1X9WB

T7 dna polymerase in complex with a primer/template dna containing a disordered n-2 aminofluorene on the template, crystallized with dideoxy-atp as the incoming nucleotide.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
105
structure length
105
Chain Sequence
KIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/electron transport/dna
molecule keywords 5'-D(*GP*GP*AP*GP*AP*GP*TP*GP*AP*TP*T*GP*GP*T*AP*GP*TP*GP*TP
publication title Crystal structures of 2-acetylaminofluorene and 2-aminofluorene in complex with T7 DNA polymerase reveal mechanisms of mutagenesis.
pubmed doi rcsb
source organism Enterobacteria phage t7
total genus 28
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2004-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1x9wB00
5HR1A 4DSRA 3GFKA 3P8WA 4HZ2A 2LEGA 2C80A 2J23A 4IKHA 2NBSA 4K7NA 4ECJA 2IFQB 3U6VA 1O7UA 3VWXA 4K2DA 2YV9A 1GRXA 3ZFBA 1YQ1A 4K6XA 2FCHA 3GKKA 3F63A 4EDYA 1XWKA 5G2ZA 3KXOA 4XS6A 5GZZB 4KAEA 1TI1A 3GNJA 4PX1A 1ZMAA 1EGRA 5G30A 2GT6A 3TUEA 1M9BA 5DDLA 1SYRA 1U87A 4FH8A 5G1KA 4K7IA 3GIXA 5B6MA 2L6CA 3VK9A 1GULA 2K6VA 4K0NA 3O6TA 4LA1A 1GTBA 1XVQA 2GSRA 1K0DA 3UL3A 3APSA 2IMKA 4G2EA 5IPGA 4X1UA 3D5JA 1NSWA 2H74A 2F51A 5KEJA 2CZ2A 1GUHA 3LYPA 4F2IA 2DBCA 3GYKA 2ON7A 4I97A 3VPQA 2LQOA 1K3OA 5F06A 4MABA 2YZHA 4LMWA 5ELAA 1V58A 3LQ7A 11GSA 3ZIJA 2E2MA 3ERWA 4TW5A 4YQVA 1O8XA 2FY6A 4GTUA 1TW9A 4N0VA 4KW6A 4HQZA 2P5QA 1GSFA 2GSTA 4J57E 5IMAA 4ZL9A 3D0ZA 2WULA 1QXHA 2GQLA 2IPAA 4GLTA 5IIZA 3HVXA 3G9BA 3Q74A 5DAKA 5ECHB 5AISA 4GSSA 1GWCA 2WJUA 5ELGA 4XTSA 2YJ7A 1X5DA 4RQXA 3WGDA 2RUEA 4NV2A 2FHEA 1RW1A 6GSSA 3WT2A 5IM9A 3LYKA 5CRHA 1OYJA 2VL2A 4PGTA 1XOBA 2V6KA 3CTFA 2DMLA 2DC5A 2H1AA 3K8NA 4GWRA 2Z9SA 2HZEB 5ID2A 1OC3A 3EURA 2D2ZA 5A4VA 5D9TA 3LORA 1OC9A 5IO2A 4MP4A 1AUCA 2VCXA 4WR5A 4EKZA 3PINA 5D8IA 5CO3A 2HNLA 1QGVA 1XW5A 4YAPA 5A4UA 1VF1A 1BX9A 1KTEA 3KEBA 4XS4B 4GXZA 1TXXA 1V57A 3KP8A 4I8BA 2NDOA 1S3DA 6GSUA 2VL3A 1ERTA 1NM3A 1WPIA 3MAKA 3J7Yk 3KMNA 1TDIA 1SK2A 2LUSA 3LXTA 3QR6A 1WOUA 5DVBA 3LGCA 4OFNA 1A24A 1K0MA 3QAGA 2EIQA 1EWXA 4ZB8A 1PA3A 2PU9C 2PMTA 2A2SA 2DJKA 4Q5NA 2X99A 2GGTA 4MH3A 4MF7A 1R5AA 1HYUA 1EOHA 5D9XA 3M9KA 1AQVA 1F3AA 5ECSA 4XIHA 1XWBA 3CYNA 4ECIA 2H0HA 2HRNA 4EL1A 2EC4A 1FB6A 2VO4A 4ZILA 1VGLA 3VI5A 5IMVA 3TOTA 3BCIA 1M7TA 3A5WA 3KTBA 1ZZYA 5CRWA 1Y25A 3C73A 3TKSA 3ZFLA 4YH2A 3LFLA 5ECRB 2YWOA 3HVSA 1AIUA 2N5FA 5J41A 2O85A 1T8EB 4TR4A 5L71A 1O85A 1WJKA 3EC3A 1M0UA 22GSA 2VAFA 1PD21 2VL9A 3RPNA 4ZL8A 4PNFA 5LNKe 1OKTA 5KN3A 5G5FA 4OMVA 1Z7PA 2P0GA 1DUGA 2B7KA 4I2UA 3VPTA 2WRTA 1UC7A 3I6AA 4Q5FA 1Z3EA 5CREA 2IMFA 5HFIA 4WBRD 1SK1A 4NWYA 2FWGA 9GSSA 5JWOB 1KBNA 5A5KA 3EMPA 1M2DA 3TGZA 2ALBA 1U6TA 1F3BA 1EV9A 2AHEA 5DALA 1KNGA 4TR1A 4D73B 3TOUA 2CAQA 1XW6A 2YOIA 1G0TA 2CX3A 4POLA 4CHSA 2GZPA 2EIRA 2CAIA 2X8CA 4EXJA 2A4VA 1G7OA 1I5GA 2MMNA 3IA1A 1XCCA 1TU7A 3CRUA 1EP7A 4P3YB 4HUAA 4WF4A 3IBHA 3IK9A 4LL1B 2EIOA 2N5BA 2L4CA 3QDNA 5C00A 4L0UA 4FYBA 1SJ6A 4HZ4A 4BVYA 5ENUA 1G7EA 3KJYA 1SL1B 5DCGA 3HJPA 2K8SA 4D73A 1WP0A 4TXOB 1ZYQB 1XW9A 4WETA 4TRXA 1HNBA 2V32A 1HQOA 1USBA 4EUYA 1GTIA 1HD2A 1QFNA 2OJLA 1PMTA 1V40A 3L9SA 3FYGA 4IJIA 2C0DA 1QMVA 2E7PA 2LRCA 1SKWB 1BQ7A 4HJ2A 1TK5B 1V98A 2KUCA 2I3YA 2F8AA 3H8QA 5F0GA 3L0HA 2A2RA 2G2QA 4IVFA 5F05A 10GSA 4ACSA 4AJ6A 2FUG2 4K8MA 5GSTA 3U5RE 2LJRA 3I9V2 3TKPA 1CQGA 1THXA 2JZRA 4V1Ag 4MZBA 3HD5A 1ILOA 4JU5A 1XBSA 3WYWA 1VF3A 1V2AA 4MLYA 1U3AA 1YZXA 1SD9A 2FLSA 2KP2A 2L4QA 1JHBA 1OKDA 1SENA 2C0EA 2OKAA 2F9SA 3EWLA 4TR0A 2BTOT 5GSSA 1Y6EA 1NHYA 2OACA 1TTZA 1EOGA 2HE3A 1TK8B 3HKRA 3ZMLA 3TJFA 2B1KA 4ZL7A 5HR0A 3OR5A 3ERFA 3TKRA 2VCZA 4HU9A 3F3RA 2YN1A 3DD3A 2CT6A 4KCEA 3G7IA 1LJRA 2V1MA 1B8XA 3MDKA 5LD0A 3GL5A 2AV4A 4V2LA 3FR6A 5EPFA 1GP1A 20GSA 4IQ1A 3LWAA 4ZBDA 5F8BA 4KH7A 1O81A 3D6IA 2M80A 3F0IA 1K0NA 2VLVA 2GLRA 3NZNA 2JU5A 2AUVA 3MSZA 4OCEA 3APOA 2XBIA 1M9AA 1ABAA 3TJKA 1FW1A 1R5PA 2OA7A 1B4PA 2XC2A 4OD7A 2PPTA 1GSEA 3PR8A 3CBUA 2PVQA 1JLVA 3IE3A 3GUSA 2CX4A 2JSZA 4MDCA 5ECNB 3UEMA 1QUWA 3FRCA 1WMJA 3IR4A 1M2BA 2H8LA 5JWRB 1PGTA 16GSA 2V6OA 1ZCPA 1GTUA 4GQFA 5AGYA 3IHQA 2VCTA 3ZVJD 2H71A 1A0FA 5ECLB 3F4RA 1AAZA 4PUFC 3EINA 4L5LA 2K8VA 4F9ZA 2VLUA 2CZ3A 4MJBA 2OBKA 4BVXA 3QMXA 1YF0A 1X9SB 1XIYA 3DVXA 4I6XA 2TRXA 3QD9A 3TB2A 5CRDA 3FEUA 3M0FA 2LJKA 3DMLA 4QL9A 1PL1A 3A2XA 2CA8A 1PSQA 1M99A 3ERGA 2RM5A 2H1GA 3TDGA 3CXGA 3C71A 4ML6A 2M46A 4X0XA 3M8NA 1K0CA 1FAAA 4XRDA 3GA4A 2IFQA 2GT5A 3TKQA 3WGEA 3IXRA 5KN1A 1GTAA 2JZTA 4EVMA 1GLPA 2PGTA 4GCIA 2FGXA 1TOFA 3AY8A 4K1FA 2VOCA 3BOAA 5B8BA 2XPDA 2MMZA 4POKA 5AN1A 5G1LA 2YWMA 2LQQA 3ZMKA 1RK4A 2R4VA 4AGSA 2X8HA 1BJXA 4F0CA 2IMEA 4IN0A 2C3TA 1OAZA 1UA5A 2LJAA 3G7JA 3GN3A 2R2JA 2WFCA 4NV5A 1K0OA 5EY6A 4HOJA 4I2TA 3IC4A 4LL4B 3EMXA 3DEXA 5J9BA 2FWFA 4AJ7A 4BPYA 2JADA 5EL8A 2ZUPA 1Z9HA 5J9CA 2PVOC 3DWVA 1TRSA 4X43A 4CDOA 3JCML 1SJIA 2C0GA 4KDUA 5ECIB 5CRGA 1VF4A 4KDXA 5HFGA 4DVCA 2HLSA 3F4TA 3KD0A 2GSSA 2MZCA 2VL2C 1AQWA 4ZB9A 1LU4A 5D9WA 2H6ZA 2CVDA 3FHKA 3H4KA 5FHIA 4GSNA 3KGKA 4GSTA 1A8LA 1MDKA 2H70A 1EP8A 2WGRA 2LRNA 1UVZA 3WGXA 3BD2A 1ON4A 2H6YA 2ES7A 1T7PB 4MF6A 4LLRA 1LBKA 2R3XA 1KEBA 5B8AA 3VFIA 5H5SA 1A8YA 2YZUA 4NMUA 1K3YA 3P90A 2V41A 4ZXGA 3GL3A 1WRYA 2I4AA 2L5OA 3RPPA 2WCIA 1ERVA 2OBIA 5IMCA 3J7Yb 1NHOA 1PRXA 2B5XA 6GSXA 3S9FA 2IMIA 5DBQA 2L5LA 2HYXA 1YKAA 5J5NA 1ZL9A 3VURA 1XFLA 2HZEA 1B48A 4MZCA 3DVWA 12GSA 3ZZXA 2OADA 5J3RA 2K9FA 4BWSA 4E8HA 4MF5A 4TR3A 3UJ1A 2I81A 2B5YA 4F82A 2GVPA 3I43A 3UIWA 3VWVA 4XS4A 3TCOA 4EDZA 4DSSB 2GTUA 3VLNA 5GAPD 1SU9A 2C3NA 1IYHA 2N5AA 5IPHA 3LEFA 2B3SA 3KH7A 3R2QA 3TKSC 1FB0A 13GSA 4PQIA 1B9XC 2X64A 3E3EA 3ZITA 4OO4A 2L57A 4OWYA 2DIYA 4IJ3A 5CNWA 2DSAA 3C1SA 3D4MA 3PGTA 1J08A 3I69A 1GH2A 3O76A 2P5RA 1SKRB 3CMIA 4O32A 3ME7A 4ECBA 2GS3A 2FNOA 3GV1A 3FR9A 3QAVA 4IELA 4Q5RA 1URMA 2R5GA 2H66A 1SL2B 2H0IA 3IDVA 1Z6NA 1Z7RA 5G5EA 2AAWA 1FO5A 2J9HA 1R7HA 1F9MA 1XWAA 2JACA 2OE0A 1FOVA 1T1VA 1ST9A 4Z7XA 4TN8A 4PXOA 3V1WA 5KN0A 2DJ2A 3L78A 1AQXA 4EE0A 2YPMA 4XHMA 2WDUA 4RQRA 4PUAA 1EV4A 2P31A 1PKZA 1Z6MA 2VLTA 1FVJA 3ZLPA 1BG5A 1N8JA 5D93A 2WB9A 3DKSA 4PNGA 4KA0A 4QL7A 2R6KA 2QGVA 4OO5A 4IW9A 4HI7A 1H4OA 1ERWA 3GURA 1I9DA 2B1LA 4L8EA 2KHPA 4XS1A 1U3IA 1VRSD 2O7KA 1FG4A 3GTUB 3APQA 2C8UA 2F8FA 5JCWA 5IMFA 3LG6A 3MWHA 3W8JA 1W4VA 1QQ2A 2VCWA 1XZOA 2RLIA 4V1Ap 1DSBA 4GF0A 4YQUA 3P7XA 4WR4A 2AYTA 4POBA 1FVKA 3HJOA 1G6YA 4KSMA 1SK0A 3D22A 2LSTA 2KLXA 2CVKA 3F6FA 5G31A 4N0ZA 3CTGA 3KM6A 3RBTA 4NXIA 3HY2A 3KCMA 3M9JA 3GX8A 4J56E 3QFBC 4WF5A 1ZOFA 5ABRA 3ED3A 4NHZA 4L5OA 1GLQA 2B5EA 4TXOA 2ON5A 1GSUA 5D96A 4MCUA 3FY7A 3GSTA 3QAWA 5KN2A 1JZDA 1AXDA 2O87A 3C8EA 4JR4A 2WZ9A 4JZQA 5GAND 2DLXA 1CQHA 1TRUA 1ZYEA 1TJDA 2LNTA 1OVNA 5D73A 1S3AA 3Q18A 1X5CA 1JLWA 2LRTA 4IBPA 2TRCP 3GSSA 3F9UA 1GSQA 4HQSA 4KGIA 5JCGA 3PH9A 4EO3A 1SYXA 2C3QA 4HS1A 18GSA 1THOA 5DQYA 3HZ4A 2I1UA 2VD0A 3ZRDA 1DE1A 3WD6A 2RIIA 1TRVA 3LJRA 3O3TA 4GRFA 5DQSA 3TRXA 4RI7A 2H73A 4ZBAA 3ZVJA 2JSYA 5COHA 4H86A 3FZ5A 2H75A 1X0RA 3BBYA 2VIMA 5IOWA 3ZL5A 4K7OA 3VWUA 4V2NA 5IMDA 4BWQA 2E0QA 5AIXA 3A2WA 2FWEA 1GNEA 3HVVA 1C72A 4J2FA 1EZKA 1MDIA 3L9UA 4POMA 5JCUA 2FWHA 2R37A 3GH6A 4IP6A 4FO5A 2DJ1A 2K18A 3DYRA 2E2GA 3EVIA 4G19A 4MH2A 3EU3A 3UBLA 3FW2A 5ECPB 3C7MA 3VI7A 2BMXA 1JZRA 3E0UA 3KH9A 5ECOB 5D9VA 1SJZA 2XPEA 5HR3A 19GSA 1H75A 4WEYA 1XWCA 2IL3A 1GNWA 1VF2A 4KCAA 5HQPA 2H72A 5CAXA 2JL4A 5J4UA 5ECKB 4MPFA 4ILFA 2LTKA 1J9BA 4MPGA 3IAM2 3IK7A 3FZ4A 3BCKA 3GH9A 3FZAA 1GL8A 1A2JA 2H1BA 4CW9A 4JE1A 1YEPA 4OFTA 3Q19A 3W8SA 1O8WA 2IWTA 2MYGA 4N11A 1MTCA 2FA8A 2MBTA 1EEMA 5DCHA 1EGOA 1OE7A 2CQ9A 5ECMB 5B6NA 3L9VA 1GSYA 3D21A 5DAKB 1S3CA 1QK8A 2RM6A 3GX0A 2HT9A 1R4WA 3CRTA 4O5RA 3N5OA 7GSSA 1EEJA 2CVBA 4V2MA 1T4ZA 2GSQA 3TJJA 4GQCA 2NPBA 2YWIA 5AIVA 2PN8A 3P2AA 1BEDA 4JBBA 2GQMA 4IP1A 2DJ0A 4F03A 1HNCA 3KP9A 2V2GA 5ID2B 2GZYA 4AJ8A 17GSA 1PN9A 2GDRA 4ID0A 4OCFA 1OC9B 4HEA2 4FYCA 1OC8A 2OE1A 2O89A 2LKUA 2PBJA 3US3A 3CSJA 3UOMA 2DJ3A 3UBKA 3ISOA 2REMA 4ZB6A 5A4WA 1WIKA 4ISDA 2O8VB 2YNXA 4KSOA 3TRQA 4PQ1A 4KNDA 1OE8A 4PURA 4TOPA 1YF1A 2BJXA 1M2AA 2YCDA 3IOSA 2XBQA 4FYUA 2B6MA 2ZCTA 1G6WA 3HZ8A 4KB3A 5LCZA 4WBJA 5DJMA 3FZ9A 3WT1A 3F6DA 1A2MA 2LNSA 3H93A 5CYYA 2HI7A 1ZGNA 1GUMA 1TI3A 1JZWA 3Q6OA 3QCPA 4MK3A 2LV3A 1ERUA 1R26A 3UMAA 2VM2A 2VD1A 1TRWA 3N9JA 4WXTA 4N30A 2C0FA 2YWNA 1U88A 3CSIA 2WS2A 1YEXA 6GSTA 4KUNA 2MBSA 4E8EA 4RI6A 1GSDA 2HFDA 5IQYA 4ULXA 4KX4A 14GSA 2X8GA 3HXSA 1O73A 1O6JA 1ML6A 4QQ7A 1K0AA 3L4NA 4ML1A 4NPBA 1X9MB 1WWJA 4KDYA 4K9ZA 3LSZA 1XVWA 3G7YA 1K3LA 2HRFA 2KP1A 5ECQB 1DBYA 3F3QA 4MJCA 5E4WA 1PQNA 2FD3A 2QSIA 3IAS2 1UN2A 3EU4A 2IJYA 3F4SA 3KMOA 1X5EA 4O92A 1XWGA 3KTLA 4HU7A 3FKFA 2HXKA 4IS0A 3IRAA 3FK8A 3RHCA 4MJAA 3E9JB 3M3MA 3HCZA 2IMDA 5DALB 1AC1A 2YP6A 1XXUA 3H1NA 4TR1B 3ZREA 5FWGA 4DSSA 4OFMA 4BL7A 3UVHA 3A3TA 3H79A 4NAXA 3DGQA 1DE2A 2L6DA 5B7CA 5CP1A 4ZBBA 4JRRA 3LXZA 1PL2A 1TK0B 1YDKA 1V9WA 3EE2A 5H5RA 4YAVA 3EYTA 2HSYA 2M72A 3GKMA 4G9HA 2H0GA 2ZNMA 2JZSA 4MMMA 1SD8A 1TP9A 2PERA 3HYPA 4ZIJA 4L0WA 2YV7A 8GSSA 3GHAA 2H1DA 4RUVA 3HHVA 1BYEA 3KIJA 4DSQA 5HFKA 3C1RA 4XRAA 1T3BA 2AJQB 2H30A 4XCSA 1N2AA 5IOXA 1E6BA 5HR2A 2I9HA 1A2LA 6GSWA 3D4TA 2RUFA 3SWLA 2VUPA 1IYIA 4TXVA 2B7JA 1A0RP 4ECCA 2XHFA 1TKDB 4BA7A 1JZOA 4O7HA 3DIEA 1YJ6A 1MD4A 2MMAA 1SL0B 1AW9A 3DRNA 2NVLA 1T4YA 3NIVA 1GUKA 3HJMA 2PUKC 1RQMA 1FHEA 2DJJA 2OE3A 3HDCA 3TKSE 2GZZA 3GMFA 2PWJA 4JEDA 2H19A 5E59A 1MD3A 4I5QA 3F8UA 4IHUA 2F3MA 4AF2A 4EC0A 3RDWA 2QKEA 4KE3A 6GSVA 4MA9A 6GSYA 1B4QA 3ZTLA 2TIRA 4FIWA 4IGJA 4YQMA 4IQAA 2MMOA 3GTUA 1X9WB 1HNAA 4K0GA 3MNGA 2YJHA 1YY7A 1NW2A 4PQHA 3DXBA 3W6GA 5IO0A 1Z5YE 4N10A 4LMVA 4G10A 2NTOA 1SKSB 3GKNA 2H01A 3ZIVA 3VWWA 2HZFA 5DJLA 3ZYWA 3BJ5A 2DMMA 4HJMA 2GQKA 3TRPA 2L59A 5H5QA 3KZQA 1JFUA 1BAYA 2QC7A 4MZWA 2VCQA 4DEJA 1Q98A 2H76A 2IIYA 1WE0A 3IV4A 4TKYA 1PX7A 1W89A 2C4JA 4NHWA 3RHBA 5FT3A 1MEKA 3TJBA 1PX6A 3TJGA 5IMZA 1XPVA 1E2YA 1T00A 1TU8A 4HDEA 2VM1A 3CSHA 1F2EA 1A23A 3UARA 1B9YC 1YKCA 1J0FA 1MDJA 3QPMA 4TVEA 3IPZA 2AB6A 4F0BA 4MJEA 2HSHA 3M1GA 4EF0A 2KOKA 3GRXA 1Q4JA 3UAPA 2DIZA 3UVTA 5JWQB 1K0BA 3QFAC 3A2VA 3ME8A 3NOFA 2H6XA 3QOUA 5INYA 1PKWA 2CV4A 1GSSA 1ACVA 5EVOA 3FR3A 2VCVA 2YANA 1XOAA 3GKXA 4WKWA 5C04A 4Q5QA 3RAZA 5F07A 3HA9A 2FA4A 1F6MC 2LS5A 1F37A 2IN3A 3SBCA 2G0FA 4JR6A 2C1YA
