1X9WB

T7 dna polymerase in complex with a primer/template dna containing a disordered n-2 aminofluorene on the template, crystallized with dideoxy-atp as the incoming nucleotide.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
105
structure length
105
Chain Sequence
KIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*GP*AP*GP*AP*GP*TP*GP*AP*TP*T*GP*GP*T*AP*GP*TP*GP*TP
publication title Crystal structures of 2-acetylaminofluorene and 2-aminofluorene in complex with T7 DNA polymerase reveal mechanisms of mutagenesis.
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Transferase/electron transport/dna
total genus 28
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2004-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1x9wB00
2CAQA 3M0FA 2GLRA 2XC2A 4GF0A 3FZAA 3U6VA 2HNLA 1EV9A 1Y6EA 1AUCA 1RW1A 1C72A 3VURA 4WXTA 2V6KA 4X43A 5DCHA 2B5EA 1GSQA 2LS5A 2VCVA 2C0EA 1JLVA 2M80A 3GHAA 2KP1A 4TOPA 5JWRB 5IIZA 5ECKB 2FGXA 3UBKA 3F8UA 4N30A 1GSYA 4TW5A 2EIOA 3PINA 1FB0A 1XVQA 1I5GA 3RHCA 1OC9B 5HFKA 3DIEA 5EPFA 1GTBA 3Q19A 3HJPA 2MMOA 5IQYA 3P90A 4GSNA 4O32A 3FYGA 4RI6A 2PERA 2CX3A 3KIJA 5D9WA 1GTUA 1M2DA 4ML1A 1B4QA 2VLVA 1G7OA 5CNWA 2LKUA 1TI3A 5F8BA 3CRTA 2WFCA 1PGTA 1K3YA 2IN3A 3IOSA 4IQ1A 4DSSA 2VCXA 3D0ZA 3CSHA 2GQMA 2LUSA 1ZYQB 3ERWA 3FR3A 2C80A 1BAYA 1X9MB 5EY6A 3KTLA 5IOXA 2GQLA 3F3RA 2QC7A 4HEA2 1AQXA 3GTUB 4J56E 1TP9A 2VO4A 2YZUA 1XPVA 3LJRA 3ZVJA 5IMVA 4YQVA 4JE1A 8GSSA 1U6TA 4GLTA 1Z5YE 1G6WA 1PRXA 2H01A 3GIXA 1S3CA 4V1Ap 1UC7A 1I9DA 1THOA 4J2FA 4TR1A 4YQMA 2H1DA 2LJAA 3Q6OA 3ZMLA 5AIVA 1PQNA 5G31A 4OD7A 2I4AA 3H79A 3HDCA 22GSA 3HCZA 3KP8A 1GUKA 2DIZA 4V2LA 3GKXA 4F2IA 3IR4A 3JCML 3DKSA 2E2GA 2GT6A 3BJ5A 4X0XA 4L8EA 5KN3A 1EEMA 5EVOA 5G5EA 2HYXA 4NHZA 2RIIA 4FYBA 3GKMA 3Q18A 3F0IA 2V1MA 4WEYA 3KCMA 1OKDA 1E2YA 1JFUA 3IC4A 2FUG2 2OBKA 4I5QA 5F0GA 1U88A 1EOHA 3GMFA 3GH6A 1A0RP 2AB6A 1HD2A 1ILOA 4K7IA 1KNGA 3RDWA 4NAXA 1NHYA 1GP1A 1A8YA 4PX1A 3WYWA 3HZ4A 1Y25A 2GZZA 2PMTA 4LL1B 4DVCA 2KP2A 2JACA 1GSFA 4HS1A 2OACA 2XPEA 2C4JA 2BTOT 3UL3A 1O73A 12GSA 2AJQB 1XW9A 2WCIA 4ZL7A 4MF5A 2K18A 2F8AA 2H19A 2O8VB 1R4WA 4HJ2A 2B1LA 3KTBA 1JHBA 5ECQB 3TRPA 3US3A 4KSMA 2O89A 2VCZA 2LRTA 1EP8A 3D5JA 4DSRA 2REMA 1SK1A 1GNEA 4ISDA 2AV4A 1F2EA 3F4SA 5DDLA 1B9XC 2K8SA 1QUWA 4HDEA 4F9ZA 2FY6A 4V2NA 2YV7A 2N5FA 2H6XA 3TKSA 2OE3A 1R5AA 6GSYA 4HU9A 3G7YA 3U5RE 2H0GA 2LQQA 1AAZA 1FVJA 1OYJA 1X5EA 1B48A 2KLXA 5ECNB 1YF1A 5AIXA 5J41A 2IFQB 3LSZA 5CRGA 4K0NA 3F6DA 1ST9A 1TRUA 3HVXA 5ID2B 2P5RA 1ZCPA 4PQIA 1SKSB 1XIYA 5A4WA 4NXIA 4LLRA 1HNAA 1EZKA 2H76A 2PN8A 3TGZA 2L6CA 6GSWA 5ECLB 3E3EA 5DAKA 2H6ZA 3UVTA 1XWCA 1T7PB 1ZL9A 2J9HA 2MYGA 4ZB6A 4ID0A 1XWBA 4WR5A 3QAWA 2YWMA 2DJJA 2VL9A 1K0AA 1SL2B 2K9FA 3EMXA 3APQA 3KXOA 1GNWA 3GH9A 3UEMA 1DBYA 2H66A 2GS3A 3QAGA 4JEDA 4OFTA 4JRRA 4HUAA 3QCPA 4EDZA 2HXKA 5D96A 1M2AA 3RPNA 4KE3A 1A8LA 2LNTA 2GSRA 4HZ4A 4MCUA 1LBKA 4JZQA 1K3LA 3GRXA 4RI7A 1PL1A 1QFNA 1EV4A 3TKSE 2H1GA 1GTIA 4ZILA 1EWXA 3DD3A 3UBLA 4POLA 1Q4JA 2VCWA 4EKZA 2TRXA 2H30A 2VL3A 1TU7A 2RM5A 5HQPA 3IAM2 4L0UA 2HRFA 2A2RA 2MMZA 3LYKA 2AHEA 1XOAA 3A2XA 1BJXA 1X9WB 3Q74A 2HRNA 1LJRA 2NBSA 3QMXA 4N0VA 4MZCA 2PUKC 4I97A 3VK9A 3VWWA 1FVKA 4MK3A 2JSYA 3QR6A 3DVWA 3ZITA 2NVLA 2CVBA 1HNBA 4IKHA 3VI7A 2I9HA 5KEJA 3GL3A 3ZFBA 1VF2A 3J7Yb 5HR2A 1A2LA 1ZGNA 3GTUA 3KH7A 3IDVA 3TRQA 3SBCA 3EVIA 3BOAA 5CO3A 5DALB 4ZL8A 2J23A 3IK9A 4YQUA 2L5LA 3L9VA 1SJ6A 3PH9A 1X5DA 4FYUA 4X1UA 4OWYA 3NZNA 3KGKA 2L4CA 2I3YA 3W6GA 4MMMA 1XWAA 2K6VA 2DJ0A 3F4RA 1LU4A 1NW2A 4L5LA 6GSSA 2FNOA 3D4TA 1PN9A 4V2MA 4MLYA 3EWLA 1OC8A 1ERWA 1Z9HA 4NWYA 5LNKe 3N9JA 1AC1A 4N11A 3GKKA 2P31A 3GX8A 2ALBA 4PNGA 4G9HA 4MABA 4DSQA 2R2JA 1U3AA 1PKZA 3M3MA 4YAPA 4MP4A 3HVVA 2B6MA 2FWHA 6GSUA 4MJCA 3WGXA 1W89A 1YDKA 1PL2A 5G1KA 5INYA 1EOGA 1AQVA 1HYUA 2G2QA 4LA1A 2P5QA 3ME7A 2F9SA 1VF1A 4NHWA 1BX9A 5EL8A 4RQXA 1EEJA 3WGDA 1GUHA 4P3YB 1F3BA 3F3QA 1V9WA 5HR3A 4WETA 3ED3A 3ZRDA 4BWQA 5J3RA 1AIUA 4AJ6A 5FHIA 7GSSA 3TKSC 3GFKA 4D73B 2VL2A 1ZOFA 3IBHA 2HLSA 3WT1A 4JU5A 2C1YA 3ZIJA 2V41A 1B9YC 5ECPB 3I43A 1B8XA 5JCUA 3E0UA 5A4VA 1GWCA 5J9CA 1OAZA 3BCKA 3CRUA 4K6XA 4PNFA 3J7Yk 1YQ1A 2WGRA 5IPHA 5IO2A 2H1BA 2OE0A 2VCQA 4TR0A 4KH7A 2HT9A 3QAVA 2Z9SA 4HOJA 3LYPA 1ML6A 5IPGA 4XTSA 3GN3A 4WKWA 1TXXA 1CQHA 2LJKA 3C7MA 4O7HA 2HI7A 3KMNA 1AXDA 1K0OA 1GLQA 4NV5A 3IRAA 2VLUA 4EXJA 3TJGA 4Q5NA 2L6DA 3EINA 2WULA 4CW9A 2I1UA 3TKRA 3BCIA 2JZRA 1X5CA 3N5OA 5ID2A 1QXHA 3E9JB 4ZB9A 2MBSA 3ZYWA 4WF5A 2KHPA 2E7PA 1XW5A 4IBPA 4KCEA 2DJKA 3D4MA 1MDIA 4TRXA 1F6MC 5F06A 1WP0A 4FYCA 1T4YA 2LEGA 3PR8A 3A2WA 4DEJA 5G30A 3GUSA 3K8NA 4I6XA 2PVQA 4L5OA 3SWLA 2I81A 11GSA 4GCIA 4KB3A 4BA7A 3IPZA 1T8EB 4K1FA 3P8WA 3GKNA 4BVYA 1R5PA 1SK0A 3P7XA 1WIKA 1ZZYA 1K0BA 4LMVA 4IP1A 5JCGA 3FZ4A 2X99A 3P2AA 1SK2A 4GWRA 3C71A 3ZVJD 1AQWA 5B8BA 4XS1A 1Z7PA 3M9KA 1K0DA 4JR6A 2TIRA 5IMFA 5ELGA 4K7OA 3M9JA 4ZBAA 4NMUA 4TXVA 1M99A 2H8LA 3FEUA 3V1WA 1V98A 5ECSA 4PUFC 1GUMA 4K0GA 1KTEA 3EYTA 4BL7A 3TDGA 2IMDA 3R2QA 5G5FA 3GX0A 3AY8A 3EURA 4IN0A 5B6NA 2CZ3A 1USBA 3H4KA 3GYKA 5HR0A 3HXSA 3LGCA 3FZ5A 1KEBA 1BQ7A 4KX4A 3C73A 2VM2A 1SENA 2ZCTA 2VCTA 5IMCA 1OE7A 1PMTA 5F05A 4TKYA 3F9UA 2JADA 1Z7RA 5IM9A 1YY7A 4G2EA 3C8EA 2YNXA 2V6OA 4NV2A 1O81A 1SJZA 5B8AA 2AAWA 1G7EA 3HJMA 3LQ7A 3KM6A 1DE2A 2YCDA 3UMAA 3IE3A 4IW9A 16GSA 1PD21 3TCOA 2R5GA 2GZPA 3LEFA 4H86A 4ECIA 4QL7A 4IHUA 1F9MA 1N2AA 4TR4A 5H5RA 2L5OA 1SD8A 2HZFA 4GTUA 1EP7A 2YZHA 3GA4A 1YZXA 1TK8B 3VFIA 4TR3A 1O7UA 4GXZA 3DYRA 4IP6A 5GSSA 1Z6NA 3MAKA 1NHOA 4KCAA 3HJOA 5ECOB 1JLWA 1R7HA 1ON4A 4KW6A 2F51A 1A2MA 1JZWA 4Q5FA 3F4TA 1XCCA 3ZIVA 3A5WA 4MJEA 1GSEA 5GZZB 1U3IA 2DJ3A 5G1LA 3VPQA 3L78A 3FR6A 2LJRA 4KNDA 3M1GA 5DBQA 2VL2C 2M72A 3FKFA 4HI7A 3CMIA 4N0ZA 2IPAA 2YANA 9GSSA 2CX4A 2PBJA 5ECRB 3RBTA 1S3AA 2HSHA 3TJFA 2LRCA 3KJYA 2EIQA 2DMMA 4KDUA 1PX6A 3LORA 3TOUA 2LV3A 3DWVA 4DSSB 3I6AA 4V1Ag 3DGQA 2CVDA 2A4VA 2FWFA 5JCWA 3DEXA 4CDOA 1TJDA 3ERFA 1T3BA 2YV9A 1A2JA 1MEKA 1K3OA 2C3TA 2HZEB 5A4UA 3O3TA 5DQYA 3C1SA 4I2TA 2V32A 2FD3A 2VD1A 4TR1B 3TUEA 1OC9A 1MDKA 2H73A 5KN1A 3FZ9A 3W8JA 2YJ7A 1TRVA 3ZZXA 4TN8A 5D93A 5B7CA 2CT6A 2NDOA 4EO3A 2L57A 1TI1A 5D9VA 4JR4A 3FY7A 4KUNA 1A23A 1YEPA 4WBJA 1J0FA 1GULA 4ACSA 1URMA 3D6IA 4E8EA 2KOKA 3I9V2 3EU3A 2FWEA 2VM1A 2WS2A 1G0TA 4MF7A 1X9SB 4JBBA 2WB9A 1O85A 2LNSA 3TJKA 2EC4A 1E6BA 1TOFA 2WZ9A 3UARA 2H1AA 3H1NA 4MPGA 4TVEA 2D2ZA 2GSQA 2C8UA 2DJ2A 4N10A 5CRWA 3LXTA 3TJBA 1JZOA 3TOTA 1HNCA 5ABRA 3FK8A 2JZTA 3APSA 3IA1A 4XRAA 2VOCA 4EL1A 4HJMA 5D73A 1PKWA 3TKPA 4F0CA 3LFLA 4AF2A 3DMLA 1AW9A 1TW9A 3KH9A 1O8XA 4ILFA 5CRHA 5IOWA 1H75A 5FT3A 5HR1A 2YOIA 3W8SA 1H4OA 4ECBA 1ERTA 1XWGA 4EF0A 1SU9A 1O8WA 1YEXA 2C3QA 1QMVA 3GSSA 1ABAA 14GSA 2E0QA 3MSZA 1B4PA 2DMLA 3QOUA 4YH2A 5ECIB 2JL4A 3VWUA 2G0FA 1SL0B 5DQSA 3D22A 5AISA 3HYPA 2RM6A 2IMKA 1V58A 4EC0A 5CYYA 1FG4A 3L0HA 1ERVA 3FRCA 1M0UA 2H75A 2ZNMA 2MMNA 4EDYA 1K0CA 1U87A 1XWKA 1OE8A 5D8IA 2X64A 2B1KA 5H5SA 1QQ2A 2OA7A 1F37A 1K0MA 2CV4A 1SYRA 5KN2A 2XBIA 4IVFA 1TK0B 1GLPA 5LD0A 5DJLA 5DAKB 10GSA 2O85A 4XCSA 2VLTA 2ON5A 5ECHB 2O7KA 3KD0A 2C0GA 4MZWA 4GSSA 3KMOA 4XHMA 2N5BA 2RUEA 2WRTA 3IHQA 4MDCA 2FA4A 4FO5A 1WOUA 2NPBA 4LMWA 1UN2A 3EE2A 4POMA 1VRSD 3TB2A 1OKTA 1RQMA 5D9TA 1HQOA 2RLIA 3QD9A 3S9FA 17GSA 3UAPA 4E8HA 2YN1A 1FB6A 2IIYA 2VD0A 3ISOA 2CA8A 4J57E 2MBTA 3WGEA 1GRXA 5ECMB 3UVHA 1VGLA 3ERGA 4KSOA 5E59A 3LG6A 2VIMA 3CSIA 2OBIA 2JSZA 2IFQA 2IWTA 2DLXA 3QPMA 1X0RA 4WBRD 1V2AA 3EU4A 1XXUA 2GVPA 4XS6A 2LRNA 5AGYA 3H8QA 5IMAA 1FAAA 3ZFLA 4KDYA 2HFDA 3OR5A 4BVXA 2V2GA 4GRFA 3HD5A 2HE3A 1GSUA 4ZXGA 2ZUPA 3VPTA 1QGVA 2DIYA 5DJMA 4AJ7A 3GV1A 3BD2A 5CRDA 2FA8A 3CTGA 1TK5B 3KZQA 4CHSA 2ES7A 3O6TA 2H72A 2R6KA 3F63A 1PX7A 2PGTA 3ZTLA 2M46A 4XS4B 1MD3A 4POKA 2P0GA 1T1VA 4OFMA 4MA9A 4OO4A 4O5RA 4POBA 2HZEA 1FO5A 5KN0A 5J5NA 4MPFA 3I69A 3GNJA 2DJ1A 2WDUA 2F8FA 1XOBA 2H6YA 3APOA 3GURA 4OFNA 6GSVA 6GSTA 3CYNA 4Z7XA 2DC5A 2BMXA 4XRDA 4TXOB 1TKDB 2CVKA 3O76A 4GQFA 2HSYA 19GSA 2N5AA 2L59A 1WE0A 4IQAA 2OKAA 3G7IA 3ZREA 4NPBA 4MJAA 2LTKA 3WT2A 5GAPD 1OVNA 1THXA 1EGRA 2MZCA 1A0FA 3TJJA 2C0FA 5CREA 1S3DA 1PA3A 1Z6MA 2YWIA 4HQSA 2O87A 5IMZA 5D9XA 1M2BA 4ZIJA 3ZLPA 3FW2A 4ZBDA 5IMDA 3HY2A 4RQRA 1ACVA 2YWOA 4IS0A 3FR9A 2L4QA 2X8HA 5E4WA 2JZSA 2R4VA 2CAIA 1A24A 3UIWA 2ON7A 5JWQB 1V57A 2RUFA 2XBQA 3EC3A 4ZBBA 3GL5A 1SKWB 4IELA 1G6YA 2IL3A 5DALA 1PSQA 4ECJA 4WF4A 1TRSA 2IJYA 2VAFA 2X8GA 3TRXA 1SJIA 3D21A 3LXZA 4K7NA 5ELAA 5J9BA 1SL1B 2GT5A 1BG5A 3M8NA 4MH3A 4ULXA 2GSTA 4EVMA 2C3NA 1NM3A 4HU7A 4OCFA 4F03A 4XIHA 1BYEA 5A5KA 3QDNA 3LWAA 5JWOB 3IV4A 4WR4A 3WD6A 3HVSA 5AN1A 4MZBA 5LCZA 1T4ZA 1XFLA 2LSTA 5C04A 3QFBC 4I8BA 5HFGA 4QQ7A 4FH8A 2X8CA 2AYTA 1J08A 4K8MA 2FWGA 2GZYA 5G2ZA 1BEDA 5ENUA 2H74A 3NOFA 1SYXA 3RHBA 3NIVA 5H5QA 3CSJA 3KEBA 3DVXA 1WWJA 1WJKA 4ECCA 2K8VA 2MMAA 13GSA 2AUVA 4MF6A 1WRYA 1N8JA 4Q5RA 1ERUA 1XVWA 1WMJA 2DBCA 2VUPA 2BJXA 3HZ8A 3QFAC 2R37A 2H71A 4ZL9A 1K0NA 1KBNA 3L9UA 2XHFA 18GSA 3CTFA 3MWHA 4HQZA 3EMPA 3GSTA 4G10A 1FHEA 3BBYA 4EE0A 4HZ2A 4I2UA 4O92A 4D73A 4IGJA 1F3AA 4L0WA 2YJHA 5GAND 2A2SA 3A3TA 4RUVA 5F07A 3RAZA 2IMEA 2B7JA 1YF0A 2QGVA 1TTZA 5COHA 1M7TA 1VF3A 1RK4A 5CP1A 3G9BA 5C00A 4LL4B 2PPTA 5GSTA 1CQGA 4PQ1A 3VWXA 1QK8A 4BPYA 1GH2A 2GSSA 2OADA 4IJ3A 20GSA 3FHKA 2H0IA 5B6MA 5L71A 6GSXA 2IMIA 2LQOA 3CXGA 3G7JA 1O6JA 1ZMAA 2GQKA 4IJIA 4EUYA 4G19A 2PVOC 4F0BA 5CAXA 1MDJA 4PUAA 1T00A 1TRWA 3ME8A 1FOVA 2EIRA 3IXRA 2GDRA 4MJBA 4OCEA 1MD4A 5IO0A 2IMFA 3PGTA 4KAEA 4OMVA 1MTCA 1YJ6A 1IYIA 1J9BA 4F82A 1V40A 4KDXA 4ZB8A 2XPDA 2JU5A 3UJ1A 1DUGA 3CBUA 3KP9A 2QSIA 2F3MA 3HKRA 1Z3EA 2GTUA 3C1RA 2B3SA 1IYHA 5DVBA 1DE1A 3ZL5A 3F6FA 2H0HA 1YKCA 1VF4A 2B7KA 1FW1A 4XS4A 3VI5A 4PXOA 4GSTA 4BWSA 3VLNA 2GGTA 1ZYEA 2C0DA 1JZRA 1TU8A 1OC3A 1Q98A 2PWJA 1UVZA 1YKAA 2E2MA 3UOMA 4FIWA 4GQCA 3A2VA 1WPIA 1EGOA 1GSDA 4TXOA 2R3XA 1GTAA 3RPPA 1XW6A 5DCGA 3L4NA 2CQ9A 2KUCA 1TDIA 2OE1A 5FWGA 4OO5A 1JZDA 1NSWA 3HA9A 4KA0A 4AJ8A 4YAVA 3ZMKA 4QL9A 3IK7A 1XZOA 3IAS2 4PGTA 1GSSA 1UA5A 2B5XA 1GL8A 2FLSA 2DSAA 1R26A 2YWNA 5HFIA 3TKQA 4K9ZA 2CZ2A 4Q5QA 3DXBA 3H93A 2B5YA 4KGIA 1M9AA 1DSBA 2TRCP 5J4UA 1SKRB 3DRNA 4MH2A 4AGSA 3MNGA 2FHEA 2PU9C 4K2DA 4PURA 3HHVA 2H70A 2YP6A 1XBSA 4PQHA 1SD9A 2NTOA 1M9BA 3VWVA 4ML6A 3MDKA 2FCHA 1W4VA 3L9SA 2OJLA 2QKEA 2WJUA 2YPMA
