3DEXA

Crystal structure of sav_2001 protein from streptomyces avermitilis, northeast structural genomics consortium target svr107.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
79
structure length
79
Chain Sequence
HTHRVQIEYCTQCRWLPRAAWLAQELLTTFETELTELALKPGTGGVFVVRVDDEVVWDRREQGFPEPTAVKRLVRDRVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAV_2001
publication title Crystal structure of SAV_2001 protein from Streptomyces avermitilis, Northeast Structural Genomics Consortium Target SvR107.
rcsb
source organism Streptomyces avermitilis
molecule tags Structural genomics, unknown function
total genus 23
structure length 79
sequence length 79
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10262 Rdx Rdx family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3dexA00
4CW9A 1A2LA 1XW5A 2HT9A 2HYXA 3HKRA 4IS0A 3L9SA 2C0GA 1UC7A 2DJ2A 5IPHA 4O32A 2QC7A 1Q4JA 4TVEA 2PVQA 1S3CA 1MDIA 3EMPA 1S3DA 2L5LA 3UIWA 4KAEA 2MZCA 4NV5A 3PR8A 2TIRA 1HNBA 3MSZA 1VF4A 1GLPA 4L5LA 1ZGNA 4GCIA 3E3EA 1J08A 1T00A 5AISA 4ZB6A 5ECHB 2OE3A 4KDUA 2VIMA 4I2UA 1LBKA 2EIOA 1BQ7A 5ELAA 1GSEA 5G5FA 4O92A 4E8HA 4IJ3A 4IVFA 2YP6A 1GTAA 2FWGA 2GT5A 5HR1A 3QDNA 4I97A 3GTUB 5G5EA 3UVTA 1H75A 5CYYA 2E2GA 2DLXA 3PINA 3C71A 3P2AA 2DJ0A 3F4RA 4F03A 5JWQB 2VAFA 3APOA 2GVPA 1K3OA 1JLWA 2GQLA 3MAKA 4V1Ap 1O7UA 4IGJA 3F63A 2FA4A 1AIUA 5B6MA 3HYPA 5D96A 1B8XA 5G1LA 5CRHA 1JZDA 4HDEA 2VL2C 5HR3A 2CV4A 1RQMA 5ECRB 1V40A 4J57E 4MJBA 1U88A 2B6MA 4X43A 1K0MA 3C8EA 2N5FA 4DVCA 3KP8A 1FOVA 3QPMA 4TN8A 3APSA 2HSHA 3EVIA 4KUNA 4K1FA 3EWLA 1MTCA 2H74A 1ZCPA 2GLRA 1FB0A 3ZLPA 3U5RE 5KEJA 2MBSA 3ZRDA 2ZCTA 2O85A 2M72A 2VM2A 2LQQA 1W4VA 5LD0A 2CAQA 2I4AA 16GSA 3VWXA 1Z3EA 1ML6A 2V41A 2VLVA 4X0XA 1SJ6A 4MF5A 3A2XA 2WDUA 4GSSA 3D22A 2I3YA 4JBBA 1TDIA 3HVVA 4WR5A 3UVHA 2C8UA 9GSSA 5INYA 3GIXA 1SYRA 2H6ZA 5DAKB 2GZZA 2DJKA 2LJAA 3I43A 5DALB 3GKNA 4FIWA 4V1Ag 1GTUA 4MPGA 5D8IA 3FZ5A 4DSRA 1WWJA 2H70A 1K0BA 4HU9A 2H73A 2LJRA 4XIHA 3D21A 1DBYA 4H86A 5IMCA 4DEJA 5LCZA 2PPTA 4F9ZA 3TUEA 4MH3A 3GN3A 1EP7A 4AGSA 2YANA 3GYKA 3G7IA 4EDZA 3P7XA 3K8NA 3F6DA 3G7JA 2VL3A 4TKYA 2LRNA 4EC0A 1B48A 2VCQA 2F51A 8GSSA 2LEGA 5AN1A 3BCIA 1NHYA 4POKA 4P3YB 4LL4B 2B1LA 5GAPD 5D9XA 5EVOA 1T3BA 1SYXA 2GQMA 1YKCA 3KTBA 4EKZA 2HZFA 4XS1A 1OC9B 2H0HA 3N5OA 1TI1A 3HCZA 5DALA 4KCEA 2H1DA 2PVOC 4PQ1A 2LSTA 2GZYA 2CVDA 3GL5A 2XBIA 1A24A 4KB3A 4LL1B 4NHWA 2PN8A 1QK8A 5DQSA 2B5YA 4TR0A 3WGEA 1SK0A 5G2ZA 2JZSA 4XS4A 5GSTA 4MMMA 2PU9C 3GH9A 2ZUPA 1H4OA 1TOFA 3NOFA 1GSYA 2V1MA 3IA1A 4MZCA 4WKWA 2TRCP 4MCUA 3P90A 1T4ZA 4MDCA 3BOAA 4BA7A 3FR3A 4K6XA 1I9DA 1TRSA 1CQGA 3VK9A 3ZFLA 2M46A 2DJ3A 2PBJA 3RPPA 1EEMA 4MPFA 5F07A 2KHPA 2L4CA 4XCSA 3Q6OA 1OE8A 3FYGA 3C7MA 1SL2B 3GX8A 3IE3A 5JCGA 4FYUA 5DVBA 2C1YA 4TRXA 2GT6A 1XOAA 3JCML 3VFIA 2PERA 2VD1A 2D2ZA 2YWMA 4KDXA 2OE1A 3IK7A 3EYTA 2C0FA 2DJ1A 1X9SB 5ECQB 4EVMA 1XPVA 1YQ1A 4NPBA 4K8MA 4O7HA 1ACVA 2LV3A 3EMXA 2K8SA 1BJXA 4PQHA 1PQNA 4OCFA 1Z6NA 5H5SA 4TR3A 2I9HA 1EZKA 2XPEA 4LMVA 4KH7A 1FB6A 2YOIA 1O8WA 3TJGA 1JHBA 2OA7A 2YWOA 1ERTA 4K2DA 3APQA 1UN2A 3F9UA 4CDOA 4QL9A 5CNWA 1GUMA 4Q5RA 2R6KA 18GSA 2ZNMA 2VLTA 4ILFA 4ZILA 1SK1A 2B7JA 2YZUA 2NVLA 3FZ9A 1TI3A 1T4YA 1XVWA 4POMA 4AJ8A 4MA9A 4HUAA 5KN2A 1TU7A 1G6WA 2YWIA 1OC8A 2DC5A 2IWTA 3QOUA 2P0GA 3CMIA 3TKPA 2FGXA 5ECMB 2C3TA 3LSZA 3DIEA 3GH6A 1YEPA 3M0FA 4F82A 4TW5A 3IRAA 4YQMA 2FY6A 4PUAA 2VM1A 2LNSA 2YWNA 5IMVA 3EE2A 4NV2A 3L78A 1M2AA 3HA9A 1FVJA 1RW1A 2B5EA 1K3YA 4KX4A 4MP4A 2QKEA 1FO5A 1U87A 2V6KA 3ED3A 1U3AA 3TKSA 1XFLA 2FD3A 2HXKA 5ENUA 3M3MA 1SJIA 2VCWA 4NAXA 2B1KA 3KXOA 1JFUA 3KEBA 3QFBC 5J5NA 4MH2A 1XZOA 3PGTA 2FA8A 5G30A 3MWHA 3ZMKA 3LFLA 2WULA 4JZQA 1Y25A 2X99A 1TTZA 1URMA 4X1UA 1OYJA 3IAM2 3IBHA 1WOUA 4OO4A 2VCZA 3TRPA 5L71A 3UBKA 2MMAA 2LUSA 2WS2A 1BEDA 1WJKA 2FHEA 3UEMA 3UBLA 1PL1A 2LQOA 5F05A 1KNGA 5C00A 2WCIA 2V32A 13GSA 4G9HA 2VUPA 5D9WA 1GSQA 2ON7A 1R26A 1J0FA 2IMKA 1XW9A 2P5QA 3RPNA 5J4UA 2E0QA 2H71A 2R3XA 2B7KA 1GSDA 1R5PA 2YCDA 2X8GA 3CXGA 2QSIA 3IDVA 2H0GA 2LRTA 3Q19A 3GKXA 1F9MA 2GZPA 2CZ3A 4LMWA 4TOPA 1DSBA 1K0NA 2PGTA 4ZL9A 2IJYA 1AQXA 4D73A 4QL7A 2F9SA 3IK9A 1W89A 5B7CA 6GSTA 1PKZA 3KJYA 2GSQA 4ECIA 5ECNB 3QAGA 4HQSA 2C3NA 3DVWA 1Z5YE 3H4KA 4ACSA 3G9BA 4HS1A 1XVQA 2H76A 3Q18A 1NHOA 1ZL9A 3VWUA 3US3A 3TJBA 2VCVA 5JWOB 4G19A 3VURA 3U6VA 3GSSA 3N9JA 3SBCA 4ECJA 1QXHA 3QR6A 2LNTA 2E2MA 3HDCA 5IM9A 3UAPA 4MJAA 3FEUA 1AXDA 2OADA 4MLYA 4K7OA 3ME8A 4EUYA 5EL8A 6GSWA 3KGKA 2RUFA 3HJOA 4NWYA 1F3BA 2REMA 1EWXA 2NTOA 2AB6A 2IMFA 4MABA 2R4VA 1AQVA 4RI7A 2JSZA 5ID2A 1MD3A 4I2TA 3IOSA 2XHFA 2TRXA 4K7NA 1V98A 1HNCA 3IC4A 2GTUA 3F4TA 2JZRA 2WGRA 5J41A 4ZIJA 2HRFA 3WYWA 2N5AA 5AIVA 2GGTA 1EGRA 3HVSA 1M2BA 4N10A 2H0IA 3ZFBA 4OMVA 1X0RA 4ZB8A 2CZ2A 1ABAA 2O7KA 2O89A 3KTLA 4KCAA 1GWCA 2ALBA 1GUHA 3GURA 1K0AA 1ZZYA 2WJUA 4MF7A 4PQIA 1SU9A 2H30A 4JU5A 1F3AA 1A2JA 2HI7A 2F8AA 2RUEA 1FAAA 1E6BA 3HY2A 2L59A 5H5QA 4N0VA 4ZBBA 4XHMA 3RDWA 3LG6A 4TXOA 4ZB9A 3DMLA 1M9AA 4V2MA 3TKQA 2VOCA 3A3TA 5A5KA 3TCOA 1T7PB 1TXXA 3L9UA 1XCCA 4HI7A 1KTEA 2C80A 4GQCA 2GSTA 5CRGA 3I6AA 5DQYA 5C04A 5IPGA 4GLTA 4K9ZA 4L8EA 2VLUA 2H6XA 3TOUA 4BPYA 1TK0B 5ECOB 4XS6A 4YAPA 3GL3A 5DJMA 4IP6A 2H01A 3H1NA 2ES7A 10GSA 1PRXA 2JSYA 2YJHA 2FUG2 1X5CA 4AJ6A 5D73A 3VI7A 3LJRA 4XS4B 3KD0A 4ML6A 3ERFA 2OBKA 1EV4A 4CHSA 4POLA 1XIYA 3EU4A 3BBYA 1XWBA 4YQUA 1V9WA 4FYCA 5D9TA 5E59A 4OO5A 1SD8A 2AJQB 4BWSA 4TR1A 3HD5A 2CVBA 2A4VA 4AF2A 3J7Yk 1VF1A 2A2SA 2WB9A 4BWQA 1GL8A 1SL1B 5FT3A 4IQAA 3TKSC 3ZITA 3DVXA 6GSYA 4I5QA 1PA3A 4XRAA 4KNDA 2HZEB 1GUKA 3TOTA 3UMAA 2OKAA 5F0GA 2DJJA 2DMMA 2IFQB 5ECSA 3QD9A 4G2EA 5HR0A 3TRQA 4EL1A 1M0UA 5IOXA 1AUCA 4FYBA 4HU7A 1XW6A 1IYIA 1BG5A 4GSNA 2RM6A 2H66A 1LJRA 4YH2A 5B8BA 3QMXA 2P31A 4PGTA 1SKRB 1ON4A 3W8JA 3ERGA 4BVYA 5B6NA 4POBA 2PMTA 1GSSA 2AAWA 2DIYA 3PH9A 1O8XA 4OWYA 4KDYA 3DRNA 1VF3A 3CSHA 2KUCA 3IXRA 2HZEA 4XTSA 4N0ZA 2LTKA 2C0DA 2IFQA 1DE2A 2AV4A 2EIRA 4ZL8A 4EDYA 3H8QA 3V1WA 5E4WA 2CQ9A 3M8NA 1BAYA 1PD21 3P8WA 5IMDA 3M1GA 3H93A 5ECLB 4L0UA 4YQVA 1XBSA 3QAWA 1FG4A 4AJ7A 4F0BA 2WFCA 2BMXA 1XWGA 4J2FA 1O81A 2GDRA 2CVKA 1ZMAA 5HR2A 1B9XC 3BD2A 4ISDA 1PX7A 4OCEA 2KP1A 4JRRA 4E8EA 1CQHA 4V2LA 4TXVA 1R5AA 3C73A 1UVZA 4ECCA 1EOHA 1PGTA 4JEDA 3CSIA 3KMNA 3GKKA 1O73A 2YPMA 4IBPA 5IIZA 1MDKA 2YZHA 4RUVA 2WRTA 1SL0B 1GSUA 2KOKA 3Q74A 4GWRA 1HNAA 4ZBAA 5ECIB 1QGVA 2MMOA 3R2QA 4HQZA 1S3AA 2H1BA 1QUWA 4MZWA 3KMOA 2VO4A 4WBJA 3WT1A 3QFAC 2H75A 2I81A 1U6TA 1V58A 3TRXA 5AIXA 2V2GA 4N30A 3CRUA 1TP9A 3ISOA 3ZZXA 3KH9A 1XWKA 3A5WA 4JE1A 6GSXA 4EE0A 2AHEA 3HXSA 4KSMA 4V2NA 2IN3A 4MJEA 1DE1A 2PWJA 3H79A 1TK5B 5COHA 3S9FA 4FO5A 4KW6A 3ZREA 4NXIA 1X9MB 2L57A 3IR4A 4OFMA 1X9WB 2BTOT 2M80A 4EXJA 2H6YA 4I8BA 4OFTA 1EP8A 3BCKA 3C1RA 2H1AA 2CAIA 5J3RA 3F8UA 3CTGA 2EIQA 2DIZA 1ERWA 2GS3A 3O6TA 3D6IA 1J9BA 5GAND 5FWGA 1R7HA 1ERVA 3VI5A 3KCMA 20GSA 1ST9A 2C4JA 1OVNA 3HHVA 1F6MC 5GSSA 1NSWA 4NHZA 3RHCA 5EY6A 4MK3A 2XC2A 3CSJA 4D73B 1VF2A 5CRWA 3EURA 4ML1A 2JZTA 1A8LA 3FR6A 5CP1A 3WT2A 3GX0A 3KIJA 4DSQA 4WF5A 2HSYA 1EEJA 1JLVA 5B8AA 3IV4A 17GSA 2IPAA 3M9KA 6GSVA 1TRWA 5A4WA 2K6VA 3VPQA 2OJLA 2OBIA 4HJMA 1K0OA 1FVKA 5KN1A 3RBTA 2RIIA 3HJPA 5IO2A 3J7Yb 3TKSE 4PNGA 1TRUA 2CX4A 3ERWA 4YAVA 2X8CA 2MMNA 3ZVJD 3QCPA 5G31A 1TK8B 2KP2A 1GTIA 1WRYA 2L4QA 5JCUA 3AY8A 6GSSA 1SJZA 1BX9A 5DCHA 3UARA 5ID2B 3L9VA 1RK4A 3LGCA 3F0IA 2H1GA 3NZNA 3EC3A 3HVXA 1ERUA 5G1KA 4DSSA 1O85A 3ZVJA 1UA5A 3E9JB 22GSA 1OAZA 4MF6A 1G0TA 4XRDA 4ECBA 4PUFC 3D4TA 3DXBA 2K9FA 4RI6A 4BVXA 3L0HA 2P5RA 5IMZA 1XWCA 1KBNA 1T1VA 2LS5A 3CYNA 4HZ4A 3HZ8A 3ZIVA 3F3RA 2G2QA 11GSA 1AW9A 4PURA 1HYUA 2LKUA 4IN0A 3D0ZA 1YKAA 3NIVA 1MD4A 4WETA 1M2DA 4FH8A 4IW9A 2JACA 4I6XA 1GNWA 4TXOB 1MEKA 1WE0A 3FW2A 1XWAA 1B4PA 3UL3A 2CX3A 4KE3A 1SKWB 2B5XA 1K3LA 1YZXA 1G6YA 3OR5A 2C0EA 3VLNA 2JADA 3LORA 2Z9SA 3FRCA 3GV1A 1TU8A 3TGZA 1K0DA 1OC3A 2PUKC 5ECKB 1GRXA 2XBQA 2FCHA 1C72A 2FWHA 2K18A 3LYPA 2VL9A 3LWAA 3MNGA 1NW2A 2YN1A 14GSA 5D93A 3E0UA 1OKTA 4F2IA 4JR6A 3GSTA 5LNKe 1ZOFA 4BL7A 4RQXA 2E7PA 5IMAA 2VCTA 4IHUA 3GTUA 1YF0A 3IAS2 4EO3A 2J9HA 3FR9A 3KH7A 2FLSA 3BJ5A 1WIKA 2MBTA 3IPZA 4TR1B 1XOBA 4F0CA 1G7EA 5JCWA 1KEBA 3LEFA 1FHEA 1DUGA 2HNLA 5J9BA 2L6DA 3ZMLA 5F8BA 3GNJA 4WEYA 4EF0A 3GFKA 1ZYQB 2QGVA 2A2RA 4PXOA 1PKWA 2DMLA 2MYGA 1GSFA 3O3TA 2LRCA 2RM5A 1M99A 1F37A 3LQ7A 2O8VB 3FZAA 5DDLA 3DD3A 4OD7A 4GQFA 5CO3A 1YEXA 4G10A 4LLRA 2H72A 3TJJA 2J23A 4Q5QA 3KP9A 1EOGA 2K8VA 1AQWA 1TRVA 2MMZA 1YJ6A 4ZBDA 2EC4A 3A2VA 5JWRB 4QQ7A 4ZL7A 3MDKA 3F4SA 4J56E 1V2AA 2GSRA 3VWWA 7GSSA 5H5RA 2IMDA 3O76A 5IO0A 12GSA 2H8LA 3GKMA 1U3IA 5J9CA 1WMJA 1Z7PA 4GRFA 1B9YC 2YV7A 5FHIA 2KLXA 2C3QA 1Z9HA 3ZTLA 2H19A 3IHQA 1SENA 2BJXA 3WGDA 2AYTA 3TDGA 4RQRA 2CT6A 1YF1A 4GF0A 1PSQA 2YJ7A 3L4NA 4L5OA 1ILOA 4KA0A 5DAKA 2R2JA 1A8YA 3TB2A 3D4MA 4MZBA 1N8JA 2R37A 1GLQA 6GSUA 3FKFA 2JL4A 3GHAA 4Z7XA 1HQOA 1GTBA 1Y6EA 3GA4A 4IKHA 1A0FA 4JR4A 2YNXA 4LA1A 3KZQA 4HOJA 2FWEA 1USBA 2X8HA 5KN3A 1QQ2A 3LXZA 4IJIA 1EGOA 3ZL5A 1Z6MA 3UOMA 5AGYA 2L5OA 2HE3A 3I9V2 5D9VA 3ZYWA 4KSOA 1O6JA 2GQKA 4IQ1A 4Q5NA 5IQYA 4HZ2A 2ON5A 5DCGA 1I5GA 5IMFA 1EV9A 1GNEA 3RHBA 3G7YA 5GZZB 1THXA 1PX6A 1K0CA 3C1SA 5EPFA 1OC9A 4WR4A 2HFDA 1YY7A 1M9BA 1GULA 1G7OA 2AUVA 3HZ4A 4PNFA 2VL2A 1PL2A 4IELA 3FK8A 5CRDA 3TJKA 1LU4A 3DKSA 4O5RA 1Z7RA 5F06A 2GSSA 2V6OA 1BYEA 2JU5A 4HJ2A 2FNOA 3DEXA 5DBQA 3TKRA 1T8EB 1B4QA 1PMTA 2RLIA 4K0GA 3GRXA 3ZIJA 2YV9A 3A2WA 1TKDB 1NM3A 3LYKA 2O87A 3GMFA 2IMIA 3FY7A 1THOA 1OKDA 4K7IA 1E2YA 1FW1A 1VGLA 2B3SA 2F3MA 2NDOA 4Q5FA 3RAZA 4KGIA 4WF4A 1A23A 3DGQA 5CAXA 1V57A 2X64A 1HD2A 1WP0A 2VD0A 5ELGA 3D5JA 3CRTA 4K0NA 4NMUA 4OFNA 1QMVA 1SKSB 2FWFA 2IL3A 1IYHA 2HRNA 2IMEA 2DBCA 4WXTA 4MJCA 2DSAA 3CTFA 2CA8A 3VPTA 2G0FA 1GH2A 1M7TA 3DYRA 5HFGA 1MDJA 5IOWA 2F8FA 2IIYA 3WGXA 5HFIA 3DWVA 1JZOA 1JZWA 3EINA 1OE7A 3M9JA 2NBSA 4L0WA 3TJFA 3KM6A 4IP1A 3GUSA 3VWVA 1AC1A 3FZ4A 5KN0A 2OACA 3LXTA 3FHKA 3CBUA 4GSTA 1F2EA 1ZYEA 1YDKA 3W8SA 2HLSA 4TR4A 3UJ1A 2I1UA 3I69A 1WPIA 5CREA 2LJKA 3F3QA 1SD9A 3W6GA 1Q98A 4ZXGA 1VRSD 4ULXA 2R5GA 1PN9A 3EU3A 4PX1A 4WBRD 3F6FA 5HFKA 1GP1A 4GTUA 1QFNA 4GXZA 1R4WA 5ABRA 5ECPB 2NPBA 3SWLA 5DJLA 1TW9A 4DSSB 1JZRA 2OE0A 1A0RP 4N11A 5A4VA 1SK2A 2N5BA 2VCXA 1N2AA 1A2MA 19GSA 3QAVA 1XXUA 3ME7A 4HEA2 3WD6A 1X5EA 4ID0A 1X5DA 1AAZA 5HQPA 2L6CA 5A4UA 1TJDA 2XPDA 2WZ9A 3HJMA