chains in the Genus database with same CATH superfamily
5HR1A 4DSRA 3GFKA 3P8WA 4HZ2A 2LEGA 2C80A 2J23A 4IKHA 2NBSA 4K7NA 4ECJA 2IFQB 3U6VA 1O7UA 3VWXA 4K2DA 2YV9A 1GRXA 3ZFBA 1YQ1A 4K6XA 2FCHA 3GKKA 2X4AA 3F63A 4EDYA 1XWKA 5G2ZA 3KXOA 4XS6A 5GZZB 4KAEA 1TI1A 3GNJA 4PX1A 1ZMAA 1EGRA 5G30A 2GT6A 3TUEA 1M9BA 5DDLA 1SYRA 1U87A 4FH8A 5G1KA 4K7IA 3GIXA 5B6MA 2L6CA 3VK9A 1GULA 2K6VA 4K0NA 3O6TA 4LA1A 1GTBA 1XVQA 2GSRA 1K0DA 1M3JA 3UL3A 3APSA 2IMKA 4G2EA 5IPGA 4X1UA 3D5JA 1NSWA 2H74A 2F51A 5KEJA 2CZ2A 1GUHA 1ZYPA 3LYPA 4F2IA 2DBCA 3GYKA 2ON7A 4I97A 3VPQA 2LQOA 1K3OA 5F06A 4MABA 2YZHA 4LMWA 5ELAA 1V58A 3LQ7A 11GSA 3ZIJA 2E2MA 3ERWA 4TW5A 4YQVA 1O8XA 2FY6A 4GTUA 2QA1A 1TW9A 4N0VA 4KW6A 4HQZA 2P5QA 1GSFA 2GSTA 4J57E 5IMAA 4ZL9A 3D0ZA 2WULA 1QXHA 2GQLA 2IPAA 4GLTA 5IIZA 3HVXA 3G9BA 3Q74A 5DAKA 5ECHB 5AISA 4GSSA 1GWCA 2WJUA 5ELGA 4XTSA 2YJ7A 1X5DA 4RQXA 3WGDA 2RUEA 4NV2A 2FHEA 1RW1A 6GSSA 3WT2A 5IM9A 3LYKA 5CRHA 1OYJA 2VL2A 4PGTA 1XOBA 2V6KA 3CTFA 2DMLA 2DC5A 2H1AA 3K8NA 4GWRA 2Z9SA 2HZEB 5ID2A 1OC3A 3EURA 2D2ZA 5A4VA 5D9TA 3LORA 1OC9A 5IO2A 4MP4A 1AUCA 2VCXA 4WR5A 4EKZA 3PINA 5D8IA 5CO3A 2HNLA 1QGVA 1XW5A 4YAPA 5A4UA 1VF1A 1BX9A 1KTEA 3KEBA 4XS4B 4GXZA 1TXXA 1V57A 3KP8A 4I8BA 2NDOA 1S3DA 6GSUA 2VL3A 1ERTA 1NM3A 1WPIA 3MAKA 3J7Yk 3KMNA 1TDIA 1SK2A 2LUSA 3LXTA 3QR6A 1WOUA 5DVBA 3LGCA 4OFNA 1ZYNA 1A24A 1K0MA 3QAGA 2EIQA 1EWXA 4ZB8A 1PA3A 2DKIA 2PU9C 2PMTA 2A2SA 2DJKA 4Q5NA 2X99A 2GGTA 4MH3A 4MF7A 4Z2RA 1R5AA 2HSMA 1HYUA 1EOHA 5D9XA 3M9KA 1AQVA 1F3AA 5ECSA 4XIHA 1XWBA 3CYNA 4ECIA 2H0HA 2HRNA 4EL1A 2EC4A 1FB6A 2VO4A 4ZILA 1VGLA 3VI5A 5IMVA 3TOTA 3BCIA 1M7TA 3A5WA 3KTBA 1ZZYA 5CRWA 1Y25A 3C73A 3TKSA 3ZFLA 4YH2A 3LFLA 3FMWA 5ECRB 2YWOA 3HVSA 1AIUA 2N5FA 5J41A 2O85A 1T8EB 4TR4A 5L71A 1O85A 1WJKA 3EC3A 2QA2A 1M0UA 22GSA 2VAFA 1PD21 2VL9A 3RPNA 4ZL8A 4PNFA 5LNKe 1OKTA 5KN3A 5G5FA 4OMVA 1Z7PA 2P0GA 1DUGA 4KF9A 2B7KA 4I2UA 3VPTA 2WRTA 1UC7A 3I6AA 4Q5FA 1Z3EA 5CREA 2IMFA 5HFIA 4WBRD 1SK1A 4NWYA 2FWGA 9GSSA 5JWOB 1KBNA 5A5KA 3EMPA 1M2DA 4EIQA 3TGZA 2ALBA 1U6TA 4YKGA 1F3BA 1EV9A 2AHEA 5DALA 1KNGA 4TR1A 4D73B 3TOUA 2CAQA 1XW6A 2YOIA 1G0TA 2CX3A 4POLA 4CHSA 2GZPA 2EIRA 2CAIA 2X8CA 4EXJA 2A4VA 1G7OA 1I5GA 2MMNA 3IA1A 1XCCA 1TU7A 3CRUA 1EP7A 4P3YB 4HUAA 4WF4A 3IBHA 3IK9A 3MYDA 4LL1B 2EIOA 2N5BA 2L4CA 3QDNA 5C00A 4L0UA 4FYBA 1SJ6A 4HZ4A 4BVYA 5ENUA 1G7EA 3KJYA 1SL1B 1XG8A 5DCGA 3HJPA 2K8SA 4D73A 1WP0A 4TXOB 1ZYQB 1XW9A 4WETA 4TRXA 1HNBA 2V32A 1HQOA 1USBA 4EUYA 1GTIA 1HD2A 1QFNA 2OJLA 1PMTA 1V40A 3L9SA 3FYGA 4IJIA 2C0DA 1QMVA 2E7PA 2LRCA 1SKWB 1BQ7A 4HJ2A 3HVNA 1TK5B 1V98A 2KUCA 3IHGA 2I3YA 2F8AA 3H8QA 5F0GA 3L0HA 2A2RA 2G2QA 4IVFA 5F05A 10GSA 4ACSA 4AJ6A 2FUG2 4K8MA 5GSTA 3U5RE 2LJRA 3I9V2 3TKPA 1CQGA 1THXA 2JZRA 4V1Ag 4MZBA 3HD5A 1ILOA 4JU5A 1XBSA 3WYWA 1VF3A 1V2AA 4MLYA 1U3AA 1YZXA 1SD9A 2FLSA 2KP2A 2L4QA 1JHBA 1OKDA 1SENA 2C0EA 2OKAA 2F9SA 3EWLA 4TR0A 2BTOT 5GSSA 1Y6EA 1FOHA 1NHYA 2OACA 3A5IA 1TTZA 1EOGA 2HE3A 1TK8B 3HKRA 3ZMLA 3TJFA 2B1KA 4ZL7A 5HR0A 3OR5A 3ERFA 3TKRA 2VCZA 4HU9A 3F3RA 2YN1A 3DD3A 2CT6A 4KCEA 3G7IA 1LJRA 2V1MA 1B8XA 3MDKA 5LD0A 3GL5A 2AV4A 4V2LA 4CY6A 3FR6A 3PPUA 5EPFA 1GP1A 20GSA 4IQ1A 3LWAA 4ZBDA 5F8BA 4KH7A 1O81A 3D6IA 2M80A 3F0IA 1K0NA 2VLVA 2GLRA 3NZNA 2JU5A 2AUVA 3MSZA 4OCEA 3APOA 2XBIA 1M9AA 1ABAA 3TJKA 1FW1A 1R5PA 2OA7A 1B4PA 2XC2A 5KOWA 4OD7A 2PPTA 1GSEA 3PR8A 3CBUA 2PVQA 1JLVA 3IE3A 3GUSA 2CX4A 2JSZA 4MDCA 5ECNB 3UEMA 1QUWA 3FRCA 1WMJA 3IR4A 1M2BA 2H8LA 5JWRB 1PGTA 16GSA 2V6OA 1ZCPA 1GTUA 4GQFA 5AGYA 3IHQA 2VCTA 3ZVJD 2H71A 1A0FA 5ECLB 3F4RA 1AAZA 4PUFC 3EINA 4L5LA 2K8VA 4F9ZA 2VLUA 2CZ3A 4MJBA 2OBKA 4BVXA 3QMXA 1YF0A 1X9SB 1XIYA 3DVXA 4I6XA 2TRXA 3QD9A 3TB2A 5CRDA 3FEUA 3M0FA 2LJKA 3DMLA 4QL9A 1PL1A 3A2XA 2CA8A 1PSQA 1M99A 3ERGA 2RM5A 2H1GA 3TDGA 3CXGA 3C71A 4ML6A 2M46A 4X0XA 3M8NA 1K0CA 1FAAA 4XRDA 3GA4A 2IFQA 2GT5A 3TKQA 2HRAA 3WGEA 3IXRA 4HSCX 4G0KA 5KN1A 1GTAA 2JZTA 4EVMA 1GLPA 2PGTA 4GCIA 2FGXA 1TOFA 3AY8A 4K1FA 2VOCA 3BOAA 5B8BA 2XPDA 2MMZA 4POKA 5AN1A 5G1LA 2YWMA 2LQQA 3ZMKA 1RK4A 2R4VA 4AGSA 2X8HA 1BJXA 4F0CA 2IMEA 4IN0A 2C3TA 1OAZA 1UA5A 2LJAA 3G7JA 3GN3A 2R2JA 2WFCA 4NV5A 1K0OA 5EY6A 4HOJA 4I2TA 2A4HA 3IC4A 4LL4B 3EMXA 3DEXA 5J9BA 2FWFA 4AJ7A 4BPYA 2JADA 5EL8A 2ZUPA 1Z9HA 5J9CA 2PVOC 3DWVA 1TRSA 4X43A 4CDOA 3JCML 1SJIA 2C0GA 4KDUA 5ECIB 5CRGA 1VF4A 4KDXA 5HFGA 4DVCA 2HLSA 3F4TA 3KD0A 2GSSA 2MZCA 2VL2C 1AQWA 4ZB9A 1LU4A 5D9WA 2H6ZA 2CVDA 3FHKA 3H4KA 5FHIA 4GSNA 3KGKA 2R0CA 4GSTA 1A8LA 1MDKA 2H70A 1EP8A 2WGRA 2LRNA 1UVZA 3WGXA 3BD2A 1ON4A 2H6YA 2ES7A 1T7PB 4MF6A 4LLRA 1LBKA 2R3XA 1KEBA 5B8AA 3VFIA 5H5SA 1A8YA 2YZUA 4NMUA 1K3YA 3P90A 2V41A 4ZXGA 3GL3A 1WRYA 2I4AA 2L5OA 4X4JA 3RPPA 2WCIA 4A5PA 1ERVA 2OBIA 5IMCA 3J7Yb 1NHOA 1PRXA 2B5XA 6GSXA 3CQFA 3S9FA 2IMIA 5DBQA 2L5LA 2R0GA 2HYXA 1YKAA 5J5NA 1ZL9A 3VURA 1XFLA 2HZEA 1B48A 4MZCA 3DVWA 12GSA 4Z2TA 3ZZXA 2OADA 5J3RA 2K9FA 4BWSA 4E8HA 4MF5A 4TR3A 3UJ1A 2I81A 2B5YA 4F82A 2GVPA 3I43A 3UIWA 3VWVA 4XS4A 3TCOA 4EDZA 4DSSB 2GTUA 3VLNA 5GAPD 3MIXA 1SU9A 2C3NA 4BL7B 1IYHA 2N5AA 5IPHA 3LEFA 2B3SA 3KH7A 2HRKA 3R2QA 3TKSC 1FB0A 13GSA 4PQIA 1B9XC 2X64A 3E3EA 3ZITA 4G0IA 4OO4A 2L57A 1PN0A 4OWYA 2DIYA 4IJ3A 5CNWA 2DSAA 3C1SA 3D4MA 3PGTA 1J08A 3I69A 1GH2A 3O76A 2P5RA 1SKRB 2X49A 3CMIA 4O32A 3ME7A 4ECBA 2GS3A 2FNOA 4K5SA 3GV1A 3FR9A 3QAVA 4IELA 4Q5RA 1URMA 2R5GA 2H66A 1SL2B 2H0IA 3IDVA 3EPTA 1Z6NA 1Z7RA 5G5EA 2AAWA 1FO5A 2J9HA 1R7HA 1F9MA 1XWAA 2JACA 2OE0A 1FOVA 1T1VA 1ST9A 4Z7XA 4TN8A 4PXOA 3V1WA 5KN0A 2DJ2A 3L78A 1AQXA 4EE0A 2YPMA 4XHMA 2WDUA 4RQRA 4PUAA 1EV4A 2P31A 1PKZA 1Z6MA 2VLTA 1FVJA 3ZLPA 1BG5A 1N8JA 5D93A 2WB9A 3DKSA 4PNGA 4KA0A 4QL7A 2R6KA 2QGVA 4OO5A 4IW9A 4HI7A 1PFOA 1H4OA 1ERWA 3GURA 1I9DA 2B1LA 4L8EA 2KHPA 4XS1A 1U3IA 1VRSD 2O7KA 1FG4A 3GTUB 3APQA 2C8UA 2F8FA 5JCWA 5IMFA 3LG6A 3MWHA 3W8JA 1W4VA 1QQ2A 2VCWA 1XZOA 2RLIA 4V1Ap 1DSBA 4GF0A 4YQUA 3P7XA 4WR4A 2AYTA 4POBA 1FVKA 3HJOA 1G6YA 4KSMA 1SK0A 3D22A 2LSTA 2KLXA 2CVKA 3F6FA 5G31A 4N0ZA 3CTGA 3KM6A 3RBTA 4NXIA 3HY2A 3KCMA 3M9JA 3GX8A 4J56E 3QFBC 4WF5A 1ZOFA 5ABRA 3ED3A 4NHZA 4L5OA 1GLQA 2B5EA 4TXOA 2ON5A 1GSUA 5D96A 4MCUA 3FY7A 3GSTA 3QAWA 5KN2A 1JZDA 1AXDA 2O87A 3C8EA 4JR4A 2WZ9A 4JZQA 5GAND 2DLXA 1CQHA 1TRUA 1ZYEA 1TJDA 2LNTA 1OVNA 5D73A 1S3AA 3Q18A 1X5CA 1JLWA 2LRTA 4IBPA 2TRCP 3GSSA 3F9UA 1GSQA 4HQSA 4KGIA 5JCGA 3PH9A 4EO3A 1SYXA 2C3QA 4HS1A 18GSA 1THOA 5DQYA 3HZ4A 2I1UA 2VD0A 3LW9A 4YKFA 3ZRDA 1DE1A 3WD6A 2RIIA 1TRVA 3LJRA 3O3TA 4GRFA 5DQSA 3TRXA 4RI7A 2H73A 4ZBAA 3ZVJA 2JSYA 5COHA 4H86A 3FZ5A 2H75A 1X0RA 3BBYA 2VIMA 5IOWA 3ZL5A 4K7OA 3VWUA 4V2NA 5IMDA 4BWQA 2E0QA 5AIXA 3A2WA 2FWEA 1GNEA 3HVVA 1C72A 4J2FA 1EZKA 1MDIA 3L9UA 4POMA 5JCUA 2FWHA 2R37A 3GH6A 4IP6A 4FO5A 2DJ1A 2K18A 3DYRA 2E2GA 3EVIA 4G19A 4MH2A 3EU3A 3UBLA 3FW2A 5ECPB 3C7MA 3VI7A 2BMXA 1JZRA 1M3IA 3E0UA 3KH9A 5ECOB 5D9VA 1SJZA 2XPEA 5HR3A 19GSA 1H75A 4WEYA 1XWCA 2IL3A 1GNWA 1VF2A 4KCAA 5HQPA 2H72A 5CAXA 5BMUA 2JL4A 5J4UA 5ECKB 4MPFA 4ILFA 2LTKA 1J9BA 4MPGA 3IAM2 3IK7A 3FZ4A 3BCKA 3GH9A 3FZAA 1GL8A 1A2JA 2H1BA 4CW9A 4JE1A 1YEPA 4OFTA 3Q19A 3W8SA 1O8WA 2IWTA 5BRTA 2MYGA 4N11A 1MTCA 2FA8A 2MBTA 1EEMA 5DCHA 1EGOA 1OE7A 2CQ9A 5ECMB 5B6NA 3L9VA 1GSYA 3D21A 5DAKB 1S3CA 1QK8A 2RM6A 2UZ8A 3GX0A 2HT9A 1R4WA 3CRTA 4O5RA 3N5OA 7GSSA 1EEJA 4EIPA 2CVBA 4V2MA 1T4ZA 2GSQA 3TJJA 4GQCA 2NPBA 1S3RA 2YWIA 5AIVA 2PN8A 3P2AA 3R3EA 1BEDA 4JBBA 2GQMA 4IP1A 2DJ0A 4F03A 1HNCA 3KP9A 2V2GA 5ID2B 2GZYA 4AJ8A 17GSA 1PN9A 2GDRA 2A2PA 4ID0A 1OC9B 4OCFA 4HEA2 4FYCA 1OC8A 2OE1A 2O89A 2LKUA 2PBJA 3US3A 3CSJA 3UOMA 2DJ3A 3UBKA 3ISOA 2REMA 4CY8A 4ZB6A 5A4WA 1WIKA 4ISDA 2O8VB 2YNXA 4KSOA 3TRQA 4PQ1A 4KNDA 1OE8A 4PURA 4TOPA 1YF1A 2BJXA 1M2AA 2YCDA 3IOSA 2XBQA 4FYUA 2B6MA 2ZCTA 1G6WA 3HZ8A 4KB3A 2R0PA 5LCZA 4WBJA 5DJMA 3FZ9A 3WT1A 3F6DA 1A2MA 2LNSA 3H93A 5CYYA 2HI7A 1ZGNA 1GUMA 4O5UA 1TI3A 1JZWA 3Q6OA 3QCPA 4MK3A 2LV3A 1ERUA 1R26A 4BIKA 3UMAA 2VM2A 2VD1A 1TRWA 4WXTA 3N9JA 4N30A 2C0FA 2YWNA 1U88A 3CSIA 2WS2A 1YEXA 6GSTA 4KUNA 5KOXA 2MBSA 4E8EA 4RI6A 1GSDA 2HFDA 5IQYA 4ULXA 4KX4A 4PTSA 14GSA 2X8GA 3HXSA 1O73A 1O6JA 1ML6A 4QQ7A 1K0AA 3L4NA 4ML1A 4NPBA 1X9MB 1WWJA 4KDYA 4K9ZA 3LSZA 1XVWA 3G7YA 1K3LA 2HRFA 2KP1A 5ECQB 1DBYA 3F3QA 4MJCA 5E4WA 1PQNA 2FD3A 2QSIA 3IAS2 1UN2A 3EU4A 2IJYA 3F4SA 3KMOA 1X5EA 4O92A 1XWGA 3KTLA 4HU7A 3FKFA 2HXKA 