2FD3A

Crystal structure of thioredoxin mutant p34h
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
108
structure length
108
Chain Sequence
SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGHCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Thioredoxin 1
publication title Crystal Structure of Thioredoxin Mutant P34H
rcsb
source organism Escherichia coli
total genus 30
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2fd3A00
3I69A 1F3AA 3GNJA 2I81A 2IIYA 2GSQA 1WWJA 2DJ3A 3UVTA 2PMTA 5IOXA 4HEA2 1GTIA 3I9V2 1EV4A 1OYJA 1TKDB 3WGEA 5IM9A 5CRGA 3FRCA 2MMOA 4KH7A 3RAZA 3M3MA 1GSSA 2WDUA 1OC8A 4V1Ap 3HZ8A 4EF0A 3ERGA 1GNEA 2B3SA 5D9XA 3BBYA 3ZLPA 1XW5A 2NPBA 2XPEA 5DQYA 2YJHA 3DD3A 2I1UA 2WJUA 3ZREA 4NHWA 1U88A 2CAQA 13GSA 2LRNA 4KSMA 3VWVA 1JFUA 2VM1A 1F9MA 2H75A 4G10A 3DMLA 2GZZA 1EP7A 5ECHB 3EMPA 3DGQA 4XS4B 1ERWA 3ERFA 5CO3A 1SK2A 2QSIA 2K18A 3ZMKA 3IA1A 2REMA 1GNWA 3C8EA 1SYXA 3QAGA 5D96A 1U6TA 2H1DA 1OC3A 1WP0A 3D6IA 1SENA 3BD2A 3WGXA 4HQSA 1GULA 1TRWA 4EE0A 2CT6A 4EO3A 4TR4A 4RQRA 1R4WA 2CX4A 2GDRA 3SWLA 3J7Yb 3W8JA 4K7OA 5CREA 3FZ4A 1TK0B 3N9JA 1NHYA 5CAXA 3A2VA 3ERWA 2I4AA 4TR1A 4NXIA 1BX9A 1YEPA 3M8NA 3D4MA 2AJQB 1I9DA 1O85A 3A3TA 3P7XA 3TGZA 2HXKA 4K7IA 4HJ2A 3TOUA 1M9BA 3EURA 4NHZA 1UN2A 4JR4A 4MK3A 1WPIA 4N11A 1TP9A 3QFAC 1B4QA 5JCGA 19GSA 1XVWA 1YF0A 5DALB 3H93A 3HA9A 3P90A 5E4WA 4MZWA 2VL2C 1PKZA 4X1UA 4KSOA 1A0FA 1CQGA 1PX7A 4NPBA 4ID0A 3E9JB 2HSYA 1X0RA 3LSZA 2LV3A 5IIZA 4N30A 3TRXA 2GLRA 5DVBA 1GTBA 1ZCPA 2VCXA 2C3TA 4ZBBA 3CMIA 1K3LA 4ECCA 3EMXA 1GSEA 1FG4A 5JWRB 1EWXA 5DQSA 2LEGA 4GF0A 5ECIB 1M2BA 17GSA 3QOUA 2DBCA 2C3NA 2FUG2 1SKRB 1R5PA 1EEMA 1GSQA 5D8IA 1GSDA 1YEXA 1BYEA 4TVEA 4MLYA 1MD3A 3SBCA 2YN1A 4IN0A 2PGTA 2K9FA 1XCCA 1FO5A 1SYRA 3TJFA 2KHPA 3PINA 4HU7A 3MDKA 5KN1A 5A4WA 4JEDA 1G7EA 6GSXA 2GSSA 1V57A 4TR1B 4MF5A 4AGSA 3VPQA 3GH6A 1GUKA 5KN3A 2ON7A 3HY2A 1Z5YE 3GKXA 3UMAA 1ST9A 2B1KA 2I9HA 4JBBA 3RPNA 1SK0A 1YDKA 2GGTA 3I6AA 2H71A 5GSTA 14GSA 5ECQB 1T4ZA 4PGTA 1ZOFA 4L8EA 2CZ2A 1M0UA 2H8LA 2R4VA 3ME7A 2L5LA 3Q6OA 4FYCA 4JR6A 2N5BA 4PNGA 4YAPA 3R2QA 5B6NA 4GXZA 1JZOA 4BPYA 1ZZYA 2Z9SA 3Q19A 3UJ1A 4KAEA 3GSTA 22GSA 4LMVA 2J9HA 4XRAA 2OJLA 1DSBA 4HOJA 5A4VA 4IS0A 2O89A 1GP1A 2XC2A 2JZTA 2VL2A 2C80A 5ECSA 5F8BA 5L71A 3F4TA 2VCVA 4XCSA 3IOSA 2DIZA 4GQFA 2YZUA 2FWGA 3GTUA 5CRDA 4ZXGA 4FYBA 2HE3A 2LRCA 2FY6A 4WBJA 3F6FA 2WCIA 5DAKB 4I5QA 2FNOA 5H5RA 3KH7A 2C0GA 5J5NA 2EIQA 1PQNA 4KUNA 1Z6MA 1EZKA 3FR6A 3TKPA 3GUSA 2MMZA 1AQWA 4K1FA 3CYNA 2X8HA 3QFBC 2HT9A 2H01A 4POLA 4F0CA 2JSZA 1K0OA 2BMXA 4L0WA 2M46A 4HZ4A 5D73A 6GSVA 1JHBA 1N2AA 4YAVA 5CRHA 2QC7A 1EGRA 1OKDA 5KN0A 2K8SA 3J7Yk 1XWKA 1GWCA 1GSYA 2FWEA 2TIRA 5ENUA 5ELAA 3TDGA 2YWNA 4OO4A 4G2EA 4G19A 4I2TA 1X5EA 2NBSA 3GKMA 4TOPA 2YWIA 1ZYEA 4K2DA 5F06A 2FWFA 1KEBA 4XRDA 3G7JA 1XOAA 2LNTA 12GSA 3TKSC 2LJAA 1OAZA 3LJRA 3MNGA 3LGCA 2N5FA 4ZB9A 2LSTA 3MWHA 4GWRA 4E8HA 1A2LA 6GSTA 4QL9A 1THXA 1Z7PA 3C1SA 1HNAA 3UAPA 1I5GA 1A8LA 5CRWA 5ECKB 1PD21 3GX8A 3CRUA 1JZWA 3UOMA 1B8XA 4JE1A 3TCOA 2R2JA 3HXSA 1A23A 2CAIA 4I97A 1O7UA 3EE2A 4HS1A 4RI7A 1DBYA 3CSHA 2O7KA 3HVVA 2FWHA 4XTSA 4DVCA 2TRCP 2F9SA 2HI7A 3EINA 5AN1A 4PNFA 1R5AA 3ZVJA 4BWQA 3LFLA 3IV4A 3DIEA 5IO0A 3S9FA 1E2YA 4MZCA 2A4VA 2H6XA 3KP8A 3RHCA 4PXOA 3KEBA 2GS3A 4ML6A 5GAND 2I3YA 2VCTA 2O87A 4P3YB 1XZOA 4HJMA 3E0UA 4JZQA 2OBIA 1TK8B 4ISDA 2P5RA 5AISA 3UVHA 1FAAA 2AUVA 1Q98A 1SL0B 1K0CA 2PERA 2WRTA 4O7HA 1HYUA 3CBUA 3M9JA 2FLSA 4CDOA 2DMMA 2FD3A 3D21A 1OKTA 1AC1A 4RQXA 3GL5A 1Q4JA 5CYYA 2L4QA 5C04A 1J9BA 3GRXA 5B7CA 5JCUA 2GTUA 3M9KA 2H1GA 1GLPA 5AGYA 1B4PA 3V1WA 2QGVA 5H5SA 4BL7A 3H8QA 2H66A 4KCEA 4DSSB 3DWVA 