chains in the Genus database with same CATH superfamily
2CAQA 3M0FA 2GLRA 2XC2A 4GF0A 3FZAA 3U6VA 2HNLA 1EV9A 1Y6EA 1AUCA 1RW1A 1C72A 3VURA 4WXTA 2V6KA 4X43A 5DCHA 2B5EA 1GSQA 2LS5A 2VCVA 2C0EA 1JLVA 2M80A 3GHAA 2KP1A 4TOPA 5JWRB 5IIZA 5ECKB 2FGXA 3UBKA 4USSA 3F8UA 4N30A 4CY8A 1GSYA 4TW5A 2EIOA 3PINA 1FB0A 1XVQA 1I5GA 3RHCA 1OC9B 5HFKA 3DIEA 5EPFA 1GTBA 3Q19A 3HJPA 2MMOA 5IQYA 3P90A 4GSNA 4O32A 3FYGA 4RI6A 2PERA 4YKFA 2CX3A 3KIJA 5D9WA 1GTUA 1M2DA 4ML1A 1B4QA 2VLVA 1G7OA 5CNWA 4Z2TA 2LKUA 1TI3A 5F8BA 3CRTA 4A5PA 2WFCA 1PGTA 1K3YA 2IN3A 3IOSA 4G0KA 4IQ1A 4DSSA 2VCXA 3D0ZA 3CSHA 2GQMA 2LUSA 1ZYQB 3ERWA 3FR3A 2C80A 1BAYA 1X9MB 5EY6A 3KTLA 5IOXA 2GQLA 3F3RA 2QC7A 4HEA2 1AQXA 3GTUB 4J56E 1TP9A 2VO4A 2YZUA 1XPVA 3LJRA 3ZVJA 5IMVA 4YQVA 4JE1A 8GSSA 1U6TA 4GLTA 1Z5YE 1G6WA 1PRXA 2H01A 3GIXA 1S3CA 4V1Ap 1UC7A 1I9DA 1THOA 4J2FA 4TR1A 4YQMA 2H1DA 2LJAA 3Q6OA 3ZMLA 5AIVA 1PQNA 5G31A 4OD7A 2I4AA 3H79A 3HDCA 22GSA 3HCZA 3KP8A 1GUKA 2DIZA 4V2LA 3GKXA 4KF9A 4F2IA 3IR4A 3JCML 3DKSA 2E2GA 2GT6A 3BJ5A 4X0XA 4L8EA 5KN3A 1EEMA 5EVOA 5G5EA 2HYXA 4NHZA 2RIIA 4FYBA 3GKMA 3Q18A 3F0IA 2V1MA 4WEYA 3KCMA 1OKDA 1E2YA 1JFUA 3IC4A 2FUG2 2OBKA 4I5QA 5F0GA 1U88A 1EOHA 3GMFA 3GH6A 1A0RP 2AB6A 1HD2A 1ILOA 4K7IA 1KNGA 3RDWA 4NAXA 1NHYA 1GP1A 1A8YA 4PX1A 3WYWA 3HZ4A 1Y25A 2GZZA 2PMTA 4LL1B 2DKIA 4DVCA 2KP2A 2JACA 1GSFA 4HS1A 2OACA 2XPEA 2C4JA 2BTOT 3UL3A 1ZYNA 1O73A 12GSA 2AJQB 1XW9A 3CQFA 2WCIA 4ZL7A 4MF5A 2K18A 2F8AA 2H19A 2O8VB 1R4WA 4HJ2A 2B1LA 3KTBA 1JHBA 5ECQB 3TRPA 3US3A 4KSMA 2O89A 2VCZA 2LRTA 1EP8A 3D5JA 4DSRA 2REMA 1SK1A 1GNEA 4ISDA 2AV4A 1F2EA 1PN0A 3F4SA 5DDLA 1B9XC 2K8SA 1QUWA 4HDEA 4F9ZA 2FY6A 4V2NA 2A4HA 2YV7A 2N5FA 2H6XA 3TKSA 2OE3A 1R5AA 6GSYA 4HU9A 3G7YA 3U5RE 2H0GA 4HSCX 2LQQA 1AAZA 1FVJA 1OYJA 1X5EA 1B48A 2KLXA 5ECNB 1YF1A 5AIXA 5J41A 4BIKA 2IFQB 3LSZA 5CRGA 4K0NA 3F6DA 1ST9A 1TRUA 3HVXA 5BRTA 5ID2B 2P5RA 1ZCPA 4PQIA 1SKSB 1XIYA 5A4WA 4NXIA 4LLRA 1HNAA 1EZKA 2H76A 2PN8A 3TGZA 2L6CA 6GSWA 5ECLB 3E3EA 5DAKA 2H6ZA 3UVTA 1XWCA 1T7PB 1ZL9A 2J9HA 2MYGA 4ZB6A 4ID0A 1XWBA 4WR5A 4BVXB 3QAWA 2YWMA 2DJJA 2VL9A 1K0AA 1SL2B 2K9FA 3EMXA 3APQA 3KXOA 1GNWA 2HRAA 3GH9A 3UEMA 1DBYA 2H66A 2GS3A 3QAGA 4JEDA 4OFTA 4JRRA 4HUAA 3QCPA 4EDZA 2HXKA 4BVYB 5D96A 1M2AA 3RPNA 4KE3A 1A8LA 2LNTA 2GSRA 4HZ4A 4MCUA 1LBKA 4JZQA 1K3LA 3GRXA 4RI7A 1PL1A 1QFNA 1EV4A 3TKSE 2H1GA 1GTIA 4ZILA 1EWXA 3DD3A 4K5RA 3UBLA 4POLA 1Q4JA 2VCWA 4EKZA 2TRXA 2H30A 4MNNA 2VL3A 1TU7A 2RM5A 5HQPA 3IAM2 4FQUA 4L0UA 2HRFA 2A2RA 2MMZA 3LYKA 2AHEA 1XOAA 3A2XA 1BJXA 1X9WB 5KOXA 3Q74A 2HRNA 1LJRA 2NBSA 3QMXA 4N0VA 4MZCA 2PUKC 4I97A 3VK9A 3VWWA 1FVKA 4MK3A 2JSYA 3QR6A 3DVWA 3ZITA 2NVLA 2CVBA 1HNBA 4IKHA 1ZYPA 3VI7A 2I9HA 5KEJA 3GL3A 3ZFBA 1VF2A 3J7Yb 5HR2A 1A2LA 1ZGNA 3GTUA 3KH7A 3IDVA 3TRQA 3SBCA 3EVIA 3BOAA 5CO3A 5DALB 4ZL8A 2J23A 3IK9A 4YQUA 2L5LA 3L9VA 1SJ6A 3PH9A 1X5DA 4FYUA 4X1UA 4OWYA 3NZNA 3KGKA 2L4CA 2I3YA 3W6GA 4MMMA 1XWAA 2K6VA 2DJ0A 3F4RA 1LU4A 1NW2A 4L5LA 6GSSA 2FNOA 3D4TA 1PN9A 4V2MA 4MLYA 3EWLA 1OC8A 1ERWA 1Z9HA 4NWYA 5LNKe 3N9JA 1AC1A 4N11A 3GKKA 2P31A 3GX8A 2ALBA 4PNGA 4G9HA 4MABA 4DSQA 2R2JA 1U3AA 1PKZA 3M3MA 4YAPA 4MP4A 3HVVA 2B6MA 2FWHA 6GSUA 4MJCA 3WGXA 1W89A 1YDKA 1PL2A 5G1KA 5INYA 1EOGA 1AQVA 1HYUA 2G2QA 4LA1A 2P5QA 3ME7A 2F9SA 1VF1A 4NHWA 1BX9A 5EL8A 4RQXA 1EEJA 3WGDA 1GUHA 4P3YB 1F3BA 3F3QA 1V9WA 4K2XA 5HR3A 4WETA 3ED3A 3ZRDA 4BWQA 5J3RA 2X49A 1AIUA 4AJ6A 5FHIA 7GSSA 3TKSC 3GFKA 4D73B 2VL2A 1ZOFA 3IBHA 2HLSA 3WT1A 4JU5A 2C1YA 3ZIJA 2V41A 1B9YC 5ECPB 3I43A 1B8XA 5JCUA 3E0UA 5A4VA 1GWCA 5J9CA 1OAZA 3BCKA 3CRUA 4K6XA 4PNFA 3J7Yk 3MYDA 1YQ1A 2WGRA 5IPHA 5IO2A 2H1BA 2OE0A 2VCQA 4TR0A 4KH7A 2HT9A 3IHGA 2Z9SA 3QAVA 4HOJA 3LYPA 1ML6A 5IPGA 4XTSA 3GN3A 4WKWA 1TXXA 1CQHA 2LJKA 3C7MA 4O7HA 2HI7A 3KMNA 1AXDA 1K0OA 1GLQA 4NV5A 3IRAA 3HVNA 2VLUA 4EXJA 3TJGA 4Q5NA 2L6DA 3EINA 2WULA 4CW9A 4Z2UA 2I1UA 3TKRA 3BCIA 2JZRA 1X5CA 3N5OA 5ID2A 1QXHA 3E9JB 4ZB9A 2MBSA 3ZYWA 4WF5A 2KHPA 2E7PA 1XW5A 4IBPA 4KCEA 2DJKA 3D4MA 1MDIA 4TRXA 1F6MC 5F06A 1WP0A 4FYCA 1T4YA 2LEGA 3PR8A 3A2WA 4DEJA 5G30A 3GUSA 2A2PA 3K8NA 4I6XA 2PVQA 4L5OA 3SWLA 2I81A 11GSA 4GCIA 4KB3A 4BA7A 3IPZA 1T8EB 4K1FA 3P8WA 4G0IA 3GKNA 4BVYA 1R5PA 1SK0A 3P7XA 1WIKA 1ZZYA 1K0BA 4LMVA 4IP1A 5JCGA 3FZ4A 2X99A 3P2AA 1SK2A 4GWRA 3C71A 3ZVJD 1AQWA 4X4JA 5B8BA 4XS1A 1Z7PA 3M9KA 1K0DA 4JR6A 2TIRA 5IMFA 5ELGA 4K7OA 3M9JA 4ZBAA 4NMUA 4TXVA 1M99A 2H8LA 3FEUA 3V1WA 1V98A 5ECSA 4PUFC 1GUMA 4K0GA 1KTEA 3EYTA 4BL7A 3TDGA 2IMDA 3R2QA 5G5FA 3GX0A 3AY8A 3EURA 4IN0A 5B6NA 2CZ3A 1USBA 3H4KA 3GYKA 5HR0A 3HXSA 3LGCA 3FZ5A 1KEBA 4KX4A 1BQ7A 3C73A 2VM2A 1SENA 2ZCTA 2VCTA 5IMCA 1OE7A 1PMTA 5F05A 4TKYA 3F9UA 2JADA 1Z7RA 5IM9A 1YY7A 4G2EA 3C8EA 2YNXA 2V6OA 4NV2A 1O81A 1SJZA 5B8AA 2AAWA 1G7EA 3HJMA 3LQ7A 3KM6A 1DE2A 2YCDA 3UMAA 3IE3A 4IW9A 16GSA 1PD21 3TCOA 2R5GA 2GZPA 3LEFA 4H86A 4ECIA 4QL7A 4IHUA 1F9MA 1N2AA 4TR4A 5H5RA 2L5OA 1SD8A 2HZFA 4GTUA 1EP7A 2YZHA 3GA4A 3R3EA 1YZXA 1TK8B 3VFIA 4TR3A 1O7UA 4GXZA 3DYRA 4IP6A 5GSSA 1Z6NA 3MAKA 1NHOA 4KCAA 3HJOA 5ECOB 1JLWA 1R7HA 1ON4A 4KW6A 2F51A 1A2MA 1JZWA 4Q5FA 3F4TA 1XCCA 3ZIVA 3A5WA 4MJEA 1GSEA 5GZZB 1U3IA 2DJ3A 5G1LA 3VPQA 3L78A 3FR6A 2LJRA 4KNDA 3M1GA 5DBQA 2VL2C 2M72A 3FKFA 4HI7A 3CMIA 4N0ZA 2IPAA 2YANA 9GSSA 2CX4A 2PBJA 5ECRB 3RBTA 1S3AA 2HSHA 3TJFA 2LRCA 3KJYA 2EIQA 2DMMA 4KDUA 1PX6A 3LORA 3TOUA 2LV3A 3DWVA 4DSSB 3I6AA 4V1Ag 3DGQA 4G0LA 2CVDA 2A4VA 2FWFA 5JCWA 3DEXA 4CDOA 1TJDA 3ERFA 1T3BA 2YV9A 1A2JA 1MEKA 4EIPA 1K3OA 2C3TA 2HZEB 5A4UA 3O3TA 5DQYA 3C1SA 4I2TA 3MIXA 2V32A 2FD3A 2VD1A 4TR1B 3TUEA 1OC9A 1MDKA 2H73A 5KN1A 3FZ9A 3W8JA 2YJ7A 1TRVA 3ZZXA 4TN8A 5D93A 5B7CA 2CT6A 2NDOA 4EO3A 2L57A 1TI1A 5D9VA 4JR4A 3FY7A 4KUNA 1A23A 1YEPA 2QA1A 4WBJA 1J0FA 1GULA 4ACSA 1URMA 3D6IA 4E8EA 2KOKA 3I9V2 2R0GA 3EU3A 2FWEA 2VM1A 2WS2A 1G0TA 4MF7A 1X9SB 4JBBA 2WB9A 1O85A 2LNSA 3TJKA 2EC4A 1E6BA 5KOWA 1TOFA 2WZ9A 3UARA 2H1AA 3H1NA 4MPGA 4TVEA 2D2ZA 2GSQA 2C8UA 2DJ2A 4N10A 2R0PA 5CRWA 3LXTA 3TJBA 1JZOA 3TOTA 1HNCA 5ABRA 3FK8A 2JZTA 3APSA 3IA1A 4XRAA 2VOCA 4EL1A 4HJMA 5D73A 1PKWA 3TKPA 4O5UA 4F0CA 3LFLA 4AF2A 3DMLA 1AW9A 1TW9A 3KH9A 1O8XA 4ILFA 5CRHA 5IOWA 1H75A 4YKGA 5FT3A 5HR1A 2YOIA 3W8SA 1H4OA 2UZ8A 4ECBA 1ERTA 1XWGA 4Z2RA 4EF0A 1SU9A 1O8WA 1YEXA 2C3QA 1QMVA 1XG8A 3GSSA 1ABAA 14GSA 2E0QA 3MSZA 1B4PA 2DMLA 3QOUA 4YH2A 5ECIB 4EIQA 2JL4A 3VWUA 2G0FA 1SL0B 4PTSA 5DQSA 3D22A 5AISA 3HYPA 2RM6A 2IMKA 1V58A 4EC0A 5CYYA 1FG4A 3LW9A 3L0HA 1ERVA 3FRCA 1M0UA 2H75A 2ZNMA 2MMNA 4EDYA 1K0CA 1U87A 1XWKA 1OE8A 5D8IA 2X64A 2B1KA 5H5SA 1QQ2A 2OA7A 1F37A 1K0MA 2CV4A 1SYRA 5KN2A 2XBIA 4IVFA 1TK0B 1GLPA 5LD0A 5DJLA 5DAKB 10GSA 2O85A 4XCSA 2VLTA 2ON5A 5ECHB 2O7KA 3KD0A 2C0GA 4MZWA 4GSSA 3KMOA 4XHMA 2N5BA 2RUEA 2WRTA 3IHQA 4MDCA 2FA4A 4FO5A 1WOUA 2NPBA 4LMWA 1UN2A 3EE2A 4POMA 1VRSD 3TB2A 1OKTA 1RQMA 5D9TA 1HQOA 2RLIA 3QD9A 3S9FA 17GSA 3UAPA 4E8HA 2YN1A 1FB6A 2IIYA 2VD0A 1M3JA 3ISOA 2CA8A 4J57E 2MBTA 3WGEA 1GRXA 5ECMB 3UVHA 1VGLA 3ERGA 4KSOA 5E59A 3LG6A 2VIMA 3CSIA 2OBIA 2JSZA 2IFQA 3EPTA 2QA2A 2IWTA 2DLXA 3QPMA 1X0RA 4WBRD 1V2AA 3EU4A 1XXUA 2GVPA 4XS6A 2LRNA 5AGYA 3H8QA 5IMAA 1FAAA 3ZFLA 4KDYA 2HFDA 3OR5A 4BVXA 2V2GA 4GRFA 3HD5A 2HE3A 1GSUA 4ZXGA 2ZUPA 3VPTA 2R0CA 1QGVA 2DIYA 5DJMA 4AJ7A 3GV1A 3BD2A 5CRDA 2FA8A 3CTGA 1TK5B 3KZQA 4CHSA 1PFOA 2ES7A 3O6TA 2H72A 2R6KA 3F63A 1PX7A 2PGTA 3ZTLA 2M46A 4XS4B 1MD3A 4POKA 2P0GA 1T1VA 4OFMA 4MA9A 4OO4A 4O5RA 4POBA 2HZEA 1FO5A 5KN0A 5J5NA 4MPFA 3I69A 3GNJA 2DJ1A 2WDUA 2F8FA 1XOBA 2H6YA 3APOA 3GURA 4OFNA 6GSVA 6GSTA 3CYNA 4Z7XA 2DC5A 3FMWA 2BMXA 4XRDA 4TXOB 1TKDB 2CVKA 3O76A 4GQFA 2HSYA 19GSA 2N5AA 2L59A 1WE0A 4IQAA 2OKAA 3G7IA 3ZREA 4NPBA 4MJAA 2LTKA 3WT2A 5GAPD 1OVNA 1THXA 3IC8A 1EGRA 4ICYA 2MZCA 1A0FA 3TJJA 2C0FA 5CREA 1S3DA 1PA3A 1Z6MA 2YWIA 4HQSA 2O87A 5IMZA 5D9XA 1M2BA 4ZIJA 3ZLPA 3FW2A 4ZBDA 5IMDA 3HY2A 4RQRA 1ACVA 2YWOA 2HSMA 4IS0A 3FR9A 2L4QA 2X8HA 5E4WA 2JZSA 2R4VA 2CAIA 1A24A 3UIWA 2ON7A 5JWQB 1V57A 1M3IA 2RUFA 2XBQA 3EC3A 4ZBBA 3GL5A 1SKWB 4IELA 1G6YA 2IL3A 5DALA 1PSQA 4ECJA 4WF4A 1TRSA 2IJYA 2VAFA 2X8GA 3TRXA 1SJIA 3D21A 3LXZA 4K7NA 5ELAA 5J9BA 1SL1B 2GT5A 1BG5A 3M8NA 4MH3A 4ULXA 2GSTA 4EVMA 2C3NA 1NM3A 4HU7A 4OCFA 4F03A 4XIHA 1BYEA 5A5KA 3QDNA 3LWAA 5JWOB 3IV4A 4WR4A 3WD6A 3HVSA 5AN1A 4MZBA 5LCZA 1T4ZA 1XFLA 2LSTA 5C04A 4O5QA 3QFBC 4I8BA 5HFGA 4QQ7A 4FH8A 