4IS0A 3IRAA 3IC8A 3FK8A 3RHCA 4MJAA 3E9JB 3M3MA 3HCZA 2IMDA 5DALB 1AC1A 2YP6A 1XXUA 3H1NA 4TR1B 3ZREA 5FWGA 4DSSA 4OFMA 4BL7A 3UVHA 3A3TA 3H79A 4NAXA 3DGQA 1DE2A 2L6DA 5B7CA 5CP1A 4ZBBA 4JRRA 3LXZA 1PL2A 1TK0B 1YDKA 1V9WA 3EE2A 5H5RA 4YAVA 3EYTA 2HSYA 2M72A 3GKMA 4G9HA 2H0GA 2ZNMA 2JZSA 4MMMA 1SD8A 1TP9A 2PERA 3HYPA 4ZIJA 4L0WA 4BVYB 2YV7A 8GSSA 3GHAA 2H1DA 4RUVA 3HHVA 1BYEA 3KIJA 4DSQA 5HFKA 3C1RA 4XRAA 1T3BA 2AJQB 2H30A 4XCSA 1N2AA 5IOXA 1E6BA 5HR2A 2I9HA 1A2LA 6GSWA 3D4TA 2RUFA 3SWLA 2VUPA 1IYIA 4TXVA 4G0LA 2B7JA 1A0RP 4ECCA 2XHFA 1TKDB 4BA7A 1JZOA 4O7HA 3DIEA 4FQUA 1YJ6A 1MD4A 2MMAA 1SL0B 1AW9A 3DRNA 2NVLA 1T4YA 3NIVA 1GUKA 3HJMA 2PUKC 1RQMA 2DKHA 1FHEA 2DJJA 2OE3A 3HDCA 3TKSE 2GZZA 3GMFA 2PWJA 4JEDA 2H19A 5E59A 1MD3A 4I5QA 3F8UA 4IHUA 2F3MA 4AF2A 4EC0A 3RDWA 2QKEA 4KE3A 6GSVA 4MA9A 6GSYA 1B4QA 3ZTLA 2TIRA 4FIWA 4IGJA 4YQMA 4IQAA 2MMOA 3GTUA 1X9WB 1HNAA 4K0GA 3MNGA 2YJHA 1YY7A 1NW2A 4K2XA 4PQHA 3DXBA 3W6GA 5IO0A 1Z5YE 4N10A 4LMVA 4G10A 2NTOA 1SKSB 3GKNA 2H01A 3ZIVA 3VWWA 2HZFA 5DJLA 3ZYWA 4MNNA 3BJ5A 2DMMA 4HJMA 2GQKA 3TRPA 4O5QA 2L59A 5H5QA 3KZQA 1JFUA 1BAYA 2QC7A 4MZWA 2VCQA 4DEJA 1Q98A 2H76A 2IIYA 1WE0A 3IV4A 4K5RA 4TKYA 1PX7A 1W89A 2C4JA 4NHWA 3RHBA 5FT3A 1MEKA 3TJBA 1PX6A 3TJGA 4ICYA 5IMZA 1XPVA 1E2YA 1T00A 1TU8A 4HDEA 2VM1A 3CSHA 1F2EA 1A23A 3UARA 1B9YC 1YKCA 1J0FA 1MDJA 3QPMA 4TVEA 4USSA 3IPZA 2AB6A 4F0BA 4MJEA 2HSHA 3M1GA 4EF0A 2KOKA 3GRXA 1Q4JA 3UAPA 4BVXB 2DIZA 3UVTA 5JWQB 1K0BA 3QFAC 4Z2UA 3A2VA 3ME8A 3NOFA 2H6XA 3QOUA 5INYA 1PKWA 2CV4A 1GSSA 1ACVA 5EVOA 3FR3A 2VCVA 2YANA 1XOAA 3GKXA 4WKWA 5C04A 4Q5QA 3RAZA 5F07A 3HA9A 2FA4A 1F6MC 2LS5A 1F37A 2IN3A 3SBCA 2G0FA 4JR6A 2C1YA
chains in the Genus database with same CATH topology
5HR1A 4DSRA 3GFKA 3P8WA 4HZ2A 2LEGA 2C80A 2J23A 4IKHA 2NBSA 4K7NA 4ECJA 2IFQB 3U6VA 1O7UA 3VWXA 4K2DA 2YV9A 1GRXA 3ZFBA 1YQ1A 4K6XA 2FCHA 3GKKA 2X4AA 3F63A 4EDYA 1XWKA 5G2ZA 3KXOA 4XS6A 5GZZB 4KAEA 1TI1A 3GNJA 4PX1A 1ZMAA 1EGRA 5G30A 2GT6A 3TUEA 1M9BA 5DDLA 1SYRA 1U87A 4FH8A 5G1KA 4K7IA 3GIXA 5B6MA 2L6CA 3VK9A 1GULA 2K6VA 4K0NA 3O6TA 4LA1A 1GTBA 1XVQA 2GSRA 1K0DA 3UL3A 3APSA 2IMKA 4G2EA 5IPGA 4X1UA 3D5JA 1NSWA 2H74A 2F51A 5KEJA 2CZ2A 1GUHA 1ZYPA 3LYPA 4F2IA 2DBCA 3GYKA 2ON7A 4I97A 3VPQA 2LQOA 1K3OA 5F06A 4MABA 2YZHA 4LMWA 5ELAA 1V58A 3LQ7A 11GSA 3ZIJA 2E2MA 3ERWA 4TW5A 4YQVA 1O8XA 2FY6A 4GTUA 2QA1A 1TW9A 4N0VA 4KW6A 4HQZA 2P5QA 1GSFA 2GSTA 4J57E 5IMAA 4ZL9A 3D0ZA 2WULA 1QXHA 2GQLA 2IPAA 4GLTA 5IIZA 3HVXA 3G9BA 3Q74A 5DAKA 5ECHB 5AISA 4GSSA 1GWCA 2WJUA 5ELGA 4XTSA 2YJ7A 1X5DA 4RQXA 3WGDA 2RUEA 4NV2A 2FHEA 1RW1A 6GSSA 3WT2A 5IM9A 3LYKA 5CRHA 1OYJA 2VL2A 4PGTA 1XOBA 2V6KA 3CTFA 2DMLA 2DC5A 2H1AA 3K8NA 4GWRA 2Z9SA 2HZEB 5ID2A 1OC3A 3EURA 2D2ZA 5A4VA 5D9TA 3LORA 1OC9A 5IO2A 4MP4A 1AUCA 2VCXA 4WR5A 4EKZA 3PINA 5D8IA 5CO3A 2HNLA 1QGVA 1XW5A 4YAPA 5A4UA 1VF1A 1BX9A 1KTEA 3KEBA 4XS4B 4GXZA 1TXXA 1V57A 3KP8A 4I8BA 2NDOA 1S3DA 6GSUA 2VL3A 1ERTA 1NM3A 1WPIA 3MAKA 3J7Yk 3KMNA 1TDIA 1SK2A 2LUSA 3LXTA 3QR6A 1WOUA 5DVBA 3LGCA 4OFNA 1ZYNA 1A24A 1K0MA 3QAGA 2EIQA 1EWXA 4ZB8A 1PA3A 2DKIA 2PU9C 2PMTA 2A2SA 2DJKA 4Q5NA 2X99A 2GGTA 4MH3A 4MF7A 4Z2RA 1R5AA 2HSMA 1HYUA 1EOHA 5D9XA 3M9KA 1AQVA 1F3AA 5ECSA 4XIHA 1XWBA 3CYNA 4ECIA 2H0HA 2HRNA 4EL1A 2EC4A 1FB6A 2VO4A 4ZILA 1VGLA 3VI5A 5IMVA 3TOTA 3BCIA 1M7TA 3A5WA 3KTBA 1ZZYA 5CRWA 1Y25A 3C73A 3TKSA 3ZFLA 4YH2A 3LFLA 3FMWA 5ECRB 2YWOA 3HVSA 1AIUA 2N5FA 5J41A 2O85A 1T8EB 4TR4A 5L71A 1O85A 1WJKA 3EC3A 2QA2A 1M0UA 22GSA 2VAFA 1PD21 2VL9A 3RPNA 4ZL8A 4PNFA 5LNKe 1OKTA 5KN3A 5G5FA 4OMVA 1Z7PA 2P0GA 1DUGA 4KF9A 2B7KA 4I2UA 3VPTA 2WRTA 1UC7A 3I6AA 4Q5FA 1Z3EA 5CREA 2IMFA 5HFIA 4WBRD 1SK1A 4NWYA 2FWGA 9GSSA 5JWOB 1KBNA 5A5KA 3EMPA 1M2DA 4EIQA 3TGZA 2ALBA 1U6TA 4YKGA 1F3BA 1EV9A 2AHEA 5DALA 1KNGA 4TR1A 4D73B 3TOUA 2CAQA 1XW6A 2YOIA 1G0TA 2CX3A 4POLA 4CHSA 2GZPA 2EIRA 2CAIA 2X8CA 4EXJA 2A4VA 1G7OA 1I5GA 2MMNA 3IA1A 1XCCA 1TU7A 3CRUA 1EP7A 4P3YB 4HUAA 4WF4A 3IBHA 3IK9A 3MYDA 4LL1B 2EIOA 2N5BA 2L4CA 3QDNA 5C00A 4L0UA 4FYBA 1SJ6A 4HZ4A 4BVYA 5ENUA 1G7EA 3KJYA 1SL1B 5DCGA 3HJPA 2K8SA 4D73A 1WP0A 4TXOB 1ZYQB 1XW9A 4WETA 4TRXA 1HNBA 2V32A 1HQOA 1USBA 4EUYA 1GTIA 1HD2A 1QFNA 2OJLA 1PMTA 1V40A 3L9SA 3FYGA 4IJIA 2C0DA 1QMVA 2E7PA 2LRCA 1SKWB 1BQ7A 4HJ2A 1TK5B 1V98A 2KUCA 3IHGA 2I3YA 2F8AA 3H8QA 5F0GA 3L0HA 2A2RA 2G2QA 4IVFA 5F05A 10GSA 4ACSA 4AJ6A 2FUG2 4K8MA 5GSTA 3U5RE 2LJRA 3I9V2 3TKPA 1CQGA 1THXA 2JZRA 4V1Ag 4MZBA 3HD5A 1ILOA 4JU5A 1XBSA 3WYWA 1VF3A 1V2AA 4MLYA 1U3AA 1YZXA 1SD9A 2FLSA 2KP2A 2L4QA 1JHBA 1OKDA 1SENA 2C0EA 2OKAA 2F9SA 3EWLA 4TR0A 2BTOT 5GSSA 1Y6EA 1FOHA 1NHYA 2OACA 3A5IA 1TTZA 1EOGA 2HE3A 1TK8B 3HKRA 3ZMLA 3TJFA 2B1KA 4ZL7A 5HR0A 3OR5A 3ERFA 3TKRA 2VCZA 4HU9A 3F3RA 2YN1A 3DD3A 2CT6A 4KCEA 3G7IA 1LJRA 2V1MA 1B8XA 3MDKA 5LD0A 3GL5A 2AV4A 4V2LA 4CY6A 3FR6A 3PPUA 5EPFA 1GP1A 20GSA 4IQ1A 3LWAA 4ZBDA 5F8BA 4KH7A 1O81A 3D6IA 2M80A 3F0IA 1K0NA 2VLVA 2GLRA 3NZNA 2JU5A 2AUVA 3MSZA 4OCEA 3APOA 2XBIA 1M9AA 1ABAA 3TJKA 1FW1A 1R5PA 2OA7A 1B4PA 2XC2A 5KOWA 4OD7A 2PPTA 1GSEA 3PR8A 3CBUA 2PVQA 1JLVA 3IE3A 3GUSA 2CX4A 2JSZA 4MDCA 5ECNB 3UEMA 1QUWA 3FRCA 1WMJA 3IR4A 1M2BA 2H8LA 5JWRB 1PGTA 16GSA 2V6OA 1ZCPA 1GTUA 4GQFA 5AGYA 3IHQA 2VCTA 3ZVJD 2H71A 1A0FA 5ECLB 3F4RA 1AAZA 4PUFC 3EINA 4L5LA 2K8VA 4F9ZA 2VLUA 2CZ3A 4MJBA 2OBKA 4BVXA 3QMXA 1YF0A 1X9SB 1XIYA 3DVXA 4I6XA 2TRXA 3QD9A 3TB2A 5CRDA 3FEUA 3M0FA 2LJKA 3DMLA 4QL9A 1PL1A 3A2XA 2CA8A 1PSQA 1M99A 3ERGA 2RM5A 2H1GA 3TDGA 3CXGA 3C71A 4ML6A 2M46A 4X0XA 3M8NA 1K0CA 1FAAA 4XRDA 3GA4A 2IFQA 2GT5A 3TKQA 2HRAA 3WGEA 3IXRA 4G0KA 5KN1A 1GTAA 2JZTA 4EVMA 1GLPA 2PGTA 4GCIA 2FGXA 1TOFA 3AY8A 4K1FA 2VOCA 3BOAA 5B8BA 2XPDA 2MMZA 4POKA 5AN1A 5G1LA 2YWMA 2LQQA 3ZMKA 1RK4A 2R4VA 4AGSA 2X8HA 1BJXA 4F0CA 2IMEA 4IN0A 2C3TA 1OAZA 1UA5A 2LJAA 3G7JA 3GN3A 2R2JA 2WFCA 4NV5A 1K0OA 5EY6A 4HOJA 4I2TA 2A4HA 3IC4A 4LL4B 3EMXA 3DEXA 5J9BA 2FWFA 4AJ7A 4BPYA 2JADA 5EL8A 2ZUPA 1Z9HA 5J9CA 2PVOC 3DWVA 1TRSA 4X43A 4CDOA 3JCML 1SJIA 2C0GA 4KDUA 5ECIB 5CRGA 1VF4A 4KDXA 5HFGA 4DVCA 2HLSA 3F4TA 3KD0A 2GSSA 2MZCA 2VL2C 1AQWA 4ZB9A 1LU4A 5D9WA 2H6ZA 2CVDA 3FHKA 3H4KA 5FHIA 4GSNA 3KGKA 2R0CA 4GSTA 1A8LA 1MDKA 2H70A 1EP8A 2WGRA 2LRNA 1UVZA 3WGXA 3BD2A 1ON4A 2H6YA 2ES7A 1T7PB 4MF6A 4LLRA 1LBKA 2R3XA 1KEBA 5B8AA 3VFIA 5H5SA 1A8YA 2YZUA 4NMUA 1K3YA 3P90A 2V41A 4ZXGA 3GL3A 1WRYA 2I4AA 2L5OA 4X4JA 3RPPA 2WCIA 4A5PA 1ERVA 2OBIA 5IMCA 3J7Yb 1NHOA 1PRXA 2B5XA 6GSXA 3S9FA 2IMIA 5DBQA 2L5LA 2R0GA 2HYXA 1YKAA 5J5NA 1ZL9A 3VURA 1XFLA 2HZEA 1B48A 4MZCA 3DVWA 12GSA 4Z2TA 3ZZXA 2OADA 5J3RA 2K9FA 4BWSA 4E8HA 4MF5A 4TR3A 3UJ1A 2I81A 2B5YA 4F82A 2GVPA 3I43A 3UIWA 3VWVA 4XS4A 3TCOA 4EDZA 4DSSB 2GTUA 3VLNA 5GAPD 3MIXA 1SU9A 2C3NA 4BL7B 1IYHA 2N5AA 5IPHA 3LEFA 2B3SA 3KH7A 2HRKA 3R2QA 3TKSC 1FB0A 13GSA 4PQIA 1B9XC 2X64A 3E3EA 3ZITA 4G0IA 4OO4A 2L57A 1PN0A 4OWYA 2DIYA 4IJ3A 5CNWA 2DSAA 3C1SA 3D4MA 3PGTA 1J08A 3I69A 1GH2A 3O76A 2P5RA 1SKRB 2X49A 3CMIA 4O32A 3ME7A 4ECBA 2GS3A 2FNOA 4K5SA 3GV1A 3FR9A 3QAVA 4IELA 4Q5RA 1URMA 2R5GA 2H66A 1SL2B 2H0IA 3IDVA 3EPTA 1Z6NA 1Z7RA 5G5EA 2AAWA 1FO5A 2J9HA 1R7HA 1F9MA 1XWAA 2JACA 2OE0A 1FOVA 1T1VA 1ST9A 4Z7XA 4TN8A 4PXOA 3V1WA 5KN0A 2DJ2A 3L78A 1AQXA 4EE0A 2YPMA 4XHMA 2WDUA 4RQRA 4PUAA 1EV4A 2P31A 1PKZA 1Z6MA 2VLTA 1FVJA 3ZLPA 1BG5A 1N8JA 5D93A 2WB9A 3DKSA 4PNGA 4KA0A 4QL7A 2R6KA 2QGVA 4OO5A 4IW9A 4HI7A 1H4OA 1ERWA 3GURA 1I9DA 2B1LA 4L8EA 2KHPA 4XS1A 1U3IA 1VRSD 2O7KA 1FG4A 3GTUB 3APQA 2C8UA 2F8FA 5JCWA 5IMFA 3LG6A 3MWHA 3W8JA 1W4VA 1QQ2A 2VCWA 1XZOA 2RLIA 4V1Ap 1DSBA 4GF0A 4YQUA 3P7XA 4WR4A 2AYTA 4POBA 1FVKA 3HJOA 1G6YA 4KSMA 1SK0A 3D22A 2LSTA 2KLXA 2CVKA 3F6FA 5G31A 4N0ZA 3CTGA 3KM6A 3RBTA 4NXIA 3HY2A 3KCMA 3M9JA 3GX8A 4J56E 3QFBC 4WF5A 1ZOFA 5ABRA 3ED3A 4NHZA 4L5OA 1GLQA 2B5EA 4TXOA 2ON5A 1GSUA 5D96A 4MCUA 3FY7A 3GSTA 3QAWA 5KN2A 1JZDA 1AXDA 2O87A 3C8EA 4JR4A 2WZ9A 4JZQA 5GAND 2DLXA 1CQHA 1TRUA 1ZYEA 1TJDA 2LNTA 1OVNA 5D73A 1S3AA 3Q18A 1X5CA 1JLWA 2LRTA 4IBPA 2TRCP 3GSSA 3F9UA 1GSQA 4HQSA 4KGIA 5JCGA 3PH9A 4EO3A 1SYXA 2C3QA 4HS1A 18GSA 1THOA 5DQYA 3HZ4A 2I1UA 2VD0A 3LW9A 4YKFA 3ZRDA 1DE1A 3WD6A 2RIIA 1TRVA 3LJRA 3O3TA 4GRFA 5DQSA 3TRXA 4RI7A 2H73A 4ZBAA 3ZVJA 2JSYA 5COHA 4H86A 3FZ5A 2H75A 1X0RA 3BBYA 2VIMA 5IOWA 3ZL5A 4K7OA 3VWUA 4V2NA 5IMDA 4BWQA 2E0QA 5AIXA 3A2WA 2FWEA 1GNEA 3HVVA 1C72A 4J2FA 1EZKA 1MDIA 3L9UA 4POMA 5JCUA 2FWHA 2R37A 3GH6A 4IP6A 4FO5A 2DJ1A 2K18A 3DYRA 2E2GA 3EVIA 4G19A 4MH2A 3EU3A 3UBLA 3FW2A 5ECPB 3C7MA 3VI7A 2BMXA 1JZRA 3E0UA 3KH9A 5ECOB 5D9VA 1SJZA 2XPEA 5HR3A 19GSA 1H75A 4WEYA 1XWCA 2IL3A 1GNWA 1VF2A 4KCAA 5HQPA 2H72A 5CAXA 5BMUA 2JL4A 5J4UA 5ECKB 4MPFA 4ILFA 2LTKA 1J9BA 4MPGA 3IAM2 3IK7A 3FZ4A 3BCKA 3GH9A 3FZAA 1GL8A 1A2JA 2H1BA 4CW9A 4JE1A 1YEPA 4OFTA 3Q19A 3W8SA 1O8WA 2IWTA 5BRTA 2MYGA 4N11A 1MTCA 2FA8A 2MBTA 1EEMA 5DCHA 1EGOA 1OE7A 2CQ9A 5ECMB 5B6NA 3L9VA 1GSYA 3D21A 5DAKB 1S3CA 1QK8A 2RM6A 2UZ8A 3GX0A 2HT9A 1R4WA 3CRTA 4O5RA 3N5OA 7GSSA 1EEJA 4EIPA 2CVBA 4V2MA 1T4ZA 2GSQA 3TJJA 4GQCA 2NPBA 2YWIA 5AIVA 2PN8A 3P2AA 3R3EA 1BEDA 4JBBA 2GQMA 4IP1A 2DJ0A 4F03A 1HNCA 3KP9A 2V2GA 5ID2B 2GZYA 4AJ8A 17GSA 1PN9A 2GDRA 2A2PA 4ID0A 1OC9B 4OCFA 4HEA2 4FYCA 1OC8A 2OE1A 2O89A 2LKUA 2PBJA 3US3A 3CSJA 3UOMA 2DJ3A 3UBKA 3ISOA 2REMA 4CY8A 4ZB6A 5A4WA 1WIKA 4ISDA 2O8VB 2YNXA 4KSOA 3TRQA 4PQ1A 4KNDA 1OE8A 4PURA 4TOPA 1YF1A 2BJXA 