3CRTA 1XW9A 3VI7A 2GT5A 5DDLA 4AJ8A 1T4YA 2F8AA 1BJXA 2OA7A 2B5YA 3WYWA 3NZNA 5ELGA 10GSA 4K8MA 3HD5A 1H75A 1O8XA 3FZ5A 2H0GA 3EWLA 2JZRA 3TKSA 2IMIA 3KMNA 1PA3A 3KD0A 3KCMA 2R3XA 5FHIA 1MEKA 2H0IA 3FZ9A 2LTKA 3ISOA 4V1Ag 1A24A 3HVSA 2AHEA 2ALBA 4L5OA 4Q5FA 4WR4A 3F4SA 4PQ1A 2E7PA 1JLVA 1F6MC 2VCZA 1X5DA 4LA1A 5IOWA 3G7IA 2CVBA 2LKUA 1X5CA 1XXUA 3LEFA 4MCUA 2IMFA 2LJRA 4F03A 4I2UA 2GQKA 1PGTA 2F51A 2L57A 3G7YA 4DEJA 1NSWA 2YP6A 4GSTA 3IDVA 1SKWB 5H5QA 1YZXA 1A8YA 5A4UA 2OKAA 2A2RA 1ABAA 4TXOB 4KA0A 1GTAA 2L59A 1B9YC 3CSJA 2HRFA 1O73A 5GSSA 1XW6A 2H70A 2C4JA 1PKWA 3WT1A 1MTCA 2DMLA 4OMVA 1WRYA 1FVJA 3VPTA 1ZL9A 3F3QA 4XS6A 5D9VA 3ME8A 1EP8A 4FYUA 2G0FA 1QK8A 2YV9A 4O32A 4MPGA 1O8WA 2IN3A 1G0TA 5LCZA 1T8EB 4OD7A 3WT2A 1OE7A 4I6XA 4JRRA 4IHUA 4KDXA 4Q5QA 1EOHA 4MJAA 3VWXA 2A2SA 3FK8A 1MDIA 2MZCA 3KZQA 4NWYA 1TW9A 5EPFA 2RUFA 3F4RA 4K7NA 3TOTA 3IAM2 3ZYWA 1ZMAA 3KGKA 2DLXA 3IC4A 1T3BA 5DJLA 6GSSA 2CA8A 1VF4A 4IJIA 3O6TA 3EVIA 2VD1A 3GH9A 3IHQA 1XBSA 3EU3A 3BCKA 5HR2A 4MABA 4PQIA 1K0BA 2GZPA 4K6XA 5IPGA 3D0ZA 2IL3A 3TRQA 4EUYA 11GSA 5INYA 3H1NA 3ZVJD 4EC0A 5GZZB 3QAWA 2CVDA 5HFGA 1A2JA 4NAXA 5G31A 5LNKe 4GSSA 4XHMA 5G5FA 2VCWA 2LJKA 1HQOA 2HSHA 4GCIA 7GSSA 4O5RA 1F2EA 2PPTA 2YOIA 5HR0A 2F8FA 3UBLA 1BQ7A 4IVFA 2CV4A 4MJEA 2X99A 3NOFA 4BA7A 1TDIA 2GZYA 2RM6A 4MH2A 4ULXA 3VI5A 4F9ZA 2DJ2A 3TJGA 1ON4A 1AUCA 1Z3EA 1LJRA 3IK7A 4MF6A 5FT3A 3M0FA 6GSWA 2MYGA 1TTZA 4TR0A 2H6ZA 1V98A 4KW6A 1R7HA 1QQ2A 4MH3A 3FY7A 3QDNA 1YKAA 2VOCA 1XPVA 4POKA 2YNXA 1TJDA 1GUHA 3WD6A 4IJ3A 2MMNA 2H0HA 4AF2A 2DC5A 1CQHA 1M2DA 2BTOT 2NDOA 3RBTA 3KJYA 4WF5A 2GVPA 3C71A 1GSUA 4HI7A 1Z9HA 1K0AA 5HQPA 1YQ1A 2XBIA 4V2MA 4HDEA 2FGXA 4ZBDA 3O76A 4HZ2A 3H4KA 1XWGA 4J57E 5IPHA 3GA4A 2L4CA 5DBQA 2OE1A 3LYPA 5DJMA 4XS1A 4ZILA 1J08A 2P31A 4NV5A 2H1BA 1SL1B 1AIUA 1C72A 5JWOB 1YY7A 4F2IA 4ML1A 5EVOA 3ZFLA 3D4TA 2FA4A 4KX4A 1A0RP 3QMXA 2GSTA 3U6VA 1E6BA 2JL4A 1AQXA 2R37A 3TUEA 2H30A 4EVMA 1VRSD 1NW2A 4AJ7A 1BEDA 5IMCA 4H86A 2YPMA 2YJ7A 4E8EA 1JZRA 4LMWA 2XHFA 3BCIA 5J41A 3GN3A 1DE1A 5D9TA 4IP6A 2KP1A 2VL3A 2R6KA 4QL7A 1S3AA 3FEUA 4KNDA 3Q74A 4X43A 1WOUA 3P2AA 3HVXA 3C73A 4NV2A 2IMDA 4BWSA 1ERTA 1SJIA 1YKCA 2NTOA 3ZZXA 4K0NA 3LXTA 3HZ4A 3DVXA 5ABRA 2VO4A 2EIRA 3C1RA 4PX1A 4LLRA 4Q5NA 1J0FA 4ILFA 2YWOA 2RUEA 2B6MA 5FWGA 2VIMA 4DSRA 2KP2A 3KTLA 1S3DA 1N8JA 5ID2A 2PBJA 2H73A 2L6DA 3F63A 3APQA 2WULA 3Q18A 1KNGA 2LS5A 4EXJA 1OE8A 4X0XA 3L9UA 3APSA 2KUCA 1ZYQB 1UA5A 1LBKA 4ECIA 3QD9A 2L6CA 3GL3A 1WE0A 1WIKA 4XIHA 3L0HA 1QUWA 4V2NA 1U87A 1AW9A 3RDWA 3GTUB 4L0UA 3VWWA 4WXTA 1S3CA 3UL3A 3L9SA 4Q5RA 4HU9A 3DEXA 1JLWA 2V41A 1SU9A 4GSNA 4MA9A 3DYRA 1USBA 4IQAA 2AYTA 3E3EA 1T1VA 4ECBA 3NIVA 2PWJA 2RIIA 2X8CA 2ZCTA 3KMOA 4IELA 3OR5A 2LUSA 5F07A 1B9XC 1XOBA 5JWQB 5D9WA 3H79A 3PGTA 1ERUA 4GRFA 3CSIA 2HFDA 3A2XA 5HFIA 1BG5A 1OVNA 4RUVA 2F3MA 2HZEA 3ZIVA 2K6VA 1VF3A 4IP1A 3LWAA 5HFKA 3TB2A 3CXGA 1HNBA 1QGVA 3LXZA 3C7MA 4PUAA 1SKSB 1TU8A 1O6JA 4XS4A 2OE0A 3O3TA 1Y25A 1RW1A 4WBRD 5ID2B 3IRAA 1SD8A 4D73A 1MD4A 3VURA 1K3OA 4OO5A 20GSA 9GSSA 1X9WB 5IMAA 5B8AA 2VAFA 5ECNB 1XWCA 4FO5A 2B5XA 1VF1A 4GLTA 1X9MB 1TI3A 1NM3A 3KM6A 2VLTA 1PRXA 5IO2A 5J9CA 4OCEA 5EL8A 4KB3A 4WEYA 5LD0A 1KBNA 3TKQA 4PUFC 4I8BA 5C00A 1XWAA 4DSQA 1UVZA 1RK4A 3FW2A 2J23A 4JU5A 2YWMA 3KP9A 1AQVA 2HYXA 2JU5A 1X9SB 2KLXA 2X64A 1GH2A 1Z7RA 3PH9A 3DKSA 5F0GA 2M80A 2H6YA 3CTGA 4EDZA 2PVQA 16GSA 2GT6A 5JCWA 3IBHA 4ZB8A 4GQCA 3LORA 4HUAA 1MDJA 3IXRA 3TKRA 2YCDA 5DALA 2PN8A 5IMVA 2HZEB 2V6KA 3LG6A 4L5LA 3P8WA 3D5JA 4Z7XA 4CW9A 1GSFA 4BVXA 2M72A 1GRXA 1VF2A 2E0QA 2VUPA 1DE2A 1TK5B 1ERVA 3GSSA 1TRUA 2OBKA 3F6DA 5ECMB 5ECRB 2HNLA 1DUGA 5G2ZA 2VLVA 4D73B 