2X8CA 2AYTA 1J08A 4K8MA 2FWGA 2GZYA 5G2ZA 1BEDA 5ENUA 2H74A 3NOFA 1SYXA 3RHBA 3NIVA 5H5QA 3CSJA 3KEBA 3DVXA 1WWJA 4CY6A 1WJKA 4ECCA 2K8VA 2DKHA 2MMAA 13GSA 2AUVA 4MF6A 1WRYA 1N8JA 4Q5RA 1ERUA 1XVWA 1WMJA 2DBCA 2VUPA 2BJXA 3HZ8A 3QFAC 2HRKA 2R37A 2H71A 4ZL9A 1K0NA 1KBNA 3L9UA 2XHFA 18GSA 3CTFA 3MWHA 4HQZA 3EMPA 3GSTA 4G10A 1FHEA 3BBYA 4EE0A 4HZ2A 4I2UA 4O92A 4D73A 4IGJA 1F3AA 4L0WA 1FOHA 2YJHA 5GAND 2A2SA 3A3TA 4RUVA 5F07A 3RAZA 2IMEA 2B7JA 1YF0A 4K5SA 2QGVA 1TTZA 5COHA 1M7TA 1VF3A 1RK4A 5CP1A 3G9BA 5C00A 4LL4B 2PPTA 5GSTA 1CQGA 4PQ1A 3VWXA 1QK8A 4BPYA 1GH2A 2GSSA 2OADA 4IJ3A 20GSA 3FHKA 2H0IA 5B6MA 5L71A 6GSXA 2IMIA 2LQOA 3CXGA 3G7JA 1O6JA 1ZMAA 2GQKA 4IJIA 4EUYA 4G19A 2PVOC 4F0BA 5CAXA 2X4AA 1MDJA 4PUAA 1T00A 1TRWA 3ME8A 1FOVA 2EIRA 3IXRA 2GDRA 4MJBA 4OCEA 1MD4A 5IO0A 2IMFA 3PGTA 4KAEA 4BL7B 4OMVA 1MTCA 1YJ6A 1IYIA 1J9BA 4F82A 1V40A 4KDXA 4ZB8A 2XPDA 2JU5A 3UJ1A 1DUGA 3CBUA 3KP9A 2QSIA 2F3MA 3HKRA 1Z3EA 2GTUA 3C1RA 2B3SA 1IYHA 5DVBA 1DE1A 3ZL5A 3F6FA 2H0HA 1YKCA 1VF4A 2B7KA 1FW1A 4XS4A 3VI5A 4PXOA 4GSTA 4BWSA 3VLNA 2GGTA 1ZYEA 2C0DA 1JZRA 1TU8A 1OC3A 1Q98A 3PPUA 5BMUA 2PWJA 1UVZA 1YKAA 2E2MA 3UOMA 4FIWA 4GQCA 3A2VA 1WPIA 1EGOA 1GSDA 4TXOA 2R3XA 1GTAA 3RPPA 1XW6A 5DCGA 3L4NA 2CQ9A 2KUCA 1TDIA 2OE1A 5FWGA 4OO5A 1JZDA 1NSWA 1S3RA 3HA9A 4KA0A 4AJ8A 4YAVA 3ZMKA 4QL9A 3IK7A 1XZOA 3IAS2 4PGTA 1GSSA 1UA5A 2B5XA 1GL8A 2FLSA 2DSAA 1R26A 2YWNA 5HFIA 3TKQA 4K9ZA 2CZ2A 4Q5QA 3DXBA 3H93A 2B5YA 4KGIA 1M9AA 1DSBA 2TRCP 5J4UA 1SKRB 3DRNA 4MH2A 3A5IA 4AGSA 3MNGA 2FHEA 2PU9C 4K2DA 4PURA 3HHVA 2H70A 2YP6A 1XBSA 4PQHA 1SD9A 2NTOA 1M9BA 3VWVA 4ML6A 3MDKA 2FCHA 1W4VA 3L9SA 2OJLA 2QKEA 2WJUA 2YPMA
chains in the Genus database with same CATH topology
2CAQA 3M0FA 2GLRA 2XC2A 4GF0A 3FZAA 3U6VA 2HNLA 1EV9A 1Y6EA 1AUCA 1RW1A 1C72A 3VURA 4WXTA 2V6KA 4X43A 5DCHA 2B5EA 1GSQA 2LS5A 2VCVA 2C0EA 1JLVA 2M80A 3GHAA 2KP1A 4TOPA 5JWRB 5IIZA 5ECKB 2FGXA 3UBKA 4USSA 3F8UA 4N30A 4CY8A 1GSYA 4TW5A 2EIOA 3PINA 1FB0A 1XVQA 1I5GA 3RHCA 1OC9B 5HFKA 3DIEA 5EPFA 1GTBA 3Q19A 3HJPA 2MMOA 5IQYA 3P90A 4GSNA 4O32A 3FYGA 4RI6A 2PERA 4YKFA 2CX3A 3KIJA 5D9WA 1GTUA 1M2DA 4ML1A 1B4QA 2VLVA 1G7OA 5CNWA 4Z2TA 2LKUA 1TI3A 5F8BA 3CRTA 4A5PA 2WFCA 1PGTA 1K3YA 2IN3A 3IOSA 4G0KA 4IQ1A 4DSSA 2VCXA 3D0ZA 3CSHA 2GQMA 2LUSA 1ZYQB 3ERWA 3FR3A 2C80A 1BAYA 1X9MB 5EY6A 3KTLA 5IOXA 2GQLA 3F3RA 2QC7A 4HEA2 1AQXA 3GTUB 4J56E 1TP9A 2VO4A 2YZUA 1XPVA 3LJRA 3ZVJA 5IMVA 4YQVA 4JE1A 8GSSA 1U6TA 4GLTA 1Z5YE 1G6WA 1PRXA 2H01A 3GIXA 1S3CA 4V1Ap 1UC7A 1I9DA 1THOA 4J2FA 4TR1A 4YQMA 2H1DA 2LJAA 3Q6OA 3ZMLA 5AIVA 1PQNA 5G31A 4OD7A 2I4AA 3H79A 3HDCA 22GSA 3HCZA 3KP8A 1GUKA 2DIZA 4V2LA 3GKXA 4KF9A 4F2IA 3IR4A 3JCML 3DKSA 2E2GA 2GT6A 3BJ5A 4X0XA 4L8EA 5KN3A 1EEMA 5EVOA 5G5EA 2HYXA 4NHZA 2RIIA 4FYBA 3GKMA 3Q18A 3F0IA 2V1MA 4WEYA 3KCMA 1OKDA 1E2YA 1JFUA 3IC4A 2FUG2 2OBKA 4I5QA 5F0GA 1U88A 1EOHA 3GMFA 3GH6A 1A0RP 2AB6A 1HD2A 1ILOA 4K7IA 1KNGA 3RDWA 4NAXA 1NHYA 1GP1A 1A8YA 4PX1A 3WYWA 3HZ4A 1Y25A 2GZZA 2PMTA 4LL1B 2DKIA 4DVCA 2KP2A 2JACA 1GSFA 4HS1A 2OACA 2XPEA 2C4JA 2BTOT 3UL3A 1ZYNA 1O73A 12GSA 2AJQB 1XW9A 2WCIA 4ZL7A 4MF5A 2K18A 2F8AA 2H19A 2O8VB 1R4WA 4HJ2A 2B1LA 3KTBA 1JHBA 5ECQB 3TRPA 3US3A 4KSMA 2O89A 2VCZA 2LRTA 1EP8A 3D5JA 4DSRA 2REMA 1SK1A 1GNEA 4ISDA 2AV4A 1F2EA 1PN0A 3F4SA 5DDLA 1B9XC 2K8SA 1QUWA 4HDEA 4F9ZA 2FY6A 4V2NA 2A4HA 2YV7A 2N5FA 2H6XA 3TKSA 2OE3A 1R5AA 6GSYA 4HU9A 3G7YA 3U5RE 2H0GA 2LQQA 1AAZA 1FVJA 1OYJA 1X5EA 1B48A 2KLXA 5ECNB 1YF1A 5AIXA 5J41A 2IFQB 3LSZA 5CRGA 4K0NA 3F6DA 1ST9A 1TRUA 3HVXA 5BRTA 5ID2B 2P5RA 1ZCPA 4PQIA 1SKSB 1XIYA 5A4WA 4NXIA 4LLRA 1HNAA 1EZKA 2H76A 2PN8A 3TGZA 2L6CA 6GSWA 5ECLB 3E3EA 5DAKA 2H6ZA 3UVTA 1XWCA 1T7PB 1ZL9A 2J9HA 2MYGA 4ZB6A 4ID0A 1XWBA 4WR5A 4BVXB 3QAWA 2YWMA 2DJJA 2VL9A 1K0AA 1SL2B 2K9FA 3EMXA 3APQA 3KXOA 1GNWA 2HRAA 3GH9A 3UEMA 1DBYA 2H66A 2GS3A 3QAGA 4JEDA 4OFTA 4JRRA 4HUAA 3QCPA 4EDZA 2HXKA 4BVYB 5D96A 1M2AA 3RPNA 4KE3A 1A8LA 2LNTA 2GSRA 4HZ4A 4MCUA 1LBKA 4JZQA 1K3LA 3GRXA 4RI7A 1PL1A 1QFNA 1EV4A 3TKSE 2H1GA 1GTIA 4ZILA 1EWXA 3DD3A 4K5RA 3UBLA 4POLA 1Q4JA 2VCWA 4EKZA 2TRXA 2H30A 4MNNA 2VL3A 1TU7A 2RM5A 5HQPA 3IAM2 4FQUA 4L0UA 2HRFA 2A2RA 2MMZA 3LYKA 2AHEA 1XOAA 3A2XA 1BJXA 1X9WB 5KOXA 3Q74A 2HRNA 1LJRA 2NBSA 3QMXA 4N0VA 4MZCA 2PUKC 4I97A 3VK9A 3VWWA 1FVKA 4MK3A 2JSYA 3QR6A 3DVWA 3ZITA 2NVLA 2CVBA 1HNBA 4IKHA 1ZYPA 3VI7A 2I9HA 5KEJA 3GL3A 3ZFBA 1VF2A 3J7Yb 5HR2A 1A2LA 1ZGNA 3GTUA 3KH7A 3IDVA 3TRQA 3SBCA 3EVIA 3BOAA 5CO3A 5DALB 4ZL8A 2J23A 3IK9A 4YQUA 2L5LA 3L9VA 1SJ6A 3PH9A 1X5DA 4FYUA 4X1UA 4OWYA 3NZNA 3KGKA 2L4CA 2I3YA 3W6GA 4MMMA 1XWAA 2K6VA 2DJ0A 3F4RA 1LU4A 1NW2A 4L5LA 6GSSA 2FNOA 3D4TA 1PN9A 4V2MA 4MLYA 3EWLA 1OC8A 1ERWA 1Z9HA 4NWYA 5LNKe 3N9JA 1AC1A 4N11A 3GKKA 2P31A 3GX8A 2ALBA 4PNGA 4G9HA 4MABA 4DSQA 2R2JA 1U3AA 1PKZA 3M3MA 4YAPA 4MP4A 3HVVA 2B6MA 2FWHA 6GSUA 4MJCA 3WGXA 1W89A 1YDKA 1PL2A 5G1KA 5INYA 1EOGA 1AQVA 1HYUA 2G2QA 4LA1A 2P5QA 3ME7A 2F9SA 1VF1A 4NHWA 1BX9A 5EL8A 4RQXA 1EEJA 3WGDA 1GUHA 4P3YB 1F3BA 3F3QA 1V9WA 4K2XA 5HR3A 4WETA 3ED3A 3ZRDA 4BWQA 5J3RA 2X49A 1AIUA 4AJ6A 5FHIA 7GSSA 3TKSC 3GFKA 4D73B 2VL2A 1ZOFA 3IBHA 2HLSA 3WT1A 4JU5A 2C1YA 3ZIJA 2V41A 1B9YC 5ECPB 3I43A 1B8XA 5JCUA 3E0UA 5A4VA 1GWCA 5J9CA 1OAZA 3BCKA 3CRUA 4K6XA 4PNFA 3J7Yk 3MYDA 1YQ1A 2WGRA 5IPHA 5IO2A 2H1BA 2OE0A 2VCQA 4TR0A 4KH7A 2HT9A 3IHGA 2Z9SA 3QAVA 4HOJA 3LYPA 1ML6A 5IPGA 4XTSA 3GN3A 4WKWA 1TXXA 1CQHA 2LJKA 3C7MA 4O7HA 2HI7A 3KMNA 1AXDA 1K0OA 1GLQA 4NV5A 3IRAA 2VLUA 4EXJA 3TJGA 4Q5NA 2L6DA 3EINA 2WULA 4CW9A 4Z2UA 2I1UA 3TKRA 3BCIA 2JZRA 1X5CA 3N5OA 5ID2A 1QXHA 3E9JB 4ZB9A 2MBSA 3ZYWA 4WF5A 2KHPA 2E7PA 1XW5A 4IBPA 4KCEA 2DJKA 3D4MA 1MDIA 4TRXA 1F6MC 5F06A 1WP0A 4FYCA 1T4YA 2LEGA 3PR8A 3A2WA 4DEJA 5G30A 3GUSA 2A2PA 3K8NA 4I6XA 2PVQA 4L5OA 3SWLA 2I81A 11GSA 4GCIA 4KB3A 4BA7A 3IPZA 1T8EB 4K1FA 3P8WA 4G0IA 3GKNA 4BVYA 1R5PA 1SK0A 3P7XA 1WIKA 1ZZYA 1K0BA 4LMVA 4IP1A 5JCGA 3FZ4A 2X99A 3P2AA 1SK2A 4GWRA 3C71A 3ZVJD 1AQWA 4X4JA 5B8BA 4XS1A 1Z7PA 3M9KA 1K0DA 4JR6A 2TIRA 5IMFA 5ELGA 4K7OA 3M9JA 4ZBAA 4NMUA 4TXVA 1M99A 2H8LA 3FEUA 3V1WA 1V98A 5ECSA 4PUFC 1GUMA 4K0GA 1KTEA 3EYTA 4BL7A 3TDGA 2IMDA 3R2QA 5G5FA 3GX0A 3AY8A 3EURA 4IN0A 5B6NA 2CZ3A 1USBA 3H4KA 3GYKA 5HR0A 3HXSA 3LGCA 3FZ5A 1KEBA 4KX4A 1BQ7A 3C73A 2VM2A 1SENA 2ZCTA 2VCTA 5IMCA 1OE7A 1PMTA 5F05A 4TKYA 3F9UA 2JADA 1Z7RA 5IM9A 1YY7A 4G2EA 3C8EA 2YNXA 2V6OA 4NV2A 1O81A 1SJZA 5B8AA 2AAWA 1G7EA 3HJMA 3LQ7A 3KM6A 1DE2A 2YCDA 3UMAA 3IE3A 4IW9A 16GSA 1PD21 3TCOA 2R5GA 2GZPA 3LEFA 4H86A 4ECIA 4QL7A 4IHUA 1F9MA 1N2AA 4TR4A 5H5RA 2L5OA 1SD8A 2HZFA 4GTUA 1EP7A 2YZHA 3GA4A 3R3EA 1YZXA 1TK8B 3VFIA 4TR3A 1O7UA 4GXZA 3DYRA 4IP6A 5GSSA 1Z6NA 3MAKA 1NHOA 4KCAA 3HJOA 5ECOB 1JLWA 1R7HA 1ON4A 4KW6A 2F51A 1A2MA 1JZWA 4Q5FA 3F4TA 1XCCA 3ZIVA 3A5WA 4MJEA 1GSEA 5GZZB 1U3IA 2DJ3A 5G1LA 3VPQA 3L78A 3FR6A 2LJRA 4KNDA 3M1GA 5DBQA 2VL2C 2M72A 3FKFA 4HI7A 3CMIA 4N0ZA 2IPAA 2YANA 9GSSA 2CX4A 2PBJA 5ECRB 3RBTA 1S3AA 2HSHA 3TJFA 2LRCA 3KJYA 2EIQA 2DMMA 4KDUA 1PX6A 3LORA 3TOUA 2LV3A 3DWVA 4DSSB 3I6AA 4V1Ag 3DGQA 4G0LA 2CVDA 2A4VA 2FWFA 5JCWA 3DEXA 4CDOA 1TJDA 3ERFA 1T3BA 2YV9A 1A2JA 1MEKA 4EIPA 1K3OA 2C3TA 2HZEB 5A4UA 3O3TA 5DQYA 3C1SA 4I2TA 3MIXA 2V32A 2FD3A 2VD1A 4TR1B 3TUEA 1OC9A 1MDKA 2H73A 5KN1A 3FZ9A 3W8JA 2YJ7A 1TRVA 3ZZXA 4TN8A 5D93A 5B7CA 2CT6A 2NDOA 4EO3A 2L57A 1TI1A 5D9VA 4JR4A 3FY7A 4KUNA 1A23A 1YEPA 2QA1A 4WBJA 1J0FA 1GULA 4ACSA 1URMA 3D6IA 4E8EA 2KOKA 3I9V2 2R0GA 3EU3A 2FWEA 2VM1A 2WS2A 1G0TA 4MF7A 1X9SB 4JBBA 2WB9A 1O85A 2LNSA 3TJKA 2EC4A 1E6BA 5KOWA 1TOFA 2WZ9A 3UARA 2H1AA 3H1NA 4MPGA 4TVEA 2D2ZA 2GSQA 2C8UA 2DJ2A 4N10A 2R0PA 5CRWA 3LXTA 3TJBA 1JZOA 3TOTA 1HNCA 5ABRA 3FK8A 2JZTA 3APSA 3IA1A 4XRAA 2VOCA 4EL1A 4HJMA 5D73A 1PKWA 3TKPA 4O5UA 4F0CA 3LFLA 4AF2A 3DMLA 1AW9A 1TW9A 3KH9A 1O8XA 4ILFA 5CRHA 5IOWA 1H75A 4YKGA 5FT3A 5HR1A 2YOIA 3W8SA 1H4OA 2UZ8A 4ECBA 1ERTA 1XWGA 4Z2RA 4EF0A 1SU9A 1O8WA 1YEXA 2C3QA 1QMVA 3GSSA 1ABAA 14GSA 2E0QA 3MSZA 1B4PA 2DMLA 3QOUA 4YH2A 5ECIB 4EIQA 2JL4A 3VWUA 2G0FA 1SL0B 4PTSA 5DQSA 3D22A 5AISA 3HYPA 2RM6A 2IMKA 1V58A 4EC0A 5CYYA 1FG4A 3LW9A 3L0HA 1ERVA 3FRCA 1M0UA 2H75A 2ZNMA 2MMNA 4EDYA 1K0CA 1U87A 1XWKA 1OE8A 5D8IA 2X64A 2B1KA 5H5SA 1QQ2A 2OA7A 1F37A 1K0MA 2CV4A 1SYRA 5KN2A 2XBIA 4IVFA 1TK0B 1GLPA 5LD0A 5DJLA 5DAKB 10GSA 2O85A 4XCSA 2VLTA 2ON5A 5ECHB 2O7KA 3KD0A 2C0GA 4MZWA 4GSSA 3KMOA 4XHMA 2N5BA 2RUEA 2WRTA 3IHQA 4MDCA 2FA4A 4FO5A 1WOUA 2NPBA 4LMWA 1UN2A 3EE2A 4POMA 1VRSD 3TB2A 1OKTA 1RQMA 5D9TA 1HQOA 2RLIA 3QD9A 3S9FA 17GSA 3UAPA 4E8HA 2YN1A 1FB6A 2IIYA 2VD0A 3ISOA 2CA8A 4J57E 2MBTA 3WGEA 1GRXA 5ECMB 3UVHA 1VGLA 3ERGA 4KSOA 5E59A 3LG6A 2VIMA 3CSIA 2OBIA 2JSZA 2IFQA 3EPTA 2QA2A 2IWTA 2DLXA 3QPMA 1X0RA 4WBRD 1V2AA 3EU4A 1XXUA 2GVPA 4XS6A 2LRNA 5AGYA 3H8QA 5IMAA 1FAAA 3ZFLA 4KDYA 2HFDA 3OR5A 4BVXA 2V2GA 4GRFA 3HD5A 2HE3A 1GSUA 4ZXGA 2ZUPA 3VPTA 2R0CA 1QGVA 2DIYA 5DJMA 4AJ7A 3GV1A 3BD2A 5CRDA 2FA8A 3CTGA 1TK5B 3KZQA 4CHSA 2ES7A 3O6TA 2H72A 2R6KA 3F63A 1PX7A 2PGTA 3ZTLA 2M46A 4XS4B 1MD3A 4POKA 2P0GA 1T1VA 4OFMA 4MA9A 4OO4A 4O5RA 4POBA 2HZEA 1FO5A 5KN0A 5J5NA 4MPFA 3I69A 3GNJA 2DJ1A 2WDUA 2F8FA 1XOBA 2H6YA 3APOA 3GURA 4OFNA 6GSVA 6GSTA 3CYNA 4Z7XA 2DC5A 3FMWA 2BMXA 4XRDA 4TXOB 1TKDB 2CVKA 3O76A 4GQFA 2HSYA 19GSA 2N5AA 2L59A 1WE0A 4IQAA 2OKAA 3G7IA 3ZREA 4NPBA 4MJAA 2LTKA 3WT2A 5GAPD 