1M2AA 2YCDA 3IOSA 2XBQA 4FYUA 2B6MA 2ZCTA 1G6WA 3HZ8A 4KB3A 2R0PA 5LCZA 4WBJA 5DJMA 3FZ9A 3WT1A 3F6DA 1A2MA 2LNSA 3H93A 5CYYA 2HI7A 1ZGNA 1GUMA 4O5UA 1TI3A 1JZWA 3Q6OA 3QCPA 4MK3A 2LV3A 1ERUA 1R26A 3UMAA 2VM2A 2VD1A 1TRWA 3N9JA 4WXTA 4N30A 2C0FA 2YWNA 1U88A 3CSIA 2WS2A 1YEXA 6GSTA 4KUNA 5KOXA 2MBSA 4E8EA 4RI6A 1GSDA 2HFDA 5IQYA 4ULXA 4KX4A 4PTSA 14GSA 2X8GA 3HXSA 1O73A 1O6JA 1ML6A 4QQ7A 1K0AA 3L4NA 4ML1A 4NPBA 1X9MB 1WWJA 4KDYA 4K9ZA 3LSZA 1XVWA 3G7YA 1K3LA 2HRFA 2KP1A 5ECQB 1DBYA 3F3QA 4MJCA 5E4WA 1PQNA 2FD3A 2QSIA 3IAS2 1UN2A 3EU4A 2IJYA 3F4SA 3KMOA 1X5EA 4O92A 1XWGA 3KTLA 4HU7A 3FKFA 2HXKA 4IS0A 3IRAA 3IC8A 3FK8A 3RHCA 4MJAA 3E9JB 3M3MA 3HCZA 2IMDA 5DALB 1AC1A 2YP6A 1XXUA 3H1NA 4TR1B 3ZREA 5FWGA 4DSSA 4OFMA 4BL7A 3UVHA 3A3TA 3H79A 4NAXA 3DGQA 1DE2A 2L6DA 5B7CA 5CP1A 4ZBBA 4JRRA 3LXZA 1PL2A 1TK0B 1YDKA 1V9WA 3EE2A 5H5RA 4YAVA 3EYTA 2HSYA 2M72A 3GKMA 4G9HA 2H0GA 2ZNMA 2JZSA 4MMMA 1SD8A 1TP9A 2PERA 3HYPA 4ZIJA 4L0WA 4BVYB 2YV7A 8GSSA 3GHAA 2H1DA 4RUVA 3HHVA 1BYEA 3KIJA 4DSQA 5HFKA 3C1RA 4XRAA 1T3BA 2AJQB 2H30A 4XCSA 1N2AA 5IOXA 1E6BA 5HR2A 2I9HA 1A2LA 6GSWA 3D4TA 2RUFA 3SWLA 2VUPA 1IYIA 4TXVA 4G0LA 2B7JA 1A0RP 4ECCA 2XHFA 1TKDB 4BA7A 1JZOA 4O7HA 3DIEA 4FQUA 1YJ6A 1MD4A 2MMAA 1SL0B 1AW9A 3DRNA 2NVLA 1T4YA 3NIVA 1GUKA 3HJMA 2PUKC 1RQMA 2DKHA 1FHEA 2DJJA 2OE3A 3HDCA 3TKSE 2GZZA 3GMFA 2PWJA 4JEDA 2H19A 5E59A 1MD3A 4I5QA 3F8UA 4IHUA 2F3MA 4AF2A 4EC0A 3RDWA 2QKEA 4KE3A 6GSVA 4MA9A 6GSYA 1B4QA 3ZTLA 2TIRA 4FIWA 4IGJA 4YQMA 4IQAA 2MMOA 3GTUA 1X9WB 1HNAA 4K0GA 3MNGA 2YJHA 1YY7A 1NW2A 4K2XA 4PQHA 3DXBA 3W6GA 5IO0A 1Z5YE 4N10A 4LMVA 4G10A 2NTOA 1SKSB 3GKNA 2H01A 3ZIVA 3VWWA 2HZFA 5DJLA 3ZYWA 4MNNA 3BJ5A 2DMMA 4HJMA 2GQKA 3TRPA 4O5QA 2L59A 5H5QA 3KZQA 1JFUA 1BAYA 2QC7A 4MZWA 2VCQA 4DEJA 1Q98A 2H76A 2IIYA 1WE0A 3IV4A 4K5RA 4TKYA 1PX7A 1W89A 2C4JA 4NHWA 3RHBA 5FT3A 1MEKA 3TJBA 1PX6A 3TJGA 4ICYA 5IMZA 1XPVA 1E2YA 1T00A 1TU8A 4HDEA 2VM1A 3CSHA 1F2EA 1A23A 3UARA 1B9YC 1YKCA 1J0FA 1MDJA 3QPMA 4TVEA 4USSA 3IPZA 2AB6A 4F0BA 4MJEA 2HSHA 3M1GA 4EF0A 2KOKA 3GRXA 1Q4JA 3UAPA 4BVXB 2DIZA 3UVTA 5JWQB 1K0BA 3QFAC 4Z2UA 3A2VA 3ME8A 3NOFA 2H6XA 3QOUA 5INYA 1PKWA 2CV4A 1GSSA 1ACVA 5EVOA 3FR3A 2VCVA 2YANA 1XOAA 3GKXA 4WKWA 5C04A 4Q5QA 3RAZA 5F07A 3HA9A 2FA4A 1F6MC 2LS5A 1F37A 2IN3A 3SBCA 2G0FA 4JR6A 2C1YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HR1 A;  4DSR A;  3GFK A;  3P8W A;  4HZ2 A;  2LEG A;  2C80 A;  2J23 A;  4IKH A;  2NBS A;  4K7N A;  4ECJ A;  2IFQ B;  3U6V A;  1O7U A;  3VWX A;  4K2D A;  2YV9 A;  1GRX A;  3ZFB A;  1YQ1 A;  4K6X A;  2FCH A;  3GKK A;  3F63 A;  4EDY A;  1XWK A;  5G2Z A;  3KXO A;  4XS6 A;  5GZZ B;  4KAE A;  1TI1 A;  3GNJ A;  4PX1 A;  1ZMA A;  1EGR A;  5G30 A;  2GT6 A;  3TUE A;  1M9B A;  5DDL A;  1SYR A;  1U87 A;  4FH8 A;  5G1K A;  4K7I A;  3GIX A;  5B6M A;  2L6C A;  3VK9 A;  1GUL A;  2K6V A;  4K0N A;  3O6T A;  4LA1 A;  1GTB A;  1XVQ A;  2GSR A;  1K0D A;  3UL3 A;  3APS A;  2IMK A;  4G2E A;  5IPG A;  4X1U A;  3D5J A;  1NSW A;  2H74 A;  2F51 A;  5KEJ A;  2CZ2 A;  1GUH A;  3LYP A;  4F2I A;  2DBC A;  3GYK A;  2ON7 A;  4I97 A;  3VPQ A;  2LQO A;  1K3O A;  5F06 A;  4MAB A;  2YZH A;  4LMW A;  5ELA A;  1V58 A;  3LQ7 A;  11GS A;  3ZIJ A;  2E2M A;  3ERW A;  4TW5 A;  4YQV A;  1O8X A;  2FY6 A;  4GTU A;  1TW9 A;  4N0V A;  4KW6 A;  4HQZ A;  2P5Q A;  1GSF A;  2GST A;  4J57 E;  5IMA A;  4ZL9 A;  3D0Z A;  2WUL A;  1QXH A;  2GQL A;  2IPA A;  4GLT A;  5IIZ A;  3HVX A;  3G9B A;  3Q74 A;  5DAK A;  5ECH B;  5AIS A;  4GSS A;  1GWC A;  2WJU A;  5ELG A;  4XTS A;  2YJ7 A;  1X5D A;  4RQX A;  3WGD A;  2RUE A;  4NV2 A;  2FHE A;  1RW1 A;  6GSS A;  3WT2 A;  5IM9 A;  3LYK A;  5CRH A;  1OYJ A;  2VL2 A;  4PGT A;  1XOB A;  2V6K A;  3CTF A;  2DML A;  2DC5 A;  2H1A A;  3K8N A;  4GWR A;  2Z9S A;  2HZE B;  5ID2 A;  1OC3 A;  3EUR A;  2D2Z A;  5A4V A;  5D9T A;  3LOR A;  1OC9 A;  5IO2 A;  4MP4 A;  1AUC A;  2VCX A;  4WR5 A;  4EKZ A;  3PIN A;  5D8I A;  5CO3 A;  2HNL A;  1QGV A;  1XW5 A;  4YAP A;  5A4U A;  1VF1 A;  1BX9 A;  1KTE A;  3KEB A;  4XS4 B;  4GXZ A;  1TXX A;  1V57 A;  3KP8 A;  4I8B A;  2NDO A;  1S3D A;  6GSU A;  2VL3 A;  1ERT A;  1NM3 A;  1WPI A;  3MAK A;  3J7Y k;  3KMN A;  1TDI A;  1SK2 A;  2LUS A;  3LXT A;  3QR6 A;  1WOU A;  5DVB A;  3LGC A;  4OFN A;  1A24 A;  1K0M A;  3QAG A;  2EIQ A;  1EWX A;  4ZB8 A;  1PA3 A;  2PU9 C;  2PMT A;  2A2S A;  2DJK A;  4Q5N A;  2X99 A;  2GGT A;  4MH3 A;  4MF7 A;  1R5A A;  1HYU A;  1EOH A;  5D9X A;  3M9K A;  1AQV A;  1F3A A;  5ECS A;  4XIH A;  1XWB A;  3CYN A;  4ECI A;  2H0H A;  2HRN A;  4EL1 A;  2EC4 A;  1FB6 A;  2VO4 A;  4ZIL A;  1VGL A;  3VI5 A;  5IMV A;  3TOT A;  3BCI A;  1M7T A;  3A5W A;  3KTB A;  1ZZY A;  5CRW A;  1Y25 A;  3C73 A;  3TKS A;  3ZFL A;  4YH2 A;  3LFL A;  5ECR B;  2YWO A;  3HVS A;  1AIU A;  2N5F A;  5J41 A;  2O85 A;  1T8E B;  4TR4 A;  5L71 A;  1O85 A;  1WJK A;  3EC3 A;  1M0U A;  22GS A;  2VAF A;  1PD2 1;  2VL9 A;  3RPN A;  4ZL8 A;  4PNF A;  5LNK e;  1OKT A;  5KN3 A;  5G5F A;  4OMV A;  1Z7P A;  2P0G A;  1DUG A;  2B7K A;  4I2U A;  3VPT A;  2WRT A;  1UC7 A;  3I6A A;  4Q5F A;  1Z3E A;  5CRE A;  2IMF A;  5HFI A;  4WBR D;  1SK1 A;  4NWY A;  2FWG A;  9GSS A;  5JWO B;  1KBN A;  5A5K A;  3EMP A;  1M2D A;  3TGZ A;  2ALB A;  1U6T A;  1F3B A;  1EV9 A;  2AHE A;  5DAL A;  1KNG A;  4TR1 A;  4D73 B;  3TOU A;  2CAQ A;  1XW6 A;  2YOI A;  1G0T A;  2CX3 A;  4POL A;  4CHS A;  2GZP A;  2EIR A;  2CAI A;  2X8C A;  4EXJ A;  2A4V A;  1G7O A;  1I5G A;  2MMN A;  3IA1 A;  1XCC A;  1TU7 A;  3CRU A;  1EP7 A;  4P3Y B;  4HUA A;  4WF4 A;  3IBH A;  3IK9 A;  4LL1 B;  2EIO A;  2N5B A;  2L4C A;  3QDN A;  5C00 A;  4L0U A;  4FYB A;  1SJ6 A;  4HZ4 A;  4BVY A;  5ENU A;  1G7E A;  3KJY A;  1SL1 B;  5DCG A;  3HJP A;  2K8S A;  4D73 A;  1WP0 A;  4TXO B;  1ZYQ B;  1XW9 A;  4WET A;  4TRX A;  1HNB A;  2V32 A;  1HQO A;  1USB A;  4EUY A;  1GTI A;  1HD2 A;  1QFN A;  2OJL A;  1PMT A;  1V40 A;  3L9S A;  3FYG A;  4IJI A;  2C0D A;  1QMV A;  2E7P A;  2LRC A;  1SKW B;  1BQ7 A;  4HJ2 A;  1TK5 B;  1V98 A;  2KUC A;  2I3Y A;  2F8A A;  3H8Q A;  5F0G A;  3L0H A;  2A2R A;  2G2Q A;  4IVF A;  5F05 A;  10GS A;  4ACS A;  4AJ6 A;  2FUG 2;  4K8M A;  5GST A;  3U5R E;  2LJR A;  3I9V 2;  3TKP A;  1CQG A;  1THX A;  2JZR A;  4V1A g;  4MZB A;  3HD5 A;  1ILO A;  4JU5 A;  1XBS A;  3WYW A;  1VF3 A;  1V2A A;  4MLY A;  1U3A A;  1YZX A;  1SD9 A;  2FLS A;  2KP2 A;  2L4Q A;  1JHB A;  1OKD A;  1SEN A;  2C0E A;  2OKA A;  2F9S A;  3EWL A;  4TR0 A;  2BTO T;  5GSS A;  1Y6E A;  1NHY A;  2OAC A;  1TTZ A;  1EOG A;  2HE3 A;  1TK8 B;  3HKR A;  3ZML A;  3TJF A;  2B1K A;  4ZL7 A;  5HR0 A;  3OR5 A;  3ERF A;  3TKR A;  2VCZ A;  4HU9 A;  3F3R A;  2YN1 A;  3DD3 A;  2CT6 A;  4KCE A;  3G7I A;  1LJR A;  2V1M A;  1B8X A;  3MDK A;  5LD0 A;  3GL5 A;  2AV4 A;  4V2L A;  3FR6 A;  5EPF A;  1GP1 A;  20GS A;  4IQ1 A;  3LWA A;  4ZBD A;  5F8B A;  4KH7 A;  1O81 A;  3D6I A;  2M80 A;  3F0I A;  1K0N A;  2VLV A;  2GLR A;  3NZN A;  2JU5 A;  2AUV A;  3MSZ A;  4OCE A;  3APO A;  2XBI A;  1M9A A;  1ABA A;  3TJK A;  1FW1 A;  1R5P A;  2OA7 A;  1B4P A;  2XC2 A;  4OD7 A;  2PPT A;  1GSE A;  3PR8 A;  3CBU A;  2PVQ A;  1JLV A;  3IE3 A;  3GUS A;  2CX4 A;  2JSZ A;  4MDC A;  5ECN B;  3UEM A;  1QUW A;  3FRC A;  1WMJ A;  3IR4 A;  1M2B A;  2H8L A;  5JWR B;  1PGT A;  16GS A;  2V6O A;  1ZCP A;  1GTU A;  4GQF A;  5AGY A;  3IHQ A;  2VCT A;  3ZVJ D;  2H71 A;  1A0F A;  5ECL B;  3F4R A;  1AAZ A;  4PUF C;  3EIN A;  4L5L A;  2K8V A;  4F9Z A;  2VLU A;  2CZ3 A;  4MJB A;  2OBK A;  4BVX A;  3QMX A;  1YF0 A;  1X9S B;  1XIY A;  3DVX A;  4I6X A;  2TRX A;  3QD9 A;  3TB2 A;  5CRD A;  3FEU A;  3M0F A;  2LJK A;  3DML A;  4QL9 A;  1PL1 A;  3A2X A;  2CA8 A;  1PSQ A;  1M99 A;  3ERG A;  2RM5 A;  2H1G A;  3TDG A;  3CXG A;  3C71 A;  4ML6 A;  2M46 A;  4X0X A;  3M8N A;  1K0C A;  1FAA A;  4XRD A;  3GA4 A;  2IFQ A;  2GT5 A;  3TKQ A;  3WGE A;  3IXR A;  5KN1 A;  1GTA A;  2JZT A;  4EVM A;  1GLP A;  2PGT A;  4GCI A;  2FGX A;  1TOF A;  3AY8 A;  4K1F A;  2VOC A;  3BOA A;  5B8B A;  2XPD A;  2MMZ A;  4POK A;  5AN1 A;  5G1L A;  2YWM A;  2LQQ A;  3ZMK A;  1RK4 A;  2R4V A;  4AGS A;  2X8H A;  1BJX A;  4F0C A;  2IME A;  4IN0 A;  2C3T A;  1OAZ A;  1UA5 A;  2LJA A;  3G7J A;  3GN3 A;  2R2J A;  2WFC A;  4NV5 A;  1K0O A;  5EY6 A;  4HOJ A;  4I2T A;  3IC4 A;  4LL4 B;  3EMX A;  3DEX A;  5J9B A;  2FWF A;  4AJ7 A;  4BPY A;  2JAD A;  5EL8 A;  2ZUP A;  1Z9H A;  5J9C A;  2PVO C;  3DWV A;  1TRS A;  4X43 A;  4CDO A;  3JCM L;  1SJI A;  2C0G A;  4KDU A;  5ECI B;  5CRG A;  1VF4 A;  4KDX A;  5HFG A;  4DVC A;  2HLS A;  3F4T A;  3KD0 A;  2GSS A;  2MZC A;  2VL2 C;  1AQW A;  4ZB9 A;  1LU4 A;  5D9W A;  2H6Z A;  2CVD A;  3FHK A;  3H4K A;  5FHI A;  4GSN A;  3KGK A;  4GST A;  1A8L A;  1MDK A;  2H70 A;  1EP8 A;  2WGR A;  2LRN A;  1UVZ A;  3WGX A;  3BD2 A;  1ON4 A;  2H6Y A;  2ES7 A;  1T7P B;  4MF6 A;  4LLR A;  1LBK A;  2R3X A;  1KEB A;  5B8A A;  3VFI A;  5H5S A;  1A8Y A;  2YZU A;  4NMU A;  1K3Y A;  3P90 A;  2V41 A;  4ZXG A;  3GL3 A;  1WRY A;  2I4A A;  2L5O A;  3RPP A;  2WCI A;  1ERV A;  2OBI A;  5IMC A;  3J7Y b;  1NHO A;  1PRX A;  2B5X A;  6GSX A;  3S9F A;  2IMI A;  5DBQ A;  2L5L A;  2HYX A;  1YKA A;  5J5N A;  1ZL9 A;  3VUR A;  1XFL A;  2HZE A;  1B48 A;  4MZC A;  3DVW A;  12GS A;  3ZZX A;  