4FO5A

Crystal structure of a thioredoxin-like protein (bdi_1100) from parabacteroides distasonis atcc 8503 at 2.02 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
141
structure length
136
Chain Sequence
KLTEGVNPGDLAPRIEFKASFHNQLGRYTLLNFWAAYDAESRARNVQLANEVNKFGPDKIAMCSISMDEKESIFTETVKIDKLDLSTQFHEGLGKESELYKKYDLRKGFKNFLINDEGVIIAANVTPEKLTEILKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thioredoxin-like protein
publication title Crystal structure of a thioredoxin-like protein (BDI_1100) from Parabacteroides distasonis ATCC 8503 at 2.02 A resolution
rcsb
source organism Parabacteroides distasonis
molecule tags Oxidoreductase
total genus 38
structure length 136
sequence length 141
ec nomenclature
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13905 Thioredoxin_8 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4fo5A00
1DUGA 1HD2A 2H71A 5E4WA 4BWSA 3LQ7A 3PR8A 3QAVA 4TW5A 3P8WA 1GSFA 1WE0A 4WF4A 3C1RA 4X1UA 3ED3A 1A2MA 1R7HA 3LEFA 2AJQB 3RBTA 5ECKB 5IO0A 3EC3A 1W4VA 2YWNA 5EVOA 3VWWA 1OC9A 4P3YB 1ACVA 5JWRB 1OC9B 4TR1B 3F4SA 4ZL9A 1XVQA 3GKNA 2AYTA 2JZSA 4DSRA 5ECHB 4GSSA 4KNDA 4POKA 1ON4A 2KP1A 2K18A 3ME7A 1X9SB 1O81A 4O5RA 4GRFA 4N0VA 1WOUA 3GKKA 2BTOT 4IP1A 4GCIA 3HJOA 4OWYA 4ZIJA 1B9XC 5D73A 2DJ3A 5KN0A 3CSIA 2IMDA 4MF7A 2DSAA 3MNGA 3VWXA 1Z6MA 1KNGA 4K6XA 4MDCA 2RUEA 1G7OA 3VWVA 4Q5FA 5D9VA 1Z7PA 1H75A 2OE3A 4OFTA 1A24A 1AUCA 1VF1A 3QR6A 2H1AA 1UA5A 2VCXA 3IBHA 3U6VA 3IPZA 4ZL7A 4EVMA 1GSSA 4ZBDA 3FEUA 3ZRDA 3A2VA 3HY2A 1TTZA 3ZLPA 3WGDA 3E0UA 1G7EA 2CV4A 5LCZA 1GLPA 4G9HA 2PMTA 2QC7A 3HDCA 5JCUA 2H0GA 1PKWA 4E8EA 4Z7XA 4WXTA 3LXZA 5CREA 2YP6A 1XPVA 3DYRA 2H01A 1K3LA 2L57A 1TKDB 2YZHA 2YOIA 5IPHA 3M9KA 1TU7A 1DE2A 3VI5A 1JZRA 3HHVA 1U6TA 2FD3A 3WT2A 2JZTA 5C00A 4GQFA 1JHBA 5JWOB 4ULXA 3TKPA 1H4OA 3L0HA 4NXIA 4EF0A 3RPNA 4RUVA 1B4QA 3FW2A 2IL3A 1TRVA 4CDOA 4F0CA 4K8MA 4OCEA 3KIJA 2KLXA 1YEPA 3LWAA 3LYPA 2VLTA 2GSSA 2I1UA 4X43A 4MZWA 2VD0A 2QSIA 3KMNA 2WZ9A 4ML6A 3TKQA 3TDGA 5INYA 2RM6A 5J9CA 1WWJA 4FH8A 2HI7A 2J23A 3IK7A 4HQZA 5CRGA 3TRPA 4V1Ag 3BJ5A 6GSYA 1F6MC 1U3AA 4KH7A 2ES7A 1S3CA 1FW1A 1AQWA 3IXRA 4DSSB 4LA1A 2WS2A 2VL2C 3FKFA 4HI7A 1PX6A 2YANA 4HJMA 1GTAA 2F9SA 2GQLA 2K6VA 3EMXA 5D9XA 3D6IA 1ERTA 4MCUA 3EU3A 3LSZA 3G7JA 2LKUA 3H93A 4GSNA 1XOBA 2LV3A 2VLUA 3LYKA 1WIKA 3S9FA 2I81A 2MMOA 1HNAA 1M0UA 1XFLA 3RDWA 4RI6A 5ECSA 1E2YA 2GT5A 3D5JA 3KMOA 1T4YA 4ECIA 1MD4A 3L78A 3KEBA 3IAS2 4HOJA 3TOUA 1LU4A 2VL2A 2R37A 1V98A 4ML1A 3PGTA 1AC1A 2C0FA 3ZVJA 3ZYWA 4YQUA 4TN8A 1TW9A 1XWAA 1TK5B 1ERWA 4WEYA 1A2LA 3LGCA 4HUAA 2OA7A 4AF2A 3GX8A 2MZCA 1F3AA 5J41A 1SL0B 3CMIA 1KEBA 5ECIB 5CP1A 4MMMA 2VM2A 4ECJA 5ECNB 3KZQA 1NM3A 1Z6NA 5A4VA 3CSJA 1DE1A 3ISOA 3IA1A 4BA7A 1V2AA 3K8NA 3M8NA 3TGZA 3M0FA 2OJLA 2HRNA 5GSTA 6GSVA 2CVDA 1EGRA 2NVLA 3P7XA 1FOVA 4ISDA 1C72A 2EIQA 1MDIA 1OKDA 2FWGA 2LRNA 2EIRA 1ZYEA 3HVXA 3M1GA 4IELA 4J57E 1PKZA 5JCWA 3Q74A 2YZUA 2JACA 1JFUA 2R6KA 3DGQA 3UEMA 3QCPA 2H75A 5HFKA 4FIWA 3DMLA 5IMFA 5DBQA 3DKSA 1TJDA 3UARA 5ECQB 1ZGNA 1N2AA 2G0FA 3RHCA 5IMZA 3AY8A 2PU9C 3CXGA 4MJAA 2C1YA 2H6XA 2CX3A 4V1Ap 4JU5A 2CA8A 2FA8A 1X9MB 4AJ6A 1Z9HA 4IQ1A 4YQMA 4PQ1A 1A2JA 2V1MA 5DJMA 4ECCA 5C04A 1PRXA 3FY7A 1PL1A 3O3TA 4DEJA 2WDUA 1ERUA 1R4WA 1TRWA 1O8WA 3LXTA 1EOGA 3IC4A 4MABA 3BBYA 1JZDA 1SKRB 11GSA 1GUKA 4MH3A 4DVCA 3BCIA 5ELAA 2LUSA 3KJYA 2O89A 3W6GA 4TXOB 3WD6A 1BJXA 1NHYA 2LJRA 1SYXA 2AB6A 1SK1A 1PN9A 1T4ZA 2C0GA 2NTOA 22GSA 3QFBC 2ZNMA 3V1WA 1EV4A 5HFIA 1SK2A 3G7YA 6GSWA 1AW9A 4X0XA 2B7KA 1PQNA 1PSQA 5AIXA 1K0NA 1K0DA 3A5WA 5IQYA 3HJMA 1YF0A 3FR9A 1HNBA 5DALB 1GWCA 5IPGA 2O7KA 1M2BA 1V57A 3GKXA 2FA4A 2A4VA 3SWLA 5F06A 3ZFBA 1EP7A 1DBYA 2H70A 2IN3A 5G2ZA 1GTUA 4ZBBA 2H72A 4ILFA 2IMKA 1CQGA 3F3RA 3EURA 2H19A 3Q19A 4MPFA 4EDYA 2R5GA 3QAWA 3ZIVA 3PH9A 1PMTA 3H1NA 2EIOA 4XHMA 3KXOA 4NAXA 3UJ1A 1YY7A 5F8BA 5CAXA 3CSHA 1SJZA 3LFLA 3ZL5A 2FUG2 5KEJA 3A2WA 4MA9A 1M9BA 2F8AA 4FO5A 1G6WA 2VCVA 5E59A 4PXOA 2CAIA 1VRSD 3L4NA 3ERGA 2LS5A 1RQMA 2CT6A 4MJEA 2I3YA 1GULA 1YJ6A 4F82A 2JADA 3IV4A 3IDVA 1EEJA 3UVTA 2MBTA 1XCCA 4F0BA 2GQKA 3QMXA 3HJPA 1ZZYA 1Z7RA 4RQXA 3TJGA 1J0FA 1N8JA 4NV5A 2JU5A 4AJ7A 2CZ3A 2WULA 4GQCA 1XBSA 3W8JA 7GSSA 1FG4A 4TOPA 2I4AA 1TXXA 1X5DA 5A4WA 3I43A 4PX1A 5B8AA 1GSEA 2RUFA 3PINA 4IVFA 4G2EA 2G2QA 1GUMA 2DJ0A 3FZ5A 3OR5A 5IMVA 2VIMA 4WBJA 3NOFA 1TI1A 1GSQA 3A2XA 4MJBA 1EEMA 1YZXA 2DIZA 4L0WA 2IMIA 4I5QA 4TR4A 1E6BA 2IWTA 4N11A 3HVSA 2GQMA 2E2GA 2N5FA 1JLWA 4TR3A 5IOWA 1BX9A 1OE7A 2LQOA 3TJBA 2J9HA 4ZB6A 3H4KA 2FGXA 5KN2A 2VD1A 3FYGA 2NDOA 1K0BA 1O85A 3C7MA 14GSA 1BQ7A 2R4VA 3EWLA 4L0UA 2P5QA 3F63A 1ILOA 3HVVA 4G10A 4HU9A 2PPTA 3TKRA 2DJ2A 3KH9A 3GV1A 3LJRA 2HZEA 4V2NA 1S3DA 3TRQA 3ZMKA 4I2TA 2HZEB 3N5OA 1F9MA 5DAKA 5G5FA 2E2MA 1VF4A 2C80A 5G1LA 1SD8A 5FHIA 4EL1A 1TOFA 3GRXA 2V32A 4MH2A 5COHA 2VLVA 5HFGA 4L5OA 1OE8A 3UAPA 2OE0A 1AQVA 1XWCA 1F37A 4K2DA 5ID2A 3L9SA 3ZREA 2X8GA 2OKAA 4F03A 4PQIA 1MDKA 2LJKA 3ERWA 4IKHA 1V9WA 1PL2A 3GA4A 4KDXA 4ZILA 4WR4A 4GTUA 3RPPA 4Q5NA 3FZAA 4KUNA 4LMWA 1T1VA 4O32A 5IIZA 4J56E 1TDIA 5H5RA 4OO4A 1SL2B 3VURA 1OVNA 2DJ1A 1MD3A 2XPDA 3D4TA 2P31A 1K3OA 1ZMAA 2O85A 4IGJA 2VCTA 2VM1A 6GSTA 1U87A 4ACSA 1M2DA 4KB3A 1XZOA 3TJJA 19GSA 4MK3A 3BOAA 1TK8B 1O6JA 1QUWA 1OYJA 4G19A 4HEA2 2GZZA 4K7NA 3G7IA 4CW9A 2DBCA 2OACA 4BVYA 2EC4A 1GNEA 2N5AA 2PWJA 2RM5A 3ZFLA 1AIUA 1RW1A 4JE1A 4WETA 1S3AA 12GSA 4I8BA 3F4TA 1ABAA 2M46A 1HNCA 1NHOA 3GFKA 2IMEA 3WT1A 4KCEA 3SBCA 1W89A 4HDEA 2H74A 4QQ7A 5ENUA 2B7JA 4PUFC 3APSA 1FB0A 4PQHA 1EOHA 1M99A 1DSBA 2FWHA 2PGTA 4ZL8A 3F3QA 1YDKA 2YWOA 2CAQA 3GN3A 3GUSA 4PUAA 3FR3A 4OFNA 4GSTA 2VOCA 3KH7A 1T00A 5ABRA 1XWKA 1BG5A 5ECPB 5CYYA 4BVXA 4FYUA 2C3QA 1FB6A 1USBA 2H76A 3EYTA 5DQSA 2MMNA 3E9JB 4BL7A 2KUCA 1K0OA 2YJ7A 1PX7A 3HZ8A 3VWUA 1TU8A 1EV9A 1XW9A 4JEDA 3QPMA 1FVKA 1SK0A 3DWVA 5CRWA 3N9JA 1M7TA 2OBKA 5HR2A 1B8XA 4V2MA 3CTGA 3TRXA 2LQQA 2AUVA 2K8SA 2GVPA 2CZ2A 2GSQA 3D21A 3M9JA 4WF5A 1B4PA 2VO4A 5B6MA 1O73A 2C0EA 3H79A 3TJKA 3QD9A 2I9HA 1A23A 4TRXA 1TI3A 5G30A 1LJRA 4POLA 1WP0A 5J9BA 3EU4A 2IMFA 1VF3A 4ZXGA 3KTLA 4WR5A 3F0IA 2HZFA 1K0AA 2D2ZA 1YEXA 1MEKA 3QDNA 2MMAA 2H1GA 3MWHA 1F3BA 4F9ZA 1TRSA 4HZ4A 1ML6A 2PVOC 2REMA 3F6DA 4XRDA 3J7Yk 1GSUA 4K7OA 1VGLA 3VLNA 2JZRA 4PNGA 5D93A 4J2FA 3VFIA 3LORA 1UN2A 2V2GA 3Q6OA 1WRYA 4KX4A 3TJFA 2CVKA 3HKRA 2FWEA 2HRFA 4L5LA 2IIYA 4K7IA 4Q5QA 3KGKA 1JZWA 2C0DA 1GTBA 1A0RP 2E0QA 4MLYA 5HR0A 3FZ4A 3GL3A 3VPTA 1FAAA 1KTEA 2HE3A 2DJKA 3CTFA 3ERFA 3HXSA 4QL7A 4YAVA 2H66A 3DRNA 3IRAA 1XW6A 3GSTA 3HA9A 3DD3A 5IMAA 2YWMA 3IAM2 2R3XA 4NHWA 2H6YA 17GSA 4TR0A 1QFNA 2P5RA 4YQVA 4XS4A 2GS3A 1SKWB 4OCFA 2FWFA 4PURA 2O8VB 5ECMB 3QAGA 5KN3A 4IW9A 4XRAA 5LD0A 2LEGA 2L6DA 5CRDA 1GL8A 3TCOA 5HR1A 1B9YC 3LG6A 2F3MA 2FLSA 1QK8A 2NBSA 1URMA 3Q18A 3ZITA 2LJAA 2OBIA 3DVWA 4EKZA 1NW2A 2AAWA 3IE3A 2XC2A 5IM9A 5ELGA 2LTKA 2TIRA 4JBBA 2YV7A 2L5OA 2VCWA 2YV9A 1SL1B 5H5QA 4DSQA 1WPIA 2B1LA 2LNSA 2WB9A 2GSTA 3TKSC 4EXJA 5JCGA 4HU7A 4MF6A 1SKSB 4AGSA 5HR3A 2WJUA 4XTSA 2IFQA 5JWQB 4EDZA 2IFQB 4RI7A 3CYNA 3ZVJD 5D8IA 1Y25A 2YPMA 3KCMA 3J7Yb 3HD5A 4JR6A 5AIVA 4WBRD 5DCHA 1XW5A 5FWGA 2OADA 3A3TA 3APOA 4HS1A 2B3SA 3BD2A 2FCHA 2PUKC 4EUYA 1GSYA 3ZZXA 3TKSA 1X5CA 1KBNA 2L5LA 4JR4A 4HJ2A 4O92A 1ERVA 4PGTA 1Z5YE 1R26A 3EVIA 3BCKA 1TP9A 3UOMA 3GL5A 1M9AA 1T8EB 2YNXA 1X9WB 2XBQA 2GGTA 2TRCP 2HNLA 2PERA 3GH6A 4XIHA 4XS6A 5GAND 4OFMA 3VK9A 4NHZA 3ZIJA 5B8BA 3RAZA 4H86A 4TR1A 2L59A 5FT3A 2F8FA 5J4UA 4EO3A 4KSMA 4AJ8A 5ECOB 4MJCA 4NPBA 4KDYA 3D22A 4POMA 2QKEA 1XXUA 2LSTA 1Q98A 4GF0A 5CNWA 5AGYA 4K0NA 5F07A 2H0IA 4OD7A 4TVEA 3QFAC 1AXDA 4KW6A 3GKMA 3KM6A 2MYGA 5IMCA 5IO2A 5B6NA 2HT9A 4F2IA 3GH9A 1MDJA 2ZCTA 1Q4JA 2HXKA 3FR6A 3RHBA 2GSRA 4BWQA 3CRUA 3L9UA 4ECBA 2DMLA 2AV4A 5F05A 1IYHA 2LRCA 3GMFA 2WGRA 1OAZA 2VUPA 4KGIA 2FHEA 4MF5A 2ON7A 2WCIA 4ZB8A 4GXZA 2Z9SA 1TRUA 18GSA 3KP9A 5DQYA 1EZKA 2QGVA 3ZMLA 2MBSA 4N30A 5HQPA 1YF1A 5F0GA 1WMJA 2L4CA 2M80A 1SENA 4LLRA 2C3TA 5DAKB 3UVHA 4FYBA 3DEXA 2DJJA 2RLIA 4E8HA 4EC0A 3P90A 3TB2A 3DVXA 3GHAA 4L8EA 2CVBA 1QQ2A 4LL1B 5EPFA 2IPAA 1LBKA 3FHKA 4HQSA 3EMPA 2YCDA 5CO3A 1XVWA 3MSZA 13GSA 3DIEA 1SYRA 2B5YA 5D9TA 2A2SA 5ID2B 1T7PB 1VF2A 3E3EA 3GSSA 1OKTA 3CRTA 3L9VA 2KOKA 2WRTA 1T3BA 2X99A 2X8CA 16GSA 5EY6A 4V2LA 2YWIA 1J08A 4KE3A 1WJKA 3D4MA 1UC7A 2XBIA 1K3YA 3IHQA 1FO5A 2XHFA 5G31A 3WGXA 2K9FA 1SU9A 1Z3EA 3FRCA 3UIWA 4K1FA 4DSSA 4TKYA 4CHSA 1G6YA 2HLSA 3C8EA 4OMVA 2YJHA 2R2JA 5D9WA 1A0FA 1GH2A 3IR4A 4QL9A 4IN0A 4KDUA 3CBUA 4BPYA 1BEDA 2FY6A 5DCGA 1G0TA 1RK4A 1U3IA 3G9BA 3TOTA 2H6ZA 1ZL9A 2KP2A 2ALBA 5A4UA 2H8LA 3C1SA 4XS1A 2GLRA 2B6MA 2CX4A 1SJIA 5J3RA 1GLQA 3GURA 1AAZA 4IJ3A 2PBJA 2TRXA 2GZPA 1YKCA 3HZ4A 4Q5RA 3FZ9A 4D73A 5AISA 4D73B 3M3MA 5ECLB 2VL3A 3VI7A 2K8VA 2H0HA 1K0MA 1EWXA 10GSA 4MZCA 3TUEA 3EINA 2DIYA 1GSDA 4ZB9A 1ST9A 3GTUA 2H30A 4NV2A 1YKAA 2HSYA 1JLVA 3GTUB 2H1DA 4YAPA 3P2AA 3UL3A 3F6FA 4TXVA 3KTBA 1V58A 4I2UA 1IYIA 3NZNA 1A8YA 2IJYA 4MP4A 5H5SA 2C8UA 4MZBA 4LL4B 2A2RA 2NPBA 4KCAA 2X8HA 4LMVA 2BJXA 2B5XA 1ZYQB 1PD21 3D0ZA 1O8XA 3I9V2 2C3NA 4IS0A 3UMAA 4RQRA 3C71A 1OC3A 3UBKA 4I97A 6GSSA 1AQXA 2X64A 3H8QA 5DVBA 4YH2A 1U88A 1R5PA 6GSUA 1GTIA 2L4QA 3GNJA 3WGEA 1SD9A 3C73A 1THOA 3JCML 3KP8A 4POBA 2VL9A 1R5AA 4JRRA 3VPQA 5D96A 4OO5A 3F4RA 5G5EA 1I9DA 3I69A 1THXA 3MAKA 2P0GA 2V6OA 2M72A 2LRTA 4GWRA 3HCZA 2WFCA 20GSA 4ID0A 1GP1A 1XIYA 2JL4A 4IJIA 2DLXA 1PGTA 3O6TA 2ON5A 5ECRB 2JSZA 2F51A 3GYKA 4KSOA 1I5GA 4KAEA 4IHUA 2CQ9A 4N0ZA 3ME8A 5IOXA 2XPEA 2H1BA 3DXBA 2OE1A 4GLTA 4HZ2A 2GDRA 4O7HA 5G1KA 3F8UA 1F2EA 3QOUA 2GTUA 2H73A 2ZUPA 2FNOA 2B1KA 5GZZB 1XWBA 2HFDA 2N5BA 2HSHA 3IOSA 4PNFA 1NSWA 3ZTLA 3GX0A 1HQOA 4IP6A 1QXHA 5AN1A 5IMDA 4TXOA 4JZQA 3O76A 6GSXA 1GUHA 4MPGA 2GT6A 4XS4B 9GSSA 1XWGA 1XOAA 1FHEA 1ZCPA 1GNWA 4NMUA 1BYEA 1FVJA 1MTCA 2JSYA 4EE0A 2AHEA 1OC8A 2VCQA 3US3A 1QMVA 2C4JA 5DJLA 5CRHA 1J9BA 5DDLA 5GSSA 3W8SA 5DALA 1QGVA 1ZOFA 2DMMA 5LNKe 2YN1A 3MDKA 2DC5A 2GZYA 4IBPA 3WYWA 5J5NA 3F9UA 2RIIA 2HYXA 2PVQA 1EGOA 1SJ6A 3FK8A 5EL8A 5L71A 2KHPA 1TK0B 5B7CA 4XCSA 1YQ1A 1O7UA 4N10A 2BMXA 4KA0A 4IQAA 3I6AA 2VAFA 1EP8A 5KN1A 2E7PA 2MMZA 2LNTA 2V6KA 3R2QA 4K0GA 2VCZA 4I6XA 4ZBAA 1X5EA 1Y6EA 2O87A 3KD0A 1BAYA 8GSSA 3IK9A 5GAPD 1HYUA 3EE2A 4WKWA 3UBLA 4NWYA 3TKSE 1PA3A 1UVZA 1M2AA 3NIVA 1V40A 2B5EA 4K9ZA 1K0CA 2L6CA 1CQHA 4FYCA 3GIXA 1A8LA 2V41A 3APQA 3HYPA 5A5KA 1B48A 2PN8A 3U5RE 1X0RA 1GRXA 1JZOA