1OVNA 1THXA 3IC8A 1EGRA 4ICYA 2MZCA 1A0FA 3TJJA 2C0FA 5CREA 1S3DA 1PA3A 1Z6MA 2YWIA 4HQSA 2O87A 5IMZA 5D9XA 1M2BA 4ZIJA 3ZLPA 3FW2A 4ZBDA 5IMDA 3HY2A 4RQRA 1ACVA 2YWOA 2HSMA 4IS0A 3FR9A 2L4QA 2X8HA 5E4WA 2JZSA 2R4VA 2CAIA 1A24A 3UIWA 2ON7A 5JWQB 1V57A 2RUFA 2XBQA 3EC3A 4ZBBA 3GL5A 1SKWB 4IELA 1G6YA 2IL3A 5DALA 1PSQA 4ECJA 4WF4A 1TRSA 2IJYA 2VAFA 2X8GA 3TRXA 1SJIA 3D21A 3LXZA 4K7NA 5ELAA 5J9BA 1SL1B 2GT5A 1BG5A 3M8NA 4MH3A 4ULXA 2GSTA 4EVMA 2C3NA 1NM3A 4HU7A 4OCFA 4F03A 4XIHA 1BYEA 5A5KA 3QDNA 3LWAA 5JWOB 3IV4A 4WR4A 3WD6A 3HVSA 5AN1A 4MZBA 5LCZA 1T4ZA 1XFLA 2LSTA 5C04A 4O5QA 3QFBC 4I8BA 5HFGA 4QQ7A 4FH8A 2X8CA 2AYTA 1J08A 4K8MA 2FWGA 2GZYA 5G2ZA 1BEDA 5ENUA 2H74A 3NOFA 1SYXA 3RHBA 3NIVA 5H5QA 3CSJA 3KEBA 3DVXA 1WWJA 4CY6A 1WJKA 4ECCA 2K8VA 2DKHA 2MMAA 13GSA 2AUVA 4MF6A 1WRYA 1N8JA 4Q5RA 1ERUA 1XVWA 1WMJA 2DBCA 2VUPA 2BJXA 3HZ8A 3QFAC 2HRKA 2R37A 2H71A 4ZL9A 1K0NA 1KBNA 3L9UA 2XHFA 18GSA 3CTFA 3MWHA 4HQZA 3EMPA 3GSTA 4G10A 1FHEA 3BBYA 4EE0A 4HZ2A 4I2UA 4O92A 4D73A 4IGJA 1F3AA 4L0WA 1FOHA 2YJHA 5GAND 2A2SA 3A3TA 4RUVA 5F07A 3RAZA 2IMEA 2B7JA 1YF0A 4K5SA 2QGVA 1TTZA 5COHA 1M7TA 1VF3A 1RK4A 5CP1A 3G9BA 5C00A 4LL4B 2PPTA 5GSTA 1CQGA 4PQ1A 3VWXA 1QK8A 4BPYA 1GH2A 2GSSA 2OADA 4IJ3A 20GSA 3FHKA 2H0IA 5B6MA 5L71A 6GSXA 2IMIA 2LQOA 3CXGA 3G7JA 1O6JA 1ZMAA 2GQKA 4IJIA 4EUYA 4G19A 2PVOC 4F0BA 5CAXA 2X4AA 1MDJA 4PUAA 1T00A 1TRWA 3ME8A 1FOVA 2EIRA 3IXRA 2GDRA 4MJBA 4OCEA 1MD4A 5IO0A 2IMFA 3PGTA 4KAEA 4BL7B 4OMVA 1MTCA 1YJ6A 1IYIA 1J9BA 4F82A 1V40A 4KDXA 4ZB8A 2XPDA 2JU5A 3UJ1A 1DUGA 3CBUA 3KP9A 2QSIA 2F3MA 3HKRA 1Z3EA 2GTUA 3C1RA 2B3SA 1IYHA 5DVBA 1DE1A 3ZL5A 3F6FA 2H0HA 1YKCA 1VF4A 2B7KA 1FW1A 4XS4A 3VI5A 4PXOA 4GSTA 4BWSA 3VLNA 2GGTA 1ZYEA 2C0DA 1JZRA 1TU8A 1OC3A 1Q98A 3PPUA 5BMUA 2PWJA 1UVZA 1YKAA 2E2MA 3UOMA 4FIWA 4GQCA 3A2VA 1WPIA 1EGOA 1GSDA 4TXOA 2R3XA 1GTAA 3RPPA 1XW6A 5DCGA 3L4NA 2CQ9A 2KUCA 1TDIA 2OE1A 5FWGA 4OO5A 1JZDA 1NSWA 3HA9A 4KA0A 4AJ8A 4YAVA 3ZMKA 4QL9A 3IK7A 1XZOA 3IAS2 4PGTA 1GSSA 1UA5A 2B5XA 1GL8A 2FLSA 2DSAA 1R26A 2YWNA 5HFIA 3TKQA 4K9ZA 2CZ2A 4Q5QA 3DXBA 3H93A 2B5YA 4KGIA 1M9AA 1DSBA 2TRCP 5J4UA 1SKRB 3DRNA 4MH2A 3A5IA 4AGSA 3MNGA 2FHEA 2PU9C 4K2DA 4PURA 3HHVA 2H70A 2YP6A 1XBSA 4PQHA 1SD9A 2NTOA 1M9BA 3VWVA 4ML6A 3MDKA 2FCHA 1W4VA 3L9SA 2OJLA 2QKEA 2WJUA 2YPMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CAQ A;  3M0F A;  2GLR A;  2XC2 A;  4GF0 A;  3FZA A;  3U6V A;  2HNL A;  1EV9 A;  1Y6E A;  1AUC A;  1RW1 A;  1C72 A;  3VUR A;  4WXT A;  2V6K A;  4X43 A;  5DCH A;  2B5E A;  1GSQ A;  2LS5 A;  2VCV A;  2C0E A;  1JLV A;  2M80 A;  3GHA A;  2KP1 A;  4TOP A;  5JWR B;  5IIZ A;  5ECK B;  2FGX A;  3UBK A;  3F8U A;  4N30 A;  1GSY A;  4TW5 A;  2EIO A;  3PIN A;  1FB0 A;  1XVQ A;  1I5G A;  3RHC A;  1OC9 B;  5HFK A;  3DIE A;  5EPF A;  1GTB A;  3Q19 A;  3HJP A;  2MMO A;  5IQY A;  3P90 A;  4GSN A;  4O32 A;  3FYG A;  4RI6 A;  2PER A;  2CX3 A;  3KIJ A;  5D9W A;  1GTU A;  1M2D A;  4ML1 A;  1B4Q A;  2VLV A;  1G7O A;  5CNW A;  2LKU A;  1TI3 A;  5F8B A;  3CRT A;  2WFC A;  1PGT A;  1K3Y A;  2IN3 A;  3IOS A;  4IQ1 A;  4DSS A;  2VCX A;  3D0Z A;  3CSH A;  2GQM A;  2LUS A;  1ZYQ B;  3ERW A;  3FR3 A;  2C80 A;  1BAY A;  1X9M B;  5EY6 A;  3KTL A;  5IOX A;  2GQL A;  3F3R A;  2QC7 A;  4HEA 2;  1AQX A;  3GTU B;  4J56 E;  1TP9 A;  2VO4 A;  2YZU A;  1XPV A;  3LJR A;  3ZVJ A;  5IMV A;  4YQV A;  4JE1 A;  8GSS A;  1U6T A;  4GLT A;  1Z5Y E;  1G6W A;  1PRX A;  2H01 A;  3GIX A;  1S3C A;  4V1A p;  1UC7 A;  1I9D A;  1THO A;  4J2F A;  4TR1 A;  4YQM A;  2H1D A;  2LJA A;  3Q6O A;  3ZML A;  5AIV A;  1PQN A;  5G31 A;  4OD7 A;  2I4A A;  3H79 A;  3HDC A;  22GS A;  3HCZ A;  3KP8 A;  1GUK A;  2DIZ A;  4V2L A;  3GKX A;  4F2I A;  3IR4 A;  3JCM L;  3DKS A;  2E2G A;  2GT6 A;  3BJ5 A;  4X0X A;  4L8E A;  5KN3 A;  1EEM A;  5EVO A;  5G5E A;  2HYX A;  4NHZ A;  2RII A;  4FYB A;  3GKM A;  3Q18 A;  3F0I A;  2V1M A;  4WEY A;  3KCM A;  1OKD A;  1E2Y A;  1JFU A;  3IC4 A;  2FUG 2;  2OBK A;  4I5Q A;  5F0G A;  1U88 A;  1EOH A;  3GMF A;  3GH6 A;  1A0R P;  2AB6 A;  1HD2 A;  1ILO A;  4K7I A;  1KNG A;  3RDW A;  4NAX A;  1NHY A;  1GP1 A;  1A8Y A;  4PX1 A;  3WYW A;  3HZ4 A;  1Y25 A;  2GZZ A;  2PMT A;  4LL1 B;  4DVC A;  2KP2 A;  2JAC A;  1GSF A;  4HS1 A;  2OAC A;  2XPE A;  2C4J A;  2BTO T;  3UL3 A;  1O73 A;  12GS A;  2AJQ B;  1XW9 A;  2WCI A;  4ZL7 A;  4MF5 A;  2K18 A;  2F8A A;  2H19 A;  2O8V B;  1R4W A;  4HJ2 A;  2B1L A;  3KTB A;  1JHB A;  5ECQ B;  3TRP A;  3US3 A;  4KSM A;  2O89 A;  2VCZ A;  2LRT A;  1EP8 A;  3D5J A;  4DSR A;  2REM A;  1SK1 A;  1GNE A;  4ISD A;  2AV4 A;  1F2E A;  3F4S A;  5DDL A;  1B9X C;  2K8S A;  1QUW A;  4HDE A;  4F9Z A;  2FY6 A;  4V2N A;  2YV7 A;  2N5F A;  2H6X A;  3TKS A;  2OE3 A;  1R5A A;  6GSY A;  4HU9 A;  3G7Y A;  3U5R E;  2H0G A;  2LQQ A;  1AAZ A;  1FVJ A;  1OYJ A;  1X5E A;  1B48 A;  2KLX A;  5ECN B;  1YF1 A;  5AIX A;  5J41 A;  2IFQ B;  3LSZ A;  5CRG A;  4K0N A;  3F6D A;  1ST9 A;  1TRU A;  3HVX A;  5ID2 B;  2P5R A;  1ZCP A;  4PQI A;  1SKS B;  1XIY A;  5A4W A;  4NXI A;  4LLR A;  1HNA A;  1EZK A;  2H76 A;  2PN8 A;  3TGZ A;  2L6C A;  6GSW A;  5ECL B;  3E3E A;  5DAK A;  2H6Z A;  3UVT A;  1XWC A;  1T7P B;  1ZL9 A;  2J9H A;  2MYG A;  4ZB6 A;  4ID0 A;  1XWB A;  4WR5 A;  3QAW A;  2YWM A;  2DJJ A;  2VL9 A;  1K0A A;  1SL2 B;  2K9F A;  3EMX A;  3APQ A;  3KXO A;  1GNW A;  3GH9 A;  3UEM A;  1DBY A;  2H66 A;  2GS3 A;  3QAG A;  4JED A;  4OFT A;  4JRR A;  4HUA A;  3QCP A;  4EDZ A;  2HXK A;  5D96 A;  1M2A A;  3RPN A;  4KE3 A;  1A8L A;  2LNT A;  2GSR A;  4HZ4 A;  4MCU A;  1LBK A;  4JZQ A;  1K3L A;  3GRX A;  4RI7 A;  1PL1 A;  1QFN A;  1EV4 A;  3TKS E;  2H1G A;  1GTI A;  4ZIL A;  1EWX A;  3DD3 A;  3UBL A;  4POL A;  1Q4J A;  2VCW A;  4EKZ A;  2TRX A;  2H30 A;  2VL3 A;  1TU7 A;  2RM5 A;  5HQP A;  3IAM 2;  4L0U A;  2HRF A;  2A2R A;  2MMZ A;  3LYK A;  2AHE A;  1XOA A;  3A2X A;  1BJX A;  1X9W B;  3Q74 A;  2HRN A;  1LJR A;  2NBS A;  3QMX A;  4N0V A;  4MZC A;  2PUK C;  4I97 A;  3VK9 A;  3VWW A;  1FVK A;  4MK3 A;  2JSY A;  3QR6 A;  3DVW A;  3ZIT A;  2NVL A;  2CVB A;  1HNB A;  4IKH A;  3VI7 A;  2I9H A;  5KEJ A;  3GL3 A;  3ZFB A;  1VF2 A;  3J7Y b;  5HR2 A;  1A2L A;  1ZGN A;  3GTU A;  3KH7 A;  3IDV A;  3TRQ A;  3SBC A;  3EVI A;  3BOA A;  5CO3 A;  5DAL B;  4ZL8 A;  2J23 A;  3IK9 A;  4YQU A;  2L5L A;  3L9V A;  1SJ6 A;  3PH9 A;  1X5D A;  4FYU A;  4X1U A;  4OWY A;  3NZN A;  3KGK A;  2L4C A;  2I3Y A;  3W6G A;  4MMM A;  1XWA A;  2K6V A;  2DJ0 A;  3F4R A;  1LU4 A;  1NW2 A;  4L5L A;  6GSS A;  2FNO A;  3D4T A;  1PN9 A;  4V2M A;  4MLY A;  3EWL A;  1OC8 A;  1ERW A;  1Z9H A;  4NWY A;  5LNK e;  3N9J A;  1AC1 A;  4N11 A;  3GKK A;  2P31 A;  3GX8 A;  2ALB A;  4PNG A;  4G9H A;  4MAB A;  4DSQ A;  2R2J A;  1U3A A;  1PKZ A;  3M3M A;  4YAP A;  4MP4 A;  3HVV A;  2B6M A;  2FWH A;  6GSU A;  4MJC A;  3WGX A;  1W89 A;  1YDK A;  1PL2 A;  5G1K A;  5INY A;  1EOG A;  1AQV A;  1HYU A;  2G2Q A;  4LA1 A;  2P5Q A;  3ME7 A;  2F9S A;  1VF1 A;  4NHW A;  1BX9 A;  5EL8 A;  4RQX A;  1EEJ A;  3WGD A;  1GUH A;  4P3Y B;  1F3B A;  3F3Q A;  1V9W A;  5HR3 A;  4WET A;  3ED3 A;  3ZRD A;  4BWQ A;  5J3R A;  1AIU A;  4AJ6 A;  5FHI A;  7GSS A;  3TKS C;  3GFK A;  4D73 B;  2VL2 A;  1ZOF A;  3IBH A;  2HLS A;  3WT1 A;  4JU5 A;  2C1Y A;  3ZIJ A;  2V41 A;  1B9Y C;  5ECP B;  3I43 A;  1B8X A;  5JCU A;  3E0U A;  5A4V A;  1GWC A;  5J9C A;  1OAZ A;  3BCK A;  3CRU A;  4K6X A;  4PNF A;  3J7Y k;  1YQ1 A;  2WGR A;  5IPH A;  5IO2 A;  2H1B A;  2OE0 A;  2VCQ A;  4TR0 A;  4KH7 A;  2HT9 A;  3QAV A;  2Z9S A;  4HOJ A;  3LYP A;  1ML6 A;  5IPG A;  4XTS A;  3GN3 A;  4WKW A;  1TXX A;  1CQH A;  2LJK A;  3C7M A;  4O7H A;  2HI7 A;  3KMN A;  1AXD A;  1K0O A;  1GLQ A;  4NV5 A;  3IRA A;  2VLU A;  4EXJ A;  3TJG A;  4Q5N A;  2L6D A;  3EIN A;  2WUL A;  4CW9 A;  2I1U A;  3TKR A;  3BCI A;  2JZR A;  1X5C A;  3N5O A;  5ID2 A;  1QXH A;  3E9J B;  4ZB9 A;  2MBS A;  3ZYW A;  4WF5 A;  2KHP A;  2E7P A;  1XW5 A;  4IBP A;  4KCE A;  2DJK A;  3D4M A;  1MDI A;  4TRX A;  1F6M C;  5F06 A;  1WP0 A;  4FYC A;  1T4Y A;  2LEG A;  3PR8 A;  3A2W A;  4DEJ A;  5G30 A;  3GUS A;  3K8N A;  4I6X A;  2PVQ A;  4L5O A;  3SWL A;  2I81 A;  11GS A;  4GCI A;  4KB3 A;  4BA7 A;  3IPZ A;  1T8E B;  4K1F A;  3P8W A;  3GKN A;  4BVY A;  1R5P A;  1SK0 A;  3P7X A;  1WIK A;  1ZZY A;  1K0B A;  4LMV A;  4IP1 A;  5JCG A;  3FZ4 A;  2X99 A;  3P2A A;  1SK2 A;  4GWR A;  3C71 A;  3ZVJ D;  1AQW A;  5B8B A;  4XS1 A;  1Z7P A;  3M9K A;  1K0D A;  4JR6 A;  2TIR A;  5IMF A;  5ELG A;  4K7O A;  3M9J A;  4ZBA A;  4NMU A;  4TXV A;  1M99 A;  2H8L A;  3FEU A;  3V1W A;  1V98 A;  5ECS A;  4PUF C;  1GUM A;  4K0G A;  1KTE A;  3EYT A;  4BL7 A;  3TDG A;  2IMD A;  3R2Q A;  5G5F A;  3GX0 A;  3AY8 A;  3EUR A;  4IN0 A;  5B6N A;  2CZ3 A;  1USB A;  3H4K A;  3GYK A;  5HR0 A;  3HXS A;  3LGC A;  3FZ5 A;  1KEB A;  1BQ7 A;  4KX4 A;  3C73 A;  2VM2 A;  1SEN A;  2ZCT A;  2VCT A;  5IMC A;  1OE7 A;  1PMT A;  5F05 A;  4TKY A;  3F9U A;  2JAD A;  1Z7R A;  5IM9 A;  1YY7 A;  4G2E A;  3C8E A;  2YNX A;  2V6O A;  4NV2 A;  1O81 A;  1SJZ A;  5B8A A;  2AAW A;  1G7E A;  3HJM A;  3LQ7 A;  3KM6 A;  1DE2 A;  2YCD A;  3UMA A;  3IE3 A;  4IW9 A;  16GS A;  1PD2 1;  3TCO A;  2R5G A;  2GZP A;  3LEF A;  4H86 A;  4ECI A;  4QL7 A;  4IHU A;  1F9M A;  1N2A A;  