chains in the Genus database with same CATH superfamily
4CW9A 1A2LA 1XW5A 2HT9A 2HYXA 3HKRA 4IS0A 3L9SA 2C0GA 1UC7A 2DJ2A 5IPHA 4O32A 2QC7A 1Q4JA 4TVEA 2PVQA 1S3CA 1MDIA 3EMPA 1S3DA 2L5LA 3UIWA 4KAEA 2MZCA 4NV5A 3PR8A 2TIRA 3R3EA 1HNBA 3MSZA 1VF4A 1GLPA 4L5LA 1ZGNA 4Z2TA 4GCIA 3E3EA 1J08A 1T00A 5AISA 4ZB6A 1S3RA 5ECHB 2OE3A 4KDUA 2VIMA 4I2UA 1LBKA 2EIOA 1BQ7A 5ELAA 1GSEA 5G5FA 4O92A 4E8HA 4IJ3A 4IVFA 2YP6A 1GTAA 2FWGA 4BL7B 2GT5A 5HR1A 3QDNA 4I97A 3GTUB 5G5EA 3UVTA 1H75A 5CYYA 2E2GA 2DLXA 3PINA 3C71A 3P2AA 2DJ0A 4HSCX 3F4RA 4F03A 5JWQB 2VAFA 3APOA 2GVPA 1K3OA 1JLWA 4X4JA 2GQLA 3MAKA 4V1Ap 1O7UA 4IGJA 2R0GA 3F63A 2FA4A 1AIUA 5B6MA 3HYPA 5D96A 1B8XA 5G1LA 5CRHA 1JZDA 4HDEA 2VL2C 3HVNA 5HR3A 2CV4A 1RQMA 5ECRB 1V40A 2DKIA 4J57E 4MJBA 1U88A 2B6MA 4X43A 1K0MA 3C8EA 2N5FA 4DVCA 3KP8A 1FOVA 3QPMA 4TN8A 3APSA 2HSHA 3EVIA 4KUNA 4K1FA 3EWLA 1MTCA 2H74A 1ZCPA 2GLRA 1FB0A 3ZLPA 3U5RE 5KEJA 2MBSA 3ZRDA 2ZCTA 2O85A 2M72A 2VM2A 2LQQA 1W4VA 5LD0A 2CAQA 2I4AA 16GSA 3VWXA 1Z3EA 1ML6A 2V41A 2VLVA 4X0XA 1SJ6A 4MF5A 3A2XA 2WDUA 4GSSA 3D22A 2I3YA 4JBBA 1TDIA 3HVVA 4WR5A 3UVHA 2C8UA 9GSSA 5INYA 3GIXA 1SYRA 1ZYPA 2H6ZA 5DAKB 2GZZA 2DJKA 2LJAA 3I43A 5DALB 3GKNA 4FIWA 4V1Ag 1GTUA 4MPGA 5KOXA 5D8IA 3FZ5A 4DSRA 1WWJA 2H70A 1K0BA 4HU9A 4KF9A 2H73A 2LJRA 4XIHA 3D21A 1DBYA 4H86A 5IMCA 4DEJA 5LCZA 2PPTA 4F9ZA 3TUEA 4MH3A 3GN3A 1EP7A 4AGSA 2YANA 3GYKA 3G7IA 4EDZA 3P7XA 3K8NA 3F6DA 3G7JA 2VL3A 4TKYA 2LRNA 4EC0A 1B48A 4G0IA 2VCQA 2F51A 8GSSA 2LEGA 5AN1A 3BCIA 1NHYA 4POKA 4P3YB 4LL4B 2B1LA 5GAPD 5D9XA 5EVOA 1T3BA 1SYXA 2GQMA 1YKCA 3KTBA 4EKZA 2HZFA 4XS1A 1OC9B 2H0HA 3N5OA 1TI1A 3HCZA 5DALA 4KCEA 2H1DA 2PVOC 4PQ1A 2LSTA 2R0CA 2GZYA 2CVDA 3GL5A 2XBIA 1A24A 4KB3A 4LL1B 4NHWA 2PN8A 1QK8A 5DQSA 2B5YA 4TR0A 3WGEA 1SK0A 5G2ZA 2JZSA 4XS4A 5GSTA 4MMMA 2PU9C 3GH9A 2ZUPA 1H4OA 1TOFA 3NOFA 1GSYA 2V1MA 3IA1A 4MZCA 4WKWA 2TRCP 4MCUA 3P90A 1T4ZA 4MDCA 3BOAA 4K5SA 4BA7A 3FR3A 4K6XA 1I9DA 1TRSA 1CQGA 3VK9A 3ZFLA 2M46A 2DJ3A 2PBJA 3RPPA 1EEMA 4MPFA 5F07A 2KHPA 2L4CA 4XCSA 3Q6OA 1OE8A 3FYGA 3C7MA 1SL2B 3GX8A 3IE3A 5JCGA 4FYUA 4USSA 5DVBA 2C1YA 4TRXA 2GT6A 1XOAA 3JCML 3VFIA 2PERA 2VD1A 2D2ZA 2YWMA 4KDXA 2OE1A 3IK7A 3EYTA 2C0FA 2QA1A 2DJ1A 1X9SB 5ECQB 4EVMA 1XPVA 1YQ1A 4NPBA 4K8MA 4O7HA 1ACVA 2LV3A 3EMXA 2K8SA 1BJXA 4PQHA 1PQNA 4OCFA 1XG8A 3FMWA 1Z6NA 5H5SA 4TR3A 2I9HA 1EZKA 2XPEA 4LMVA 4KH7A 1FB6A 2YOIA 1O8WA 3TJGA 1JHBA 2OA7A 2YWOA 1ERTA 4K2DA 3APQA 1UN2A 3F9UA 4CDOA 4QL9A 5CNWA 1GUMA 4Q5RA 2R6KA 18GSA 2ZNMA 2VLTA 4ILFA 4ZILA 1SK1A 2B7JA 2YZUA 2NVLA 3FZ9A 1TI3A 1T4YA 1XVWA 4POMA 4AJ8A 4MA9A 4HUAA 5KN2A 1TU7A 1G6WA 2YWIA 1OC8A 2DC5A 2IWTA 3QOUA 2P0GA 3CMIA 3TKPA 2FGXA 5ECMB 2C3TA 3LW9A 3LSZA 3DIEA 3GH6A 1YEPA 3M0FA 4F82A 4TW5A 3IRAA 4YQMA 2FY6A 4PUAA 2VM1A 2LNSA 2YWNA 5IMVA 3EE2A 4NV2A 3L78A 1M2AA 3HA9A 1FVJA 1RW1A 5BRTA 2B5EA 1K3YA 4KX4A 4MP4A 2QKEA 1FO5A 1U87A 2V6KA 3ED3A 1U3AA 3TKSA 1XFLA 2FD3A 2HXKA 5ENUA 3M3MA 1SJIA 2VCWA 4NAXA 2B1KA 3KXOA 1JFUA 3KEBA 3QFBC 5J5NA 4MH2A 1XZOA 3PGTA 2FA8A 5G30A 3MWHA 3ZMKA 3LFLA 2WULA 4JZQA 1Y25A 2X99A 1TTZA 1URMA 4X1UA 1OYJA 3IAM2 3IBHA 1WOUA 4OO4A 2VCZA 3TRPA 5L71A 3UBKA 2MMAA 2LUSA 2WS2A 1BEDA 1WJKA 2FHEA 3UEMA 4FQUA 3UBLA 1PL1A 3A5IA 2LQOA 5F05A 1KNGA 5KOWA 5C00A 2WCIA 2V32A 13GSA 4G9HA 2VUPA 5D9WA 1GSQA 2ON7A 1R26A 1J0FA 2IMKA 1XW9A 2P5QA 3RPNA 5J4UA 2E0QA 2H71A 2R3XA 2B7KA 1GSDA 1R5PA 2YCDA 2X8GA 3CXGA 2QSIA 3IDVA 2H0GA 2LRTA 3Q19A 3GKXA 1F9MA 2GZPA 2CZ3A 4LMWA 4TOPA 1DSBA 1K0NA 2PGTA 4ZL9A 4Z2UA 2IJYA 1AQXA 4D73A 4QL7A 2F9SA 2A4HA 3IK9A 1W89A 5B7CA 6GSTA 1PKZA 3KJYA 2GSQA 4ECIA 5ECNB 3QAGA 4HQSA 2C3NA 3DVWA 1Z5YE 3H4KA 4ACSA 3G9BA 4HS1A 1XVQA 2H76A 3Q18A 1NHOA 1ZL9A 3VWUA 3US3A 3TJBA 2VCVA 5JWOB 4G19A 3VURA 3U6VA 3GSSA 3N9JA 3SBCA 4ECJA 1QXHA 3QR6A 2LNTA 2E2MA 3HDCA 5IM9A 3UAPA 4MJAA 3FEUA 1AXDA 2OADA 4MLYA 4K7OA 3ME8A 4EUYA 5EL8A 6GSWA 3KGKA 2RUFA 3HJOA 4NWYA 1F3BA 2REMA 1EWXA 2NTOA 2AB6A 2IMFA 4MABA 2R4VA 1AQVA 4RI7A 2JSZA 5ID2A 1MD3A 4I2TA 3IOSA 2XHFA 4O5QA 2TRXA 4K7NA 1V98A 1HNCA 3IC4A 2GTUA 3F4TA 2JZRA 2WGRA 5J41A 4ZIJA 2HRFA 3WYWA 2N5AA 5AIVA 5BMUA 2GGTA 1EGRA 3HVSA 1M2BA 4N10A 2H0IA 3ZFBA 4OMVA 1X0RA 4ZB8A 2CZ2A 1ABAA 2O7KA 2O89A 3KTLA 4KCAA 1GWCA 2ALBA 1GUHA 3GURA 1K0AA 1ZZYA 2WJUA 4MF7A 4PQIA 1SU9A 2H30A 4JU5A 1F3AA 1A2JA 2HI7A 2F8AA 2RUEA 1FAAA 1E6BA 3HY2A 2L59A 5H5QA 4N0VA 4ZBBA 4XHMA 3RDWA 3LG6A 1M3JA 4TXOA 4ZB9A 3DMLA 1M9AA 4V2MA 3TKQA 2VOCA 3A3TA 5A5KA 3TCOA 1T7PB 1TXXA 3L9UA 1XCCA 4HI7A 1KTEA 2C80A 4GQCA 2GSTA 5CRGA 3I6AA 5DQYA 5C04A 5IPGA 4GLTA 4K9ZA 4L8EA 2VLUA 2H6XA 3TOUA 4BPYA 1TK0B 5ECOB 4XS6A 4YAPA 4BIKA 3GL3A 5DJMA 4IP6A 2H01A 3H1NA 2ES7A 10GSA 1PRXA 2JSYA 2YJHA 2FUG2 1X5CA 4AJ6A 5D73A 3VI7A 3LJRA 4XS4B 3KD0A 4ML6A 3ERFA 2OBKA 1EV4A 4CHSA 4POLA 1XIYA 3EU4A 3BBYA 1XWBA 4YQUA 1V9WA 4FYCA 5D9TA 4BVYB 5E59A 4OO5A 1SD8A 2AJQB 4BWSA 4TR1A 3HD5A 2CVBA 2A4VA 4AF2A 3J7Yk 1VF1A 2A2SA 2WB9A 4BWQA 1GL8A 4G0LA 1SL1B 5FT3A 4IQAA 3TKSC 3ZITA 3DVXA 6GSYA 4I5QA 1PA3A 4XRAA 4KNDA 2HZEB 1GUKA 3TOTA 3UMAA 2OKAA 5F0GA 2DJJA 2DMMA 2IFQB 5ECSA 3QD9A 4G2EA 5HR0A 3TRQA 4EL1A 1M0UA 5IOXA 1AUCA 4FYBA 4HU7A 1XW6A 1IYIA 1BG5A 4GSNA 2RM6A 2H66A 1LJRA 4YH2A 5B8BA 3QMXA 2P31A 4PGTA 1SKRB 4EIPA 1ON4A 3W8JA 3ERGA 4BVYA 5B6NA 4POBA 2PMTA 1GSSA 2AAWA 2DIYA 3PH9A 1O8XA 2A2PA 4CY6A 4OWYA 4KDYA 3DRNA 1VF3A 3CSHA 2KUCA 3IXRA 2HZEA 4XTSA 4EIQA 4N0ZA 2LTKA 2C0DA 2IFQA 1DE2A 2AV4A 2EIRA 4ZL8A 4EDYA 3H8QA 3V1WA 5E4WA 2CQ9A 3M8NA 1BAYA 1PD21 3P8WA 5IMDA 3M1GA 3H93A 5ECLB 4L0UA 4YQVA 1XBSA 3QAWA 1FG4A 4AJ7A 4F0BA 2DKHA 2WFCA 2BMXA 1XWGA 4J2FA 1O81A 2GDRA 2CVKA 1ZMAA 5HR2A 1B9XC 3BD2A 4ISDA 1PX7A 4OCEA 2KP1A 4JRRA 4E8EA 1CQHA 4V2LA 4TXVA 1R5AA 3C73A 1UVZA 4ECCA 1EOHA 1PGTA 4JEDA 3CSIA 3KMNA 3GKKA 1O73A 2YPMA 4IBPA 5IIZA 1MDKA 2YZHA 4RUVA 2WRTA 1SL0B 1GSUA 2KOKA 3Q74A 3MYDA 4GWRA 1HNAA 4ZBAA 5ECIB 1QGVA 2MMOA 3R2QA 4HQZA 1S3AA 2H1BA 1QUWA 4MZWA 3KMOA 2VO4A 4WBJA 3WT1A 3QFAC 2H75A 2I81A 1U6TA 1V58A 3TRXA 5AIXA 2HRAA 2V2GA 4N30A 1ZYNA 3CRUA 1TP9A 3ISOA 3ZZXA 3KH9A 1XWKA 3A5WA 4JE1A 6GSXA 4EE0A 2AHEA 3HXSA 4KSMA 4V2NA 2IN3A 3MIXA 4MJEA 1DE1A 2PWJA 3H79A 1TK5B 5COHA 3IC8A 3S9FA 4FO5A 4KW6A 3ZREA 1M3IA 4NXIA 1X9MB 2L57A 3IR4A 4OFMA 1X9WB 2BTOT 2M80A 4EXJA 2H6YA 4I8BA 4OFTA 1EP8A 3BCKA 3C1RA 2H1AA 2CAIA 5J3RA 3F8UA 3CTGA 2EIQA 2DIZA 1ERWA 2GS3A 3O6TA 3D6IA 1J9BA 5GAND 5FWGA 1R7HA 1ERVA 3VI5A 3KCMA 20GSA 1ST9A 2C4JA 1OVNA 3HHVA 1F6MC 5GSSA 1NSWA 4NHZA 3RHCA 5EY6A 4MK3A 2XC2A 3CSJA 4D73B 1VF2A 5CRWA 3EURA 4ML1A 2JZTA 1A8LA 3FR6A 5CP1A 3WT2A 3GX0A 3KIJA 4DSQA 4WF5A 2HSYA 1EEJA 1JLVA 5B8AA 3IV4A 17GSA 2IPAA 3M9KA 6GSVA 1TRWA 5A4WA 2K6VA 3VPQA 2OJLA 2OBIA 4HJMA 1K0OA 1FVKA 5KN1A 3RBTA 2RIIA 3HJPA 5IO2A 3J7Yb 3TKSE 4PNGA 1TRUA 2CX4A 3ERWA 4YAVA 4CY8A 2X8CA 2MMNA 3ZVJD 4O5UA 3QCPA 5G31A 1TK8B 2KP2A 1GTIA 1WRYA 2L4QA 5JCUA 3AY8A 6GSSA 1SJZA 1BX9A 5DCHA 3UARA 5ID2B 3L9VA 1RK4A 3LGCA 3F0IA 2H1GA 3NZNA 3EC3A 3HVXA 1ERUA 5G1KA 4DSSA 1O85A 3ZVJA 1UA5A 3E9JB 22GSA 1OAZA 4MF6A 1G0TA 4XRDA 4ECBA 4PUFC 3D4TA 3DXBA 2K9FA 2R0PA 4RI6A 4BVXA 3L0HA 2P5RA 5IMZA 4PTSA 4YKGA 1XWCA 1KBNA 1T1VA 2LS5A 3CYNA 4HZ4A 3HZ8A 4YKFA 3ZIVA 3F3RA 2G2QA 11GSA 1AW9A 2HRKA 1HYUA 4PURA 2LKUA 4IN0A 3D0ZA 1YKAA 3PPUA 3NIVA 1MD4A 4WETA 1M2DA 4FH8A 4IW9A 2JACA 4I6XA 1GNWA 4TXOB 1MEKA 1WE0A 3EPTA 3FW2A 1XWAA 2UZ8A 1B4PA 3UL3A 2CX3A 4KE3A 1SKWB 2B5XA 1K3LA 1YZXA 1G6YA 3OR5A 2C0EA 3VLNA 2JADA 3LORA 2Z9SA 3FRCA 3GV1A 1TU8A 3TGZA 1K0DA 1OC3A 2PUKC 5ECKB 1GRXA 2XBQA 2FCHA 1C72A 1PN0A 2FWHA 2K18A 3LYPA 2VL9A 3LWAA 3MNGA 1NW2A 2YN1A 14GSA 5D93A 3E0UA 1OKTA 4F2IA 4JR6A 3GSTA 5LNKe 1ZOFA 4BL7A 4RQXA 2E7PA 5IMAA 2VCTA 4IHUA 3GTUA 1YF0A 3IAS2 4EO3A 2J9HA 3FR9A 3KH7A 2FLSA 3BJ5A 1WIKA 2MBTA 3IPZA 4TR1B 1XOBA 4F0CA 1G7EA 5JCWA 1KEBA 3LEFA 1FHEA 4G0KA 1DUGA 2HNLA 5J9BA 2L6DA 3ZMLA 5F8BA 3GNJA 4WEYA 4EF0A 3GFKA 1ZYQB 2QGVA 2A2RA 4PXOA 1PKWA 2DMLA 2MYGA 1FOHA 1GSFA 3O3TA 2LRCA 2RM5A 1M99A 1F37A 3LQ7A 2O8VB 3FZAA 5DDLA 4K2XA 3DD3A 4OD7A 4GQFA 5CO3A 1YEXA 4G10A 4LLRA 2H72A 3TJJA 2J23A 4Q5QA 3KP9A 1EOGA 2K8VA 1AQWA 1TRVA 2MMZA 1YJ6A 4ZBDA 2EC4A 3A2VA 5JWRB 4QQ7A 4ZL7A 3MDKA 3F4SA 4J56E 1V2AA 2GSRA 3VWWA 7GSSA 5H5RA 2IMDA 3O76A 5IO0A 12GSA 2H8LA 3GKMA 1U3IA 5J9CA 1WMJA 1Z7PA 4GRFA 1B9YC 2YV7A 5FHIA 2KLXA 2C3QA 1Z9HA 3ZTLA 2H19A 3IHQA 1SENA 2BJXA 3WGDA 