4RI6A 3PR8A 4FIWA 1QFNA 2YZHA 1GLQA 1NHOA 3IAS2 3UARA 2LRTA 4G9HA 1T7PB 1QXHA 3I43A 3GFKA 4WETA 4MMMA 1TU7A 1H4OA 3ZMLA 4IGJA 4K0GA 1ILOA 1O81A 3L4NA 2HLSA 4MDCA 4MPFA 2GSRA 3EU4A 5IMFA 2KOKA 18GSA 1PN9A 4N0VA 3KH9A 1PMTA 2LNSA 2C3QA 2MBSA 2DIYA 2C1YA 3W6GA 4FH8A 2RLIA 2B7JA 4YQVA 3LQ7A 4ACSA 5DCGA 1T00A 1HNCA 4OFMA 3GX0A 3VWUA 4KDYA 2OACA 2O8VB 2IWTA 5HR3A 1G6YA 2C0FA 2FCHA 2IFQA 4IW9A 3A2WA 2ZUPA 1GL8A 1M99A 2MBTA 5A5KA 4POBA 2VCQA 4MZBA 3HJMA 4MJCA 1PX6A 4WR5A 5DCHA 3HHVA 3FR3A 4V2LA 1K0NA 1Y6EA 2B1LA 3K8NA 1R26A 1GUMA 3TJJA 4TKYA 5F05A 2BJXA 6GSUA 2N5AA 5D93A 4OFTA 3A5WA 2EIOA 5EY6A 3UIWA 4LL4B 2RM5A 2PVOC 2CZ3A 2AB6A 4ZL7A 2JZSA 4AJ6A 2MMAA 3APOA 2WB9A 1F3BA 2DJKA 4OWYA 4LL1B 3G9BA 4TR3A 1URMA 1W4VA 3W8SA 2CQ9A 3FHKA 4QQ7A 4J2FA 3JCML 3ZL5A 3QPMA 2DSAA 2WGRA 3QR6A 2TRXA 5AIXA 5CP1A 3VLNA 1UC7A 5DAKA 2VL9A 3ZIJA 2FA8A 5IMZA 1XIYA 5J4UA 4HQZA 1V9WA 3CTFA 5COHA 1V40A 1AAZA 1K3YA 3L78A 2HRNA 1XWBA 3EC3A 1W89A 1K0DA 5GAPD 3FYGA 6GSYA 2IFQB 1GTUA 4IBPA 1V2AA 1SL2B 3DXBA 2DJ1A 2GQMA 4IKHA 5J9BA 1SJ6A 2ON5A 3QCPA 3ED3A 1HD2A 2H76A 5B8BA 4ZL9A 2GQLA 2XPDA 3ZFBA 1B48A 2P5QA 1FB0A 4MF7A 2C0EA 2WS2A 5B6MA 2HZFA 4OCFA 2X8GA 2CX3A 3EYTA 3U5RE 3HDCA 3ZITA 2L5OA 4F0BA 1MDKA 3FKFA 1QMVA 1PL1A 5AIVA 1EGOA 1M2AA 3F3RA 3GMFA 3L9VA 2QKEA 2YV7A 5G1KA 3QAVA 4KCAA 2H72A 3LYKA 1TRVA 3F9UA 4N0ZA 4ECJA 4O92A 3ZRDA 4YQMA 1M9AA 2V6OA 5E59A 1BAYA 3TJKA 4KGIA 1TI1A 1TOFA 3MAKA 2R5GA 2AAWA 3M1GA 4CHSA 4EKZA 2DJJA 1SD9A 1SK1A 2IJYA 1OC9A 1XFLA 1EV9A 4F82A 1VGLA 2K8VA 3DVWA 3IR4A 2FHEA 4BVYA 2V32A 3TRPA 4PQHA 2LQQA 1RQMA 2ES7A 1AXDA 2OADA 2EC4A 2H1AA 5ECPB 2P0GA 4IQ1A 4POMA 3RHBA 2PUKC 3VFIA 2H74A 4N10A 2B7KA 3IK9A 5HR1A 3WGDA 2VM2A 1F37A 1PSQA 2ZNMA 4KDUA 2WZ9A 3TKSE 1U3AA 3BOAA 5IQYA 4K9ZA 1XVQA 1FW1A 2OE3A 2DJ0A 2JSYA 2VLUA 2V2GA 4TRXA 1EOGA 1KTEA 1ML6A 2WFCA 3VK9A 4EDYA 1TXXA 5CNWA 3ZTLA 3HYPA 3TJBA 3GHAA 4NMUA 3DRNA 3HCZA 1YF1A 4OFNA 2E2MA 2IMKA 1IYIA 2PU9C 5KEJA 3FZAA 1LU4A 2C0DA 4MP4A 4DSSA 1WMJA 3HKRA 3KTBA 2VD0A 3D22A 4ZBAA 4WF4A 4TN8A 1SJZA 5G5EA 3HJOA 1U3IA 4WKWA 3F8UA 5IMDA 1A2MA 3BJ5A 4ZB6A 4J56E 3UBKA 2NVLA 3AY8A 3GKNA 3HJPA 2B5EA 2IMEA 2YANA 5G1LA 1FVKA 1EEJA 4ZL8A 1V58A 1JZDA 4TXVA 3FR9A 3GIXA 3MSZA 3KXOA 2D2ZA 2XBQA 2H19A 1OC9B 3N5OA 1Z6NA 1YJ6A 3UEMA 4YQUA 1PL2A 1IYHA 1THOA 1ZGNA 3IPZA 2O85A 3GURA 1G6WA 3GKKA 2C8UA 1TRSA 1G7OA 3KIJA 3GV1A 5ECOB 1M7TA 3RPPA 2E2GA 5G30A 4MJBA 8GSSA 2JACA 4ZIJA 1FOVA 2IPAA 3F0IA 3GYKA 1ACVA 4YH2A 2AV4A 5J3RA 2LQOA 2CVKA 1K0MA 3IE3A 2G2QA 4PURA 4KE3A 5ECLB 4TW5A 4GTUA 3US3A 1FHEA 2V1MA 1WJKA 5KN2A 2JADA 1FB6A 4EL1A 4TXOA
chains in the Genus database with same CATH superfamily
3I69A 1F3AA 3GNJA 2I81A 2IIYA 2GSQA 1WWJA 2DJ3A 3UVTA 2PMTA 5IOXA 4HEA2 1GTIA 3I9V2 1EV4A 1OYJA 1TKDB 3WGEA 5IM9A 5CRGA 3FRCA 2MMOA 4KH7A 3RAZA 3M3MA 1GSSA 2WDUA 1OC8A 4V1Ap 3HZ8A 4EF0A 3ERGA 1GNEA 2B3SA 5D9XA 4K5RA 3BBYA 3ZLPA 1XW5A 2NPBA 2XPEA 3PPUA 5DQYA 2YJHA 3DD3A 2I1UA 2WJUA 3ZREA 3HVNA 4NHWA 1U88A 2CAQA 13GSA 2LRNA 4KSMA 3VWVA 1JFUA 2VM1A 1F9MA 2H75A 4G10A 3DMLA 2GZZA 1EP7A 5ECHB 3EMPA 3DGQA 4XS4B 5BMUA 1ERWA 3ERFA 5CO3A 1SK2A 2QSIA 2K18A 3ZMKA 3IA1A 2REMA 1GNWA 3C8EA 1SYXA 3QAGA 5D96A 1U6TA 2H1DA 1OC3A 1WP0A 3D6IA 1SENA 3BD2A 3WGXA 4HQSA 1GULA 1TRWA 4EE0A 2CT6A 4EO3A 4TR4A 4RQRA 1R4WA 2CX4A 2GDRA 3SWLA 3J7Yb 3W8JA 4K7OA 5CREA 3FZ4A 1TK0B 3N9JA 1NHYA 5CAXA 3A2VA 3ERWA 2I4AA 4TR1A 4NXIA 1BX9A 1YEPA 3M8NA 3D4MA 2AJQB 1I9DA 1O85A 3A3TA 3P7XA 3TGZA 2HXKA 4K7IA 4HJ2A 3TOUA 2X49A 1M9BA 5KOXA 3EURA 4NHZA 1UN2A 4JR4A 4MK3A 1WPIA 4N11A 1TP9A 3QFAC 1B4QA 5JCGA 19GSA 1XVWA 1YF0A 5DALB 3H93A 3HA9A 3P90A 5E4WA 4MZWA 2VL2C 1PKZA 4X1UA 4KSOA 1A0FA 1CQGA 1PX7A 