4TR4 A;  5H5R A;  2L5O A;  1SD8 A;  2HZF A;  4GTU A;  1EP7 A;  2YZH A;  3GA4 A;  1YZX A;  1TK8 B;  3VFI A;  4TR3 A;  1O7U A;  4GXZ A;  3DYR A;  4IP6 A;  5GSS A;  1Z6N A;  3MAK A;  1NHO A;  4KCA A;  3HJO A;  5ECO B;  1JLW A;  1R7H A;  1ON4 A;  4KW6 A;  2F51 A;  1A2M A;  1JZW A;  4Q5F A;  3F4T A;  1XCC A;  3ZIV A;  3A5W A;  4MJE A;  1GSE A;  5GZZ B;  1U3I A;  2DJ3 A;  5G1L A;  3VPQ A;  3L78 A;  3FR6 A;  2LJR A;  4KND A;  3M1G A;  5DBQ A;  2VL2 C;  2M72 A;  3FKF A;  4HI7 A;  3CMI A;  4N0Z A;  2IPA A;  2YAN A;  9GSS A;  2CX4 A;  2PBJ A;  5ECR B;  3RBT A;  1S3A A;  2HSH A;  3TJF A;  2LRC A;  3KJY A;  2EIQ A;  2DMM A;  4KDU A;  1PX6 A;  3LOR A;  3TOU A;  2LV3 A;  3DWV A;  4DSS B;  3I6A A;  4V1A g;  3DGQ A;  2CVD A;  2A4V A;  2FWF A;  5JCW A;  3DEX A;  4CDO A;  1TJD A;  3ERF A;  1T3B A;  2YV9 A;  1A2J A;  1MEK A;  1K3O A;  2C3T A;  2HZE B;  5A4U A;  3O3T A;  5DQY A;  3C1S A;  4I2T A;  2V32 A;  2FD3 A;  2VD1 A;  4TR1 B;  3TUE A;  1OC9 A;  1MDK A;  2H73 A;  5KN1 A;  3FZ9 A;  3W8J A;  2YJ7 A;  1TRV A;  3ZZX A;  4TN8 A;  5D93 A;  5B7C A;  2CT6 A;  2NDO A;  4EO3 A;  2L57 A;  1TI1 A;  5D9V A;  4JR4 A;  3FY7 A;  4KUN A;  1A23 A;  1YEP A;  4WBJ A;  1J0F A;  1GUL A;  4ACS A;  1URM A;  3D6I A;  4E8E A;  2KOK A;  3I9V 2;  3EU3 A;  2FWE A;  2VM1 A;  2WS2 A;  1G0T A;  4MF7 A;  1X9S B;  4JBB A;  2WB9 A;  1O85 A;  2LNS A;  3TJK A;  2EC4 A;  1E6B A;  1TOF A;  2WZ9 A;  3UAR A;  2H1A A;  3H1N A;  4MPG A;  4TVE A;  2D2Z A;  2GSQ A;  2C8U A;  2DJ2 A;  4N10 A;  5CRW A;  3LXT A;  3TJB A;  1JZO A;  3TOT A;  1HNC A;  5ABR A;  3FK8 A;  2JZT A;  3APS A;  3IA1 A;  4XRA A;  2VOC A;  4EL1 A;  4HJM A;  5D73 A;  1PKW A;  3TKP A;  4F0C A;  3LFL A;  4AF2 A;  3DML A;  1AW9 A;  1TW9 A;  3KH9 A;  1O8X A;  4ILF A;  5CRH A;  5IOW A;  1H75 A;  5FT3 A;  5HR1 A;  2YOI A;  3W8S A;  1H4O A;  4ECB A;  1ERT A;  1XWG A;  4EF0 A;  1SU9 A;  1O8W A;  1YEX A;  2C3Q A;  1QMV A;  3GSS A;  1ABA A;  14GS A;  2E0Q A;  3MSZ A;  1B4P A;  2DML A;  3QOU A;  4YH2 A;  5ECI B;  2JL4 A;  3VWU A;  2G0F A;  1SL0 B;  5DQS A;  3D22 A;  5AIS A;  3HYP A;  2RM6 A;  2IMK A;  1V58 A;  4EC0 A;  5CYY A;  1FG4 A;  3L0H A;  1ERV A;  3FRC A;  1M0U A;  2H75 A;  2ZNM A;  2MMN A;  4EDY A;  1K0C A;  1U87 A;  1XWK A;  1OE8 A;  5D8I A;  2X64 A;  2B1K A;  5H5S A;  1QQ2 A;  2OA7 A;  1F37 A;  1K0M A;  2CV4 A;  1SYR A;  5KN2 A;  2XBI A;  4IVF A;  1TK0 B;  1GLP A;  5LD0 A;  5DJL A;  5DAK B;  10GS A;  2O85 A;  4XCS A;  2VLT A;  2ON5 A;  5ECH B;  2O7K A;  3KD0 A;  2C0G A;  4MZW A;  4GSS A;  3KMO A;  4XHM A;  2N5B A;  2RUE A;  2WRT A;  3IHQ A;  4MDC A;  2FA4 A;  4FO5 A;  1WOU A;  2NPB A;  4LMW A;  1UN2 A;  3EE2 A;  4POM A;  1VRS D;  3TB2 A;  1OKT A;  1RQM A;  5D9T A;  1HQO A;  2RLI A;  3QD9 A;  3S9F A;  17GS A;  3UAP A;  4E8H A;  2YN1 A;  1FB6 A;  2IIY A;  2VD0 A;  3ISO A;  2CA8 A;  4J57 E;  2MBT A;  3WGE A;  1GRX A;  5ECM B;  3UVH A;  1VGL A;  3ERG A;  4KSO A;  5E59 A;  3LG6 A;  2VIM A;  3CSI A;  2OBI A;  2JSZ A;  2IFQ A;  2IWT A;  2DLX A;  3QPM A;  1X0R A;  4WBR D;  1V2A A;  3EU4 A;  1XXU A;  2GVP A;  4XS6 A;  2LRN A;  5AGY A;  3H8Q A;  5IMA A;  1FAA A;  3ZFL A;  4KDY A;  2HFD A;  3OR5 A;  4BVX A;  2V2G A;  4GRF A;  3HD5 A;  2HE3 A;  1GSU A;  4ZXG A;  2ZUP A;  3VPT A;  1QGV A;  2DIY A;  5DJM A;  4AJ7 A;  3GV1 A;  3BD2 A;  5CRD A;  2FA8 A;  3CTG A;  1TK5 B;  3KZQ A;  4CHS A;  2ES7 A;  3O6T A;  2H72 A;  2R6K A;  3F63 A;  1PX7 A;  2PGT A;  3ZTL A;  2M46 A;  4XS4 B;  1MD3 A;  4POK A;  2P0G A;  1T1V A;  4OFM A;  4MA9 A;  4OO4 A;  4O5R A;  4POB A;  2HZE A;  1FO5 A;  5KN0 A;  5J5N A;  4MPF A;  3I69 A;  3GNJ A;  2DJ1 A;  2WDU A;  2F8F A;  1XOB A;  2H6Y A;  3APO A;  3GUR A;  4OFN A;  6GSV A;  6GST A;  3CYN A;  4Z7X A;  2DC5 A;  2BMX A;  4XRD A;  4TXO B;  1TKD B;  2CVK A;  3O76 A;  4GQF A;  2HSY A;  19GS A;  2N5A A;  2L59 A;  1WE0 A;  4IQA A;  2OKA A;  3G7I A;  3ZRE A;  4NPB A;  4MJA A;  2LTK A;  3WT2 A;  5GAP D;  1OVN A;  1THX A;  1EGR A;  2MZC A;  1A0F A;  3TJJ A;  2C0F A;  5CRE A;  1S3D A;  1PA3 A;  1Z6M A;  2YWI A;  4HQS A;  2O87 A;  5IMZ A;  5D9X A;  1M2B A;  4ZIJ A;  3ZLP A;  3FW2 A;  4ZBD A;  5IMD A;  3HY2 A;  4RQR A;  1ACV A;  2YWO A;  4IS0 A;  3FR9 A;  2L4Q A;  2X8H A;  5E4W A;  2JZS A;  2R4V A;  2CAI A;  1A24 A;  3UIW A;  2ON7 A;  5JWQ B;  1V57 A;  2RUF A;  2XBQ A;  3EC3 A;  4ZBB A;  3GL5 A;  1SKW B;  4IEL A;  1G6Y A;  2IL3 A;  5DAL A;  1PSQ A;  4ECJ A;  4WF4 A;  1TRS A;  2IJY A;  2VAF A;  2X8G A;  3TRX A;  1SJI A;  3D21 A;  3LXZ A;  4K7N A;  5ELA A;  5J9B A;  1SL1 B;  2GT5 A;  1BG5 A;  3M8N A;  4MH3 A;  4ULX A;  2GST A;  4EVM A;  2C3N A;  1NM3 A;  4HU7 A;  4OCF A;  4F03 A;  4XIH A;  1BYE A;  5A5K A;  3QDN A;  3LWA A;  5JWO B;  3IV4 A;  4WR4 A;  3WD6 A;  3HVS A;  5AN1 A;  4MZB A;  5LCZ A;  1T4Z A;  1XFL A;  2LST A;  5C04 A;  3QFB C;  4I8B A;  5HFG A;  4QQ7 A;  4FH8 A;  2X8C A;  2AYT A;  1J08 A;  4K8M A;  2FWG A;  2GZY A;  5G2Z A;  1BED A;  5ENU A;  2H74 A;  3NOF A;  1SYX A;  3RHB A;  3NIV A;  5H5Q A;  3CSJ A;  3KEB A;  3DVX A;  1WWJ A;  1WJK A;  4ECC A;  2K8V A;  2MMA A;  13GS A;  2AUV A;  4MF6 A;  1WRY A;  1N8J A;  4Q5R A;  1ERU A;  1XVW A;  1WMJ A;  2DBC A;  2VUP A;  2BJX A;  3HZ8 A;  3QFA C;  2R37 A;  2H71 A;  4ZL9 A;  1K0N A;  1KBN A;  3L9U A;  2XHF A;  18GS A;  3CTF A;  3MWH A;  4HQZ A;  3EMP A;  3GST A;  4G10 A;  1FHE A;  3BBY A;  4EE0 A;  4HZ2 A;  4I2U A;  4O92 A;  4D73 A;  4IGJ A;  1F3A A;  4L0W A;  2YJH A;  5GAN D;  2A2S A;  3A3T A;  4RUV A;  5F07 A;  3RAZ A;  2IME A;  2B7J A;  1YF0 A;  2QGV A;  1TTZ A;  5COH A;  1M7T A;  1VF3 A;  1RK4 A;  5CP1 A;  3G9B A;  5C00 A;  4LL4 B;  2PPT A;  5GST A;  1CQG A;  4PQ1 A;  3VWX A;  1QK8 A;  4BPY A;  1GH2 A;  2GSS A;  2OAD A;  4IJ3 A;  20GS A;  3FHK A;  2H0I A;  5B6M A;  5L71 A;  6GSX A;  2IMI A;  2LQO A;  3CXG A;  3G7J A;  1O6J A;  1ZMA A;  2GQK A;  4IJI A;  4EUY A;  4G19 A;  2PVO C;  4F0B A;  5CAX A;  1MDJ A;  4PUA A;  1T00 A;  1TRW A;  3ME8 A;  1FOV A;  2EIR A;  3IXR A;  2GDR A;  4MJB A;  4OCE A;  1MD4 A;  5IO0 A;  2IMF A;  3PGT A;  4KAE A;  4OMV A;  1MTC A;  1YJ6 A;  1IYI A;  1J9B A;  4F82 A;  1V40 A;  4KDX A;  4ZB8 A;  2XPD A;  2JU5 A;  3UJ1 A;  1DUG A;  3CBU A;  3KP9 A;  2QSI A;  2F3M A;  3HKR A;  1Z3E A;  2GTU A;  3C1R A;  2B3S A;  1IYH A;  5DVB A;  1DE1 A;  3ZL5 A;  3F6F A;  2H0H A;  1YKC A;  1VF4 A;  2B7K A;  1FW1 A;  4XS4 A;  3VI5 A;  4PXO A;  4GST A;  4BWS A;  3VLN A;  2GGT A;  1ZYE A;  2C0D A;  1JZR A;  1TU8 A;  1OC3 A;  1Q98 A;  2PWJ A;  1UVZ A;  1YKA A;  2E2M A;  3UOM A;  4FIW A;  4GQC A;  3A2V A;  1WPI A;  1EGO A;  1GSD A;  4TXO A;  2R3X A;  1GTA A;  3RPP A;  1XW6 A;  5DCG A;  3L4N A;  2CQ9 A;  2KUC A;  1TDI A;  2OE1 A;  5FWG A;  4OO5 A;  1JZD A;  1NSW A;  3HA9 A;  4KA0 A;  4AJ8 A;  4YAV A;  3ZMK A;  4QL9 A;  3IK7 A;  1XZO A;  3IAS 2;  4PGT A;  1GSS A;  1UA5 A;  2B5X A;  1GL8 A;  2FLS A;  2DSA A;  1R26 A;  2YWN A;  5HFI A;  3TKQ A;  4K9Z A;  2CZ2 A;  4Q5Q A;  3DXB A;  3H93 A;  2B5Y A;  4KGI A;  1M9A A;  1DSB A;  2TRC P;  5J4U A;  1SKR B;  3DRN A;  4MH2 A;  4AGS A;  3MNG A;  2FHE A;  2PU9 C;  4K2D A;  4PUR A;  3HHV A;  2H70 A;  2YP6 A;  1XBS A;  4PQH A;  1SD9 A;  2NTO A;  1M9B A;  3VWV A;  4ML6 A;  3MDK A;  2FCH A;  1W4V A;  3L9S A;  2OJL A;  2QKE A;  2WJU A;  2YPM A; 
#chains in the Genus database with same CATH topology
 2CAQ A;  3M0F A;  2GLR A;  2XC2 A;  4GF0 A;  3FZA A;  3U6V A;  2HNL A;  1EV9 A;  1Y6E A;  1AUC A;  1RW1 A;  1C72 A;  3VUR A;  4WXT A;  2V6K A;  4X43 A;  5DCH A;  2B5E A;  1GSQ A;  2LS5 A;  2VCV A;  2C0E A;  1JLV A;  2M80 A;  3GHA A;  2KP1 A;  4TOP A;  5JWR B;  5IIZ A;  5ECK B;  2FGX A;  3UBK A;  4USS A;  3F8U A;  4N30 A;  4CY8 A;  1GSY A;  4TW5 A;  2EIO A;  3PIN A;  1FB0 A;  1XVQ A;  1I5G A;  3RHC A;  1OC9 B;  5HFK A;  3DIE A;  5EPF A;  1GTB A;  3Q19 A;  3HJP A;  2MMO A;  5IQY A;  3P90 A;  4GSN A;  4O32 A;  3FYG A;  4RI6 A;  2PER A;  4YKF A;  2CX3 A;  3KIJ A;  5D9W A;  1GTU A;  1M2D A;  4ML1 A;  1B4Q A;  2VLV A;  1G7O A;  5CNW A;  4Z2T A;  2LKU A;  1TI3 A;  5F8B A;  3CRT A;  4A5P A;  2WFC A;  1PGT A;  1K3Y A;  2IN3 A;  3IOS A;  4G0K A;  4IQ1 A;  4DSS A;  2VCX A;  3D0Z A;  3CSH A;  2GQM A;  2LUS A;  1ZYQ B;  3ERW A;  3FR3 A;  2C80 A;  1BAY A;  1X9M B;  5EY6 A;  3KTL A;  5IOX A;  2GQL A;  3F3R A;  2QC7 A;  4HEA 2;  1AQX A;  3GTU B;  4J56 E;  1TP9 A;  2VO4 A;  2YZU A;  1XPV A;  3LJR A;  3ZVJ A;  5IMV A;  4YQV A;  4JE1 A;  8GSS A;  1U6T A;  4GLT A;  1Z5Y E;  1G6W A;  1PRX A;  2H01 A;  3GIX A;  1S3C A;  4V1A p;  1UC7 A;  1I9D A;  1THO A;  4J2F A;  4TR1 A;  4YQM A;  2H1D A;  2LJA A;  3Q6O A;  3ZML A;  5AIV A;  1PQN A;  5G31 A;  4OD7 A;  2I4A A;  3H79 A;  3HDC A;  22GS A;  3HCZ A;  3KP8 A;  1GUK A;  2DIZ A;  4V2L A;  3GKX A;  4KF9 A;  4F2I A;  3IR4 A;  3JCM L;  3DKS A;  2E2G A;  2GT6 A;  3BJ5 A;  4X0X A;  4L8E A;  5KN3 A;  1EEM A;  5EVO A;  5G5E A;  2HYX A;  4NHZ A;  2RII A;  4FYB A;  3GKM A;  3Q18 A;  3F0I A;  2V1M A;  4WEY A;  3KCM A;  1OKD A;  1E2Y A;  1JFU A;  3IC4 A;  2FUG 2;  2OBK A;  4I5Q A;  5F0G A;  1U88 A;  1EOH A;  3GMF A;  3GH6 A;  1A0R P;  2AB6 A;  1HD2 A;  1ILO A;  4K7I A;  1KNG A;  3RDW A;  4NAX A;  1NHY A;  1GP1 A;  1A8Y A;  4PX1 A;  3WYW A;  3HZ4 A;  1Y25 A;  2GZZ A;  2PMT A;  4LL1 B;  2DKI A;  4DVC