chains in the Genus database with same CATH superfamily
1DUGA 1HD2A 2H71A 5E4WA 4CY6A 4BWSA 3LQ7A 4O5QA 3PR8A 3QAVA 4TW5A 3P8WA 1GSFA 1WE0A 4WF4A 3C1RA 4X1UA 3ED3A 1A2MA 1R7HA 3LEFA 2AJQB 3RBTA 5ECKB 5IO0A 3EC3A 1W4VA 2YWNA 5EVOA 3VWWA 1OC9A 4P3YB 1ACVA 5JWRB 1OC9B 4TR1B 1XG8A 3F4SA 4ZL9A 1XVQA 3GKNA 2AYTA 2JZSA 4DSRA 5ECHB 4GSSA 4KNDA 4POKA 1ON4A 2KP1A 2K18A 3ME7A 1X9SB 1O81A 4O5RA 4GRFA 4N0VA 1WOUA 3GKKA 2BTOT 4IP1A 4GCIA 3HJOA 4OWYA 4ZIJA 1B9XC 5D73A 2DJ3A 5KN0A 3CSIA 2IMDA 3CQFA 4MF7A 2DSAA 3MNGA 3VWXA 1Z6MA 1KNGA 4K6XA 4MDCA 2QA2A 2RUEA 1G7OA 3VWVA 4Q5FA 5D9VA 1Z7PA 1H75A 2OE3A 4OFTA 1A24A 1AUCA 1VF1A 3QR6A 2H1AA 1UA5A 2VCXA 3IBHA 3U6VA 3IPZA 4ZL7A 4EVMA 1GSSA 4ZBDA 3FEUA 3ZRDA 3A2VA 3HY2A 5KOWA 4KF9A 1TTZA 3ZLPA 3WGDA 3E0UA 1G7EA 2CV4A 5LCZA 1GLPA 4G9HA 2PMTA 2QC7A 3HDCA 5JCUA 2H0GA 1PKWA 4E8EA 2R0CA 4Z7XA 4WXTA 3LXZA 5CREA 2YP6A 1XPVA 3DYRA 2H01A 1K3LA 2L57A 1TKDB 2YZHA 2YOIA 5IPHA 3IHGA 3M9KA 1TU7A 1DE2A 3VI5A 1JZRA 3HHVA 1U6TA 2FD3A 4K5SA 3WT2A 2JZTA 5C00A 4GQFA 1JHBA 5JWOB 4ULXA 3TKPA 1H4OA 3L0HA 4NXIA 4EF0A 3RPNA 4RUVA 5BMUA 1B4QA 3FW2A 2IL3A 1TRVA 4CDOA 4F0CA 4K8MA 4OCEA 3KIJA 2KLXA 1YEPA 3LWAA 3LYPA 2VLTA 2GSSA 2I1UA 4X43A 4MZWA 2VD0A 2QSIA 3KMNA 2WZ9A 4ML6A 3TKQA 3TDGA 1PFOA 5INYA 2RM6A 5J9CA 1WWJA 4FH8A 2HI7A 2J23A 3IK7A 4HQZA 5CRGA 3TRPA 4V1Ag 3BJ5A 6GSYA 1F6MC 1U3AA 4KH7A 2ES7A 1S3CA 1FW1A 1AQWA 4G0IA 3IXRA 4DSSB 4LA1A 2WS2A 2VL2C 3FKFA 4HI7A 1PX6A 2YANA 4HJMA 1GTAA 2F9SA 4YKFA 2GQLA 2K6VA 3EMXA 5D9XA 3D6IA 1ERTA 4MCUA 4Z2TA 3EU3A 3LSZA 3G7JA 2LKUA 3H93A 4GSNA 1XOBA 2LV3A 2VLUA 3LYKA 1WIKA 3S9FA 2I81A 2MMOA 1HNAA 1M0UA 1XFLA 3RDWA 4RI6A 5ECSA 1E2YA 2GT5A 3D5JA 3KMOA 1T4YA 4ECIA 4CY8A 1MD4A 3L78A 3KEBA 3IAS2 4HOJA 3TOUA 1LU4A 2VL2A 2R37A 1V98A 4ML1A 3PGTA 1AC1A 2C0FA 3ZVJA 3ZYWA 4YQUA 4TN8A 1TW9A 1XWAA 1TK5B 1ERWA 4WEYA 1A2LA 3LGCA 4HUAA 2OA7A 4AF2A 3GX8A 2MZCA 1F3AA 5J41A 1SL0B 3CMIA 1KEBA 5ECIB 5CP1A 4MMMA 2VM2A 4ECJA 5ECNB 3KZQA 1NM3A 1Z6NA 5A4VA 3CSJA 3EPTA 1DE1A 3ISOA 3IA1A 4BA7A 1V2AA 3K8NA 3M8NA 3TGZA 3M0FA 2OJLA 2HRNA 5GSTA 6GSVA 2CVDA 1EGRA 2NVLA 4EIPA 3P7XA 1FOVA 4ISDA 1C72A 2EIQA 1MDIA 1OKDA 2FWGA 2LRNA 2EIRA 1ZYEA 3HVXA 3M1GA 4IELA 4J57E 1PKZA 5JCWA 3Q74A 2YZUA 2JACA 1JFUA 2R6KA 3DGQA 3UEMA 3QCPA 2H75A 4BIKA 5HFKA 4FIWA 3DMLA 5IMFA 5DBQA 3DKSA 1TJDA 3UARA 5ECQB 1ZGNA 1N2AA 2G0FA 3RHCA 5IMZA 3AY8A 2PU9C 3CXGA 4MJAA 2C1YA 2H6XA 2CX3A 4V1Ap 4JU5A 2CA8A 2FA8A 1X9MB 4AJ6A 1Z9HA 4IQ1A 4YQMA 4PQ1A 1A2JA 2V1MA 5DJMA 4ECCA 5C04A 1PRXA 3FY7A 1PL1A 3O3TA 4DEJA 2WDUA 1ERUA 1R4WA 1TRWA 1O8WA 3LXTA 1EOGA 3IC4A 4MABA 3BBYA 1JZDA 1SKRB 11GSA 1GUKA 4MH3A 4DVCA 3BCIA 5ELAA 2LUSA 3KJYA 2O89A 3W6GA 4TXOB 3WD6A 1BJXA 1NHYA 2LJRA 1SYXA 2AB6A 1SK1A 1PN9A 3A5IA 1T4ZA 2C0GA 2NTOA 22GSA 3QFBC 2ZNMA 3V1WA 1EV4A 5HFIA 1SK2A 3G7YA 6GSWA 1AW9A 4X0XA 2B7KA 1PQNA 1PSQA 5AIXA 1K0NA 1K0DA 3A5WA 5IQYA 3HJMA 1YF0A 3FR9A 1HNBA 5DALB 1GWCA 5IPGA 2O7KA 1M2BA 4X4JA 1V57A 3GKXA 2FA4A 2A4VA 3FMWA 3SWLA 5F06A 3ZFBA 1EP7A 1DBYA 2H70A 4Z2RA 2UZ8A 2IN3A 5G2ZA 1GTUA 4ZBBA 2H72A 4ILFA 2IMKA 1CQGA 4G0LA 3F3RA 3EURA 2H19A 3Q19A 4MPFA 4EDYA 2R5GA 3QAWA 3ZIVA 3PH9A 1PMTA 3H1NA 2EIOA 4XHMA 1FOHA 3KXOA 4NAXA 3UJ1A 1YY7A 5F8BA 5CAXA 3CSHA 1SJZA 3LFLA 4YKGA 3ZL5A 2FUG2 5KEJA 3A2WA 4MA9A 1M9BA 2F8AA 4FO5A 1G6WA 2VCVA 5E59A 4PXOA 2CAIA 1VRSD 3L4NA 3ERGA 2LS5A 1M3JA 1RQMA 2CT6A 4MJEA 2I3YA 1GULA 1YJ6A 4F82A 2JADA 3IV4A 4G0KA 3IDVA 1EEJA 3UVTA 2MBTA 1XCCA 4F0BA 2GQKA 3QMXA 3HJPA 1ZZYA 1Z7RA 4RQXA 3TJGA 1J0FA 1N8JA 4NV5A 2JU5A 4AJ7A 2CZ3A 2WULA 4GQCA 1XBSA 3W8JA 7GSSA 1FG4A 4TOPA 2I4AA 1TXXA 1X5DA 5A4WA 3I43A 4PX1A 5B8AA 1GSEA 2RUFA 3PPUA 3PINA 4IVFA 4G2EA 2G2QA 1GUMA 2DJ0A 3FZ5A 3OR5A 5IMVA 4WBJA 2VIMA 3NOFA 1TI1A 1GSQA 3A2XA 4MJBA 1EEMA 2R0PA 1YZXA 2DIZA 4L0WA 2IMIA 4I5QA 4TR4A 1E6BA 2IWTA 4N11A 3HVSA 2GQMA 2E2GA 2N5FA 1JLWA 4TR3A 5IOWA 4FQUA 1BX9A 1OE7A 2LQOA 3TJBA 2J9HA 4ZB6A 3H4KA 2FGXA 5KN2A 2VD1A 3FYGA 2NDOA 1K0BA 1O85A 3C7MA 14GSA 1BQ7A 2R4VA 3EWLA 4L0UA 2P5QA 4MNNA 3F63A 1ILOA 3HVVA 4G10A 1ZYNA 4HU9A 2PPTA 3TKRA 2DJ2A 3KH9A 3GV1A 2HRAA 3LJRA 2HZEA 4V2NA 1S3DA 3TRQA 3ZMKA 4I2TA 2HZEB 3N5OA 1F9MA 5DAKA 5G5FA 3MIXA 2E2MA 1VF4A 2C80A 5G1LA 1SD8A 5FHIA 4EL1A 1TOFA 3GRXA 2V32A 4MH2A 5COHA 2VLVA 5HFGA 4L5OA 1OE8A 3UAPA 2OE0A 4K2XA 1AQVA 1XWCA 1F37A 4K2DA 5ID2A 3L9SA 3ZREA 2X8GA 2OKAA 4F03A 4PQIA 1MDKA 2LJKA 3ERWA 4IKHA 1V9WA 1PL2A 3GA4A 4KDXA 4ZILA 4WR4A 4GTUA 3RPPA 4Q5NA 3FZAA 4KUNA 4LMWA 1T1VA 4O32A 5IIZA 4J56E 2X49A 1TDIA 5H5RA 4OO4A 1SL2B 3VURA 1OVNA 2DJ1A 1MD3A 2XPDA 3D4TA 2P31A 1K3OA 1ZMAA 2O85A 4IGJA 2VCTA 2VM1A 6GSTA 1U87A 4ACSA 1M2DA 4KB3A 1XZOA 3TJJA 19GSA 4MK3A 3BOAA 1TK8B 1O6JA 1QUWA 1OYJA 4G19A 4HEA2 2GZZA 4K7NA 3G7IA 4CW9A 2DBCA 2OACA 4BVYA 2EC4A 4BVYB 1GNEA 2N5AA 2PWJA 2RM5A 3ZFLA 1AIUA 1RW1A 4JE1A 4WETA 1S3AA 12GSA 4I8BA 3F4TA 1ABAA 2M46A 1HNCA 1NHOA 3GFKA 2IMEA 3WT1A 4KCEA 3SBCA 1W89A 4HDEA 2H74A 4QQ7A 5ENUA 2B7JA 4PUFC 3APSA 1FB0A 4PQHA 1EOHA 1M99A 1DSBA 2FWHA 2PGTA 4ZL8A 3F3QA 1YDKA 2YWOA 2CAQA 3GN3A 3GUSA 4PUAA 3FR3A 4OFNA 4GSTA 2VOCA 3KH7A 1T00A 5ABRA 1XWKA 1BG5A 5ECPB 2QA1A 5CYYA 4BVXA 4FYUA 2C3QA 1FB6A 1USBA 4BVXB 2H76A 3EYTA 5DQSA 2MMNA 3E9JB 4BL7A 2KUCA 4BL7B 1K0OA 2YJ7A 1PX7A 3HZ8A 3VWUA 1TU8A 2A2PA 1EV9A 1XW9A 4JEDA 3QPMA 1FVKA 1SK0A 3DWVA 5CRWA 3N9JA 1M7TA 2OBKA 5HR2A 1B8XA 4V2MA 3CTGA 3TRXA 2LQQA 2AUVA 2K8SA 2GVPA 2CZ2A 2GSQA 3D21A 3M9JA 4WF5A 1B4PA 2VO4A 5B6MA 1O73A 2C0EA 3H79A 3TJKA 3QD9A 2I9HA 1A23A 4TRXA 1TI3A 5G30A 1LJRA 4POLA 2DKHA 1WP0A 5J9BA 3EU4A 2IMFA 1VF3A 4ZXGA 3KTLA 4WR5A 3F0IA 2HZFA 1K0AA 2D2ZA 1YEXA 1MEKA 3QDNA 2MMAA 2H1GA 3MWHA 1F3BA 4F9ZA 1TRSA 4HZ4A 1ML6A 2PVOC 2REMA 3F6DA 4XRDA 3J7Yk 1GSUA 4K7OA 1VGLA 3VLNA 2JZRA 4PNGA 5D93A 4J2FA 3VFIA 3LORA 1UN2A 2V2GA 3Q6OA 1WRYA 4KX4A 3TJFA 2CVKA 3HKRA 2FWEA 2HRFA 4L5LA 2IIYA 4K7IA 4Q5QA 3KGKA 1JZWA 2C0DA 1GTBA 1A0RP 2E0QA 4MLYA 5HR0A 3FZ4A 3GL3A 3VPTA 1FAAA 1KTEA 2HE3A 2DJKA 3CTFA 3ERFA 3HXSA 4QL7A 4YAVA 2H66A 3DRNA 3IRAA 1XW6A 3GSTA 3HA9A 3DD3A 5IMAA 2YWMA 3IAM2 2R3XA 4NHWA 2H6YA 17GSA 4TR0A 1QFNA 2P5RA 3MYDA 4YQVA 4XS4A 2GS3A 1SKWB 4OCFA 2FWFA 4PURA 2O8VB 5ECMB 3QAGA 5KN3A 4IW9A 4XRAA 5LD0A 2LEGA 2L6DA 5CRDA 1GL8A 3TCOA 5HR1A 1B9YC 3LG6A 2F3MA 2FLSA 1QK8A 2NBSA 1URMA 3Q18A 3ZITA 2LJAA 2OBIA 3DVWA 4EKZA 1NW2A 2AAWA 3IE3A 2XC2A 5IM9A 5ELGA 2LTKA 5KOXA 2TIRA 4O5UA 4JBBA 2YV7A 2L5OA 2VCWA 2YV9A 1SL1B 5H5QA 4DSQA 4Z2UA 1WPIA 2B1LA 2LNSA 2WB9A 2GSTA 3TKSC 4EXJA 5JCGA 4HU7A 4MF6A 1SKSB 4AGSA 5HR3A 2WJUA 4XTSA 2IFQA 5JWQB 4EDZA 2IFQB 4RI7A 3CYNA 3ZVJD 5D8IA 1Y25A 2YPMA 3KCMA 3J7Yb 3HD5A 4JR6A 5AIVA 4WBRD 5DCHA 1XW5A 5FWGA 2OADA 3A3TA 3APOA 4HS1A 2B3SA 3BD2A 2FCHA 2PUKC 4EUYA 1GSYA 3ZZXA 3TKSA 1X5CA 3R3EA 1KBNA 2L5LA 4JR4A 4HJ2A 2HSMA 4O92A 1ERVA 4PGTA 1Z5YE 1R26A 3EVIA 3BCKA 1TP9A 3UOMA 3GL5A 1M9AA 1T8EB 2YNXA 1X9WB 2XBQA 2GGTA 2TRCP 2HNLA 2PERA 3GH6A 4XIHA 4XS6A 5GAND 4OFMA 3VK9A 4NHZA 3ZIJA 5B8BA 3RAZA 4H86A 4TR1A 2L59A 5FT3A 2F8FA 5J4UA 4EO3A 4KSMA 4AJ8A 5ECOB 4MJCA 4NPBA 4EIQA 4KDYA 3D22A 4POMA 1ZYPA 2QKEA 1XXUA 2LSTA 1Q98A 1M3IA 4GF0A 5CNWA 5AGYA 4K0NA 5F07A 2H0IA 4OD7A 4TVEA 3QFAC 1AXDA 4KW6A 3GKMA 3KM6A 2MYGA 5IMCA 5IO2A 5B6NA 2HT9A 4F2IA 3GH9A 1MDJA 2ZCTA 1Q4JA 2HXKA 3FR6A 3HVNA 3RHBA 2GSRA 4BWQA 3CRUA 3L9UA 4ECBA 2DMLA 2AV4A 5F05A 1IYHA 2LRCA 4PTSA 3GMFA 2WGRA 1OAZA 2VUPA 4KGIA 2FHEA 4MF5A 2ON7A 2WCIA 4ZB8A 4GXZA 2Z9SA 1TRUA 18GSA 3KP9A 5DQYA 4USSA 1EZKA 2HRKA 2QGVA 3ZMLA 2MBSA 4N30A 5HQPA 1YF1A 5F0GA 1WMJA 2L4CA 3IC8A 2M80A 1SENA 4LLRA 2C3TA 5DAKB 3UVHA 4FYBA 3DEXA 2DJJA 2RLIA 4E8HA 4EC0A 3P90A 3TB2A 3DVXA 3GHAA 4L8EA 2CVBA 1QQ2A 4LL1B 5EPFA 2IPAA 1LBKA 3FHKA 4HQSA 3EMPA 2YCDA 5CO3A 1XVWA 3MSZA 13GSA 3DIEA 1SYRA 2B5YA 5D9TA 2A2SA 5ID2B 1T7PB 1VF2A 3E3EA 3GSSA 1OKTA 3CRTA 3L9VA 2KOKA 2WRTA 1T3BA 2X99A 2X8CA 16GSA 5EY6A 4V2LA 2YWIA 1J08A 4KE3A 1WJKA 3D4MA 1UC7A 2XBIA 1K3YA 3IHQA 4A5PA 1FO5A 2XHFA 5G31A 3WGXA 2K9FA 1SU9A 1Z3EA 3FRCA 3UIWA 4K1FA 1PN0A 4DSSA 1S3RA 4TKYA 4CHSA 1G6YA 2HLSA 3C8EA 4OMVA 2YJHA 2R2JA 5D9WA 1A0FA 1GH2A 3IR4A 4QL9A 4IN0A 4KDUA 3CBUA 4BPYA 1BEDA 4HSCX 2FY6A 5DCGA 1G0TA 1RK4A 2DKIA 1U3IA 3G9BA 3TOTA 2H6ZA 1ZL9A 2KP2A 2ALBA 5A4UA 2H8LA 3C1SA 4XS1A 2GLRA 2B6MA 2CX4A 1SJIA 5J3RA 1GLQA 3GURA 1AAZA 4IJ3A 2PBJA 2TRXA 2GZPA 1YKCA 3HZ4A 