2OAD A;  5J3R A;  2K9F A;  4BWS A;  4E8H A;  4MF5 A;  4TR3 A;  3UJ1 A;  2I81 A;  2B5Y A;  4F82 A;  2GVP A;  3I43 A;  3UIW A;  3VWV A;  4XS4 A;  3TCO A;  4EDZ A;  4DSS B;  2GTU A;  3VLN A;  5GAP D;  1SU9 A;  2C3N A;  1IYH A;  2N5A A;  5IPH A;  3LEF A;  2B3S A;  3KH7 A;  3R2Q A;  3TKS C;  1FB0 A;  13GS A;  4PQI A;  1B9X C;  2X64 A;  3E3E A;  3ZIT A;  4OO4 A;  2L57 A;  4OWY A;  2DIY A;  4IJ3 A;  5CNW A;  2DSA A;  3C1S A;  3D4M A;  3PGT A;  1J08 A;  3I69 A;  1GH2 A;  3O76 A;  2P5R A;  1SKR B;  3CMI A;  4O32 A;  3ME7 A;  4ECB A;  2GS3 A;  2FNO A;  3GV1 A;  3FR9 A;  3QAV A;  4IEL A;  4Q5R A;  1URM A;  2R5G A;  2H66 A;  1SL2 B;  2H0I A;  3IDV A;  1Z6N A;  1Z7R A;  5G5E A;  2AAW A;  1FO5 A;  2J9H A;  1R7H A;  1F9M A;  1XWA A;  2JAC A;  2OE0 A;  1FOV A;  1T1V A;  1ST9 A;  4Z7X A;  4TN8 A;  4PXO A;  3V1W A;  5KN0 A;  2DJ2 A;  3L78 A;  1AQX A;  4EE0 A;  2YPM A;  4XHM A;  2WDU A;  4RQR A;  4PUA A;  1EV4 A;  2P31 A;  1PKZ A;  1Z6M A;  2VLT A;  1FVJ A;  3ZLP A;  1BG5 A;  1N8J A;  5D93 A;  2WB9 A;  3DKS A;  4PNG A;  4KA0 A;  4QL7 A;  2R6K A;  2QGV A;  4OO5 A;  4IW9 A;  4HI7 A;  1H4O A;  1ERW A;  3GUR A;  1I9D A;  2B1L A;  4L8E A;  2KHP A;  4XS1 A;  1U3I A;  1VRS D;  2O7K A;  1FG4 A;  3GTU B;  3APQ A;  2C8U A;  2F8F A;  5JCW A;  5IMF A;  3LG6 A;  3MWH A;  3W8J A;  1W4V A;  1QQ2 A;  2VCW A;  1XZO A;  2RLI A;  4V1A p;  1DSB A;  4GF0 A;  4YQU A;  3P7X A;  4WR4 A;  2AYT A;  4POB A;  1FVK A;  3HJO A;  1G6Y A;  4KSM A;  1SK0 A;  3D22 A;  2LST A;  2KLX A;  2CVK A;  3F6F A;  5G31 A;  4N0Z A;  3CTG A;  3KM6 A;  3RBT A;  4NXI A;  3HY2 A;  3KCM A;  3M9J A;  3GX8 A;  4J56 E;  3QFB C;  4WF5 A;  1ZOF A;  5ABR A;  3ED3 A;  4NHZ A;  4L5O A;  1GLQ A;  2B5E A;  4TXO A;  2ON5 A;  1GSU A;  5D96 A;  4MCU A;  3FY7 A;  3GST A;  3QAW A;  5KN2 A;  1JZD A;  1AXD A;  2O87 A;  3C8E A;  4JR4 A;  2WZ9 A;  4JZQ A;  5GAN D;  2DLX A;  1CQH A;  1TRU A;  1ZYE A;  1TJD A;  2LNT A;  1OVN A;  5D73 A;  1S3A A;  3Q18 A;  1X5C A;  1JLW A;  2LRT A;  4IBP A;  2TRC P;  3GSS A;  3F9U A;  1GSQ A;  4HQS A;  4KGI A;  5JCG A;  3PH9 A;  4EO3 A;  1SYX A;  2C3Q A;  4HS1 A;  18GS A;  1THO A;  5DQY A;  3HZ4 A;  2I1U A;  2VD0 A;  3ZRD A;  1DE1 A;  3WD6 A;  2RII A;  1TRV A;  3LJR A;  3O3T A;  4GRF A;  5DQS A;  3TRX A;  4RI7 A;  2H73 A;  4ZBA A;  3ZVJ A;  2JSY A;  5COH A;  4H86 A;  3FZ5 A;  2H75 A;  1X0R A;  3BBY A;  2VIM A;  5IOW A;  3ZL5 A;  4K7O A;  3VWU A;  4V2N A;  5IMD A;  4BWQ A;  2E0Q A;  5AIX A;  3A2W A;  2FWE A;  1GNE A;  3HVV A;  1C72 A;  4J2F A;  1EZK A;  1MDI A;  3L9U A;  4POM A;  5JCU A;  2FWH A;  2R37 A;  3GH6 A;  4IP6 A;  4FO5 A;  2DJ1 A;  2K18 A;  3DYR A;  2E2G A;  3EVI A;  4G19 A;  4MH2 A;  3EU3 A;  3UBL A;  3FW2 A;  5ECP B;  3C7M A;  3VI7 A;  2BMX A;  1JZR A;  3E0U A;  3KH9 A;  5ECO B;  5D9V A;  1SJZ A;  2XPE A;  5HR3 A;  19GS A;  1H75 A;  4WEY A;  1XWC A;  2IL3 A;  1GNW A;  1VF2 A;  4KCA A;  5HQP A;  2H72 A;  5CAX A;  2JL4 A;  5J4U A;  5ECK B;  4MPF A;  4ILF A;  2LTK A;  1J9B A;  4MPG A;  3IAM 2;  3IK7 A;  3FZ4 A;  3BCK A;  3GH9 A;  3FZA A;  1GL8 A;  1A2J A;  2H1B A;  4CW9 A;  4JE1 A;  1YEP A;  4OFT A;  3Q19 A;  3W8S A;  1O8W A;  2IWT A;  2MYG A;  4N11 A;  1MTC A;  2FA8 A;  2MBT A;  1EEM A;  5DCH A;  1EGO A;  1OE7 A;  2CQ9 A;  5ECM B;  5B6N A;  3L9V A;  1GSY A;  3D21 A;  5DAK B;  1S3C A;  1QK8 A;  2RM6 A;  3GX0 A;  2HT9 A;  1R4W A;  3CRT A;  4O5R A;  3N5O A;  7GSS A;  1EEJ A;  2CVB A;  4V2M A;  1T4Z A;  2GSQ A;  3TJJ A;  4GQC A;  2NPB A;  2YWI A;  5AIV A;  2PN8 A;  3P2A A;  1BED A;  4JBB A;  2GQM A;  4IP1 A;  2DJ0 A;  4F03 A;  1HNC A;  3KP9 A;  2V2G A;  5ID2 B;  2GZY A;  4AJ8 A;  17GS A;  1PN9 A;  2GDR A;  4ID0 A;  4OCF A;  1OC9 B;  4HEA 2;  4FYC A;  1OC8 A;  2OE1 A;  2O89 A;  2LKU A;  2PBJ A;  3US3 A;  3CSJ A;  3UOM A;  2DJ3 A;  3UBK A;  3ISO A;  2REM A;  4ZB6 A;  5A4W A;  1WIK A;  4ISD A;  2O8V B;  2YNX A;  4KSO A;  3TRQ A;  4PQ1 A;  4KND A;  1OE8 A;  4PUR A;  4TOP A;  1YF1 A;  2BJX A;  1M2A A;  2YCD A;  3IOS A;  2XBQ A;  4FYU A;  2B6M A;  2ZCT A;  1G6W A;  3HZ8 A;  4KB3 A;  5LCZ A;  4WBJ A;  5DJM A;  3FZ9 A;  3WT1 A;  3F6D A;  1A2M A;  2LNS A;  3H93 A;  5CYY A;  2HI7 A;  1ZGN A;  1GUM A;  1TI3 A;  1JZW A;  3Q6O A;  3QCP A;  4MK3 A;  2LV3 A;  1ERU A;  1R26 A;  3UMA A;  2VM2 A;  2VD1 A;  1TRW A;  3N9J A;  4WXT A;  4N30 A;  2C0F A;  2YWN A;  1U88 A;  3CSI A;  2WS2 A;  1YEX A;  6GST A;  4KUN A;  2MBS A;  4E8E A;  4RI6 A;  1GSD A;  2HFD A;  5IQY A;  4ULX A;  4KX4 A;  14GS A;  2X8G A;  3HXS A;  1O73 A;  1O6J A;  1ML6 A;  4QQ7 A;  1K0A A;  3L4N A;  4ML1 A;  4NPB A;  1X9M B;  1WWJ A;  4KDY A;  4K9Z A;  3LSZ A;  1XVW A;  3G7Y A;  1K3L A;  2HRF A;  2KP1 A;  5ECQ B;  1DBY A;  3F3Q A;  4MJC A;  5E4W A;  1PQN A;  2FD3 A;  2QSI A;  3IAS 2;  1UN2 A;  3EU4 A;  2IJY A;  3F4S A;  3KMO A;  1X5E A;  4O92 A;  1XWG A;  3KTL A;  4HU7 A;  3FKF A;  2HXK A;  4IS0 A;  3IRA A;  3FK8 A;  3RHC A;  4MJA A;  3E9J B;  3M3M A;  3HCZ A;  2IMD A;  5DAL B;  1AC1 A;  2YP6 A;  1XXU A;  3H1N A;  4TR1 B;  3ZRE A;  5FWG A;  4DSS A;  4OFM A;  4BL7 A;  3UVH A;  3A3T A;  3H79 A;  4NAX A;  3DGQ A;  1DE2 A;  2L6D A;  5B7C A;  5CP1 A;  4ZBB A;  4JRR A;  3LXZ A;  1PL2 A;  1TK0 B;  1YDK A;  1V9W A;  3EE2 A;  5H5R A;  4YAV A;  3EYT A;  2HSY A;  2M72 A;  3GKM A;  4G9H A;  2H0G A;  2ZNM A;  2JZS A;  4MMM A;  1SD8 A;  1TP9 A;  2PER A;  3HYP A;  4ZIJ A;  4L0W A;  2YV7 A;  8GSS A;  3GHA A;  2H1D A;  4RUV A;  3HHV A;  1BYE A;  3KIJ A;  4DSQ A;  5HFK A;  3C1R A;  4XRA A;  1T3B A;  2AJQ B;  2H30 A;  4XCS A;  1N2A A;  5IOX A;  1E6B A;  5HR2 A;  2I9H A;  1A2L A;  6GSW A;  3D4T A;  2RUF A;  3SWL A;  2VUP A;  1IYI A;  4TXV A;  2B7J A;  1A0R P;  4ECC A;  2XHF A;  1TKD B;  4BA7 A;  1JZO A;  4O7H A;  3DIE A;  1YJ6 A;  1MD4 A;  2MMA A;  1SL0 B;  1AW9 A;  3DRN A;  2NVL A;  1T4Y A;  3NIV A;  1GUK A;  3HJM A;  2PUK C;  1RQM A;  1FHE A;  2DJJ A;  2OE3 A;  3HDC A;  3TKS E;  2GZZ A;  3GMF A;  2PWJ A;  4JED A;  2H19 A;  5E59 A;  1MD3 A;  4I5Q A;  3F8U A;  4IHU A;  2F3M A;  4AF2 A;  4EC0 A;  3RDW A;  2QKE A;  4KE3 A;  6GSV A;  4MA9 A;  6GSY A;  1B4Q A;  3ZTL A;  2TIR A;  4FIW A;  4IGJ A;  4YQM A;  4IQA A;  2MMO A;  3GTU A;  1X9W B;  1HNA A;  4K0G A;  3MNG A;  2YJH A;  1YY7 A;  1NW2 A;  4PQH A;  3DXB A;  3W6G A;  5IO0 A;  1Z5Y E;  4N10 A;  4LMV A;  4G10 A;  2NTO A;  1SKS B;  3GKN A;  2H01 A;  3ZIV A;  3VWW A;  2HZF A;  5DJL A;  3ZYW A;  3BJ5 A;  2DMM A;  4HJM A;  2GQK A;  3TRP A;  2L59 A;  5H5Q A;  3KZQ A;  1JFU A;  1BAY A;  2QC7 A;  4MZW A;  2VCQ A;  4DEJ A;  1Q98 A;  2H76 A;  2IIY A;  1WE0 A;  3IV4 A;  4TKY A;  1PX7 A;  1W89 A;  2C4J A;  4NHW A;  3RHB A;  5FT3 A;  1MEK A;  3TJB A;  1PX6 A;  3TJG A;  5IMZ A;  1XPV A;  1E2Y A;  1T00 A;  1TU8 A;  4HDE A;  2VM1 A;  3CSH A;  1F2E A;  1A23 A;  3UAR A;  1B9Y C;  1YKC A;  1J0F A;  1MDJ A;  3QPM A;  4TVE A;  3IPZ A;  2AB6 A;  4F0B A;  4MJE A;  2HSH A;  3M1G A;  4EF0 A;  2KOK A;  3GRX A;  1Q4J A;  3UAP A;  2DIZ A;  3UVT A;  5JWQ B;  1K0B A;  3QFA C;  3A2V A;  3ME8 A;  3NOF A;  2H6X A;  3QOU A;  5INY A;  1PKW A;  2CV4 A;  1GSS A;  1ACV A;  5EVO A;  3FR3 A;  2VCV A;  2YAN A;  1XOA A;  3GKX A;  4WKW A;  5C04 A;  4Q5Q A;  3RAZ A;  5F07 A;  3HA9 A;  2FA4 A;  1F6M C;  2LS5 A;  1F37 A;  2IN3 A;  3SBC A;  2G0F A;  4JR6 A;  2C1Y A; 
#chains in the Genus database with same CATH topology
 5HR1 A;  4DSR A;  3GFK A;  3P8W A;  4HZ2 A;  2LEG A;  2C80 A;  2J23 A;  4IKH A;  2NBS A;  4K7N A;  4ECJ A;  2IFQ B;  3U6V A;  1O7U A;  3VWX A;  4K2D A;  2YV9 A;  1GRX A;  3ZFB A;  1YQ1 A;  4K6X A;  2FCH A;  3GKK A;  2X4A A;  3F63 A;  4EDY A;  1XWK A;  5G2Z A;  3KXO A;  4XS6 A;  5GZZ B;  4KAE A;  1TI1 A;  3GNJ A;  4PX1 A;  1ZMA A;  1EGR A;  5G30 A;  2GT6 A;  3TUE A;  1M9B A;  5DDL A;  1SYR A;  1U87 A;  4FH8 A;  5G1K A;  4K7I A;  3GIX A;  5B6M A;  2L6C A;  3VK9 A;  1GUL A;  2K6V A;  4K0N A;  3O6T A;  4LA1 A;  1GTB A;  1XVQ A;  2GSR A;  1K0D A;  1M3J A;  3UL3 A;  3APS A;  2IMK A;  4G2E A;  5IPG A;  4X1U A;  3D5J A;  1NSW A;  2H74 A;  2F51 A;  5KEJ A;  2CZ2 A;  1GUH A;  1ZYP A;  3LYP A;  4F2I A;  2DBC A;  3GYK A;  2ON7 A;  4I97 A;  3VPQ A;  2LQO A;  1K3O A;  5F06 A;  4MAB A;  2YZH A;  4LMW A;  5ELA A;  1V58 A;  3LQ7 A;  11GS A;  3ZIJ A;  2E2M A;  3ERW A;  4TW5 A;  4YQV A;  1O8X A;  2FY6 A;  4GTU A;  2QA1 A;  1TW9 A;  4N0V A;  4KW6 A;  4HQZ A;  2P5Q A;  1GSF A;  2GST A;  4J57 E;  5IMA A;  4ZL9 A;  3D0Z A;  2WUL A;  1QXH A;  2GQL A;  2IPA A;  4GLT A;  5IIZ A;  3HVX A;  3G9B A;  3Q74 A;  5DAK A;  5ECH B;  5AIS A;  4GSS A;  1GWC A;  2WJU A;  5ELG A;  4XTS A;  2YJ7 A;  1X5D A;  4RQX A;  3WGD A;  2RUE A;  4NV2 A;  2FHE A;  1RW1 A;  6GSS A;  3WT2 A;  5IM9 A;  3LYK A;  5CRH A;  1OYJ A;  2VL2 A;  4PGT A;  1XOB A;  2V6K A;  3CTF A;  2DML A;  2DC5 A;  2H1A A;  3K8N A;  4GWR A;  2Z9S A;  2HZE B;  5ID2 A;  1OC3 A;  3EUR A;  2D2Z A;  5A4V A;  5D9T A;  3LOR A;  1OC9 A;  5IO2 A;  4MP4 A;  1AUC A;  2VCX A;  4WR5 A;  4EKZ A;  3PIN A;  5D8I A;  5CO3 A;  2HNL A;  1QGV A;  1XW5 A;  4YAP A;  5A4U A;  1VF1 A;  1BX9 A;  1KTE A;  3KEB A;  4XS4 B;  4GXZ A;  1TXX A;  1V57 A;  3KP8 A;  4I8B A;  2NDO A;  1S3D A;  6GSU A;  2VL3 A;  1ERT A;  1NM3 A;  1WPI A;  3MAK A;  3J7Y k;  3KMN A;  1TDI A;  1SK2 A;  2LUS A;  3LXT A;  3QR6 A;  1WOU A;  