2AYTA 3TDGA 4RQRA 2CT6A 1YF1A 4GF0A 1PSQA 2YJ7A 3L4NA 4L5OA 1ILOA 4KA0A 5DAKA 2R2JA 1A8YA 3TB2A 3D4MA 4MZBA 1N8JA 2R37A 1GLQA 4K5RA 6GSUA 3FKFA 2JL4A 3GHAA 4Z7XA 1HQOA 1GTBA 1Y6EA 3GA4A 4IKHA 1A0FA 4JR4A 2YNXA 4LA1A 3KZQA 4HOJA 2FWEA 1USBA 2X8HA 5KN3A 1QQ2A 3CQFA 3LXZA 4IJIA 1EGOA 3ZL5A 1Z6MA 3UOMA 5AGYA 2L5OA 2HE3A 3I9V2 5D9VA 2X4AA 3ZYWA 4KSOA 1O6JA 2GQKA 4IQ1A 4Q5NA 5IQYA 4HZ2A 2ON5A 5DCGA 1I5GA 5IMFA 1EV9A 1GNEA 3RHBA 2QA2A 3G7YA 4MNNA 5GZZB 1THXA 1PX6A 1K0CA 3C1SA 5EPFA 1OC9A 4WR4A 2HFDA 1YY7A 1M9BA 1GULA 1G7OA 2AUVA 3HZ4A 4PNFA 4Z2RA 2VL2A 1PL2A 4IELA 3FK8A 5CRDA 3TJKA 1LU4A 3DKSA 4O5RA 1Z7RA 5F06A 2GSSA 2V6OA 1BYEA 2JU5A 4HJ2A 2FNOA 3DEXA 5DBQA 3TKRA 1T8EB 1PFOA 2X49A 1B4QA 1PMTA 2RLIA 4K0GA 3GRXA 3ZIJA 2YV9A 3A2WA 1TKDB 1NM3A 3LYKA 2O87A 3GMFA 2HSMA 2IMIA 3FY7A 1THOA 1OKDA 4K7IA 1E2YA 1FW1A 1VGLA 2B3SA 2F3MA 2NDOA 4Q5FA 3RAZA 4KGIA 4WF4A 1A23A 3DGQA 5CAXA 1V57A 2X64A 1HD2A 1WP0A 2VD0A 5ELGA 3D5JA 3CRTA 4K0NA 4NMUA 4OFNA 1QMVA 1SKSB 2FWFA 2IL3A 1IYHA 2HRNA 2IMEA 2DBCA 4WXTA 4MJCA 2DSAA 3CTFA 2CA8A 3VPTA 2G0FA 1GH2A 1M7TA 3DYRA 5HFGA 1MDJA 5IOWA 2F8FA 2IIYA 3WGXA 5HFIA 3DWVA 1JZOA 1JZWA 3EINA 1OE7A 3M9JA 2NBSA 3IHGA 4L0WA 3TJFA 3KM6A 4IP1A 3GUSA 3VWVA 1AC1A 3FZ4A 5KN0A 2OACA 3LXTA 3FHKA 3CBUA 4GSTA 1F2EA 1ZYEA 1YDKA 3W8SA 2HLSA 4TR4A 3UJ1A 2I1UA 3I69A 1WPIA 5CREA 2LJKA 3F3QA 1SD9A 3W6GA 1Q98A 4ZXGA 1VRSD 4ULXA 2R5GA 1PN9A 3EU3A 4PX1A 4WBRD 3F6FA 5HFKA 1GP1A 4GTUA 1QFNA 4GXZA 1R4WA 5ABRA 5ECPB 2NPBA 3SWLA 5DJLA 1TW9A 4DSSB 4A5PA 1JZRA 2OE0A 1A0RP 4N11A 5A4VA 1SK2A 2N5BA 2VCXA 1N2AA 4BVXB 1A2MA 4ICYA 19GSA 3QAVA 1XXUA 3ME7A 4HEA2 3WD6A 1X5EA 4ID0A 1X5DA 1AAZA 5HQPA 2L6CA 5A4UA 1TJDA 2XPDA 2WZ9A 3HJMA
chains in the Genus database with same CATH topology
4CW9A 1A2LA 1XW5A 2HT9A 2HYXA 3HKRA 4IS0A 3L9SA 2C0GA 1UC7A 2DJ2A 5IPHA 4O32A 2QC7A 1Q4JA 4TVEA 2PVQA 1S3CA 1MDIA 3EMPA 1S3DA 2L5LA 3UIWA 4KAEA 2MZCA 4NV5A 3PR8A 2TIRA 3R3EA 1HNBA 3MSZA 1VF4A 1GLPA 4L5LA 1ZGNA 4Z2TA 4GCIA 3E3EA 1J08A 1T00A 5AISA 4ZB6A 5ECHB 2OE3A 4KDUA 2VIMA 4I2UA 1LBKA 2EIOA 1BQ7A 5ELAA 1GSEA 5G5FA 4O92A 4E8HA 4IJ3A 4IVFA 2YP6A 1GTAA 2FWGA 4BL7B 2GT5A 5HR1A 3QDNA 4I97A 3GTUB 5G5EA 3UVTA 1H75A 5CYYA 2E2GA 2DLXA 3PINA 3C71A 3P2AA 2DJ0A 3F4RA 4F03A 5JWQB 2VAFA 3APOA 2GVPA 1K3OA 1JLWA 4X4JA 2GQLA 3MAKA 4V1Ap 1O7UA 4IGJA 2R0GA 3F63A 2FA4A 1AIUA 5B6MA 3HYPA 5D96A 1B8XA 5G1LA 5CRHA 1JZDA 4HDEA 2VL2C 5HR3A 2CV4A 1RQMA 5ECRB 1V40A 2DKIA 4J57E 4MJBA 1U88A 2B6MA 4X43A 1K0MA 3C8EA 2N5FA 4DVCA 3KP8A 1FOVA 3QPMA 4TN8A 3APSA 2HSHA 3EVIA 4KUNA 4K1FA 3EWLA 1MTCA 2H74A 1ZCPA 2GLRA 1FB0A 3ZLPA 3U5RE 5KEJA 2MBSA 3ZRDA 2ZCTA 2O85A 2M72A 2VM2A 2LQQA 1W4VA 5LD0A 2CAQA 2I4AA 16GSA 3VWXA 1Z3EA 1ML6A 2V41A 2VLVA 4X0XA 1SJ6A 4MF5A 3A2XA 2WDUA 4GSSA 3D22A 2I3YA 4JBBA 1TDIA 3HVVA 4WR5A 3UVHA 2C8UA 9GSSA 5INYA 3GIXA 1SYRA 1ZYPA 2H6ZA 5DAKB 2GZZA 2DJKA 2LJAA 3I43A 5DALB 3GKNA 4FIWA 4V1Ag 1GTUA 4MPGA 5KOXA 5D8IA 3FZ5A 4DSRA 1WWJA 2H70A 1K0BA 4HU9A 4KF9A 2H73A 2LJRA 4XIHA 3D21A 1DBYA 4H86A 5IMCA 4DEJA 5LCZA 2PPTA 4F9ZA 3TUEA 4MH3A 3GN3A 1EP7A 4AGSA 2YANA 3GYKA 3G7IA 4EDZA 3P7XA 3K8NA 3F6DA 3G7JA 2VL3A 4TKYA 2LRNA 4EC0A 1B48A 4G0IA 2VCQA 2F51A 8GSSA 2LEGA 5AN1A 3BCIA 1NHYA 4POKA 4P3YB 4LL4B 2B1LA 5GAPD 5D9XA 5EVOA 1T3BA 1SYXA 2GQMA 1YKCA 3KTBA 4EKZA 2HZFA 4XS1A 1OC9B 2H0HA 3N5OA 1TI1A 3HCZA 5DALA 4KCEA 2H1DA 2PVOC 4PQ1A 2LSTA 2R0CA 2GZYA 2CVDA 3GL5A 2XBIA 1A24A 4KB3A 4LL1B 4NHWA 2PN8A 1QK8A 5DQSA 2B5YA 4TR0A 3WGEA 1SK0A 5G2ZA 2JZSA 4XS4A 5GSTA 4MMMA 2PU9C 3GH9A 2ZUPA 1H4OA 1TOFA 3NOFA 1GSYA 2V1MA 3IA1A 4MZCA 4WKWA 2TRCP 4MCUA 3P90A 1T4ZA 4MDCA 3BOAA 4K5SA 4BA7A 3FR3A 4K6XA 1I9DA 1TRSA 1CQGA 3VK9A 3ZFLA 2M46A 2DJ3A 2PBJA 3RPPA 1EEMA 4MPFA 5F07A 2KHPA 2L4CA 4XCSA 3Q6OA 1OE8A 3FYGA 3C7MA 1SL2B 3GX8A 3IE3A 5JCGA 4FYUA 4USSA 5DVBA 2C1YA 4TRXA 2GT6A 1XOAA 3JCML 3VFIA 2PERA 2VD1A 2D2ZA 2YWMA 4KDXA 2OE1A 3IK7A 3EYTA 2C0FA 2QA1A 2DJ1A 1X9SB 5ECQB 4EVMA 1XPVA 1YQ1A 4NPBA 4K8MA 4O7HA 1ACVA 2LV3A 3EMXA 2K8SA 1BJXA 4PQHA 1PQNA 3FMWA 4OCFA 1Z6NA 5H5SA 4TR3A 2I9HA 1EZKA 2XPEA 4LMVA 4KH7A 1FB6A 2YOIA 1O8WA 3TJGA 1JHBA 2OA7A 2YWOA 1ERTA 4K2DA 3APQA 1UN2A 3F9UA 4CDOA 4QL9A 5CNWA 1GUMA 4Q5RA 2R6KA 18GSA 2ZNMA 2VLTA 4ILFA 4ZILA 1SK1A 2B7JA 2YZUA 2NVLA 3FZ9A 1TI3A 1T4YA 1XVWA 4POMA 4AJ8A 4MA9A 4HUAA 5KN2A 1TU7A 1G6WA 2YWIA 1OC8A 2DC5A 2IWTA 3QOUA 2P0GA 3CMIA 3TKPA 2FGXA 5ECMB 2C3TA 3LW9A 3LSZA 3DIEA 3GH6A 1YEPA 3M0FA 4F82A 4TW5A 3IRAA 4YQMA 2FY6A 4PUAA 2VM1A 2LNSA 2YWNA 5IMVA 3EE2A 4NV2A 3L78A 1M2AA 3HA9A 1FVJA 1RW1A 5BRTA 2B5EA 1K3YA 4KX4A 4MP4A 2QKEA 1FO5A 1U87A 2V6KA 3ED3A 1U3AA 3TKSA 1XFLA 2FD3A 2HXKA 5ENUA 3M3MA 1SJIA 2VCWA 4NAXA 2B1KA 3KXOA 1JFUA 3KEBA 3QFBC 5J5NA 4MH2A 1XZOA 3PGTA 2FA8A 5G30A 3MWHA 3ZMKA 3LFLA 2WULA 4JZQA 1Y25A 2X99A 1TTZA 1URMA 4X1UA 1OYJA 3IAM2 3IBHA 1WOUA 4OO4A 2VCZA 3TRPA 5L71A 3UBKA 2MMAA 2LUSA 2WS2A 1BEDA 1WJKA 2FHEA 3UEMA 4FQUA 3UBLA 1PL1A 3A5IA 2LQOA 5F05A 1KNGA 5KOWA 5C00A 2WCIA 2V32A 13GSA 4G9HA 2VUPA 5D9WA 1GSQA 2ON7A 1R26A 1J0FA 2IMKA 1XW9A 2P5QA 3RPNA 5J4UA 2E0QA 2H71A 2R3XA 2B7KA 1GSDA 1R5PA 2YCDA 2X8GA 3CXGA 2QSIA 3IDVA 2H0GA 2LRTA 3Q19A 3GKXA 1F9MA 2GZPA 2CZ3A 4LMWA 4TOPA 1DSBA 1K0NA 2PGTA 4ZL9A 4Z2UA 2IJYA 1AQXA 4D73A 4QL7A 2F9SA 2A4HA 3IK9A 1W89A 5B7CA 6GSTA 1PKZA 3KJYA 2GSQA 4ECIA 5ECNB 3QAGA 4HQSA 2C3NA 3DVWA 1Z5YE 3H4KA 4ACSA 3G9BA 4HS1A 1XVQA 2H76A 3Q18A 1NHOA 1ZL9A 3VWUA 3US3A 3TJBA 2VCVA 5JWOB 4G19A 3VURA 3U6VA 3GSSA 3N9JA 3SBCA 4ECJA 1QXHA 3QR6A 2LNTA 2E2MA 3HDCA 5IM9A 3UAPA 4MJAA 3FEUA 1AXDA 2OADA 4MLYA 4K7OA 3ME8A 4EUYA 5EL8A 6GSWA 3KGKA 2RUFA 3HJOA 4NWYA 1F3BA 2REMA 1EWXA 2NTOA 2AB6A 2IMFA 4MABA 2R4VA 1AQVA 4RI7A 2JSZA 5ID2A 1MD3A 4I2TA 3IOSA 2XHFA 4O5QA 2TRXA 4K7NA 1V98A 1HNCA 3IC4A 2GTUA 3F4TA 2JZRA 2WGRA 5J41A 4ZIJA 2HRFA 3WYWA 2N5AA 5AIVA 5BMUA 2GGTA 1EGRA 3HVSA 1M2BA 4N10A 2H0IA 3ZFBA 4OMVA 1X0RA 4ZB8A 2CZ2A 1ABAA 2O7KA 2O89A 3KTLA 4KCAA 1GWCA 2ALBA 1GUHA 3GURA 1K0AA 1ZZYA 2WJUA 4MF7A 4PQIA 1SU9A 2H30A 4JU5A 1F3AA 1A2JA 2HI7A 2F8AA 2RUEA 1FAAA 1E6BA 3HY2A 2L59A 5H5QA 4N0VA 4ZBBA 4XHMA 3RDWA 3LG6A 4TXOA 4ZB9A 3DMLA 1M9AA 4V2MA 3TKQA 2VOCA 3A3TA 5A5KA 3TCOA 1T7PB 1TXXA 3L9UA 1XCCA 4HI7A 1KTEA 2C80A 4GQCA 2GSTA 5CRGA 3I6AA 5DQYA 5C04A 5IPGA 4GLTA 4K9ZA 4L8EA 2VLUA 2H6XA 3TOUA 4BPYA 1TK0B 5ECOB 4XS6A 4YAPA 3GL3A 5DJMA 4IP6A 2H01A 3H1NA 2ES7A 10GSA 1PRXA 2JSYA 2YJHA 2FUG2 1X5CA 4AJ6A 5D73A 3VI7A 3LJRA 4XS4B 3KD0A 4ML6A 3ERFA 2OBKA 1EV4A 4CHSA 4POLA 1XIYA 3EU4A 3BBYA 1XWBA 4YQUA 1V9WA 4FYCA 5D9TA 4BVYB 5E59A 4OO5A 1SD8A 2AJQB 4BWSA 4TR1A 3HD5A 2CVBA 2A4VA 4AF2A 3J7Yk 1VF1A 2A2SA 2WB9A 4BWQA 1GL8A 4G0LA 1SL1B 5FT3A 4IQAA 3TKSC 3ZITA 3DVXA 6GSYA 4I5QA 1PA3A 4XRAA 4KNDA 2HZEB 1GUKA 3TOTA 3UMAA 2OKAA 5F0GA 2DJJA 2DMMA 2IFQB 5ECSA 3QD9A 4G2EA 5HR0A 3TRQA 4EL1A 1M0UA 5IOXA 1AUCA 4FYBA 4HU7A 1XW6A 1IYIA 1BG5A 4GSNA 2RM6A 2H66A 1LJRA 4YH2A 5B8BA 3QMXA 2P31A 4PGTA 1SKRB 4EIPA 1ON4A 3W8JA 3ERGA 4BVYA 5B6NA 4POBA 2PMTA 1GSSA 2AAWA 2DIYA 3PH9A 1O8XA 2A2PA 4CY6A 4OWYA 4KDYA 3DRNA 1VF3A 3CSHA 2KUCA 3IXRA 2HZEA 4XTSA 4EIQA 4N0ZA 2LTKA 2C0DA 2IFQA 1DE2A 2AV4A 2EIRA 4ZL8A 4EDYA 3H8QA 3V1WA 5E4WA 2CQ9A 3M8NA 1BAYA 1PD21 3P8WA 5IMDA 3M1GA 3H93A 5ECLB 4L0UA 4YQVA 1XBSA 3QAWA 1FG4A 4AJ7A 4F0BA 2DKHA 2WFCA 2BMXA 1XWGA 4J2FA 1O81A 2GDRA 2CVKA 1ZMAA 5HR2A 1B9XC 3BD2A 4ISDA 1PX7A 4OCEA 2KP1A 4JRRA 4E8EA 1CQHA 4V2LA 4TXVA 1R5AA 3C73A 1UVZA 4ECCA 1EOHA 1PGTA 4JEDA 3CSIA 3KMNA 3GKKA 1O73A 2YPMA 4IBPA 5IIZA 1MDKA 2YZHA 4RUVA 2WRTA 1SL0B 1GSUA 2KOKA 3Q74A 3MYDA 4GWRA 1HNAA 4ZBAA 5ECIB 1QGVA 2MMOA 3R2QA 4HQZA 1S3AA 2H1BA 1QUWA 4MZWA 3KMOA 2VO4A 4WBJA 3WT1A 3QFAC 2H75A 2I81A 1U6TA 1V58A 3TRXA 5AIXA 2HRAA 2V2GA 4N30A 1ZYNA 3CRUA 1TP9A 3ISOA 3ZZXA 3KH9A 1XWKA 3A5WA 4JE1A 6GSXA 4EE0A 2AHEA 3HXSA 4KSMA 4V2NA 2IN3A 3MIXA 4MJEA 1DE1A 2PWJA 3H79A 1TK5B 5COHA 3IC8A 3S9FA 4FO5A 4KW6A 3ZREA 4NXIA 1X9MB 2L57A 3IR4A 4OFMA 1X9WB 2BTOT 2M80A 4EXJA 2H6YA 4I8BA 4OFTA 1EP8A 3BCKA 3C1RA 2H1AA 2CAIA 5J3RA 3F8UA 3CTGA 2EIQA 2DIZA 1ERWA 2GS3A 3O6TA 3D6IA 1J9BA 5GAND 5FWGA 1R7HA 1ERVA 3VI5A 3KCMA 20GSA 1ST9A 2C4JA 1OVNA 3HHVA 1F6MC 5GSSA 1NSWA 4NHZA 3RHCA 5EY6A 4MK3A 2XC2A 3CSJA 4D73B 1VF2A 5CRWA 3EURA 4ML1A 2JZTA 1A8LA 3FR6A 5CP1A 3WT2A 3GX0A 3KIJA 4DSQA 4WF5A 2HSYA 1EEJA 1JLVA 5B8AA 3IV4A 17GSA 2IPAA 3M9KA 6GSVA 1TRWA 5A4WA 2K6VA 3VPQA 2OJLA 2OBIA 4HJMA 1K0OA 1FVKA 5KN1A 3RBTA 2RIIA 3HJPA 5IO2A 3J7Yb 3TKSE 4PNGA 1TRUA 2CX4A 3ERWA 4YAVA 4CY8A 2X8CA 2MMNA 3ZVJD 4O5UA 3QCPA 5G31A 1TK8B 2KP2A 1GTIA 1WRYA 2L4QA 5JCUA 3AY8A 6GSSA 1SJZA 1BX9A 5DCHA 3UARA 5ID2B 3L9VA 1RK4A 3LGCA 3F0IA 2H1GA 3NZNA 3EC3A 3HVXA 1ERUA 5G1KA 4DSSA 1O85A 3ZVJA 1UA5A 3E9JB 22GSA 1OAZA 4MF6A 1G0TA 4XRDA 4ECBA 4PUFC 3D4TA 3DXBA 2K9FA 2R0PA 4RI6A 4BVXA 3L0HA 2P5RA 5IMZA 4PTSA 4YKGA 1XWCA 1KBNA 1T1VA 2LS5A 3CYNA 4HZ4A 3HZ8A 4YKFA 3ZIVA 3F3RA 2G2QA 11GSA 1AW9A 2HRKA 1HYUA 4PURA 2LKUA 4IN0A 3D0ZA 1YKAA 3PPUA 3NIVA 1MD4A 4WETA 1M2DA 4FH8A 4IW9A 2JACA 4I6XA 1GNWA 4TXOB 1MEKA 1WE0A 3EPTA 3FW2A 1XWAA 2UZ8A 1B4PA 3UL3A 2CX3A 4KE3A 1SKWB 2B5XA 1K3LA 1YZXA 1G6YA 3OR5A 2C0EA 3VLNA 2JADA 3LORA 2Z9SA 3FRCA 3GV1A 1TU8A 3TGZA 1K0DA 1OC3A 2PUKC 5ECKB 1GRXA 2XBQA 2FCHA 1C72A 1PN0A 2FWHA 2K18A 3LYPA 2VL9A 3LWAA 3MNGA 1NW2A 2YN1A 14GSA 5D93A 3E0UA 1OKTA 4F2IA 4JR6A 3GSTA 5LNKe 1ZOFA 4BL7A 4RQXA 2E7PA 5IMAA 2VCTA 4IHUA 3GTUA 1YF0A 3IAS2 