4Q5RA 3FZ9A 4D73A 5AISA 4D73B 3M3MA 5ECLB 2VL3A 3VI7A 2K8VA 2H0HA 1K0MA 1EWXA 10GSA 4MZCA 3TUEA 3EINA 2DIYA 1GSDA 4ZB9A 1ST9A 3GTUA 2H30A 4NV2A 1YKAA 2HSYA 1JLVA 3GTUB 2H1DA 4YAPA 3P2AA 3UL3A 3F6FA 4TXVA 3KTBA 1V58A 4I2UA 1IYIA 3NZNA 1A8YA 2IJYA 4MP4A 5H5SA 2C8UA 4MZBA 4LL4B 2A2RA 2NPBA 4KCAA 2X8HA 4LMVA 2BJXA 3LW9A 2B5XA 2R0GA 1ZYQB 1PD21 3D0ZA 1O8XA 3I9V2 2C3NA 4IS0A 3UMAA 4RQRA 3C71A 1OC3A 3UBKA 5BRTA 4I97A 6GSSA 1AQXA 2X64A 3H8QA 5DVBA 4YH2A 1U88A 1R5PA 6GSUA 1GTIA 2L4QA 3GNJA 3WGEA 1SD9A 3C73A 1THOA 3JCML 3KP8A 4POBA 2VL9A 1R5AA 4JRRA 3VPQA 5D96A 4OO5A 3F4RA 5G5EA 1I9DA 3I69A 1THXA 3MAKA 2P0GA 2X4AA 2V6OA 2M72A 2LRTA 4GWRA 3HCZA 2WFCA 20GSA 4ID0A 1GP1A 1XIYA 2JL4A 4IJIA 2DLXA 1PGTA 3O6TA 2ON5A 5ECRB 2JSZA 2F51A 3GYKA 4KSOA 1I5GA 4KAEA 4IHUA 2CQ9A 4N0ZA 3ME8A 5IOXA 2XPEA 2H1BA 3DXBA 2OE1A 4GLTA 4HZ2A 2GDRA 4O7HA 5G1KA 3F8UA 1F2EA 3QOUA 2GTUA 2H73A 2ZUPA 2FNOA 2B1KA 5GZZB 1XWBA 2HFDA 2N5BA 2HSHA 3IOSA 4PNFA 1NSWA 3ZTLA 3GX0A 4ICYA 1HQOA 4IP6A 1QXHA 5AN1A 5IMDA 4TXOA 4JZQA 3O76A 6GSXA 1GUHA 4MPGA 2GT6A 4XS4B 9GSSA 1XWGA 1XOAA 1FHEA 1ZCPA 1GNWA 4NMUA 1BYEA 1FVJA 1MTCA 2JSYA 4EE0A 2AHEA 1OC8A 2VCQA 3US3A 1QMVA 2C4JA 5DJLA 5CRHA 1J9BA 5DDLA 5GSSA 3W8SA 5DALA 1QGVA 1ZOFA 2DMMA 5LNKe 2YN1A 3MDKA 2DC5A 2GZYA 4IBPA 3WYWA 5J5NA 3F9UA 2RIIA 2HYXA 2PVQA 1EGOA 1SJ6A 3FK8A 5EL8A 5L71A 2KHPA 1TK0B 5B7CA 4XCSA 1YQ1A 1O7UA 4N10A 2BMXA 4KA0A 4IQAA 3I6AA 2VAFA 1EP8A 5KN1A 2E7PA 2MMZA 2A4HA 2LNTA 2V6KA 3R2QA 4K0GA 2VCZA 4I6XA 4ZBAA 1X5EA 1Y6EA 4K5RA 2O87A 3KD0A 1BAYA 8GSSA 3IK9A 5GAPD 1HYUA 3EE2A 4WKWA 3UBLA 4NWYA 3TKSE 1PA3A 1UVZA 1M2AA 3NIVA 1V40A 2B5EA 4K9ZA 1K0CA 2L6CA 1CQHA 4FYCA 3GIXA 1A8LA 2V41A 3APQA 3HYPA 5A5KA 1B48A 2PN8A 3U5RE 1X0RA 1GRXA 1JZOA
chains in the Genus database with same CATH topology
1DUGA 1HD2A 2H71A 5E4WA 4CY6A 4BWSA 3LQ7A 4O5QA 3PR8A 3QAVA 4TW5A 3P8WA 1GSFA 1WE0A 4WF4A 3C1RA 4X1UA 3ED3A 1A2MA 1R7HA 3LEFA 2AJQB 3RBTA 5ECKB 5IO0A 3EC3A 1W4VA 2YWNA 5EVOA 3VWWA 1OC9A 4P3YB 1ACVA 5JWRB 1OC9B 4TR1B 3F4SA 4ZL9A 1XVQA 3GKNA 2AYTA 2JZSA 4DSRA 5ECHB 4GSSA 4KNDA 4POKA 1ON4A 2KP1A 2K18A 3ME7A 1X9SB 1O81A 4O5RA 4GRFA 4N0VA 1WOUA 3GKKA 2BTOT 4IP1A 4GCIA 3HJOA 4OWYA 4ZIJA 1B9XC 5D73A 2DJ3A 5KN0A 3CSIA 2IMDA 4MF7A 2DSAA 3MNGA 3VWXA 1Z6MA 1KNGA 4K6XA 4MDCA 2QA2A 2RUEA 1G7OA 3VWVA 4Q5FA 5D9VA 1Z7PA 1H75A 2OE3A 4OFTA 1A24A 1AUCA 1VF1A 3QR6A 2H1AA 1UA5A 2VCXA 3IBHA 3U6VA 3IPZA 4ZL7A 4EVMA 1GSSA 4ZBDA 3FEUA 3ZRDA 3A2VA 3HY2A 5KOWA 4KF9A 1TTZA 3ZLPA 3WGDA 3E0UA 1G7EA 2CV4A 5LCZA 1GLPA 4G9HA 2PMTA 2QC7A 3HDCA 5JCUA 2H0GA 1PKWA 4E8EA 2R0CA 4Z7XA 4WXTA 3LXZA 5CREA 2YP6A 1XPVA 3DYRA 2H01A 1K3LA 2L57A 1TKDB 2YZHA 2YOIA 5IPHA 3IHGA 3M9KA 1TU7A 1DE2A 3VI5A 1JZRA 3HHVA 1U6TA 2FD3A 4K5SA 3WT2A 2JZTA 5C00A 4GQFA 1JHBA 5JWOB 4ULXA 3TKPA 1H4OA 3L0HA 4NXIA 4EF0A 3RPNA 4RUVA 5BMUA 1B4QA 3FW2A 2IL3A 1TRVA 4CDOA 4F0CA 4K8MA 4OCEA 3KIJA 2KLXA 1YEPA 3LWAA 3LYPA 2VLTA 2GSSA 2I1UA 4X43A 4MZWA 2VD0A 2QSIA 3KMNA 2WZ9A 4ML6A 3TKQA 3TDGA 5INYA 2RM6A 5J9CA 1WWJA 4FH8A 2HI7A 2J23A 3IK7A 4HQZA 5CRGA 3TRPA 4V1Ag 3BJ5A 6GSYA 1F6MC 1U3AA 4KH7A 2ES7A 1S3CA 1FW1A 1AQWA 4G0IA 3IXRA 4DSSB 4LA1A 2WS2A 2VL2C 3FKFA 4HI7A 1PX6A 2YANA 4HJMA 1GTAA 2F9SA 4YKFA 2GQLA 2K6VA 3EMXA 5D9XA 3D6IA 1ERTA 4MCUA 4Z2TA 3EU3A 3LSZA 3G7JA 2LKUA 3H93A 4GSNA 1XOBA 2LV3A 2VLUA 3LYKA 1WIKA 3S9FA 2I81A 2MMOA 1HNAA 1M0UA 1XFLA 3RDWA 4RI6A 5ECSA 1E2YA 2GT5A 3D5JA 3KMOA 1T4YA 4ECIA 4CY8A 1MD4A 3L78A 3KEBA 3IAS2 4HOJA 3TOUA 1LU4A 2VL2A 2R37A 1V98A 4ML1A 3PGTA 1AC1A 2C0FA 3ZVJA 3ZYWA 4YQUA 4TN8A 1TW9A 1XWAA 1TK5B 1ERWA 4WEYA 1A2LA 3LGCA 4HUAA 2OA7A 4AF2A 3GX8A 2MZCA 1F3AA 5J41A 1SL0B 3CMIA 1KEBA 5ECIB 5CP1A 4MMMA 2VM2A 4ECJA 5ECNB 3KZQA 1NM3A 1Z6NA 5A4VA 3CSJA 3EPTA 1DE1A 3ISOA 3IA1A 4BA7A 1V2AA 3K8NA 3M8NA 3TGZA 3M0FA 2OJLA 2HRNA 5GSTA 6GSVA 2CVDA 1EGRA 2NVLA 4EIPA 3P7XA 1FOVA 4ISDA 1C72A 2EIQA 1MDIA 1OKDA 2FWGA 2LRNA 2EIRA 1ZYEA 3HVXA 3M1GA 4IELA 4J57E 1PKZA 5JCWA 3Q74A 2YZUA 2JACA 1JFUA 2R6KA 3DGQA 3UEMA 3QCPA 2H75A 5HFKA 4FIWA 3DMLA 5IMFA 5DBQA 3DKSA 1TJDA 3UARA 5ECQB 1ZGNA 1N2AA 2G0FA 3RHCA 5IMZA 3AY8A 2PU9C 3CXGA 4MJAA 2C1YA 2H6XA 2CX3A 4V1Ap 4JU5A 2CA8A 2FA8A 1X9MB 4AJ6A 1Z9HA 4IQ1A 4YQMA 4PQ1A 1A2JA 2V1MA 5DJMA 4ECCA 5C04A 1PRXA 3FY7A 1PL1A 3O3TA 4DEJA 2WDUA 1ERUA 1R4WA 1TRWA 1O8WA 3LXTA 1EOGA 3IC4A 4MABA 3BBYA 1JZDA 1SKRB 11GSA 1GUKA 4MH3A 4DVCA 3BCIA 5ELAA 2LUSA 3KJYA 2O89A 3W6GA 4TXOB 3WD6A 1BJXA 1NHYA 2LJRA 1SYXA 2AB6A 1SK1A 1PN9A 3A5IA 1T4ZA 2C0GA 2NTOA 22GSA 3QFBC 2ZNMA 3V1WA 1EV4A 5HFIA 1SK2A 3G7YA 6GSWA 1AW9A 4X0XA 2B7KA 1PQNA 1PSQA 5AIXA 1K0NA 1K0DA 3A5WA 5IQYA 3HJMA 1YF0A 3FR9A 1HNBA 5DALB 1GWCA 5IPGA 2O7KA 1M2BA 4X4JA 1V57A 3GKXA 2FA4A 2A4VA 3FMWA 3SWLA 5F06A 3ZFBA 1EP7A 1DBYA 2H70A 4Z2RA 2UZ8A 2IN3A 5G2ZA 1GTUA 4ZBBA 2H72A 4ILFA 2IMKA 1CQGA 4G0LA 3F3RA 3EURA 2H19A 3Q19A 4MPFA 4EDYA 2R5GA 3QAWA 3ZIVA 3PH9A 1PMTA 3H1NA 2EIOA 4XHMA 1FOHA 3KXOA 4NAXA 3UJ1A 1YY7A 5F8BA 5CAXA 3CSHA 1SJZA 3LFLA 4YKGA 3ZL5A 2FUG2 5KEJA 3A2WA 4MA9A 1M9BA 2F8AA 4FO5A 1G6WA 2VCVA 5E59A 4PXOA 2CAIA 1VRSD 3L4NA 3ERGA 2LS5A 1RQMA 2CT6A 4MJEA 2I3YA 1GULA 1YJ6A 4F82A 2JADA 3IV4A 4G0KA 3IDVA 1EEJA 3UVTA 2MBTA 1XCCA 4F0BA 2GQKA 3QMXA 3HJPA 1ZZYA 1Z7RA 4RQXA 3TJGA 1J0FA 1N8JA 4NV5A 2JU5A 4AJ7A 2CZ3A 2WULA 4GQCA 1XBSA 3W8JA 7GSSA 1FG4A 4TOPA 2I4AA 1TXXA 1X5DA 5A4WA 3I43A 4PX1A 5B8AA 1GSEA 2RUFA 3PPUA 3PINA 4IVFA 4G2EA 2G2QA 1GUMA 2DJ0A 3FZ5A 3OR5A 5IMVA 4WBJA 2VIMA 3NOFA 1TI1A 1GSQA 3A2XA 4MJBA 1EEMA 2R0PA 1YZXA 2DIZA 4L0WA 2IMIA 4I5QA 4TR4A 1E6BA 2IWTA 4N11A 3HVSA 2GQMA 2E2GA 2N5FA 1JLWA 4TR3A 5IOWA 4FQUA 1BX9A 1OE7A 2LQOA 3TJBA 2J9HA 4ZB6A 3H4KA 2FGXA 5KN2A 2VD1A 3FYGA 2NDOA 1K0BA 1O85A 3C7MA 14GSA 1BQ7A 2R4VA 3EWLA 4L0UA 2P5QA 4MNNA 3F63A 1ILOA 3HVVA 4G10A 1ZYNA 4HU9A 2PPTA 3TKRA 2DJ2A 3KH9A 3GV1A 2HRAA 3LJRA 2HZEA 4V2NA 1S3DA 3TRQA 3ZMKA 4I2TA 2HZEB 3N5OA 1F9MA 5DAKA 5G5FA 3MIXA 2E2MA 1VF4A 2C80A 5G1LA 1SD8A 5FHIA 4EL1A 1TOFA 3GRXA 2V32A 4MH2A 5COHA 2VLVA 5HFGA 4L5OA 1OE8A 3UAPA 2OE0A 4K2XA 1AQVA 1XWCA 1F37A 4K2DA 5ID2A 3L9SA 3ZREA 2X8GA 2OKAA 4F03A 4PQIA 1MDKA 2LJKA 3ERWA 4IKHA 1V9WA 1PL2A 3GA4A 4KDXA 4ZILA 4WR4A 4GTUA 3RPPA 4Q5NA 3FZAA 4KUNA 4LMWA 1T1VA 4O32A 5IIZA 4J56E 2X49A 1TDIA 5H5RA 4OO4A 1SL2B 3VURA 1OVNA 2DJ1A 1MD3A 2XPDA 3D4TA 2P31A 1K3OA 1ZMAA 2O85A 4IGJA 2VCTA 2VM1A 6GSTA 1U87A 4ACSA 1M2DA 4KB3A 1XZOA 3TJJA 19GSA 4MK3A 3BOAA 1TK8B 1O6JA 1QUWA 1OYJA 4G19A 4HEA2 2GZZA 4K7NA 3G7IA 4CW9A 2DBCA 2OACA 4BVYA 2EC4A 4BVYB 1GNEA 2N5AA 2PWJA 2RM5A 3ZFLA 1AIUA 1RW1A 4JE1A 4WETA 1S3AA 12GSA 4I8BA 3F4TA 1ABAA 2M46A 1HNCA 1NHOA 3GFKA 2IMEA 3WT1A 4KCEA 3SBCA 1W89A 4HDEA 2H74A 4QQ7A 5ENUA 2B7JA 4PUFC 3APSA 1FB0A 4PQHA 1EOHA 1M99A 1DSBA 2FWHA 2PGTA 4ZL8A 3F3QA 1YDKA 2YWOA 2CAQA 3GN3A 3GUSA 4PUAA 3FR3A 4OFNA 4GSTA 2VOCA 3KH7A 1T00A 5ABRA 1XWKA 1BG5A 5ECPB 2QA1A 5CYYA 4BVXA 4FYUA 2C3QA 1FB6A 1USBA 4BVXB 2H76A 3EYTA 5DQSA 2MMNA 3E9JB 4BL7A 2KUCA 4BL7B 1K0OA 2YJ7A 1PX7A 3HZ8A 3VWUA 1TU8A 2A2PA 1EV9A 1XW9A 4JEDA 3QPMA 1FVKA 1SK0A 3DWVA 5CRWA 3N9JA 1M7TA 2OBKA 5HR2A 1B8XA 4V2MA 3CTGA 3TRXA 2LQQA 2AUVA 2K8SA 2GVPA 2CZ2A 2GSQA 3D21A 3M9JA 4WF5A 1B4PA 2VO4A 5B6MA 1O73A 2C0EA 3H79A 3TJKA 3QD9A 2I9HA 1A23A 4TRXA 1TI3A 5G30A 1LJRA 4POLA 2DKHA 1WP0A 5J9BA 3EU4A 2IMFA 1VF3A 4ZXGA 3KTLA 4WR5A 3F0IA 2HZFA 1K0AA 2D2ZA 1YEXA 1MEKA 3QDNA 2MMAA 2H1GA 3MWHA 1F3BA 4F9ZA 1TRSA 4HZ4A 1ML6A 2PVOC 2REMA 3F6DA 4XRDA 3J7Yk 1GSUA 4K7OA 1VGLA 3VLNA 2JZRA 4PNGA 5D93A 4J2FA 3VFIA 3LORA 1UN2A 2V2GA 3Q6OA 1WRYA 4KX4A 3TJFA 2CVKA 3HKRA 2FWEA 2HRFA 4L5LA 2IIYA 4K7IA 4Q5QA 3KGKA 1JZWA 2C0DA 1GTBA 1A0RP 2E0QA 4MLYA 5HR0A 3FZ4A 3GL3A 3VPTA 1FAAA 1KTEA 2HE3A 2DJKA 3CTFA 3ERFA 3HXSA 4QL7A 4YAVA 2H66A 3DRNA 3IRAA 1XW6A 3GSTA 3HA9A 3DD3A 5IMAA 2YWMA 3IAM2 2R3XA 4NHWA 2H6YA 17GSA 4TR0A 1QFNA 2P5RA 3MYDA 4YQVA 4XS4A 2GS3A 1SKWB 4OCFA 2FWFA 4PURA 2O8VB 5ECMB 3QAGA 5KN3A 4IW9A 4XRAA 5LD0A 2LEGA 2L6DA 5CRDA 1GL8A 3TCOA 5HR1A 1B9YC 3LG6A 2F3MA 2FLSA 1QK8A 2NBSA 1URMA 3Q18A 3ZITA 2LJAA 2OBIA 3DVWA 4EKZA 1NW2A 2AAWA 3IE3A 2XC2A 5IM9A 5ELGA 2LTKA 5KOXA 2TIRA 4O5UA 4JBBA 2YV7A 2L5OA 2VCWA 2YV9A 1SL1B 5H5QA 4DSQA 4Z2UA 1WPIA 2B1LA 2LNSA 2WB9A 2GSTA 3TKSC 4EXJA 5JCGA 4HU7A 4MF6A 1SKSB 4AGSA 5HR3A 2WJUA 4XTSA 2IFQA 5JWQB 4EDZA 2IFQB 4RI7A 3CYNA 3ZVJD 5D8IA 1Y25A 2YPMA 3KCMA 3J7Yb 3HD5A 4JR6A 5AIVA 4WBRD 5DCHA 1XW5A 5FWGA 2OADA 3A3TA 3APOA 4HS1A 2B3SA 3BD2A 2FCHA 2PUKC 4EUYA 1GSYA 3ZZXA 3TKSA 1X5CA 3R3EA 1KBNA 2L5LA 4JR4A 4HJ2A 2HSMA 4O92A 1ERVA 4PGTA 1Z5YE 1R26A 3EVIA 3BCKA 1TP9A 3UOMA 3GL5A 1M9AA 1T8EB 2YNXA 1X9WB 2XBQA 2GGTA 2TRCP 2HNLA 2PERA 3GH6A 4XIHA 4XS6A 5GAND 4OFMA 3VK9A 4NHZA 3ZIJA 5B8BA 3RAZA 4H86A 4TR1A 2L59A 5FT3A 2F8FA 5J4UA 4EO3A 4KSMA 4AJ8A 5ECOB 4MJCA 4NPBA 4EIQA 4KDYA 3D22A 4POMA 1ZYPA 2QKEA 1XXUA 2LSTA 1Q98A 4GF0A 5CNWA 5AGYA 4K0NA 5F07A 2H0IA 4OD7A 4TVEA 3QFAC 1AXDA 4KW6A 3GKMA 3KM6A 2MYGA 5IMCA 5IO2A 5B6NA 2HT9A 4F2IA 3GH9A 1MDJA 2ZCTA 1Q4JA 2HXKA 3FR6A 3RHBA 2GSRA 4BWQA 3CRUA 3L9UA 4ECBA 2DMLA 2AV4A 5F05A 1IYHA 2LRCA 4PTSA 3GMFA 2WGRA 1OAZA 2VUPA 4KGIA 2FHEA 4MF5A 2ON7A 2WCIA 4ZB8A 4GXZA 2Z9SA 1TRUA 18GSA 3KP9A 5DQYA 4USSA 1EZKA 2HRKA 2QGVA 3ZMLA 2MBSA 4N30A 5HQPA 1YF1A 5F0GA 1WMJA 2L4CA 3IC8A 2M80A 1SENA 4LLRA 2C3TA 5DAKB 3UVHA 4FYBA 3DEXA 2DJJA 2RLIA 4E8HA 4EC0A 3P90A 3TB2A 3DVXA 3GHAA 4L8EA 2CVBA 1QQ2A 4LL1B 5EPFA 2IPAA 1LBKA 