5DVB A;  3LGC A;  4OFN A;  1ZYN A;  1A24 A;  1K0M A;  3QAG A;  2EIQ A;  1EWX A;  4ZB8 A;  1PA3 A;  2DKI A;  2PU9 C;  2PMT A;  2A2S A;  2DJK A;  4Q5N A;  2X99 A;  2GGT A;  4MH3 A;  4MF7 A;  4Z2R A;  1R5A A;  2HSM A;  1HYU A;  1EOH A;  5D9X A;  3M9K A;  1AQV A;  1F3A A;  5ECS A;  4XIH A;  1XWB A;  3CYN A;  4ECI A;  2H0H A;  2HRN A;  4EL1 A;  2EC4 A;  1FB6 A;  2VO4 A;  4ZIL A;  1VGL A;  3VI5 A;  5IMV A;  3TOT A;  3BCI A;  1M7T A;  3A5W A;  3KTB A;  1ZZY A;  5CRW A;  1Y25 A;  3C73 A;  3TKS A;  3ZFL A;  4YH2 A;  3LFL A;  3FMW A;  5ECR B;  2YWO A;  3HVS A;  1AIU A;  2N5F A;  5J41 A;  2O85 A;  1T8E B;  4TR4 A;  5L71 A;  1O85 A;  1WJK A;  3EC3 A;  2QA2 A;  1M0U A;  22GS A;  2VAF A;  1PD2 1;  2VL9 A;  3RPN A;  4ZL8 A;  4PNF A;  5LNK e;  1OKT A;  5KN3 A;  5G5F A;  4OMV A;  1Z7P A;  2P0G A;  1DUG A;  4KF9 A;  2B7K A;  4I2U A;  3VPT A;  2WRT A;  1UC7 A;  3I6A A;  4Q5F A;  1Z3E A;  5CRE A;  2IMF A;  5HFI A;  4WBR D;  1SK1 A;  4NWY A;  2FWG A;  9GSS A;  5JWO B;  1KBN A;  5A5K A;  3EMP A;  1M2D A;  4EIQ A;  3TGZ A;  2ALB A;  1U6T A;  4YKG A;  1F3B A;  1EV9 A;  2AHE A;  5DAL A;  1KNG A;  4TR1 A;  4D73 B;  3TOU A;  2CAQ A;  1XW6 A;  2YOI A;  1G0T A;  2CX3 A;  4POL A;  4CHS A;  2GZP A;  2EIR A;  2CAI A;  2X8C A;  4EXJ A;  2A4V A;  1G7O A;  1I5G A;  2MMN A;  3IA1 A;  1XCC A;  1TU7 A;  3CRU A;  1EP7 A;  4P3Y B;  4HUA A;  4WF4 A;  3IBH A;  3IK9 A;  3MYD A;  4LL1 B;  2EIO A;  2N5B A;  2L4C A;  3QDN A;  5C00 A;  4L0U A;  4FYB A;  1SJ6 A;  4HZ4 A;  4BVY A;  5ENU A;  1G7E A;  3KJY A;  1SL1 B;  1XG8 A;  5DCG A;  3HJP A;  2K8S A;  4D73 A;  1WP0 A;  4TXO B;  1ZYQ B;  1XW9 A;  4WET A;  4TRX A;  1HNB A;  2V32 A;  1HQO A;  1USB A;  4EUY A;  1GTI A;  1HD2 A;  1QFN A;  2OJL A;  1PMT A;  1V40 A;  3L9S A;  3FYG A;  4IJI A;  2C0D A;  1QMV A;  2E7P A;  2LRC A;  1SKW B;  1BQ7 A;  4HJ2 A;  3HVN A;  1TK5 B;  1V98 A;  2KUC A;  3IHG A;  2I3Y A;  2F8A A;  3H8Q A;  5F0G A;  3L0H A;  2A2R A;  2G2Q A;  4IVF A;  5F05 A;  10GS A;  4ACS A;  4AJ6 A;  2FUG 2;  4K8M A;  5GST A;  3U5R E;  2LJR A;  3I9V 2;  3TKP A;  1CQG A;  1THX A;  2JZR A;  4V1A g;  4MZB A;  3HD5 A;  1ILO A;  4JU5 A;  1XBS A;  3WYW A;  1VF3 A;  1V2A A;  4MLY A;  1U3A A;  1YZX A;  1SD9 A;  2FLS A;  2KP2 A;  2L4Q A;  1JHB A;  1OKD A;  1SEN A;  2C0E A;  2OKA A;  2F9S A;  3EWL A;  4TR0 A;  2BTO T;  5GSS A;  1Y6E A;  1FOH A;  1NHY A;  2OAC A;  3A5I A;  1TTZ A;  1EOG A;  2HE3 A;  1TK8 B;  3HKR A;  3ZML A;  3TJF A;  2B1K A;  4ZL7 A;  5HR0 A;  3OR5 A;  3ERF A;  3TKR A;  2VCZ A;  4HU9 A;  3F3R A;  2YN1 A;  3DD3 A;  2CT6 A;  4KCE A;  3G7I A;  1LJR A;  2V1M A;  1B8X A;  3MDK A;  5LD0 A;  3GL5 A;  2AV4 A;  4V2L A;  4CY6 A;  3FR6 A;  3PPU A;  5EPF A;  1GP1 A;  20GS A;  4IQ1 A;  3LWA A;  4ZBD A;  5F8B A;  4KH7 A;  1O81 A;  3D6I A;  2M80 A;  3F0I A;  1K0N A;  2VLV A;  2GLR A;  3NZN A;  2JU5 A;  2AUV A;  3MSZ A;  4OCE A;  3APO A;  2XBI A;  1M9A A;  1ABA A;  3TJK A;  1FW1 A;  1R5P A;  2OA7 A;  1B4P A;  2XC2 A;  5KOW A;  4OD7 A;  2PPT A;  1GSE A;  3PR8 A;  3CBU A;  2PVQ A;  1JLV A;  3IE3 A;  3GUS A;  2CX4 A;  2JSZ A;  4MDC A;  5ECN B;  3UEM A;  1QUW A;  3FRC A;  1WMJ A;  3IR4 A;  1M2B A;  2H8L A;  5JWR B;  1PGT A;  16GS A;  2V6O A;  1ZCP A;  1GTU A;  4GQF A;  5AGY A;  3IHQ A;  2VCT A;  3ZVJ D;  2H71 A;  1A0F A;  5ECL B;  3F4R A;  1AAZ A;  4PUF C;  3EIN A;  4L5L A;  2K8V A;  4F9Z A;  2VLU A;  2CZ3 A;  4MJB A;  2OBK A;  4BVX A;  3QMX A;  1YF0 A;  1X9S B;  1XIY A;  3DVX A;  4I6X A;  2TRX A;  3QD9 A;  3TB2 A;  5CRD A;  3FEU A;  3M0F A;  2LJK A;  3DML A;  4QL9 A;  1PL1 A;  3A2X A;  2CA8 A;  1PSQ A;  1M99 A;  3ERG A;  2RM5 A;  2H1G A;  3TDG A;  3CXG A;  3C71 A;  4ML6 A;  2M46 A;  4X0X A;  3M8N A;  1K0C A;  1FAA A;  4XRD A;  3GA4 A;  2IFQ A;  2GT5 A;  3TKQ A;  2HRA A;  3WGE A;  3IXR A;  4HSC X;  4G0K A;  5KN1 A;  1GTA A;  2JZT A;  4EVM A;  1GLP A;  2PGT A;  4GCI A;  2FGX A;  1TOF A;  3AY8 A;  4K1F A;  2VOC A;  3BOA A;  5B8B A;  2XPD A;  2MMZ A;  4POK A;  5AN1 A;  5G1L A;  2YWM A;  2LQQ A;  3ZMK A;  1RK4 A;  2R4V A;  4AGS A;  2X8H A;  1BJX A;  4F0C A;  2IME A;  4IN0 A;  2C3T A;  1OAZ A;  1UA5 A;  2LJA A;  3G7J A;  3GN3 A;  2R2J A;  2WFC A;  4NV5 A;  1K0O A;  5EY6 A;  4HOJ A;  4I2T A;  2A4H A;  3IC4 A;  4LL4 B;  3EMX A;  3DEX A;  5J9B A;  2FWF A;  4AJ7 A;  4BPY A;  2JAD A;  5EL8 A;  2ZUP A;  1Z9H A;  5J9C A;  2PVO C;  3DWV A;  1TRS A;  4X43 A;  4CDO A;  3JCM L;  1SJI A;  2C0G A;  4KDU A;  5ECI B;  5CRG A;  1VF4 A;  4KDX A;  5HFG A;  4DVC A;  2HLS A;  3F4T A;  3KD0 A;  2GSS A;  2MZC A;  2VL2 C;  1AQW A;  4ZB9 A;  1LU4 A;  5D9W A;  2H6Z A;  2CVD A;  3FHK A;  3H4K A;  5FHI A;  4GSN A;  3KGK A;  2R0C A;  4GST A;  1A8L A;  1MDK A;  2H70 A;  1EP8 A;  2WGR A;  2LRN A;  1UVZ A;  3WGX A;  3BD2 A;  1ON4 A;  2H6Y A;  2ES7 A;  1T7P B;  4MF6 A;  4LLR A;  1LBK A;  2R3X A;  1KEB A;  5B8A A;  3VFI A;  5H5S A;  1A8Y A;  2YZU A;  4NMU A;  1K3Y A;  3P90 A;  2V41 A;  4ZXG A;  3GL3 A;  1WRY A;  2I4A A;  2L5O A;  4X4J A;  3RPP A;  2WCI A;  4A5P A;  1ERV A;  2OBI A;  5IMC A;  3J7Y b;  1NHO A;  1PRX A;  2B5X A;  6GSX A;  3CQF A;  3S9F A;  2IMI A;  5DBQ A;  2L5L A;  2R0G A;  2HYX A;  1YKA A;  5J5N A;  1ZL9 A;  3VUR A;  1XFL A;  2HZE A;  1B48 A;  4MZC A;  3DVW A;  12GS A;  4Z2T A;  3ZZX A;  2OAD A;  5J3R A;  2K9F A;  4BWS A;  4E8H A;  4MF5 A;  4TR3 A;  3UJ1 A;  2I81 A;  2B5Y A;  4F82 A;  2GVP A;  3I43 A;  3UIW A;  3VWV A;  4XS4 A;  3TCO A;  4EDZ A;  4DSS B;  2GTU A;  3VLN A;  5GAP D;  3MIX A;  1SU9 A;  2C3N A;  4BL7 B;  1IYH A;  2N5A A;  5IPH A;  3LEF A;  2B3S A;  3KH7 A;  2HRK A;  3R2Q A;  3TKS C;  1FB0 A;  13GS A;  4PQI A;  1B9X C;  2X64 A;  3E3E A;  3ZIT A;  4G0I A;  4OO4 A;  2L57 A;  1PN0 A;  4OWY A;  2DIY A;  4IJ3 A;  5CNW A;  2DSA A;  3C1S A;  3D4M A;  3PGT A;  1J08 A;  3I69 A;  1GH2 A;  3O76 A;  2P5R A;  1SKR B;  2X49 A;  3CMI A;  4O32 A;  3ME7 A;  4ECB A;  2GS3 A;  2FNO A;  4K5S A;  3GV1 A;  3FR9 A;  3QAV A;  4IEL A;  4Q5R A;  1URM A;  2R5G A;  2H66 A;  1SL2 B;  2H0I A;  3IDV A;  3EPT A;  1Z6N A;  1Z7R A;  5G5E A;  2AAW A;  1FO5 A;  2J9H A;  1R7H A;  1F9M A;  1XWA A;  2JAC A;  2OE0 A;  1FOV A;  1T1V A;  1ST9 A;  4Z7X A;  4TN8 A;  4PXO A;  3V1W A;  5KN0 A;  2DJ2 A;  3L78 A;  1AQX A;  4EE0 A;  2YPM A;  4XHM A;  2WDU A;  4RQR A;  4PUA A;  1EV4 A;  2P31 A;  1PKZ A;  1Z6M A;  2VLT A;  1FVJ A;  3ZLP A;  1BG5 A;  1N8J A;  5D93 A;  2WB9 A;  3DKS A;  4PNG A;  4KA0 A;  4QL7 A;  2R6K A;  2QGV A;  4OO5 A;  4IW9 A;  4HI7 A;  1PFO A;  1H4O A;  1ERW A;  3GUR A;  1I9D A;  2B1L A;  4L8E A;  2KHP A;  4XS1 A;  1U3I A;  1VRS D;  2O7K A;  1FG4 A;  3GTU B;  3APQ A;  2C8U A;  2F8F A;  5JCW A;  5IMF A;  3LG6 A;  3MWH A;  3W8J A;  1W4V A;  1QQ2 A;  2VCW A;  1XZO A;  2RLI A;  4V1A p;  1DSB A;  4GF0 A;  4YQU A;  3P7X A;  4WR4 A;  2AYT A;  4POB A;  1FVK A;  3HJO A;  1G6Y A;  4KSM A;  1SK0 A;  3D22 A;  2LST A;  2KLX A;  2CVK A;  3F6F A;  5G31 A;  4N0Z A;  3CTG A;  3KM6 A;  3RBT A;  4NXI A;  3HY2 A;  3KCM A;  3M9J A;  3GX8 A;  4J56 E;  3QFB C;  4WF5 A;  1ZOF A;  5ABR A;  3ED3 A;  4NHZ A;  4L5O A;  1GLQ A;  2B5E A;  4TXO A;  2ON5 A;  1GSU A;  5D96 A;  4MCU A;  3FY7 A;  3GST A;  3QAW A;  5KN2 A;  1JZD A;  1AXD A;  2O87 A;  3C8E A;  4JR4 A;  2WZ9 A;  4JZQ A;  5GAN D;  2DLX A;  1CQH A;  1TRU A;  1ZYE A;  1TJD A;  2LNT A;  1OVN A;  5D73 A;  1S3A A;  3Q18 A;  1X5C A;  1JLW A;  2LRT A;  4IBP A;  2TRC P;  3GSS A;  3F9U A;  1GSQ A;  4HQS A;  4KGI A;  5JCG A;  3PH9 A;  4EO3 A;  1SYX A;  2C3Q A;  4HS1 A;  18GS A;  1THO A;  5DQY A;  3HZ4 A;  2I1U A;  2VD0 A;  3LW9 A;  4YKF A;  3ZRD A;  1DE1 A;  3WD6 A;  2RII A;  1TRV A;  3LJR A;  3O3T A;  4GRF A;  5DQS A;  3TRX A;  4RI7 A;  2H73 A;  4ZBA A;  3ZVJ A;  2JSY A;  5COH A;  4H86 A;  3FZ5 A;  2H75 A;  1X0R A;  3BBY A;  2VIM A;  5IOW A;  3ZL5 A;  4K7O A;  3VWU A;  4V2N A;  5IMD A;  4BWQ A;  2E0Q A;  5AIX A;  3A2W A;  2FWE A;  1GNE A;  3HVV A;  1C72 A;  4J2F A;  1EZK A;  1MDI A;  3L9U A;  4POM A;  5JCU A;  2FWH A;  2R37 A;  3GH6 A;  4IP6 A;  4FO5 A;  2DJ1 A;  2K18 A;  3DYR A;  2E2G A;  3EVI A;  4G19 A;  4MH2 A;  3EU3 A;  3UBL A;  3FW2 A;  5ECP B;  3C7M A;  3VI7 A;  2BMX A;  1JZR A;  1M3I A;  3E0U A;  3KH9 A;  5ECO B;  5D9V A;  1SJZ A;  2XPE A;  5HR3 A;  19GS A;  1H75 A;  4WEY A;  1XWC A;  2IL3 A;  1GNW A;  1VF2 A;  4KCA A;  5HQP A;  2H72 A;  5CAX A;  5BMU A;  2JL4 A;  5J4U A;  5ECK B;  4MPF A;  4ILF A;  2LTK A;  1J9B A;  4MPG A;  3IAM 2;  3IK7 A;  3FZ4 A;  3BCK A;  3GH9 A;  3FZA A;  1GL8 A;  1A2J A;  2H1B A;  4CW9 A;  4JE1 A;  1YEP A;  4OFT A;  3Q19 A;  3W8S A;  1O8W A;  2IWT A;  5BRT A;  2MYG A;  4N11 A;  1MTC A;  2FA8 A;  2MBT A;  1EEM A;  5DCH A;  1EGO A;  1OE7 A;  2CQ9 A;  5ECM B;  5B6N A;  3L9V A;  1GSY A;  3D21 A;  5DAK B;  1S3C A;  1QK8 A;  2RM6 A;  2UZ8 A;  3GX0 A;  2HT9 A;  1R4W A;  3CRT A;  4O5R A;  3N5O A;  7GSS A;  1EEJ A;  4EIP A;  2CVB A;  4V2M A;  1T4Z A;  2GSQ A;  3TJJ A;  4GQC A;  2NPB A;  1S3R A;  2YWI A;  5AIV A;  2PN8 A;  3P2A A;  3R3E A;  1BED A;  4JBB A;  2GQM A;  4IP1 A;  2DJ0 A;  4F03 A;  1HNC A;  3KP9 A;  2V2G A;  5ID2 B;  2GZY A;  4AJ8 A;  17GS A;  1PN9 A;  2GDR A;  2A2P A;  4ID0 A;  1OC9 B;  4OCF A;  4HEA 2;  4FYC A;  1OC8 A;  2OE1 A;  2O89 A;  2LKU A;  2PBJ A;  3US3 A;  3CSJ A;  3UOM A;  2DJ3 A;  