4EO3A 2J9HA 3FR9A 3KH7A 2FLSA 3BJ5A 1WIKA 2MBTA 3IPZA 4TR1B 1XOBA 4F0CA 1G7EA 5JCWA 1KEBA 3LEFA 1FHEA 4G0KA 1DUGA 2HNLA 5J9BA 2L6DA 3ZMLA 5F8BA 3GNJA 4WEYA 4EF0A 3GFKA 1ZYQB 2QGVA 2A2RA 4PXOA 1PKWA 2DMLA 2MYGA 1FOHA 1GSFA 3O3TA 2LRCA 2RM5A 1M99A 1F37A 3LQ7A 2O8VB 3FZAA 5DDLA 4K2XA 3DD3A 4OD7A 4GQFA 5CO3A 1YEXA 4G10A 4LLRA 2H72A 3TJJA 2J23A 4Q5QA 3KP9A 1EOGA 2K8VA 1AQWA 1TRVA 2MMZA 1YJ6A 4ZBDA 2EC4A 3A2VA 5JWRB 4QQ7A 4ZL7A 3MDKA 3F4SA 4J56E 1V2AA 2GSRA 3VWWA 7GSSA 5H5RA 2IMDA 3O76A 5IO0A 12GSA 2H8LA 3GKMA 1U3IA 5J9CA 1WMJA 1Z7PA 4GRFA 1B9YC 2YV7A 5FHIA 2KLXA 2C3QA 1Z9HA 3ZTLA 2H19A 3IHQA 1SENA 2BJXA 3WGDA 2AYTA 3TDGA 4RQRA 2CT6A 1YF1A 4GF0A 1PSQA 2YJ7A 3L4NA 4L5OA 1ILOA 4KA0A 5DAKA 2R2JA 1A8YA 3TB2A 3D4MA 4MZBA 1N8JA 2R37A 1GLQA 4K5RA 6GSUA 3FKFA 2JL4A 3GHAA 4Z7XA 1HQOA 1GTBA 1Y6EA 3GA4A 4IKHA 1A0FA 4JR4A 2YNXA 4LA1A 3KZQA 4HOJA 2FWEA 1USBA 2X8HA 5KN3A 1QQ2A 3LXZA 4IJIA 1EGOA 3ZL5A 1Z6MA 3UOMA 5AGYA 2L5OA 2HE3A 3I9V2 5D9VA 2X4AA 3ZYWA 4KSOA 1O6JA 2GQKA 4IQ1A 4Q5NA 5IQYA 4HZ2A 2ON5A 5DCGA 1I5GA 5IMFA 1EV9A 1GNEA 3RHBA 2QA2A 3G7YA 4MNNA 5GZZB 1THXA 1PX6A 1K0CA 3C1SA 5EPFA 1OC9A 4WR4A 2HFDA 1YY7A 1M9BA 1GULA 1G7OA 2AUVA 3HZ4A 4PNFA 4Z2RA 2VL2A 1PL2A 4IELA 3FK8A 5CRDA 3TJKA 1LU4A 3DKSA 4O5RA 1Z7RA 5F06A 2GSSA 2V6OA 1BYEA 2JU5A 4HJ2A 2FNOA 3DEXA 5DBQA 3TKRA 1T8EB 2X49A 1B4QA 1PMTA 2RLIA 4K0GA 3GRXA 3ZIJA 2YV9A 3A2WA 1TKDB 1NM3A 3LYKA 2O87A 3GMFA 2HSMA 2IMIA 3FY7A 1THOA 1OKDA 4K7IA 1E2YA 1FW1A 1VGLA 2B3SA 2F3MA 2NDOA 4Q5FA 3RAZA 4KGIA 4WF4A 1A23A 3DGQA 5CAXA 1V57A 2X64A 1HD2A 1WP0A 2VD0A 5ELGA 3D5JA 3CRTA 4K0NA 4NMUA 4OFNA 1QMVA 1SKSB 2FWFA 2IL3A 1IYHA 2HRNA 2IMEA 2DBCA 4WXTA 4MJCA 2DSAA 3CTFA 2CA8A 3VPTA 2G0FA 1GH2A 1M7TA 3DYRA 5HFGA 1MDJA 5IOWA 2F8FA 2IIYA 3WGXA 5HFIA 3DWVA 1JZOA 1JZWA 3EINA 1OE7A 3M9JA 2NBSA 3IHGA 4L0WA 3TJFA 3KM6A 4IP1A 3GUSA 3VWVA 1AC1A 3FZ4A 5KN0A 2OACA 3LXTA 3FHKA 3CBUA 4GSTA 1F2EA 1ZYEA 1YDKA 3W8SA 2HLSA 4TR4A 3UJ1A 2I1UA 3I69A 1WPIA 5CREA 2LJKA 3F3QA 1SD9A 3W6GA 1Q98A 4ZXGA 1VRSD 4ULXA 2R5GA 1PN9A 3EU3A 4PX1A 4WBRD 3F6FA 5HFKA 1GP1A 4GTUA 1QFNA 4GXZA 1R4WA 5ABRA 5ECPB 2NPBA 3SWLA 5DJLA 1TW9A 4DSSB 4A5PA 1JZRA 2OE0A 1A0RP 4N11A 5A4VA 1SK2A 2N5BA 2VCXA 1N2AA 4BVXB 1A2MA 4ICYA 19GSA 3QAVA 1XXUA 3ME7A 4HEA2 3WD6A 1X5EA 4ID0A 1X5DA 1AAZA 5HQPA 2L6CA 5A4UA 1TJDA 2XPDA 2WZ9A 3HJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CW9 A;  1A2L A;  1XW5 A;  2HT9 A;  2HYX A;  3HKR A;  4IS0 A;  3L9S A;  2C0G A;  1UC7 A;  2DJ2 A;  5IPH A;  4O32 A;  2QC7 A;  1Q4J A;  4TVE A;  2PVQ A;  1S3C A;  1MDI A;  3EMP A;  1S3D A;  2L5L A;  3UIW A;  4KAE A;  2MZC A;  4NV5 A;  3PR8 A;  2TIR A;  1HNB A;  3MSZ A;  1VF4 A;  1GLP A;  4L5L A;  1ZGN A;  4GCI A;  3E3E A;  1J08 A;  1T00 A;  5AIS A;  4ZB6 A;  5ECH B;  2OE3 A;  4KDU A;  2VIM A;  4I2U A;  1LBK A;  2EIO A;  1BQ7 A;  5ELA A;  1GSE A;  5G5F A;  4O92 A;  4E8H A;  4IJ3 A;  4IVF A;  2YP6 A;  1GTA A;  2FWG A;  2GT5 A;  5HR1 A;  3QDN A;  4I97 A;  3GTU B;  5G5E A;  3UVT A;  1H75 A;  5CYY A;  2E2G A;  2DLX A;  3PIN A;  3C71 A;  3P2A A;  2DJ0 A;  3F4R A;  4F03 A;  5JWQ B;  2VAF A;  3APO A;  2GVP A;  1K3O A;  1JLW A;  2GQL A;  3MAK A;  4V1A p;  1O7U A;  4IGJ A;  3F63 A;  2FA4 A;  1AIU A;  5B6M A;  3HYP A;  5D96 A;  1B8X A;  5G1L A;  5CRH A;  1JZD A;  4HDE A;  2VL2 C;  5HR3 A;  2CV4 A;  1RQM A;  5ECR B;  1V40 A;  4J57 E;  4MJB A;  1U88 A;  2B6M A;  4X43 A;  1K0M A;  3C8E A;  2N5F A;  4DVC A;  3KP8 A;  1FOV A;  3QPM A;  4TN8 A;  3APS A;  2HSH A;  3EVI A;  4KUN A;  4K1F A;  3EWL A;  1MTC A;  2H74 A;  1ZCP A;  2GLR A;  1FB0 A;  3ZLP A;  3U5R E;  5KEJ A;  2MBS A;  3ZRD A;  2ZCT A;  2O85 A;  2M72 A;  2VM2 A;  2LQQ A;  1W4V A;  5LD0 A;  2CAQ A;  2I4A A;  16GS A;  3VWX A;  1Z3E A;  1ML6 A;  2V41 A;  2VLV A;  4X0X A;  1SJ6 A;  4MF5 A;  3A2X A;  2WDU A;  4GSS A;  3D22 A;  2I3Y A;  4JBB A;  1TDI A;  3HVV A;  4WR5 A;  3UVH A;  2C8U A;  9GSS A;  5INY A;  3GIX A;  1SYR A;  2H6Z A;  5DAK B;  2GZZ A;  2DJK A;  2LJA A;  3I43 A;  5DAL B;  3GKN A;  4FIW A;  4V1A g;  1GTU A;  4MPG A;  5D8I A;  3FZ5 A;  4DSR A;  1WWJ A;  2H70 A;  1K0B A;  4HU9 A;  2H73 A;  2LJR A;  4XIH A;  3D21 A;  1DBY A;  4H86 A;  5IMC A;  4DEJ A;  5LCZ A;  2PPT A;  4F9Z A;  3TUE A;  4MH3 A;  3GN3 A;  1EP7 A;  4AGS A;  2YAN A;  3GYK A;  3G7I A;  4EDZ A;  3P7X A;  3K8N A;  3F6D A;  3G7J A;  2VL3 A;  4TKY A;  2LRN A;  4EC0 A;  1B48 A;  2VCQ A;  2F51 A;  8GSS A;  2LEG A;  5AN1 A;  3BCI A;  1NHY A;  4POK A;  4P3Y B;  4LL4 B;  2B1L A;  5GAP D;  5D9X A;  5EVO A;  1T3B A;  1SYX A;  2GQM A;  1YKC A;  3KTB A;  4EKZ A;  2HZF A;  4XS1 A;  1OC9 B;  2H0H A;  3N5O A;  1TI1 A;  3HCZ A;  5DAL A;  4KCE A;  2H1D A;  2PVO C;  4PQ1 A;  2LST A;  2GZY A;  2CVD A;  3GL5 A;  2XBI A;  1A24 A;  4KB3 A;  4LL1 B;  4NHW A;  2PN8 A;  1QK8 A;  5DQS A;  2B5Y A;  4TR0 A;  3WGE A;  1SK0 A;  5G2Z A;  2JZS A;  4XS4 A;  5GST A;  4MMM A;  2PU9 C;  3GH9 A;  2ZUP A;  1H4O A;  1TOF A;  3NOF A;  1GSY A;  2V1M A;  3IA1 A;  4MZC A;  4WKW A;  2TRC P;  4MCU A;  3P90 A;  1T4Z A;  4MDC A;  3BOA A;  4BA7 A;  3FR3 A;  4K6X A;  1I9D A;  1TRS A;  1CQG A;  3VK9 A;  3ZFL A;  2M46 A;  2DJ3 A;  2PBJ A;  3RPP A;  1EEM A;  4MPF A;  5F07 A;  2KHP A;  2L4C A;  4XCS A;  3Q6O A;  1OE8 A;  3FYG A;  3C7M A;  1SL2 B;  3GX8 A;  3IE3 A;  5JCG A;  4FYU A;  5DVB A;  2C1Y A;  4TRX A;  2GT6 A;  1XOA A;  3JCM L;  3VFI A;  2PER A;  2VD1 A;  2D2Z A;  2YWM A;  4KDX A;  2OE1 A;  3IK7 A;  3EYT A;  2C0F A;  2DJ1 A;  1X9S B;  5ECQ B;  4EVM A;  1XPV A;  1YQ1 A;  4NPB A;  4K8M A;  4O7H A;  1ACV A;  2LV3 A;  3EMX A;  2K8S A;  1BJX A;  4PQH A;  1PQN A;  4OCF A;  1Z6N A;  5H5S A;  4TR3 A;  2I9H A;  1EZK A;  2XPE A;  4LMV A;  4KH7 A;  1FB6 A;  2YOI A;  1O8W A;  3TJG A;  1JHB A;  2OA7 A;  2YWO A;  1ERT A;  4K2D A;  3APQ A;  1UN2 A;  3F9U A;  4CDO A;  4QL9 A;  5CNW A;  1GUM A;  4Q5R A;  2R6K A;  18GS A;  2ZNM A;  2VLT A;  4ILF A;  4ZIL A;  1SK1 A;  2B7J A;  2YZU A;  2NVL A;  3FZ9 A;  1TI3 A;  1T4Y A;  1XVW A;  4POM A;  4AJ8 A;  4MA9 A;  4HUA A;  5KN2 A;  1TU7 A;  1G6W A;  2YWI A;  1OC8 A;  2DC5 A;  2IWT A;  3QOU A;  2P0G A;  3CMI A;  3TKP A;  2FGX A;  5ECM B;  2C3T A;  3LSZ A;  3DIE A;  3GH6 A;  1YEP A;  3M0F A;  4F82 A;  4TW5 A;  3IRA A;  4YQM A;  2FY6 A;  4PUA A;  2VM1 A;  2LNS A;  2YWN A;  5IMV A;  3EE2 A;  4NV2 A;  3L78 A;  1M2A A;  3HA9 A;  1FVJ A;  1RW1 A;  2B5E A;  1K3Y A;  4KX4 A;  4MP4 A;  2QKE A;  1FO5 A;  1U87 A;  2V6K A;  3ED3 A;  1U3A A;  3TKS A;  1XFL A;  2FD3 A;  2HXK A;  5ENU A;  3M3M A;  1SJI A;  2VCW A;  4NAX A;  2B1K A;  3KXO A;  1JFU A;  3KEB A;  3QFB C;  5J5N A;  4MH2 A;  1XZO A;  3PGT A;  2FA8 A;  5G30 A;  3MWH A;  3ZMK A;  3LFL A;  2WUL A;  4JZQ A;  1Y25 A;  2X99 A;  1TTZ A;  1URM A;  4X1U A;  1OYJ A;  3IAM 2;  3IBH A;  1WOU A;  4OO4 A;  2VCZ A;  3TRP A;  5L71 A;  3UBK A;  2MMA A;  2LUS A;  2WS2 A;  1BED A;  1WJK A;  2FHE A;  3UEM A;  3UBL A;  1PL1 A;  2LQO A;  5F05 A;  1KNG A;  5C00 A;  2WCI A;  2V32 A;  13GS A;  4G9H A;  2VUP A;  5D9W A;  1GSQ A;  2ON7 A;  1R26 A;  1J0F A;  2IMK A;  1XW9 A;  2P5Q A;  3RPN A;  5J4U A;  2E0Q A;  2H71 A;  2R3X A;  2B7K A;  1GSD A;  1R5P A;  2YCD A;  2X8G A;  3CXG A;  2QSI A;  3IDV A;  2H0G A;  2LRT A;  3Q19 A;  3GKX A;  1F9M A;  2GZP A;  2CZ3 A;  4LMW A;  4TOP A;  1DSB A;  1K0N A;  2PGT A;  4ZL9 A;  2IJY A;  1AQX A;  4D73 A;  4QL7 A;  2F9S A;  3IK9 A;  1W89 A;  5B7C A;  6GST A;  1PKZ A;  3KJY A;  2GSQ A;  4ECI A;  5ECN B;  3QAG A;  4HQS A;  2C3N A;  3DVW A;  1Z5Y E;  3H4K A;  4ACS A;  3G9B A;  4HS1 A;  1XVQ A;  2H76 A;  3Q18 A;  1NHO A;  1ZL9 A;  3VWU A;  3US3 A;  3TJB A;  2VCV A;  5JWO B;  4G19 A;  3VUR A;  3U6V A;  3GSS A;  3N9J A;  3SBC A;  4ECJ A;  1QXH A;  3QR6 A;  2LNT A;  2E2M A;  3HDC A;  5IM9 A;  3UAP A;  4MJA A;  3FEU A;  1AXD A;  2OAD A;  4MLY A;  4K7O A;  3ME8 A;  4EUY A;  5EL8 A;  6GSW A;  3KGK A;  2RUF A;  3HJO A;  4NWY A;  1F3B A;  2REM A;  1EWX A;  2NTO A;  2AB6 A;  2IMF A;  4MAB A;  2R4V A;  1AQV A;  4RI7 A;  2JSZ A;  5ID2 A;  1MD3 A;  4I2T A;  3IOS A;  2XHF A;  2TRX A;  4K7N A;  1V98 A;  1HNC A;  3IC4 A;  2GTU A;  3F4T A;  2JZR A;  2WGR A;  5J41 A;  4ZIJ A;  2HRF A;  3WYW A;  2N5A A;  5AIV A;  2GGT A;  1EGR A;  3HVS A;  1M2B A;  4N10 A;  2H0I A;  3ZFB A;  4OMV A;  1X0R A;  4ZB8 A;  2CZ2 A;  1ABA A;  2O7K A;  2O89 A;  3KTL A;  4KCA A;  1GWC A;  2ALB A;  1GUH A;  3GUR A;  1K0A A;  1ZZY A;  2WJU A;  4MF7 A;  4PQI A;  1SU9 A;  2H30 A;  4JU5 A;  1F3A A;  1A2J A;  2HI7 A;  2F8A A;  2RUE A;  1FAA A;  1E6B A;  3HY2 A;  2L59 A;  5H5Q A;  4N0V A;  4ZBB A;  4XHM A;  3RDW A;  3LG6 A;  4TXO A;  4ZB9 A;  3DML A;  1M9A A;  4V2M A;  3TKQ A;  2VOC A;  3A3T A;  5A5K A;  3TCO A;  1T7P B;  1TXX A;  3L9U A;  1XCC A;  4HI7 A;  1KTE A;  2C80 A;  4GQC A;  2GST A;  5CRG A;  3I6A A;  5DQY A;  5C04 A;  5IPG A;  4GLT A;  4K9Z A;  4L8E A;  2VLU A;  2H6X A;  3TOU A;  4BPY A;  1TK0 B;  5ECO B;  4XS6 A;  4YAP A;  3GL3 A;  5DJM A;  4IP6 A;  2H01 A;  3H1N A;  2ES7 A;  10GS A;  1PRX A;  2JSY A;  2YJH A;  2FUG 2;  1X5C A;  4AJ6 A;  5D73 A;  3VI7 A;  3LJR A;  4XS4 B;  3KD0 A;  4ML6 A;  3ERF A;  2OBK A;  1EV4 A;  4CHS A;  4POL A;  1XIY A;  3EU4 A;  3BBY A;  1XWB A;  4YQU A;  1V9W A;  4FYC A;  5D9T A;  5E59 A;  4OO5 A;  1SD8 A;  2AJQ B;  4BWS A;  4TR1 A;  3HD5 A;  