRB 4MMMA 4ULXA 2XPDA 1XIYA 2GZZA 5D9VA 5FWGA 2IFQA 4TR0A 4XS6A 2H66A 1T7PB 3DKSA 3UIWA 1J9BA 2HSHA 2JACA 4JBBA 4NHZA 1Z3EA 2REMA 2GSSA 2X8GA 2V41A 1EWXA 1G0TA 3IBHA 3FR6A 3P2AA 2FLSA 4WETA 1O73A 1ZYEA 1WE0A 2GQKA 2DJKA 3GUSA 2DMMA 3MDKA 4NMUA 4GLTA 5ECPB 3TKSE 3EURA 1R5PA 5JCGA 2H1AA 5IPGA 1H75A 5AIVA 1FW1A 1OC9B 18GSA 3Q18A 5ECNB 5CAXA 5GAND 5D9WA 1I9DA 4HQSA 1U3IA 4K0GA 1SJZA 3E0UA 3KMOA 5CREA 3D21A 3GL5A 4N0ZA 4HUAA 3QPMA 2KOKA 5LNKe 3FZ9A 4PX1A 2HNLA 2GS3A 1YY7A 2WULA 2H19A 5DCHA 1TP9A 3GRXA 3DGQA 1F2EA 3EU4A 3LGCA 5B6NA 5COHA 4K8MA 5J9BA 4KCEA 2E2MA 2HRNA 1RK4A 5DDLA 1SYRA 3L4NA 2JL4A 1XWAA 5IOWA 5ID2A 4K7IA 1HNAA 3BOAA 1G7OA 2MMAA 1EOGA 1EP7A 2IL3A 5DCGA 2O8VB 3ZREA 3F4SA 4Q5RA 2FHEA 1O8WA 1PD21 1W4VA 1XWGA 2VCTA 3FHKA 1U87A 4LLRA 2RIIA 4WF5A 5AN1A 1RW1A 3ED3A 1QMVA 2YN1A 2PBJA 3KGKA 3APSA 2R3XA 1QFNA 3GTUA 5IMFA 2VAFA 4PNFA 1UN2A 2IMKA 4ZILA 5KN0A 4CW9A 2CV4A 3VWVA 1EV9A 1O7UA 4OWYA 3IK7A 2M46A 6GSVA 5DQYA 4LL1B 1R4WA 3GL3A 3P7XA 1F3BA 4L8EA 4NAXA 4Z7XA 1JZOA 2YANA 4MF7A 4V2LA 4DVCA 3C71A 1GNWA 3D4TA 3KIJA 2WFCA 1ERTA 4MA9A 1GWCA 3KH7A 3LQ7A 4H86A 1GTBA 5HFIA 1SENA 5DJMA 2CAQA 4D73A 4HQZA 1K0OA 4MH2A 1BYEA 4GWRA 4OFTA 3LFLA 2FA4A 4O32A 4F0CA 1AQVA 1T4ZA 4BL7A 1XFLA 2BJXA 3WGDA 1N2AA 2C4JA 1MD3A 3UOMA 1WJKA 1SD8A 4L5OA 1NHOA 3IDVA 2VL3A 2C80A 2C8UA 1A8LA 3HDCA 2L4CA 3RAZA 3EMXA 4WXTA 2OE1A 1F3AA 1PGTA 4V1Ag 3IK9A 1XW5A 2GGTA 2F8AA 5KN2A 2K8VA 3P8WA 3FR3A 1UA5A 1LBKA 1YEXA 3GKKA 3EINA 4KE3A 4PQIA 3CSHA 4DSRA 1OVNA 1XOBA 2Z9SA 1VGLA 2HLSA 1O85A 1SK0A 1A2JA 3VPQA 1SKWB 2CZ2A 4PQHA 1QQ2A 4OCFA 3CSIA 2C0FA 2QKEA 5JCWA 4MK3A 3UL3A 1X0RA 2PERA 2K6VA 1XVWA 3HJPA 3GX8A 3LJRA 4V2NA 3GIXA 4EE0A 1SL1B 1ZYQB 2VCZA 3LSZA 2FUG2 4WR5A 3HHVA 3LXTA 1V98A 1V2AA 1XW9A 4ZB8A 5J3RA 2GQMA 4KGIA 2LEGA 2CX4A 1F37A 3HVXA 4POBA 3I43A 1WMJA 2L5LA 2JU5A 4KB3A 3QAGA 2YPMA 3TJGA 2GT5A 1QK8A 2X8HA 2X64A 1B8XA 1DE2A 3ZIJA 4BVYA 1ZCPA 1M9AA 2L59A 2JSYA 2O7KA 4EO3A 4HZ2A 3EVIA 2IJYA 2PWJA 1K3OA 2FWFA 3GYKA 3DMLA 5DAKB 4MZWA 2K8SA 3KCMA 2FA8A 3GN3A 3J7Yk 2CA8A 4IELA 3HJMA 3HYPA 2OE3A 2DIYA 6GSYA 2YOIA 2PVOC 1GTAA 1VF1A 3A2WA 3IHQA 1YKCA 3IE3A 3H93A 3KM6A 3D22A 3GA4A 1GSSA 5F06A 4KAEA 3ZZXA 4GSSA 4YH2A 1GSEA 1A8YA 2H6XA 1QGVA 2TIRA 3RDWA 2OADA 3FW2A 2WDUA 1YJ6A 1EV4A 3RHBA 3TRPA 1K0DA 2A2RA 4PQ1A 2F9SA 2GDRA 1A2LA 1GH2A 3H79A 22GSA 1SJIA 1Y6EA 5D93A 1ABAA 4Q5FA 1TI3A 1DBYA 5DBQA 3DXBA 3IOSA 2GZYA 2C3NA 2VO4A 3ZITA 1O8XA 5FT3A 4JU5A 3GKMA 2VLUA 4KSOA 3FYGA 3H4KA 5D9XA 2P5QA 2O87A 2E2GA 1M0UA 4ZIJA 3GKNA 4F0BA 1PX6A 5ECOB 1Z9HA 5J9CA 4I6XA 1JLWA 2H0GA 5IMDA 4GQCA 4IP6A 2G2QA 5HFKA 3WT2A 2R37A 1XWCA 2C0GA 1BJXA 2HSYA 3KP9A 4I2UA 3F8UA 1YF1A 3WD6A 2VCVA 4AF2A 2VL2A 2D2ZA 3QAVA 3TOUA 4ZBAA 4OO5A 1NW2A 4V1Ap 2GSQA 1DUGA 1WPIA 4IBPA 3HA9A 1S3CA 3N9JA 3KZQA 5A4UA 1PA3A 3CTFA 1YQ1A 4TR3A 2WB9A 4ECBA 4IHUA 1PRXA 1SL0B 5D73A 3UARA 1Z6NA 5DALA 3ERWA 3BBYA 4AGSA 1PSQA 3GMFA 5L71A 2WCIA 4KCAA 5ABRA 1U88A 3EU3A 2JADA 2IMDA 4XS4A 1BAYA 2X99A 1HNBA 1NHYA 3KEBA 4RI7A 1GSQA 2X8CA 2MYGA 4KA0A 3F9UA 4MZBA 1G6YA 3M3MA 1SK2A 3KD0A 4HZ4A 4PURA 5CO3A 3RPPA 3D6IA 2NVLA 2HRFA 5ECHB 5ECQB 4ZL7A 3RPNA 4XRDA 2E0QA 1ZGNA 4GQFA 4PNGA 3O3TA 5F05A 4YQUA 4ECJA 4OCEA 1PMTA 4BVXA 2C3TA 5HR3A 3C73A 3TRQA 4TW5A 4TR4A 1AUCA 2VD1A 1G6WA 2DSAA 3M9KA 4MJCA 4HU7A 1FG4A 1C72A 2OJLA 2B5EA 16GSA 4IN0A 4EL1A 1GSYA 5AGYA 5DQSA 4OFNA 4JEDA 1HQOA 4PUAA 1AXDA 3I9V2 1PKWA 1TTZA 1MDKA 4XS1A 4GSTA 4JR4A 2LQOA 1TK5B 1FOVA 3HJOA 4GTUA 1GLPA 4EDZA 2M72A 2AB6A 5G5FA 2I1UA 5GZZB 2H1DA 1YF0A 2GVPA 2N5FA 4TKYA 2LUSA 5GSTA 1R7HA 6GSTA 3ERFA 3VURA 4ECIA 1JFUA 3WGEA 3CRTA 3DVWA 1SKRB 2DLXA 4JRRA 4OD7A 3H1NA 1X9SB 4O7HA 5CRWA 4Q5NA 5AISA 4PXOA 2EIOA 8GSSA 2LNSA 4DSQA 4EF0A 3FY7A 1EOHA 4IP1A 4LA1A 2HZEB 4IJIA
chains in the Genus database with same CATH superfamily
4L5LA 3IPZA 3GH6A 5AIXA 1M9BA 1B48A 3CSJA 3US3A 1TRWA 4NWYA 4TR1B 2YZHA 2YWOA 4POKA 3ZIVA 4YQMA 2AV4A 4TOPA 1V40A 4G0KA 4RQXA 5INYA 3GSSA 5EPFA 2V1MA 2PGTA 3UBKA 2VUPA 2KLXA 1ST9A 5EY6A 5DJLA 1V57A 2H30A 5G30A 3ZL5A 5KOXA 5B8AA 4TXOB 5DVBA 6GSUA 4KDXA 2J9HA 2H0IA 4ZL9A 1JZRA 4MH3A 3UVHA 2B7JA 4HSCX 4EDYA 4E8EA 4IS0A 2YP6A 3E3EA 3Q74A 4K7OA 2G0FA 3TJKA 2DBCA 4BA7A 1OC3A 1OC9A 1EZKA 2R2JA 2PMTA 2FWHA 3C8EA 3GFKA 3GHAA 3TKRA 3LEFA 4IGJA 2NDOA 4KSMA 2LRCA 4KF9A 3I69A 4ZB6A 1X5EA 4X4JA 3ZVJA 4I8BA 4MDCA 2F51A 1USBA 2VM2A 1AW9A 1K3LA 4TN8A 2F3MA 1IYIA 1JZWA 3PPUA 2MBSA 5JCUA 4ICYA 2P5RA 1ZYNA 1F6MC 2JZSA 4TRXA 3F0IA 4QL7A 2HRAA 4NHWA 2R0PA 4N10A 1LU4A 1AQWA 1OC8A 3CQFA 4PGTA 3DWVA 1OAZA 1XOAA 1M2BA 4TVEA 20GSA 4ZBDA 3GSTA 2H73A 1JHBA 1GUKA 4G0LA 2JZTA 5ELAA 4XIHA 1XPVA 3F6DA 1SK1A 1M3JA 4MJEA 3QOUA 1UVZA 1TU7A 2LTKA 2CQ9A 2XPEA 4N0VA 2GTUA 1GRXA 1KNGA 2TRXA 2VCWA 3NZNA 4EXJA 2H76A 2YV7A 4IVFA 5C00A 3QR6A 4NXIA 1YDKA 2GZPA 4A5PA 1G7EA 1IYHA 2PN8A 2JSZA 1B9YC 1E2YA 2DJJA 3W6GA 2R6KA 3ZLPA 3C1SA 4YAVA 2B5XA 4K6XA 3LYKA 2HRKA 3I6AA 4RI6A 1PQNA 3ERGA 2NPBA 3PH9A 1X5DA 2VLVA 5CRGA 1XVQA 3ME8A 3WGXA 1E6BA 2N5BA 1TK8B 2OE0A 3ZTLA 1TK0B 3HY2A 2MBTA 3GH9A 1X5CA 2GSTA 2PPTA 2B5YA 3ZMLA 1Z7RA 3M1GA 3JCML 2ON7A 1SYXA 3LXZA 3GURA 4FIWA 3GV1A 1Z6MA 5IMVA 1K0MA 4AJ8A 4WBJA 2B1LA 5G2ZA 4ZXGA 3HVSA 1J08A 3G7JA 4MPFA 1EEJA 1MDIA 3MNGA 5JWOB 3HZ4A 2QA1A 1TXXA 3TRXA 3O6TA 2P31A 3TOTA 1OE8A 6GSWA 5ECSA 4EKZA 3BJ5A 5ECKB 1ZZYA 5ENUA 2FD3A 1FO5A 1M2DA 1M7TA 3MWHA 3VLNA 2DC5A 3IR4A 5IIZA 5ECMB 2M80A 5A4WA 4DSSA 4NPBA 1A0RP 1GTUA 2LQQA 2FNOA 5H5QA 1KEBA 1QUWA 3DYRA 3F63A 3D4MA 3QDNA 4BWQA 3LG6A 4G2EA 3PR8A 3F4TA 1GULA 3RBTA 4XRAA 3G9BA 3A5WA 2CVBA 5CRHA 2AAWA 2B1KA 4EUYA 2HFDA 3LWAA 3TCOA 4YKGA 1WIKA 4X1UA 2PVQA 3W8SA 5KN1A 3FZ4A 5ELGA 1A2MA 1TOFA 4KH7A 5HR0A 1OYJA 4F9ZA 4CHSA 1HYUA 3ZYWA 3TJJA 2DKIA 1XWKA 2E7PA 4MF5A 1M99A 4CDOA 1GL8A 5D8IA 4CY8A 4GCIA 2XC2A 1U3AA 2KP1A 4POMA 4WF4A 3APQA 3HVVA 1NSWA 3DD3A 4AJ6A 2H8LA 1ZYPA 5IO2A 3GNJA 2VCXA 3VPTA 5CP1A 1SKSB 2YWMA 2HT9A 2OBKA 2RUFA 5IM9A 2VCQA 5LCZA 4O5UA 1WRYA 2MMZA 1SU9A 3ZVJD 1ILOA 1T8EB 1O81A 2H71A 1GP1A 4CY6A 1T4YA 4X0XA 1K0BA 2L4QA 3KP8A 2IN3A 1WP0A 4I2TA 1YZXA 4EIQA 3K8NA 4K7NA 2IFQB 2YCDA 1ML6A 3F4RA 2DIZA 2KUCA 2H6YA 3IAS2 5IPHA 3E9JB 1XWBA 2QC7A 3HVNA 1ERVA 4HOJA 1BQ7A 1PFOA 1QXHA 1CQGA 3PGTA 2C1YA 2IIYA 4KDYA 5B6MA 2ZCTA 3IC4A 5IOXA 3FR9A 4RQRA 1Y25A 4K1FA 2JZRA 1S3RA 4HJMA 3GX0A 4K0NA 3GKXA 4NV5A 3TKSA 4N11A 1B9XC 4G10A 3G7IA 4EVMA 2NTOA 4RUVA 4IW9A 4WBRD 3H8QA 5E4WA 2V6KA 2A4HA 3FZAA 2A4VA 2GSRA 1TU8A 2J23A 4G9HA 5EVOA 3NIVA 1VRSD 3ZFLA 2ES7A 5KN3A 2XBIA 5B8BA 9GSSA 3FMWA 5EL8A 4BIKA 3P90A 2RLIA 1SL2B 3EMPA 4GXZA 5IMZA 5D9TA 1PN9A 1TRUA 2XBQA 4IJ3A 2L5OA 1FHEA 4OFMA 4YKFA 2DJ2A 5ECIB 5ECRB 4N30A 1YEPA 1GSUA 1A24A 2IMIA 1WOUA 3A2VA 1KTEA 2C0EA 1TJDA 2R0CA 5JWQB 4IQ1A 5ID2B 2OA7A 3TDGA 3U6VA 3A3TA 3EE2A 4I5QA 1U6TA 3M8NA 3MAKA 1Q4JA 3L9VA 2H01A 4QL9A 3N5OA 4OMVA 3DRNA 4MJBA 2YWIA 3QFAC 1GLQA 1TRVA 3TJFA 2EC4A 3M0FA 4ML6A 2KP2A 3KJYA 2WGRA 2P0GA 3GTUB 2NBSA 1ZMAA 3TJBA 2TRCP 4J56E 2RM6A 2VOCA 1S3DA 5IMCA 5KEJA 3ZFBA 1J0FA 4FO5A 2YNXA 2CX3A 1PL1A 3FEUA 14GSA 4K5SA 2EIQA 4MF6A 4GSNA 4F82A 4LMWA 5H5SA 1XBSA 1FVKA 5E59A 4MABA 5FHIA 3D5JA 4Q5QA 1K0CA 2FWEA 3APOA 4J57E 4PUFC 1YKAA 2WRTA 1VF4A 3UBLA 4FYBA 3C7MA 4HEA2 11GSA 2EIRA 3BCIA 4ML1A 1NM3A 3VI7A 2LJKA 4D73B 3S9FA 1K3YA 1PL2A 3QMXA 4QQ7A 2K18A 3VWWA 4K2XA 4J2FA 5CRDA 2H6ZA 1ZL9A 4BL7B 2H1GA 2V32A 2B3SA 1VF2A 1FAAA 2YJ7A 1MDJA 1BG5A 2MMOA 3TB2A 3SWLA 5F8BA 4Z2TA 1B4QA 2H0HA 4ZBBA 4ECCA 1GUHA 1JLVA 5G5EA 1K0NA 1TW9A 3Q6OA 2H1BA 3VK9A 3D0ZA 2LS5A 2LJRA 2RM5A 5G1LA 3F3QA 3BCKA 1KBNA 1AQXA 1XXUA 1T3BA 3KXOA 5GAPD 1SJ6A 3KH9A 1N8JA 3WT1A 3IRAA 1TRSA 2QGVA 4MLYA 1GSFA 1X9MB 4L0UA 4ILFA 2HZEA 3QAWA 1TKDB 2L6DA 2OBIA 2B6MA 4MZCA 1R5AA 1PX7A 5IO0A 3J7Yb 4TR1A 4V2MA 3U5RE 3F3RA 2O89A 4P3YB 3G7YA 3IV4A 2AHEA 2A2SA 3ZMKA 2FGXA 3VI5A 2VL9A 2VM1A 10GSA 17GSA 4MCUA 2QSIA 1Q98A 3L0HA 3BD2A 4I97A 2I3YA 5CNWA 1RQMA 4GF0A 2FCHA 1AC1A 3RHCA 3WYWA 1S3AA 2HE3A 1MTCA 4FYCA 2KHPA 2ALBA 2O85A 4Z2RA 4BVYB 4TXOA 3C1RA 2LSTA 2LJAA 3TGZA 2F8FA 3FRCA 3V1WA 2I4AA 2DJ1A 1DSBA 1FB6A 3OR5A 13GSA 2VL2C 2XHFA 3CYNA 3SBCA 5J4UA 4LL4B 2R4VA 2HI7A 2R5GA 3ZRDA 3TUEA 1HD2A 2B7KA 3MIXA 2LRNA 2AUVA 5C04A 5IQYA 5GSSA 5J41A 2BTOT 3KTLA 4JZQA 5HR2A 4O5RA 5LD0A 2WZ9A 2C3QA 3R2QA 2I81A 1EGRA 5F0GA 2FWGA 1ERWA 3L9UA 2FY6A 6GSXA 1XW6A 2RUEA 4LMVA 5ECLB 1Z7PA 3EWLA 3MYDA 4DSSB 6GSSA 2VIMA 2H75A 2CZ3A 4XHMA 4AJ7A 4DEJA 7GSSA 1TDIA 1GUMA 4BWSA 1GNEA 3KMNA 1FVJA 3Q19A 4HJ2A 1T1VA 1OE7A 2VLTA 5D96A 4WEYA 4G19A 1ON4A 2CVKA 1XG8A 2H72A 2GT6A 1CQHA 