3FHKA 4HQSA 3EMPA 2YCDA 5CO3A 1XVWA 3MSZA 13GSA 3DIEA 1SYRA 2B5YA 5D9TA 2A2SA 5ID2B 1T7PB 1VF2A 3E3EA 3GSSA 1OKTA 3CRTA 3L9VA 2KOKA 2WRTA 1T3BA 2X99A 2X8CA 16GSA 5EY6A 4V2LA 2YWIA 1J08A 4KE3A 1WJKA 3D4MA 1UC7A 2XBIA 1K3YA 3IHQA 4A5PA 1FO5A 2XHFA 5G31A 3WGXA 2K9FA 1SU9A 1Z3EA 3FRCA 3UIWA 4K1FA 1PN0A 4DSSA 4TKYA 4CHSA 1G6YA 2HLSA 3C8EA 4OMVA 2YJHA 2R2JA 5D9WA 1A0FA 1GH2A 3IR4A 4QL9A 4IN0A 4KDUA 3CBUA 4BPYA 1BEDA 2FY6A 5DCGA 1G0TA 1RK4A 2DKIA 1U3IA 3G9BA 3TOTA 2H6ZA 1ZL9A 2KP2A 2ALBA 5A4UA 2H8LA 3C1SA 4XS1A 2GLRA 2B6MA 2CX4A 1SJIA 5J3RA 1GLQA 3GURA 1AAZA 4IJ3A 2PBJA 2TRXA 2GZPA 1YKCA 3HZ4A 4Q5RA 3FZ9A 4D73A 5AISA 4D73B 3M3MA 5ECLB 2VL3A 3VI7A 2K8VA 2H0HA 1K0MA 1EWXA 10GSA 4MZCA 3TUEA 3EINA 2DIYA 1GSDA 4ZB9A 1ST9A 3GTUA 2H30A 4NV2A 1YKAA 2HSYA 1JLVA 3GTUB 2H1DA 4YAPA 3P2AA 3UL3A 3F6FA 4TXVA 3KTBA 1V58A 4I2UA 1IYIA 3NZNA 1A8YA 2IJYA 4MP4A 5H5SA 2C8UA 4MZBA 4LL4B 2A2RA 2NPBA 4KCAA 2X8HA 4LMVA 2BJXA 3LW9A 2B5XA 2R0GA 1ZYQB 1PD21 3D0ZA 1O8XA 3I9V2 2C3NA 4IS0A 3UMAA 4RQRA 3C71A 1OC3A 3UBKA 5BRTA 4I97A 6GSSA 1AQXA 2X64A 3H8QA 5DVBA 4YH2A 1U88A 1R5PA 6GSUA 1GTIA 2L4QA 3GNJA 3WGEA 1SD9A 3C73A 1THOA 3JCML 3KP8A 4POBA 2VL9A 1R5AA 4JRRA 3VPQA 5D96A 4OO5A 3F4RA 5G5EA 1I9DA 3I69A 1THXA 3MAKA 2P0GA 2X4AA 2V6OA 2M72A 2LRTA 4GWRA 3HCZA 2WFCA 20GSA 4ID0A 1GP1A 1XIYA 2JL4A 4IJIA 2DLXA 1PGTA 3O6TA 2ON5A 5ECRB 2JSZA 2F51A 3GYKA 4KSOA 1I5GA 4KAEA 4IHUA 2CQ9A 4N0ZA 3ME8A 5IOXA 2XPEA 2H1BA 3DXBA 2OE1A 4GLTA 4HZ2A 2GDRA 4O7HA 5G1KA 3F8UA 1F2EA 3QOUA 2GTUA 2H73A 2ZUPA 2FNOA 2B1KA 5GZZB 1XWBA 2HFDA 2N5BA 2HSHA 3IOSA 4PNFA 1NSWA 3ZTLA 3GX0A 4ICYA 1HQOA 4IP6A 1QXHA 5AN1A 5IMDA 4TXOA 4JZQA 3O76A 6GSXA 1GUHA 4MPGA 2GT6A 4XS4B 9GSSA 1XWGA 1XOAA 1FHEA 1ZCPA 1GNWA 4NMUA 1BYEA 1FVJA 1MTCA 2JSYA 4EE0A 2AHEA 1OC8A 2VCQA 3US3A 1QMVA 2C4JA 5DJLA 5CRHA 1J9BA 5DDLA 5GSSA 3W8SA 5DALA 1QGVA 1ZOFA 2DMMA 5LNKe 2YN1A 3MDKA 2DC5A 2GZYA 4IBPA 3WYWA 5J5NA 3F9UA 2RIIA 2HYXA 2PVQA 1EGOA 1SJ6A 3FK8A 5EL8A 5L71A 2KHPA 1TK0B 5B7CA 4XCSA 1YQ1A 1O7UA 4N10A 2BMXA 4KA0A 4IQAA 3I6AA 2VAFA 1EP8A 5KN1A 2E7PA 2MMZA 2A4HA 2LNTA 2V6KA 3R2QA 4K0GA 2VCZA 4I6XA 4ZBAA 1X5EA 1Y6EA 4K5RA 2O87A 3KD0A 1BAYA 8GSSA 3IK9A 5GAPD 1HYUA 3EE2A 4WKWA 3UBLA 4NWYA 3TKSE 1PA3A 1UVZA 1M2AA 3NIVA 1V40A 2B5EA 4K9ZA 1K0CA 2L6CA 1CQHA 4FYCA 3GIXA 1A8LA 2V41A 3APQA 3HYPA 5A5KA 1B48A 2PN8A 3U5RE 1X0RA 1GRXA 1JZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DUG A;  1HD2 A;  2H71 A;  5E4W A;  4BWS A;  3LQ7 A;  3PR8 A;  3QAV A;  4TW5 A;  3P8W A;  1GSF A;  1WE0 A;  4WF4 A;  3C1R A;  4X1U A;  3ED3 A;  1A2M A;  1R7H A;  3LEF A;  2AJQ B;  3RBT A;  5ECK B;  5IO0 A;  3EC3 A;  1W4V A;  2YWN A;  5EVO A;  3VWW A;  1OC9 A;  4P3Y B;  1ACV A;  5JWR B;  1OC9 B;  4TR1 B;  3F4S A;  4ZL9 A;  1XVQ A;  3GKN A;  2AYT A;  2JZS A;  4DSR A;  5ECH B;  4GSS A;  4KND A;  4POK A;  1ON4 A;  2KP1 A;  2K18 A;  3ME7 A;  1X9S B;  1O81 A;  4O5R A;  4GRF A;  4N0V A;  1WOU A;  3GKK A;  2BTO T;  4IP1 A;  4GCI A;  3HJO A;  4OWY A;  4ZIJ A;  1B9X C;  5D73 A;  2DJ3 A;  5KN0 A;  3CSI A;  2IMD A;  4MF7 A;  2DSA A;  3MNG A;  3VWX A;  1Z6M A;  1KNG A;  4K6X A;  4MDC A;  2RUE A;  1G7O A;  3VWV A;  4Q5F A;  5D9V A;  1Z7P A;  1H75 A;  2OE3 A;  4OFT A;  1A24 A;  1AUC A;  1VF1 A;  3QR6 A;  2H1A A;  1UA5 A;  2VCX A;  3IBH A;  3U6V A;  3IPZ A;  4ZL7 A;  4EVM A;  1GSS A;  4ZBD A;  3FEU A;  3ZRD A;  3A2V A;  3HY2 A;  1TTZ A;  3ZLP A;  3WGD A;  3E0U A;  1G7E A;  2CV4 A;  5LCZ A;  1GLP A;  4G9H A;  2PMT A;  2QC7 A;  3HDC A;  5JCU A;  2H0G A;  1PKW A;  4E8E A;  4Z7X A;  4WXT A;  3LXZ A;  5CRE A;  2YP6 A;  1XPV A;  3DYR A;  2H01 A;  1K3L A;  2L57 A;  1TKD B;  2YZH A;  2YOI A;  5IPH A;  3M9K A;  1TU7 A;  1DE2 A;  3VI5 A;  1JZR A;  3HHV A;  1U6T A;  2FD3 A;  3WT2 A;  2JZT A;  5C00 A;  4GQF A;  1JHB A;  5JWO B;  4ULX A;  3TKP A;  1H4O A;  3L0H A;  4NXI A;  4EF0 A;  3RPN A;  4RUV A;  1B4Q A;  3FW2 A;  2IL3 A;  1TRV A;  4CDO A;  4F0C A;  4K8M A;  4OCE A;  3KIJ A;  2KLX A;  1YEP A;  3LWA A;  3LYP A;  2VLT A;  2GSS A;  2I1U A;  4X43 A;  4MZW A;  2VD0 A;  2QSI A;  3KMN A;  2WZ9 A;  4ML6 A;  3TKQ A;  3TDG A;  5INY A;  2RM6 A;  5J9C A;  1WWJ A;  4FH8 A;  2HI7 A;  2J23 A;  3IK7 A;  4HQZ A;  5CRG A;  3TRP A;  4V1A g;  3BJ5 A;  6GSY A;  1F6M C;  1U3A A;  4KH7 A;  2ES7 A;  1S3C A;  1FW1 A;  1AQW A;  3IXR A;  4DSS B;  4LA1 A;  2WS2 A;  2VL2 C;  3FKF A;  4HI7 A;  1PX6 A;  2YAN A;  4HJM A;  1GTA A;  2F9S A;  2GQL A;  2K6V A;  3EMX A;  5D9X A;  3D6I A;  1ERT A;  4MCU A;  3EU3 A;  3LSZ A;  3G7J A;  2LKU A;  3H93 A;  4GSN A;  1XOB A;  2LV3 A;  2VLU A;  3LYK A;  1WIK A;  3S9F A;  2I81 A;  2MMO A;  1HNA A;  1M0U A;  1XFL A;  3RDW A;  4RI6 A;  5ECS A;  1E2Y A;  2GT5 A;  3D5J A;  3KMO A;  1T4Y A;  4ECI A;  1MD4 A;  3L78 A;  3KEB A;  3IAS 2;  4HOJ A;  3TOU A;  1LU4 A;  2VL2 A;  2R37 A;  1V98 A;  4ML1 A;  3PGT A;  1AC1 A;  2C0F A;  3ZVJ A;  3ZYW A;  4YQU A;  4TN8 A;  1TW9 A;  1XWA A;  1TK5 B;  1ERW A;  4WEY A;  1A2L A;  3LGC A;  4HUA A;  2OA7 A;  4AF2 A;  3GX8 A;  2MZC A;  1F3A A;  5J41 A;  1SL0 B;  3CMI A;  1KEB A;  5ECI B;  5CP1 A;  4MMM A;  2VM2 A;  4ECJ A;  5ECN B;  3KZQ A;  1NM3 A;  1Z6N A;  5A4V A;  3CSJ A;  1DE1 A;  3ISO A;  3IA1 A;  4BA7 A;  1V2A A;  3K8N A;  3M8N A;  3TGZ A;  3M0F A;  2OJL A;  2HRN A;  5GST A;  6GSV A;  2CVD A;  1EGR A;  2NVL A;  3P7X A;  1FOV A;  4ISD A;  1C72 A;  2EIQ A;  1MDI A;  1OKD A;  2FWG A;  2LRN A;  2EIR A;  1ZYE A;  3HVX A;  3M1G A;  4IEL A;  4J57 E;  1PKZ A;  5JCW A;  3Q74 A;  2YZU A;  2JAC A;  1JFU A;  2R6K A;  3DGQ A;  3UEM A;  3QCP A;  2H75 A;  5HFK A;  4FIW A;  3DML A;  5IMF A;  5DBQ A;  3DKS A;  1TJD A;  3UAR A;  5ECQ B;  1ZGN A;  1N2A A;  2G0F A;  3RHC A;  5IMZ A;  3AY8 A;  2PU9 C;  3CXG A;  4MJA A;  2C1Y A;  2H6X A;  2CX3 A;  4V1A p;  4JU5 A;  2CA8 A;  2FA8 A;  1X9M B;  4AJ6 A;  1Z9H A;  4IQ1 A;  4YQM A;  4PQ1 A;  1A2J A;  2V1M A;  5DJM A;  4ECC A;  5C04 A;  1PRX A;  3FY7 A;  1PL1 A;  3O3T A;  4DEJ A;  2WDU A;  1ERU A;  1R4W A;  1TRW A;  1O8W A;  3LXT A;  1EOG A;  3IC4 A;  4MAB A;  3BBY A;  1JZD A;  1SKR B;  11GS A;  1GUK A;  4MH3 A;  4DVC A;  3BCI A;  5ELA A;  2LUS A;  3KJY A;  2O89 A;  3W6G A;  4TXO B;  3WD6 A;  1BJX A;  1NHY A;  2LJR A;  1SYX A;  2AB6 A;  1SK1 A;  1PN9 A;  1T4Z A;  2C0G A;  2NTO A;  22GS A;  3QFB C;  2ZNM A;  3V1W A;  1EV4 A;  5HFI A;  1SK2 A;  3G7Y A;  6GSW A;  1AW9 A;  4X0X A;  2B7K A;  1PQN A;  1PSQ A;  5AIX A;  1K0N A;  1K0D A;  3A5W A;  5IQY A;  3HJM A;  1YF0 A;  3FR9 A;  1HNB A;  5DAL B;  1GWC A;  5IPG A;  2O7K A;  1M2B A;  1V57 A;  3GKX A;  2FA4 A;  2A4V A;  3SWL A;  5F06 A;  3ZFB A;  1EP7 A;  1DBY A;  2H70 A;  2IN3 A;  5G2Z A;  1GTU A;  4ZBB A;  2H72 A;  4ILF A;  2IMK A;  1CQG A;  3F3R A;  3EUR A;  2H19 A;  3Q19 A;  4MPF A;  4EDY A;  2R5G A;  3QAW A;  3ZIV A;  3PH9 A;  1PMT A;  3H1N A;  2EIO A;  4XHM A;  3KXO A;  4NAX A;  3UJ1 A;  1YY7 A;  5F8B A;  5CAX A;  3CSH A;  1SJZ A;  3LFL A;  3ZL5 A;  2FUG 2;  5KEJ A;  3A2W A;  4MA9 A;  1M9B A;  2F8A A;  4FO5 A;  1G6W A;  2VCV A;  5E59 A;  4PXO A;  2CAI A;  1VRS D;  3L4N A;  3ERG A;  2LS5 A;  1RQM A;  2CT6 A;  4MJE A;  2I3Y A;  1GUL A;  1YJ6 A;  4F82 A;  2JAD A;  3IV4 A;  3IDV A;  1EEJ A;  3UVT A;  2MBT A;  1XCC A;  4F0B A;  2GQK A;  3QMX A;  3HJP A;  1ZZY A;  1Z7R A;  4RQX A;  3TJG A;  1J0F A;  1N8J A;  4NV5 A;  2JU5 A;  4AJ7 A;  2CZ3 A;  2WUL A;  4GQC A;  1XBS A;  3W8J A;  7GSS A;  1FG4 A;  4TOP A;  2I4A A;  1TXX A;  1X5D A;  5A4W A;  3I43 A;  4PX1 A;  5B8A A;  1GSE A;  2RUF A;  3PIN A;  4IVF A;  4G2E A;  2G2Q A;  1GUM A;  2DJ0 A;  3FZ5 A;  3OR5 A;  5IMV A;  2VIM A;  4WBJ A;  3NOF A;  1TI1 A;  1GSQ A;  3A2X A;  4MJB A;  1EEM A;  1YZX A;  2DIZ A;  4L0W A;  2IMI A;  4I5Q A;  4TR4 A;  1E6B A;  2IWT A;  4N11 A;  3HVS A;  2GQM A;  2E2G A;  2N5F A;  1JLW A;  4TR3 A;  5IOW A;  1BX9 A;  1OE7 A;  2LQO A;  3TJB A;  2J9H A;  4ZB6 A;  3H4K A;  2FGX A;  5KN2 A;  2VD1 A;  3FYG A;  2NDO A;  1K0B A;  1O85 A;  3C7M A;  14GS A;  1BQ7 A;  2R4V A;  3EWL A;  4L0U A;  2P5Q A;  3F63 A;  1ILO A;  3HVV A;  4G10 A;  4HU9 A;  2PPT A;  3TKR A;  2DJ2 A;  3KH9 A;  3GV1 A;  3LJR A;  2HZE A;  4V2N A;  1S3D A;  3TRQ A;  3ZMK A;  4I2T A;  2HZE B;  3N5O A;  1F9M A;  5DAK A;  5G5F A;  2E2M A;  1VF4 A;  2C80 A;  5G1L A;  1SD8 A;  5FHI A;  4EL1 A;  1TOF A;  3GRX A;  2V32 A;  4MH2 A;  5COH A;  2VLV A;  5HFG A;  4L5O A;  1OE8 A;  3UAP A;  2OE0 A;  1AQV A;  1XWC A;  1F37 A;  4K2D A;  5ID2 A;  3L9S A;  3ZRE A;  2X8G A;  2OKA A;  4F03 A;  4PQI A;  1MDK A;  2LJK A;  3ERW A;  4IKH A;  1V9W A;  1PL2 A;  3GA4 A;  4KDX A;  4ZIL A;  4WR4 A;  4GTU A;  3RPP A;  4Q5N A;  3FZA A;  4KUN A;  4LMW A;  1T1V A;  4O32 A;  5IIZ A;  4J56 E;  1TDI A;  5H5R A;  4OO4 A;  1SL2 B;  3VUR A;  1OVN A;  2DJ1 A;  1MD3 A;  2XPD A;  3D4T A;  2P31 A;  1K3O A;  1ZMA A;  2O85 A;  4IGJ A;  2VCT A;  2VM1 A;  6GST A;  1U87 A;  4ACS A;  1M2D A;  4KB3 A;  1XZO A;  3TJJ A;  19GS A;  4MK3 A;  3BOA A;  1TK8 B;  1O6J A;  1QUW A;  1OYJ A;  4G19 A;  4HEA 2;  2GZZ A;  4K7N A;  3G7I A;  4CW9 A;  2DBC A;  2OAC A;  4BVY A;  2EC4 A;  1GNE A;  2N5A A;  2PWJ A;  2RM5 A;  3ZFL A;  1AIU A;  1RW1 A;  4JE1 A;  4WET A;  1S3A A;  12GS A;  4I8B A;  3F4T A;  1ABA A;  2M46 A;  1HNC A;  1NHO A;  3GFK A;  2IME A;  3WT1 A;  4KCE A;  3SBC A;  1W89 A;  4HDE A;  