4NPBA 4ID0A 3E9JB 2HSYA 4BVXB 1X0RA 3LSZA 2LV3A 5IIZA 4N30A 3TRXA 2GLRA 5DVBA 1GTBA 1ZCPA 2VCXA 2C3TA 4ZBBA 4O5QA 3CMIA 1K3LA 4ECCA 3EMXA 1GSEA 1FG4A 5JWRB 1EWXA 5DQSA 2LEGA 4GF0A 5ECIB 4Z2UA 1M2BA 17GSA 3QOUA 2DBCA 2C3NA 2FUG2 1SKRB 1R5PA 1EEMA 1GSQA 5D8IA 1GSDA 1YEXA 1BYEA 4TVEA 4MLYA 1MD3A 3SBCA 2YN1A 4IN0A 2PGTA 2K9FA 1XCCA 1FO5A 1SYRA 3TJFA 2KHPA 3PINA 4HU7A 2UZ8A 3MDKA 5KN1A 5A4WA 4JEDA 1G7EA 6GSXA 2GSSA 1V57A 4TR1B 4MF5A 4AGSA 3VPQA 3GH6A 1GUKA 5KN3A 2ON7A 3HY2A 1Z5YE 3GKXA 3UMAA 1ST9A 2B1KA 2I9HA 4JBBA 3RPNA 1SK0A 1YDKA 2GGTA 3I6AA 2H71A 5GSTA 14GSA 5ECQB 1T4ZA 4PGTA 1ZOFA 4L8EA 2CZ2A 1M0UA 2H8LA 2R4VA 3ME7A 2L5LA 3Q6OA 4FYCA 4O5UA 4JR6A 2N5BA 4PNGA 4YAPA 3R2QA 5B6NA 4A5PA 4GXZA 1JZOA 4BPYA 1ZZYA 2Z9SA 4ICYA 3Q19A 3UJ1A 4KAEA 3GSTA 22GSA 4LMVA 2J9HA 4XRAA 2OJLA 1DSBA 4HOJA 5A4VA 4IS0A 4Z2TA 2O89A 1GP1A 2XC2A 2JZTA 2VL2A 2C80A 5ECSA 5F8BA 5L71A 3F4TA 2VCVA 4XCSA 3IOSA 2DIZA 4GQFA 2YZUA 2FWGA 3GTUA 2QA1A 5CRDA 4ZXGA 4FYBA 2HE3A 2LRCA 2FY6A 4WBJA 3F6FA 4CY6A 2WCIA 5DAKB 4I5QA 2FNOA 5H5RA 3KH7A 2C0GA 5J5NA 2EIQA 1PQNA 4KUNA 1Z6MA 1EZKA 3FR6A 3TKPA 3GUSA 2MMZA 1AQWA 4K1FA 3CYNA 2X8HA 3QFBC 2HT9A 2H01A 4POLA 4F0CA 2JSZA 1K0OA 2BMXA 4L0WA 2M46A 4HZ4A 5D73A 6GSVA 1JHBA 1N2AA 4YAVA 5CRHA 2QC7A 4KF9A 1EGRA 1OKDA 4BIKA 5KN0A 2K8SA 3J7Yk 1XWKA 1GWCA 1GSYA 4G0KA 2FWEA 2TIRA 5ENUA 5ELAA 3TDGA 2YWNA 4OO4A 4G2EA 4G19A 4I2TA 1X5EA 1FOHA 2NBSA 3GKMA 4TOPA 2YWIA 1ZYEA 4K2DA 5F06A 2FWFA 1KEBA 4XRDA 3G7JA 1XOAA 2LNTA 12GSA 3TKSC 2LJAA 1OAZA 3LJRA 3MNGA 3LGCA 2N5FA 4ZB9A 2LSTA 3MWHA 4GWRA 4E8HA 1A2LA 6GSTA 4QL9A 1THXA 1Z7PA 3C1SA 1HNAA 3UAPA 1I5GA 1A8LA 5CRWA 5ECKB 1PD21 3GX8A 3CRUA 1JZWA 3UOMA 1B8XA 4JE1A 3TCOA 2R2JA 3HXSA 1A23A 2CAIA 4I97A 1O7UA 3EE2A 4HS1A 4RI7A 1DBYA 3CSHA 2HRKA 4K5SA 2O7KA 3HVVA 2FWHA 4XTSA 4DVCA 2TRCP 2F9SA 2HI7A 3EINA 5AN1A 4PNFA 1R5AA 3ZVJA 4BWQA 3LFLA 3IV4A 3DIEA 5IO0A 3S9FA 1E2YA 4MZCA 2A4VA 2H6XA 3KP8A 3RHCA 4PXOA 3KEBA 2GS3A 4ML6A 5GAND 2I3YA 2VCTA 2O87A 4P3YB 1XZOA 4HJMA 3E0UA 4JZQA 2OBIA 1TK8B 4G0IA 4ISDA 2P5RA 5AISA 3UVHA 1FAAA 2AUVA 1Q98A 1SL0B 1K0CA 2PERA 2WRTA 4O7HA 1HYUA 3CBUA 3M9JA 2FLSA 4CDOA 2DMMA 2FD3A 4EIPA 3D21A 1OKTA 1AC1A 4RQXA 3GL5A 1Q4JA 5CYYA 2L4QA 5C04A 1J9BA 3GRXA 5B7CA 5JCUA 2GTUA 3M9KA 2H1GA 1GLPA 5AGYA 1B4PA 3V1WA 2QGVA 5H5SA 4BL7A 3H8QA 2H66A 4KCEA 4DSSB 3DWVA 3CRTA 1XW9A 3VI7A 2GT5A 5DDLA 4AJ8A 1T4YA 2F8AA 1BJXA 2OA7A 2B5YA 3WYWA 3NZNA 5ELGA 10GSA 4K8MA 3HD5A 1H75A 1O8XA 3FZ5A 2H0GA 3EWLA 2JZRA 3TKSA 2IMIA 3KMNA 1PA3A 3KD0A 3KCMA 2R3XA 5FHIA 1MEKA 2H0IA 3FZ9A 2LTKA 3ISOA 4V1Ag 1A24A 3HVSA 2AHEA 2ALBA 4L5OA 4Q5FA 4WR4A 3F4SA 4PQ1A 2E7PA 1JLVA 1F6MC 2VCZA 1X5DA 4LA1A 5IOWA 3G7IA 2A4HA 2CVBA 2LKUA 1X5CA 1XXUA 3LEFA 4MCUA 2IMFA 2LJRA 4F03A 4I2UA 2GQKA 1PGTA 2F51A 2L57A 3G7YA 4DEJA 1NSWA 2YP6A 4GSTA 3IDVA 1SKWB 5H5QA 1YZXA 1A8YA 5A4UA 2OKAA 3IC8A 2A2RA 1ABAA 4TXOB 4KA0A 1GTAA 2L59A 1B9YC 3CSJA 2HRFA 1O73A 5GSSA 1XW6A 2H70A 2C4JA 1PKWA 3WT1A 1MTCA 2DMLA 4OMVA 1WRYA 1FVJA 3VPTA 1ZL9A 3F3QA 4XS6A 5D9VA 3ME8A 1EP8A 4FYUA 3IHGA 2G0FA 1QK8A 2YV9A 5BRTA 4O32A 1XG8A 4MPGA 1O8WA 2IN3A 1G0TA 5LCZA 1T8EB 4OD7A 3WT2A 1OE7A 4I6XA 4JRRA 4IHUA 4KDXA 4Q5QA 1EOHA 4MJAA 3VWXA 2A2SA 3FK8A 1MDIA 4X4JA 2MZCA 3KZQA 4NWYA 1TW9A 5EPFA 2RUFA 3F4RA 4K7NA 3TOTA 3IAM2 3ZYWA 1ZMAA 3KGKA 2DLXA 3IC4A 1T3BA 5DJLA 6GSSA 2CA8A 1VF4A 4IJIA 1ZYPA 3O6TA 3EVIA 2VD1A 3GH9A 3IHQA 1XBSA 3EU3A 3BCKA 5HR2A 4MABA 4PQIA 1K0BA 2GZPA 4K6XA 5IPGA 3D0ZA 2IL3A 3TRQA 4EUYA 11GSA 5INYA 3H1NA 3ZVJD 4EC0A 4USSA 5GZZB 3QAWA 2CVDA 5HFGA 1A2JA 4NAXA 5G31A 5LNKe 4GSSA 4XHMA 5G5FA 2VCWA 2LJKA 1HQOA 2HSHA 4GCIA 7GSSA 4O5RA 1F2EA 2PPTA 2YOIA 5HR0A 2F8FA 3UBLA 1BQ7A 