2CVB A;  2A4V A;  4AF2 A;  3J7Y k;  1VF1 A;  2A2S A;  2WB9 A;  4BWQ A;  1GL8 A;  1SL1 B;  5FT3 A;  4IQA A;  3TKS C;  3ZIT A;  3DVX A;  6GSY A;  4I5Q A;  1PA3 A;  4XRA A;  4KND A;  2HZE B;  1GUK A;  3TOT A;  3UMA A;  2OKA A;  5F0G A;  2DJJ A;  2DMM A;  2IFQ B;  5ECS A;  3QD9 A;  4G2E A;  5HR0 A;  3TRQ A;  4EL1 A;  1M0U A;  5IOX A;  1AUC A;  4FYB A;  4HU7 A;  1XW6 A;  1IYI A;  1BG5 A;  4GSN A;  2RM6 A;  2H66 A;  1LJR A;  4YH2 A;  5B8B A;  3QMX A;  2P31 A;  4PGT A;  1SKR B;  1ON4 A;  3W8J A;  3ERG A;  4BVY A;  5B6N A;  4POB A;  2PMT A;  1GSS A;  2AAW A;  2DIY A;  3PH9 A;  1O8X A;  4OWY A;  4KDY A;  3DRN A;  1VF3 A;  3CSH A;  2KUC A;  3IXR A;  2HZE A;  4XTS A;  4N0Z A;  2LTK A;  2C0D A;  2IFQ A;  1DE2 A;  2AV4 A;  2EIR A;  4ZL8 A;  4EDY A;  3H8Q A;  3V1W A;  5E4W A;  2CQ9 A;  3M8N A;  1BAY A;  1PD2 1;  3P8W A;  5IMD A;  3M1G A;  3H93 A;  5ECL B;  4L0U A;  4YQV A;  1XBS A;  3QAW A;  1FG4 A;  4AJ7 A;  4F0B A;  2WFC A;  2BMX A;  1XWG A;  4J2F A;  1O81 A;  2GDR A;  2CVK A;  1ZMA A;  5HR2 A;  1B9X C;  3BD2 A;  4ISD A;  1PX7 A;  4OCE A;  2KP1 A;  4JRR A;  4E8E A;  1CQH A;  4V2L A;  4TXV A;  1R5A A;  3C73 A;  1UVZ A;  4ECC A;  1EOH A;  1PGT A;  4JED A;  3CSI A;  3KMN A;  3GKK A;  1O73 A;  2YPM A;  4IBP A;  5IIZ A;  1MDK A;  2YZH A;  4RUV A;  2WRT A;  1SL0 B;  1GSU A;  2KOK A;  3Q74 A;  4GWR A;  1HNA A;  4ZBA A;  5ECI B;  1QGV A;  2MMO A;  3R2Q A;  4HQZ A;  1S3A A;  2H1B A;  1QUW A;  4MZW A;  3KMO A;  2VO4 A;  4WBJ A;  3WT1 A;  3QFA C;  2H75 A;  2I81 A;  1U6T A;  1V58 A;  3TRX A;  5AIX A;  2V2G A;  4N30 A;  3CRU A;  1TP9 A;  3ISO A;  3ZZX A;  3KH9 A;  1XWK A;  3A5W A;  4JE1 A;  6GSX A;  4EE0 A;  2AHE A;  3HXS A;  4KSM A;  4V2N A;  2IN3 A;  4MJE A;  1DE1 A;  2PWJ A;  3H79 A;  1TK5 B;  5COH A;  3S9F A;  4FO5 A;  4KW6 A;  3ZRE A;  4NXI A;  1X9M B;  2L57 A;  3IR4 A;  4OFM A;  1X9W B;  2BTO T;  2M80 A;  4EXJ A;  2H6Y A;  4I8B A;  4OFT A;  1EP8 A;  3BCK A;  3C1R A;  2H1A A;  2CAI A;  5J3R A;  3F8U A;  3CTG A;  2EIQ A;  2DIZ A;  1ERW A;  2GS3 A;  3O6T A;  3D6I A;  1J9B A;  5GAN D;  5FWG A;  1R7H A;  1ERV A;  3VI5 A;  3KCM A;  20GS A;  1ST9 A;  2C4J A;  1OVN A;  3HHV A;  1F6M C;  5GSS A;  1NSW A;  4NHZ A;  3RHC A;  5EY6 A;  4MK3 A;  2XC2 A;  3CSJ A;  4D73 B;  1VF2 A;  5CRW A;  3EUR A;  4ML1 A;  2JZT A;  1A8L A;  3FR6 A;  5CP1 A;  3WT2 A;  3GX0 A;  3KIJ A;  4DSQ A;  4WF5 A;  2HSY A;  1EEJ A;  1JLV A;  5B8A A;  3IV4 A;  17GS A;  2IPA A;  3M9K A;  6GSV A;  1TRW A;  5A4W A;  2K6V A;  3VPQ A;  2OJL A;  2OBI A;  4HJM A;  1K0O A;  1FVK A;  5KN1 A;  3RBT A;  2RII A;  3HJP A;  5IO2 A;  3J7Y b;  3TKS E;  4PNG A;  1TRU A;  2CX4 A;  3ERW A;  4YAV A;  2X8C A;  2MMN A;  3ZVJ D;  3QCP A;  5G31 A;  1TK8 B;  2KP2 A;  1GTI A;  1WRY A;  2L4Q A;  5JCU A;  3AY8 A;  6GSS A;  1SJZ A;  1BX9 A;  5DCH A;  3UAR A;  5ID2 B;  3L9V A;  1RK4 A;  3LGC A;  3F0I A;  2H1G A;  3NZN A;  3EC3 A;  3HVX A;  1ERU A;  5G1K A;  4DSS A;  1O85 A;  3ZVJ A;  1UA5 A;  3E9J B;  22GS A;  1OAZ A;  4MF6 A;  1G0T A;  4XRD A;  4ECB A;  4PUF C;  3D4T A;  3DXB A;  2K9F A;  4RI6 A;  4BVX A;  3L0H A;  2P5R A;  5IMZ A;  1XWC A;  1KBN A;  1T1V A;  2LS5 A;  3CYN A;  4HZ4 A;  3HZ8 A;  3ZIV A;  3F3R A;  2G2Q A;  11GS A;  1AW9 A;  4PUR A;  1HYU A;  2LKU A;  4IN0 A;  3D0Z A;  1YKA A;  3NIV A;  1MD4 A;  4WET A;  1M2D A;  4FH8 A;  4IW9 A;  2JAC A;  4I6X A;  1GNW A;  4TXO B;  1MEK A;  1WE0 A;  3FW2 A;  1XWA A;  1B4P A;  3UL3 A;  2CX3 A;  4KE3 A;  1SKW B;  2B5X A;  1K3L A;  1YZX A;  1G6Y A;  3OR5 A;  2C0E A;  3VLN A;  2JAD A;  3LOR A;  2Z9S A;  3FRC A;  3GV1 A;  1TU8 A;  3TGZ A;  1K0D A;  1OC3 A;  2PUK C;  5ECK B;  1GRX A;  2XBQ A;  2FCH A;  1C72 A;  2FWH A;  2K18 A;  3LYP A;  2VL9 A;  3LWA A;  3MNG A;  1NW2 A;  2YN1 A;  14GS A;  5D93 A;  3E0U A;  1OKT A;  4F2I A;  4JR6 A;  3GST A;  5LNK e;  1ZOF A;  4BL7 A;  4RQX A;  2E7P A;  5IMA A;  2VCT A;  4IHU A;  3GTU A;  1YF0 A;  3IAS 2;  4EO3 A;  2J9H A;  3FR9 A;  3KH7 A;  2FLS A;  3BJ5 A;  1WIK A;  2MBT A;  3IPZ A;  4TR1 B;  1XOB A;  4F0C A;  1G7E A;  5JCW A;  1KEB A;  3LEF A;  1FHE A;  1DUG A;  2HNL A;  5J9B A;  2L6D A;  3ZML A;  5F8B A;  3GNJ A;  4WEY A;  4EF0 A;  3GFK A;  1ZYQ B;  2QGV A;  2A2R A;  4PXO A;  1PKW A;  2DML A;  2MYG A;  1GSF A;  3O3T A;  2LRC A;  2RM5 A;  1M99 A;  1F37 A;  3LQ7 A;  2O8V B;  3FZA A;  5DDL A;  3DD3 A;  4OD7 A;  4GQF A;  5CO3 A;  1YEX A;  4G10 A;  4LLR A;  2H72 A;  3TJJ A;  2J23 A;  4Q5Q A;  3KP9 A;  1EOG A;  2K8V A;  1AQW A;  1TRV A;  2MMZ A;  1YJ6 A;  4ZBD A;  2EC4 A;  3A2V A;  5JWR B;  4QQ7 A;  4ZL7 A;  3MDK A;  3F4S A;  4J56 E;  1V2A A;  2GSR A;  3VWW A;  7GSS A;  5H5R A;  2IMD A;  3O76 A;  5IO0 A;  12GS A;  2H8L A;  3GKM A;  1U3I A;  5J9C A;  1WMJ A;  1Z7P A;  4GRF A;  1B9Y C;  2YV7 A;  5FHI A;  2KLX A;  2C3Q A;  1Z9H A;  3ZTL A;  2H19 A;  3IHQ A;  1SEN A;  2BJX A;  3WGD A;  2AYT A;  3TDG A;  4RQR A;  2CT6 A;  1YF1 A;  4GF0 A;  1PSQ A;  2YJ7 A;  3L4N A;  4L5O A;  1ILO A;  4KA0 A;  5DAK A;  2R2J A;  1A8Y A;  3TB2 A;  3D4M A;  4MZB A;  1N8J A;  2R37 A;  1GLQ A;  6GSU A;  3FKF A;  2JL4 A;  3GHA A;  4Z7X A;  1HQO A;  1GTB A;  1Y6E A;  3GA4 A;  4IKH A;  1A0F A;  4JR4 A;  2YNX A;  4LA1 A;  3KZQ A;  4HOJ A;  2FWE A;  1USB A;  2X8H A;  5KN3 A;  1QQ2 A;  3LXZ A;  4IJI A;  1EGO A;  3ZL5 A;  1Z6M A;  3UOM A;  5AGY A;  2L5O A;  2HE3 A;  3I9V 2;  5D9V A;  3ZYW A;  4KSO A;  1O6J A;  2GQK A;  4IQ1 A;  4Q5N A;  5IQY A;  4HZ2 A;  2ON5 A;  5DCG A;  1I5G A;  5IMF A;  1EV9 A;  1GNE A;  3RHB A;  3G7Y A;  5GZZ B;  1THX A;  1PX6 A;  1K0C A;  3C1S A;  5EPF A;  1OC9 A;  4WR4 A;  2HFD A;  1YY7 A;  1M9B A;  1GUL A;  1G7O A;  2AUV A;  3HZ4 A;  4PNF A;  2VL2 A;  1PL2 A;  4IEL A;  3FK8 A;  5CRD A;  3TJK A;  1LU4 A;  3DKS A;  4O5R A;  1Z7R A;  5F06 A;  2GSS A;  2V6O A;  1BYE A;  2JU5 A;  4HJ2 A;  2FNO A;  3DEX A;  5DBQ A;  3TKR A;  1T8E B;  1B4Q A;  1PMT A;  2RLI A;  4K0G A;  3GRX A;  3ZIJ A;  2YV9 A;  3A2W A;  1TKD B;  1NM3 A;  3LYK A;  2O87 A;  3GMF A;  2IMI A;  3FY7 A;  1THO A;  1OKD A;  4K7I A;  1E2Y A;  1FW1 A;  1VGL A;  2B3S A;  2F3M A;  2NDO A;  4Q5F A;  3RAZ A;  4KGI A;  4WF4 A;  1A23 A;  3DGQ A;  5CAX A;  1V57 A;  2X64 A;  1HD2 A;  1WP0 A;  2VD0 A;  5ELG A;  3D5J A;  3CRT A;  4K0N A;  4NMU A;  4OFN A;  1QMV A;  1SKS B;  2FWF A;  2IL3 A;  1IYH A;  2HRN A;  2IME A;  2DBC A;  4WXT A;  4MJC A;  2DSA A;  3CTF A;  2CA8 A;  3VPT A;  2G0F A;  1GH2 A;  1M7T A;  3DYR A;  5HFG A;  1MDJ A;  5IOW A;  2F8F A;  2IIY A;  3WGX A;  5HFI A;  3DWV A;  1JZO A;  1JZW A;  3EIN A;  1OE7 A;  3M9J A;  2NBS A;  4L0W A;  3TJF A;  3KM6 A;  4IP1 A;  3GUS A;  3VWV A;  1AC1 A;  3FZ4 A;  5KN0 A;  2OAC A;  3LXT A;  3FHK A;  3CBU A;  4GST A;  1F2E A;  1ZYE A;  1YDK A;  3W8S A;  2HLS A;  4TR4 A;  3UJ1 A;  2I1U A;  3I69 A;  1WPI A;  5CRE A;  2LJK A;  3F3Q A;  1SD9 A;  3W6G A;  1Q98 A;  4ZXG A;  1VRS D;  4ULX A;  2R5G A;  1PN9 A;  3EU3 A;  4PX1 A;  4WBR D;  3F6F A;  5HFK A;  1GP1 A;  4GTU A;  1QFN A;  4GXZ A;  1R4W A;  5ABR A;  5ECP B;  2NPB A;  3SWL A;  5DJL A;  1TW9 A;  4DSS B;  1JZR A;  2OE0 A;  1A0R P;  4N11 A;  5A4V A;  1SK2 A;  2N5B A;  2VCX A;  1N2A A;  1A2M A;  19GS A;  3QAV A;  1XXU A;  3ME7 A;  4HEA 2;  3WD6 A;  1X5E A;  4ID0 A;  1X5D A;  1AAZ A;  5HQP A;  2L6C A;  5A4U A;  1TJD A;  2XPD A;  2WZ9 A;  3HJM A; 
#chains in the Genus database with same CATH topology
 4CW9 A;  1A2L A;  1XW5 A;  2HT9 A;  2HYX A;  3HKR A;  4IS0 A;  3L9S A;  2C0G A;  1UC7 A;  2DJ2 A;  5IPH A;  4O32 A;  2QC7 A;  1Q4J A;  4TVE A;  2PVQ A;  1S3C A;  1MDI A;  3EMP A;  1S3D A;  2L5L A;  3UIW A;  4KAE A;  2MZC A;  4NV5 A;  3PR8 A;  2TIR A;  3R3E A;  1HNB A;  3MSZ A;  1VF4 A;  1GLP A;  4L5L A;  1ZGN A;  4Z2T A;  4GCI A;  3E3E A;  1J08 A;  1T00 A;  5AIS A;  4ZB6 A;  1S3R A;  5ECH B;  2OE3 A;  4KDU A;  2VIM A;  4I2U A;  1LBK A;  2EIO A;  1BQ7 A;  5ELA A;  1GSE A;  5G5F A;  4O92 A;  4E8H A;  4IJ3 A;  4IVF A;  2YP6 A;  1GTA A;  2FWG A;  4BL7 B;  2GT5 A;  5HR1 A;  3QDN A;  4I97 A;  3GTU B;  5G5E A;  3UVT A;  1H75 A;  5CYY A;  2E2G A;  2DLX A;  3PIN A;  3C71 A;  3P2A A;  2DJ0 A;  4HSC X;  3F4R A;  4F03 A;  5JWQ B;  2VAF A;  3APO A;  2GVP A;  1K3O A;  1JLW A;  4X4J A;  2GQL A;  3MAK A;  4V1A p;  1O7U A;  4IGJ A;  2R0G A;  3F63 A;  2FA4 A;  1AIU A;  5B6M A;  3HYP A;  5D96 A;  1B8X A;  5G1L A;  5CRH A;  1JZD A;  4HDE A;  2VL2 C;  3HVN A;  5HR3 A;  2CV4 A;  1RQM A;  5ECR B;  1V40 A;  2DKI A;  4J57 E;  4MJB A;  1U88 A;  2B6M A;  4X43 A;  1K0M A;  3C8E A;  2N5F A;  4DVC A;  3KP8 A;  1FOV A;  3QPM A;  4TN8 A;  3APS A;  2HSH A;  3EVI A;  4KUN A;  4K1F A;  3EWL A;  1MTC A;  2H74 A;  1ZCP A;  2GLR A;  1FB0 A;  3ZLP A;  3U5R E;  5KEJ A;  2MBS A;  3ZRD A;  2ZCT A;  2O85 A;  2M72 A;  2VM2 A;  2LQQ A;  1W4V A;  5LD0 A;  2CAQ A;  2I4A A;  16GS A;  3VWX A;  1Z3E A;  1ML6 A;  2V41 A;  2VLV A;  4X0X A;  1SJ6 A;  4MF5 A;  3A2X A;  2WDU A;  4GSS A;  3D22 A;  2I3Y A;  4JBB A;  1TDI A;  3HVV A;  4WR5 A;  3UVH A;  2C8U A;  9GSS A;  5INY A;  3GIX A;  1SYR A;  1ZYP A;  2H6Z A;  5DAK B;  2GZZ A;  2DJK A;  2LJA A;  3I43 A;  5DAL B;  3GKN A;  4FIW A;  4V1A g;  1GTU A;  4MPG A;  5KOX A;  5D8I A;  3FZ5 A;  4DSR A;  1WWJ A;  2H70 A;  1K0B A;  4HU9 A;  4KF9 A;  2H73 A;  2LJR A;  4XIH A;  3D21 A;  1DBY A;  4H86 A;  5IMC A;  