2H74 A;  4QQ7 A;  5ENU A;  2B7J A;  4PUF C;  3APS A;  1FB0 A;  4PQH A;  1EOH A;  1M99 A;  1DSB A;  2FWH A;  2PGT A;  4ZL8 A;  3F3Q A;  1YDK A;  2YWO A;  2CAQ A;  3GN3 A;  3GUS A;  4PUA A;  3FR3 A;  4OFN A;  4GST A;  2VOC A;  3KH7 A;  1T00 A;  5ABR A;  1XWK A;  1BG5 A;  5ECP B;  5CYY A;  4BVX A;  4FYU A;  2C3Q A;  1FB6 A;  1USB A;  2H76 A;  3EYT A;  5DQS A;  2MMN A;  3E9J B;  4BL7 A;  2KUC A;  1K0O A;  2YJ7 A;  1PX7 A;  3HZ8 A;  3VWU A;  1TU8 A;  1EV9 A;  1XW9 A;  4JED A;  3QPM A;  1FVK A;  1SK0 A;  3DWV A;  5CRW A;  3N9J A;  1M7T A;  2OBK A;  5HR2 A;  1B8X A;  4V2M A;  3CTG A;  3TRX A;  2LQQ A;  2AUV A;  2K8S A;  2GVP A;  2CZ2 A;  2GSQ A;  3D21 A;  3M9J A;  4WF5 A;  1B4P A;  2VO4 A;  5B6M A;  1O73 A;  2C0E A;  3H79 A;  3TJK A;  3QD9 A;  2I9H A;  1A23 A;  4TRX A;  1TI3 A;  5G30 A;  1LJR A;  4POL A;  1WP0 A;  5J9B A;  3EU4 A;  2IMF A;  1VF3 A;  4ZXG A;  3KTL A;  4WR5 A;  3F0I A;  2HZF A;  1K0A A;  2D2Z A;  1YEX A;  1MEK A;  3QDN A;  2MMA A;  2H1G A;  3MWH A;  1F3B A;  4F9Z A;  1TRS A;  4HZ4 A;  1ML6 A;  2PVO C;  2REM A;  3F6D A;  4XRD A;  3J7Y k;  1GSU A;  4K7O A;  1VGL A;  3VLN A;  2JZR A;  4PNG A;  5D93 A;  4J2F A;  3VFI A;  3LOR A;  1UN2 A;  2V2G A;  3Q6O A;  1WRY A;  4KX4 A;  3TJF A;  2CVK A;  3HKR A;  2FWE A;  2HRF A;  4L5L A;  2IIY A;  4K7I A;  4Q5Q A;  3KGK A;  1JZW A;  2C0D A;  1GTB A;  1A0R P;  2E0Q A;  4MLY A;  5HR0 A;  3FZ4 A;  3GL3 A;  3VPT A;  1FAA A;  1KTE A;  2HE3 A;  2DJK A;  3CTF A;  3ERF A;  3HXS A;  4QL7 A;  4YAV A;  2H66 A;  3DRN A;  3IRA A;  1XW6 A;  3GST A;  3HA9 A;  3DD3 A;  5IMA A;  2YWM A;  3IAM 2;  2R3X A;  4NHW A;  2H6Y A;  17GS A;  4TR0 A;  1QFN A;  2P5R A;  4YQV A;  4XS4 A;  2GS3 A;  1SKW B;  4OCF A;  2FWF A;  4PUR A;  2O8V B;  5ECM B;  3QAG A;  5KN3 A;  4IW9 A;  4XRA A;  5LD0 A;  2LEG A;  2L6D A;  5CRD A;  1GL8 A;  3TCO A;  5HR1 A;  1B9Y C;  3LG6 A;  2F3M A;  2FLS A;  1QK8 A;  2NBS A;  1URM A;  3Q18 A;  3ZIT A;  2LJA A;  2OBI A;  3DVW A;  4EKZ A;  1NW2 A;  2AAW A;  3IE3 A;  2XC2 A;  5IM9 A;  5ELG A;  2LTK A;  2TIR A;  4JBB A;  2YV7 A;  2L5O A;  2VCW A;  2YV9 A;  1SL1 B;  5H5Q A;  4DSQ A;  1WPI A;  2B1L A;  2LNS A;  2WB9 A;  2GST A;  3TKS C;  4EXJ A;  5JCG A;  4HU7 A;  4MF6 A;  1SKS B;  4AGS A;  5HR3 A;  2WJU A;  4XTS A;  2IFQ A;  5JWQ B;  4EDZ A;  2IFQ B;  4RI7 A;  3CYN A;  3ZVJ D;  5D8I A;  1Y25 A;  2YPM A;  3KCM A;  3J7Y b;  3HD5 A;  4JR6 A;  5AIV A;  4WBR D;  5DCH A;  1XW5 A;  5FWG A;  2OAD A;  3A3T A;  3APO A;  4HS1 A;  2B3S A;  3BD2 A;  2FCH A;  2PUK C;  4EUY A;  1GSY A;  3ZZX A;  3TKS A;  1X5C A;  1KBN A;  2L5L A;  4JR4 A;  4HJ2 A;  4O92 A;  1ERV A;  4PGT A;  1Z5Y E;  1R26 A;  3EVI A;  3BCK A;  1TP9 A;  3UOM A;  3GL5 A;  1M9A A;  1T8E B;  2YNX A;  1X9W B;  2XBQ A;  2GGT A;  2TRC P;  2HNL A;  2PER A;  3GH6 A;  4XIH A;  4XS6 A;  5GAN D;  4OFM A;  3VK9 A;  4NHZ A;  3ZIJ A;  5B8B A;  3RAZ A;  4H86 A;  4TR1 A;  2L59 A;  5FT3 A;  2F8F A;  5J4U A;  4EO3 A;  4KSM A;  4AJ8 A;  5ECO B;  4MJC A;  4NPB A;  4KDY A;  3D22 A;  4POM A;  2QKE A;  1XXU A;  2LST A;  1Q98 A;  4GF0 A;  5CNW A;  5AGY A;  4K0N A;  5F07 A;  2H0I A;  4OD7 A;  4TVE A;  3QFA C;  1AXD A;  4KW6 A;  3GKM A;  3KM6 A;  2MYG A;  5IMC A;  5IO2 A;  5B6N A;  2HT9 A;  4F2I A;  3GH9 A;  1MDJ A;  2ZCT A;  1Q4J A;  2HXK A;  3FR6 A;  3RHB A;  2GSR A;  4BWQ A;  3CRU A;  3L9U A;  4ECB A;  2DML A;  2AV4 A;  5F05 A;  1IYH A;  2LRC A;  3GMF A;  2WGR A;  1OAZ A;  2VUP A;  4KGI A;  2FHE A;  4MF5 A;  2ON7 A;  2WCI A;  4ZB8 A;  4GXZ A;  2Z9S A;  1TRU A;  18GS A;  3KP9 A;  5DQY A;  1EZK A;  2QGV A;  3ZML A;  2MBS A;  4N30 A;  5HQP A;  1YF1 A;  5F0G A;  1WMJ A;  2L4C A;  2M80 A;  1SEN A;  4LLR A;  2C3T A;  5DAK B;  3UVH A;  4FYB A;  3DEX A;  2DJJ A;  2RLI A;  4E8H A;  4EC0 A;  3P90 A;  3TB2 A;  3DVX A;  3GHA A;  4L8E A;  2CVB A;  1QQ2 A;  4LL1 B;  5EPF A;  2IPA A;  1LBK A;  3FHK A;  4HQS A;  3EMP A;  2YCD A;  5CO3 A;  1XVW A;  3MSZ A;  13GS A;  3DIE A;  1SYR A;  2B5Y A;  5D9T A;  2A2S A;  5ID2 B;  1T7P B;  1VF2 A;  3E3E A;  3GSS A;  1OKT A;  3CRT A;  3L9V A;  2KOK A;  2WRT A;  1T3B A;  2X99 A;  2X8C A;  16GS A;  5EY6 A;  4V2L A;  2YWI A;  1J08 A;  4KE3 A;  1WJK A;  3D4M A;  1UC7 A;  2XBI A;  1K3Y A;  3IHQ A;  1FO5 A;  2XHF A;  5G31 A;  3WGX A;  2K9F A;  1SU9 A;  1Z3E A;  3FRC A;  3UIW A;  4K1F A;  4DSS A;  4TKY A;  4CHS A;  1G6Y A;  2HLS A;  3C8E A;  4OMV A;  2YJH A;  2R2J A;  5D9W A;  1A0F A;  1GH2 A;  3IR4 A;  4QL9 A;  4IN0 A;  4KDU A;  3CBU A;  4BPY A;  1BED A;  2FY6 A;  5DCG A;  1G0T A;  1RK4 A;  1U3I A;  3G9B A;  3TOT A;  2H6Z A;  1ZL9 A;  2KP2 A;  2ALB A;  5A4U A;  2H8L A;  3C1S A;  4XS1 A;  2GLR A;  2B6M A;  2CX4 A;  1SJI A;  5J3R A;  1GLQ A;  3GUR A;  1AAZ A;  4IJ3 A;  2PBJ A;  2TRX A;  2GZP A;  1YKC A;  3HZ4 A;  4Q5R A;  3FZ9 A;  4D73 A;  5AIS A;  4D73 B;  3M3M A;  5ECL B;  2VL3 A;  3VI7 A;  2K8V A;  2H0H A;  1K0M A;  1EWX A;  10GS A;  4MZC A;  3TUE A;  3EIN A;  2DIY A;  1GSD A;  4ZB9 A;  1ST9 A;  3GTU A;  2H30 A;  4NV2 A;  1YKA A;  2HSY A;  1JLV A;  3GTU B;  2H1D A;  4YAP A;  3P2A A;  3UL3 A;  3F6F A;  4TXV A;  3KTB A;  1V58 A;  4I2U A;  1IYI A;  3NZN A;  1A8Y A;  2IJY A;  4MP4 A;  5H5S A;  2C8U A;  4MZB A;  4LL4 B;  2A2R A;  2NPB A;  4KCA A;  2X8H A;  4LMV A;  2BJX A;  2B5X A;  1ZYQ B;  1PD2 1;  3D0Z A;  1O8X A;  3I9V 2;  2C3N A;  4IS0 A;  3UMA A;  4RQR A;  3C71 A;  1OC3 A;  3UBK A;  4I97 A;  6GSS A;  1AQX A;  2X64 A;  3H8Q A;  5DVB A;  4YH2 A;  1U88 A;  1R5P A;  6GSU A;  1GTI A;  2L4Q A;  3GNJ A;  3WGE A;  1SD9 A;  3C73 A;  1THO A;  3JCM L;  3KP8 A;  4POB A;  2VL9 A;  1R5A A;  4JRR A;  3VPQ A;  5D96 A;  4OO5 A;  3F4R A;  5G5E A;  1I9D A;  3I69 A;  1THX A;  3MAK A;  2P0G A;  2V6O A;  2M72 A;  2LRT A;  4GWR A;  3HCZ A;  2WFC A;  20GS A;  4ID0 A;  1GP1 A;  1XIY A;  2JL4 A;  4IJI A;  2DLX A;  1PGT A;  3O6T A;  2ON5 A;  5ECR B;  2JSZ A;  2F51 A;  3GYK A;  4KSO A;  1I5G A;  4KAE A;  4IHU A;  2CQ9 A;  4N0Z A;  3ME8 A;  5IOX A;  2XPE A;  2H1B A;  3DXB A;  2OE1 A;  4GLT A;  4HZ2 A;  2GDR A;  4O7H A;  5G1K A;  3F8U A;  1F2E A;  3QOU A;  2GTU A;  2H73 A;  2ZUP A;  2FNO A;  2B1K A;  5GZZ B;  1XWB A;  2HFD A;  2N5B A;  2HSH A;  3IOS A;  4PNF A;  1NSW A;  3ZTL A;  3GX0 A;  1HQO A;  4IP6 A;  1QXH A;  5AN1 A;  5IMD A;  4TXO A;  4JZQ A;  3O76 A;  6GSX A;  1GUH A;  4MPG A;  2GT6 A;  4XS4 B;  9GSS A;  1XWG A;  1XOA A;  1FHE A;  1ZCP A;  1GNW A;  4NMU A;  1BYE A;  1FVJ A;  1MTC A;  2JSY A;  4EE0 A;  2AHE A;  1OC8 A;  2VCQ A;  3US3 A;  1QMV A;  2C4J A;  5DJL A;  5CRH A;  1J9B A;  5DDL A;  5GSS A;  3W8S A;  5DAL A;  1QGV A;  1ZOF A;  2DMM A;  5LNK e;  2YN1 A;  3MDK A;  2DC5 A;  2GZY A;  4IBP A;  3WYW A;  5J5N A;  3F9U A;  2RII A;  2HYX A;  2PVQ A;  1EGO A;  1SJ6 A;  3FK8 A;  5EL8 A;  5L71 A;  2KHP A;  1TK0 B;  5B7C A;  4XCS A;  1YQ1 A;  1O7U A;  4N10 A;  2BMX A;  4KA0 A;  4IQA A;  3I6A A;  2VAF A;  1EP8 A;  5KN1 A;  2E7P A;  2MMZ A;  2LNT A;  2V6K A;  3R2Q A;  4K0G A;  2VCZ A;  4I6X A;  4ZBA A;  1X5E A;  1Y6E A;  2O87 A;  3KD0 A;  1BAY A;  8GSS A;  3IK9 A;  5GAP D;  1HYU A;  3EE2 A;  4WKW A;  3UBL A;  4NWY A;  3TKS E;  1PA3 A;  1UVZ A;  1M2A A;  3NIV A;  1V40 A;  2B5E A;  4K9Z A;  1K0C A;  2L6C A;  1CQH A;  4FYC A;  3GIX A;  1A8L A;  2V41 A;  3APQ A;  3HYP A;  5A5K A;  1B48 A;  2PN8 A;  3U5R E;  1X0R A;  1GRX A;  1JZO A; 
#chains in the Genus database with same CATH topology
 1DUG A;  1HD2 A;  2H71 A;  5E4W A;  4CY6 A;  4BWS A;  3LQ7 A;  4O5Q A;  3PR8 A;  3QAV A;  4TW5 A;  3P8W A;  1GSF A;  1WE0 A;  4WF4 A;  3C1R A;  4X1U A;  3ED3 A;  1A2M A;  1R7H A;  3LEF A;  2AJQ B;  3RBT A;  5ECK B;  5IO0 A;  3EC3 A;  1W4V A;  2YWN A;  5EVO A;  3VWW A;  1OC9 A;  4P3Y B;  1ACV A;  5JWR B;  1OC9 B;  4TR1 B;  1XG8 A;  3F4S A;  4ZL9 A;  1XVQ A;  3GKN A;  2AYT A;  2JZS A;  4DSR A;  5ECH B;  4GSS A;  4KND A;  4POK A;  1ON4 A;  2KP1 A;  2K18 A;  3ME7 A;  1X9S B;  1O81 A;  4O5R A;  4GRF A;  4N0V A;  1WOU A;  3GKK A;  2BTO T;  4IP1 A;  4GCI A;  3HJO A;  4OWY A;  4ZIJ A;  1B9X C;  5D73 A;  2DJ3 A;  5KN0 A;  3CSI A;  2IMD A;  3CQF A;  4MF7 A;  2DSA A;  3MNG A;  3VWX A;  1Z6M A;  1KNG A;  4K6X A;  4MDC A;  2QA2 A;  2RUE A;  1G7O A;  3VWV A;  4Q5F A;  5D9V A;  1Z7P A;  1H75 A;  2OE3 A;  4OFT A;  1A24 A;  1AUC A;  1VF1 A;  3QR6 A;  2H1A A;  1UA5 A;  2VCX A;  3IBH A;  3U6V A;  3IPZ A;  4ZL7 A;  4EVM A;  1GSS A;  4ZBD A;  3FEU A;  3ZRD A;  3A2V A;  3HY2 A;  5KOW A;  4KF9 A;  1TTZ A;  3ZLP A;  3WGD A;  3E0U A;  1G7E A;  2CV4 A;  5LCZ A;  1GLP A;  4G9H A;  2PMT A;  2QC7 A;  3HDC A;  5JCU A;  2H0G A;  1PKW A;  4E8E A;  2R0C A;  4Z7X A;  4WXT A;  3LXZ A;  5CRE A;  2YP6 A;  1XPV A;  3DYR A;  2H01 A;  1K3L A;  2L57 A;  1TKD B;  2YZH A;  2YOI A;  5IPH A;  3IHG A;  3M9K A;  1TU7 A;  1DE2 A;  3VI5 A;  1JZR A;  3HHV A;  1U6T A;  2FD3 A;  4K5S A;  3WT2 A;  2JZT A;  5C00 A;  4GQF A;  1JHB A;  5JWO B;  4ULX A;  3TKP A;  1H4O A;  3L0H A;  4NXI A;  4EF0 A;  3RPN A;  4RUV A;  5BMU A;  1B4Q A;  3FW2 A;  2IL3 A;  1TRV A;  4CDO A;  4F0C A;  4K8M A;  4OCE A;  3KIJ A;  2KLX A;  1YEP A;  3LWA A;  3LYP A;  2VLT A;  2GSS A;  2I1U A;  4X43 A;  4MZW A;  2VD0 A;  2QSI A;  3KMN A;  2WZ9 A;  4ML6 A;  3TKQ A;  3TDG A;  1PFO A;  5INY A;  2RM6 A;  5J9C A;  1WWJ A;  4FH8 A;  2HI7 A;  2J23 A;  3IK7 A;  4HQZ A;  