4IVFA 2CV4A 4MJEA 2X99A 3NOFA 4BA7A 1TDIA 2GZYA 2RM6A 4MH2A 4ULXA 3VI5A 4F9ZA 2DJ2A 3TJGA 1ON4A 1AUCA 1Z3EA 1LJRA 3IK7A 4MF6A 5FT3A 2R0GA 3M0FA 6GSWA 2MYGA 1TTZA 4TR0A 2H6ZA 1V98A 4KW6A 1R7HA 1QQ2A 4MH3A 3FY7A 3QDNA 1YKAA 2VOCA 1XPVA 4POKA 2YNXA 1TJDA 1GUHA 3WD6A 4IJ3A 2MMNA 2H0HA 4AF2A 2DC5A 1CQHA 1M2DA 2BTOT 2NDOA 3RBTA 3KJYA 4WF5A 2GVPA 3C71A 1GSUA 4HI7A 1Z9HA 1K0AA 5HQPA 1YQ1A 2XBIA 4V2MA 4HDEA 2FGXA 4ZBDA 3O76A 4HZ2A 3H4KA 1XWGA 4J57E 5IPHA 3GA4A 2L4CA 5DBQA 2OE1A 3LYPA 5DJMA 4XS1A 4ZILA 1J08A 2P31A 4NV5A 2H1BA 1SL1B 1AIUA 1C72A 5JWOB 1YY7A 4F2IA 4ML1A 5EVOA 3ZFLA 3D4TA 2FA4A 4KX4A 1A0RP 3QMXA 2GSTA 3U6VA 1E6BA 2JL4A 1AQXA 2R37A 3TUEA 2H30A 4EVMA 1VRSD 1NW2A 4AJ7A 1BEDA 5IMCA 4H86A 2HSMA 2YPMA 2YJ7A 4E8EA 1JZRA 4LMWA 2XHFA 3BCIA 5J41A 3GN3A 1DE1A 5D9TA 4IP6A 2KP1A 2VL3A 2R6KA 3EPTA 4QL7A 1S3AA 3FEUA 4KNDA 3Q74A 4X43A 1WOUA 3P2AA 3HVXA 3C73A 4NV2A 2IMDA 4BWSA 2R0PA 1ERTA 1SJIA 4K2XA 1YKCA 2NTOA 3ZZXA 4K0NA 3LXTA 3HZ4A 3DVXA 5ABRA 2VO4A 2EIRA 3C1RA 4PX1A 4LLRA 4Q5NA 4PTSA 1J0FA 4ILFA 2HRAA 2YWOA 2RUEA 2B6MA 5FWGA 2VIMA 4DSRA 4EIQA 2KP2A 3KTLA 1S3DA 1N8JA 5ID2A 2PBJA 2H73A 2L6DA 3F63A 3APQA 2WULA 3Q18A 1KNGA 2LS5A 4EXJA 1OE8A 4X0XA 3L9UA 3APSA 2KUCA 1ZYQB 1UA5A 1LBKA 4ECIA 3QD9A 2R0CA 2L6CA 3GL3A 1WE0A 1WIKA 4XIHA 3L0HA 1QUWA 4V2NA 1U87A 1AW9A 3RDWA 3GTUB 4L0UA 3VWWA 4WXTA 1S3CA 3UL3A 3L9SA 4Q5RA 4HU9A 3DEXA 3A5IA 1JLWA 2V41A 1SU9A 4GSNA 4MA9A 3DYRA 1USBA 4IQAA 2AYTA 3E3EA 1T1VA 4ECBA 3NIVA 2PWJA 2RIIA 2X8CA 2ZCTA 3KMOA 4IELA 3OR5A 2LUSA 5F07A 1B9XC 1XOBA 5JWQB 5D9WA 3H79A 3PGTA 1ERUA 4GRFA 3CSIA 2HFDA 3A2XA 5HFIA 3MYDA 1BG5A 1OVNA 4RUVA 2F3MA 2HZEA 3ZIVA 2K6VA 1VF3A 4IP1A 3LWAA 4HSCX 5HFKA 3TB2A 3CXGA 1HNBA 1QGVA 3LXZA 3C7MA 4PUAA 1SKSB 1TU8A 1O6JA 4XS4A 1PFOA 2OE0A 3O3TA 1Y25A 1RW1A 4WBRD 5ID2B 3IRAA 1SD8A 4D73A 1MD4A 3VURA 1K3OA 4OO5A 20GSA 9GSSA 1X9WB 5IMAA 5B8AA 2VAFA 5ECNB 1XWCA 4FO5A 2B5XA 1VF1A 4GLTA 1X9MB 1TI3A 1NM3A 3KM6A 2VLTA 1PRXA 5IO2A 5J9CA 4OCEA 5EL8A 4KB3A 4WEYA 5LD0A 1KBNA 3TKQA 3CQFA 4PUFC 5KOWA 4I8BA 5C00A 1XWAA 4DSQA 4FQUA 1UVZA 1RK4A 3FW2A 2J23A 4JU5A 2YWMA 3KP9A 1AQVA 2HYXA 2JU5A 1X9SB 2KLXA 2X64A 1GH2A 1Z7RA 3PH9A 3DKSA 5F0GA 2M80A 2H6YA 3CTGA 4EDZA 2PVQA 16GSA 2GT6A 5JCWA 3IBHA 4ZB8A 4GQCA 3LORA 4HUAA 1MDJA 3IXRA 3TKRA 2YCDA 5DALA 2PN8A 5IMVA 2HZEB 2V6KA 3LG6A 4L5LA 3P8WA 3D5JA 4Z7XA 4CW9A 1GSFA 4BVXA 2M72A 1GRXA 1VF2A 2E0QA 2VUPA 1DE2A 1TK5B 1ERVA 3GSSA 1TRUA 2OBKA 3F6DA 5ECMB 5ECRB 2HNLA 1DUGA 5G2ZA 2VLVA 4D73B 4RI6A 3PR8A 4FIWA 1QFNA 2YZHA 1GLQA 1NHOA 3IAS2 3UARA 2LRTA 4G9HA 1T7PB 1QXHA 3I43A 3GFKA 4WETA 4BL7B 4MMMA 1TU7A 1H4OA 3ZMLA 4IGJA 4K0GA 1ILOA 1O81A 3L4NA 2HLSA 4MDCA 4MPFA 2GSRA 3EU4A 1M3IA 3LW9A 5IMFA 2KOKA 18GSA 4YKFA 1PN9A 4N0VA 3KH9A 1PMTA 2LNSA 2C3QA 2MBSA 2DIYA 2C1YA 3W6GA 4FH8A 2RLIA 2B7JA 4YQVA 3LQ7A 4ACSA 5DCGA 1T00A 1HNCA 4OFMA 3GX0A 3VWUA 4KDYA 2OACA 2O8VB 2IWTA 5HR3A 1G6YA 2C0FA 2FCHA 2IFQA 4IW9A 3A2WA 2ZUPA 1GL8A 1M99A 2MBTA 5A5KA 4POBA 2VCQA 4MZBA 3HJMA 4MJCA 1PX6A 4WR5A 5DCHA 3HHVA 1M3JA 3FR3A 4V2LA 1K0NA 1Y6EA 1S3RA 2B1LA 3K8NA 1PN0A 1R26A 1GUMA 3TJJA 4TKYA 5F05A 2BJXA 6GSUA 2N5AA 5D93A 4OFTA 3A5WA 2EIOA 5EY6A 3UIWA 4LL4B 2RM5A 2PVOC 2CZ3A 2AB6A 4ZL7A 2JZSA 4AJ6A 2MMAA 3APOA 2WB9A 1F3BA 2DJKA 4OWYA 4LL1B 3G9BA 4TR3A 1URMA 1W4VA 3W8SA 2CQ9A 3FHKA 4QQ7A 4J2FA 3JCML 3ZL5A 3QPMA 2DSAA 2WGRA 4G0LA 3QR6A 2TRXA 5AIXA 5CP1A 3VLNA 1UC7A 4MNNA 5DAKA 2VL9A 3ZIJA 2FA8A 5IMZA 1XIYA 5J4UA 4HQZA 1V9WA 3CTFA 5COHA 1V40A 1AAZA 1K3YA 3L78A 2HRNA 1XWBA 3EC3A 1W89A 1K0DA 5GAPD 3FYGA 6GSYA 2IFQB 1GTUA 3FMWA 4IBPA 1V2AA 1SL2B 3DXBA 2DJ1A 2GQMA 4IKHA 5J9BA 1SJ6A 2ON5A 3QCPA 3ED3A 1HD2A 2H76A 5B8BA 2QA2A 4ZL9A 