4DEJ A;  5LCZ A;  2PPT A;  4F9Z A;  3TUE A;  4MH3 A;  3GN3 A;  1EP7 A;  4AGS A;  2YAN A;  3GYK A;  3G7I A;  4EDZ A;  3P7X A;  3K8N A;  3F6D A;  3G7J A;  2VL3 A;  4TKY A;  2LRN A;  4EC0 A;  1B48 A;  4G0I A;  2VCQ A;  2F51 A;  8GSS A;  2LEG A;  5AN1 A;  3BCI A;  1NHY A;  4POK A;  4P3Y B;  4LL4 B;  2B1L A;  5GAP D;  5D9X A;  5EVO A;  1T3B A;  1SYX A;  2GQM A;  1YKC A;  3KTB A;  4EKZ A;  2HZF A;  4XS1 A;  1OC9 B;  2H0H A;  3N5O A;  1TI1 A;  3HCZ A;  5DAL A;  4KCE A;  2H1D A;  2PVO C;  4PQ1 A;  2LST A;  2R0C A;  2GZY A;  2CVD A;  3GL5 A;  2XBI A;  1A24 A;  4KB3 A;  4LL1 B;  4NHW A;  2PN8 A;  1QK8 A;  5DQS A;  2B5Y A;  4TR0 A;  3WGE A;  1SK0 A;  5G2Z A;  2JZS A;  4XS4 A;  5GST A;  4MMM A;  2PU9 C;  3GH9 A;  2ZUP A;  1H4O A;  1TOF A;  3NOF A;  1GSY A;  2V1M A;  3IA1 A;  4MZC A;  4WKW A;  2TRC P;  4MCU A;  3P90 A;  1T4Z A;  4MDC A;  3BOA A;  4K5S A;  4BA7 A;  3FR3 A;  4K6X A;  1I9D A;  1TRS A;  1CQG A;  3VK9 A;  3ZFL A;  2M46 A;  2DJ3 A;  2PBJ A;  3RPP A;  1EEM A;  4MPF A;  5F07 A;  2KHP A;  2L4C A;  4XCS A;  3Q6O A;  1OE8 A;  3FYG A;  3C7M A;  1SL2 B;  3GX8 A;  3IE3 A;  5JCG A;  4FYU A;  4USS A;  5DVB A;  2C1Y A;  4TRX A;  2GT6 A;  1XOA A;  3JCM L;  3VFI A;  2PER A;  2VD1 A;  2D2Z A;  2YWM A;  4KDX A;  2OE1 A;  3IK7 A;  3EYT A;  2C0F A;  2QA1 A;  2DJ1 A;  1X9S B;  5ECQ B;  4EVM A;  1XPV A;  1YQ1 A;  4NPB A;  4K8M A;  4O7H A;  1ACV A;  2LV3 A;  3EMX A;  2K8S A;  1BJX A;  4PQH A;  1PQN A;  4OCF A;  1XG8 A;  3FMW A;  1Z6N A;  5H5S A;  4TR3 A;  2I9H A;  1EZK A;  2XPE A;  4LMV A;  4KH7 A;  1FB6 A;  2YOI A;  1O8W A;  3TJG A;  1JHB A;  2OA7 A;  2YWO A;  1ERT A;  4K2D A;  3APQ A;  1UN2 A;  3F9U A;  4CDO A;  4QL9 A;  5CNW A;  1GUM A;  4Q5R A;  2R6K A;  18GS A;  2ZNM A;  2VLT A;  4ILF A;  4ZIL A;  1SK1 A;  2B7J A;  2YZU A;  2NVL A;  3FZ9 A;  1TI3 A;  1T4Y A;  1XVW A;  4POM A;  4AJ8 A;  4MA9 A;  4HUA A;  5KN2 A;  1TU7 A;  1G6W A;  2YWI A;  1OC8 A;  2DC5 A;  2IWT A;  3QOU A;  2P0G A;  3CMI A;  3TKP A;  2FGX A;  5ECM B;  2C3T A;  3LW9 A;  3LSZ A;  3DIE A;  3GH6 A;  1YEP A;  3M0F A;  4F82 A;  4TW5 A;  3IRA A;  4YQM A;  2FY6 A;  4PUA A;  2VM1 A;  2LNS A;  2YWN A;  5IMV A;  3EE2 A;  4NV2 A;  3L78 A;  1M2A A;  3HA9 A;  1FVJ A;  1RW1 A;  5BRT A;  2B5E A;  1K3Y A;  4KX4 A;  4MP4 A;  2QKE A;  1FO5 A;  1U87 A;  2V6K A;  3ED3 A;  1U3A A;  3TKS A;  1XFL A;  2FD3 A;  2HXK A;  5ENU A;  3M3M A;  1SJI A;  2VCW A;  4NAX A;  2B1K A;  3KXO A;  1JFU A;  3KEB A;  3QFB C;  5J5N A;  4MH2 A;  1XZO A;  3PGT A;  2FA8 A;  5G30 A;  3MWH A;  3ZMK A;  3LFL A;  2WUL A;  4JZQ A;  1Y25 A;  2X99 A;  1TTZ A;  1URM A;  4X1U A;  1OYJ A;  3IAM 2;  3IBH A;  1WOU A;  4OO4 A;  2VCZ A;  3TRP A;  5L71 A;  3UBK A;  2MMA A;  2LUS A;  2WS2 A;  1BED A;  1WJK A;  2FHE A;  3UEM A;  4FQU A;  3UBL A;  1PL1 A;  3A5I A;  2LQO A;  5F05 A;  1KNG A;  5KOW A;  5C00 A;  2WCI A;  2V32 A;  13GS A;  4G9H A;  2VUP A;  5D9W A;  1GSQ A;  2ON7 A;  1R26 A;  1J0F A;  2IMK A;  1XW9 A;  2P5Q A;  3RPN A;  5J4U A;  2E0Q A;  2H71 A;  2R3X A;  2B7K A;  1GSD A;  1R5P A;  2YCD A;  2X8G A;  3CXG A;  2QSI A;  3IDV A;  2H0G A;  2LRT A;  3Q19 A;  3GKX A;  1F9M A;  2GZP A;  2CZ3 A;  4LMW A;  4TOP A;  1DSB A;  1K0N A;  2PGT A;  4ZL9 A;  4Z2U A;  2IJY A;  1AQX A;  4D73 A;  4QL7 A;  2F9S A;  2A4H A;  3IK9 A;  1W89 A;  5B7C A;  6GST A;  1PKZ A;  3KJY A;  2GSQ A;  4ECI A;  5ECN B;  3QAG A;  4HQS A;  2C3N A;  3DVW A;  1Z5Y E;  3H4K A;  4ACS A;  3G9B A;  4HS1 A;  1XVQ A;  2H76 A;  3Q18 A;  1NHO A;  1ZL9 A;  3VWU A;  3US3 A;  3TJB A;  2VCV A;  5JWO B;  4G19 A;  3VUR A;  3U6V A;  3GSS A;  3N9J A;  3SBC A;  4ECJ A;  1QXH A;  3QR6 A;  2LNT A;  2E2M A;  3HDC A;  5IM9 A;  3UAP A;  4MJA A;  3FEU A;  1AXD A;  2OAD A;  4MLY A;  4K7O A;  3ME8 A;  4EUY A;  5EL8 A;  6GSW A;  3KGK A;  2RUF A;  3HJO A;  4NWY A;  1F3B A;  2REM A;  1EWX A;  2NTO A;  2AB6 A;  2IMF A;  4MAB A;  2R4V A;  1AQV A;  4RI7 A;  2JSZ A;  5ID2 A;  1MD3 A;  4I2T A;  3IOS A;  2XHF A;  4O5Q A;  2TRX A;  4K7N A;  1V98 A;  1HNC A;  3IC4 A;  2GTU A;  3F4T A;  2JZR A;  2WGR A;  5J41 A;  4ZIJ A;  2HRF A;  3WYW A;  2N5A A;  5AIV A;  5BMU A;  2GGT A;  1EGR A;  3HVS A;  1M2B A;  4N10 A;  2H0I A;  3ZFB A;  4OMV A;  1X0R A;  4ZB8 A;  2CZ2 A;  1ABA A;  2O7K A;  2O89 A;  3KTL A;  4KCA A;  1GWC A;  2ALB A;  1GUH A;  3GUR A;  1K0A A;  1ZZY A;  2WJU A;  4MF7 A;  4PQI A;  1SU9 A;  2H30 A;  4JU5 A;  1F3A A;  1A2J A;  2HI7 A;  2F8A A;  2RUE A;  1FAA A;  1E6B A;  3HY2 A;  2L59 A;  5H5Q A;  4N0V A;  4ZBB A;  4XHM A;  3RDW A;  3LG6 A;  1M3J A;  4TXO A;  4ZB9 A;  3DML A;  1M9A A;  4V2M A;  3TKQ A;  2VOC A;  3A3T A;  5A5K A;  3TCO A;  1T7P B;  1TXX A;  3L9U A;  1XCC A;  4HI7 A;  1KTE A;  2C80 A;  4GQC A;  2GST A;  5CRG A;  3I6A A;  5DQY A;  5C04 A;  5IPG A;  4GLT A;  4K9Z A;  4L8E A;  2VLU A;  2H6X A;  3TOU A;  4BPY A;  1TK0 B;  5ECO B;  4XS6 A;  4YAP A;  4BIK A;  3GL3 A;  5DJM A;  4IP6 A;  2H01 A;  3H1N A;  2ES7 A;  10GS A;  1PRX A;  2JSY A;  2YJH A;  2FUG 2;  1X5C A;  4AJ6 A;  5D73 A;  3VI7 A;  3LJR A;  4XS4 B;  3KD0 A;  4ML6 A;  3ERF A;  2OBK A;  1EV4 A;  4CHS A;  4POL A;  1XIY A;  3EU4 A;  3BBY A;  1XWB A;  4YQU A;  1V9W A;  4FYC A;  5D9T A;  4BVY B;  5E59 A;  4OO5 A;  1SD8 A;  2AJQ B;  4BWS A;  4TR1 A;  3HD5 A;  2CVB A;  2A4V A;  4AF2 A;  3J7Y k;  1VF1 A;  2A2S A;  2WB9 A;  4BWQ A;  1GL8 A;  4G0L A;  1SL1 B;  5FT3 A;  4IQA A;  3TKS C;  3ZIT A;  3DVX A;  6GSY A;  4I5Q A;  1PA3 A;  4XRA A;  4KND A;  2HZE B;  1GUK A;  3TOT A;  3UMA A;  2OKA A;  5F0G A;  2DJJ A;  2DMM A;  2IFQ B;  5ECS A;  3QD9 A;  4G2E A;  5HR0 A;  3TRQ A;  4EL1 A;  1M0U A;  5IOX A;  1AUC A;  4FYB A;  4HU7 A;  1XW6 A;  1IYI A;  1BG5 A;  4GSN A;  2RM6 A;  2H66 A;  1LJR A;  4YH2 A;  5B8B A;  3QMX A;  2P31 A;  4PGT A;  1SKR B;  4EIP A;  1ON4 A;  3W8J A;  3ERG A;  4BVY A;  5B6N A;  4POB A;  2PMT A;  1GSS A;  2AAW A;  2DIY A;  3PH9 A;  1O8X A;  2A2P A;  4CY6 A;  4OWY A;  4KDY A;  3DRN A;  1VF3 A;  3CSH A;  2KUC A;  3IXR A;  2HZE A;  4XTS A;  4EIQ A;  4N0Z A;  2LTK A;  2C0D A;  2IFQ A;  1DE2 A;  2AV4 A;  2EIR A;  4ZL8 A;  4EDY A;  3H8Q A;  3V1W A;  5E4W A;  2CQ9 A;  3M8N A;  1BAY A;  1PD2 1;  3P8W A;  5IMD A;  3M1G A;  3H93 A;  5ECL B;  4L0U A;  4YQV A;  1XBS A;  3QAW A;  1FG4 A;  4AJ7 A;  4F0B A;  2DKH A;  2WFC A;  2BMX A;  1XWG A;  4J2F A;  1O81 A;  2GDR A;  2CVK A;  1ZMA A;  5HR2 A;  1B9X C;  3BD2 A;  4ISD A;  1PX7 A;  4OCE A;  2KP1 A;  4JRR A;  4E8E A;  1CQH A;  4V2L A;  4TXV A;  1R5A A;  3C73 A;  1UVZ A;  4ECC A;  1EOH A;  1PGT A;  4JED A;  3CSI A;  3KMN A;  3GKK A;  1O73 A;  2YPM A;  4IBP A;  5IIZ A;  1MDK A;  2YZH A;  4RUV A;  2WRT A;  1SL0 B;  1GSU A;  2KOK A;  3Q74 A;  3MYD A;  4GWR A;  1HNA A;  4ZBA A;  5ECI B;  1QGV A;  2MMO A;  3R2Q A;  4HQZ A;  1S3A A;  2H1B A;  1QUW A;  4MZW A;  3KMO A;  2VO4 A;  4WBJ A;  3WT1 A;  3QFA C;  2H75 A;  2I81 A;  1U6T A;  1V58 A;  3TRX A;  5AIX A;  2HRA A;  2V2G A;  4N30 A;  1ZYN A;  3CRU A;  1TP9 A;  3ISO A;  3ZZX A;  3KH9 A;  1XWK A;  3A5W A;  4JE1 A;  6GSX A;  4EE0 A;  2AHE A;  3HXS A;  4KSM A;  4V2N A;  2IN3 A;  3MIX A;  4MJE A;  1DE1 A;  2PWJ A;  3H79 A;  1TK5 B;  5COH A;  3IC8 A;  3S9F A;  4FO5 A;  4KW6 A;  3ZRE A;  1M3I A;  4NXI A;  1X9M B;  2L57 A;  3IR4 A;  4OFM A;  1X9W B;  2BTO T;  2M80 A;  4EXJ A;  2H6Y A;  4I8B A;  4OFT A;  1EP8 A;  3BCK A;  3C1R A;  2H1A A;  2CAI A;  5J3R A;  3F8U A;  3CTG A;  2EIQ A;  2DIZ A;  1ERW A;  2GS3 A;  3O6T A;  3D6I A;  1J9B A;  5GAN D;  5FWG A;  1R7H A;  1ERV A;  3VI5 A;  3KCM A;  20GS A;  1ST9 A;  2C4J A;  1OVN A;  3HHV A;  1F6M C;  5GSS A;  1NSW A;  4NHZ A;  3RHC A;  5EY6 A;  4MK3 A;  2XC2 A;  3CSJ A;  4D73 B;  1VF2 A;  5CRW A;  3EUR A;  4ML1 A;  2JZT A;  1A8L A;  3FR6 A;  5CP1 A;  3WT2 A;  3GX0 A;  3KIJ A;  4DSQ A;  4WF5 A;  2HSY A;  1EEJ A;  1JLV A;  5B8A A;  3IV4 A;  17GS A;  2IPA A;  3M9K A;  6GSV A;  1TRW A;  5A4W A;  2K6V A;  3VPQ A;  2OJL A;  2OBI A;  4HJM A;  1K0O A;  1FVK A;  5KN1 A;  3RBT A;  2RII A;  3HJP A;  5IO2 A;  3J7Y b;  3TKS E;  4PNG A;  1TRU A;  2CX4 A;  3ERW A;  4YAV A;  4CY8 A;  2X8C A;  2MMN A;  3ZVJ D;  4O5U A;  3QCP A;  5G31 A;  1TK8 B;  2KP2 A;  1GTI A;  1WRY A;  2L4Q A;  5JCU A;  3AY8 A;  6GSS A;  1SJZ A;  1BX9 A;  5DCH A;  3UAR A;  5ID2 B;  3L9V A;  1RK4 A;  3LGC A;  3F0I A;  2H1G A;  3NZN A;  3EC3 A;  3HVX A;  1ERU A;  5G1K A;  4DSS A;  1O85 A;  3ZVJ A;  1UA5 A;  3E9J B;  22GS A;  1OAZ A;  4MF6 A;  1G0T A;  4XRD A;  4ECB A;  4PUF C;  3D4T A;  3DXB A;  2K9F A;  2R0P A;  4RI6 A;  4BVX A;  3L0H A;  2P5R A;  5IMZ A;  4PTS A;  4YKG A;  1XWC A;  1KBN A;  1T1V A;  2LS5 A;  3CYN A;  4HZ4 A;  3HZ8 A;  4YKF A;  3ZIV A;  3F3R A;  2G2Q A;  11GS A;  1AW9 A;  2HRK A;  1HYU A;  4PUR A;  2LKU A;  4IN0 A;  3D0Z A;  1YKA A;  3PPU A;  3NIV A;  1MD4 A;  4WET A;  1M2D A;  4FH8 A;  4IW9 A;  2JAC A;  4I6X A;  1GNW A;  4TXO B;  1MEK A;  1WE0 A;  3EPT A;  3FW2 A;  1XWA A;  2UZ8 A;  1B4P A;  3UL3 A;  2CX3 A;  4KE3 A;  1SKW B;  2B5X A;  1K3L A;  1YZX A;  1G6Y A;  3OR5 A;  2C0E A;  3VLN A;  2JAD A;  3LOR A;  2Z9S A;  3FRC A;  3GV1 A;  1TU8 A;  3TGZ A;  1K0D A;  1OC3 A;  2PUK C;  5ECK B;  1GRX A;  2XBQ A;  2FCH A;  1C72 A;  1PN0 A;  2FWH A;  2K18 A;  3LYP A;  2VL9 A;  3LWA A;  3MNG A;  1NW2 A;  2YN1 A;  14GS A;  5D93 A;  