5CRG A;  3TRP A;  4V1A g;  3BJ5 A;  6GSY A;  1F6M C;  1U3A A;  4KH7 A;  2ES7 A;  1S3C A;  1FW1 A;  1AQW A;  4G0I A;  3IXR A;  4DSS B;  4LA1 A;  2WS2 A;  2VL2 C;  3FKF A;  4HI7 A;  1PX6 A;  2YAN A;  4HJM A;  1GTA A;  2F9S A;  4YKF A;  2GQL A;  2K6V A;  3EMX A;  5D9X A;  3D6I A;  1ERT A;  4MCU A;  4Z2T A;  3EU3 A;  3LSZ A;  3G7J A;  2LKU A;  3H93 A;  4GSN A;  1XOB A;  2LV3 A;  2VLU A;  3LYK A;  1WIK A;  3S9F A;  2I81 A;  2MMO A;  1HNA A;  1M0U A;  1XFL A;  3RDW A;  4RI6 A;  5ECS A;  1E2Y A;  2GT5 A;  3D5J A;  3KMO A;  1T4Y A;  4ECI A;  4CY8 A;  1MD4 A;  3L78 A;  3KEB A;  3IAS 2;  4HOJ A;  3TOU A;  1LU4 A;  2VL2 A;  2R37 A;  1V98 A;  4ML1 A;  3PGT A;  1AC1 A;  2C0F A;  3ZVJ A;  3ZYW A;  4YQU A;  4TN8 A;  1TW9 A;  1XWA A;  1TK5 B;  1ERW A;  4WEY A;  1A2L A;  3LGC A;  4HUA A;  2OA7 A;  4AF2 A;  3GX8 A;  2MZC A;  1F3A A;  5J41 A;  1SL0 B;  3CMI A;  1KEB A;  5ECI B;  5CP1 A;  4MMM A;  2VM2 A;  4ECJ A;  5ECN B;  3KZQ A;  1NM3 A;  1Z6N A;  5A4V A;  3CSJ A;  3EPT A;  1DE1 A;  3ISO A;  3IA1 A;  4BA7 A;  1V2A A;  3K8N A;  3M8N A;  3TGZ A;  3M0F A;  2OJL A;  2HRN A;  5GST A;  6GSV A;  2CVD A;  1EGR A;  2NVL A;  4EIP A;  3P7X A;  1FOV A;  4ISD A;  1C72 A;  2EIQ A;  1MDI A;  1OKD A;  2FWG A;  2LRN A;  2EIR A;  1ZYE A;  3HVX A;  3M1G A;  4IEL A;  4J57 E;  1PKZ A;  5JCW A;  3Q74 A;  2YZU A;  2JAC A;  1JFU A;  2R6K A;  3DGQ A;  3UEM A;  3QCP A;  2H75 A;  4BIK A;  5HFK A;  4FIW A;  3DML A;  5IMF A;  5DBQ A;  3DKS A;  1TJD A;  3UAR A;  5ECQ B;  1ZGN A;  1N2A A;  2G0F A;  3RHC A;  5IMZ A;  3AY8 A;  2PU9 C;  3CXG A;  4MJA A;  2C1Y A;  2H6X A;  2CX3 A;  4V1A p;  4JU5 A;  2CA8 A;  2FA8 A;  1X9M B;  4AJ6 A;  1Z9H A;  4IQ1 A;  4YQM A;  4PQ1 A;  1A2J A;  2V1M A;  5DJM A;  4ECC A;  5C04 A;  1PRX A;  3FY7 A;  1PL1 A;  3O3T A;  4DEJ A;  2WDU A;  1ERU A;  1R4W A;  1TRW A;  1O8W A;  3LXT A;  1EOG A;  3IC4 A;  4MAB A;  3BBY A;  1JZD A;  1SKR B;  11GS A;  1GUK A;  4MH3 A;  4DVC A;  3BCI A;  5ELA A;  2LUS A;  3KJY A;  2O89 A;  3W6G A;  4TXO B;  3WD6 A;  1BJX A;  1NHY A;  2LJR A;  1SYX A;  2AB6 A;  1SK1 A;  1PN9 A;  3A5I A;  1T4Z A;  2C0G A;  2NTO A;  22GS A;  3QFB C;  2ZNM A;  3V1W A;  1EV4 A;  5HFI A;  1SK2 A;  3G7Y A;  6GSW A;  1AW9 A;  4X0X A;  2B7K A;  1PQN A;  1PSQ A;  5AIX A;  1K0N A;  1K0D A;  3A5W A;  5IQY A;  3HJM A;  1YF0 A;  3FR9 A;  1HNB A;  5DAL B;  1GWC A;  5IPG A;  2O7K A;  1M2B A;  4X4J A;  1V57 A;  3GKX A;  2FA4 A;  2A4V A;  3FMW A;  3SWL A;  5F06 A;  3ZFB A;  1EP7 A;  1DBY A;  2H70 A;  4Z2R A;  2UZ8 A;  2IN3 A;  5G2Z A;  1GTU A;  4ZBB A;  2H72 A;  4ILF A;  2IMK A;  1CQG A;  4G0L A;  3F3R A;  3EUR A;  2H19 A;  3Q19 A;  4MPF A;  4EDY A;  2R5G A;  3QAW A;  3ZIV A;  3PH9 A;  1PMT A;  3H1N A;  2EIO A;  4XHM A;  1FOH A;  3KXO A;  4NAX A;  3UJ1 A;  1YY7 A;  5F8B A;  5CAX A;  3CSH A;  1SJZ A;  3LFL A;  4YKG A;  3ZL5 A;  2FUG 2;  5KEJ A;  3A2W A;  4MA9 A;  1M9B A;  2F8A A;  4FO5 A;  1G6W A;  2VCV A;  5E59 A;  4PXO A;  2CAI A;  1VRS D;  3L4N A;  3ERG A;  2LS5 A;  1M3J A;  1RQM A;  2CT6 A;  4MJE A;  2I3Y A;  1GUL A;  1YJ6 A;  4F82 A;  2JAD A;  3IV4 A;  4G0K A;  3IDV A;  1EEJ A;  3UVT A;  2MBT A;  1XCC A;  4F0B A;  2GQK A;  3QMX A;  3HJP A;  1ZZY A;  1Z7R A;  4RQX A;  3TJG A;  1J0F A;  1N8J A;  4NV5 A;  2JU5 A;  4AJ7 A;  2CZ3 A;  2WUL A;  4GQC A;  1XBS A;  3W8J A;  7GSS A;  1FG4 A;  4TOP A;  2I4A A;  1TXX A;  1X5D A;  5A4W A;  3I43 A;  4PX1 A;  5B8A A;  1GSE A;  2RUF A;  3PPU A;  3PIN A;  4IVF A;  4G2E A;  2G2Q A;  1GUM A;  2DJ0 A;  3FZ5 A;  3OR5 A;  5IMV A;  4WBJ A;  2VIM A;  3NOF A;  1TI1 A;  1GSQ A;  3A2X A;  4MJB A;  1EEM A;  2R0P A;  1YZX A;  2DIZ A;  4L0W A;  2IMI A;  4I5Q A;  4TR4 A;  1E6B A;  2IWT A;  4N11 A;  3HVS A;  2GQM A;  2E2G A;  2N5F A;  1JLW A;  4TR3 A;  5IOW A;  4FQU A;  1BX9 A;  1OE7 A;  2LQO A;  3TJB A;  2J9H A;  4ZB6 A;  3H4K A;  2FGX A;  5KN2 A;  2VD1 A;  3FYG A;  2NDO A;  1K0B A;  1O85 A;  3C7M A;  14GS A;  1BQ7 A;  2R4V A;  3EWL A;  4L0U A;  2P5Q A;  4MNN A;  3F63 A;  1ILO A;  3HVV A;  4G10 A;  1ZYN A;  4HU9 A;  2PPT A;  3TKR A;  2DJ2 A;  3KH9 A;  3GV1 A;  2HRA A;  3LJR A;  2HZE A;  4V2N A;  1S3D A;  3TRQ A;  3ZMK A;  4I2T A;  2HZE B;  3N5O A;  1F9M A;  5DAK A;  5G5F A;  3MIX A;  2E2M A;  1VF4 A;  2C80 A;  5G1L A;  1SD8 A;  5FHI A;  4EL1 A;  1TOF A;  3GRX A;  2V32 A;  4MH2 A;  5COH A;  2VLV A;  5HFG A;  4L5O A;  1OE8 A;  3UAP A;  2OE0 A;  4K2X A;  1AQV A;  1XWC A;  1F37 A;  4K2D A;  5ID2 A;  3L9S A;  3ZRE A;  2X8G A;  2OKA A;  4F03 A;  4PQI A;  1MDK A;  2LJK A;  3ERW A;  4IKH A;  1V9W A;  1PL2 A;  3GA4 A;  4KDX A;  4ZIL A;  4WR4 A;  4GTU A;  3RPP A;  4Q5N A;  3FZA A;  4KUN A;  4LMW A;  1T1V A;  4O32 A;  5IIZ A;  4J56 E;  2X49 A;  1TDI A;  5H5R A;  4OO4 A;  1SL2 B;  3VUR A;  1OVN A;  2DJ1 A;  1MD3 A;  2XPD A;  3D4T A;  2P31 A;  1K3O A;  1ZMA A;  2O85 A;  4IGJ A;  2VCT A;  2VM1 A;  6GST A;  1U87 A;  4ACS A;  1M2D A;  4KB3 A;  1XZO A;  3TJJ A;  19GS A;  4MK3 A;  3BOA A;  1TK8 B;  1O6J A;  1QUW A;  1OYJ A;  4G19 A;  4HEA 2;  2GZZ A;  4K7N A;  3G7I A;  4CW9 A;  2DBC A;  2OAC A;  4BVY A;  2EC4 A;  4BVY B;  1GNE A;  2N5A A;  2PWJ A;  2RM5 A;  3ZFL A;  1AIU A;  1RW1 A;  4JE1 A;  4WET A;  1S3A A;  12GS A;  4I8B A;  3F4T A;  1ABA A;  2M46 A;  1HNC A;  1NHO A;  3GFK A;  2IME A;  3WT1 A;  4KCE A;  3SBC A;  1W89 A;  4HDE A;  2H74 A;  4QQ7 A;  5ENU A;  2B7J A;  4PUF C;  3APS A;  1FB0 A;  4PQH A;  1EOH A;  1M99 A;  1DSB A;  2FWH A;  2PGT A;  4ZL8 A;  3F3Q A;  1YDK A;  2YWO A;  2CAQ A;  3GN3 A;  3GUS A;  4PUA A;  3FR3 A;  4OFN A;  4GST A;  2VOC A;  3KH7 A;  1T00 A;  5ABR A;  1XWK A;  1BG5 A;  5ECP B;  2QA1 A;  5CYY A;  4BVX A;  4FYU A;  2C3Q A;  1FB6 A;  1USB A;  4BVX B;  2H76 A;  3EYT A;  5DQS A;  2MMN A;  3E9J B;  4BL7 A;  2KUC A;  4BL7 B;  1K0O A;  2YJ7 A;  1PX7 A;  3HZ8 A;  3VWU A;  1TU8 A;  2A2P A;  1EV9 A;  1XW9 A;  4JED A;  3QPM A;  1FVK A;  1SK0 A;  3DWV A;  5CRW A;  3N9J A;  1M7T A;  2OBK A;  5HR2 A;  1B8X A;  4V2M A;  3CTG A;  3TRX A;  2LQQ A;  2AUV A;  2K8S A;  2GVP A;  2CZ2 A;  2GSQ A;  3D21 A;  3M9J A;  4WF5 A;  1B4P A;  2VO4 A;  5B6M A;  1O73 A;  2C0E A;  3H79 A;  3TJK A;  3QD9 A;  2I9H A;  1A23 A;  4TRX A;  1TI3 A;  5G30 A;  1LJR A;  4POL A;  2DKH A;  1WP0 A;  5J9B A;  3EU4 A;  2IMF A;  1VF3 A;  4ZXG A;  3KTL A;  4WR5 A;  3F0I A;  2HZF A;  1K0A A;  2D2Z A;  1YEX A;  1MEK A;  3QDN A;  2MMA A;  2H1G A;  3MWH A;  1F3B A;  4F9Z A;  1TRS A;  4HZ4 A;  1ML6 A;  2PVO C;  2REM A;  3F6D A;  4XRD A;  3J7Y k;  1GSU A;  4K7O A;  1VGL A;  3VLN A;  2JZR A;  4PNG A;  5D93 A;  4J2F A;  3VFI A;  3LOR A;  1UN2 A;  2V2G A;  3Q6O A;  1WRY A;  4KX4 A;  3TJF A;  2CVK A;  3HKR A;  2FWE A;  2HRF A;  4L5L A;  2IIY A;  4K7I A;  4Q5Q A;  3KGK A;  1JZW A;  2C0D A;  1GTB A;  1A0R P;  2E0Q A;  4MLY A;  5HR0 A;  3FZ4 A;  3GL3 A;  3VPT A;  1FAA A;  1KTE A;  2HE3 A;  2DJK A;  3CTF A;  3ERF A;  3HXS A;  4QL7 A;  4YAV A;  2H66 A;  3DRN A;  3IRA A;  1XW6 A;  3GST A;  3HA9 A;  3DD3 A;  5IMA A;  2YWM A;  3IAM 2;  2R3X A;  4NHW A;  2H6Y A;  17GS A;  4TR0 A;  1QFN A;  2P5R A;  3MYD A;  4YQV A;  4XS4 A;  2GS3 A;  1SKW B;  4OCF A;  2FWF A;  4PUR A;  2O8V B;  5ECM B;  3QAG A;  5KN3 A;  4IW9 A;  4XRA A;  5LD0 A;  2LEG A;  2L6D A;  5CRD A;  1GL8 A;  3TCO A;  5HR1 A;  1B9Y C;  3LG6 A;  2F3M A;  2FLS A;  1QK8 A;  2NBS A;  1URM A;  3Q18 A;  3ZIT A;  2LJA A;  2OBI A;  3DVW A;  4EKZ A;  1NW2 A;  2AAW A;  3IE3 A;  2XC2 A;  5IM9 A;  5ELG A;  2LTK A;  5KOX A;  2TIR A;  4O5U A;  4JBB A;  2YV7 A;  2L5O A;  2VCW A;  2YV9 A;  1SL1 B;  5H5Q A;  4DSQ A;  4Z2U A;  1WPI A;  2B1L A;  2LNS A;  2WB9 A;  2GST A;  3TKS C;  4EXJ A;  5JCG A;  4HU7 A;  4MF6 A;  1SKS B;  4AGS A;  5HR3 A;  2WJU A;  4XTS A;  2IFQ A;  5JWQ B;  4EDZ A;  2IFQ B;  4RI7 A;  3CYN A;  3ZVJ D;  5D8I A;  1Y25 A;  2YPM A;  3KCM A;  3J7Y b;  3HD5 A;  4JR6 A;  5AIV A;  4WBR D;  5DCH A;  1XW5 A;  5FWG A;  2OAD A;  3A3T A;  3APO A;  4HS1 A;  2B3S A;  3BD2 A;  2FCH A;  2PUK C;  4EUY A;  1GSY A;  3ZZX A;  3TKS A;  1X5C A;  3R3E A;  1KBN A;  2L5L A;  4JR4 A;  4HJ2 A;  2HSM A;  4O92 A;  1ERV A;  4PGT A;  1Z5Y E;  1R26 A;  3EVI A;  3BCK A;  1TP9 A;  3UOM A;  3GL5 A;  1M9A A;  1T8E B;  2YNX A;  1X9W B;  2XBQ A;  2GGT A;  2TRC P;  2HNL A;  2PER A;  3GH6 A;  4XIH A;  4XS6 A;  5GAN D;  4OFM A;  3VK9 A;  4NHZ A;  3ZIJ A;  5B8B A;  3RAZ A;  4H86 A;  4TR1 A;  2L59 A;  5FT3 A;  2F8F A;  5J4U A;  4EO3 A;  4KSM A;  4AJ8 A;  5ECO B;  4MJC A;  4NPB A;  4EIQ A;  4KDY A;  3D22 A;  4POM A;  1ZYP A;  2QKE A;  1XXU A;  2LST A;  1Q98 A;  1M3I A;  4GF0 A;  5CNW A;  5AGY A;  4K0N A;  5F07 A;  2H0I A;  4OD7 A;  4TVE A;  3QFA C;  1AXD A;  4KW6 A;  3GKM A;  3KM6 A;  2MYG A;  5IMC A;  5IO2 A;  5B6N A;  2HT9 A;  4F2I A;  3GH9 A;  1MDJ A;  2ZCT A;  1Q4J A;  2HXK A;  3FR6 A;  3HVN A;  3RHB A;  2GSR A;  4BWQ A;  3CRU A;  3L9U A;  4ECB A;  2DML A;  2AV4 A;  5F05 A;  1IYH A;  2LRC A;  4PTS A;  3GMF A;  2WGR A;  1OAZ A;  2VUP A;  4KGI A;  2FHE A;  4MF5 A;  2ON7 A;  2WCI A;  4ZB8 A;  4GXZ A;  2Z9S A;  1TRU A;  18GS A;  3KP9 A;  5DQY A;  4USS A;  1EZK A;  2HRK A;  2QGV A;  3ZML A;  2MBS A;  4N30 A;  5HQP A;  1YF1 A;  5F0G A;  1WMJ A;  2L4C A;  3IC8 A;  2M80 A;  1SEN A;  4LLR A;  2C3T A;  5DAK B;  3UVH A;  4FYB A;  3DEX A;  2DJJ A;  2RLI A;  4E8H