2GQLA 2XPDA 3ZFBA 1B48A 2P5QA 1FB0A 4MF7A 2C0EA 2WS2A 5B6MA 2HZFA 4OCFA 2X8GA 2CX3A 4CY8A 2DKHA 3EYTA 3U5RE 3HDCA 3ZITA 2L5OA 4F0BA 1MDKA 3FKFA 1QMVA 1PL1A 5AIVA 1EGOA 1M2AA 3F3RA 3GMFA 3L9VA 2QKEA 2YV7A 5G1KA 3QAVA 4KCAA 2H72A 3LYKA 1TRVA 3F9UA 4N0ZA 4ECJA 4O92A 3ZRDA 4YQMA 1M9AA 2V6OA 1ZYNA 1BAYA 5E59A 3TJKA 4KGIA 1TI1A 1TOFA 3MAKA 2R5GA 2AAWA 3M1GA 2X4AA 4CHSA 4EKZA 2DJJA 1SD9A 1SK1A 2IJYA 1OC9A 1XFLA 1EV9A 4F82A 1VGLA 2K8VA 3DVWA 3IR4A 2FHEA 4BVYA 2V32A 3TRPA 4PQHA 2LQQA 1RQMA 2ES7A 1AXDA 2OADA 2EC4A 2H1AA 5ECPB 2P0GA 4IQ1A 4POMA 3RHBA 2PUKC 3VFIA 2H74A 4N10A 2B7KA 3IK9A 5HR1A 4Z2RA 3WGDA 2VM2A 1F37A 1PSQA 2ZNMA 4KDUA 2WZ9A 3TKSE 1U3AA 3BOAA 5IQYA 4K9ZA 1XVQA 1FW1A 2OE3A 2DJ0A 2JSYA 2VLUA 2V2GA 4TRXA 1EOGA 1KTEA 1ML6A 2WFCA 3VK9A 4EDYA 1TXXA 5CNWA 3ZTLA 3HYPA 3TJBA 3GHAA 4NMUA 3DRNA 3HCZA 1YF1A 4OFNA 2E2MA 2IMKA 1IYIA 2PU9C 5KEJA 3FZAA 1LU4A 2C0DA 4MP4A 4DSSA 1WMJA 3HKRA 3KTBA 2VD0A 3D22A 4ZBAA 4WF4A 4TN8A 1SJZA 5G5EA 3HJOA 1U3IA 4WKWA 3F8UA 5IMDA 1A2MA 3BJ5A 4ZB6A 4J56E 3UBKA 2NVLA 3AY8A 3GKNA 3HJPA 2B5EA 2IMEA 2YANA 5G1LA 1FVKA 1EEJA 3R3EA 4ZL8A 1V58A 1JZDA 4TXVA 3FR9A 3GIXA 3MSZA 3KXOA 2D2ZA 2XBQA 2H19A 1OC9B 3N5OA 1Z6NA 1YJ6A 3UEMA 4YQUA 1PL2A 1IYHA 1THOA 1ZGNA 3IPZA 2O85A 3GURA 1G6WA 3GKKA 4BVYB 2C8UA 1TRSA 1G7OA 3KIJA 3GV1A 5ECOB 1M7TA 3MIXA 3RPPA 2E2GA 5G30A 4MJBA 8GSSA 2A2PA 2JACA 4ZIJA 1FOVA 2IPAA 3F0IA 3GYKA 1ACVA 4YH2A 2AV4A 5J3RA 4YKGA 2LQOA 2CVKA 1K0MA 3IE3A 2G2QA 4PURA 4KE3A 5ECLB 4TW5A 4GTUA 3US3A 2DKIA 1FHEA 2V1MA 1WJKA 5KN2A 2JADA 1FB6A 4EL1A 4TXOA
chains in the Genus database with same CATH topology
3I69A 1F3AA 3GNJA 2I81A 2IIYA 2GSQA 1WWJA 2DJ3A 3UVTA 2PMTA 5IOXA 4HEA2 1GTIA 3I9V2 1EV4A 1OYJA 1TKDB 3WGEA 5IM9A 5CRGA 3FRCA 2MMOA 4KH7A 3RAZA 3M3MA 1GSSA 2WDUA 1OC8A 4V1Ap 3HZ8A 4EF0A 3ERGA 1GNEA 2B3SA 5D9XA 4K5RA 3BBYA 3ZLPA 1XW5A 2NPBA 2XPEA 3PPUA 5DQYA 2YJHA 3DD3A 2I1UA 2WJUA 3ZREA 4NHWA 1U88A 2CAQA 13GSA 2LRNA 4KSMA 3VWVA 1JFUA 2VM1A 1F9MA 2H75A 4G10A 3DMLA 2GZZA 1EP7A 5ECHB 3EMPA 3DGQA 4XS4B 5BMUA 1ERWA 3ERFA 5CO3A 1SK2A 2QSIA 2K18A 3ZMKA 3IA1A 2REMA 1GNWA 3C8EA 1SYXA 3QAGA 5D96A 1U6TA 2H1DA 1OC3A 1WP0A 3D6IA 1SENA 3BD2A 3WGXA 4HQSA 1GULA 1TRWA 4EE0A 2CT6A 4EO3A 4TR4A 4RQRA 1R4WA 2CX4A 2GDRA 3SWLA 3J7Yb 3W8JA 4K7OA 5CREA 3FZ4A 1TK0B 3N9JA 1NHYA 5CAXA 3A2VA 3ERWA 2I4AA 4TR1A 4NXIA 1BX9A 1YEPA 3M8NA 3D4MA 2AJQB 1I9DA 1O85A 3A3TA 3P7XA 3TGZA 2HXKA 4K7IA 4HJ2A 3TOUA 2X49A 1M9BA 5KOXA 3EURA 4NHZA 1UN2A 4JR4A 4MK3A 1WPIA 4N11A 1TP9A 3QFAC 1B4QA 5JCGA 19GSA 1XVWA 1YF0A 5DALB 3H93A 3HA9A 3P90A 5E4WA 4MZWA 2VL2C 1PKZA 4X1UA 4KSOA 1A0FA 1CQGA 1PX7A 4NPBA 4ID0A 3E9JB 2HSYA 4BVXB 1X0RA 3LSZA 2LV3A 5IIZA 4N30A 3TRXA 2GLRA 5DVBA 1GTBA 1ZCPA 2VCXA 2C3TA 4ZBBA 4O5QA 3CMIA 1K3LA 4ECCA 3EMXA 1GSEA 1FG4A 5JWRB 1EWXA 5DQSA 2LEGA 4GF0A 5ECIB 4Z2UA 1M2BA 17GSA 3QOUA 2DBCA 2C3NA 2FUG2 1SKRB 1R5PA 1EEMA 1GSQA 5D8IA 1GSDA 1YEXA 1BYEA 4TVEA 4MLYA 1MD3A 3SBCA 2YN1A 4IN0A 2PGTA 2K9FA 1XCCA 1FO5A 1SYRA 3TJFA 2KHPA 3PINA 4HU7A 2UZ8A 3MDKA 5KN1A 5A4WA 4JEDA 1G7EA 6GSXA 2GSSA 1V57A 4TR1B 4MF5A 4AGSA 3VPQA 3GH6A 1GUKA 5KN3A 2ON7A 3HY2A 1Z5YE 3GKXA 3UMAA 1ST9A 2B1KA 2I9HA 4JBBA 3RPNA 1SK0A 1YDKA 2GGTA 3I6AA 2H71A 5GSTA 14GSA 5ECQB 1T4ZA 4PGTA 1ZOFA 4L8EA 2CZ2A 1M0UA 2H8LA 2R4VA 3ME7A 2L5LA 3Q6OA 4FYCA 4O5UA 4JR6A 2N5BA 4PNGA 4YAPA 3R2QA 5B6NA 4A5PA 4GXZA 1JZOA 4BPYA 1ZZYA 2Z9SA 4ICYA 3Q19A 3UJ1A 4KAEA 3GSTA 22GSA 4LMVA 2J9HA 4XRAA 2OJLA 1DSBA 4HOJA 5A4VA 4IS0A 4Z2TA 2O89A 1GP1A 2XC2A 2JZTA 2VL2A 2C80A 5ECSA 5F8BA 5L71A 3F4TA 2VCVA 4XCSA 3IOSA 2DIZA 4GQFA 2YZUA 2FWGA 3GTUA 2QA1A 5CRDA 4ZXGA 4FYBA 2HE3A 2LRCA 2FY6A 4WBJA 3F6FA 4CY6A 2WCIA 5DAKB 4I5QA 