3E0U A;  1OKT A;  4F2I A;  4JR6 A;  3GST A;  5LNK e;  1ZOF A;  4BL7 A;  4RQX A;  2E7P A;  5IMA A;  2VCT A;  4IHU A;  3GTU A;  1YF0 A;  3IAS 2;  4EO3 A;  2J9H A;  3FR9 A;  3KH7 A;  2FLS A;  3BJ5 A;  1WIK A;  2MBT A;  3IPZ A;  4TR1 B;  1XOB A;  4F0C A;  1G7E A;  5JCW A;  1KEB A;  3LEF A;  1FHE A;  4G0K A;  1DUG A;  2HNL A;  5J9B A;  2L6D A;  3ZML A;  5F8B A;  3GNJ A;  4WEY A;  4EF0 A;  3GFK A;  1ZYQ B;  2QGV A;  2A2R A;  4PXO A;  1PKW A;  2DML A;  2MYG A;  1FOH A;  1GSF A;  3O3T A;  2LRC A;  2RM5 A;  1M99 A;  1F37 A;  3LQ7 A;  2O8V B;  3FZA A;  5DDL A;  4K2X A;  3DD3 A;  4OD7 A;  4GQF A;  5CO3 A;  1YEX A;  4G10 A;  4LLR A;  2H72 A;  3TJJ A;  2J23 A;  4Q5Q A;  3KP9 A;  1EOG A;  2K8V A;  1AQW A;  1TRV A;  2MMZ A;  1YJ6 A;  4ZBD A;  2EC4 A;  3A2V A;  5JWR B;  4QQ7 A;  4ZL7 A;  3MDK A;  3F4S A;  4J56 E;  1V2A A;  2GSR A;  3VWW A;  7GSS A;  5H5R A;  2IMD A;  3O76 A;  5IO0 A;  12GS A;  2H8L A;  3GKM A;  1U3I A;  5J9C A;  1WMJ A;  1Z7P A;  4GRF A;  1B9Y C;  2YV7 A;  5FHI A;  2KLX A;  2C3Q A;  1Z9H A;  3ZTL A;  2H19 A;  3IHQ A;  1SEN A;  2BJX A;  3WGD A;  2AYT A;  3TDG A;  4RQR A;  2CT6 A;  1YF1 A;  4GF0 A;  1PSQ A;  2YJ7 A;  3L4N A;  4L5O A;  1ILO A;  4KA0 A;  5DAK A;  2R2J A;  1A8Y A;  3TB2 A;  3D4M A;  4MZB A;  1N8J A;  2R37 A;  1GLQ A;  4K5R A;  6GSU A;  3FKF A;  2JL4 A;  3GHA A;  4Z7X A;  1HQO A;  1GTB A;  1Y6E A;  3GA4 A;  4IKH A;  1A0F A;  4JR4 A;  2YNX A;  4LA1 A;  3KZQ A;  4HOJ A;  2FWE A;  1USB A;  2X8H A;  5KN3 A;  1QQ2 A;  3CQF A;  3LXZ A;  4IJI A;  1EGO A;  3ZL5 A;  1Z6M A;  3UOM A;  5AGY A;  2L5O A;  2HE3 A;  3I9V 2;  5D9V A;  2X4A A;  3ZYW A;  4KSO A;  1O6J A;  2GQK A;  4IQ1 A;  4Q5N A;  5IQY A;  4HZ2 A;  2ON5 A;  5DCG A;  1I5G A;  5IMF A;  1EV9 A;  1GNE A;  3RHB A;  2QA2 A;  3G7Y A;  4MNN A;  5GZZ B;  1THX A;  1PX6 A;  1K0C A;  3C1S A;  5EPF A;  1OC9 A;  4WR4 A;  2HFD A;  1YY7 A;  1M9B A;  1GUL A;  1G7O A;  2AUV A;  3HZ4 A;  4PNF A;  4Z2R A;  2VL2 A;  1PL2 A;  4IEL A;  3FK8 A;  5CRD A;  3TJK A;  1LU4 A;  3DKS A;  4O5R A;  1Z7R A;  5F06 A;  2GSS A;  2V6O A;  1BYE A;  2JU5 A;  4HJ2 A;  2FNO A;  3DEX A;  5DBQ A;  3TKR A;  1T8E B;  1PFO A;  2X49 A;  1B4Q A;  1PMT A;  2RLI A;  4K0G A;  3GRX A;  3ZIJ A;  2YV9 A;  3A2W A;  1TKD B;  1NM3 A;  3LYK A;  2O87 A;  3GMF A;  2HSM A;  2IMI A;  3FY7 A;  1THO A;  1OKD A;  4K7I A;  1E2Y A;  1FW1 A;  1VGL A;  2B3S A;  2F3M A;  2NDO A;  4Q5F A;  3RAZ A;  4KGI A;  4WF4 A;  1A23 A;  3DGQ A;  5CAX A;  1V57 A;  2X64 A;  1HD2 A;  1WP0 A;  2VD0 A;  5ELG A;  3D5J A;  3CRT A;  4K0N A;  4NMU A;  4OFN A;  1QMV A;  1SKS B;  2FWF A;  2IL3 A;  1IYH A;  2HRN A;  2IME A;  2DBC A;  4WXT A;  4MJC A;  2DSA A;  3CTF A;  2CA8 A;  3VPT A;  2G0F A;  1GH2 A;  1M7T A;  3DYR A;  5HFG A;  1MDJ A;  5IOW A;  2F8F A;  2IIY A;  3WGX A;  5HFI A;  3DWV A;  1JZO A;  1JZW A;  3EIN A;  1OE7 A;  3M9J A;  2NBS A;  3IHG A;  4L0W A;  3TJF A;  3KM6 A;  4IP1 A;  3GUS A;  3VWV A;  1AC1 A;  3FZ4 A;  5KN0 A;  2OAC A;  3LXT A;  3FHK A;  3CBU A;  4GST A;  1F2E A;  1ZYE A;  1YDK A;  3W8S A;  2HLS A;  4TR4 A;  3UJ1 A;  2I1U A;  3I69 A;  1WPI A;  5CRE A;  2LJK A;  3F3Q A;  1SD9 A;  3W6G A;  1Q98 A;  4ZXG A;  1VRS D;  4ULX A;  2R5G A;  1PN9 A;  3EU3 A;  4PX1 A;  4WBR D;  3F6F A;  5HFK A;  1GP1 A;  4GTU A;  1QFN A;  4GXZ A;  1R4W A;  5ABR A;  5ECP B;  2NPB A;  3SWL A;  5DJL A;  1TW9 A;  4DSS B;  4A5P A;  1JZR A;  2OE0 A;  1A0R P;  4N11 A;  5A4V A;  1SK2 A;  2N5B A;  2VCX A;  1N2A A;  4BVX B;  1A2M A;  4ICY A;  19GS A;  3QAV A;  1XXU A;  3ME7 A;  4HEA 2;  3WD6 A;  1X5E A;  4ID0 A;  1X5D A;  1AAZ A;  5HQP A;  2L6C A;  5A4U A;  1TJD A;  2XPD A;  2WZ9 A;  3HJM A; 
#chains in the Genus database with same CATH homology
 4CW9 A;  1A2L A;  1XW5 A;  2HT9 A;  2HYX A;  3HKR A;  4IS0 A;  3L9S A;  2C0G A;  1UC7 A;  2DJ2 A;  5IPH A;  4O32 A;  2QC7 A;  1Q4J A;  4TVE A;  2PVQ A;  1S3C A;  1MDI A;  3EMP A;  1S3D A;  2L5L A;  3UIW A;  4KAE A;  2MZC A;  4NV5 A;  3PR8 A;  2TIR A;  3R3E A;  1HNB A;  3MSZ A;  1VF4 A;  1GLP A;  4L5L A;  1ZGN A;  4Z2T A;  4GCI A;  3E3E A;  1J08 A;  1T00 A;  5AIS A;  4ZB6 A;  5ECH B;  2OE3 A;  4KDU A;  2VIM A;  4I2U A;  1LBK A;  2EIO A;  1BQ7 A;  5ELA A;  1GSE A;  5G5F A;  4O92 A;  4E8H A;  4IJ3 A;  4IVF A;  2YP6 A;  1GTA A;  2FWG A;  4BL7 B;  2GT5 A;  5HR1 A;  3QDN A;  4I97 A;  3GTU B;  5G5E A;  3UVT A;  1H75 A;  5CYY A;  2E2G A;  2DLX A;  3PIN A;  3C71 A;  3P2A A;  2DJ0 A;  3F4R A;  4F03 A;  5JWQ B;  2VAF A;  3APO A;  2GVP A;  1K3O A;  1JLW A;  4X4J A;  2GQL A;  3MAK A;  4V1A p;  1O7U A;  4IGJ A;  2R0G A;  3F63 A;  2FA4 A;  1AIU A;  5B6M A;  3HYP A;  5D96 A;  1B8X A;  5G1L A;  5CRH A;  1JZD A;  4HDE A;  2VL2 C;  5HR3 A;  2CV4 A;  1RQM A;  5ECR B;  1V40 A;  2DKI A;  4J57 E;  4MJB A;  1U88 A;  2B6M A;  4X43 A;  1K0M A;  3C8E A;  2N5F A;  4DVC A;  3KP8 A;  1FOV A;  3QPM A;  4TN8 A;  3APS A;  2HSH A;  3EVI A;  4KUN A;  4K1F A;  3EWL A;  1MTC A;  2H74 A;  1ZCP A;  2GLR A;  1FB0 A;  3ZLP A;  3U5R E;  5KEJ A;  2MBS A;  3ZRD A;  2ZCT A;  2O85 A;  2M72 A;  2VM2 A;  2LQQ A;  1W4V A;  5LD0 A;  2CAQ A;  2I4A A;  16GS A;  3VWX A;  1Z3E A;  1ML6 A;  2V41 A;  2VLV A;  4X0X A;  1SJ6 A;  4MF5 A;  3A2X A;  2WDU A;  4GSS A;  3D22 A;  2I3Y A;  4JBB A;  1TDI A;  3HVV A;  4WR5 A;  3UVH A;  2C8U A;  9GSS A;  5INY A;  3GIX A;  1SYR A;  1ZYP A;  2H6Z A;  5DAK B;  2GZZ A;  2DJK A;  2LJA A;  3I43 A;  5DAL B;  3GKN A;  4FIW A;  4V1A g;  1GTU A;  4MPG A;  5KOX A;  5D8I A;  3FZ5 A;  4DSR A;  1WWJ A;  2H70 A;  1K0B A;  4HU9 A;  4KF9 A;  2H73 A;  2LJR A;  4XIH A;  3D21 A;  1DBY A;  4H86 A;  5IMC A;  4DEJ A;  5LCZ A;  2PPT A;  4F9Z A;  3TUE A;  4MH3 A;  3GN3 A;  1EP7 A;  4AGS A;  2YAN A;  3GYK A;  3G7I A;  4EDZ A;  3P7X A;  3K8N A;  3F6D A;  3G7J A;  2VL3 A;  4TKY A;  2LRN A;  4EC0 A;  1B48 A;  4G0I A;  2VCQ A;  2F51 A;  8GSS A;  2LEG A;  5AN1 A;  3BCI A;  1NHY A;  4POK A;  4P3Y B;  4LL4 B;  2B1L A;  5GAP D;  5D9X A;  5EVO A;  1T3B A;  1SYX A;  2GQM A;  1YKC A;  3KTB A;  4EKZ A;  2HZF A;  4XS1 A;  1OC9 B;  2H0H A;  3N5O A;  1TI1 A;  3HCZ A;  5DAL A;  4KCE A;  2H1D A;  2PVO C;  4PQ1 A;  2LST A;  2R0C A;  2GZY A;  2CVD A;  3GL5 A;  2XBI A;  1A24 A;  4KB3 A;  4LL1 B;  4NHW A;  2PN8 A;  1QK8 A;  5DQS A;  2B5Y A;  4TR0 A;  3WGE A;  1SK0 A;  5G2Z A;  2JZS A;  4XS4 A;  5GST A;  4MMM A;  2PU9 C;  3GH9 A;  2ZUP A;  1H4O A;  1TOF A;  3NOF A;  1GSY A;  2V1M A;  3IA1 A;  4MZC A;  4WKW A;  2TRC P;  4MCU A;  3P90 A;  1T4Z A;  4MDC A;  3BOA A;  4K5S A;  4BA7 A;  3FR3 A;  4K6X A;  1I9D A;  1TRS A;  1CQG A;  3VK9 A;  3ZFL A;  2M46 A;  2DJ3 A;  2PBJ A;  3RPP A;  1EEM A;  4MPF A;  5F07 A;  2KHP A;  2L4C A;  4XCS A;  3Q6O A;  1OE8 A;  3FYG A;  3C7M A;  1SL2 B;  3GX8 A;  3IE3 A;  5JCG A;  4FYU A;  4USS A;  5DVB A;  2C1Y A;  4TRX A;  2GT6 A;  1XOA A;  3JCM L;  3VFI A;  2PER A;  2VD1 A;  2D2Z A;  2YWM A;  4KDX A;  2OE1 A;  3IK7 A;  3EYT A;  2C0F A;  2QA1 A;  2DJ1 A;  1X9S B;  5ECQ B;  4EVM A;  1XPV A;  1YQ1 A;  4NPB A;  4K8M A;  4O7H A;  1ACV A;  2LV3 A;  3EMX A;  2K8S A;  1BJX A;  4PQH A;  1PQN A;  3FMW A;  4OCF A;  1Z6N A;  5H5S A;  4TR3 A;  2I9H A;  1EZK A;  2XPE A;  4LMV A;  4KH7 A;  1FB6 A;  2YOI A;  1O8W A;  3TJG A;  1JHB A;  2OA7 A;  2YWO A;  1ERT A;  4K2D A;  3APQ A;  1UN2 A;  3F9U A;  4CDO A;  4QL9 A;  5CNW A;  1GUM A;  4Q5R A;  2R6K A;  18GS A;  2ZNM A;  2VLT A;  4ILF A;  4ZIL A;  1SK1 A;  2B7J A;  2YZU A;  2NVL A;  3FZ9 A;  1TI3 A;  1T4Y A;  1XVW A;  4POM A;  4AJ8 A;  4MA9 A;  4HUA A;  5KN2 A;  1TU7 A;  1G6W A;  2YWI A;  1OC8 A;  2DC5 A;  2IWT A;  3QOU A;  2P0G A;  3CMI A;  3TKP A;  2FGX A;  5ECM B;  2C3T A;  3LW9 A;  3LSZ A;  3DIE A;  3GH6 A;  1YEP A;  3M0F A;  4F82 A;  4TW5 A;  3IRA A;  4YQM A;  2FY6 A;  4PUA A;  2VM1 A;  2LNS A;  2YWN A;  5IMV A;  3EE2 A;  4NV2 A;  3L78 A;  1M2A A;  3HA9 A;  1FVJ A;  1RW1 A;  5BRT A;  2B5E A;  1K3Y A;  4KX4 A;  4MP4 A;  2QKE A;  1FO5 A;  1U87 A;  2V6K A;  3ED3 A;  1U3A A;  3TKS A;  1XFL A;  2FD3 A;  2HXK A;  5ENU A;  3M3M A;  1SJI A;  2VCW A;  4NAX A;  2B1K A;  3KXO A;  1JFU A;  3KEB A;  3QFB C;  5J5N A;  4MH2 A;  1XZO A;  3PGT A;  2FA8 A;  5G30 A;  3MWH A;  3ZMK A;  3LFL A;  2WUL A;  4JZQ A;  1Y25 A;  2X99 A;  1TTZ A;  1URM A;  4X1U A;  1OYJ A;  3IAM 2;  3IBH A;  1WOU A;  4OO4 A;  2VCZ A;  3TRP A;  5L71 A;  3UBK A;  2MMA A;  2LUS A;  2WS2 A;  1BED A;  1WJK A;  2FHE A;  3UEM A;  4FQU A;  3UBL A;  1PL1 A;  3A5I A;  2LQO A;  5F05 A;  1KNG A;  5KOW A;  5C00 A;  2WCI A;  2V32 A;  13GS A;  4G9H A;  2VUP A;  5D9W A;  1GSQ A;  2ON7 A;  1R26 A;  1J0F A;  2IMK A;  1XW9 A;  2P5Q A;  3RPN A;  5J4U A;  2E0Q A;  2H71 A;  2R3X A;  2B7K A;  1GSD A;  1R5P A;  2YCD A;  2X8G A;  3CXG A;  2QSI A;  3IDV A;  2H0G A;  2LRT A;  3Q19 A;  3GKX A;  1F9M A;  2GZP A;  2CZ3 A;  4LMW A;  4TOP A;  1DSB A;  1K0N A;  2PGT A;  4ZL9 A;  4Z2U A;  2IJY A;  1AQX A;  4D73 A;  4QL7 A;  2F9S A;  2A4H A;  3IK9 A;  1W89 A;  5B7C A;  6GST A;  1PKZ A;  3KJY A;  2GSQ A;  4ECI A;  5ECN B;  3QAG A;  4HQS A;  2C3N A;  3DVW A;  1Z5Y E;  3H4K A;  4ACS A;  3G9B A;  4HS1 A;  1XVQ A;  2H76 A;  3Q18 A;  1NHO A;  1ZL9 A;  3VWU A;  3US3 A;  3TJB A;  2VCV A;  5JWO B;  4G19 A;  3VUR A;  3U6V A;  3GSS A;  3N9J A;  3SBC A;  4ECJ A;  1QXH A;  3QR6 A;  2LNT A;  2E2M A;  3HDC