3UBK A;  3ISO A;  2REM A;  4CY8 A;  4ZB6 A;  5A4W A;  1WIK A;  4ISD A;  2O8V B;  2YNX A;  4KSO A;  3TRQ A;  4PQ1 A;  4KND A;  1OE8 A;  4PUR A;  4TOP A;  1YF1 A;  2BJX A;  1M2A A;  2YCD A;  3IOS A;  2XBQ A;  4FYU A;  2B6M A;  2ZCT A;  1G6W A;  3HZ8 A;  4KB3 A;  2R0P A;  5LCZ A;  4WBJ A;  5DJM A;  3FZ9 A;  3WT1 A;  3F6D A;  1A2M A;  2LNS A;  3H93 A;  5CYY A;  2HI7 A;  1ZGN A;  1GUM A;  4O5U A;  1TI3 A;  1JZW A;  3Q6O A;  3QCP A;  4MK3 A;  2LV3 A;  1ERU A;  1R26 A;  4BIK A;  3UMA A;  2VM2 A;  2VD1 A;  1TRW A;  4WXT A;  3N9J A;  4N30 A;  2C0F A;  2YWN A;  1U88 A;  3CSI A;  2WS2 A;  1YEX A;  6GST A;  4KUN A;  5KOX A;  2MBS A;  4E8E A;  4RI6 A;  1GSD A;  2HFD A;  5IQY A;  4ULX A;  4KX4 A;  4PTS A;  14GS A;  2X8G A;  3HXS A;  1O73 A;  1O6J A;  1ML6 A;  4QQ7 A;  1K0A A;  3L4N A;  4ML1 A;  4NPB A;  1X9M B;  1WWJ A;  4KDY A;  4K9Z A;  3LSZ A;  1XVW A;  3G7Y A;  1K3L A;  2HRF A;  2KP1 A;  5ECQ B;  1DBY A;  3F3Q A;  4MJC A;  5E4W A;  1PQN A;  2FD3 A;  2QSI A;  3IAS 2;  1UN2 A;  3EU4 A;  2IJY A;  3F4S A;  3KMO A;  1X5E A;  4O92 A;  1XWG A;  3KTL A;  4HU7 A;  3FKF A;  2HXK A;  4IS0 A;  3IRA A;  3IC8 A;  3FK8 A;  3RHC A;  4MJA A;  3E9J B;  3M3M A;  3HCZ A;  2IMD A;  5DAL B;  1AC1 A;  2YP6 A;  1XXU A;  3H1N A;  4TR1 B;  3ZRE A;  5FWG A;  4DSS A;  4OFM A;  4BL7 A;  3UVH A;  3A3T A;  3H79 A;  4NAX A;  3DGQ A;  1DE2 A;  2L6D A;  5B7C A;  5CP1 A;  4ZBB A;  4JRR A;  3LXZ A;  1PL2 A;  1TK0 B;  1YDK A;  1V9W A;  3EE2 A;  5H5R A;  4YAV A;  3EYT A;  2HSY A;  2M72 A;  3GKM A;  4G9H A;  2H0G A;  2ZNM A;  2JZS A;  4MMM A;  1SD8 A;  1TP9 A;  2PER A;  3HYP A;  4ZIJ A;  4L0W A;  4BVY B;  2YV7 A;  8GSS A;  3GHA A;  2H1D A;  4RUV A;  3HHV A;  1BYE A;  3KIJ A;  4DSQ A;  5HFK A;  3C1R A;  4XRA A;  1T3B A;  2AJQ B;  2H30 A;  4XCS A;  1N2A A;  5IOX A;  1E6B A;  5HR2 A;  2I9H A;  1A2L A;  6GSW A;  3D4T A;  2RUF A;  3SWL A;  2VUP A;  1IYI A;  4TXV A;  4G0L A;  2B7J A;  1A0R P;  4ECC A;  2XHF A;  1TKD B;  4BA7 A;  1JZO A;  4O7H A;  3DIE A;  4FQU A;  1YJ6 A;  1MD4 A;  2MMA A;  1SL0 B;  1AW9 A;  3DRN A;  2NVL A;  1T4Y A;  3NIV A;  1GUK A;  3HJM A;  2PUK C;  1RQM A;  2DKH A;  1FHE A;  2DJJ A;  2OE3 A;  3HDC A;  3TKS E;  2GZZ A;  3GMF A;  2PWJ A;  4JED A;  2H19 A;  5E59 A;  1MD3 A;  4I5Q A;  3F8U A;  4IHU A;  2F3M A;  4AF2 A;  4EC0 A;  3RDW A;  2QKE A;  4KE3 A;  6GSV A;  4MA9 A;  6GSY A;  1B4Q A;  3ZTL A;  2TIR A;  4FIW A;  4IGJ A;  4YQM A;  4IQA A;  2MMO A;  3GTU A;  1X9W B;  1HNA A;  4K0G A;  3MNG A;  2YJH A;  1YY7 A;  1NW2 A;  4K2X A;  4PQH A;  3DXB A;  3W6G A;  5IO0 A;  1Z5Y E;  4N10 A;  4LMV A;  4G10 A;  2NTO A;  1SKS B;  3GKN A;  2H01 A;  3ZIV A;  3VWW A;  2HZF A;  5DJL A;  3ZYW A;  4MNN A;  3BJ5 A;  2DMM A;  4HJM A;  2GQK A;  3TRP A;  4O5Q A;  2L59 A;  5H5Q A;  3KZQ A;  1JFU A;  1BAY A;  2QC7 A;  4MZW A;  2VCQ A;  4DEJ A;  1Q98 A;  2H76 A;  2IIY A;  1WE0 A;  3IV4 A;  4K5R A;  4TKY A;  1PX7 A;  1W89 A;  2C4J A;  4NHW A;  3RHB A;  5FT3 A;  1MEK A;  3TJB A;  1PX6 A;  3TJG A;  4ICY A;  5IMZ A;  1XPV A;  1E2Y A;  1T00 A;  1TU8 A;  4HDE A;  2VM1 A;  3CSH A;  1F2E A;  1A23 A;  3UAR A;  1B9Y C;  1YKC A;  1J0F A;  1MDJ A;  3QPM A;  4TVE A;  4USS A;  3IPZ A;  2AB6 A;  4F0B A;  4MJE A;  2HSH A;  3M1G A;  4EF0 A;  2KOK A;  3GRX A;  1Q4J A;  3UAP A;  4BVX B;  2DIZ A;  3UVT A;  5JWQ B;  1K0B A;  3QFA C;  4Z2U A;  3A2V A;  3ME8 A;  3NOF A;  2H6X A;  3QOU A;  5INY A;  1PKW A;  2CV4 A;  1GSS A;  1ACV A;  5EVO A;  3FR3 A;  2VCV A;  2YAN A;  1XOA A;  3GKX A;  4WKW A;  5C04 A;  4Q5Q A;  3RAZ A;  5F07 A;  3HA9 A;  2FA4 A;  1F6M C;  2LS5 A;  1F37 A;  2IN3 A;  3SBC A;  2G0F A;  4JR6 A;  2C1Y A; 
#chains in the Genus database with same CATH homology
 5HR1 A;  4DSR A;  3GFK A;  3P8W A;  4HZ2 A;  2LEG A;  2C80 A;  2J23 A;  4IKH A;  2NBS A;  4K7N A;  4ECJ A;  2IFQ B;  3U6V A;  1O7U A;  3VWX A;  4K2D A;  2YV9 A;  1GRX A;  3ZFB A;  1YQ1 A;  4K6X A;  2FCH A;  3GKK A;  2X4A A;  3F63 A;  4EDY A;  1XWK A;  5G2Z A;  3KXO A;  4XS6 A;  5GZZ B;  4KAE A;  1TI1 A;  3GNJ A;  4PX1 A;  1ZMA A;  1EGR A;  5G30 A;  2GT6 A;  3TUE A;  1M9B A;  5DDL A;  1SYR A;  1U87 A;  4FH8 A;  5G1K A;  4K7I A;  3GIX A;  5B6M A;  2L6C A;  3VK9 A;  1GUL A;  2K6V A;  4K0N A;  3O6T A;  4LA1 A;  1GTB A;  1XVQ A;  2GSR A;  1K0D A;  3UL3 A;  3APS A;  2IMK A;  4G2E A;  5IPG A;  4X1U A;  3D5J A;  1NSW A;  2H74 A;  2F51 A;  5KEJ A;  2CZ2 A;  1GUH A;  1ZYP A;  3LYP A;  4F2I A;  2DBC A;  3GYK A;  2ON7 A;  4I97 A;  3VPQ A;  2LQO A;  1K3O A;  5F06 A;  4MAB A;  2YZH A;  4LMW A;  5ELA A;  1V58 A;  3LQ7 A;  11GS A;  3ZIJ A;  2E2M A;  3ERW A;  4TW5 A;  4YQV A;  1O8X A;  2FY6 A;  4GTU A;  2QA1 A;  1TW9 A;  4N0V A;  4KW6 A;  4HQZ A;  2P5Q A;  1GSF A;  2GST A;  4J57 E;  5IMA A;  4ZL9 A;  3D0Z A;  2WUL A;  1QXH A;  2GQL A;  2IPA A;  4GLT A;  5IIZ A;  3HVX A;  3G9B A;  3Q74 A;  5DAK A;  5ECH B;  5AIS A;  4GSS A;  1GWC A;  2WJU A;  5ELG A;  4XTS A;  2YJ7 A;  1X5D A;  4RQX A;  3WGD A;  2RUE A;  4NV2 A;  2FHE A;  1RW1 A;  6GSS A;  3WT2 A;  5IM9 A;  3LYK A;  5CRH A;  1OYJ A;  2VL2 A;  4PGT A;  1XOB A;  2V6K A;  3CTF A;  2DML A;  2DC5 A;  2H1A A;  3K8N A;  4GWR A;  2Z9S A;  2HZE B;  5ID2 A;  1OC3 A;  3EUR A;  2D2Z A;  5A4V A;  5D9T A;  3LOR A;  1OC9 A;  5IO2 A;  4MP4 A;  1AUC A;  2VCX A;  4WR5 A;  4EKZ A;  3PIN A;  5D8I A;  5CO3 A;  2HNL A;  1QGV A;  1XW5 A;  4YAP A;  5A4U A;  1VF1 A;  1BX9 A;  1KTE A;  3KEB A;  4XS4 B;  4GXZ A;  1TXX A;  1V57 A;  3KP8 A;  4I8B A;  2NDO A;  1S3D A;  6GSU A;  2VL3 A;  1ERT A;  1NM3 A;  1WPI A;  3MAK A;  3J7Y k;  3KMN A;  1TDI A;  1SK2 A;  2LUS A;  3LXT A;  3QR6 A;  1WOU A;  5DVB A;  3LGC A;  4OFN A;  1ZYN A;  1A24 A;  1K0M A;  3QAG A;  2EIQ A;  1EWX A;  4ZB8 A;  1PA3 A;  2DKI A;  2PU9 C;  2PMT A;  2A2S A;  2DJK A;  4Q5N A;  2X99 A;  2GGT A;  4MH3 A;  4MF7 A;  4Z2R A;  1R5A A;  2HSM A;  1HYU A;  1EOH A;  5D9X A;  3M9K A;  1AQV A;  1F3A A;  5ECS A;  4XIH A;  1XWB A;  3CYN A;  4ECI A;  2H0H A;  2HRN A;  4EL1 A;  2EC4 A;  1FB6 A;  2VO4 A;  4ZIL A;  1VGL A;  3VI5 A;  5IMV A;  3TOT A;  3BCI A;  1M7T A;  3A5W A;  3KTB A;  1ZZY A;  5CRW A;  1Y25 A;  3C73 A;  3TKS A;  3ZFL A;  4YH2 A;  3LFL A;  3FMW A;  5ECR B;  2YWO A;  3HVS A;  1AIU A;  2N5F A;  5J41 A;  2O85 A;  1T8E B;  4TR4 A;  5L71 A;  1O85 A;  1WJK A;  3EC3 A;  2QA2 A;  1M0U A;  22GS A;  2VAF A;  1PD2 1;  2VL9 A;  3RPN A;  4ZL8 A;  4PNF A;  5LNK e;  1OKT A;  5KN3 A;  5G5F A;  4OMV A;  1Z7P A;  2P0G A;  1DUG A;  4KF9 A;  2B7K A;  4I2U A;  3VPT A;  2WRT A;  1UC7 A;  3I6A A;  4Q5F A;  1Z3E A;  5CRE A;  2IMF A;  5HFI A;  4WBR D;  1SK1 A;  4NWY A;  2FWG A;  9GSS A;  5JWO B;  1KBN A;  5A5K A;  3EMP A;  1M2D A;  4EIQ A;  3TGZ A;  2ALB A;  1U6T A;  4YKG A;  1F3B A;  1EV9 A;  2AHE A;  5DAL A;  1KNG A;  4TR1 A;  4D73 B;  3TOU A;  2CAQ A;  1XW6 A;  2YOI A;  1G0T A;  2CX3 A;  4POL A;  4CHS A;  2GZP A;  2EIR A;  2CAI A;  2X8C A;  4EXJ A;  2A4V A;  1G7O A;  1I5G A;  2MMN A;  3IA1 A;  1XCC A;  1TU7 A;  3CRU A;  1EP7 A;  4P3Y B;  4HUA A;  4WF4 A;  3IBH A;  3IK9 A;  3MYD A;  4LL1 B;  2EIO A;  2N5B A;  2L4C A;  3QDN A;  5C00 A;  4L0U A;  4FYB A;  1SJ6 A;  4HZ4 A;  4BVY A;  5ENU A;  1G7E A;  3KJY A;  1SL1 B;  5DCG A;  3HJP A;  2K8S A;  4D73 A;  1WP0 A;  4TXO B;  1ZYQ B;  1XW9 A;  4WET A;  4TRX A;  1HNB A;  2V32 A;  1HQO A;  1USB A;  4EUY A;  1GTI A;  1HD2 A;  1QFN A;  2OJL A;  1PMT A;  1V40 A;  3L9S A;  3FYG A;  4IJI A;  2C0D A;  1QMV A;  2E7P A;  2LRC A;  1SKW B;  1BQ7 A;  4HJ2 A;  1TK5 B;  1V98 A;  2KUC A;  3IHG A;  2I3Y A;  2F8A A;  3H8Q A;  5F0G A;  3L0H A;  2A2R A;  2G2Q A;  4IVF A;  5F05 A;  10GS A;  4ACS A;  4AJ6 A;  2FUG 2;  4K8M A;  5GST A;  3U5R E;  2LJR A;  3I9V 2;  3TKP A;  1CQG A;  1THX A;  2JZR A;  4V1A g;  4MZB A;  3HD5 A;  1ILO A;  4JU5 A;  1XBS A;  3WYW A;  1VF3 A;  1V2A A;  4MLY A;  1U3A A;  1YZX A;  1SD9 A;  2FLS A;  2KP2 A;  2L4Q A;  1JHB A;  1OKD A;  1SEN A;  2C0E A;  2OKA A;  2F9S A;  3EWL A;  4TR0 A;  2BTO T;  5GSS A;  1Y6E A;  1FOH A;  1NHY A;  2OAC A;  3A5I A;  1TTZ A;  1EOG A;  2HE3 A;  1TK8 B;  3HKR A;  3ZML A;  3TJF A;  2B1K A;  4ZL7 A;  5HR0 A;  3OR5 A;  3ERF A;  3TKR A;  2VCZ A;  4HU9 A;  3F3R A;  2YN1 A;  3DD3 A;  2CT6 A;  4KCE A;  3G7I A;  1LJR A;  2V1M A;  1B8X A;  3MDK A;  5LD0 A;  3GL5 A;  2AV4 A;  4V2L A;  4CY6 A;  3FR6 A;  3PPU A;  5EPF A;  1GP1 A;  20GS A;  4IQ1 A;  3LWA A;  4ZBD A;  5F8B A;  4KH7 A;  1O81 A;  3D6I A;  2M80 A;  3F0I A;  1K0N A;  2VLV A;  2GLR A;  3NZN A;  2JU5 A;  2AUV A;  3MSZ A;  4OCE A;  3APO A;  2XBI A;  1M9A A;  1ABA A;  3TJK A;  1FW1 A;  1R5P A;  2OA7 A;  1B4P A;  2XC2 A;  5KOW A;  4OD7 A;  2PPT A;  1GSE A;  3PR8 A;  3CBU A;  2PVQ A;  1JLV A;  3IE3 A;  3GUS A;  2CX4 A;  2JSZ A;  4MDC A;  5ECN B;  3UEM A;  1QUW A;  3FRC A;  1WMJ A;  3IR4 A;  1M2B A;  2H8L A;  5JWR B;  1PGT A;  16GS A;  2V6O A;  1ZCP A;  1GTU A;  4GQF A;  5AGY A;  3IHQ A;  2VCT A;  3ZVJ D;  2H71 A;  1A0F A;  5ECL B;  3F4R A;  1AAZ A;  4PUF C;  3EIN A;  4L5L A;  2K8V A;  4F9Z A;  2VLU A;  2CZ3 A;  4MJB A;  2OBK A;  4BVX A;  3QMX A;  1YF0 A;  1X9S B;  1XIY A;  3DVX A;  4I6X A;  2TRX A;  3QD9 A;  3TB2 A;  5CRD A;  3FEU A;  3M0F A;  2LJK A;  3DML A;  4QL9 A;  1PL1 A;  3A2X A;  2CA8 A;  1PSQ A;  1M99 A;  3ERG A;  2RM5 A;  2H1G A;  3TDG