A;  2KP2 A;  2JAC A;  1GSF A;  4HS1 A;  2OAC A;  2XPE A;  2C4J A;  2BTO T;  3UL3 A;  1ZYN A;  1O73 A;  12GS A;  2AJQ B;  1XW9 A;  3CQF A;  2WCI A;  4ZL7 A;  4MF5 A;  2K18 A;  2F8A A;  2H19 A;  2O8V B;  1R4W A;  4HJ2 A;  2B1L A;  3KTB A;  1JHB A;  5ECQ B;  3TRP A;  3US3 A;  4KSM A;  2O89 A;  2VCZ A;  2LRT A;  1EP8 A;  3D5J A;  4DSR A;  2REM A;  1SK1 A;  1GNE A;  4ISD A;  2AV4 A;  1F2E A;  1PN0 A;  3F4S A;  5DDL A;  1B9X C;  2K8S A;  1QUW A;  4HDE A;  4F9Z A;  2FY6 A;  4V2N A;  2A4H A;  2YV7 A;  2N5F A;  2H6X A;  3TKS A;  2OE3 A;  1R5A A;  6GSY A;  4HU9 A;  3G7Y A;  3U5R E;  2H0G A;  4HSC X;  2LQQ A;  1AAZ A;  1FVJ A;  1OYJ A;  1X5E A;  1B48 A;  2KLX A;  5ECN B;  1YF1 A;  5AIX A;  5J41 A;  4BIK A;  2IFQ B;  3LSZ A;  5CRG A;  4K0N A;  3F6D A;  1ST9 A;  1TRU A;  3HVX A;  5BRT A;  5ID2 B;  2P5R A;  1ZCP A;  4PQI A;  1SKS B;  1XIY A;  5A4W A;  4NXI A;  4LLR A;  1HNA A;  1EZK A;  2H76 A;  2PN8 A;  3TGZ A;  2L6C A;  6GSW A;  5ECL B;  3E3E A;  5DAK A;  2H6Z A;  3UVT A;  1XWC A;  1T7P B;  1ZL9 A;  2J9H A;  2MYG A;  4ZB6 A;  4ID0 A;  1XWB A;  4WR5 A;  4BVX B;  3QAW A;  2YWM A;  2DJJ A;  2VL9 A;  1K0A A;  1SL2 B;  2K9F A;  3EMX A;  3APQ A;  3KXO A;  1GNW A;  2HRA A;  3GH9 A;  3UEM A;  1DBY A;  2H66 A;  2GS3 A;  3QAG A;  4JED A;  4OFT A;  4JRR A;  4HUA A;  3QCP A;  4EDZ A;  2HXK A;  4BVY B;  5D96 A;  1M2A A;  3RPN A;  4KE3 A;  1A8L A;  2LNT A;  2GSR A;  4HZ4 A;  4MCU A;  1LBK A;  4JZQ A;  1K3L A;  3GRX A;  4RI7 A;  1PL1 A;  1QFN A;  1EV4 A;  3TKS E;  2H1G A;  1GTI A;  4ZIL A;  1EWX A;  3DD3 A;  4K5R A;  3UBL A;  4POL A;  1Q4J A;  2VCW A;  4EKZ A;  2TRX A;  2H30 A;  4MNN A;  2VL3 A;  1TU7 A;  2RM5 A;  5HQP A;  3IAM 2;  4FQU A;  4L0U A;  2HRF A;  2A2R A;  2MMZ A;  3LYK A;  2AHE A;  1XOA A;  3A2X A;  1BJX A;  1X9W B;  5KOX A;  3Q74 A;  2HRN A;  1LJR A;  2NBS A;  3QMX A;  4N0V A;  4MZC A;  2PUK C;  4I97 A;  3VK9 A;  3VWW A;  1FVK A;  4MK3 A;  2JSY A;  3QR6 A;  3DVW A;  3ZIT A;  2NVL A;  2CVB A;  1HNB A;  4IKH A;  1ZYP A;  3VI7 A;  2I9H A;  5KEJ A;  3GL3 A;  3ZFB A;  1VF2 A;  3J7Y b;  5HR2 A;  1A2L A;  1ZGN A;  3GTU A;  3KH7 A;  3IDV A;  3TRQ A;  3SBC A;  3EVI A;  3BOA A;  5CO3 A;  5DAL B;  4ZL8 A;  2J23 A;  3IK9 A;  4YQU A;  2L5L A;  3L9V A;  1SJ6 A;  3PH9 A;  1X5D A;  4FYU A;  4X1U A;  4OWY A;  3NZN A;  3KGK A;  2L4C A;  2I3Y A;  3W6G A;  4MMM A;  1XWA A;  2K6V A;  2DJ0 A;  3F4R A;  1LU4 A;  1NW2 A;  4L5L A;  6GSS A;  2FNO A;  3D4T A;  1PN9 A;  4V2M A;  4MLY A;  3EWL A;  1OC8 A;  1ERW A;  1Z9H A;  4NWY A;  5LNK e;  3N9J A;  1AC1 A;  4N11 A;  3GKK A;  2P31 A;  3GX8 A;  2ALB A;  4PNG A;  4G9H A;  4MAB A;  4DSQ A;  2R2J A;  1U3A A;  1PKZ A;  3M3M A;  4YAP A;  4MP4 A;  3HVV A;  2B6M A;  2FWH A;  6GSU A;  4MJC A;  3WGX A;  1W89 A;  1YDK A;  1PL2 A;  5G1K A;  5INY A;  1EOG A;  1AQV A;  1HYU A;  2G2Q A;  4LA1 A;  2P5Q A;  3ME7 A;  2F9S A;  1VF1 A;  4NHW A;  1BX9 A;  5EL8 A;  4RQX A;  1EEJ A;  3WGD A;  1GUH A;  4P3Y B;  1F3B A;  3F3Q A;  1V9W A;  4K2X A;  5HR3 A;  4WET A;  3ED3 A;  3ZRD A;  4BWQ A;  5J3R A;  2X49 A;  1AIU A;  4AJ6 A;  5FHI A;  7GSS A;  3TKS C;  3GFK A;  4D73 B;  2VL2 A;  1ZOF A;  3IBH A;  2HLS A;  3WT1 A;  4JU5 A;  2C1Y A;  3ZIJ A;  2V41 A;  1B9Y C;  5ECP B;  3I43 A;  1B8X A;  5JCU A;  3E0U A;  5A4V A;  1GWC A;  5J9C A;  1OAZ A;  3BCK A;  3CRU A;  4K6X A;  4PNF A;  3J7Y k;  3MYD A;  1YQ1 A;  2WGR A;  5IPH A;  5IO2 A;  2H1B A;  2OE0 A;  2VCQ A;  4TR0 A;  4KH7 A;  2HT9 A;  3IHG A;  2Z9S A;  3QAV A;  4HOJ A;  3LYP A;  1ML6 A;  5IPG A;  4XTS A;  3GN3 A;  4WKW A;  1TXX A;  1CQH A;  2LJK A;  3C7M A;  4O7H A;  2HI7 A;  3KMN A;  1AXD A;  1K0O A;  1GLQ A;  4NV5 A;  3IRA A;  3HVN A;  2VLU A;  4EXJ A;  3TJG A;  4Q5N A;  2L6D A;  3EIN A;  2WUL A;  4CW9 A;  4Z2U A;  2I1U A;  3TKR A;  3BCI A;  2JZR A;  1X5C A;  3N5O A;  5ID2 A;  1QXH A;  3E9J B;  4ZB9 A;  2MBS A;  3ZYW A;  4WF5 A;  2KHP A;  2E7P A;  1XW5 A;  4IBP A;  4KCE A;  2DJK A;  3D4M A;  1MDI A;  4TRX A;  1F6M C;  5F06 A;  1WP0 A;  4FYC A;  1T4Y A;  2LEG A;  3PR8 A;  3A2W A;  4DEJ A;  5G30 A;  3GUS A;  2A2P A;  3K8N A;  4I6X A;  2PVQ A;  4L5O A;  3SWL A;  2I81 A;  11GS A;  4GCI A;  4KB3 A;  4BA7 A;  3IPZ A;  1T8E B;  4K1F A;  3P8W A;  4G0I A;  3GKN A;  4BVY A;  1R5P A;  1SK0 A;  3P7X A;  1WIK A;  1ZZY A;  1K0B A;  4LMV A;  4IP1 A;  5JCG A;  3FZ4 A;  2X99 A;  3P2A A;  1SK2 A;  4GWR A;  3C71 A;  3ZVJ D;  1AQW A;  4X4J A;  5B8B A;  4XS1 A;  1Z7P A;  3M9K A;  1K0D A;  4JR6 A;  2TIR A;  5IMF A;  5ELG A;  4K7O A;  3M9J A;  4ZBA A;  4NMU A;  4TXV A;  1M99 A;  2H8L A;  3FEU A;  3V1W A;  1V98 A;  5ECS A;  4PUF C;  1GUM A;  4K0G A;  1KTE A;  3EYT A;  4BL7 A;  3TDG A;  2IMD A;  3R2Q A;  5G5F A;  3GX0 A;  3AY8 A;  3EUR A;  4IN0 A;  5B6N A;  2CZ3 A;  1USB A;  3H4K A;  3GYK A;  5HR0 A;  3HXS A;  3LGC A;  3FZ5 A;  1KEB A;  4KX4 A;  1BQ7 A;  3C73 A;  2VM2 A;  1SEN A;  2ZCT A;  2VCT A;  5IMC A;  1OE7 A;  1PMT A;  5F05 A;  4TKY A;  3F9U A;  2JAD A;  1Z7R A;  5IM9 A;  1YY7 A;  4G2E A;  3C8E A;  2YNX A;  2V6O A;  4NV2 A;  1O81 A;  1SJZ A;  5B8A A;  2AAW A;  1G7E A;  3HJM A;  3LQ7 A;  3KM6 A;  1DE2 A;  2YCD A;  3UMA A;  3IE3 A;  4IW9 A;  16GS A;  1PD2 1;  3TCO A;  2R5G A;  2GZP A;  3LEF A;  4H86 A;  4ECI A;  4QL7 A;  4IHU A;  1F9M A;  1N2A A;  4TR4 A;  5H5R A;  2L5O A;  1SD8 A;  2HZF A;  4GTU A;  1EP7 A;  2YZH A;  3GA4 A;  3R3E A;  1YZX A;  1TK8 B;  3VFI A;  4TR3 A;  1O7U A;  4GXZ A;  3DYR A;  4IP6 A;  5GSS A;  1Z6N A;  3MAK A;  1NHO A;  4KCA A;  3HJO A;  5ECO B;  1JLW A;  1R7H A;  1ON4 A;  4KW6 A;  2F51 A;  1A2M A;  1JZW A;  4Q5F A;  3F4T A;  1XCC A;  3ZIV A;  3A5W A;  4MJE A;  1GSE A;  5GZZ B;  1U3I A;  2DJ3 A;  5G1L A;  3VPQ A;  3L78 A;  3FR6 A;  2LJR A;  4KND A;  3M1G A;  5DBQ A;  2VL2 C;  2M72 A;  3FKF A;  4HI7 A;  3CMI A;  4N0Z A;  2IPA A;  2YAN A;  9GSS A;  2CX4 A;  2PBJ A;  5ECR B;  3RBT A;  1S3A A;  2HSH A;  3TJF A;  2LRC A;  3KJY A;  2EIQ A;  2DMM A;  4KDU A;  1PX6 A;  3LOR A;  3TOU A;  2LV3 A;  3DWV A;  4DSS B;  3I6A A;  4V1A g;  3DGQ A;  4G0L A;  2CVD A;  2A4V A;  2FWF A;  5JCW A;  3DEX A;  4CDO A;  1TJD A;  3ERF A;  1T3B A;  2YV9 A;  1A2J A;  1MEK A;  4EIP A;  1K3O A;  2C3T A;  2HZE B;  5A4U A;  3O3T A;  5DQY A;  3C1S A;  4I2T A;  3MIX A;  2V32 A;  2FD3 A;  2VD1 A;  4TR1 B;  3TUE A;  1OC9 A;  1MDK A;  2H73 A;  5KN1 A;  3FZ9 A;  3W8J A;  2YJ7 A;  1TRV A;  3ZZX A;  4TN8 A;  5D93 A;  5B7C A;  2CT6 A;  2NDO A;  4EO3 A;  2L57 A;  1TI1 A;  5D9V A;  4JR4 A;  3FY7 A;  4KUN A;  1A23 A;  1YEP A;  2QA1 A;  4WBJ A;  1J0F A;  1GUL A;  4ACS A;  1URM A;  3D6I A;  4E8E A;  2KOK A;  3I9V 2;  2R0G A;  3EU3 A;  2FWE A;  2VM1 A;  2WS2 A;  1G0T A;  4MF7 A;  1X9S B;  4JBB A;  2WB9 A;  1O85 A;  2LNS A;  3TJK A;  2EC4 A;  1E6B A;  5KOW A;  1TOF A;  2WZ9 A;  3UAR A;  2H1A A;  3H1N A;  4MPG A;  4TVE A;  2D2Z A;  2GSQ A;  2C8U A;  2DJ2 A;  4N10 A;  2R0P A;  5CRW A;  3LXT A;  3TJB A;  1JZO A;  3TOT A;  1HNC A;  5ABR A;  3FK8 A;  2JZT A;  3APS A;  3IA1 A;  4XRA A;  2VOC A;  4EL1 A;  4HJM A;  5D73 A;  1PKW A;  3TKP A;  4O5U A;  4F0C A;  3LFL A;  4AF2 A;  3DML A;  1AW9 A;  1TW9 A;  3KH9 A;  1O8X A;  4ILF A;  5CRH A;  5IOW A;  1H75 A;  4YKG A;  5FT3 A;  5HR1 A;  2YOI A;  3W8S A;  1H4O A;  2UZ8 A;  4ECB A;  1ERT A;  1XWG A;  4Z2R A;  4EF0 A;  1SU9 A;  1O8W A;  1YEX A;  2C3Q A;  1QMV A;  1XG8 A;  3GSS A;  1ABA A;  14GS A;  2E0Q A;  3MSZ A;  1B4P A;  2DML A;  3QOU A;  4YH2 A;  5ECI B;  4EIQ A;  2JL4 A;  3VWU A;  2G0F A;  1SL0 B;  4PTS A;  5DQS A;  3D22 A;  5AIS A;  3HYP A;  2RM6 A;  2IMK A;  1V58 A;  4EC0 A;  5CYY A;  1FG4 A;  3LW9 A;  3L0H A;  1ERV A;  3FRC A;  1M0U A;  2H75 A;  2ZNM A;  2MMN A;  4EDY A;  1K0C A;  1U87 A;  1XWK A;  1OE8 A;  5D8I A;  2X64 A;  2B1K A;  5H5S A;  1QQ2 A;  2OA7 A;  1F37 A;  1K0M A;  2CV4 A;  1SYR A;  5KN2 A;  2XBI A;  4IVF A;  1TK0 B;  1GLP A;  5LD0 A;  5DJL A;  5DAK B;  10GS A;  2O85 A;  4XCS A;  2VLT A;  2ON5 A;  5ECH B;  2O7K A;  3KD0 A;  2C0G A;  4MZW A;  4GSS A;  3KMO A;  4XHM A;  2N5B A;  2RUE A;  2WRT A;  3IHQ A;  4MDC A;  2FA4 A;  4FO5 A;  1WOU A;  2NPB A;  4LMW A;  1UN2 A;  3EE2 A;  4POM A;  1VRS D;  3TB2 A;  1OKT A;  1RQM A;  5D9T A;  1HQO A;  2RLI A;  3QD9 A;  3S9F A;  17GS A;  3UAP A;  4E8H A;  2YN1 A;  1FB6 A;  2IIY A;  2VD0 A;  1M3J A;  3ISO A;  2CA8 A;  4J57 E;  2MBT A;  3WGE A;  1GRX A;  5ECM B;  3UVH A;  1VGL A;  3ERG A;  4KSO A;  5E59 A;  3LG6 A;  2VIM A;  3CSI A;  2OBI A;  2JSZ A;  2IFQ A;  3EPT A;  2QA2 A;  2IWT A;  2DLX A;  3QPM A;  1X0R A;  4WBR D;  1V2A A;  3EU4 A;  1XXU A;  2GVP A;  4XS6 A;  2LRN A;  5AGY A;  3H8Q A;  5IMA A;  1FAA A;  3ZFL A;  4KDY A;  2HFD A;  3OR5 A;  4BVX A;  2V2G A;  4GRF A;  3HD5 A;  2HE3 A;  1GSU A;  4ZXG A;  2ZUP A;  3VPT A;  2R0C A;  1QGV A;  2DIY A;  5DJM A;  4AJ7 A;  3GV1 A;  3BD2 A;  5CRD A;  2FA8 A;  3CTG A;  1TK5 B;  3KZQ A;  4CHS A;  1PFO A;  2ES7 A;  3O6T A;  2H72 A;  2R6K A;  3F63 A;  1PX7 A;  2PGT A;  3ZTL A;  2M46 A;  4XS4 B;  1MD3 A;  4POK A;  2P0G A;  1T1V A;  4OFM A;  4MA9 A;  4OO4 A;  4O5R A;  4POB A;  2HZE A;  1FO5 A;  5KN0 A;  5J5N A;  4MPF A;  3I69 A;  3GNJ A;  2DJ1 A;  2WDU A;  2F8F A;  1XOB A;  2H6Y A;  3APO A;  3GUR A;  4OFN A;  6GSV A;  6GST A;  3CYN A;  4Z7X A;  2DC5 A;  3FMW A;  2BMX A;  4XRD A;  4TXO