4NV2A 1M2AA 3TKSC 3QFBC 1R26A 1K0AA 3M9JA 1AIUA 2HYXA 4EC0A 2HSMA 2WS2A 3UAPA 4F03A 3FKFA 2H74A 4E8HA 2K9FA 4MPGA 1WWJA 4K9ZA 4WKWA 2YWNA 1FOHA 4KNDA 2CAIA 2CVDA 4FYUA 3NOFA 2X49A 4GRFA 1THXA 3DEXA 3CBUA 4YQVA 1OKTA 1MD4A 3TKQA 1UC7A 2HZFA 1V58A 2N5AA 3TKPA 4MJAA 5IMAA 2C0DA 4ISDA 3KTBA 2MMNA 1EEMA 5A5KA 5HQPA 1FB0A 1EP8A 2HXKA 3ISOA 2LNTA 5G1KA 3EC3A 2IPAA 3F6FA 5A4VA 5B7CA 1TI1A 2ZUPA 5DALB 5H5RA 4KW6A 5HFGA 1H4OA 2DJ0A 4F2IA 3DVXA 1THOA 2L6CA 2R0GA 1W89A 3FK8A 3PINA 3L78A 4XS4B 4IQAA 2AJQB 2BMXA 3CXGA 3CRUA 1AAZA 3HD5A 2X4AA 2GLRA 4HI7A 4IKHA 1LJRA 3HKRA 1DE1A 1OKDA 1BX9A 2MZCA 5DAKA 2OACA 5BRTA 1SD9A 4X43A 2I9HA 4O92A 4K2DA 1JZDA 1ACVA 12GSA 1V9WA 2YJHA 5J5NA 3VWXA 2DMLA 4YAPA 2YZUA 3A2XA 1BEDA 3UMAA 5CYYA 3LYPA 4KX4A 4JR6A 4BVXB 3W8JA 4ID0A 3MSZA 4ZB9A 4XTSA 1ZOFA 3A5IA 3ME7A 4BPYA 1Z5YE 3HZ8A 3VFIA 4OO4A 2L57A 2ON5A 1F9MA 3HCZA 3DIEA 1I5GA 2GQLA 3IXRA 4O5QA 5HR1A 2LRTA 3CMIA 4XCSA 2LV3A 2AYTA 1ERUA 1PKZA 1A0FA 4L0WA 2V6OA 3O76A 1EGOA 1B4PA 2WJUA 4FH8A 1GSDA 3UJ1A 5F07A 3VWUA 2PUKC 2ZNMA 1A23A 3LORA 3IA1A 2CT6A 1M3IA 1O6JA 3QD9A 4HS1A 2OKAA 3FZ5A 1MEKA 2IMFA 4WR4A 2DJ3A 4POLA 4TXVA 5G31A 1URMA 19GSA 1VF3A 4HU9A 3IAM2 4JE1A 2H70A 3HXSA 4KDUA 3UVTA 4MP4A 3EYTA 3CTGA 3QCPA 2V2GA 3UEMA 4ZL8A 2IMEA 4KUNA 1HNCA 3AY8A 1XZOA 2LKUA 2PU9C 2IWTA 1GTIA 4HDEA 4ACSA 1X9WB 3L9SA 1T00A 2YV9A 2VD0A 1XCCA 5JWRB 4MMMA 4ULXA 2XPDA 1XIYA 2GZZA 5D9VA 5FWGA 2IFQA 4TR0A 4XS6A 2H66A 1T7PB 3DKSA 3UIWA 1J9BA 2HSHA 2JACA 4JBBA 4NHZA 1Z3EA 2REMA 2GSSA 2X8GA 2V41A 1EWXA 1G0TA 3IBHA 3FR6A 3P2AA 2FLSA 4USSA 4WETA 1O73A 1ZYEA 1WE0A 2GQKA 2DJKA 3GUSA 2DMMA 3MDKA 4NMUA 4GLTA 5ECPB 3TKSE 3EURA 1R5PA 5JCGA 2H1AA 5IPGA 1H75A 5AIVA 1FW1A 1OC9B 18GSA 3Q18A 5ECNB 5CAXA 5GAND 5D9WA 1I9DA 4HQSA 1U3IA 4K0GA 1SJZA 3E0UA 3KMOA 5CREA 3D21A 3GL5A 4N0ZA 4HUAA 3QPMA 2KOKA 5LNKe 3FZ9A 4PX1A 2HNLA 2GS3A 1YY7A 2WULA 2H19A 5DCHA 1TP9A 3GRXA 3DGQA 1F2EA 4EIPA 3EU4A 3LGCA 5B6NA 5COHA 4K8MA 5J9BA 4KCEA 2E2MA 2HRNA 1RK4A 5DDLA 1SYRA 3L4NA 2JL4A 1XWAA 5IOWA 5ID2A 4K7IA 1HNAA 3BOAA 1G7OA 2MMAA 1EOGA 1EP7A 2IL3A 5DCGA 4K5RA 2O8VB 3ZREA 3F4SA 4Q5RA 2FHEA 1O8WA 1PD21 1W4VA 1XWGA 2VCTA 3FHKA 1U87A 4LLRA 2RIIA 4WF5A 5AN1A 1RW1A 3ED3A 1QMVA 2YN1A 2PBJA 3KGKA 3APSA 2R3XA 1QFNA 3GTUA 5IMFA 4MNNA 2VAFA 4PNFA 1UN2A 2IMKA 4ZILA 5KN0A 4CW9A 2CV4A 3VWVA 1EV9A 1O7UA 4OWYA 3IK7A 2M46A 6GSVA 5DQYA 4LL1B 1R4WA 3GL3A 3P7XA 1F3BA 4L8EA 4NAXA 4Z7XA 1JZOA 2YANA 4MF7A 4V2LA 4DVCA 3C71A 1GNWA 3D4TA 3KIJA 2WFCA 1ERTA 4MA9A 1GWCA 3KH7A 3LQ7A 4H86A 1GTBA 5HFIA 1SENA 5DJMA 2CAQA 4D73A 4HQZA 1K0OA 4MH2A 1BYEA 4GWRA 4OFTA 3LFLA 2FA4A 4O32A 4F0CA 1AQVA 1T4ZA 4BL7A 1XFLA 2BJXA 3WGDA 1N2AA 2C4JA 1MD3A 3UOMA 1WJKA 1SD8A 4L5OA 1NHOA 3IDVA 2VL3A 2C80A 2C8UA 1A8LA 3HDCA 2L4CA 3RAZA 3EMXA 3R3EA 4WXTA 2OE1A 1F3AA 1PGTA 4V1Ag 3IK9A 2QA2A 1XW5A 2GGTA 2F8AA 5KN2A 2K8VA 3P8WA 3FR3A 1UA5A 1LBKA 1YEXA 3GKKA 3EINA 4KE3A 4PQIA 3CSHA 4DSRA 5KOWA 1OVNA 1XOBA 2Z9SA 4G0IA 1VGLA 2HLSA 1O85A 1SK0A 1A2JA 3VPQA 1SKWB 2CZ2A 4PQHA 1QQ2A 4OCFA 3CSIA 2C0FA 2QKEA 5JCWA 4MK3A 3UL3A 1X0RA 2PERA 2K6VA 1XVWA 3HJPA 3GX8A 3LJRA 4V2NA 3GIXA 4EE0A 1SL1B 1ZYQB 2VCZA 3LSZA 2FUG2 5BMUA 4WR5A 3HHVA 3LXTA 1V98A 1V2AA 1XW9A 4ZB8A 5J3RA 2GQMA 4KGIA 2LEGA 2CX4A 1F37A 3HVXA 4POBA 3I43A 1WMJA 2L5LA 2JU5A 4KB3A 3QAGA 2YPMA 3TJGA 2GT5A 1QK8A 2X8HA 2X64A 1B8XA 1DE2A 3ZIJA 4BVYA 1ZCPA 1M9AA 2L59A 2JSYA 2O7KA 3IC8A 4EO3A 4HZ2A 3EVIA 2IJYA 2PWJA 1K3OA 2FWFA 3GYKA 3DMLA 5DAKB 4MZWA 2K8SA 3KCMA 2FA8A 3GN3A 3J7Yk 2CA8A 4IELA 3HJMA 3HYPA 2OE3A 2DIYA 6GSYA 2YOIA 2PVOC 1GTAA 1VF1A 3A2WA 3IHQA 1YKCA 3IE3A 3H93A 3KM6A 4FQUA 3D22A 3GA4A 1GSSA 5F06A 4KAEA 3ZZXA 4GSSA 4YH2A 1GSEA 1A8YA 2H6XA 1QGVA 2TIRA 3RDWA 2OADA 3FW2A 2WDUA 1YJ6A 1EV4A 3RHBA 3TRPA 1K0DA 2A2RA 4PQ1A 3EPTA 2F9SA 2GDRA 1A2LA 1GH2A 3H79A 22GSA 1SJIA 1Y6EA 5D93A 1ABAA 4Q5FA 1TI3A 1DBYA 5DBQA 1PN0A 3DXBA 3IOSA 2GZYA 2C3NA 2VO4A 3ZITA 1O8XA 5FT3A 4JU5A 3GKMA 2VLUA 4KSOA 3FYGA 3H4KA 5D9XA 2P5QA 2O87A 2E2GA 1M0UA 4ZIJA 3GKNA 4F0BA 1PX6A 5ECOB 1Z9HA 5J9CA 4I6XA 1JLWA 2H0GA 3LW9A 5IMDA 4GQCA 4IP6A 2G2QA 5HFKA 3WT2A 2R37A 1XWCA 2C0GA 1BJXA 2HSYA 3KP9A 4I2UA 3F8UA 1YF1A 3WD6A 2VCVA 4AF2A 2VL2A 2D2ZA 3QAVA 3TOUA 4ZBAA 4OO5A 1NW2A 4V1Ap 2GSQA 1DUGA 1WPIA 4IBPA 3HA9A 1S3CA 3N9JA 3KZQA 5A4UA 1PA3A 3CTFA 1YQ1A 4TR3A 2WB9A 4ECBA 4IHUA 1PRXA 1SL0B 5D73A 3UARA 1Z6NA 5DALA 3ERWA 3BBYA 4AGSA 1PSQA 3GMFA 5L71A 2WCIA 4KCAA 5ABRA 1U88A 3EU3A 2JADA 2IMDA 4XS4A 1BAYA 2X99A 1HNBA 1NHYA 3KEBA 4RI7A 1GSQA 2X8CA 2MYGA 4KA0A 3F9UA 4MZBA 1G6YA 3M3MA 1SK2A 3KD0A 4HZ4A 4PURA 5CO3A 3RPPA 3D6IA 2NVLA 2HRFA 5ECHB 5ECQB 4ZL7A 3RPNA 4XRDA 2E0QA 1ZGNA 4GQFA 4PNGA 3O3TA 5F05A 4YQUA 4ECJA 4OCEA 1PMTA 4BVXA 2C3TA 5HR3A 3C73A 3TRQA 4TW5A 3IHGA 4TR4A 1AUCA 2VD1A 1G6WA 2DSAA 3M9KA 4MJCA 2A2PA 4HU7A 1FG4A 1C72A 2OJLA 2B5EA 16GSA 4IN0A 4EL1A 1GSYA 5AGYA 5DQSA 4Z2UA 4OFNA 4JEDA 1HQOA 4PUAA 1AXDA 3I9V2 1PKWA 1TTZA 1MDKA 4XS1A 4GSTA 4JR4A 2LQOA 1TK5B 1FOVA 3HJOA 4GTUA 1GLPA 4EDZA 2M72A 4PTSA 2AB6A 5G5FA 2I1UA 5GZZB 2H1DA 1YF0A 2GVPA 2N5FA 4TKYA 2LUSA 5GSTA 1R7HA 6GSTA 3ERFA 3VURA 4ECIA 1JFUA 3WGEA 3CRTA 3DVWA 1SKRB 2DLXA 4JRRA 4OD7A 3H1NA 1X9SB 4O7HA 5CRWA 4Q5NA 5AISA 4PXOA 2EIOA 8GSSA 2DKHA 2LNSA 4DSQA 4EF0A 3FY7A 2UZ8A 1EOHA 4IP1A 4LA1A 2HZEB 4IJIA
chains in the Genus database with same CATH topology
4L5LA 3IPZA 3GH6A 5AIXA 1M9BA 1B48A 3CSJA 3US3A 1TRWA 4NWYA 4TR1B 2YZHA 2YWOA 4POKA 3ZIVA 4YQMA 2AV4A 4TOPA 1V40A 4G0KA 4RQXA 5INYA 3GSSA 5EPFA 2V1MA 2PGTA 3UBKA 2VUPA 2KLXA 1ST9A 5EY6A 5DJLA 1V57A 2H30A 5G30A 3ZL5A 5KOXA 5B8AA 4TXOB 5DVBA 6GSUA 4KDXA 2J9HA 2H0IA 4ZL9A 1JZRA 4MH3A 3UVHA 2B7JA 4EDYA 4E8EA 4IS0A 2YP6A 3E3EA 3Q74A 4K7OA 2G0FA 3TJKA 2DBCA 4BA7A 1OC3A 1OC9A 1EZKA 2R2JA 2PMTA 2FWHA 3C8EA 3GFKA 3GHAA 3TKRA 3LEFA 4IGJA 2NDOA 4KSMA 2LRCA 4KF9A 3I69A 4ZB6A 1X5EA 4X4JA 3ZVJA 4I8BA 4MDCA 2F51A 1USBA 2VM2A 1AW9A 1K3LA 4TN8A 2F3MA 1IYIA 1JZWA 3PPUA 2MBSA 5JCUA 4ICYA 2P5RA 1ZYNA 1F6MC 2JZSA 4TRXA 3F0IA 4QL7A 2HRAA 4NHWA 2R0PA 4N10A 1LU4A 1AQWA 1OC8A 4PGTA 3DWVA 1OAZA 1XOAA 1M2BA 4TVEA 20GSA 4ZBDA 3GSTA 2H73A 1JHBA 1GUKA 4G0LA 2JZTA 5ELAA 4XIHA 1XPVA 3F6DA 1SK1A 4MJEA 3QOUA 1UVZA 1TU7A 2LTKA 2CQ9A 2XPEA 4N0VA 2GTUA 1GRXA 1KNGA 2TRXA 2VCWA 3NZNA 4EXJA 2H76A 2YV7A 4IVFA 5C00A 3QR6A 4NXIA 1YDKA 2GZPA 4A5PA 1G7EA 1IYHA 2PN8A 2JSZA 1B9YC 1E2YA 2DJJA 3W6GA 2R6KA 3ZLPA 3C1SA 4YAVA 2B5XA 4K6XA 3LYKA 2HRKA 3I6AA 4RI6A 1PQNA 3ERGA 2NPBA 3PH9A 1X5DA 2VLVA 5CRGA 1XVQA 3ME8A 3WGXA 1E6BA 2N5BA 1TK8B 2OE0A 3ZTLA 1TK0B 3HY2A 2MBTA 3GH9A 1X5CA 2GSTA 2PPTA 2B5YA 3ZMLA 1Z7RA 3M1GA 3JCML 2ON7A 1SYXA 3LXZA 3GURA 4FIWA 3GV1A 1Z6MA 5IMVA 1K0MA 4AJ8A 4WBJA 2B1LA 5G2ZA 4ZXGA 3HVSA 1J08A 3G7JA 4MPFA 1EEJA 1MDIA 3MNGA 5JWOB 3HZ4A 2QA1A 1TXXA 3TRXA 3O6TA 2P31A 3TOTA 1OE8A 6GSWA 5ECSA 4EKZA 3BJ5A 5ECKB 1ZZYA 5ENUA 2FD3A 1FO5A 1M2DA 1M7TA 3MWHA 3VLNA 2DC5A 3IR4A 5IIZA 5ECMB 2M80A 5A4WA 4DSSA 4NPBA 1A0RP 1GTUA 2LQQA 2FNOA 5H5QA 1KEBA 1QUWA 3DYRA 3F63A 3D4MA 3QDNA 4BWQA 3LG6A 4G2EA 3PR8A 3F4TA 1GULA 3RBTA 4XRAA 3G9BA 3A5WA 2CVBA 5CRHA 2AAWA 2B1KA 4EUYA 2HFDA 3LWAA 3TCOA 4YKGA 1WIKA 4X1UA 2PVQA 3W8SA 5KN1A 3FZ4A 5ELGA 1A2MA 1TOFA 4KH7A 5HR0A 1OYJA 4F9ZA 4CHSA 1HYUA 3ZYWA 3TJJA 2DKIA 1XWKA 2E7PA 4MF5A 1M99A 4CDOA 1GL8A 5D8IA 4CY8A 4GCIA 2XC2A 1U3AA 2KP1A 4POMA 4WF4A 3APQA 3HVVA 1NSWA 3DD3A 4AJ6A 2H8LA 1ZYPA 5IO2A 3GNJA 2VCXA 3VPTA 5CP1A 1SKSB 2YWMA 2HT9A 2OBKA 2RUFA 5IM9A 2VCQA 5LCZA 4O5UA 1WRYA 2MMZA 1SU9A 3ZVJD 1ILOA 1T8EB 1O81A 2H71A 1GP1A 4CY6A 1T4YA 4X0XA 1K0BA 2L4QA 3KP8A 2IN3A 1WP0A 4I2TA 1YZXA 4EIQA 3K8NA 4K7NA 2IFQB 2YCDA 1ML6A 3F4RA 2DIZA 2KUCA 2H6YA 3IAS2 5IPHA 3E9JB 1XWBA 2QC7A 1ERVA 4HOJA 1BQ7A 1QXHA 1CQGA 3PGTA 2C1YA 2IIYA 4KDYA 5B6MA 2ZCTA 3IC4A 5IOXA 3FR9A 4RQRA 1Y25A 4K1FA 2JZRA 4HJMA 3GX0A 4K0NA 3GKXA 4NV5A 3TKSA 4N11A 1B9XC 4G10A 3G7IA 4EVMA 2NTOA 4RUVA 4IW9A 4WBRD 3H8QA 5E4WA 2V6KA 2A4HA 3FZAA 2A4VA 2GSRA 1TU8A 2J23A 4G9HA 5EVOA 3NIVA 1VRSD 3ZFLA 2ES7A 5KN3A 2XBIA 5B8BA 9GSSA 3FMWA 5EL8A 3P90A 2RLIA 1SL2B 3EMPA 4GXZA 5IMZA 5D9TA 1PN9A 1TRUA 2XBQA 4IJ3A 2L5OA 1FHEA 4OFMA 4YKFA 2DJ2A 5ECIB 5ECRB 4N30A 1YEPA 1GSUA 1A24A 2IMIA 1WOUA 3A2VA 1KTEA 2C0EA 1TJDA 2R0CA 5JWQB 4IQ1A 5ID2B 2OA7A 3TDGA 3U6VA 3A3TA 3EE2A 4I5QA 1U6TA 3M8NA 3MAKA 1Q4JA 3L9VA 2H01A 4QL9A 3N5OA 4OMVA 3DRNA 4MJBA 2YWIA 3QFAC 1GLQA 1TRVA 3TJFA 2EC4A 3M0FA 4ML6A 2KP2A 3KJYA 2WGRA 2P0GA 3GTUB 2NBSA 1ZMAA 3TJBA 2TRCP 4J56E 2RM6A 2VOCA 1S3DA 5IMCA 5KEJA 3ZFBA 1J0FA 4FO5A 2YNXA 2CX3A 1PL1A 3FEUA 14GSA 4K5SA 2EIQA 