A;  4EC0 A;  3P90 A;  3TB2 A;  3DVX A;  3GHA A;  4L8E A;  2CVB A;  1QQ2 A;  4LL1 B;  5EPF A;  2IPA A;  1LBK A;  3FHK A;  4HQS A;  3EMP A;  2YCD A;  5CO3 A;  1XVW A;  3MSZ A;  13GS A;  3DIE A;  1SYR A;  2B5Y A;  5D9T A;  2A2S A;  5ID2 B;  1T7P B;  1VF2 A;  3E3E A;  3GSS A;  1OKT A;  3CRT A;  3L9V A;  2KOK A;  2WRT A;  1T3B A;  2X99 A;  2X8C A;  16GS A;  5EY6 A;  4V2L A;  2YWI A;  1J08 A;  4KE3 A;  1WJK A;  3D4M A;  1UC7 A;  2XBI A;  1K3Y A;  3IHQ A;  4A5P A;  1FO5 A;  2XHF A;  5G31 A;  3WGX A;  2K9F A;  1SU9 A;  1Z3E A;  3FRC A;  3UIW A;  4K1F A;  1PN0 A;  4DSS A;  1S3R A;  4TKY A;  4CHS A;  1G6Y A;  2HLS A;  3C8E A;  4OMV A;  2YJH A;  2R2J A;  5D9W A;  1A0F A;  1GH2 A;  3IR4 A;  4QL9 A;  4IN0 A;  4KDU A;  3CBU A;  4BPY A;  1BED A;  4HSC X;  2FY6 A;  5DCG A;  1G0T A;  1RK4 A;  2DKI A;  1U3I A;  3G9B A;  3TOT A;  2H6Z A;  1ZL9 A;  2KP2 A;  2ALB A;  5A4U A;  2H8L A;  3C1S A;  4XS1 A;  2GLR A;  2B6M A;  2CX4 A;  1SJI A;  5J3R A;  1GLQ A;  3GUR A;  1AAZ A;  4IJ3 A;  2PBJ A;  2TRX A;  2GZP A;  1YKC A;  3HZ4 A;  4Q5R A;  3FZ9 A;  4D73 A;  5AIS A;  4D73 B;  3M3M A;  5ECL B;  2VL3 A;  3VI7 A;  2K8V A;  2H0H A;  1K0M A;  1EWX A;  10GS A;  4MZC A;  3TUE A;  3EIN A;  2DIY A;  1GSD A;  4ZB9 A;  1ST9 A;  3GTU A;  2H30 A;  4NV2 A;  1YKA A;  2HSY A;  1JLV A;  3GTU B;  2H1D A;  4YAP A;  3P2A A;  3UL3 A;  3F6F A;  4TXV A;  3KTB A;  1V58 A;  4I2U A;  1IYI A;  3NZN A;  1A8Y A;  2IJY A;  4MP4 A;  5H5S A;  2C8U A;  4MZB A;  4LL4 B;  2A2R A;  2NPB A;  4KCA A;  2X8H A;  4LMV A;  2BJX A;  3LW9 A;  2B5X A;  2R0G A;  1ZYQ B;  1PD2 1;  3D0Z A;  1O8X A;  3I9V 2;  2C3N A;  4IS0 A;  3UMA A;  4RQR A;  3C71 A;  1OC3 A;  3UBK A;  5BRT A;  4I97 A;  6GSS A;  1AQX A;  2X64 A;  3H8Q A;  5DVB A;  4YH2 A;  1U88 A;  1R5P A;  6GSU A;  1GTI A;  2L4Q A;  3GNJ A;  3WGE A;  1SD9 A;  3C73 A;  1THO A;  3JCM L;  3KP8 A;  4POB A;  2VL9 A;  1R5A A;  4JRR A;  3VPQ A;  5D96 A;  4OO5 A;  3F4R A;  5G5E A;  1I9D A;  3I69 A;  1THX A;  3MAK A;  2P0G A;  2X4A A;  2V6O A;  2M72 A;  2LRT A;  4GWR A;  3HCZ A;  2WFC A;  20GS A;  4ID0 A;  1GP1 A;  1XIY A;  2JL4 A;  4IJI A;  2DLX A;  1PGT A;  3O6T A;  2ON5 A;  5ECR B;  2JSZ A;  2F51 A;  3GYK A;  4KSO A;  1I5G A;  4KAE A;  4IHU A;  2CQ9 A;  4N0Z A;  3ME8 A;  5IOX A;  2XPE A;  2H1B A;  3DXB A;  2OE1 A;  4GLT A;  4HZ2 A;  2GDR A;  4O7H A;  5G1K A;  3F8U A;  1F2E A;  3QOU A;  2GTU A;  2H73 A;  2ZUP A;  2FNO A;  2B1K A;  5GZZ B;  1XWB A;  2HFD A;  2N5B A;  2HSH A;  3IOS A;  4PNF A;  1NSW A;  3ZTL A;  3GX0 A;  4ICY A;  1HQO A;  4IP6 A;  1QXH A;  5AN1 A;  5IMD A;  4TXO A;  4JZQ A;  3O76 A;  6GSX A;  1GUH A;  4MPG A;  2GT6 A;  4XS4 B;  9GSS A;  1XWG A;  1XOA A;  1FHE A;  1ZCP A;  1GNW A;  4NMU A;  1BYE A;  1FVJ A;  1MTC A;  2JSY A;  4EE0 A;  2AHE A;  1OC8 A;  2VCQ A;  3US3 A;  1QMV A;  2C4J A;  5DJL A;  5CRH A;  1J9B A;  5DDL A;  5GSS A;  3W8S A;  5DAL A;  1QGV A;  1ZOF A;  2DMM A;  5LNK e;  2YN1 A;  3MDK A;  2DC5 A;  2GZY A;  4IBP A;  3WYW A;  5J5N A;  3F9U A;  2RII A;  2HYX A;  2PVQ A;  1EGO A;  1SJ6 A;  3FK8 A;  5EL8 A;  5L71 A;  2KHP A;  1TK0 B;  5B7C A;  4XCS A;  1YQ1 A;  1O7U A;  4N10 A;  2BMX A;  4KA0 A;  4IQA A;  3I6A A;  2VAF A;  1EP8 A;  5KN1 A;  2E7P A;  2MMZ A;  2A4H A;  2LNT A;  2V6K A;  3R2Q A;  4K0G A;  2VCZ A;  4I6X A;  4ZBA A;  1X5E A;  1Y6E A;  4K5R A;  2O87 A;  3KD0 A;  1BAY A;  8GSS A;  3IK9 A;  5GAP D;  1HYU A;  3EE2 A;  4WKW A;  3UBL A;  4NWY A;  3TKS E;  1PA3 A;  1UVZ A;  1M2A A;  3NIV A;  1V40 A;  2B5E A;  4K9Z A;  1K0C A;  2L6C A;  1CQH A;  4FYC A;  3GIX A;  1A8L A;  2V41 A;  3APQ A;  3HYP A;  5A5K A;  1B48 A;  2PN8 A;  3U5R E;  1X0R A;  1GRX A;  1JZO A; 
#chains in the Genus database with same CATH homology
 1DUG A;  1HD2 A;  2H71 A;  5E4W A;  4CY6 A;  4BWS A;  3LQ7 A;  4O5Q A;  3PR8 A;  3QAV A;  4TW5 A;  3P8W A;  1GSF A;  1WE0 A;  4WF4 A;  3C1R A;  4X1U A;  3ED3 A;  1A2M A;  1R7H A;  3LEF A;  2AJQ B;  3RBT A;  5ECK B;  5IO0 A;  3EC3 A;  1W4V A;  2YWN A;  5EVO A;  3VWW A;  1OC9 A;  4P3Y B;  1ACV A;  5JWR B;  1OC9 B;  4TR1 B;  3F4S A;  4ZL9 A;  1XVQ A;  3GKN A;  2AYT A;  2JZS A;  4DSR A;  5ECH B;  4GSS A;  4KND A;  4POK A;  1ON4 A;  2KP1 A;  2K18 A;  3ME7 A;  1X9S B;  1O81 A;  4O5R A;  4GRF A;  4N0V A;  1WOU A;  3GKK A;  2BTO T;  4IP1 A;  4GCI A;  3HJO A;  4OWY A;  4ZIJ A;  1B9X C;  5D73 A;  2DJ3 A;  5KN0 A;  3CSI A;  2IMD A;  4MF7 A;  2DSA A;  3MNG A;  3VWX A;  1Z6M A;  1KNG A;  4K6X A;  4MDC A;  2QA2 A;  2RUE A;  1G7O A;  3VWV A;  4Q5F A;  5D9V A;  1Z7P A;  1H75 A;  2OE3 A;  4OFT A;  1A24 A;  1AUC A;  1VF1 A;  3QR6 A;  2H1A A;  1UA5 A;  2VCX A;  3IBH A;  3U6V A;  3IPZ A;  4ZL7 A;  4EVM A;  1GSS A;  4ZBD A;  3FEU A;  3ZRD A;  3A2V A;  3HY2 A;  5KOW A;  4KF9 A;  1TTZ A;  3ZLP A;  3WGD A;  3E0U A;  1G7E A;  2CV4 A;  5LCZ A;  1GLP A;  4G9H A;  2PMT A;  2QC7 A;  3HDC A;  5JCU A;  2H0G A;  1PKW A;  4E8E A;  2R0C A;  4Z7X A;  4WXT A;  3LXZ A;  5CRE A;  2YP6 A;  1XPV A;  3DYR A;  2H01 A;  1K3L A;  2L57 A;  1TKD B;  2YZH A;  2YOI A;  5IPH A;  3IHG A;  3M9K A;  1TU7 A;  1DE2 A;  3VI5 A;  1JZR A;  3HHV A;  1U6T A;  2FD3 A;  4K5S A;  3WT2 A;  2JZT A;  5C00 A;  4GQF A;  1JHB A;  5JWO B;  4ULX A;  3TKP A;  1H4O A;  3L0H A;  4NXI A;  4EF0 A;  3RPN A;  4RUV A;  5BMU A;  1B4Q A;  3FW2 A;  2IL3 A;  1TRV A;  4CDO A;  4F0C A;  4K8M A;  4OCE A;  3KIJ A;  2KLX A;  1YEP A;  3LWA A;  3LYP A;  2VLT A;  2GSS A;  2I1U A;  4X43 A;  4MZW A;  2VD0 A;  2QSI A;  3KMN A;  2WZ9 A;  4ML6 A;  3TKQ A;  3TDG A;  5INY A;  2RM6 A;  5J9C A;  1WWJ A;  4FH8 A;  2HI7 A;  2J23 A;  3IK7 A;  4HQZ A;  5CRG A;  3TRP A;  4V1A g;  3BJ5 A;  6GSY A;  1F6M C;  1U3A A;  4KH7 A;  2ES7 A;  1S3C A;  1FW1 A;  1AQW A;  4G0I A;  3IXR A;  4DSS B;  4LA1 A;  2WS2 A;  2VL2 C;  3FKF A;  4HI7 A;  1PX6 A;  2YAN A;  4HJM A;  1GTA A;  2F9S A;  4YKF A;  2GQL A;  2K6V A;  3EMX A;  5D9X A;  3D6I A;  1ERT A;  4MCU A;  4Z2T A;  3EU3 A;  3LSZ A;  3G7J A;  2LKU A;  3H93 A;  4GSN A;  1XOB A;  2LV3 A;  2VLU A;  3LYK A;  1WIK A;  3S9F A;  2I81 A;  2MMO A;  1HNA A;  1M0U A;  1XFL A;  3RDW A;  4RI6 A;  5ECS A;  1E2Y A;  2GT5 A;  3D5J A;  3KMO A;  1T4Y A;  4ECI A;  4CY8 A;  1MD4 A;  3L78 A;  3KEB A;  3IAS 2;  4HOJ A;  3TOU A;  1LU4 A;  2VL2 A;  2R37 A;  1V98 A;  4ML1 A;  3PGT A;  1AC1 A;  2C0F A;  3ZVJ A;  3ZYW A;  4YQU A;  4TN8 A;  1TW9 A;  1XWA A;  1TK5 B;  1ERW A;  4WEY A;  1A2L A;  3LGC A;  4HUA A;  2OA7 A;  4AF2 A;  3GX8 A;  2MZC A;  1F3A A;  5J41 A;  1SL0 B;  3CMI A;  1KEB A;  5ECI B;  5CP1 A;  4MMM A;  2VM2 A;  4ECJ A;  5ECN B;  3KZQ A;  1NM3 A;  1Z6N A;  5A4V A;  3CSJ A;  3EPT A;  1DE1 A;  3ISO A;  3IA1 A;  4BA7 A;  1V2A A;  3K8N A;  3M8N A;  3TGZ A;  3M0F A;  2OJL A;  2HRN A;  5GST A;  6GSV A;  2CVD A;  1EGR A;  2NVL A;  4EIP A;  3P7X A;  1FOV A;  4ISD A;  1C72 A;  2EIQ A;  1MDI A;  1OKD A;  2FWG A;  2LRN A;  2EIR A;  1ZYE A;  3HVX A;  3M1G A;  4IEL A;  4J57 E;  1PKZ A;  5JCW A;  3Q74 A;  2YZU A;  2JAC A;  1JFU A;  2R6K A;  3DGQ A;  3UEM A;  3QCP A;  2H75 A;  5HFK A;  4FIW A;  3DML A;  5IMF A;  5DBQ A;  3DKS A;  1TJD A;  3UAR A;  5ECQ B;  1ZGN A;  1N2A A;  2G0F A;  3RHC A;  5IMZ A;  3AY8 A;  2PU9 C;  3CXG A;  4MJA A;  2C1Y A;  2H6X A;  2CX3 A;  4V1A p;  4JU5 A;  2CA8 A;  2FA8 A;  1X9M B;  4AJ6 A;  1Z9H A;  4IQ1 A;  4YQM A;  4PQ1 A;  1A2J A;  2V1M A;  5DJM A;  4ECC A;  5C04 A;  1PRX A;  3FY7 A;  1PL1 A;  3O3T A;  4DEJ A;  2WDU A;  1ERU A;  1R4W A;  1TRW A;  1O8W A;  3LXT A;  1EOG A;  3IC4 A;  4MAB A;  3BBY A;  1JZD A;  1SKR B;  11GS A;  1GUK A;  4MH3 A;  4DVC A;  3BCI A;  5ELA A;  2LUS A;  3KJY A;  2O89 A;  3W6G A;  4TXO B;  3WD6 A;  1BJX A;  1NHY A;  2LJR A;  1SYX A;  2AB6 A;  1SK1 A;  1PN9 A;  3A5I A;  1T4Z A;  2C0G A;  2NTO A;  22GS A;  3QFB C;  2ZNM A;  3V1W A;  1EV4 A;  5HFI A;  1SK2 A;  3G7Y A;  6GSW A;  1AW9 A;  4X0X A;  2B7K A;  1PQN A;  1PSQ A;  5AIX A;  1K0N A;  1K0D A;  3A5W A;  5IQY A;  3HJM A;  1YF0 A;  3FR9 A;  1HNB A;  5DAL B;  1GWC A;  5IPG A;  2O7K A;  1M2B A;  4X4J A;  1V57 A;  3GKX A;  2FA4 A;  2A4V A;  3FMW A;  3SWL A;  5F06 A;  3ZFB A;  1EP7 A;  1DBY A;  2H70 A;  4Z2R A;  2UZ8 A;  2IN3 A;  5G2Z A;  1GTU A;  4ZBB A;  2H72 A;  4ILF A;  2IMK A;  1CQG A;  4G0L A;  3F3R A;  3EUR A;  2H19 A;  3Q19 A;  4MPF A;  4EDY A;  2R5G A;  3QAW A;  3ZIV A;  3PH9 A;  1PMT A;  3H1N A;  2EIO A;  4XHM A;  1FOH A;  3KXO A;  4NAX A;  3UJ1 A;  1YY7 A;  5F8B A;  5CAX A;  3CSH A;  1SJZ A;  3LFL A;  4YKG A;  3ZL5 A;  2FUG 2;  5KEJ A;  3A2W A;  4MA9 A;  1M9B A;  2F8A A;  4FO5 A;  1G6W A;  2VCV A;  5E59 A;  4PXO A;  2CAI A;  1VRS D;  3L4N A;  3ERG A;  2LS5 A;  1RQM A;  2CT6 A;  4MJE A;  2I3Y A;  1GUL A;  1YJ6 A;  4F82 A;  2JAD A;  3IV4 A;  4G0K A;  3IDV A;  1EEJ A;  3UVT A;  2MBT A;  1XCC A;  4F0B A;  2GQK A;  3QMX A;  3HJP A;  1ZZY A;  1Z7R A;  4RQX A;  3TJG A;  1J0F A;  1N8J A;  4NV5 A;  2JU5 A;  4AJ7 A;  2CZ3 A;  2WUL A;  4GQC A;  1XBS A;  3W8J A;  7GSS A;  1FG4 A;  4TOP A;  2I4A A;  1TXX A;  1X5D A;  5A4W A;  3I43 A;  4PX1 A;  5B8A A;  1GSE A;  2RUF A;  3PPU A;  3PIN A;  4IVF A;  4G2E A;  2G2Q A;  1GUM A;  2DJ0 A;  3FZ5 A;  3OR5 A;  5IMV A;  4WBJ A;  2VIM A;  3NOF A;  1TI1 A;  1GSQ A;  3A2X A;  4MJB A;  1EEM A;  2R0P A;  1YZX A;  2DIZ A;  4L0W A;  2IMI A;  4I5Q A;  4TR4 A;  1E6B