B;  1TKD B;  2CVK A;  3O76 A;  4GQF A;  2HSY A;  19GS A;  2N5A A;  2L59 A;  1WE0 A;  4IQA A;  2OKA A;  3G7I A;  3ZRE A;  4NPB A;  4MJA A;  2LTK A;  3WT2 A;  5GAP D;  1OVN A;  1THX A;  3IC8 A;  1EGR A;  4ICY A;  2MZC A;  1A0F A;  3TJJ A;  2C0F A;  5CRE A;  1S3D A;  1PA3 A;  1Z6M A;  2YWI A;  4HQS A;  2O87 A;  5IMZ A;  5D9X A;  1M2B A;  4ZIJ A;  3ZLP A;  3FW2 A;  4ZBD A;  5IMD A;  3HY2 A;  4RQR A;  1ACV A;  2YWO A;  2HSM A;  4IS0 A;  3FR9 A;  2L4Q A;  2X8H A;  5E4W A;  2JZS A;  2R4V A;  2CAI A;  1A24 A;  3UIW A;  2ON7 A;  5JWQ B;  1V57 A;  1M3I A;  2RUF A;  2XBQ A;  3EC3 A;  4ZBB A;  3GL5 A;  1SKW B;  4IEL A;  1G6Y A;  2IL3 A;  5DAL A;  1PSQ A;  4ECJ A;  4WF4 A;  1TRS A;  2IJY A;  2VAF A;  2X8G A;  3TRX A;  1SJI A;  3D21 A;  3LXZ A;  4K7N A;  5ELA A;  5J9B A;  1SL1 B;  2GT5 A;  1BG5 A;  3M8N A;  4MH3 A;  4ULX A;  2GST A;  4EVM A;  2C3N A;  1NM3 A;  4HU7 A;  4OCF A;  4F03 A;  4XIH A;  1BYE A;  5A5K A;  3QDN A;  3LWA A;  5JWO B;  3IV4 A;  4WR4 A;  3WD6 A;  3HVS A;  5AN1 A;  4MZB A;  5LCZ A;  1T4Z A;  1XFL A;  2LST A;  5C04 A;  4O5Q A;  3QFB C;  4I8B A;  5HFG A;  4QQ7 A;  4FH8 A;  2X8C A;  2AYT A;  1J08 A;  4K8M A;  2FWG A;  2GZY A;  5G2Z A;  1BED A;  5ENU A;  2H74 A;  3NOF A;  1SYX A;  3RHB A;  3NIV A;  5H5Q A;  3CSJ A;  3KEB A;  3DVX A;  1WWJ A;  4CY6 A;  1WJK A;  4ECC A;  2K8V A;  2DKH A;  2MMA A;  13GS A;  2AUV A;  4MF6 A;  1WRY A;  1N8J A;  4Q5R A;  1ERU A;  1XVW A;  1WMJ A;  2DBC A;  2VUP A;  2BJX A;  3HZ8 A;  3QFA C;  2HRK A;  2R37 A;  2H71 A;  4ZL9 A;  1K0N A;  1KBN A;  3L9U A;  2XHF A;  18GS A;  3CTF A;  3MWH A;  4HQZ A;  3EMP A;  3GST A;  4G10 A;  1FHE A;  3BBY A;  4EE0 A;  4HZ2 A;  4I2U A;  4O92 A;  4D73 A;  4IGJ A;  1F3A A;  4L0W A;  1FOH A;  2YJH A;  5GAN D;  2A2S A;  3A3T A;  4RUV A;  5F07 A;  3RAZ A;  2IME A;  2B7J A;  1YF0 A;  4K5S A;  2QGV A;  1TTZ A;  5COH A;  1M7T A;  1VF3 A;  1RK4 A;  5CP1 A;  3G9B A;  5C00 A;  4LL4 B;  2PPT A;  5GST A;  1CQG A;  4PQ1 A;  3VWX A;  1QK8 A;  4BPY A;  1GH2 A;  2GSS A;  2OAD A;  4IJ3 A;  20GS A;  3FHK A;  2H0I A;  5B6M A;  5L71 A;  6GSX A;  2IMI A;  2LQO A;  3CXG A;  3G7J A;  1O6J A;  1ZMA A;  2GQK A;  4IJI A;  4EUY A;  4G19 A;  2PVO C;  4F0B A;  5CAX A;  2X4A A;  1MDJ A;  4PUA A;  1T00 A;  1TRW A;  3ME8 A;  1FOV A;  2EIR A;  3IXR A;  2GDR A;  4MJB A;  4OCE A;  1MD4 A;  5IO0 A;  2IMF A;  3PGT A;  4KAE A;  4BL7 B;  4OMV A;  1MTC A;  1YJ6 A;  1IYI A;  1J9B A;  4F82 A;  1V40 A;  4KDX A;  4ZB8 A;  2XPD A;  2JU5 A;  3UJ1 A;  1DUG A;  3CBU A;  3KP9 A;  2QSI A;  2F3M A;  3HKR A;  1Z3E A;  2GTU A;  3C1R A;  2B3S A;  1IYH A;  5DVB A;  1DE1 A;  3ZL5 A;  3F6F A;  2H0H A;  1YKC A;  1VF4 A;  2B7K A;  1FW1 A;  4XS4 A;  3VI5 A;  4PXO A;  4GST A;  4BWS A;  3VLN A;  2GGT A;  1ZYE A;  2C0D A;  1JZR A;  1TU8 A;  1OC3 A;  1Q98 A;  3PPU A;  5BMU A;  2PWJ A;  1UVZ A;  1YKA A;  2E2M A;  3UOM A;  4FIW A;  4GQC A;  3A2V A;  1WPI A;  1EGO A;  1GSD A;  4TXO A;  2R3X A;  1GTA A;  3RPP A;  1XW6 A;  5DCG A;  3L4N A;  2CQ9 A;  2KUC A;  1TDI A;  2OE1 A;  5FWG A;  4OO5 A;  1JZD A;  1NSW A;  1S3R A;  3HA9 A;  4KA0 A;  4AJ8 A;  4YAV A;  3ZMK A;  4QL9 A;  3IK7 A;  1XZO A;  3IAS 2;  4PGT A;  1GSS A;  1UA5 A;  2B5X A;  1GL8 A;  2FLS A;  2DSA A;  1R26 A;  2YWN A;  5HFI A;  3TKQ A;  4K9Z A;  2CZ2 A;  4Q5Q A;  3DXB A;  3H93 A;  2B5Y A;  4KGI A;  1M9A A;  1DSB A;  2TRC P;  5J4U A;  1SKR B;  3DRN A;  4MH2 A;  3A5I A;  4AGS A;  3MNG A;  2FHE A;  2PU9 C;  4K2D A;  4PUR A;  3HHV A;  2H70 A;  2YP6 A;  1XBS A;  4PQH A;  1SD9 A;  2NTO A;  1M9B A;  3VWV A;  4ML6 A;  3MDK A;  2FCH A;  1W4V A;  3L9S A;  2OJL A;  2QKE A;  2WJU A;  2YPM A; 
#chains in the Genus database with same CATH homology
 2CAQ A;  3M0F A;  2GLR A;  2XC2 A;  4GF0 A;  3FZA A;  3U6V A;  2HNL A;  1EV9 A;  1Y6E A;  1AUC A;  1RW1 A;  1C72 A;  3VUR A;  4WXT A;  2V6K A;  4X43 A;  5DCH A;  2B5E A;  1GSQ A;  2LS5 A;  2VCV A;  2C0E A;  1JLV A;  2M80 A;  3GHA A;  2KP1 A;  4TOP A;  5JWR B;  5IIZ A;  5ECK B;  2FGX A;  3UBK A;  4USS A;  3F8U A;  4N30 A;  4CY8 A;  1GSY A;  4TW5 A;  2EIO A;  3PIN A;  1FB0 A;  1XVQ A;  1I5G A;  3RHC A;  1OC9 B;  5HFK A;  3DIE A;  5EPF A;  1GTB A;  3Q19 A;  3HJP A;  2MMO A;  5IQY A;  3P90 A;  4GSN A;  4O32 A;  3FYG A;  4RI6 A;  2PER A;  4YKF A;  2CX3 A;  3KIJ A;  5D9W A;  1GTU A;  1M2D A;  4ML1 A;  1B4Q A;  2VLV A;  1G7O A;  5CNW A;  4Z2T A;  2LKU A;  1TI3 A;  5F8B A;  3CRT A;  4A5P A;  2WFC A;  1PGT A;  1K3Y A;  2IN3 A;  3IOS A;  4G0K A;  4IQ1 A;  4DSS A;  2VCX A;  3D0Z A;  3CSH A;  2GQM A;  2LUS A;  1ZYQ B;  3ERW A;  3FR3 A;  2C80 A;  1BAY A;  1X9M B;  5EY6 A;  3KTL A;  5IOX A;  2GQL A;  3F3R A;  2QC7 A;  4HEA 2;  1AQX A;  3GTU B;  4J56 E;  1TP9 A;  2VO4 A;  2YZU A;  1XPV A;  3LJR A;  3ZVJ A;  5IMV A;  4YQV A;  4JE1 A;  8GSS A;  1U6T A;  4GLT A;  1Z5Y E;  1G6W A;  1PRX A;  2H01 A;  3GIX A;  1S3C A;  4V1A p;  1UC7 A;  1I9D A;  1THO A;  4J2F A;  4TR1 A;  4YQM A;  2H1D A;  2LJA A;  3Q6O A;  3ZML A;  5AIV A;  1PQN A;  5G31 A;  4OD7 A;  2I4A A;  3H79 A;  3HDC A;  22GS A;  3HCZ A;  3KP8 A;  1GUK A;  2DIZ A;  4V2L A;  3GKX A;  4KF9 A;  4F2I A;  3IR4 A;  3JCM L;  3DKS A;  2E2G A;  2GT6 A;  3BJ5 A;  4X0X A;  4L8E A;  5KN3 A;  1EEM A;  5EVO A;  5G5E A;  2HYX A;  4NHZ A;  2RII A;  4FYB A;  3GKM A;  3Q18 A;  3F0I A;  2V1M A;  4WEY A;  3KCM A;  1OKD A;  1E2Y A;  1JFU A;  3IC4 A;  2FUG 2;  2OBK A;  4I5Q A;  5F0G A;  1U88 A;  1EOH A;  3GMF A;  3GH6 A;  1A0R P;  2AB6 A;  1HD2 A;  1ILO A;  4K7I A;  1KNG A;  3RDW A;  4NAX A;  1NHY A;  1GP1 A;  1A8Y A;  4PX1 A;  3WYW A;  3HZ4 A;  1Y25 A;  2GZZ A;  2PMT A;  4LL1 B;  2DKI A;  4DVC A;  2KP2 A;  2JAC A;  1GSF A;  4HS1 A;  2OAC A;  2XPE A;  2C4J A;  2BTO T;  3UL3 A;  1ZYN A;  1O73 A;  12GS A;  2AJQ B;  1XW9 A;  2WCI A;  4ZL7 A;  4MF5 A;  2K18 A;  2F8A A;  2H19 A;  2O8V B;  1R4W A;  4HJ2 A;  2B1L A;  3KTB A;  1JHB A;  5ECQ B;  3TRP A;  3US3 A;  4KSM A;  2O89 A;  2VCZ A;  2LRT A;  1EP8 A;  3D5J A;  4DSR A;  2REM A;  1SK1 A;  1GNE A;  4ISD A;  2AV4 A;  1F2E A;  1PN0 A;  3F4S A;  5DDL A;  1B9X C;  2K8S A;  1QUW A;  4HDE A;  4F9Z A;  2FY6 A;  4V2N A;  2A4H A;  2YV7 A;  2N5F A;  2H6X A;  3TKS A;  2OE3 A;  1R5A A;  6GSY A;  4HU9 A;  3G7Y A;  3U5R E;  2H0G A;  2LQQ A;  1AAZ A;  1FVJ A;  1OYJ A;  1X5E A;  1B48 A;  2KLX A;  5ECN B;  1YF1 A;  5AIX A;  5J41 A;  2IFQ B;  3LSZ A;  5CRG A;  4K0N A;  3F6D A;  1ST9 A;  1TRU A;  3HVX A;  5BRT A;  5ID2 B;  2P5R A;  1ZCP A;  4PQI A;  1SKS B;  1XIY A;  5A4W A;  4NXI A;  4LLR A;  1HNA A;  1EZK A;  2H76 A;  2PN8 A;  3TGZ A;  2L6C A;  6GSW A;  5ECL B;  3E3E A;  5DAK A;  2H6Z A;  3UVT A;  1XWC A;  1T7P B;  1ZL9 A;  2J9H A;  2MYG A;  4ZB6 A;  4ID0 A;  1XWB A;  4WR5 A;  4BVX B;  3QAW A;  2YWM A;  2DJJ A;  2VL9 A;  1K0A A;  1SL2 B;  2K9F A;  3EMX A;  3APQ A;  3KXO A;  1GNW A;  2HRA A;  3GH9 A;  3UEM A;  1DBY A;  2H66 A;  2GS3 A;  3QAG A;  4JED A;  4OFT A;  4JRR A;  4HUA A;  3QCP A;  4EDZ A;  2HXK A;  4BVY B;  5D96 A;  1M2A A;  3RPN A;  4KE3 A;  1A8L A;  2LNT A;  2GSR A;  4HZ4 A;  4MCU A;  1LBK A;  4JZQ A;  1K3L A;  3GRX A;  4RI7 A;  1PL1 A;  1QFN A;  1EV4 A;  3TKS E;  2H1G A;  1GTI A;  4ZIL A;  1EWX A;  3DD3 A;  4K5R A;  3UBL A;  4POL A;  1Q4J A;  2VCW A;  4EKZ A;  2TRX A;  2H30 A;  4MNN A;  2VL3 A;  1TU7 A;  2RM5 A;  5HQP A;  3IAM 2;  4FQU A;  4L0U A;  2HRF A;  2A2R A;  2MMZ A;  3LYK A;  2AHE A;  1XOA A;  3A2X A;  1BJX A;  1X9W B;  5KOX A;  3Q74 A;  2HRN A;  1LJR A;  2NBS A;  3QMX A;  4N0V A;  4MZC A;  2PUK C;  4I97 A;  3VK9 A;  3VWW A;  1FVK A;  4MK3 A;  2JSY A;  3QR6 A;  3DVW A;  3ZIT A;  2NVL A;  2CVB A;  1HNB A;  4IKH A;  1ZYP A;  3VI7 A;  2I9H A;  5KEJ A;  3GL3 A;  3ZFB A;  1VF2 A;  3J7Y b;  5HR2 A;  1A2L A;  1ZGN A;  3GTU A;  3KH7 A;  3IDV A;  3TRQ A;  3SBC A;  3EVI A;  3BOA A;  5CO3 A;  5DAL B;  4ZL8 A;  2J23 A;  3IK9 A;  4YQU A;  2L5L A;  3L9V A;  1SJ6 A;  3PH9 A;  1X5D A;  4FYU A;  4X1U A;  4OWY A;  3NZN A;  3KGK A;  2L4C A;  2I3Y A;  3W6G A;  4MMM A;  1XWA A;  2K6V A;  2DJ0 A;  3F4R A;  1LU4 A;  1NW2 A;  4L5L A;  6GSS A;  2FNO A;  3D4T A;  1PN9 A;  4V2M A;  4MLY A;  3EWL A;  1OC8 A;  1ERW A;  1Z9H A;  4NWY A;  5LNK e;  3N9J A;  1AC1 A;  4N11 A;  3GKK A;  2P31 A;  3GX8 A;  2ALB A;  4PNG A;  4G9H A;  4MAB A;  4DSQ A;  2R2J A;  1U3A A;  1PKZ A;  3M3M A;  4YAP A;  4MP4 A;  3HVV A;  2B6M A;  2FWH A;  6GSU A;  4MJC A;  3WGX A;  1W89 A;  1YDK A;  1PL2 A;  5G1K A;  5INY A;  1EOG A;  1AQV A;  1HYU A;  2G2Q A;  4LA1 A;  2P5Q A;  3ME7 A;  2F9S A;  1VF1 A;  4NHW A;  1BX9 A;  5EL8 A;  4RQX A;  1EEJ A;  3WGD A;  1GUH A;  4P3Y B;  1F3B A;  3F3Q A;  1V9W A;  4K2X A;  5HR3 A;  4WET A;  3ED3 A;  3ZRD A;  4BWQ A;  5J3R A;  2X49 A;  1AIU A;  4AJ6 A;  5FHI A;  7GSS A;  3TKS C;  3GFK A;  4D73 B;  2VL2 A;  1ZOF A;  3IBH A;  2HLS A;  3WT1 A;  4JU5 A;  2C1Y A;  3ZIJ A;  2V41 A;  1B9Y C;  5ECP B;  3I43 A;  1B8X A;  5JCU A;  3E0U A;  5A4V A;  1GWC A;  5J9C A;  1OAZ A;  3BCK A;  3CRU A;  4K6X A;  4PNF A;  3J7Y k;  3MYD A;  1YQ1 A;  2WGR A;  5IPH A;  5IO2 A;  2H1B A;  2OE0 A;  2VCQ A;  4TR0 A;  4KH7 A;  2HT9 A;  3IHG A;  2Z9S A;  3QAV A;  4HOJ A;  3LYP A;  1ML6 A;  5IPG A;  4XTS A;  3GN3 A;  4WKW A;  1TXX A;  1CQH A;  2LJK A;  3C7M A;  4O7H A;  2HI7 A;  3KMN A;  1AXD A;  1K0O A;  