4MF6A 4GSNA 4F82A 4LMWA 5H5SA 1XBSA 1FVKA 5E59A 4MABA 5FHIA 3D5JA 4Q5QA 1K0CA 2FWEA 3APOA 4J57E 4PUFC 1YKAA 2WRTA 1VF4A 3UBLA 4FYBA 3C7MA 4HEA2 11GSA 2EIRA 3BCIA 4ML1A 1NM3A 3VI7A 2LJKA 4D73B 3S9FA 1K3YA 1PL2A 3QMXA 4QQ7A 2K18A 3VWWA 4K2XA 4J2FA 5CRDA 2H6ZA 1ZL9A 4BL7B 2H1GA 2V32A 2B3SA 1VF2A 1FAAA 2YJ7A 1MDJA 1BG5A 2MMOA 3TB2A 3SWLA 5F8BA 4Z2TA 1B4QA 2H0HA 4ZBBA 4ECCA 1GUHA 1JLVA 5G5EA 1K0NA 1TW9A 3Q6OA 2H1BA 3VK9A 3D0ZA 2LS5A 2LJRA 2RM5A 5G1LA 3F3QA 3BCKA 1KBNA 1AQXA 1XXUA 1T3BA 3KXOA 5GAPD 1SJ6A 3KH9A 1N8JA 3WT1A 3IRAA 1TRSA 2QGVA 4MLYA 1GSFA 1X9MB 4L0UA 4ILFA 2HZEA 3QAWA 1TKDB 2L6DA 2OBIA 2B6MA 4MZCA 1R5AA 1PX7A 5IO0A 3J7Yb 4TR1A 4V2MA 3U5RE 3F3RA 2O89A 4P3YB 3G7YA 3IV4A 2AHEA 2A2SA 3ZMKA 2FGXA 3VI5A 2VL9A 2VM1A 10GSA 17GSA 4MCUA 2QSIA 1Q98A 3L0HA 3BD2A 4I97A 2I3YA 5CNWA 1RQMA 4GF0A 2FCHA 1AC1A 3RHCA 3WYWA 1S3AA 2HE3A 1MTCA 4FYCA 2KHPA 2ALBA 2O85A 4Z2RA 4BVYB 4TXOA 3C1RA 2LSTA 2LJAA 3TGZA 2F8FA 3FRCA 3V1WA 2I4AA 2DJ1A 1DSBA 1FB6A 3OR5A 13GSA 2VL2C 2XHFA 3CYNA 3SBCA 5J4UA 4LL4B 2R4VA 2HI7A 2R5GA 3ZRDA 3TUEA 1HD2A 2B7KA 3MIXA 2LRNA 2AUVA 5C04A 5IQYA 5GSSA 5J41A 2BTOT 3KTLA 4JZQA 5HR2A 4O5RA 5LD0A 2WZ9A 2C3QA 3R2QA 2I81A 1EGRA 5F0GA 2FWGA 1ERWA 3L9UA 2FY6A 6GSXA 1XW6A 2RUEA 4LMVA 5ECLB 1Z7PA 3EWLA 3MYDA 4DSSB 6GSSA 2VIMA 2H75A 2CZ3A 4XHMA 4AJ7A 4DEJA 7GSSA 1TDIA 1GUMA 4BWSA 1GNEA 3KMNA 1FVJA 3Q19A 4HJ2A 1T1VA 1OE7A 2VLTA 5D96A 4WEYA 4G19A 1ON4A 2CVKA 2H72A 2GT6A 1CQHA 4NV2A 1M2AA 3TKSC 3QFBC 1R26A 1K0AA 3M9JA 1AIUA 2HYXA 4EC0A 2HSMA 2WS2A 3UAPA 4F03A 3FKFA 2H74A 4E8HA 2K9FA 4MPGA 1WWJA 4K9ZA 4WKWA 2YWNA 1FOHA 4KNDA 2CAIA 2CVDA 4FYUA 3NOFA 2X49A 4GRFA 1THXA 3DEXA 3CBUA 4YQVA 1OKTA 1MD4A 3TKQA 1UC7A 2HZFA 1V58A 2N5AA 3TKPA 4MJAA 5IMAA 2C0DA 4ISDA 3KTBA 2MMNA 1EEMA 5A5KA 5HQPA 1FB0A 1EP8A 2HXKA 3ISOA 2LNTA 5G1KA 3EC3A 2IPAA 3F6FA 5A4VA 5B7CA 1TI1A 2ZUPA 5DALB 5H5RA 4KW6A 5HFGA 1H4OA 2DJ0A 4F2IA 3DVXA 1THOA 2L6CA 2R0GA 1W89A 3FK8A 3PINA 3L78A 4XS4B 4IQAA 2AJQB 2BMXA 3CXGA 3CRUA 1AAZA 3HD5A 2X4AA 2GLRA 4HI7A 4IKHA 1LJRA 3HKRA 1DE1A 1OKDA 1BX9A 2MZCA 5DAKA 2OACA 5BRTA 1SD9A 4X43A 2I9HA 4O92A 4K2DA 1JZDA 1ACVA 12GSA 1V9WA 2YJHA 5J5NA 3VWXA 2DMLA 4YAPA 2YZUA 3A2XA 1BEDA 3UMAA 5CYYA 3LYPA 4KX4A 4JR6A 4BVXB 3W8JA 4ID0A 3MSZA 4ZB9A 4XTSA 1ZOFA 3A5IA 3ME7A 4BPYA 1Z5YE 3HZ8A 3VFIA 4OO4A 2L57A 2ON5A 1F9MA 3HCZA 3DIEA 1I5GA 2GQLA 3IXRA 4O5QA 5HR1A 2LRTA 3CMIA 4XCSA 2LV3A 2AYTA 1ERUA 1PKZA 1A0FA 4L0WA 2V6OA 3O76A 1EGOA 1B4PA 2WJUA 4FH8A 1GSDA 3UJ1A 5F07A 3VWUA 2PUKC 2ZNMA 1A23A 3LORA 3IA1A 2CT6A 1O6JA 3QD9A 4HS1A 2OKAA 3FZ5A 1MEKA 2IMFA 4WR4A 2DJ3A 4POLA 4TXVA 5G31A 1URMA 19GSA 1VF3A 4HU9A 3IAM2 4JE1A 2H70A 3HXSA 4KDUA 3UVTA 4MP4A 3EYTA 3CTGA 3QCPA 2V2GA 3UEMA 4ZL8A 2IMEA 4KUNA 1HNCA 3AY8A 1XZOA 2LKUA 2PU9C 2IWTA 1GTIA 4HDEA 4ACSA 1X9WB 3L9SA 1T00A 2YV9A 2VD0A 1XCCA 5JWRB 4MMMA 4ULXA 2XPDA 1XIYA 2GZZA 5D9VA 5FWGA 2IFQA 4TR0A 4XS6A 2H66A 1T7PB 3DKSA 3UIWA 1J9BA 2HSHA 2JACA 4JBBA 4NHZA 1Z3EA 2REMA 2GSSA 2X8GA 2V41A 1EWXA 1G0TA 3IBHA 3FR6A 3P2AA 2FLSA 4USSA 4WETA 1O73A 1ZYEA 1WE0A 2GQKA 2DJKA 3GUSA 2DMMA 3MDKA 4NMUA 4GLTA 5ECPB 3TKSE 3EURA 1R5PA 5JCGA 2H1AA 5IPGA 1H75A 5AIVA 1FW1A 1OC9B 18GSA 3Q18A 5ECNB 5CAXA 5GAND 5D9WA 1I9DA 4HQSA 1U3IA 4K0GA 1SJZA 3E0UA 3KMOA 5CREA 3D21A 3GL5A 4N0ZA 4HUAA 3QPMA 2KOKA 5LNKe 3FZ9A 4PX1A 2HNLA 2GS3A 1YY7A 2WULA 2H19A 5DCHA 1TP9A 3GRXA 3DGQA 1F2EA 4EIPA 3EU4A 3LGCA 5B6NA 5COHA 4K8MA 5J9BA 4KCEA 2E2MA 2HRNA 1RK4A 5DDLA 1SYRA 3L4NA 2JL4A 1XWAA 5IOWA 5ID2A 4K7IA 1HNAA 3BOAA 1G7OA 2MMAA 1EOGA 1EP7A 2IL3A 5DCGA 4K5RA 2O8VB 3ZREA 3F4SA 4Q5RA 2FHEA 1O8WA 1PD21 1W4VA 1XWGA 2VCTA 3FHKA 1U87A 4LLRA 2RIIA 4WF5A 5AN1A 1RW1A 3ED3A 1QMVA 2YN1A 2PBJA 3KGKA 3APSA 2R3XA 1QFNA 3GTUA 5IMFA 4MNNA 2VAFA 4PNFA 1UN2A 2IMKA 4ZILA 5KN0A 4CW9A 2CV4A 3VWVA 1EV9A 1O7UA 4OWYA 3IK7A 2M46A 6GSVA 5DQYA 4LL1B 1R4WA 3GL3A 3P7XA 1F3BA 4L8EA 4NAXA 4Z7XA 1JZOA 2YANA 4MF7A 4V2LA 4DVCA 3C71A 1GNWA 3D4TA 3KIJA 2WFCA 1ERTA 4MA9A 1GWCA 3KH7A 3LQ7A 4H86A 1GTBA 5HFIA 1SENA 5DJMA 2CAQA 4D73A 4HQZA 1K0OA 4MH2A 1BYEA 4GWRA 4OFTA 3LFLA 2FA4A 4O32A 4F0CA 1AQVA 1T4ZA 4BL7A 1XFLA 2BJXA 3WGDA 1N2AA 2C4JA 1MD3A 3UOMA 1WJKA 1SD8A 4L5OA 1NHOA 3IDVA 2VL3A 2C80A 2C8UA 1A8LA 3HDCA 2L4CA 3RAZA 3EMXA 3R3EA 4WXTA 2OE1A 1F3AA 1PGTA 4V1Ag 3IK9A 2QA2A 1XW5A 2GGTA 2F8AA 5KN2A 2K8VA 3P8WA 3FR3A 1UA5A 1LBKA 1YEXA 3GKKA 3EINA 4KE3A 4PQIA 3CSHA 4DSRA 5KOWA 1OVNA 1XOBA 2Z9SA 4G0IA 1VGLA 2HLSA 1O85A 1SK0A 1A2JA 3VPQA 1SKWB 2CZ2A 4PQHA 1QQ2A 4OCFA 3CSIA 2C0FA 2QKEA 5JCWA 4MK3A 3UL3A 1X0RA 2PERA 2K6VA 1XVWA 3HJPA 3GX8A 3LJRA 4V2NA 3GIXA 4EE0A 1SL1B 1ZYQB 2VCZA 3LSZA 2FUG2 5BMUA 4WR5A 3HHVA 3LXTA 1V98A 1V2AA 1XW9A 4ZB8A 5J3RA 2GQMA 4KGIA 2LEGA 2CX4A 1F37A 3HVXA 4POBA 3I43A 1WMJA 2L5LA 2JU5A 4KB3A 3QAGA 2YPMA 3TJGA 2GT5A 1QK8A 2X8HA 2X64A 1B8XA 1DE2A 3ZIJA 4BVYA 1ZCPA 1M9AA 2L59A 2JSYA 2O7KA 3IC8A 4EO3A 4HZ2A 3EVIA 2IJYA 2PWJA 1K3OA 2FWFA 3GYKA 3DMLA 5DAKB 4MZWA 2K8SA 3KCMA 2FA8A 3GN3A 3J7Yk 2CA8A 4IELA 3HJMA 3HYPA 2OE3A 2DIYA 6GSYA 2YOIA 2PVOC 1GTAA 1VF1A 3A2WA 3IHQA 1YKCA 3IE3A 3H93A 3KM6A 4FQUA 3D22A 3GA4A 1GSSA 5F06A 4KAEA 3ZZXA 4GSSA 4YH2A 1GSEA 1A8YA 2H6XA 1QGVA 2TIRA 3RDWA 2OADA 3FW2A 2WDUA 1YJ6A 1EV4A 3RHBA 3TRPA 1K0DA 2A2RA 4PQ1A 3EPTA 2F9SA 2GDRA 1A2LA 1GH2A 3H79A 22GSA 1SJIA 1Y6EA 5D93A 1ABAA 4Q5FA 1TI3A 1DBYA 5DBQA 1PN0A 3DXBA 3IOSA 2GZYA 2C3NA 2VO4A 3ZITA 1O8XA 5FT3A 4JU5A 3GKMA 2VLUA 4KSOA 3FYGA 3H4KA 5D9XA 2P5QA 2O87A 2E2GA 1M0UA 4ZIJA 3GKNA 4F0BA 1PX6A 5ECOB 1Z9HA 5J9CA 4I6XA 1JLWA 2H0GA 3LW9A 5IMDA 4GQCA 4IP6A 2G2QA 5HFKA 3WT2A 2R37A 1XWCA 2C0GA 1BJXA 2HSYA 3KP9A 4I2UA 3F8UA 1YF1A 3WD6A 2VCVA 4AF2A 2VL2A 2D2ZA 3QAVA 3TOUA 4ZBAA 4OO5A 1NW2A 4V1Ap 2GSQA 1DUGA 1WPIA 4IBPA 3HA9A 1S3CA 3N9JA 3KZQA 5A4UA 1PA3A 3CTFA 1YQ1A 4TR3A 2WB9A 4ECBA 4IHUA 1PRXA 1SL0B 5D73A 3UARA 1Z6NA 5DALA 3ERWA 3BBYA 4AGSA 1PSQA 3GMFA 5L71A 2WCIA 4KCAA 5ABRA 1U88A 3EU3A 2JADA 2IMDA 4XS4A 1BAYA 2X99A 1HNBA 1NHYA 3KEBA 4RI7A 1GSQA 2X8CA 2MYGA 4KA0A 3F9UA 4MZBA 1G6YA 3M3MA 1SK2A 3KD0A 4HZ4A 4PURA 5CO3A 3RPPA 3D6IA 2NVLA 2HRFA 5ECHB 5ECQB 4ZL7A 3RPNA 4XRDA 2E0QA 1ZGNA 4GQFA 4PNGA 3O3TA 5F05A 4YQUA 4ECJA 4OCEA 1PMTA 4BVXA 2C3TA 5HR3A 3C73A 3TRQA 4TW5A 3IHGA 4TR4A 1AUCA 2VD1A 1G6WA 2DSAA 3M9KA 4MJCA 2A2PA 4HU7A 1FG4A 1C72A 2OJLA 2B5EA 16GSA 4IN0A 4EL1A 1GSYA 5AGYA 5DQSA 4Z2UA 4OFNA 4JEDA 1HQOA 4PUAA 1AXDA 3I9V2 1PKWA 1TTZA 1MDKA 4XS1A 4GSTA 4JR4A 2LQOA 1TK5B 1FOVA 3HJOA 4GTUA 1GLPA 4EDZA 2M72A 4PTSA 2AB6A 5G5FA 2I1UA 5GZZB 2H1DA 1YF0A 2GVPA 2N5FA 4TKYA 2LUSA 5GSTA 1R7HA 6GSTA 3ERFA 3VURA 4ECIA 1JFUA 3WGEA 3CRTA 3DVWA 1SKRB 2DLXA 4JRRA 4OD7A 3H1NA 1X9SB 4O7HA 5CRWA 4Q5NA 5AISA 4PXOA 2EIOA 8GSSA 2DKHA 2LNSA 4DSQA 4EF0A 3FY7A 2UZ8A 1EOHA 4IP1A 4LA1A 2HZEB 4IJIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L5L A;  3IPZ A;  3GH6 A;  5AIX A;  1M9B A;  1B48 A;  3CSJ A;  3US3 A;  1TRW A;  4NWY A;  4TR1 B;  2YZH A;  2YWO A;  4POK A;  3ZIV A;  4YQM A;  2AV4 A;  4TOP A;  1V40 A;  4RQX A;  5INY A;  3GSS A;  5EPF A;  2V1M A;  2PGT A;  3UBK A;  2VUP A;  2KLX A;  1ST9 A;  5EY6 A;  5DJL A;  1V57 A;  2H30 A;  5G30 A;  3ZL5 A;  5B8A A;  4TXO B;  5DVB A;  6GSU A;  4KDX A;  2J9H A;  2H0I A;  4ZL9 A;  1JZR A;  4MH3 A;  3UVH A;  2B7J A;  4EDY A;  4E8E A;  4IS0 A;  2YP6 A;  3E3E A;  3Q74 A;  4K7O A;  2G0F A;  3TJK A;  2DBC A;  4BA7 A;  1OC3 A;  1OC9 A;  1EZK A;  2R2J A;  2PMT A;  2FWH A;  3C8E A;  3GFK A;  3GHA A;  3TKR A;  3LEF A;  4IGJ A;  2NDO A;  4KSM A;  2LRC A;  3I69 A;  4ZB6 A;  1X5E A;  3ZVJ A;  4I8B A;  4MDC A;  2F51 A;  1USB A;  2VM2 A;  1AW9 A;  1K3L A;  4TN8 A;  2F3M A;  1IYI A;  1JZW A;  2MBS A;  5JCU A;  2P5R A;  1F6M C;  2JZS A;  4TRX A;  3F0I A;  4NHW A;  4QL7 A;  4N10 A;  1LU4 A;  1AQW A;  1OC8 A;  4PGT A;  3DWV A;  1OAZ A;  1XOA A;  1M2B A;  4TVE A;  20GS A;  4ZBD A;  3GST A;  2H73 A;  1JHB A;  1GUK A;  2JZT A;  5ELA A;  4XIH A;  1XPV A;  3F6D A;  1SK1 A;  4MJE A;  3QOU A;  1UVZ A;  1TU7 A;  2LTK A;  2CQ9 A;  2XPE A;  4N0V A;  2GTU A;  1GRX A;  1KNG A;  2TRX A;  2VCW A;  3NZN A;  4EXJ A;  2H76 A;  2YV7 A;  4IVF A;  5C00 A;  3QR6 A;  4NXI A;  1YDK A;  2GZP A;  1G7E A;  1IYH A;  2PN8 A;  2JSZ A;  1B9Y C;  1E2Y A;  2DJJ A;  3W6G A;  2R6K A;  3ZLP A;  3C1S A;  4YAV A;  2B5X A;  4K6X A;  3LYK A;  3I6A A;  4RI6 A;  1PQN A;  3ERG A;  2NPB A;  3PH9 A;  1X5D A;  2VLV A;  5CRG A;  1XVQ A;  3ME8 A;  3WGX A;  1E6B A;  2N5B A;  1TK8 B;  2OE0 A;  3ZTL A;  1TK0 B;  3HY2 A;  2MBT A;  3GH9 A;  1X5C A;  2GST A;  2PPT A;  2B5Y