2FNOA 5H5RA 3KH7A 2C0GA 5J5NA 2EIQA 1PQNA 4KUNA 1Z6MA 1EZKA 3FR6A 3TKPA 3GUSA 2MMZA 1AQWA 4K1FA 3CYNA 2X8HA 3QFBC 2HT9A 2H01A 4POLA 4F0CA 2JSZA 1K0OA 2BMXA 4L0WA 2M46A 4HZ4A 5D73A 6GSVA 1JHBA 1N2AA 4YAVA 5CRHA 2QC7A 4KF9A 1EGRA 1OKDA 5KN0A 2K8SA 3J7Yk 1XWKA 1GWCA 1GSYA 4G0KA 2FWEA 2TIRA 5ENUA 5ELAA 3TDGA 2YWNA 4OO4A 4G2EA 4G19A 4I2TA 1X5EA 1FOHA 2NBSA 3GKMA 4TOPA 2YWIA 1ZYEA 4K2DA 5F06A 2FWFA 1KEBA 4XRDA 3G7JA 1XOAA 2LNTA 12GSA 3TKSC 2LJAA 1OAZA 3LJRA 3MNGA 3LGCA 2N5FA 4ZB9A 2LSTA 3MWHA 4GWRA 4E8HA 1A2LA 6GSTA 4QL9A 1THXA 1Z7PA 3C1SA 1HNAA 3UAPA 1I5GA 1A8LA 5CRWA 5ECKB 1PD21 3GX8A 3CRUA 1JZWA 3UOMA 1B8XA 4JE1A 3TCOA 2R2JA 3HXSA 1A23A 2CAIA 4I97A 1O7UA 3EE2A 4HS1A 4RI7A 1DBYA 3CSHA 2HRKA 4K5SA 2O7KA 3HVVA 2FWHA 4XTSA 4DVCA 2TRCP 2F9SA 2HI7A 3EINA 5AN1A 4PNFA 1R5AA 3ZVJA 4BWQA 3LFLA 3IV4A 3DIEA 5IO0A 3S9FA 1E2YA 4MZCA 2A4VA 2H6XA 3KP8A 3RHCA 4PXOA 3KEBA 2GS3A 4ML6A 5GAND 2I3YA 2VCTA 2O87A 4P3YB 1XZOA 4HJMA 3E0UA 4JZQA 2OBIA 1TK8B 4G0IA 4ISDA 2P5RA 5AISA 3UVHA 1FAAA 2AUVA 1Q98A 1SL0B 1K0CA 2PERA 2WRTA 4O7HA 1HYUA 3CBUA 3M9JA 2FLSA 4CDOA 2DMMA 2FD3A 4EIPA 3D21A 1OKTA 1AC1A 4RQXA 3GL5A 1Q4JA 5CYYA 2L4QA 5C04A 1J9BA 3GRXA 5B7CA 5JCUA 2GTUA 3M9KA 2H1GA 1GLPA 5AGYA 1B4PA 3V1WA 2QGVA 5H5SA 4BL7A 3H8QA 2H66A 4KCEA 4DSSB 3DWVA 3CRTA 1XW9A 3VI7A 2GT5A 5DDLA 4AJ8A 1T4YA 2F8AA 1BJXA 2OA7A 2B5YA 3WYWA 3NZNA 5ELGA 10GSA 4K8MA 3HD5A 1H75A 1O8XA 3FZ5A 2H0GA 3EWLA 2JZRA 3TKSA 2IMIA 3KMNA 1PA3A 3KD0A 3KCMA 2R3XA 5FHIA 1MEKA 2H0IA 3FZ9A 2LTKA 3ISOA 4V1Ag 1A24A 3HVSA 2AHEA 2ALBA 4L5OA 4Q5FA 4WR4A 3F4SA 4PQ1A 2E7PA 1JLVA 1F6MC 2VCZA 1X5DA 4LA1A 5IOWA 3G7IA 2A4HA 2CVBA 2LKUA 1X5CA 1XXUA 3LEFA 4MCUA 2IMFA 2LJRA 4F03A 4I2UA 2GQKA 1PGTA 2F51A 2L57A 3G7YA 4DEJA 1NSWA 2YP6A 4GSTA 3IDVA 1SKWB 5H5QA 1YZXA 1A8YA 5A4UA 2OKAA 3IC8A 2A2RA 1ABAA 4TXOB 4KA0A 1GTAA 2L59A 1B9YC 3CSJA 2HRFA 1O73A 5GSSA 1XW6A 2H70A 2C4JA 1PKWA 3WT1A 1MTCA 2DMLA 4OMVA 1WRYA 1FVJA 3VPTA 1ZL9A 3F3QA 4XS6A 5D9VA 3ME8A 1EP8A 4FYUA 3IHGA 2G0FA 1QK8A 2YV9A 5BRTA 4O32A 4MPGA 1O8WA 2IN3A 1G0TA 5LCZA 1T8EB 4OD7A 3WT2A 1OE7A 4I6XA 4JRRA 4IHUA 4KDXA 4Q5QA 1EOHA 4MJAA 3VWXA 2A2SA 3FK8A 1MDIA 4X4JA 2MZCA 3KZQA 4NWYA 1TW9A 5EPFA 2RUFA 3F4RA 4K7NA 3TOTA 3IAM2 3ZYWA 1ZMAA 3KGKA 2DLXA 3IC4A 1T3BA 5DJLA 6GSSA 2CA8A 1VF4A 4IJIA 1ZYPA 3O6TA 3EVIA 2VD1A 3GH9A 3IHQA 1XBSA 3EU3A 3BCKA 5HR2A 4MABA 4PQIA 1K0BA 2GZPA 4K6XA 5IPGA 3D0ZA 2IL3A 3TRQA 4EUYA 11GSA 5INYA 3H1NA 3ZVJD 4EC0A 4USSA 5GZZB 3QAWA 2CVDA 5HFGA 1A2JA 4NAXA 5G31A 5LNKe 4GSSA 4XHMA 5G5FA 2VCWA 2LJKA 1HQOA 2HSHA 4GCIA 7GSSA 4O5RA 1F2EA 2PPTA 2YOIA 5HR0A 2F8FA 3UBLA 1BQ7A 4IVFA 2CV4A 4MJEA 2X99A 3NOFA 4BA7A 1TDIA 2GZYA 2RM6A 4MH2A 4ULXA 3VI5A 4F9ZA 2DJ2A 3TJGA 1ON4A 1AUCA 1Z3EA 1LJRA 3IK7A 4MF6A 5FT3A 2R0GA 3M0FA 6GSWA 2MYGA 1TTZA 4TR0A 2H6ZA 1V98A 4KW6A 1R7HA 1QQ2A 4MH3A 3FY7A 3QDNA 1YKAA 2VOCA 1XPVA 4POKA 2YNXA 1TJDA 1GUHA 3WD6A 4IJ3A 2MMNA 2H0HA 4AF2A 2DC5A 1CQHA 1M2DA 2BTOT 2NDOA 3RBTA 3KJYA 4WF5A 2GVPA 3C71A 1GSUA 4HI7A 1Z9HA 1K0AA 5HQPA 1YQ1A 2XBIA 4V2MA 4HDEA 2FGXA 4ZBDA 3O76A 4HZ2A 3H4KA 1XWGA 4J57E 5IPHA 3GA4A 2L4CA 5DBQA 2OE1A 3LYPA 5DJMA 4XS1A 4ZILA 1J08A 2P31A 4NV5A 2H1BA 1SL1B 1AIUA 1C72A 5JWOB 1YY7A 4F2IA 4ML1A 5EVOA 3ZFLA 3D4TA 2FA4A 4KX4A 1A0RP 3QMXA 2GSTA 3U6VA 1E6BA 2JL4A 1AQXA 2R37A 3TUEA 2H30A 4EVMA 1VRSD 1NW2A 4AJ7A 1BEDA 5IMCA 4H86A 2HSMA 2YPMA 2YJ7A 4E8EA 1JZRA 4LMWA 2XHFA 3BCIA 5J41A 3GN3A 1DE1A 5D9TA 4IP6A 2KP1A 2VL3A 2R6KA 3EPTA 4QL7A 1S3AA 3FEUA 4KNDA 3Q74A 4X43A 1WOUA 3P2AA 3HVXA 3C73A 4NV2A 2IMDA 4BWSA 2R0PA 1ERTA 1SJIA 4K2XA 1YKCA 2NTOA 3ZZXA 4K0NA 3LXTA 3HZ4A 3DVXA 5ABRA 2VO4A 2EIRA 3C1RA 4PX1A 4LLRA 4Q5NA 4PTSA 1J0FA 4ILFA 2HRAA 