A;  5IM9 A;  3UAP A;  4MJA A;  3FEU A;  1AXD A;  2OAD A;  4MLY A;  4K7O A;  3ME8 A;  4EUY A;  5EL8 A;  6GSW A;  3KGK A;  2RUF A;  3HJO A;  4NWY A;  1F3B A;  2REM A;  1EWX A;  2NTO A;  2AB6 A;  2IMF A;  4MAB A;  2R4V A;  1AQV A;  4RI7 A;  2JSZ A;  5ID2 A;  1MD3 A;  4I2T A;  3IOS A;  2XHF A;  4O5Q A;  2TRX A;  4K7N A;  1V98 A;  1HNC A;  3IC4 A;  2GTU A;  3F4T A;  2JZR A;  2WGR A;  5J41 A;  4ZIJ A;  2HRF A;  3WYW A;  2N5A A;  5AIV A;  5BMU A;  2GGT A;  1EGR A;  3HVS A;  1M2B A;  4N10 A;  2H0I A;  3ZFB A;  4OMV A;  1X0R A;  4ZB8 A;  2CZ2 A;  1ABA A;  2O7K A;  2O89 A;  3KTL A;  4KCA A;  1GWC A;  2ALB A;  1GUH A;  3GUR A;  1K0A A;  1ZZY A;  2WJU A;  4MF7 A;  4PQI A;  1SU9 A;  2H30 A;  4JU5 A;  1F3A A;  1A2J A;  2HI7 A;  2F8A A;  2RUE A;  1FAA A;  1E6B A;  3HY2 A;  2L59 A;  5H5Q A;  4N0V A;  4ZBB A;  4XHM A;  3RDW A;  3LG6 A;  4TXO A;  4ZB9 A;  3DML A;  1M9A A;  4V2M A;  3TKQ A;  2VOC A;  3A3T A;  5A5K A;  3TCO A;  1T7P B;  1TXX A;  3L9U A;  1XCC A;  4HI7 A;  1KTE A;  2C80 A;  4GQC A;  2GST A;  5CRG A;  3I6A A;  5DQY A;  5C04 A;  5IPG A;  4GLT A;  4K9Z A;  4L8E A;  2VLU A;  2H6X A;  3TOU A;  4BPY A;  1TK0 B;  5ECO B;  4XS6 A;  4YAP A;  3GL3 A;  5DJM A;  4IP6 A;  2H01 A;  3H1N A;  2ES7 A;  10GS A;  1PRX A;  2JSY A;  2YJH A;  2FUG 2;  1X5C A;  4AJ6 A;  5D73 A;  3VI7 A;  3LJR A;  4XS4 B;  3KD0 A;  4ML6 A;  3ERF A;  2OBK A;  1EV4 A;  4CHS A;  4POL A;  1XIY A;  3EU4 A;  3BBY A;  1XWB A;  4YQU A;  1V9W A;  4FYC A;  5D9T A;  4BVY B;  5E59 A;  4OO5 A;  1SD8 A;  2AJQ B;  4BWS A;  4TR1 A;  3HD5 A;  2CVB A;  2A4V A;  4AF2 A;  3J7Y k;  1VF1 A;  2A2S A;  2WB9 A;  4BWQ A;  1GL8 A;  4G0L A;  1SL1 B;  5FT3 A;  4IQA A;  3TKS C;  3ZIT A;  3DVX A;  6GSY A;  4I5Q A;  1PA3 A;  4XRA A;  4KND A;  2HZE B;  1GUK A;  3TOT A;  3UMA A;  2OKA A;  5F0G A;  2DJJ A;  2DMM A;  2IFQ B;  5ECS A;  3QD9 A;  4G2E A;  5HR0 A;  3TRQ A;  4EL1 A;  1M0U A;  5IOX A;  1AUC A;  4FYB A;  4HU7 A;  1XW6 A;  1IYI A;  1BG5 A;  4GSN A;  2RM6 A;  2H66 A;  1LJR A;  4YH2 A;  5B8B A;  3QMX A;  2P31 A;  4PGT A;  1SKR B;  4EIP A;  1ON4 A;  3W8J A;  3ERG A;  4BVY A;  5B6N A;  4POB A;  2PMT A;  1GSS A;  2AAW A;  2DIY A;  3PH9 A;  1O8X A;  2A2P A;  4CY6 A;  4OWY A;  4KDY A;  3DRN A;  1VF3 A;  3CSH A;  2KUC A;  3IXR A;  2HZE A;  4XTS A;  4EIQ A;  4N0Z A;  2LTK A;  2C0D A;  2IFQ A;  1DE2 A;  2AV4 A;  2EIR A;  4ZL8 A;  4EDY A;  3H8Q A;  3V1W A;  5E4W A;  2CQ9 A;  3M8N A;  1BAY A;  1PD2 1;  3P8W A;  5IMD A;  3M1G A;  3H93 A;  5ECL B;  4L0U A;  4YQV A;  1XBS A;  3QAW A;  1FG4 A;  4AJ7 A;  4F0B A;  2DKH A;  2WFC A;  2BMX A;  1XWG A;  4J2F A;  1O81 A;  2GDR A;  2CVK A;  1ZMA A;  5HR2 A;  1B9X C;  3BD2 A;  4ISD A;  1PX7 A;  4OCE A;  2KP1 A;  4JRR A;  4E8E A;  1CQH A;  4V2L A;  4TXV A;  1R5A A;  3C73 A;  1UVZ A;  4ECC A;  1EOH A;  1PGT A;  4JED A;  3CSI A;  3KMN A;  3GKK A;  1O73 A;  2YPM A;  4IBP A;  5IIZ A;  1MDK A;  2YZH A;  4RUV A;  2WRT A;  1SL0 B;  1GSU A;  2KOK A;  3Q74 A;  3MYD A;  4GWR A;  1HNA A;  4ZBA A;  5ECI B;  1QGV A;  2MMO A;  3R2Q A;  4HQZ A;  1S3A A;  2H1B A;  1QUW A;  4MZW A;  3KMO A;  2VO4 A;  4WBJ A;  3WT1 A;  3QFA C;  2H75 A;  2I81 A;  1U6T A;  1V58 A;  3TRX A;  5AIX A;  2HRA A;  2V2G A;  4N30 A;  1ZYN A;  3CRU A;  1TP9 A;  3ISO A;  3ZZX A;  3KH9 A;  1XWK A;  3A5W A;  4JE1 A;  6GSX A;  4EE0 A;  2AHE A;  3HXS A;  4KSM A;  4V2N A;  2IN3 A;  3MIX A;  4MJE A;  1DE1 A;  2PWJ A;  3H79 A;  1TK5 B;  5COH A;  3IC8 A;  3S9F A;  4FO5 A;  4KW6 A;  3ZRE A;  4NXI A;  1X9M B;  2L57 A;  3IR4 A;  4OFM A;  1X9W B;  2BTO T;  2M80 A;  4EXJ A;  2H6Y A;  4I8B A;  4OFT A;  1EP8 A;  3BCK A;  3C1R A;  2H1A A;  2CAI A;  5J3R A;  3F8U A;  3CTG A;  2EIQ A;  2DIZ A;  1ERW A;  2GS3 A;  3O6T A;  3D6I A;  1J9B A;  5GAN D;  5FWG A;  1R7H A;  1ERV A;  3VI5 A;  3KCM A;  20GS A;  1ST9 A;  2C4J A;  1OVN A;  3HHV A;  1F6M C;  5GSS A;  1NSW A;  4NHZ A;  3RHC A;  5EY6 A;  4MK3 A;  2XC2 A;  3CSJ A;  4D73 B;  1VF2 A;  5CRW A;  3EUR A;  4ML1 A;  2JZT A;  1A8L A;  3FR6 A;  5CP1 A;  3WT2 A;  3GX0 A;  3KIJ A;  4DSQ A;  4WF5 A;  2HSY A;  1EEJ A;  1JLV A;  5B8A A;  3IV4 A;  17GS A;  2IPA A;  3M9K A;  6GSV A;  1TRW A;  5A4W A;  2K6V A;  3VPQ A;  2OJL A;  2OBI A;  4HJM A;  1K0O A;  1FVK A;  5KN1 A;  3RBT A;  2RII A;  3HJP A;  5IO2 A;  3J7Y b;  3TKS E;  4PNG A;  1TRU A;  2CX4 A;  3ERW A;  4YAV A;  4CY8 A;  2X8C A;  2MMN A;  3ZVJ D;  4O5U A;  3QCP A;  5G31 A;  1TK8 B;  2KP2 A;  1GTI A;  1WRY A;  2L4Q A;  5JCU A;  3AY8 A;  6GSS A;  1SJZ A;  1BX9 A;  5DCH A;  3UAR A;  5ID2 B;  3L9V A;  1RK4 A;  3LGC A;  3F0I A;  2H1G A;  3NZN A;  3EC3 A;  3HVX A;  1ERU A;  5G1K A;  4DSS A;  1O85 A;  3ZVJ A;  1UA5 A;  3E9J B;  22GS A;  1OAZ A;  4MF6 A;  1G0T A;  4XRD A;  4ECB A;  4PUF C;  3D4T A;  3DXB A;  2K9F A;  2R0P A;  4RI6 A;  4BVX A;  3L0H A;  2P5R A;  5IMZ A;  4PTS A;  4YKG A;  1XWC A;  1KBN A;  1T1V A;  2LS5 A;  3CYN A;  4HZ4 A;  3HZ8 A;  4YKF A;  3ZIV A;  3F3R A;  2G2Q A;  11GS A;  1AW9 A;  2HRK A;  1HYU A;  4PUR A;  2LKU A;  4IN0 A;  3D0Z A;  1YKA A;  3PPU A;  3NIV A;  1MD4 A;  4WET A;  1M2D A;  4FH8 A;  4IW9 A;  2JAC A;  4I6X A;  1GNW A;  4TXO B;  1MEK A;  1WE0 A;  3EPT A;  3FW2 A;  1XWA A;  2UZ8 A;  1B4P A;  3UL3 A;  2CX3 A;  4KE3 A;  1SKW B;  2B5X A;  1K3L A;  1YZX A;  1G6Y A;  3OR5 A;  2C0E A;  3VLN A;  2JAD A;  3LOR A;  2Z9S A;  3FRC A;  3GV1 A;  1TU8 A;  3TGZ A;  1K0D A;  1OC3 A;  2PUK C;  5ECK B;  1GRX A;  2XBQ A;  2FCH A;  1C72 A;  1PN0 A;  2FWH A;  2K18 A;  3LYP A;  2VL9 A;  3LWA A;  3MNG A;  1NW2 A;  2YN1 A;  14GS A;  5D93 A;  3E0U A;  1OKT A;  4F2I A;  4JR6 A;  3GST A;  5LNK e;  1ZOF A;  4BL7 A;  4RQX A;  2E7P A;  5IMA A;  2VCT A;  4IHU A;  3GTU A;  1YF0 A;  3IAS 2;  4EO3 A;  2J9H A;  3FR9 A;  3KH7 A;  2FLS A;  3BJ5 A;  1WIK A;  2MBT A;  3IPZ A;  4TR1 B;  1XOB A;  4F0C A;  1G7E A;  5JCW A;  1KEB A;  3LEF A;  1FHE A;  4G0K A;  1DUG A;  2HNL A;  5J9B A;  2L6D A;  3ZML A;  5F8B A;  3GNJ A;  4WEY A;  4EF0 A;  3GFK A;  1ZYQ B;  2QGV A;  2A2R A;  4PXO A;  1PKW A;  2DML A;  2MYG A;  1FOH A;  1GSF A;  3O3T A;  2LRC A;  2RM5 A;  1M99 A;  1F37 A;  3LQ7 A;  2O8V B;  3FZA A;  5DDL A;  4K2X A;  3DD3 A;  4OD7 A;  4GQF A;  5CO3 A;  1YEX A;  4G10 A;  4LLR A;  2H72 A;  3TJJ A;  2J23 A;  4Q5Q A;  3KP9 A;  1EOG A;  2K8V A;  1AQW A;  1TRV A;  2MMZ A;  1YJ6 A;  4ZBD A;  2EC4 A;  3A2V A;  5JWR B;  4QQ7 A;  4ZL7 A;  3MDK A;  3F4S A;  4J56 E;  1V2A A;  2GSR A;  3VWW A;  7GSS A;  5H5R A;  2IMD A;  3O76 A;  5IO0 A;  12GS A;  2H8L A;  3GKM A;  1U3I A;  5J9C A;  1WMJ A;  1Z7P A;  4GRF A;  1B9Y C;  2YV7 A;  5FHI A;  2KLX A;  2C3Q A;  1Z9H A;  3ZTL A;  2H19 A;  3IHQ A;  1SEN A;  2BJX A;  3WGD A;  2AYT A;  3TDG A;  4RQR A;  2CT6 A;  1YF1 A;  4GF0 A;  1PSQ A;  2YJ7 A;  3L4N A;  4L5O A;  1ILO A;  4KA0 A;  5DAK A;  2R2J A;  1A8Y A;  3TB2 A;  3D4M A;  4MZB A;  1N8J A;  2R37 A;  1GLQ A;  4K5R A;  6GSU A;  3FKF A;  2JL4 A;  3GHA A;  4Z7X A;  1HQO A;  1GTB A;  1Y6E A;  3GA4 A;  4IKH A;  1A0F A;  4JR4 A;  2YNX A;  4LA1 A;  3KZQ A;  4HOJ A;  2FWE A;  1USB A;  2X8H A;  5KN3 A;  1QQ2 A;  3LXZ A;  4IJI A;  1EGO A;  3ZL5 A;  1Z6M A;  3UOM A;  5AGY A;  2L5O A;  2HE3 A;  3I9V 2;  5D9V A;  2X4A A;  3ZYW A;  4KSO A;  1O6J A;  2GQK A;  4IQ1 A;  4Q5N A;  5IQY A;  4HZ2 A;  2ON5 A;  5DCG A;  1I5G A;  5IMF A;  1EV9 A;  1GNE A;  3RHB A;  2QA2 A;  3G7Y A;  4MNN A;  5GZZ B;  1THX A;  1PX6 A;  1K0C A;  3C1S A;  5EPF A;  1OC9 A;  4WR4 A;  2HFD A;  1YY7 A;  1M9B A;  1GUL A;  1G7O A;  2AUV A;  3HZ4 A;  4PNF A;  4Z2R A;  2VL2 A;  1PL2 A;  4IEL A;  3FK8 A;  5CRD A;  3TJK A;  1LU4 A;  3DKS A;  4O5R A;  1Z7R A;  5F06 A;  2GSS A;  2V6O A;  1BYE A;  2JU5 A;  4HJ2 A;  2FNO A;  3DEX A;  5DBQ A;  3TKR A;  1T8E B;  2X49 A;  1B4Q A;  1PMT A;  2RLI A;  4K0G A;  3GRX A;  3ZIJ A;  2YV9 A;  3A2W A;  1TKD B;  1NM3 A;  3LYK A;  2O87 A;  3GMF A;  2HSM A;  2IMI A;  3FY7 A;  1THO A;  1OKD A;  4K7I A;  1E2Y A;  1FW1 A;  1VGL A;  2B3S A;  2F3M A;  2NDO A;  4Q5F A;  3RAZ A;  4KGI A;  4WF4 A;  1A23 A;  3DGQ A;  5CAX A;  1V57 A;  2X64 A;  1HD2 A;  1WP0 A;  2VD0 A;  5ELG A;  3D5J A;  3CRT A;  4K0N A;  4NMU A;  4OFN A;  1QMV A;  1SKS B;  2FWF A;  2IL3 A;  1IYH A;  2HRN A;  2IME A;  2DBC A;  4WXT A;  4MJC A;  2DSA A;  3CTF A;  2CA8 A;  3VPT A;  2G0F A;  1GH2 A;  1M7T A;  3DYR A;  5HFG A;  1MDJ A;  5IOW A;  2F8F A;  2IIY A;  3WGX A;  5HFI A;  3DWV A;  1JZO A;  1JZW A;  3EIN A;  1OE7 A;  3M9J A;  2NBS A;  3IHG A;  4L0W A;  3TJF A;  3KM6 A;  4IP1 A;  3GUS A;  3VWV A;  1AC1 A;  3FZ4 A;  5KN0 A;  2OAC A;  3LXT A;  3FHK A;  3CBU A;  4GST A;  1F2E A;  1ZYE A;  1YDK A;  3W8S A;  2HLS A;  4TR4 A;  3UJ1 A;  2I1U A;  3I69 A;  1WPI A;  5CRE A;  2LJK A;  3F3Q A;  1SD9 A;  3W6G A;  1Q98 A;  4ZXG A;  1VRS D;  4ULX A;  2R5G A;  1PN9 A;  3EU3 A;  4PX1 A;  4WBR D;  3F6F A;  5HFK A;  1GP1 A;  4GTU A;  1QFN A;  4GXZ A;  1R4W A;  5ABR A;  5ECP B;  2NPB A;  3SWL A;  5DJL A;  1TW9 A;  4DSS B;  4A5P A;  1JZR A;  2OE0 A;  1A0R P;  4N11 A;  5A4V A;  1SK2 A;  2N5B A;  2VCX A;  1N2A A;  4BVX B;  1A2M A;  4ICY A;  19GS A;  3QAV A;  1XXU A;  3ME7 A;  4HEA 2;  3WD6 A;  1X5E A;  4ID0 A;  1X5D A;  1AAZ A;  5HQP A;  2L6C A;  5A4U A;  1TJD A;  2XPD A;  2WZ9 A;  3HJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...