A;  3ZML A;  1Z7R A;  3M1G A;  3JCM L;  2ON7 A;  1SYX A;  3LXZ A;  3GUR A;  4FIW A;  3GV1 A;  1Z6M A;  5IMV A;  1K0M A;  4AJ8 A;  4WBJ A;  2B1L A;  5G2Z A;  4ZXG A;  3HVS A;  1J08 A;  3G7J A;  4MPF A;  1EEJ A;  1MDI A;  3MNG A;  5JWO B;  3HZ4 A;  1TXX A;  3TRX A;  3O6T A;  2P31 A;  3TOT A;  1OE8 A;  6GSW A;  5ECS A;  4EKZ A;  3BJ5 A;  5ENU A;  5ECK B;  1ZZY A;  2FD3 A;  1FO5 A;  1M2D A;  1M7T A;  3MWH A;  3VLN A;  2DC5 A;  3IR4 A;  5IIZ A;  5ECM B;  2M80 A;  5A4W A;  4DSS A;  4NPB A;  1A0R P;  1GTU A;  2LQQ A;  2FNO A;  5H5Q A;  1KEB A;  1QUW A;  3DYR A;  3F63 A;  3D4M A;  3QDN A;  4BWQ A;  3LG6 A;  4G2E A;  3PR8 A;  3F4T A;  1GUL A;  3RBT A;  4XRA A;  3G9B A;  3A5W A;  2CVB A;  5CRH A;  2AAW A;  2B1K A;  4EUY A;  2HFD A;  3LWA A;  3TCO A;  1WIK A;  4X1U A;  2PVQ A;  3W8S A;  5KN1 A;  3FZ4 A;  5ELG A;  1A2M A;  1TOF A;  4KH7 A;  5HR0 A;  1OYJ A;  4F9Z A;  4CHS A;  1HYU A;  3ZYW A;  3TJJ A;  1XWK A;  2E7P A;  4MF5 A;  1M99 A;  4CDO A;  1GL8 A;  5D8I A;  4GCI A;  2XC2 A;  1U3A A;  2KP1 A;  4POM A;  4WF4 A;  3APQ A;  3HVV A;  1NSW A;  3DD3 A;  4AJ6 A;  2H8L A;  5IO2 A;  3GNJ A;  2VCX A;  3VPT A;  5CP1 A;  1SKS B;  2YWM A;  2HT9 A;  2OBK A;  2RUF A;  5IM9 A;  2VCQ A;  5LCZ A;  1WRY A;  2MMZ A;  1SU9 A;  3ZVJ D;  1ILO A;  1T8E B;  1O81 A;  2H71 A;  1GP1 A;  1T4Y A;  4X0X A;  1K0B A;  2L4Q A;  3KP8 A;  2IN3 A;  1WP0 A;  4I2T A;  1YZX A;  3K8N A;  4K7N A;  2IFQ B;  2YCD A;  1ML6 A;  3F4R A;  2DIZ A;  2KUC A;  2H6Y A;  3IAS 2;  5IPH A;  3E9J B;  1XWB A;  2QC7 A;  1ERV A;  4HOJ A;  1BQ7 A;  1QXH A;  1CQG A;  3PGT A;  2C1Y A;  2IIY A;  4KDY A;  5B6M A;  2ZCT A;  3IC4 A;  5IOX A;  3FR9 A;  4RQR A;  1Y25 A;  4K1F A;  2JZR A;  4HJM A;  3GX0 A;  4K0N A;  3GKX A;  4NV5 A;  3TKS A;  4N11 A;  1B9X C;  4G10 A;  3G7I A;  4EVM A;  2NTO A;  4RUV A;  4IW9 A;  4WBR D;  3H8Q A;  5E4W A;  2V6K A;  3FZA A;  2A4V A;  2GSR A;  1TU8 A;  2J23 A;  4G9H A;  5EVO A;  3NIV A;  1VRS D;  3ZFL A;  2ES7 A;  5KN3 A;  2XBI A;  5B8B A;  9GSS A;  5EL8 A;  3P90 A;  2RLI A;  1SL2 B;  3EMP A;  4GXZ A;  5IMZ A;  5D9T A;  1PN9 A;  1TRU A;  2XBQ A;  4IJ3 A;  2L5O A;  1FHE A;  4OFM A;  2DJ2 A;  5ECI B;  5ECR B;  4N30 A;  1YEP A;  1GSU A;  1A24 A;  2IMI A;  1WOU A;  3A2V A;  1KTE A;  2C0E A;  1TJD A;  5JWQ B;  4IQ1 A;  5ID2 B;  2OA7 A;  3TDG A;  3U6V A;  3A3T A;  3EE2 A;  4I5Q A;  1U6T A;  3M8N A;  3MAK A;  1Q4J A;  3L9V A;  2H01 A;  4QL9 A;  3N5O A;  4OMV A;  3DRN A;  4MJB A;  2YWI A;  3QFA C;  1GLQ A;  1TRV A;  3TJF A;  2EC4 A;  3M0F A;  4ML6 A;  2KP2 A;  3KJY A;  2WGR A;  2P0G A;  3GTU B;  2NBS A;  1ZMA A;  3TJB A;  2TRC P;  4J56 E;  2RM6 A;  2VOC A;  1S3D A;  5IMC A;  5KEJ A;  3ZFB A;  1J0F A;  4FO5 A;  2YNX A;  2CX3 A;  1PL1 A;  3FEU A;  14GS A;  2EIQ A;  4MF6 A;  4GSN A;  4F82 A;  4LMW A;  5H5S A;  1XBS A;  1FVK A;  5E59 A;  4MAB A;  5FHI A;  3D5J A;  4Q5Q A;  1K0C A;  2FWE A;  3APO A;  4J57 E;  4PUF C;  1YKA A;  2WRT A;  1VF4 A;  3UBL A;  4FYB A;  3C7M A;  4HEA 2;  11GS A;  2EIR A;  3BCI A;  4ML1 A;  1NM3 A;  3VI7 A;  2LJK A;  4D73 B;  3S9F A;  1K3Y A;  1PL2 A;  3QMX A;  4QQ7 A;  2K18 A;  3VWW A;  5CRD A;  4J2F A;  2H6Z A;  1ZL9 A;  2H1G A;  2V32 A;  2B3S A;  1VF2 A;  1FAA A;  2YJ7 A;  1MDJ A;  1BG5 A;  2MMO A;  3TB2 A;  3SWL A;  5F8B A;  1B4Q A;  2H0H A;  4ZBB A;  4ECC A;  1GUH A;  1JLV A;  5G5E A;  1K0N A;  1TW9 A;  3Q6O A;  2H1B A;  3VK9 A;  3D0Z A;  2LS5 A;  2LJR A;  2RM5 A;  5G1L A;  3F3Q A;  3BCK A;  1KBN A;  1AQX A;  1XXU A;  1T3B A;  3KXO A;  5GAP D;  1SJ6 A;  3KH9 A;  1N8J A;  3WT1 A;  3IRA A;  1TRS A;  2QGV A;  4MLY A;  1GSF A;  1X9M B;  4L0U A;  4ILF A;  2HZE A;  3QAW A;  1TKD B;  2L6D A;  2OBI A;  2B6M A;  4MZC A;  1R5A A;  1PX7 A;  5IO0 A;  3J7Y b;  4TR1 A;  4V2M A;  3U5R E;  3F3R A;  2O89 A;  4P3Y B;  3G7Y A;  3IV4 A;  2AHE A;  2A2S A;  3ZMK A;  2FGX A;  3VI5 A;  2VL9 A;  2VM1 A;  10GS A;  17GS A;  4MCU A;  2QSI A;  1Q98 A;  3L0H A;  3BD2 A;  4I97 A;  2I3Y A;  5CNW A;  1RQM A;  4GF0 A;  2FCH A;  1AC1 A;  3RHC A;  3WYW A;  1S3A A;  2HE3 A;  1MTC A;  4FYC A;  2KHP A;  2ALB A;  2O85 A;  4TXO A;  3C1R A;  2LST A;  2LJA A;  3TGZ A;  2F8F A;  3FRC A;  3V1W A;  2I4A A;  2DJ1 A;  1DSB A;  1FB6 A;  3OR5 A;  13GS A;  2VL2 C;  2XHF A;  3CYN A;  3SBC A;  5J4U A;  4LL4 B;  2R4V A;  2HI7 A;  2R5G A;  3ZRD A;  3TUE A;  1HD2 A;  2B7K A;  2LRN A;  2AUV A;  5C04 A;  5IQY A;  5GSS A;  5J41 A;  2BTO T;  3KTL A;  4JZQ A;  5HR2 A;  4O5R A;  5LD0 A;  2WZ9 A;  2C3Q A;  3R2Q A;  2I81 A;  1EGR A;  5F0G A;  2FWG A;  1ERW A;  3L9U A;  2FY6 A;  6GSX A;  1XW6 A;  2RUE A;  4LMV A;  5ECL B;  1Z7P A;  3EWL A;  4DSS B;  6GSS A;  2VIM A;  2H75 A;  2CZ3 A;  4XHM A;  4AJ7 A;  4DEJ A;  7GSS A;  1TDI A;  1GUM A;  4BWS A;  1GNE A;  3KMN A;  1FVJ A;  3Q19 A;  4HJ2 A;  1T1V A;  1OE7 A;  2VLT A;  5D96 A;  4WEY A;  4G19 A;  1ON4 A;  2CVK A;  2H72 A;  2GT6 A;  1CQH A;  4NV2 A;  1M2A A;  3TKS C;  3QFB C;  1R26 A;  1K0A A;  3M9J A;  1AIU A;  2HYX A;  4EC0 A;  2WS2 A;  3UAP A;  4F03 A;  3FKF A;  2H74 A;  4E8H A;  2K9F A;  4MPG A;  1WWJ A;  4K9Z A;  4WKW A;  2YWN A;  4KND A;  2CAI A;  2CVD A;  4FYU A;  3NOF A;  4GRF A;  1THX A;  3DEX A;  3CBU A;  4YQV A;  1OKT A;  1MD4 A;  3TKQ A;  1UC7 A;  2HZF A;  1V58 A;  2N5A A;  3TKP A;  4MJA A;  5IMA A;  2C0D A;  4ISD A;  3KTB A;  2MMN A;  1EEM A;  5A5K A;  5HQP A;  1FB0 A;  1EP8 A;  2HXK A;  3ISO A;  2LNT A;  5G1K A;  3EC3 A;  2IPA A;  3F6F A;  5A4V A;  5B7C A;  1TI1 A;  2ZUP A;  5DAL B;  5H5R A;  4KW6 A;  5HFG A;  1H4O A;  2DJ0 A;  4F2I A;  3DVX A;  1THO A;  2L6C A;  1W89 A;  3FK8 A;  3PIN A;  3L78 A;  4XS4 B;  4IQA A;  2AJQ B;  2BMX A;  3CXG A;  3CRU A;  1AAZ A;  3HD5 A;  2GLR A;  4HI7 A;  4IKH A;  1LJR A;  3HKR A;  1DE1 A;  1OKD A;  1BX9 A;  2MZC A;  5DAK A;  2OAC A;  1SD9 A;  4X43 A;  2I9H A;  4O92 A;  4K2D A;  1JZD A;  1ACV A;  12GS A;  1V9W A;  2YJH A;  5J5N A;  3VWX A;  2DML A;  4YAP A;  2YZU A;  3A2X A;  1BED A;  3UMA A;  5CYY A;  3LYP A;  4KX4 A;  4JR6 A;  3W8J A;  4ID0 A;  3MSZ A;  4ZB9 A;  4XTS A;  1ZOF A;  3ME7 A;  4BPY A;  1Z5Y E;  3HZ8 A;  3VFI A;  4OO4 A;  2L57 A;  2ON5 A;  1F9M A;  3HCZ A;  3DIE A;  1I5G A;  2GQL A;  3IXR A;  5HR1 A;  2LRT A;  3CMI A;  4XCS A;  2LV3 A;  2AYT A;  1ERU A;  1PKZ A;  1A0F A;  4L0W A;  2V6O A;  3O76 A;  1EGO A;  1B4P A;  2WJU A;  4FH8 A;  1GSD A;  3UJ1 A;  5F07 A;  3VWU A;  2PUK C;  2ZNM A;  1A23 A;  3LOR A;  3IA1 A;  2CT6 A;  1O6J A;  3QD9 A;  4HS1 A;  2OKA A;  3FZ5 A;  1MEK A;  2IMF A;  4WR4 A;  2DJ3 A;  4POL A;  4TXV A;  5G31 A;  1URM A;  19GS A;  1VF3 A;  4HU9 A;  3IAM 2;  4JE1 A;  2H70 A;  3HXS A;  4KDU A;  3UVT A;  4MP4 A;  3EYT A;  3CTG A;  3QCP A;  2V2G A;  3UEM A;  4ZL8 A;  2IME A;  4KUN A;  1HNC A;  3AY8 A;  1XZO A;  2LKU A;  2PU9 C;  2IWT A;  1GTI A;  4HDE A;  4ACS A;  1X9W B;  3L9S A;  1T00 A;  2YV9 A;  2VD0 A;  1XCC A;  5JWR B;  4MMM A;  4ULX A;  2XPD A;  1XIY A;  2GZZ A;  5D9V A;  5FWG A;  2IFQ A;  4TR0 A;  4XS6 A;  2H66 A;  1T7P B;  3DKS A;  3UIW A;  1J9B A;  2HSH A;  2JAC A;  4JBB A;  4NHZ A;  1Z3E A;  2REM A;  2GSS A;  2X8G A;  2V41 A;  1EWX A;  1G0T A;  3IBH A;  3FR6 A;  3P2A A;  2FLS A;  4WET A;  1O73 A;  1ZYE A;  1WE0 A;  2GQK A;  2DJK A;  3GUS A;  2DMM A;  3MDK A;  4NMU A;  4GLT A;  5ECP B;  3TKS E;  3EUR A;  1R5P A;  5JCG A;  2H1A A;  5IPG A;  1H75 A;  5AIV A;  1FW1 A;  1OC9 B;  18GS A;  3Q18 A;  5ECN B;  5CAX A;  5GAN D;  5D9W A;  1I9D A;  4HQS A;  1U3I A;  4K0G A;  1SJZ A;  3E0U A;  3KMO A;  5CRE A;  3D21 A;  3GL5 A;  4N0Z A;  4HUA A;  3QPM A;  2KOK A;  5LNK e;  3FZ9 A;  4PX1 A;  2HNL A;  2GS3 A;  1YY7 A;  2WUL A;  2H19 A;  5DCH A;  1TP9 A;  3GRX A;  3DGQ A;  1F2E A;  3EU4 A;  3LGC A;  5B6N A;  5COH A;  4K8M A;  5J9B A;  4KCE A;  2E2M A;  2HRN A;  1RK4 A;  5DDL A;  1SYR A;  3L4N A;  2JL4 A;  1XWA A;  5IOW A;  5ID2 A;  4K7I A;  1HNA A;  3BOA A;  1G7O A;  2MMA A;  1EOG A;  1EP7 A;  2IL3 A;  5DCG A;  2O8V B;  3ZRE A;  3F4S A;  4Q5R A;  2FHE A;  1O8W A;  1PD2 1;  1W4V A;  1XWG A;  2VCT A;  3FHK A;  1U87 A;  4LLR A;  2RII A;  4WF5 A;  5AN1 A;  1RW1 A;  3ED3 A;  1QMV A;  2YN1 A;  2PBJ A;  3KGK A;  3APS A;  2R3X A;  1QFN A;  3GTU A;  5IMF A;  2VAF A;  4PNF A;  1UN2 A;  2IMK A;  4ZIL A;  5KN0 A;  4CW9 A;  2CV4 A;  3VWV A;  1EV9 A;  1O7U A;  4OWY A;  3IK7 A;  2M46 A;  6GSV A;  5DQY A;  4LL1 B;  1R4W A;  3GL3 A;  3P7X A;  1F3B A;  4L8E A;  4NAX A;  4Z7X A;  1JZO A;  2YAN A;  4MF7 A;  4V2L A;  4DVC A;  3C71 