A;  2IWT A;  4N11 A;  3HVS A;  2GQM A;  2E2G A;  2N5F A;  1JLW A;  4TR3 A;  5IOW A;  4FQU A;  1BX9 A;  1OE7 A;  2LQO A;  3TJB A;  2J9H A;  4ZB6 A;  3H4K A;  2FGX A;  5KN2 A;  2VD1 A;  3FYG A;  2NDO A;  1K0B A;  1O85 A;  3C7M A;  14GS A;  1BQ7 A;  2R4V A;  3EWL A;  4L0U A;  2P5Q A;  4MNN A;  3F63 A;  1ILO A;  3HVV A;  4G10 A;  1ZYN A;  4HU9 A;  2PPT A;  3TKR A;  2DJ2 A;  3KH9 A;  3GV1 A;  2HRA A;  3LJR A;  2HZE A;  4V2N A;  1S3D A;  3TRQ A;  3ZMK A;  4I2T A;  2HZE B;  3N5O A;  1F9M A;  5DAK A;  5G5F A;  3MIX A;  2E2M A;  1VF4 A;  2C80 A;  5G1L A;  1SD8 A;  5FHI A;  4EL1 A;  1TOF A;  3GRX A;  2V32 A;  4MH2 A;  5COH A;  2VLV A;  5HFG A;  4L5O A;  1OE8 A;  3UAP A;  2OE0 A;  4K2X A;  1AQV A;  1XWC A;  1F37 A;  4K2D A;  5ID2 A;  3L9S A;  3ZRE A;  2X8G A;  2OKA A;  4F03 A;  4PQI A;  1MDK A;  2LJK A;  3ERW A;  4IKH A;  1V9W A;  1PL2 A;  3GA4 A;  4KDX A;  4ZIL A;  4WR4 A;  4GTU A;  3RPP A;  4Q5N A;  3FZA A;  4KUN A;  4LMW A;  1T1V A;  4O32 A;  5IIZ A;  4J56 E;  2X49 A;  1TDI A;  5H5R A;  4OO4 A;  1SL2 B;  3VUR A;  1OVN A;  2DJ1 A;  1MD3 A;  2XPD A;  3D4T A;  2P31 A;  1K3O A;  1ZMA A;  2O85 A;  4IGJ A;  2VCT A;  2VM1 A;  6GST A;  1U87 A;  4ACS A;  1M2D A;  4KB3 A;  1XZO A;  3TJJ A;  19GS A;  4MK3 A;  3BOA A;  1TK8 B;  1O6J A;  1QUW A;  1OYJ A;  4G19 A;  4HEA 2;  2GZZ A;  4K7N A;  3G7I A;  4CW9 A;  2DBC A;  2OAC A;  4BVY A;  2EC4 A;  4BVY B;  1GNE A;  2N5A A;  2PWJ A;  2RM5 A;  3ZFL A;  1AIU A;  1RW1 A;  4JE1 A;  4WET A;  1S3A A;  12GS A;  4I8B A;  3F4T A;  1ABA A;  2M46 A;  1HNC A;  1NHO A;  3GFK A;  2IME A;  3WT1 A;  4KCE A;  3SBC A;  1W89 A;  4HDE A;  2H74 A;  4QQ7 A;  5ENU A;  2B7J A;  4PUF C;  3APS A;  1FB0 A;  4PQH A;  1EOH A;  1M99 A;  1DSB A;  2FWH A;  2PGT A;  4ZL8 A;  3F3Q A;  1YDK A;  2YWO A;  2CAQ A;  3GN3 A;  3GUS A;  4PUA A;  3FR3 A;  4OFN A;  4GST A;  2VOC A;  3KH7 A;  1T00 A;  5ABR A;  1XWK A;  1BG5 A;  5ECP B;  2QA1 A;  5CYY A;  4BVX A;  4FYU A;  2C3Q A;  1FB6 A;  1USB A;  4BVX B;  2H76 A;  3EYT A;  5DQS A;  2MMN A;  3E9J B;  4BL7 A;  2KUC A;  4BL7 B;  1K0O A;  2YJ7 A;  1PX7 A;  3HZ8 A;  3VWU A;  1TU8 A;  2A2P A;  1EV9 A;  1XW9 A;  4JED A;  3QPM A;  1FVK A;  1SK0 A;  3DWV A;  5CRW A;  3N9J A;  1M7T A;  2OBK A;  5HR2 A;  1B8X A;  4V2M A;  3CTG A;  3TRX A;  2LQQ A;  2AUV A;  2K8S A;  2GVP A;  2CZ2 A;  2GSQ A;  3D21 A;  3M9J A;  4WF5 A;  1B4P A;  2VO4 A;  5B6M A;  1O73 A;  2C0E A;  3H79 A;  3TJK A;  3QD9 A;  2I9H A;  1A23 A;  4TRX A;  1TI3 A;  5G30 A;  1LJR A;  4POL A;  2DKH A;  1WP0 A;  5J9B A;  3EU4 A;  2IMF A;  1VF3 A;  4ZXG A;  3KTL A;  4WR5 A;  3F0I A;  2HZF A;  1K0A A;  2D2Z A;  1YEX A;  1MEK A;  3QDN A;  2MMA A;  2H1G A;  3MWH A;  1F3B A;  4F9Z A;  1TRS A;  4HZ4 A;  1ML6 A;  2PVO C;  2REM A;  3F6D A;  4XRD A;  3J7Y k;  1GSU A;  4K7O A;  1VGL A;  3VLN A;  2JZR A;  4PNG A;  5D93 A;  4J2F A;  3VFI A;  3LOR A;  1UN2 A;  2V2G A;  3Q6O A;  1WRY A;  4KX4 A;  3TJF A;  2CVK A;  3HKR A;  2FWE A;  2HRF A;  4L5L A;  2IIY A;  4K7I A;  4Q5Q A;  3KGK A;  1JZW A;  2C0D A;  1GTB A;  1A0R P;  2E0Q A;  4MLY A;  5HR0 A;  3FZ4 A;  3GL3 A;  3VPT A;  1FAA A;  1KTE A;  2HE3 A;  2DJK A;  3CTF A;  3ERF A;  3HXS A;  4QL7 A;  4YAV A;  2H66 A;  3DRN A;  3IRA A;  1XW6 A;  3GST A;  3HA9 A;  3DD3 A;  5IMA A;  2YWM A;  3IAM 2;  2R3X A;  4NHW A;  2H6Y A;  17GS A;  4TR0 A;  1QFN A;  2P5R A;  3MYD A;  4YQV A;  4XS4 A;  2GS3 A;  1SKW B;  4OCF A;  2FWF A;  4PUR A;  2O8V B;  5ECM B;  3QAG A;  5KN3 A;  4IW9 A;  4XRA A;  5LD0 A;  2LEG A;  2L6D A;  5CRD A;  1GL8 A;  3TCO A;  5HR1 A;  1B9Y C;  3LG6 A;  2F3M A;  2FLS A;  1QK8 A;  2NBS A;  1URM A;  3Q18 A;  3ZIT A;  2LJA A;  2OBI A;  3DVW A;  4EKZ A;  1NW2 A;  2AAW A;  3IE3 A;  2XC2 A;  5IM9 A;  5ELG A;  2LTK A;  5KOX A;  2TIR A;  4O5U A;  4JBB A;  2YV7 A;  2L5O A;  2VCW A;  2YV9 A;  1SL1 B;  5H5Q A;  4DSQ A;  4Z2U A;  1WPI A;  2B1L A;  2LNS A;  2WB9 A;  2GST A;  3TKS C;  4EXJ A;  5JCG A;  4HU7 A;  4MF6 A;  1SKS B;  4AGS A;  5HR3 A;  2WJU A;  4XTS A;  2IFQ A;  5JWQ B;  4EDZ A;  2IFQ B;  4RI7 A;  3CYN A;  3ZVJ D;  5D8I A;  1Y25 A;  2YPM A;  3KCM A;  3J7Y b;  3HD5 A;  4JR6 A;  5AIV A;  4WBR D;  5DCH A;  1XW5 A;  5FWG A;  2OAD A;  3A3T A;  3APO A;  4HS1 A;  2B3S A;  3BD2 A;  2FCH A;  2PUK C;  4EUY A;  1GSY A;  3ZZX A;  3TKS A;  1X5C A;  3R3E A;  1KBN A;  2L5L A;  4JR4 A;  4HJ2 A;  2HSM A;  4O92 A;  1ERV A;  4PGT A;  1Z5Y E;  1R26 A;  3EVI A;  3BCK A;  1TP9 A;  3UOM A;  3GL5 A;  1M9A A;  1T8E B;  2YNX A;  1X9W B;  2XBQ A;  2GGT A;  2TRC P;  2HNL A;  2PER A;  3GH6 A;  4XIH A;  4XS6 A;  5GAN D;  4OFM A;  3VK9 A;  4NHZ A;  3ZIJ A;  5B8B A;  3RAZ A;  4H86 A;  4TR1 A;  2L59 A;  5FT3 A;  2F8F A;  5J4U A;  4EO3 A;  4KSM A;  4AJ8 A;  5ECO B;  4MJC A;  4NPB A;  4EIQ A;  4KDY A;  3D22 A;  4POM A;  1ZYP A;  2QKE A;  1XXU A;  2LST A;  1Q98 A;  4GF0 A;  5CNW A;  5AGY A;  4K0N A;  5F07 A;  2H0I A;  4OD7 A;  4TVE A;  3QFA C;  1AXD A;  4KW6 A;  3GKM A;  3KM6 A;  2MYG A;  5IMC A;  5IO2 A;  5B6N A;  2HT9 A;  4F2I A;  3GH9 A;  1MDJ A;  2ZCT A;  1Q4J A;  2HXK A;  3FR6 A;  3RHB A;  2GSR A;  4BWQ A;  3CRU A;  3L9U A;  4ECB A;  2DML A;  2AV4 A;  5F05 A;  1IYH A;  2LRC A;  4PTS A;  3GMF A;  2WGR A;  1OAZ A;  2VUP A;  4KGI A;  2FHE A;  4MF5 A;  2ON7 A;  2WCI A;  4ZB8 A;  4GXZ A;  2Z9S A;  1TRU A;  18GS A;  3KP9 A;  5DQY A;  4USS A;  1EZK A;  2HRK A;  2QGV A;  3ZML A;  2MBS A;  4N30 A;  5HQP A;  1YF1 A;  5F0G A;  1WMJ A;  2L4C A;  3IC8 A;  2M80 A;  1SEN A;  4LLR A;  2C3T A;  5DAK B;  3UVH A;  4FYB A;  3DEX A;  2DJJ A;  2RLI A;  4E8H A;  4EC0 A;  3P90 A;  3TB2 A;  3DVX A;  3GHA A;  4L8E A;  2CVB A;  1QQ2 A;  4LL1 B;  5EPF A;  2IPA A;  1LBK A;  3FHK A;  4HQS A;  3EMP A;  2YCD A;  5CO3 A;  1XVW A;  3MSZ A;  13GS A;  3DIE A;  1SYR A;  2B5Y A;  5D9T A;  2A2S A;  5ID2 B;  1T7P B;  1VF2 A;  3E3E A;  3GSS A;  1OKT A;  3CRT A;  3L9V A;  2KOK A;  2WRT A;  1T3B A;  2X99 A;  2X8C A;  16GS A;  5EY6 A;  4V2L A;  2YWI A;  1J08 A;  4KE3 A;  1WJK A;  3D4M A;  1UC7 A;  2XBI A;  1K3Y A;  3IHQ A;  4A5P A;  1FO5 A;  2XHF A;  5G31 A;  3WGX A;  2K9F A;  1SU9 A;  1Z3E A;  3FRC A;  3UIW A;  4K1F A;  1PN0 A;  4DSS A;  4TKY A;  4CHS A;  1G6Y A;  2HLS A;  3C8E A;  4OMV A;  2YJH A;  2R2J A;  5D9W A;  1A0F A;  1GH2 A;  3IR4 A;  4QL9 A;  4IN0 A;  4KDU A;  3CBU A;  4BPY A;  1BED A;  2FY6 A;  5DCG A;  1G0T A;  1RK4 A;  2DKI A;  1U3I A;  3G9B A;  3TOT A;  2H6Z A;  1ZL9 A;  2KP2 A;  2ALB A;  5A4U A;  2H8L A;  3C1S A;  4XS1 A;  2GLR A;  2B6M A;  2CX4 A;  1SJI A;  5J3R A;  1GLQ A;  3GUR A;  1AAZ A;  4IJ3 A;  2PBJ A;  2TRX A;  2GZP A;  1YKC A;  3HZ4 A;  4Q5R A;  3FZ9 A;  4D73 A;  5AIS A;  4D73 B;  3M3M A;  5ECL B;  2VL3 A;  3VI7 A;  2K8V A;  2H0H A;  1K0M A;  1EWX A;  10GS A;  4MZC A;  3TUE A;  3EIN A;  2DIY A;  1GSD A;  4ZB9 A;  1ST9 A;  3GTU A;  2H30 A;  4NV2 A;  1YKA A;  2HSY A;  1JLV A;  3GTU B;  2H1D A;  4YAP A;  3P2A A;  3UL3 A;  3F6F A;  4TXV A;  3KTB A;  1V58 A;  4I2U A;  1IYI A;  3NZN A;  1A8Y A;  2IJY A;  4MP4 A;  5H5S A;  2C8U A;  4MZB A;  4LL4 B;  2A2R A;  2NPB A;  4KCA A;  2X8H A;  4LMV A;  2BJX A;  3LW9 A;  2B5X A;  2R0G A;  1ZYQ B;  1PD2 1;  3D0Z A;  1O8X A;  3I9V 2;  2C3N A;  4IS0 A;  3UMA A;  4RQR A;  3C71 A;  1OC3 A;  3UBK A;  5BRT A;  4I97 A;  6GSS A;  1AQX A;  2X64 A;  3H8Q A;  5DVB A;  4YH2 A;  1U88 A;  1R5P A;  6GSU A;  1GTI A;  2L4Q A;  3GNJ A;  3WGE A;  1SD9 A;  3C73 A;  1THO A;  3JCM L;  3KP8 A;  4POB A;  2VL9 A;  1R5A A;  4JRR A;  3VPQ A;  5D96 A;  4OO5 A;  3F4R A;  5G5E A;  1I9D A;  3I69 A;  1THX A;  3MAK A;  2P0G A;  2X4A A;  2V6O A;  2M72 A;  2LRT A;  4GWR A;  3HCZ A;  2WFC A;  20GS A;  4ID0 A;  1GP1 A;  1XIY A;  2JL4 A;  4IJI A;  2DLX A;  1PGT A;  3O6T A;  2ON5 A;  5ECR B;  2JSZ A;  2F51 A;  3GYK A;  4KSO A;  1I5G A;  4KAE A;  4IHU A;  2CQ9 A;  4N0Z A;  3ME8 A;  5IOX A;  2XPE A;  2H1B A;  3DXB A;  2OE1 A;  4GLT A;  4HZ2 A;  2GDR A;  4O7H A;  5G1K A;  3F8U A;  1F2E A;  3QOU A;  2GTU A;  2H73 A;  2ZUP A;  2FNO A;  2B1K A;  5GZZ B;  1XWB A;  2HFD A;  2N5B A;  2HSH A;  3IOS A;  4PNF A;  1NSW A;  3ZTL A;  3GX0 A;  4ICY A;  1HQO A;  4IP6 A;  1QXH A;  5AN1 A;  5IMD A;  4TXO A;  4JZQ A;  3O76 A;  6GSX A;  1GUH A;  4MPG A;  2GT6 A;  4XS4 B;  9GSS A;  1XWG A;  1XOA A;  1FHE A;  1ZCP A;  1GNW A;  4NMU A;  1BYE A;  1FVJ A;  1MTC A;  2JSY A;  4EE0 A;  2AHE A;  1OC8 A;  2VCQ A;  3US3 A;  1QMV A;  2C4J A;  5DJL A;  5CRH A;  1J9B A;  5DDL A;  5GSS A;  3W8S A;  5DAL A;  1QGV A;  1ZOF A;  2DMM A;  5LNK e;  2YN1 A;  3MDK A;  2DC5 A;  2GZY A;  4IBP A;  3WYW A;  5J5N A;  3F9U A;  2RII A;  2HYX A;  2PVQ A;  1EGO A;  1SJ6 A;  3FK8 A;  5EL8 A;  5L71 A;  2KHP A;  1TK0 B;  5B7C A;  4XCS A;  1YQ1 A;  1O7U A;  4N10 A;  2BMX A;  4KA0 A;  4IQA A;  3I6A A;  2VAF A;  1EP8 A;  5KN1 A;  2E7P A;  2MMZ A;  2A4H A;  2LNT A;  2V6K A;  3R2Q A;  4K0G A;  2VCZ A;  4I6X A;  4ZBA A;  1X5E A;  1Y6E A;  4K5R A;  2O87 A;  3KD0 A;  1BAY A;  8GSS A;  3IK9 A;  5GAP D;  1HYU A;  3EE2 A;  4WKW A;  3UBL A;  4NWY A;  3TKS E;  1PA3 A;  1UVZ A;  1M2A A;  3NIV A;  1V40 A;  2B5E A;  4K9Z A;  1K0C A;  2L6C A;  1CQH A;  4FYC A;  3GIX A;  1A8L A;  2V41 A;  3APQ A;  3HYP A;  5A5K A;  1B48 A;  2PN8 A;  3U5R E;  1X0R A;  1GRX A;  1JZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...