1GLQ A;  4NV5 A;  3IRA A;  2VLU A;  4EXJ A;  3TJG A;  4Q5N A;  2L6D A;  3EIN A;  2WUL A;  4CW9 A;  4Z2U A;  2I1U A;  3TKR A;  3BCI A;  2JZR A;  1X5C A;  3N5O A;  5ID2 A;  1QXH A;  3E9J B;  4ZB9 A;  2MBS A;  3ZYW A;  4WF5 A;  2KHP A;  2E7P A;  1XW5 A;  4IBP A;  4KCE A;  2DJK A;  3D4M A;  1MDI A;  4TRX A;  1F6M C;  5F06 A;  1WP0 A;  4FYC A;  1T4Y A;  2LEG A;  3PR8 A;  3A2W A;  4DEJ A;  5G30 A;  3GUS A;  2A2P A;  3K8N A;  4I6X A;  2PVQ A;  4L5O A;  3SWL A;  2I81 A;  11GS A;  4GCI A;  4KB3 A;  4BA7 A;  3IPZ A;  1T8E B;  4K1F A;  3P8W A;  4G0I A;  3GKN A;  4BVY A;  1R5P A;  1SK0 A;  3P7X A;  1WIK A;  1ZZY A;  1K0B A;  4LMV A;  4IP1 A;  5JCG A;  3FZ4 A;  2X99 A;  3P2A A;  1SK2 A;  4GWR A;  3C71 A;  3ZVJ D;  1AQW A;  4X4J A;  5B8B A;  4XS1 A;  1Z7P A;  3M9K A;  1K0D A;  4JR6 A;  2TIR A;  5IMF A;  5ELG A;  4K7O A;  3M9J A;  4ZBA A;  4NMU A;  4TXV A;  1M99 A;  2H8L A;  3FEU A;  3V1W A;  1V98 A;  5ECS A;  4PUF C;  1GUM A;  4K0G A;  1KTE A;  3EYT A;  4BL7 A;  3TDG A;  2IMD A;  3R2Q A;  5G5F A;  3GX0 A;  3AY8 A;  3EUR A;  4IN0 A;  5B6N A;  2CZ3 A;  1USB A;  3H4K A;  3GYK A;  5HR0 A;  3HXS A;  3LGC A;  3FZ5 A;  1KEB A;  4KX4 A;  1BQ7 A;  3C73 A;  2VM2 A;  1SEN A;  2ZCT A;  2VCT A;  5IMC A;  1OE7 A;  1PMT A;  5F05 A;  4TKY A;  3F9U A;  2JAD A;  1Z7R A;  5IM9 A;  1YY7 A;  4G2E A;  3C8E A;  2YNX A;  2V6O A;  4NV2 A;  1O81 A;  1SJZ A;  5B8A A;  2AAW A;  1G7E A;  3HJM A;  3LQ7 A;  3KM6 A;  1DE2 A;  2YCD A;  3UMA A;  3IE3 A;  4IW9 A;  16GS A;  1PD2 1;  3TCO A;  2R5G A;  2GZP A;  3LEF A;  4H86 A;  4ECI A;  4QL7 A;  4IHU A;  1F9M A;  1N2A A;  4TR4 A;  5H5R A;  2L5O A;  1SD8 A;  2HZF A;  4GTU A;  1EP7 A;  2YZH A;  3GA4 A;  3R3E A;  1YZX A;  1TK8 B;  3VFI A;  4TR3 A;  1O7U A;  4GXZ A;  3DYR A;  4IP6 A;  5GSS A;  1Z6N A;  3MAK A;  1NHO A;  4KCA A;  3HJO A;  5ECO B;  1JLW A;  1R7H A;  1ON4 A;  4KW6 A;  2F51 A;  1A2M A;  1JZW A;  4Q5F A;  3F4T A;  1XCC A;  3ZIV A;  3A5W A;  4MJE A;  1GSE A;  5GZZ B;  1U3I A;  2DJ3 A;  5G1L A;  3VPQ A;  3L78 A;  3FR6 A;  2LJR A;  4KND A;  3M1G A;  5DBQ A;  2VL2 C;  2M72 A;  3FKF A;  4HI7 A;  3CMI A;  4N0Z A;  2IPA A;  2YAN A;  9GSS A;  2CX4 A;  2PBJ A;  5ECR B;  3RBT A;  1S3A A;  2HSH A;  3TJF A;  2LRC A;  3KJY A;  2EIQ A;  2DMM A;  4KDU A;  1PX6 A;  3LOR A;  3TOU A;  2LV3 A;  3DWV A;  4DSS B;  3I6A A;  4V1A g;  3DGQ A;  4G0L A;  2CVD A;  2A4V A;  2FWF A;  5JCW A;  3DEX A;  4CDO A;  1TJD A;  3ERF A;  1T3B A;  2YV9 A;  1A2J A;  1MEK A;  4EIP A;  1K3O A;  2C3T A;  2HZE B;  5A4U A;  3O3T A;  5DQY A;  3C1S A;  4I2T A;  3MIX A;  2V32 A;  2FD3 A;  2VD1 A;  4TR1 B;  3TUE A;  1OC9 A;  1MDK A;  2H73 A;  5KN1 A;  3FZ9 A;  3W8J A;  2YJ7 A;  1TRV A;  3ZZX A;  4TN8 A;  5D93 A;  5B7C A;  2CT6 A;  2NDO A;  4EO3 A;  2L57 A;  1TI1 A;  5D9V A;  4JR4 A;  3FY7 A;  4KUN A;  1A23 A;  1YEP A;  2QA1 A;  4WBJ A;  1J0F A;  1GUL A;  4ACS A;  1URM A;  3D6I A;  4E8E A;  2KOK A;  3I9V 2;  2R0G A;  3EU3 A;  2FWE A;  2VM1 A;  2WS2 A;  1G0T A;  4MF7 A;  1X9S B;  4JBB A;  2WB9 A;  1O85 A;  2LNS A;  3TJK A;  2EC4 A;  1E6B A;  5KOW A;  1TOF A;  2WZ9 A;  3UAR A;  2H1A A;  3H1N A;  4MPG A;  4TVE A;  2D2Z A;  2GSQ A;  2C8U A;  2DJ2 A;  4N10 A;  2R0P A;  5CRW A;  3LXT A;  3TJB A;  1JZO A;  3TOT A;  1HNC A;  5ABR A;  3FK8 A;  2JZT A;  3APS A;  3IA1 A;  4XRA A;  2VOC A;  4EL1 A;  4HJM A;  5D73 A;  1PKW A;  3TKP A;  4O5U A;  4F0C A;  3LFL A;  4AF2 A;  3DML A;  1AW9 A;  1TW9 A;  3KH9 A;  1O8X A;  4ILF A;  5CRH A;  5IOW A;  1H75 A;  4YKG A;  5FT3 A;  5HR1 A;  2YOI A;  3W8S A;  1H4O A;  2UZ8 A;  4ECB A;  1ERT A;  1XWG A;  4Z2R A;  4EF0 A;  1SU9 A;  1O8W A;  1YEX A;  2C3Q A;  1QMV A;  3GSS A;  1ABA A;  14GS A;  2E0Q A;  3MSZ A;  1B4P A;  2DML A;  3QOU A;  4YH2 A;  5ECI B;  4EIQ A;  2JL4 A;  3VWU A;  2G0F A;  1SL0 B;  4PTS A;  5DQS A;  3D22 A;  5AIS A;  3HYP A;  2RM6 A;  2IMK A;  1V58 A;  4EC0 A;  5CYY A;  1FG4 A;  3LW9 A;  3L0H A;  1ERV A;  3FRC A;  1M0U A;  2H75 A;  2ZNM A;  2MMN A;  4EDY A;  1K0C A;  1U87 A;  1XWK A;  1OE8 A;  5D8I A;  2X64 A;  2B1K A;  5H5S A;  1QQ2 A;  2OA7 A;  1F37 A;  1K0M A;  2CV4 A;  1SYR A;  5KN2 A;  2XBI A;  4IVF A;  1TK0 B;  1GLP A;  5LD0 A;  5DJL A;  5DAK B;  10GS A;  2O85 A;  4XCS A;  2VLT A;  2ON5 A;  5ECH B;  2O7K A;  3KD0 A;  2C0G A;  4MZW A;  4GSS A;  3KMO A;  4XHM A;  2N5B A;  2RUE A;  2WRT A;  3IHQ A;  4MDC A;  2FA4 A;  4FO5 A;  1WOU A;  2NPB A;  4LMW A;  1UN2 A;  3EE2 A;  4POM A;  1VRS D;  3TB2 A;  1OKT A;  1RQM A;  5D9T A;  1HQO A;  2RLI A;  3QD9 A;  3S9F A;  17GS A;  3UAP A;  4E8H A;  2YN1 A;  1FB6 A;  2IIY A;  2VD0 A;  3ISO A;  2CA8 A;  4J57 E;  2MBT A;  3WGE A;  1GRX A;  5ECM B;  3UVH A;  1VGL A;  3ERG A;  4KSO A;  5E59 A;  3LG6 A;  2VIM A;  3CSI A;  2OBI A;  2JSZ A;  2IFQ A;  3EPT A;  2QA2 A;  2IWT A;  2DLX A;  3QPM A;  1X0R A;  4WBR D;  1V2A A;  3EU4 A;  1XXU A;  2GVP A;  4XS6 A;  2LRN A;  5AGY A;  3H8Q A;  5IMA A;  1FAA A;  3ZFL A;  4KDY A;  2HFD A;  3OR5 A;  4BVX A;  2V2G A;  4GRF A;  3HD5 A;  2HE3 A;  1GSU A;  4ZXG A;  2ZUP A;  3VPT A;  2R0C A;  1QGV A;  2DIY A;  5DJM A;  4AJ7 A;  3GV1 A;  3BD2 A;  5CRD A;  2FA8 A;  3CTG A;  1TK5 B;  3KZQ A;  4CHS A;  2ES7 A;  3O6T A;  2H72 A;  2R6K A;  3F63 A;  1PX7 A;  2PGT A;  3ZTL A;  2M46 A;  4XS4 B;  1MD3 A;  4POK A;  2P0G A;  1T1V A;  4OFM A;  4MA9 A;  4OO4 A;  4O5R A;  4POB A;  2HZE A;  1FO5 A;  5KN0 A;  5J5N A;  4MPF A;  3I69 A;  3GNJ A;  2DJ1 A;  2WDU A;  2F8F A;  1XOB A;  2H6Y A;  3APO A;  3GUR A;  4OFN A;  6GSV A;  6GST A;  3CYN A;  4Z7X A;  2DC5 A;  3FMW A;  2BMX A;  4XRD A;  4TXO B;  1TKD B;  2CVK A;  3O76 A;  4GQF A;  2HSY A;  19GS A;  2N5A A;  2L59 A;  1WE0 A;  4IQA A;  2OKA A;  3G7I A;  3ZRE A;  4NPB A;  4MJA A;  2LTK A;  3WT2 A;  5GAP D;  1OVN A;  1THX A;  3IC8 A;  1EGR A;  4ICY A;  2MZC A;  1A0F A;  3TJJ A;  2C0F A;  5CRE A;  1S3D A;  1PA3 A;  1Z6M A;  2YWI A;  4HQS A;  2O87 A;  5IMZ A;  5D9X A;  1M2B A;  4ZIJ A;  3ZLP A;  3FW2 A;  4ZBD A;  5IMD A;  3HY2 A;  4RQR A;  1ACV A;  2YWO A;  2HSM A;  4IS0 A;  3FR9 A;  2L4Q A;  2X8H A;  5E4W A;  2JZS A;  2R4V A;  2CAI A;  1A24 A;  3UIW A;  2ON7 A;  5JWQ B;  1V57 A;  2RUF A;  2XBQ A;  3EC3 A;  4ZBB A;  3GL5 A;  1SKW B;  4IEL A;  1G6Y A;  2IL3 A;  5DAL A;  1PSQ A;  4ECJ A;  4WF4 A;  1TRS A;  2IJY A;  2VAF A;  2X8G A;  3TRX A;  1SJI A;  3D21 A;  3LXZ A;  4K7N A;  5ELA A;  5J9B A;  1SL1 B;  2GT5 A;  1BG5 A;  3M8N A;  4MH3 A;  4ULX A;  2GST A;  4EVM A;  2C3N A;  1NM3 A;  4HU7 A;  4OCF A;  4F03 A;  4XIH A;  1BYE A;  5A5K A;  3QDN A;  3LWA A;  5JWO B;  3IV4 A;  4WR4 A;  3WD6 A;  3HVS A;  5AN1 A;  4MZB A;  5LCZ A;  1T4Z A;  1XFL A;  2LST A;  5C04 A;  4O5Q A;  3QFB C;  4I8B A;  5HFG A;  4QQ7 A;  4FH8 A;  2X8C A;  2AYT A;  1J08 A;  4K8M A;  2FWG A;  2GZY A;  5G2Z A;  1BED A;  5ENU A;  2H74 A;  3NOF A;  1SYX A;  3RHB A;  3NIV A;  5H5Q A;  3CSJ A;  3KEB A;  3DVX A;  1WWJ A;  4CY6 A;  1WJK A;  4ECC A;  2K8V A;  2DKH A;  2MMA A;  13GS A;  2AUV A;  4MF6 A;  1WRY A;  1N8J A;  4Q5R A;  1ERU A;  1XVW A;  1WMJ A;  2DBC A;  2VUP A;  2BJX A;  3HZ8 A;  3QFA C;  2HRK A;  2R37 A;  2H71 A;  4ZL9 A;  1K0N A;  1KBN A;  3L9U A;  2XHF A;  18GS A;  3CTF A;  3MWH A;  4HQZ A;  3EMP A;  3GST A;  4G10 A;  1FHE A;  3BBY A;  4EE0 A;  4HZ2 A;  4I2U A;  4O92 A;  4D73 A;  4IGJ A;  1F3A A;  4L0W A;  1FOH A;  2YJH A;  5GAN D;  2A2S A;  3A3T A;  4RUV A;  5F07 A;  3RAZ A;  2IME A;  2B7J A;  1YF0 A;  4K5S A;  2QGV A;  1TTZ A;  5COH A;  1M7T A;  1VF3 A;  1RK4 A;  5CP1 A;  3G9B A;  5C00 A;  4LL4 B;  2PPT A;  5GST A;  1CQG A;  4PQ1 A;  3VWX A;  1QK8 A;  4BPY A;  1GH2 A;  2GSS A;  2OAD A;  4IJ3 A;  20GS A;  3FHK A;  2H0I A;  5B6M A;  5L71 A;  6GSX A;  2IMI A;  2LQO A;  3CXG A;  3G7J A;  1O6J A;  1ZMA A;  2GQK A;  4IJI A;  4EUY A;  4G19 A;  2PVO C;  4F0B A;  5CAX A;  2X4A A;  1MDJ A;  4PUA A;  1T00 A;  1TRW A;  3ME8 A;  1FOV A;  2EIR A;  3IXR A;  2GDR A;  4MJB A;  4OCE A;  1MD4 A;  5IO0 A;  2IMF A;  3PGT A;  4KAE A;  4BL7 B;  4OMV A;  1MTC A;  1YJ6 A;  1IYI A;  1J9B A;  4F82 A;  1V40 A;  4KDX A;  4ZB8 A;  2XPD A;  2JU5 A;  3UJ1 A;  1DUG A;  3CBU A;  3KP9 A;  2QSI A;  2F3M A;  3HKR A;  1Z3E A;  2GTU A;  3C1R A;  2B3S A;  1IYH A;  5DVB A;  1DE1 A;  3ZL5 A;  3F6F A;  2H0H A;  1YKC A;  1VF4 A;  2B7K A;  1FW1 A;  4XS4 A;  3VI5 A;  4PXO A;  4GST A;  4BWS A;  3VLN A;  2GGT A;  1ZYE A;  2C0D A;  1JZR A;  1TU8 A;  1OC3 A;  1Q98 A;  3PPU A;  5BMU A;  2PWJ A;  1UVZ A;  1YKA A;  2E2M A;  3UOM A;  4FIW A;  4GQC A;  3A2V A;  1WPI A;  1EGO A;  1GSD A;  4TXO A;  2R3X A;  1GTA A;  3RPP A;  1XW6 A;  5DCG A;  3L4N A;  2CQ9 A;  2KUC A;  1TDI A;  2OE1 A;  5FWG A;  4OO5 A;  1JZD A;  1NSW A;  3HA9 A;  4KA0 A;  4AJ8 A;  4YAV A;  3ZMK A;  4QL9 A;  3IK7 A;  1XZO A;  3IAS 2;  4PGT A;  1GSS A;  1UA5 A;  2B5X A;  1GL8 A;  2FLS A;  2DSA A;  1R26 A;  2YWN A;  5HFI A;  3TKQ A;  4K9Z A;  2CZ2 A;  4Q5Q A;  3DXB A;  3H93 A;  2B5Y A;  4KGI A;  1M9A A;  1DSB A;  2TRC P;  5J4U A;  1SKR B;  3DRN A;  4MH2 A;  3A5I A;  4AGS A;  3MNG A;  2FHE A;  2PU9 C;  4K2D A;  4PUR A;  3HHV A;  2H70 A;  2YP6 A;  1XBS A;  4PQH A;  1SD9 A;  2NTO A;  1M9B A;  3VWV A;  4ML6 A;  3MDK A;  2FCH A;  1W4V A;  3L9S A;  2OJL A;  2QKE A;  2WJU A;  2YPM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...