A;  1GNW A;  3D4T A;  3KIJ A;  2WFC A;  1ERT A;  4MA9 A;  1GWC A;  3KH7 A;  3LQ7 A;  4H86 A;  1GTB A;  5HFI A;  1SEN A;  5DJM A;  2CAQ A;  4D73 A;  4HQZ A;  1K0O A;  4MH2 A;  1BYE A;  4GWR A;  4OFT A;  3LFL A;  2FA4 A;  4O32 A;  4F0C A;  1AQV A;  1T4Z A;  4BL7 A;  1XFL A;  2BJX A;  3WGD A;  1N2A A;  2C4J A;  1MD3 A;  3UOM A;  1WJK A;  1SD8 A;  4L5O A;  1NHO A;  3IDV A;  2VL3 A;  2C80 A;  2C8U A;  1A8L A;  3HDC A;  2L4C A;  3RAZ A;  3EMX A;  4WXT A;  2OE1 A;  1F3A A;  1PGT A;  4V1A g;  3IK9 A;  1XW5 A;  2GGT A;  2F8A A;  5KN2 A;  2K8V A;  3P8W A;  3FR3 A;  1UA5 A;  1LBK A;  1YEX A;  3GKK A;  3EIN A;  4KE3 A;  4PQI A;  3CSH A;  4DSR A;  1OVN A;  1XOB A;  2Z9S A;  1VGL A;  2HLS A;  1O85 A;  1SK0 A;  1A2J A;  3VPQ A;  1SKW B;  2CZ2 A;  4PQH A;  1QQ2 A;  4OCF A;  3CSI A;  2C0F A;  2QKE A;  5JCW A;  4MK3 A;  3UL3 A;  1X0R A;  2PER A;  2K6V A;  1XVW A;  3HJP A;  3GX8 A;  3LJR A;  4V2N A;  3GIX A;  4EE0 A;  1SL1 B;  1ZYQ B;  2VCZ A;  3LSZ A;  2FUG 2;  4WR5 A;  3HHV A;  3LXT A;  1V98 A;  1V2A A;  1XW9 A;  4ZB8 A;  5J3R A;  2GQM A;  4KGI A;  2LEG A;  2CX4 A;  1F37 A;  3HVX A;  4POB A;  3I43 A;  1WMJ A;  2L5L A;  2JU5 A;  4KB3 A;  3QAG A;  2YPM A;  3TJG A;  2GT5 A;  1QK8 A;  2X8H A;  2X64 A;  1B8X A;  1DE2 A;  3ZIJ A;  4BVY A;  1ZCP A;  1M9A A;  2L59 A;  2JSY A;  2O7K A;  4EO3 A;  4HZ2 A;  3EVI A;  2IJY A;  2PWJ A;  1K3O A;  2FWF A;  3GYK A;  3DML A;  5DAK B;  4MZW A;  2K8S A;  3KCM A;  2FA8 A;  3GN3 A;  3J7Y k;  2CA8 A;  4IEL A;  3HJM A;  3HYP A;  2OE3 A;  2DIY A;  6GSY A;  2YOI A;  2PVO C;  1GTA A;  1VF1 A;  3A2W A;  3IHQ A;  1YKC A;  3IE3 A;  3H93 A;  3KM6 A;  3D22 A;  3GA4 A;  1GSS A;  5F06 A;  4KAE A;  3ZZX A;  4GSS A;  4YH2 A;  1GSE A;  1A8Y A;  2H6X A;  1QGV A;  2TIR A;  3RDW A;  2OAD A;  3FW2 A;  2WDU A;  1YJ6 A;  1EV4 A;  3RHB A;  3TRP A;  1K0D A;  2A2R A;  4PQ1 A;  2F9S A;  2GDR A;  1A2L A;  1GH2 A;  3H79 A;  22GS A;  1SJI A;  1Y6E A;  5D93 A;  1ABA A;  4Q5F A;  1TI3 A;  1DBY A;  5DBQ A;  3DXB A;  3IOS A;  2GZY A;  2C3N A;  2VO4 A;  3ZIT A;  1O8X A;  5FT3 A;  4JU5 A;  3GKM A;  2VLU A;  4KSO A;  3FYG A;  3H4K A;  5D9X A;  2P5Q A;  2O87 A;  2E2G A;  1M0U A;  4ZIJ A;  3GKN A;  4F0B A;  1PX6 A;  5ECO B;  1Z9H A;  5J9C A;  4I6X A;  1JLW A;  2H0G A;  5IMD A;  4GQC A;  4IP6 A;  2G2Q A;  5HFK A;  3WT2 A;  2R37 A;  1XWC A;  2C0G A;  1BJX A;  2HSY A;  3KP9 A;  4I2U A;  3F8U A;  1YF1 A;  3WD6 A;  2VCV A;  4AF2 A;  2VL2 A;  2D2Z A;  3QAV A;  3TOU A;  4ZBA A;  4OO5 A;  1NW2 A;  4V1A p;  2GSQ A;  1DUG A;  1WPI A;  4IBP A;  3HA9 A;  1S3C A;  3N9J A;  3KZQ A;  5A4U A;  1PA3 A;  3CTF A;  1YQ1 A;  4TR3 A;  2WB9 A;  4ECB A;  4IHU A;  1PRX A;  1SL0 B;  5D73 A;  3UAR A;  1Z6N A;  5DAL A;  3ERW A;  3BBY A;  4AGS A;  1PSQ A;  3GMF A;  5L71 A;  2WCI A;  4KCA A;  5ABR A;  1U88 A;  3EU3 A;  2JAD A;  2IMD A;  4XS4 A;  1BAY A;  2X99 A;  1HNB A;  1NHY A;  3KEB A;  4RI7 A;  1GSQ A;  2X8C A;  2MYG A;  4KA0 A;  3F9U A;  4MZB A;  1G6Y A;  3M3M A;  1SK2 A;  3KD0 A;  4HZ4 A;  4PUR A;  5CO3 A;  3RPP A;  3D6I A;  2NVL A;  2HRF A;  5ECH B;  5ECQ B;  4ZL7 A;  3RPN A;  4XRD A;  2E0Q A;  1ZGN A;  4GQF A;  4PNG A;  3O3T A;  5F05 A;  4YQU A;  4ECJ A;  4OCE A;  1PMT A;  4BVX A;  2C3T A;  5HR3 A;  3C73 A;  3TRQ A;  4TW5 A;  4TR4 A;  1AUC A;  2VD1 A;  1G6W A;  2DSA A;  3M9K A;  4MJC A;  4HU7 A;  1FG4 A;  1C72 A;  2OJL A;  2B5E A;  16GS A;  4IN0 A;  4EL1 A;  1GSY A;  5AGY A;  5DQS A;  4OFN A;  4JED A;  1HQO A;  4PUA A;  1AXD A;  3I9V 2;  1PKW A;  1TTZ A;  1MDK A;  4XS1 A;  4GST A;  4JR4 A;  2LQO A;  1TK5 B;  1FOV A;  3HJO A;  4GTU A;  1GLP A;  4EDZ A;  2M72 A;  2AB6 A;  5G5F A;  2I1U A;  5GZZ B;  2H1D A;  1YF0 A;  2GVP A;  2N5F A;  4TKY A;  2LUS A;  5GST A;  1R7H A;  6GST A;  3ERF A;  3VUR A;  4ECI A;  1JFU A;  3WGE A;  3CRT A;  3DVW A;  1SKR B;  2DLX A;  4JRR A;  4OD7 A;  3H1N A;  1X9S B;  4O7H A;  5CRW A;  4Q5N A;  5AIS A;  4PXO A;  2EIO A;  8GSS A;  2LNS A;  4DSQ A;  4EF0 A;  3FY7 A;  1EOH A;  4IP1 A;  4LA1 A;  2HZE B;  4IJI A; 
#chains in the Genus database with same CATH topology
 4L5L A;  3IPZ A;  3GH6 A;  5AIX A;  1M9B A;  1B48 A;  3CSJ A;  3US3 A;  1TRW A;  4NWY A;  4TR1 B;  2YZH A;  2YWO A;  4POK A;  3ZIV A;  4YQM A;  2AV4 A;  4TOP A;  1V40 A;  4G0K A;  4RQX A;  5INY A;  3GSS A;  5EPF A;  2V1M A;  2PGT A;  3UBK A;  2VUP A;  2KLX A;  1ST9 A;  5EY6 A;  5DJL A;  1V57 A;  2H30 A;  5G30 A;  3ZL5 A;  5KOX A;  5B8A A;  4TXO B;  5DVB A;  6GSU A;  4KDX A;  2J9H A;  2H0I A;  4ZL9 A;  1JZR A;  4MH3 A;  3UVH A;  2B7J A;  4HSC X;  4EDY A;  4E8E A;  4IS0 A;  2YP6 A;  3E3E A;  3Q74 A;  4K7O A;  2G0F A;  3TJK A;  2DBC A;  4BA7 A;  1OC3 A;  1OC9 A;  1EZK A;  2R2J A;  2PMT A;  2FWH A;  3C8E A;  3GFK A;  3GHA A;  3TKR A;  3LEF A;  4IGJ A;  2NDO A;  4KSM A;  2LRC A;  4KF9 A;  3I69 A;  4ZB6 A;  1X5E A;  4X4J A;  3ZVJ A;  4I8B A;  4MDC A;  2F51 A;  1USB A;  2VM2 A;  1AW9 A;  1K3L A;  4TN8 A;  2F3M A;  1IYI A;  1JZW A;  3PPU A;  2MBS A;  5JCU A;  4ICY A;  2P5R A;  1ZYN A;  1F6M C;  2JZS A;  4TRX A;  3F0I A;  4QL7 A;  2HRA A;  4NHW A;  2R0P A;  4N10 A;  1LU4 A;  1AQW A;  1OC8 A;  3CQF A;  4PGT A;  3DWV A;  1OAZ A;  1XOA A;  1M2B A;  4TVE A;  20GS A;  4ZBD A;  3GST A;  2H73 A;  1JHB A;  1GUK A;  4G0L A;  2JZT A;  5ELA A;  4XIH A;  1XPV A;  3F6D A;  1SK1 A;  1M3J A;  4MJE A;  3QOU A;  1UVZ A;  1TU7 A;  2LTK A;  2CQ9 A;  2XPE A;  4N0V A;  2GTU A;  1GRX A;  1KNG A;  2TRX A;  2VCW A;  3NZN A;  4EXJ A;  2H76 A;  2YV7 A;  4IVF A;  5C00 A;  3QR6 A;  4NXI A;  1YDK A;  2GZP A;  4A5P A;  1G7E A;  1IYH A;  2PN8 A;  2JSZ A;  1B9Y C;  1E2Y A;  2DJJ A;  3W6G A;  2R6K A;  3ZLP A;  3C1S A;  4YAV A;  2B5X A;  4K6X A;  3LYK A;  2HRK A;  3I6A A;  4RI6 A;  1PQN A;  3ERG A;  2NPB A;  3PH9 A;  1X5D A;  2VLV A;  5CRG A;  1XVQ A;  3ME8 A;  3WGX A;  1E6B A;  2N5B A;  1TK8 B;  2OE0 A;  3ZTL A;  1TK0 B;  3HY2 A;  2MBT A;  3GH9 A;  1X5C A;  2GST A;  2PPT A;  2B5Y A;  3ZML A;  1Z7R A;  3M1G A;  3JCM L;  2ON7 A;  1SYX A;  3LXZ A;  3GUR A;  4FIW A;  3GV1 A;  1Z6M A;  5IMV A;  1K0M A;  4AJ8 A;  4WBJ A;  2B1L A;  5G2Z A;  4ZXG A;  3HVS A;  1J08 A;  3G7J A;  4MPF A;  1EEJ A;  1MDI A;  3MNG A;  5JWO B;  3HZ4 A;  2QA1 A;  1TXX A;  3TRX A;  3O6T A;  2P31 A;  3TOT A;  1OE8 A;  6GSW A;  5ECS A;  4EKZ A;  3BJ5 A;  5ECK B;  1ZZY A;  5ENU A;  2FD3 A;  1FO5 A;  1M2D A;  1M7T A;  3MWH A;  3VLN A;  2DC5 A;  3IR4 A;  5IIZ A;  5ECM B;  2M80 A;  5A4W A;  4DSS A;  4NPB A;  1A0R P;  1GTU A;  2LQQ A;  2FNO A;  5H5Q A;  1KEB A;  1QUW A;  3DYR A;  3F63 A;  3D4M A;  3QDN A;  4BWQ A;  3LG6 A;  4G2E A;  3PR8 A;  3F4T A;  1GUL A;  3RBT A;  4XRA A;  3G9B A;  3A5W A;  2CVB A;  5CRH A;  2AAW A;  2B1K A;  4EUY A;  2HFD A;  3LWA A;  3TCO A;  4YKG A;  1WIK A;  4X1U A;  2PVQ A;  3W8S A;  5KN1 A;  3FZ4 A;  5ELG A;  1A2M A;  1TOF A;  4KH7 A;  5HR0 A;  1OYJ A;  4F9Z A;  4CHS A;  1HYU A;  3ZYW A;  3TJJ A;  2DKI A;  1XWK A;  2E7P A;  4MF5 A;  1M99 A;  4CDO A;  1GL8 A;  5D8I A;  4CY8 A;  4GCI A;  2XC2 A;  1U3A A;  2KP1 A;  4POM A;  4WF4 A;  3APQ A;  3HVV A;  1NSW A;  3DD3 A;  4AJ6 A;  2H8L A;  1ZYP A;  5IO2 A;  3GNJ A;  2VCX A;  3VPT A;  5CP1 A;  1SKS B;  2YWM A;  2HT9 A;  2OBK A;  2RUF A;  5IM9 A;  2VCQ A;  5LCZ A;  4O5U A;  1WRY A;  2MMZ A;  1SU9 A;  3ZVJ D;  1ILO A;  1T8E B;  1O81 A;  2H71 A;  1GP1 A;  4CY6 A;  1T4Y A;  4X0X A;  1K0B A;  2L4Q A;  3KP8 A;  2IN3 A;  1WP0 A;  4I2T A;  1YZX A;  4EIQ A;  3K8N A;  4K7N A;  2IFQ B;  2YCD A;  1ML6 A;  3F4R A;  2DIZ A;  2KUC A;  2H6Y A;  3IAS 2;  5IPH A;  3E9J B;  1XWB A;  2QC7 A;  3HVN A;  1ERV A;  4HOJ A;  1BQ7 A;  1PFO A;  1QXH A;  1CQG A;  3PGT A;  2C1Y A;  2IIY A;  4KDY A;  5B6M A;  2ZCT A;  3IC4 A;  5IOX A;  3FR9 A;  4RQR A;  1Y25 A;  4K1F A;  2JZR A;  1S3R A;  4HJM A;  3GX0 A;  4K0N A;  3GKX A;  4NV5 A;  3TKS A;  4N11 A;  1B9X C;  4G10 A;  3G7I A;  4EVM A;  2NTO A;  4RUV A;  4IW9 A;  4WBR D;  3H8Q A;  5E4W A;  2V6K A;  2A4H A;  3FZA A;  2A4V A;  2GSR A;  1TU8 A;  2J23 A;  4G9H A;  5EVO A;  3NIV A;  1VRS D;  3ZFL A;  2ES7 A;  5KN3 A;  2XBI A;  5B8B A;  9GSS A;  3FMW A;  5EL8 A;  4BIK A;  3P90 A;  2RLI A;  1SL2 B;  3EMP A;  4GXZ A;  5IMZ A;  5D9T A;  1PN9 A;  1TRU A;  2XBQ A;  4IJ3 A;  2L5O A;  1FHE A;  4OFM A;  4YKF A;  2DJ2 A;  5ECI B;  5ECR B;  4N30 A;  1YEP A;  1GSU A;  1A24 A;  2IMI A;  1WOU A;  3A2V A;  1KTE A;  2C0E A;  1TJD A;  2R0C A;  5JWQ B;  4IQ1 A;  5ID2 B;  2OA7 A;  3TDG A;  3U6V A;  3A3T A;  3EE2 A;  