A;  3CXG A;  3C71 A;  4ML6 A;  2M46 A;  4X0X A;  3M8N A;  1K0C A;  1FAA A;  4XRD A;  3GA4 A;  2IFQ A;  2GT5 A;  3TKQ A;  2HRA A;  3WGE A;  3IXR A;  4G0K A;  5KN1 A;  1GTA A;  2JZT A;  4EVM A;  1GLP A;  2PGT A;  4GCI A;  2FGX A;  1TOF A;  3AY8 A;  4K1F A;  2VOC A;  3BOA A;  5B8B A;  2XPD A;  2MMZ A;  4POK A;  5AN1 A;  5G1L A;  2YWM A;  2LQQ A;  3ZMK A;  1RK4 A;  2R4V A;  4AGS A;  2X8H A;  1BJX A;  4F0C A;  2IME A;  4IN0 A;  2C3T A;  1OAZ A;  1UA5 A;  2LJA A;  3G7J A;  3GN3 A;  2R2J A;  2WFC A;  4NV5 A;  1K0O A;  5EY6 A;  4HOJ A;  4I2T A;  2A4H A;  3IC4 A;  4LL4 B;  3EMX A;  3DEX A;  5J9B A;  2FWF A;  4AJ7 A;  4BPY A;  2JAD A;  5EL8 A;  2ZUP A;  1Z9H A;  5J9C A;  2PVO C;  3DWV A;  1TRS A;  4X43 A;  4CDO A;  3JCM L;  1SJI A;  2C0G A;  4KDU A;  5ECI B;  5CRG A;  1VF4 A;  4KDX A;  5HFG A;  4DVC A;  2HLS A;  3F4T A;  3KD0 A;  2GSS A;  2MZC A;  2VL2 C;  1AQW A;  4ZB9 A;  1LU4 A;  5D9W A;  2H6Z A;  2CVD A;  3FHK A;  3H4K A;  5FHI A;  4GSN A;  3KGK A;  2R0C A;  4GST A;  1A8L A;  1MDK A;  2H70 A;  1EP8 A;  2WGR A;  2LRN A;  1UVZ A;  3WGX A;  3BD2 A;  1ON4 A;  2H6Y A;  2ES7 A;  1T7P B;  4MF6 A;  4LLR A;  1LBK A;  2R3X A;  1KEB A;  5B8A A;  3VFI A;  5H5S A;  1A8Y A;  2YZU A;  4NMU A;  1K3Y A;  3P90 A;  2V41 A;  4ZXG A;  3GL3 A;  1WRY A;  2I4A A;  2L5O A;  4X4J A;  3RPP A;  2WCI A;  4A5P A;  1ERV A;  2OBI A;  5IMC A;  3J7Y b;  1NHO A;  1PRX A;  2B5X A;  6GSX A;  3S9F A;  2IMI A;  5DBQ A;  2L5L A;  2R0G A;  2HYX A;  1YKA A;  5J5N A;  1ZL9 A;  3VUR A;  1XFL A;  2HZE A;  1B48 A;  4MZC A;  3DVW A;  12GS A;  4Z2T A;  3ZZX A;  2OAD A;  5J3R A;  2K9F A;  4BWS A;  4E8H A;  4MF5 A;  4TR3 A;  3UJ1 A;  2I81 A;  2B5Y A;  4F82 A;  2GVP A;  3I43 A;  3UIW A;  3VWV A;  4XS4 A;  3TCO A;  4EDZ A;  4DSS B;  2GTU A;  3VLN A;  5GAP D;  3MIX A;  1SU9 A;  2C3N A;  4BL7 B;  1IYH A;  2N5A A;  5IPH A;  3LEF A;  2B3S A;  3KH7 A;  2HRK A;  3R2Q A;  3TKS C;  1FB0 A;  13GS A;  4PQI A;  1B9X C;  2X64 A;  3E3E A;  3ZIT A;  4G0I A;  4OO4 A;  2L57 A;  1PN0 A;  4OWY A;  2DIY A;  4IJ3 A;  5CNW A;  2DSA A;  3C1S A;  3D4M A;  3PGT A;  1J08 A;  3I69 A;  1GH2 A;  3O76 A;  2P5R A;  1SKR B;  2X49 A;  3CMI A;  4O32 A;  3ME7 A;  4ECB A;  2GS3 A;  2FNO A;  4K5S A;  3GV1 A;  3FR9 A;  3QAV A;  4IEL A;  4Q5R A;  1URM A;  2R5G A;  2H66 A;  1SL2 B;  2H0I A;  3IDV A;  3EPT A;  1Z6N A;  1Z7R A;  5G5E A;  2AAW A;  1FO5 A;  2J9H A;  1R7H A;  1F9M A;  1XWA A;  2JAC A;  2OE0 A;  1FOV A;  1T1V A;  1ST9 A;  4Z7X A;  4TN8 A;  4PXO A;  3V1W A;  5KN0 A;  2DJ2 A;  3L78 A;  1AQX A;  4EE0 A;  2YPM A;  4XHM A;  2WDU A;  4RQR A;  4PUA A;  1EV4 A;  2P31 A;  1PKZ A;  1Z6M A;  2VLT A;  1FVJ A;  3ZLP A;  1BG5 A;  1N8J A;  5D93 A;  2WB9 A;  3DKS A;  4PNG A;  4KA0 A;  4QL7 A;  2R6K A;  2QGV A;  4OO5 A;  4IW9 A;  4HI7 A;  1H4O A;  1ERW A;  3GUR A;  1I9D A;  2B1L A;  4L8E A;  2KHP A;  4XS1 A;  1U3I A;  1VRS D;  2O7K A;  1FG4 A;  3GTU B;  3APQ A;  2C8U A;  2F8F A;  5JCW A;  5IMF A;  3LG6 A;  3MWH A;  3W8J A;  1W4V A;  1QQ2 A;  2VCW A;  1XZO A;  2RLI A;  4V1A p;  1DSB A;  4GF0 A;  4YQU A;  3P7X A;  4WR4 A;  2AYT A;  4POB A;  1FVK A;  3HJO A;  1G6Y A;  4KSM A;  1SK0 A;  3D22 A;  2LST A;  2KLX A;  2CVK A;  3F6F A;  5G31 A;  4N0Z A;  3CTG A;  3KM6 A;  3RBT A;  4NXI A;  3HY2 A;  3KCM A;  3M9J A;  3GX8 A;  4J56 E;  3QFB C;  4WF5 A;  1ZOF A;  5ABR A;  3ED3 A;  4NHZ A;  4L5O A;  1GLQ A;  2B5E A;  4TXO A;  2ON5 A;  1GSU A;  5D96 A;  4MCU A;  3FY7 A;  3GST A;  3QAW A;  5KN2 A;  1JZD A;  1AXD A;  2O87 A;  3C8E A;  4JR4 A;  2WZ9 A;  4JZQ A;  5GAN D;  2DLX A;  1CQH A;  1TRU A;  1ZYE A;  1TJD A;  2LNT A;  1OVN A;  5D73 A;  1S3A A;  3Q18 A;  1X5C A;  1JLW A;  2LRT A;  4IBP A;  2TRC P;  3GSS A;  3F9U A;  1GSQ A;  4HQS A;  4KGI A;  5JCG A;  3PH9 A;  4EO3 A;  1SYX A;  2C3Q A;  4HS1 A;  18GS A;  1THO A;  5DQY A;  3HZ4 A;  2I1U A;  2VD0 A;  3LW9 A;  4YKF A;  3ZRD A;  1DE1 A;  3WD6 A;  2RII A;  1TRV A;  3LJR A;  3O3T A;  4GRF A;  5DQS A;  3TRX A;  4RI7 A;  2H73 A;  4ZBA A;  3ZVJ A;  2JSY A;  5COH A;  4H86 A;  3FZ5 A;  2H75 A;  1X0R A;  3BBY A;  2VIM A;  5IOW A;  3ZL5 A;  4K7O A;  3VWU A;  4V2N A;  5IMD A;  4BWQ A;  2E0Q A;  5AIX A;  3A2W A;  2FWE A;  1GNE A;  3HVV A;  1C72 A;  4J2F A;  1EZK A;  1MDI A;  3L9U A;  4POM A;  5JCU A;  2FWH A;  2R37 A;  3GH6 A;  4IP6 A;  4FO5 A;  2DJ1 A;  2K18 A;  3DYR A;  2E2G A;  3EVI A;  4G19 A;  4MH2 A;  3EU3 A;  3UBL A;  3FW2 A;  5ECP B;  3C7M A;  3VI7 A;  2BMX A;  1JZR A;  3E0U A;  3KH9 A;  5ECO B;  5D9V A;  1SJZ A;  2XPE A;  5HR3 A;  19GS A;  1H75 A;  4WEY A;  1XWC A;  2IL3 A;  1GNW A;  1VF2 A;  4KCA A;  5HQP A;  2H72 A;  5CAX A;  5BMU A;  2JL4 A;  5J4U A;  5ECK B;  4MPF A;  4ILF A;  2LTK A;  1J9B A;  4MPG A;  3IAM 2;  3IK7 A;  3FZ4 A;  3BCK A;  3GH9 A;  3FZA A;  1GL8 A;  1A2J A;  2H1B A;  4CW9 A;  4JE1 A;  1YEP A;  4OFT A;  3Q19 A;  3W8S A;  1O8W A;  2IWT A;  5BRT A;  2MYG A;  4N11 A;  1MTC A;  2FA8 A;  2MBT A;  1EEM A;  5DCH A;  1EGO A;  1OE7 A;  2CQ9 A;  5ECM B;  5B6N A;  3L9V A;  1GSY A;  3D21 A;  5DAK B;  1S3C A;  1QK8 A;  2RM6 A;  2UZ8 A;  3GX0 A;  2HT9 A;  1R4W A;  3CRT A;  4O5R A;  3N5O A;  7GSS A;  1EEJ A;  4EIP A;  2CVB A;  4V2M A;  1T4Z A;  2GSQ A;  3TJJ A;  4GQC A;  2NPB A;  2YWI A;  5AIV A;  2PN8 A;  3P2A A;  3R3E A;  1BED A;  4JBB A;  2GQM A;  4IP1 A;  2DJ0 A;  4F03 A;  1HNC A;  3KP9 A;  2V2G A;  5ID2 B;  2GZY A;  4AJ8 A;  17GS A;  1PN9 A;  2GDR A;  2A2P A;  4ID0 A;  1OC9 B;  4OCF A;  4HEA 2;  4FYC A;  1OC8 A;  2OE1 A;  2O89 A;  2LKU A;  2PBJ A;  3US3 A;  3CSJ A;  3UOM A;  2DJ3 A;  3UBK A;  3ISO A;  2REM A;  4CY8 A;  4ZB6 A;  5A4W A;  1WIK A;  4ISD A;  2O8V B;  2YNX A;  4KSO A;  3TRQ A;  4PQ1 A;  4KND A;  1OE8 A;  4PUR A;  4TOP A;  1YF1 A;  2BJX A;  1M2A A;  2YCD A;  3IOS A;  2XBQ A;  4FYU A;  2B6M A;  2ZCT A;  1G6W A;  3HZ8 A;  4KB3 A;  2R0P A;  5LCZ A;  4WBJ A;  5DJM A;  3FZ9 A;  3WT1 A;  3F6D A;  1A2M A;  2LNS A;  3H93 A;  5CYY A;  2HI7 A;  1ZGN A;  1GUM A;  4O5U A;  1TI3 A;  1JZW A;  3Q6O A;  3QCP A;  4MK3 A;  2LV3 A;  1ERU A;  1R26 A;  3UMA A;  2VM2 A;  2VD1 A;  1TRW A;  3N9J A;  4WXT A;  4N30 A;  2C0F A;  2YWN A;  1U88 A;  3CSI A;  2WS2 A;  1YEX A;  6GST A;  4KUN A;  5KOX A;  2MBS A;  4E8E A;  4RI6 A;  1GSD A;  2HFD A;  5IQY A;  4ULX A;  4KX4 A;  4PTS A;  14GS A;  2X8G A;  3HXS A;  1O73 A;  1O6J A;  1ML6 A;  4QQ7 A;  1K0A A;  3L4N A;  4ML1 A;  4NPB A;  1X9M B;  1WWJ A;  4KDY A;  4K9Z A;  3LSZ A;  1XVW A;  3G7Y A;  1K3L A;  2HRF A;  2KP1 A;  5ECQ B;  1DBY A;  3F3Q A;  4MJC A;  5E4W A;  1PQN A;  2FD3 A;  2QSI A;  3IAS 2;  1UN2 A;  3EU4 A;  2IJY A;  3F4S A;  3KMO A;  1X5E A;  4O92 A;  1XWG A;  3KTL A;  4HU7 A;  3FKF A;  2HXK A;  4IS0 A;  3IRA A;  3IC8 A;  3FK8 A;  3RHC A;  4MJA A;  3E9J B;  3M3M A;  3HCZ A;  2IMD A;  5DAL B;  1AC1 A;  2YP6 A;  1XXU A;  3H1N A;  4TR1 B;  3ZRE A;  5FWG A;  4DSS A;  4OFM A;  4BL7 A;  3UVH A;  3A3T A;  3H79 A;  4NAX A;  3DGQ A;  1DE2 A;  2L6D A;  5B7C A;  5CP1 A;  4ZBB A;  4JRR A;  3LXZ A;  1PL2 A;  1TK0 B;  1YDK A;  1V9W A;  3EE2 A;  5H5R A;  4YAV A;  3EYT A;  2HSY A;  2M72 A;  3GKM A;  4G9H A;  2H0G A;  2ZNM A;  2JZS A;  4MMM A;  1SD8 A;  1TP9 A;  2PER A;  3HYP A;  4ZIJ A;  4L0W A;  4BVY B;  2YV7 A;  8GSS A;  3GHA A;  2H1D A;  4RUV A;  3HHV A;  1BYE A;  3KIJ A;  4DSQ A;  5HFK A;  3C1R A;  4XRA A;  1T3B A;  2AJQ B;  2H30 A;  4XCS A;  1N2A A;  5IOX A;  1E6B A;  5HR2 A;  2I9H A;  1A2L A;  6GSW A;  3D4T A;  2RUF A;  3SWL A;  2VUP A;  1IYI A;  4TXV A;  4G0L A;  2B7J A;  1A0R P;  4ECC A;  2XHF A;  1TKD B;  4BA7 A;  1JZO A;  4O7H A;  3DIE A;  4FQU A;  1YJ6 A;  1MD4 A;  2MMA A;  1SL0 B;  1AW9 A;  3DRN A;  2NVL A;  1T4Y A;  3NIV A;  1GUK A;  3HJM A;  2PUK C;  1RQM A;  2DKH A;  1FHE A;  2DJJ A;  2OE3 A;  3HDC A;  3TKS E;  2GZZ A;  3GMF A;  2PWJ A;  4JED A;  2H19 A;  5E59 A;  1MD3 A;  4I5Q A;  3F8U A;  4IHU A;  2F3M A;  4AF2 A;  4EC0 A;  3RDW A;  2QKE A;  4KE3 A;  6GSV A;  4MA9 A;  6GSY A;  1B4Q A;  3ZTL A;  2TIR A;  4FIW A;  4IGJ A;  4YQM A;  4IQA A;  2MMO A;  3GTU A;  1X9W B;  1HNA A;  4K0G A;  3MNG A;  2YJH A;  1YY7 A;  1NW2 A;  4K2X A;  4PQH A;  3DXB A;  3W6G A;  5IO0 A;  1Z5Y E;  4N10 A;  4LMV A;  4G10 A;  2NTO A;  1SKS B;  3GKN A;  2H01 A;  3ZIV A;  3VWW A;  2HZF A;  5DJL A;  3ZYW A;  4MNN A;  3BJ5 A;  2DMM A;  4HJM A;  2GQK A;  3TRP A;  4O5Q A;  2L59 A;  5H5Q A;  3KZQ A;  1JFU A;  1BAY A;  2QC7 A;  4MZW A;  2VCQ A;  4DEJ A;  1Q98 A;  2H76 A;  2IIY A;  1WE0 A;  3IV4 A;  4K5R A;  4TKY A;  1PX7 A;  1W89 A;  2C4J A;  4NHW A;  3RHB A;  5FT3 A;  1MEK A;  3TJB A;  1PX6 A;  3TJG A;  4ICY A;  5IMZ A;  1XPV A;  1E2Y A;  1T00 A;  1TU8 A;  4HDE A;  2VM1 A;  3CSH A;  1F2E A;  1A23 A;  3UAR A;  1B9Y C;  1YKC A;  1J0F A;  1MDJ A;  3QPM A;  4TVE A;  4USS A;  3IPZ A;  2AB6 A;  4F0B A;  4MJE A;  2HSH A;  3M1G A;  4EF0 A;  2KOK A;  3GRX A;  1Q4J A;  3UAP A;  4BVX B;  2DIZ A;  3UVT A;  5JWQ B;  1K0B A;  3QFA C;  4Z2U A;  3A2V A;  3ME8 A;  3NOF A;  2H6X A;  3QOU A;  5INY A;  1PKW A;  2CV4 A;  1GSS A;  1ACV A;  5EVO A;  3FR3 A;  2VCV A;  2YAN A;  1XOA A;  3GKX A;  4WKW A;  5C04 A;  4Q5Q A;  3RAZ A;  5F07 A;  3HA9 A;  2FA4 A;  1F6M C;  2LS5 A;  1F37 A;  2IN3 A;  3SBC A;  2G0F A;  4JR6 A;  2C1Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...