4I5Q A;  1U6T A;  3M8N A;  3MAK A;  1Q4J A;  3L9V A;  2H01 A;  4QL9 A;  3N5O A;  4OMV A;  3DRN A;  4MJB A;  2YWI A;  3QFA C;  1GLQ A;  1TRV A;  3TJF A;  2EC4 A;  3M0F A;  4ML6 A;  2KP2 A;  3KJY A;  2WGR A;  2P0G A;  3GTU B;  2NBS A;  1ZMA A;  3TJB A;  2TRC P;  4J56 E;  2RM6 A;  2VOC A;  1S3D A;  5IMC A;  5KEJ A;  3ZFB A;  1J0F A;  4FO5 A;  2YNX A;  2CX3 A;  1PL1 A;  3FEU A;  14GS A;  4K5S A;  2EIQ A;  4MF6 A;  4GSN A;  4F82 A;  4LMW A;  5H5S A;  1XBS A;  1FVK A;  5E59 A;  4MAB A;  5FHI A;  3D5J A;  4Q5Q A;  1K0C A;  2FWE A;  3APO A;  4J57 E;  4PUF C;  1YKA A;  2WRT A;  1VF4 A;  3UBL A;  4FYB A;  3C7M A;  4HEA 2;  11GS A;  2EIR A;  3BCI A;  4ML1 A;  1NM3 A;  3VI7 A;  2LJK A;  4D73 B;  3S9F A;  1K3Y A;  1PL2 A;  3QMX A;  4QQ7 A;  2K18 A;  3VWW A;  4K2X A;  4J2F A;  5CRD A;  2H6Z A;  1ZL9 A;  4BL7 B;  2H1G A;  2V32 A;  2B3S A;  1VF2 A;  1FAA A;  2YJ7 A;  1MDJ A;  1BG5 A;  2MMO A;  3TB2 A;  3SWL A;  5F8B A;  4Z2T A;  1B4Q A;  2H0H A;  4ZBB A;  4ECC A;  1GUH A;  1JLV A;  5G5E A;  1K0N A;  1TW9 A;  3Q6O A;  2H1B A;  3VK9 A;  3D0Z A;  2LS5 A;  2LJR A;  2RM5 A;  5G1L A;  3F3Q A;  3BCK A;  1KBN A;  1AQX A;  1XXU A;  1T3B A;  3KXO A;  5GAP D;  1SJ6 A;  3KH9 A;  1N8J A;  3WT1 A;  3IRA A;  1TRS A;  2QGV A;  4MLY A;  1GSF A;  1X9M B;  4L0U A;  4ILF A;  2HZE A;  3QAW A;  1TKD B;  2L6D A;  2OBI A;  2B6M A;  4MZC A;  1R5A A;  1PX7 A;  5IO0 A;  3J7Y b;  4TR1 A;  4V2M A;  3U5R E;  3F3R A;  2O89 A;  4P3Y B;  3G7Y A;  3IV4 A;  2AHE A;  2A2S A;  3ZMK A;  2FGX A;  3VI5 A;  2VL9 A;  2VM1 A;  10GS A;  17GS A;  4MCU A;  2QSI A;  1Q98 A;  3L0H A;  3BD2 A;  4I97 A;  2I3Y A;  5CNW A;  1RQM A;  4GF0 A;  2FCH A;  1AC1 A;  3RHC A;  3WYW A;  1S3A A;  2HE3 A;  1MTC A;  4FYC A;  2KHP A;  2ALB A;  2O85 A;  4Z2R A;  4BVY B;  4TXO A;  3C1R A;  2LST A;  2LJA A;  3TGZ A;  2F8F A;  3FRC A;  3V1W A;  2I4A A;  2DJ1 A;  1DSB A;  1FB6 A;  3OR5 A;  13GS A;  2VL2 C;  2XHF A;  3CYN A;  3SBC A;  5J4U A;  4LL4 B;  2R4V A;  2HI7 A;  2R5G A;  3ZRD A;  3TUE A;  1HD2 A;  2B7K A;  3MIX A;  2LRN A;  2AUV A;  5C04 A;  5IQY A;  5GSS A;  5J41 A;  2BTO T;  3KTL A;  4JZQ A;  5HR2 A;  4O5R A;  5LD0 A;  2WZ9 A;  2C3Q A;  3R2Q A;  2I81 A;  1EGR A;  5F0G A;  2FWG A;  1ERW A;  3L9U A;  2FY6 A;  6GSX A;  1XW6 A;  2RUE A;  4LMV A;  5ECL B;  1Z7P A;  3EWL A;  3MYD A;  4DSS B;  6GSS A;  2VIM A;  2H75 A;  2CZ3 A;  4XHM A;  4AJ7 A;  4DEJ A;  7GSS A;  1TDI A;  1GUM A;  4BWS A;  1GNE A;  3KMN A;  1FVJ A;  3Q19 A;  4HJ2 A;  1T1V A;  1OE7 A;  2VLT A;  5D96 A;  4WEY A;  4G19 A;  1ON4 A;  2CVK A;  1XG8 A;  2H72 A;  2GT6 A;  1CQH A;  4NV2 A;  1M2A A;  3TKS C;  3QFB C;  1R26 A;  1K0A A;  3M9J A;  1AIU A;  2HYX A;  4EC0 A;  2HSM A;  2WS2 A;  3UAP A;  4F03 A;  3FKF A;  2H74 A;  4E8H A;  2K9F A;  4MPG A;  1WWJ A;  4K9Z A;  4WKW A;  2YWN A;  1FOH A;  4KND A;  2CAI A;  2CVD A;  4FYU A;  3NOF A;  2X49 A;  4GRF A;  1THX A;  3DEX A;  3CBU A;  4YQV A;  1OKT A;  1MD4 A;  3TKQ A;  1UC7 A;  2HZF A;  1V58 A;  2N5A A;  3TKP A;  4MJA A;  5IMA A;  2C0D A;  4ISD A;  3KTB A;  2MMN A;  1EEM A;  5A5K A;  5HQP A;  1FB0 A;  1EP8 A;  2HXK A;  3ISO A;  2LNT A;  5G1K A;  3EC3 A;  2IPA A;  3F6F A;  5A4V A;  5B7C A;  1TI1 A;  2ZUP A;  5DAL B;  5H5R A;  4KW6 A;  5HFG A;  1H4O A;  2DJ0 A;  4F2I A;  3DVX A;  1THO A;  2L6C A;  2R0G A;  1W89 A;  3FK8 A;  3PIN A;  3L78 A;  4XS4 B;  4IQA A;  2AJQ B;  2BMX A;  3CXG A;  3CRU A;  1AAZ A;  3HD5 A;  2X4A A;  2GLR A;  4HI7 A;  4IKH A;  1LJR A;  3HKR A;  1DE1 A;  1OKD A;  1BX9 A;  2MZC A;  5DAK A;  2OAC A;  5BRT A;  1SD9 A;  4X43 A;  2I9H A;  4O92 A;  4K2D A;  1JZD A;  1ACV A;  12GS A;  1V9W A;  2YJH A;  5J5N A;  3VWX A;  2DML A;  4YAP A;  2YZU A;  3A2X A;  1BED A;  3UMA A;  5CYY A;  3LYP A;  4KX4 A;  4JR6 A;  4BVX B;  3W8J A;  4ID0 A;  3MSZ A;  4ZB9 A;  4XTS A;  1ZOF A;  3A5I A;  3ME7 A;  4BPY A;  1Z5Y E;  3HZ8 A;  3VFI A;  4OO4 A;  2L57 A;  2ON5 A;  1F9M A;  3HCZ A;  3DIE A;  1I5G A;  2GQL A;  3IXR A;  4O5Q A;  5HR1 A;  2LRT A;  3CMI A;  4XCS A;  2LV3 A;  2AYT A;  1ERU A;  1PKZ A;  1A0F A;  4L0W A;  2V6O A;  3O76 A;  1EGO A;  1B4P A;  2WJU A;  4FH8 A;  1GSD A;  3UJ1 A;  5F07 A;  3VWU A;  2PUK C;  2ZNM A;  1A23 A;  3LOR A;  3IA1 A;  2CT6 A;  1M3I A;  1O6J A;  3QD9 A;  4HS1 A;  2OKA A;  3FZ5 A;  1MEK A;  2IMF A;  4WR4 A;  2DJ3 A;  4POL A;  4TXV A;  5G31 A;  1URM A;  19GS A;  1VF3 A;  4HU9 A;  3IAM 2;  4JE1 A;  2H70 A;  3HXS A;  4KDU A;  3UVT A;  4MP4 A;  3EYT A;  3CTG A;  3QCP A;  2V2G A;  3UEM A;  4ZL8 A;  2IME A;  4KUN A;  1HNC A;  3AY8 A;  1XZO A;  2LKU A;  2PU9 C;  2IWT A;  1GTI A;  4HDE A;  4ACS A;  1X9W B;  3L9S A;  1T00 A;  2YV9 A;  2VD0 A;  1XCC A;  5JWR B;  4MMM A;  4ULX A;  2XPD A;  1XIY A;  2GZZ A;  5D9V A;  5FWG A;  2IFQ A;  4TR0 A;  4XS6 A;  2H66 A;  1T7P B;  3DKS A;  3UIW A;  1J9B A;  2HSH A;  2JAC A;  4JBB A;  4NHZ A;  1Z3E A;  2REM A;  2GSS A;  2X8G A;  2V41 A;  1EWX A;  1G0T A;  3IBH A;  3FR6 A;  3P2A A;  2FLS A;  4USS A;  4WET A;  1O73 A;  1ZYE A;  1WE0 A;  2GQK A;  2DJK A;  3GUS A;  2DMM A;  3MDK A;  4NMU A;  4GLT A;  5ECP B;  3TKS E;  3EUR A;  1R5P A;  5JCG A;  2H1A A;  5IPG A;  1H75 A;  5AIV A;  1FW1 A;  1OC9 B;  18GS A;  3Q18 A;  5ECN B;  5CAX A;  5GAN D;  5D9W A;  1I9D A;  4HQS A;  1U3I A;  4K0G A;  1SJZ A;  3E0U A;  3KMO A;  5CRE A;  3D21 A;  3GL5 A;  4N0Z A;  4HUA A;  3QPM A;  2KOK A;  5LNK e;  3FZ9 A;  4PX1 A;  2HNL A;  2GS3 A;  1YY7 A;  2WUL A;  2H19 A;  5DCH A;  1TP9 A;  3GRX A;  3DGQ A;  1F2E A;  4EIP A;  3EU4 A;  3LGC A;  5B6N A;  5COH A;  4K8M A;  5J9B A;  4KCE A;  2E2M A;  2HRN A;  1RK4 A;  5DDL A;  1SYR A;  3L4N A;  2JL4 A;  1XWA A;  5IOW A;  5ID2 A;  4K7I A;  1HNA A;  3BOA A;  1G7O A;  2MMA A;  1EOG A;  1EP7 A;  2IL3 A;  5DCG A;  4K5R A;  2O8V B;  3ZRE A;  3F4S A;  4Q5R A;  2FHE A;  1O8W A;  1PD2 1;  1W4V A;  1XWG A;  2VCT A;  3FHK A;  1U87 A;  4LLR A;  2RII A;  4WF5 A;  5AN1 A;  1RW1 A;  3ED3 A;  1QMV A;  2YN1 A;  2PBJ A;  3KGK A;  3APS A;  2R3X A;  1QFN A;  3GTU A;  5IMF A;  4MNN A;  2VAF A;  4PNF A;  1UN2 A;  2IMK A;  4ZIL A;  5KN0 A;  4CW9 A;  2CV4 A;  3VWV A;  1EV9 A;  1O7U A;  4OWY A;  3IK7 A;  2M46 A;  6GSV A;  5DQY A;  4LL1 B;  1R4W A;  3GL3 A;  3P7X A;  1F3B A;  4L8E A;  4NAX A;  4Z7X A;  1JZO A;  2YAN A;  4MF7 A;  4V2L A;  4DVC A;  3C71 A;  1GNW A;  3D4T A;  3KIJ A;  2WFC A;  1ERT A;  4MA9 A;  1GWC A;  3KH7 A;  3LQ7 A;  4H86 A;  1GTB A;  5HFI A;  1SEN A;  5DJM A;  2CAQ A;  4D73 A;  4HQZ A;  1K0O A;  4MH2 A;  1BYE A;  4GWR A;  4OFT A;  3LFL A;  2FA4 A;  4O32 A;  4F0C A;  1AQV A;  1T4Z A;  4BL7 A;  1XFL A;  2BJX A;  3WGD A;  1N2A A;  2C4J A;  1MD3 A;  3UOM A;  1WJK A;  1SD8 A;  4L5O A;  1NHO A;  3IDV A;  2VL3 A;  2C80 A;  2C8U A;  1A8L A;  3HDC A;  2L4C A;  3RAZ A;  3EMX A;  3R3E A;  4WXT A;  2OE1 A;  1F3A A;  1PGT A;  4V1A g;  3IK9 A;  2QA2 A;  1XW5 A;  2GGT A;  2F8A A;  5KN2 A;  2K8V A;  3P8W A;  3FR3 A;  1UA5 A;  1LBK A;  1YEX A;  3GKK A;  3EIN A;  4KE3 A;  4PQI A;  3CSH A;  4DSR A;  5KOW A;  1OVN A;  1XOB A;  2Z9S A;  4G0I A;  1VGL A;  2HLS A;  1O85 A;  1SK0 A;  1A2J A;  3VPQ A;  1SKW B;  2CZ2 A;  4PQH A;  1QQ2 A;  4OCF A;  3CSI A;  2C0F A;  2QKE A;  5JCW A;  4MK3 A;  3UL3 A;  1X0R A;  2PER A;  2K6V A;  1XVW A;  3HJP A;  3GX8 A;  3LJR A;  4V2N A;  3GIX A;  4EE0 A;  1SL1 B;  1ZYQ B;  2VCZ A;  3LSZ A;  2FUG 2;  5BMU A;  4WR5 A;  3HHV A;  3LXT A;  1V98 A;  1V2A A;  1XW9 A;  4ZB8 A;  5J3R A;  2GQM A;  4KGI A;  2LEG A;  2CX4 A;  1F37 A;  3HVX A;  4POB A;  3I43 A;  1WMJ A;  2L5L A;  2JU5 A;  4KB3 A;  3QAG A;  2YPM A;  3TJG A;  2GT5 A;  1QK8 A;  2X8H A;  2X64 A;  1B8X A;  1DE2 A;  3ZIJ A;  4BVY A;  1ZCP A;  1M9A A;  2L59 A;  2JSY A;  2O7K A;  3IC8 A;  4EO3 A;  4HZ2 A;  3EVI A;  2IJY A;  2PWJ A;  1K3O A;  2FWF A;  3GYK A;  3DML A;  5DAK B;  4MZW A;  2K8S A;  3KCM A;  2FA8 A;  3GN3 A;  3J7Y k;  2CA8 A;  4IEL A;  3HJM A;  3HYP A;  2OE3 A;  2DIY A;  6GSY A;  2YOI A;  2PVO C;  1GTA A;  1VF1 A;  3A2W A;  3IHQ A;  1YKC A;  3IE3 A;  3H93 A;  3KM6 A;  4FQU A;  3D22 A;  3GA4 A;  1GSS A;  5F06 A;  4KAE A;  3ZZX A;  4GSS A;  4YH2 A;  1GSE A;  1A8Y A;  2H6X A;  1QGV A;  2TIR A;  3RDW A;  2OAD A;  3FW2 A;  2WDU A;  1YJ6 A;  1EV4 A;  3RHB A;  3TRP A;  1K0D A;  2A2R A;  4PQ1 A;  3EPT A;  2F9S A;  2GDR A;  1A2L A;  1GH2 A;  3H79 A;  22GS A;  1SJI A;  1Y6E A;  5D93 A;  1ABA A;  4Q5F A;  1TI3 A;  1DBY A;  5DBQ A;  1PN0 A;  3DXB A;  3IOS A;  2GZY A;  2C3N A;  2VO4 A;  3ZIT A;  1O8X A;  5FT3 A;  4JU5 A;  3GKM A;  2VLU A;  4KSO A;  3FYG A;  3H4K A;  5D9X A;  2P5Q A;  2O87 A;  2E2G A;  1M0U A;  4ZIJ A;  3GKN A;  4F0B A;  1PX6 A;  5ECO B;  1Z9H A;  5J9C A;  4I6X A;  1JLW A;  2H0G A;  3LW9 A;  5IMD A;  4GQC A;  4IP6 A;  2G2Q A;  5HFK A;  3WT2 A;  2R37 A;  1XWC A;  2C0G A;  1BJX A;  2HSY A;  3KP9 A;  4I2U A;  3F8U A;  1YF1 A;  3WD6 A;  2VCV A;  4AF2 A;  2VL2 A;  2D2Z A;  3QAV A;  3TOU A;  4ZBA A;  4OO5 A;  1NW2 A;  4V1A p;  2GSQ A;  1DUG A;  1WPI A;  4IBP A;  3HA9 A;  1S3C A;  3N9J A;  3KZQ A;  5A4U A;  1PA3 A;  3CTF A;  1YQ1 A;  4TR3 A;  2WB9 A;  4ECB A;  4IHU A;  1PRX A;  1SL0 B;  5D73 A;  3UAR A;  1Z6N A;  5DAL A;  3ERW A;  3BBY A;  4AGS A;  1PSQ A;  3GMF A;  5L71 A;  2WCI A;  4KCA A;  5ABR A;  1U88 A;  3EU3 A;  2JAD A;  2IMD A;  4XS4 A;  1BAY A;  2X99 A;  1HNB A;  1NHY A;  3KEB A;  4RI7 A;  1GSQ A;  2X8C A;  2MYG A;  4KA0 A;  3F9U A;  4MZB A;  1G6Y A;  3M3M A;  1SK2 A;  3KD0 A;  4HZ4 A;  4PUR A;  5CO3 A;  3RPP A;  3D6I A;  2NVL A;  2HRF A;  5ECH B;  5ECQ B;  4ZL7 A;  3RPN A;  4XRD A;  2E0Q A;  1ZGN A;  4GQF A;  4PNG A;  3O3T A;  5F05 A;  4YQU A;  4ECJ A;  4OCE A;  1PMT A;  4BVX A;  2C3T A;  5HR3 A;  3C73 A;  3TRQ A;  4TW5 A;  3IHG A;  4TR4 A;  1AUC A;  2VD1 A;  1G6W A;  2DSA A;  3M9K A;  4MJC A;  2A2P A;  4HU7 A;  1FG4 A;  1C72 A;  2OJL A;  2B5E A;  16GS A;  4IN0 A;  4EL1 A;  1GSY A;  5AGY A;  5DQS A;  4Z2U A;  4OFN A;  4JED A;  1HQO A;  4PUA A;  1AXD A;  3I9V 2;  1PKW A;  1TTZ A;  1MDK A;  4XS1 A;  4GST A;  4JR4 A;  2LQO A;  1TK5 B;  1FOV A;  3HJO A;  4GTU A;  1GLP A;  4EDZ A;  2M72 A;  4PTS A;  2AB6 A;  5G5F A;  2I1U A;  5GZZ B;  2H1D A;  1YF0 A;  2GVP A;  2N5F A;  4TKY A;  2LUS A;  5GST A;  1R7H A;  6GST A;  3ERF A;  3VUR A;  4ECI A;  1JFU A;  3WGE A;  3CRT A;  3DVW A;  1SKR B;  2DLX A;  4JRR A;  4OD7 A;  3H1N A;  1X9S B;  4O7H A;  5CRW A;  4Q5N A;  5AIS A;  4PXO A;  2EIO A;  8GSS A;  2DKH A;  2LNS A;  4DSQ A;  4EF0 A;  3FY7 A;  2UZ8 A;  1EOH A;  4IP1 A;  4LA1 A;  2HZE B;  4IJI A; 
#chains in the Genus database with same CATH homology
 4L5L A;  3IPZ A;  3GH6 A;  5AIX A;  1M9B A;  1B48 A;  3CSJ A;  3US3 A;  1TRW A;  4NWY A;  4TR1 B;  2YZH A;  2YWO A;  4POK A;  3ZIV A;  4YQM A;  2AV4 A;  4TOP A;  1V40 A;  4G0K A;  4RQX A;  5INY A;  3GSS A;  5EPF A;  2V1M A;  2PGT A;  3UBK A;  2VUP A;  2KLX A;  1ST9 A;  5EY6 A;  5DJL A;  1V57 A;  2H30 A;  5G30 A;  3ZL5 A;  5KOX A;  5B8A A;  4TXO B;  5DVB A;  6GSU A;  4KDX A;  2J9H A;  2H0I A;  4ZL9 A;  1JZR A;  4MH3 A;  3UVH A;  2B7J A;  4EDY A;  4E8E A;  4IS0 A;  2YP6 A;  3E3E A;  3Q74 A;  4K7O A;  2G0F A;  3TJK A;  2DBC A;  4BA7 A;  1OC3 A;  1OC9 A;  1EZK A;  2R2J A;  2PMT A;  2FWH A;  3C8E A;  3GFK A;  3GHA A;  3TKR A;  3LEF A;  4IGJ A;  2NDO A;  4KSM A;  2LRC A;  4KF9 A;  3I69 A;  4ZB6 A;  1X5E A;  4X4J A;  3ZVJ A;  4I8B A;  4MDC A;  2F51 A;  1USB A;  2VM2 A;  1AW9 A;  1K3L A;  4TN8 A;  2F3M A;  1IYI A;  1JZW A;  3PPU A;  2MBS A;  5JCU A;  4ICY A;  2P5R A;  1ZYN A;  1F6M C;  2JZS A;  4TRX A;  3F0I A;  4QL7 A;  2HRA A;  4NHW A;  2R0P A;  4N10 A;  1LU4 A;  1AQW A;  1OC8 A;  4PGT A;  3DWV A;  1OAZ A;  1XOA A;  1M2B A;  4TVE A;  20GS A;  4ZBD A;  3GST A;  2H73 A;  1JHB A;  1GUK A;  4G0L A;  2JZT A;  5ELA A;  4XIH A;  1XPV A;  3F6D A;  1SK1 A;  4MJE A;  3QOU A;  1UVZ A;  1TU7 A;  2LTK A;  2CQ9 A;  2XPE A;  4N0V A;  2GTU A;  1GRX A;  1KNG A;  2TRX A;  2VCW A;  3NZN A;  4EXJ A;  2H76 A;  2YV7 A;  4IVF A;  5C00 A;  3QR6 A;  4NXI A;  1YDK A;  2GZP A;  4A5P A;  1G7E A;  1IYH A;  2PN8 A;  2JSZ A;  1B9Y C;  1E2Y A;  2DJJ A;  3W6G A;  2R6K A;  3ZLP A;  3C1S A;  4YAV A;  2B5X A;  4K6X A;  3LYK A;  2HRK A;  3I6A A;  4RI6 A;  1PQN A;  3ERG A;  2NPB A;  3PH9 A;  1X5D A;  2VLV A;  5CRG A;  1XVQ A;  3ME8 A;  3WGX A;  1E6B A;  2N5B A;  1TK8 B;  2OE0 A;  3ZTL A;  1TK0 B;  3HY2 A;  2MBT A;  3GH9 A;  1X5C A;  2GST A;  2PPT A;  2B5Y A;  3ZML A;  1Z7R A;  3M1G A;  3JCM L;  2ON7 A;  1SYX A;  3LXZ A;  3GUR A;  4FIW A;  3GV1 A;  1Z6M A;  5IMV A;  1K0M A;  4AJ8 A;  4WBJ A;  2B1L A;  5G2Z A;  4ZXG A;  3HVS A;  1J08 A;  3G7J A;  4MPF A;  1EEJ A;  1MDI A;  3MNG A;  5JWO B;  3HZ4 A;  2QA1 A;  1TXX A;  3TRX A;  3O6T A;  2P31 A;  3TOT A;  1OE8 A;  6GSW A;  5ECS A;  4EKZ A;  3BJ5 A;  5ECK B;  1ZZY A;  5ENU A;  2FD3 A;  1FO5 A;  1M2D A;  1M7T A;  3MWH A;  3VLN A;  2DC5 A;  3IR4 A;  5IIZ A;  5ECM B;  2M80 A;  5A4W A;  4DSS A;  4NPB A;  1A0R P;  1GTU A;  2LQQ A;  2FNO A;  5H5Q A;  1KEB A;  1QUW A;  3DYR A;  3F63 A;  3D4M A;  3QDN A;  4BWQ A;  3LG6 A;  4G2E A;  3PR8 A;  3F4T A;  1GUL A;  3RBT A;  4XRA A;  3G9B A;  3A5W A;  2CVB A;  5CRH A;  2AAW A;  2B1K A;  4EUY A;  2HFD A;  3LWA A;  3TCO A;  4YKG A;  1WIK A;  4X1U A;  2PVQ A;  3W8S A;  5KN1 A;  3FZ4 A;  5ELG A;  1A2M A;  1TOF A;  4KH7 A;  5HR0 A;  1OYJ A;  4F9Z A;  4CHS A;  1HYU A;  3ZYW A;  3TJJ A;  2DKI A;  1XWK A;  2E7P A;  4MF5 A;  1M99 A;  4CDO A;  1GL8 A;  5D8I A;  4CY8 A;  4GCI A;  2XC2 A;  1U3A A;  2KP1 A;  4POM A;  4WF4 A;  3APQ A;  3HVV A;  1NSW A;  3DD3 A;  4AJ6 A;  2H8L A;  1ZYP A;  5IO2 A;  3GNJ A;  2VCX A;  3VPT A;  5CP1 A;  1SKS B;  2YWM A;  2HT9 A;  2OBK A;  2RUF A;  5IM9 A;  2VCQ A;  5LCZ A;  4O5U A;  1WRY A;  2MMZ A;  1SU9 A;  3ZVJ D;  1ILO A;  1T8E B;  1O81 A;  2H71 A;  1GP1 A;  4CY6 A;  1T4Y A;  4X0X A;  1K0B A;  2L4Q A;  3KP8 A;  2IN3 A;  1WP0 A;  4I2T A;  1YZX A;  4EIQ A;  3K8N A;  4K7N A;  2IFQ B;  2YCD A;  1ML6 A;  3F4R A;  2DIZ A;  2KUC A;  2H6Y A;  3IAS 2;  5IPH A;  3E9J B;  1XWB A;  2QC7 A;  1ERV A;  4HOJ A;  1BQ7 A;  1QXH A;  1CQG A;  3PGT A;  2C1Y A;  2IIY A;  4KDY A;  5B6M A;  2ZCT A;  3IC4 A;  5IOX A;  3FR9 A;  4RQR A;  1Y25 A;  4K1F A;  2JZR A;  4HJM A;  3GX0 A;  4K0N A;  3GKX A;  4NV5 A;  3TKS A;  4N11 A;  1B9X C;  4G10 A;  3G7I A;  4EVM A;  2NTO A;  4RUV A;  4IW9 A;  4WBR D;  3H8Q A;  5E4W A;  2V6K A;  2A4H A;  3FZA A;  2A4V A;  2GSR A;  1TU8 A;  2J23 A;  4G9H A;  5EVO A;  3NIV A;  1VRS D;  3ZFL A;  2ES7 A;  5KN3 A;  2XBI A;  5B8B A;  9GSS A;  3FMW A;  5EL8 A;  3P90 A;  2RLI A;  1SL2 B;  3EMP A;  4GXZ A;  5IMZ A;  5D9T A;  1PN9 A;  1TRU A;  2XBQ A;  4IJ3 A;  2L5O A;  1FHE A;  4OFM A;  4YKF A;  2DJ2 A;  5ECI B;  5ECR B;  4N30 A;  1YEP A;  1GSU A;  1A24 A;  2IMI A;  1WOU A;  3A2V A;  1KTE A;  2C0E A;  1TJD A;  2R0C A;  5JWQ B;  4IQ1 A;  5ID2 B;  2OA7 A;  3TDG A;  3U6V A;  3A3T A;  3EE2 A;  4I5Q A;  1U6T A;  3M8N A;  3MAK A;  1Q4J A;  3L9V A;  2H01 A;  4QL9 A;  3N5O A;  4OMV A;  3DRN A;  4MJB A;  2YWI A;  3QFA C;  1GLQ A;  1TRV A;  3TJF A;  2EC4 A;  3M0F A;  4ML6 A;  2KP2 A;  3KJY A;  2WGR A;  2P0G A;  3GTU B;  2NBS A;  1ZMA A;  3TJB A;  2TRC P;  4J56 E;  2RM6 A;  2VOC A;  1S3D A;  5IMC A;  5KEJ A;  3ZFB A;  1J0F A;  4FO5 A;  2YNX A;  2CX3 A;  1PL1 A;  3FEU A;  14GS A;  4K5S A;  2EIQ A;  4MF6 A;  4GSN A;  4F82 A;  4LMW A;  5H5S A;  1XBS A;  1FVK A;  5E59 A;  4MAB A;  5FHI A;  3D5J A;  4Q5Q A;  1K0C A;  2FWE A;  3APO A;  4J57 E;  4PUF C;  1YKA A;  2WRT A;  1VF4 A;  3UBL A;  4FYB A;  3C7M A;  4HEA 2;  11GS A;  2EIR A;  3BCI A;  4ML1 A;  1NM3 A;  3VI7 A;  2LJK A;  4D73 B;  3S9F A;  1K3Y A;  1PL2 A;  3QMX A;  4QQ7 A;  2K18 A;  3VWW A;  4K2X A;  4J2F A;  5CRD A;  2H6Z A;  1ZL9 A;  4BL7 B;  2H1G A;  2V32 A;  2B3S A;  1VF2 A;  1FAA A;  2YJ7 A;  1MDJ A;  1BG5 A;  2MMO A;  3TB2 A;  3SWL A;  5F8B A;  4Z2T A;  1B4Q A;  2H0H A;  4ZBB A;  4ECC A;  1GUH A;  1JLV A;  5G5E A;  1K0N A;  1TW9 A;  3Q6O A;  2H1B A;  3VK9 A;  3D0Z A;  2LS5 A;  2LJR A;  2RM5 A;  5G1L A;  3F3Q A;  3BCK A;  1KBN A;  1AQX A;  1XXU A;  1T3B A;  3KXO A;  5GAP D;  1SJ6 A;  3KH9 A;  1N8J A;  3WT1 A;  3IRA A;  1TRS A;  2QGV A;  4MLY A;  1GSF A;  1X9M B;  4L0U A;  4ILF A;  2HZE A;  3QAW A;  1TKD B;  2L6D A;  2OBI A;  2B6M A;  4MZC A;  1R5A A;  1PX7 A;  5IO0 A;  3J7Y b;  4TR1 A;  4V2M A;  3U5R E;  3F3R A;  2O89 A;  4P3Y B;  3G7Y A;  3IV4 A;  2AHE A;  2A2S A;  3ZMK A;  2FGX A;  3VI5 A;  2VL9 A;  2VM1 A;  10GS A;  17GS A;  4MCU A;  2QSI A;  1Q98 A;  3L0H A;  3BD2 A;  4I97 A;  2I3Y A;  5CNW A;  1RQM A;  4GF0 A;  2FCH A;  1AC1 A;  3RHC A;  3WYW A;  1S3A A;  2HE3 A;  1MTC A;  4FYC A;  2KHP A;  2ALB A;  2O85 A;  4Z2R A;  4BVY B;  4TXO A;  3C1R A;  2LST A;  2LJA A;  3TGZ A;  2F8F A;  3FRC A;  3V1W A;  2I4A A;  2DJ1 A;  1DSB A;  1FB6 A;  3OR5 A;  13GS A;  2VL2 C;  2XHF A;  3CYN A;  3SBC A;  5J4U A;  4LL4 B;  2R4V A;  2HI7 A;  2R5G A;  3ZRD A;  3TUE A;  1HD2 A;  2B7K A;  3MIX A;  2LRN A;  2AUV A;  5C04 A;  5IQY A;  5GSS A;  5J41 A;  2BTO T;  3KTL A;  4JZQ A;  5HR2 A;  4O5R A;  5LD0 A;  2WZ9 A;  2C3Q A;  3R2Q A;  2I81 A;  1EGR A;  5F0G A;  2FWG A;  1ERW A;  3L9U A;  2FY6 A;  6GSX A;  1XW6 A;  2RUE A;  4LMV A;  5ECL B;  1Z7P A;  3EWL A;  3MYD A;  4DSS B;  6GSS A;  2VIM A;  2H75 A;  2CZ3 A;  4XHM A;  4AJ7 A;  4DEJ A;  7GSS A;  1TDI A;  1GUM A;  4BWS A;  1GNE A;  3KMN A;  1FVJ A;  3Q19 A;  4HJ2 A;  1T1V A;  1OE7 A;  2VLT A;  5D96 A;  4WEY A;  4G19 A;  1ON4 A;  2CVK A;  2H72 A;  2GT6 A;  1CQH A;  4NV2 A;  1M2A A;  3TKS C;  3QFB C;  1R26 A;  1K0A A;  3M9J A;  1AIU A;  2HYX A;  4EC0 A;  2HSM A;  2WS2 A;  3UAP A;  4F03 A;  3FKF A;  2H74 A;  4E8H A;  2K9F A;  4MPG A;  1WWJ A;  4K9Z A;  4WKW A;  2YWN A;  1FOH A;  4KND A;  2CAI A;  2CVD A;  4FYU A;  3NOF A;  2X49 A;  4GRF A;  1THX A;  3DEX A;  3CBU A;  4YQV A;  1OKT A;  1MD4 A;  3TKQ A;  1UC7 A;  2HZF A;  1V58 A;  2N5A A;  3TKP A;  4MJA A;  5IMA A;  2C0D A;  4ISD A;  3KTB A;  2MMN A;  1EEM A;  5A5K A;  5HQP A;  1FB0 A;  1EP8 A;  2HXK A;  3ISO A;  2LNT A;  5G1K A;  3EC3 A;  2IPA A;  3F6F A;  5A4V A;  5B7C A;  1TI1 A;  2ZUP A;  5DAL B;  5H5R A;  4KW6 A;  5HFG A;  1H4O A;  2DJ0 A;  4F2I A;  3DVX A;  1THO A;  2L6C A;  2R0G A;  1W89 A;  3FK8 A;  3PIN A;  3L78 A;  4XS4 B;  4IQA A;  2AJQ B;  2BMX A;  3CXG A;  3CRU A;  1AAZ A;  3HD5 A;  2X4A A;  2GLR A;  4HI7 A;  4IKH A;  1LJR A;  3HKR A;  1DE1 A;  1OKD A;  1BX9 A;  2MZC A;  5DAK A;  2OAC A;  5BRT A;  1SD9 A;  4X43 A;  2I9H A;  4O92 A;  4K2D A;  1JZD A;  1ACV A;  12GS A;  1V9W A;  2YJH A;  5J5N A;  3VWX A;  2DML A;  4YAP A;  2YZU A;  3A2X A;  1BED A;  3UMA A;  5CYY A;  3LYP A;  4KX4 A;  4JR6 A;  4BVX B;  3W8J A;  4ID0 A;  3MSZ A;  4ZB9 A;  4XTS A;  1ZOF A;  3A5I A;  3ME7 A;  4BPY A;  1Z5Y E;  3HZ8 A;  3VFI A;  4OO4 A;  2L57 A;  2ON5 A;  1F9M A;  3HCZ A;  3DIE A;  1I5G A;  2GQL A;  3IXR A;  4O5Q A;  5HR1 A;  2LRT A;  3CMI A;  4XCS A;  2LV3 A;  2AYT A;  1ERU A;  1PKZ A;  1A0F A;  4L0W A;  2V6O A;  3O76 A;  1EGO A;  1B4P A;  2WJU A;  4FH8 A;  1GSD A;  3UJ1 A;  5F07 A;  3VWU A;  2PUK C;  2ZNM A;  1A23 A;  3LOR A;  3IA1 A;  2CT6 A;  1O6J A;  3QD9 A;  4HS1 A;  2OKA A;  3FZ5 A;  1MEK A;  2IMF A;  4WR4 A;  2DJ3 A;  4POL A;  4TXV A;  5G31 A;  1URM A;  19GS A;  1VF3 A;  4HU9 A;  3IAM 2;  4JE1 A;  2H70 A;  3HXS A;  4KDU A;  3UVT A;  4MP4 A;  3EYT A;  3CTG A;  3QCP A;  2V2G A;  3UEM A;  4ZL8 A;  2IME A;  4KUN A;  1HNC A;  3AY8 A;  1XZO A;  2LKU A;  2PU9 C;  2IWT A;  1GTI A;  4HDE A;  4ACS A;  1X9W B;  3L9S A;  1T00 A;  2YV9 A;  2VD0 A;  1XCC A;  5JWR B;  4MMM A;  4ULX A;  2XPD A;  1XIY A;  2GZZ A;  5D9V A;  5FWG A;  2IFQ A;  4TR0 A;  4XS6 A;  2H66 A;  1T7P B;  3DKS A;  3UIW A;  1J9B A;  2HSH A;  2JAC A;  4JBB A;  4NHZ A;  1Z3E A;  2REM A;  2GSS A;  2X8G A;  2V41 A;  1EWX A;  1G0T A;  3IBH A;  3FR6 A;  3P2A A;  2FLS A;  4USS A;  4WET A;  1O73 A;  1ZYE A;  1WE0 A;  2GQK A;  2DJK A;  3GUS A;  2DMM A;  3MDK A;  4NMU A;  4GLT A;  5ECP B;  3TKS E;  3EUR A;  1R5P A;  5JCG A;  2H1A A;  5IPG A;  1H75 A;  5AIV A;  1FW1 A;  1OC9 B;  18GS A;  3Q18 A;  5ECN B;  5CAX A;  5GAN D;  5D9W A;  1I9D A;  4HQS A;  1U3I A;  4K0G A;  1SJZ A;  3E0U A;  3KMO A;  5CRE A;  3D21 A;  3GL5 A;  4N0Z A;  4HUA A;  3QPM A;  2KOK A;  5LNK e;  3FZ9 A;  4PX1 A;  2HNL A;  2GS3 A;  1YY7 A;  2WUL A;  2H19 A;  5DCH A;  1TP9 A;  3GRX A;  3DGQ A;  1F2E A;  4EIP A;  3EU4 A;  3LGC A;  5B6N A;  5COH A;  4K8M A;  5J9B A;  4KCE A;  2E2M A;  2HRN A;  1RK4 A;  5DDL A;  1SYR A;  3L4N A;  2JL4 A;  1XWA A;  5IOW A;  5ID2 A;  4K7I A;  1HNA A;  3BOA A;  1G7O A;  2MMA A;  1EOG A;  1EP7 A;  2IL3 A;  5DCG A;  4K5R A;  2O8V B;  3ZRE A;  3F4S A;  4Q5R A;  2FHE A;  1O8W A;  1PD2 1;  1W4V A;  1XWG A;  2VCT A;  3FHK A;  1U87 A;  4LLR A;  2RII A;  4WF5 A;  5AN1 A;  1RW1 A;  3ED3 A;  1QMV A;  2YN1 A;  2PBJ A;  3KGK A;  3APS A;  2R3X A;  1QFN A;  3GTU A;  5IMF A;  4MNN A;  2VAF A;  4PNF A;  1UN2 A;  2IMK A;  4ZIL A;  5KN0 A;  4CW9 A;  2CV4 A;  3VWV A;  1EV9 A;  1O7U A;  4OWY A;  3IK7 A;  2M46 A;  6GSV A;  5DQY A;  4LL1 B;  1R4W A;  3GL3 A;  3P7X A;  1F3B A;  4L8E A;  4NAX A;  4Z7X A;  1JZO A;  2YAN A;  4MF7 A;  4V2L A;  4DVC A;  3C71 A;  1GNW A;  3D4T A;  3KIJ A;  2WFC A;  1ERT A;  4MA9 A;  1GWC A;  3KH7 A;  3LQ7 A;  4H86 A;  1GTB A;  5HFI A;  1SEN A;  5DJM A;  2CAQ A;  4D73 A;  4HQZ A;  1K0O A;  4MH2 A;  1BYE A;  4GWR A;  4OFT A;  3LFL A;  2FA4 A;  4O32 A;  4F0C A;  1AQV A;  1T4Z A;  4BL7 A;  1XFL A;  2BJX A;  3WGD A;  1N2A A;  2C4J A;  1MD3 A;  3UOM A;  1WJK A;  1SD8 A;  4L5O A;  1NHO A;  3IDV A;  2VL3 A;  2C80 A;  2C8U A;  1A8L A;  3HDC A;  2L4C A;  3RAZ A;  3EMX A;  3R3E A;  4WXT A;  2OE1 A;  1F3A A;  1PGT A;  4V1A g;  3IK9 A;  2QA2 A;  1XW5 A;  2GGT A;  2F8A A;  5KN2 A;  2K8V A;  3P8W A;  3FR3 A;  1UA5 A;  1LBK A;  1YEX A;  3GKK A;  3EIN A;  4KE3 A;  4PQI A;  3CSH A;  4DSR A;  5KOW A;  1OVN A;  1XOB A;  2Z9S A;  4G0I A;  1VGL A;  2HLS A;  1O85 A;  1SK0 A;  1A2J A;  3VPQ A;  1SKW B;  2CZ2 A;  4PQH A;  1QQ2 A;  4OCF A;  3CSI A;  2C0F A;  2QKE A;  5JCW A;  4MK3 A;  3UL3 A;  1X0R A;  2PER A;  2K6V A;  1XVW A;  3HJP A;  3GX8 A;  3LJR A;  4V2N A;  3GIX A;  4EE0 A;  1SL1 B;  1ZYQ B;  2VCZ A;  3LSZ A;  2FUG 2;  5BMU A;  4WR5 A;  3HHV A;  3LXT A;  1V98 A;  1V2A A;  1XW9 A;  4ZB8 A;  5J3R A;  2GQM A;  4KGI A;  2LEG A;  2CX4 A;  1F37 A;  3HVX A;  4POB A;  3I43 A;  1WMJ A;  2L5L A;  2JU5 A;  4KB3 A;  3QAG A;  2YPM A;  3TJG A;  2GT5 A;  1QK8 A;  2X8H A;  2X64 A;  1B8X A;  1DE2 A;  3ZIJ A;  4BVY A;  1ZCP A;  1M9A A;  2L59 A;  2JSY A;  2O7K A;  3IC8 A;  4EO3 A;  4HZ2 A;  3EVI A;  2IJY A;  2PWJ A;  1K3O A;  2FWF A;  3GYK A;  3DML A;  5DAK B;  4MZW A;  2K8S A;  3KCM A;  2FA8 A;  3GN3 A;  3J7Y k;  2CA8 A;  4IEL A;  3HJM A;  3HYP A;  2OE3 A;  2DIY A;  6GSY A;  2YOI A;  2PVO C;  1GTA A;  1VF1 A;  3A2W A;  3IHQ A;  1YKC A;  3IE3 A;  3H93 A;  3KM6 A;  4FQU A;  3D22 A;  3GA4 A;  1GSS A;  5F06 A;  4KAE A;  3ZZX A;  4GSS A;  4YH2 A;  1GSE A;  1A8Y A;  2H6X A;  1QGV A;  2TIR A;  3RDW A;  2OAD A;  3FW2 A;  2WDU A;  1YJ6 A;  1EV4 A;  3RHB A;  3TRP A;  1K0D A;  2A2R A;  4PQ1 A;  3EPT A;  2F9S A;  2GDR A;  1A2L A;  1GH2 A;  3H79 A;  22GS A;  1SJI A;  1Y6E A;  5D93 A;  1ABA A;  4Q5F A;  1TI3 A;  1DBY A;  5DBQ A;  1PN0 A;  3DXB A;  3IOS A;  2GZY A;  2C3N A;  2VO4 A;  3ZIT A;  1O8X A;  5FT3 A;  4JU5 A;  3GKM A;  2VLU A;  4KSO A;  3FYG A;  3H4K A;  5D9X A;  2P5Q A;  2O87 A;  2E2G A;  1M0U A;  4ZIJ A;  3GKN A;  4F0B A;  1PX6 A;  5ECO B;  1Z9H A;  5J9C A;  4I6X A;  1JLW A;  2H0G A;  3LW9 A;  5IMD A;  4GQC A;  4IP6 A;  2G2Q A;  5HFK A;  3WT2 A;  2R37 A;  1XWC A;  2C0G A;  1BJX A;  2HSY A;  3KP9 A;  4I2U A;  3F8U A;  1YF1 A;  3WD6 A;  2VCV A;  4AF2 A;  2VL2 A;  2D2Z A;  3QAV A;  3TOU A;  4ZBA A;  4OO5 A;  1NW2 A;  4V1A p;  2GSQ A;  1DUG A;  1WPI A;  4IBP A;  3HA9 A;  1S3C A;  3N9J A;  3KZQ A;  5A4U A;  1PA3 A;  3CTF A;  1YQ1 A;  4TR3 A;  2WB9 A;  4ECB A;  4IHU A;  1PRX A;  1SL0 B;  5D73 A;  3UAR A;  1Z6N A;  5DAL A;  3ERW A;  3BBY A;  4AGS A;  1PSQ A;  3GMF A;  5L71 A;  2WCI A;  4KCA A;  5ABR A;  1U88 A;  3EU3 A;  2JAD A;  2IMD A;  4XS4 A;  1BAY A;  2X99 A;  1HNB A;  1NHY A;  3KEB A;  4RI7 A;  1GSQ A;  2X8C A;  2MYG A;  4KA0 A;  3F9U A;  4MZB A;  1G6Y A;  3M3M A;  1SK2 A;  3KD0 A;  4HZ4 A;  4PUR A;  5CO3 A;  3RPP A;  3D6I A;  2NVL A;  2HRF A;  5ECH B;  5ECQ B;  4ZL7 A;  3RPN A;  4XRD A;  2E0Q A;  1ZGN A;  4GQF A;  4PNG A;  3O3T A;  5F05 A;  4YQU A;  4ECJ A;  4OCE A;  1PMT A;  4BVX A;  2C3T A;  5HR3 A;  3C73 A;  3TRQ A;  4TW5 A;  3IHG A;  4TR4 A;  1AUC A;  2VD1 A;  1G6W A;  2DSA A;  3M9K A;  4MJC A;  2A2P A;  4HU7 A;  1FG4 A;  1C72 A;  2OJL A;  2B5E A;  16GS A;  4IN0 A;  4EL1 A;  1GSY A;  5AGY A;  5DQS A;  4Z2U A;  4OFN A;  4JED A;  1HQO A;  4PUA A;  1AXD A;  3I9V 2;  1PKW A;  1TTZ A;  1MDK A;  4XS1 A;  4GST A;  4JR4 A;  2LQO A;  1TK5 B;  1FOV A;  3HJO A;  4GTU A;  1GLP A;  4EDZ A;  2M72 A;  4PTS A;  2AB6 A;  5G5F A;  2I1U A;  5GZZ B;  2H1D A;  1YF0 A;  2GVP A;  2N5F A;  4TKY A;  2LUS A;  5GST A;  1R7H A;  6GST A;  3ERF A;  3VUR A;  4ECI A;  1JFU A;  3WGE A;  3CRT A;  3DVW A;  1SKR B;  2DLX A;  4JRR A;  4OD7 A;  3H1N A;  1X9S B;  4O7H A;  5CRW A;  4Q5N A;  5AIS A;  4PXO A;  2EIO A;  8GSS A;  2DKH A;  2LNS A;  4DSQ A;  4EF0 A;  3FY7 A;  2UZ8 A;  1EOH A;  4IP1 A;  4LA1 A;  2HZE B;  4IJI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...