2YWOA 2RUEA 2B6MA 5FWGA 2VIMA 4DSRA 4EIQA 2KP2A 3KTLA 1S3DA 1N8JA 5ID2A 2PBJA 2H73A 2L6DA 3F63A 3APQA 2WULA 3Q18A 1KNGA 2LS5A 4EXJA 1OE8A 4X0XA 3L9UA 3APSA 2KUCA 1ZYQB 1UA5A 1LBKA 4ECIA 3QD9A 2R0CA 2L6CA 3GL3A 1WE0A 1WIKA 4XIHA 3L0HA 1QUWA 4V2NA 1U87A 1AW9A 3RDWA 3GTUB 4L0UA 3VWWA 4WXTA 1S3CA 3UL3A 3L9SA 4Q5RA 4HU9A 3DEXA 3A5IA 1JLWA 2V41A 1SU9A 4GSNA 4MA9A 3DYRA 1USBA 4IQAA 2AYTA 3E3EA 1T1VA 4ECBA 3NIVA 2PWJA 2RIIA 2X8CA 2ZCTA 3KMOA 4IELA 3OR5A 2LUSA 5F07A 1B9XC 1XOBA 5JWQB 5D9WA 3H79A 3PGTA 1ERUA 4GRFA 3CSIA 2HFDA 3A2XA 5HFIA 3MYDA 1BG5A 1OVNA 4RUVA 2F3MA 2HZEA 3ZIVA 2K6VA 1VF3A 4IP1A 3LWAA 5HFKA 3TB2A 3CXGA 1HNBA 1QGVA 3LXZA 3C7MA 4PUAA 1SKSB 1TU8A 1O6JA 4XS4A 2OE0A 3O3TA 1Y25A 1RW1A 4WBRD 5ID2B 3IRAA 1SD8A 4D73A 1MD4A 3VURA 1K3OA 4OO5A 20GSA 9GSSA 1X9WB 5IMAA 5B8AA 2VAFA 5ECNB 1XWCA 4FO5A 2B5XA 1VF1A 4GLTA 1X9MB 1TI3A 1NM3A 3KM6A 2VLTA 1PRXA 5IO2A 5J9CA 4OCEA 5EL8A 4KB3A 4WEYA 5LD0A 1KBNA 3TKQA 4PUFC 5KOWA 4I8BA 5C00A 1XWAA 4DSQA 4FQUA 1UVZA 1RK4A 3FW2A 2J23A 4JU5A 2YWMA 3KP9A 1AQVA 2HYXA 2JU5A 1X9SB 2KLXA 2X64A 1GH2A 1Z7RA 3PH9A 3DKSA 5F0GA 2M80A 2H6YA 3CTGA 4EDZA 2PVQA 16GSA 2GT6A 5JCWA 3IBHA 4ZB8A 4GQCA 3LORA 4HUAA 1MDJA 3IXRA 3TKRA 2YCDA 5DALA 2PN8A 5IMVA 2HZEB 2V6KA 3LG6A 4L5LA 3P8WA 3D5JA 4Z7XA 4CW9A 1GSFA 4BVXA 2M72A 1GRXA 1VF2A 2E0QA 2VUPA 1DE2A 1TK5B 1ERVA 3GSSA 1TRUA 2OBKA 3F6DA 5ECMB 5ECRB 2HNLA 1DUGA 5G2ZA 2VLVA 4D73B 4RI6A 3PR8A 4FIWA 1QFNA 2YZHA 1GLQA 1NHOA 3IAS2 3UARA 2LRTA 4G9HA 1T7PB 1QXHA 3I43A 3GFKA 4WETA 4BL7B 4MMMA 1TU7A 1H4OA 3ZMLA 4IGJA 4K0GA 1ILOA 1O81A 3L4NA 2HLSA 4MDCA 4MPFA 2GSRA 3EU4A 3LW9A 5IMFA 2KOKA 18GSA 4YKFA 1PN9A 4N0VA 3KH9A 1PMTA 2LNSA 2C3QA 2MBSA 2DIYA 2C1YA 3W6GA 4FH8A 2RLIA 2B7JA 4YQVA 3LQ7A 4ACSA 5DCGA 1T00A 1HNCA 4OFMA 3GX0A 3VWUA 4KDYA 2OACA 2O8VB 2IWTA 5HR3A 1G6YA 2C0FA 2FCHA 2IFQA 4IW9A 3A2WA 2ZUPA 1GL8A 1M99A 2MBTA 5A5KA 4POBA 2VCQA 4MZBA 3HJMA 4MJCA 1PX6A 4WR5A 5DCHA 3HHVA 3FR3A 4V2LA 1K0NA 1Y6EA 2B1LA 3K8NA 1PN0A 1R26A 1GUMA 3TJJA 4TKYA 5F05A 2BJXA 6GSUA 2N5AA 5D93A 4OFTA 3A5WA 2EIOA 5EY6A 3UIWA 4LL4B 2RM5A 2PVOC 2CZ3A 2AB6A 4ZL7A 2JZSA 4AJ6A 2MMAA 3APOA 2WB9A 1F3BA 2DJKA 4OWYA 4LL1B 3G9BA 4TR3A 1URMA 1W4VA 3W8SA 2CQ9A 3FHKA 4QQ7A 4J2FA 3JCML 3ZL5A 3QPMA 2DSAA 2WGRA 4G0LA 3QR6A 2TRXA 5AIXA 5CP1A 3VLNA 1UC7A 4MNNA 5DAKA 2VL9A 3ZIJA 2FA8A 5IMZA 1XIYA 5J4UA 4HQZA 1V9WA 3CTFA 5COHA 1V40A 1AAZA 1K3YA 3L78A 2HRNA 1XWBA 3EC3A 1W89A 1K0DA 5GAPD 3FYGA 6GSYA 2IFQB 1GTUA 3FMWA 4IBPA 1V2AA 1SL2B 3DXBA 2DJ1A 2GQMA 4IKHA 5J9BA 1SJ6A 2ON5A 3QCPA 3ED3A 1HD2A 2H76A 5B8BA 2QA2A 4ZL9A 2GQLA 2XPDA 3ZFBA 1B48A 2P5QA 1FB0A 4MF7A 2C0EA 2WS2A 5B6MA 2HZFA 4OCFA 2X8GA 2CX3A 4CY8A 2DKHA 3EYTA 3U5RE 3HDCA 3ZITA 2L5OA 4F0BA 1MDKA 3FKFA 1QMVA 1PL1A 5AIVA 1EGOA 1M2AA 3F3RA 3GMFA 3L9VA 2QKEA 2YV7A 5G1KA 3QAVA 4KCAA 2H72A 3LYKA 1TRVA 3F9UA 4N0ZA 4ECJA 4O92A 3ZRDA 4YQMA 1M9AA 2V6OA 1ZYNA 1BAYA 5E59A 3TJKA 4KGIA 1TI1A 1TOFA 3MAKA 2R5GA 2AAWA 3M1GA 2X4AA 4CHSA 4EKZA 2DJJA 1SD9A 1SK1A 2IJYA 1OC9A 1XFLA 1EV9A 4F82A 1VGLA 2K8VA 3DVWA 3IR4A 2FHEA 4BVYA 2V32A 3TRPA 4PQHA 2LQQA 1RQMA 2ES7A 1AXDA 2OADA 2EC4A 2H1AA 5ECPB 2P0GA 4IQ1A 4POMA 3RHBA 2PUKC 3VFIA 2H74A 4N10A 2B7KA 3IK9A 5HR1A 4Z2RA 3WGDA 2VM2A 1F37A 1PSQA 2ZNMA 4KDUA 2WZ9A 3TKSE 1U3AA 3BOAA 5IQYA 4K9ZA 1XVQA 1FW1A 2OE3A 2DJ0A 2JSYA 2VLUA 2V2GA 4TRXA 1EOGA 1KTEA 1ML6A 2WFCA 3VK9A 4EDYA 1TXXA 5CNWA 3ZTLA 3HYPA 3TJBA 3GHAA 4NMUA 3DRNA 3HCZA 1YF1A 4OFNA 2E2MA 2IMKA 1IYIA 2PU9C 5KEJA 3FZAA 1LU4A 2C0DA 4MP4A 4DSSA 1WMJA 3HKRA 3KTBA 2VD0A 3D22A 4ZBAA 4WF4A 4TN8A 1SJZA 5G5EA 3HJOA 1U3IA 4WKWA 3F8UA 5IMDA 1A2MA 3BJ5A 4ZB6A 4J56E 3UBKA 2NVLA 3AY8A 3GKNA 3HJPA 2B5EA 2IMEA 2YANA 5G1LA 1FVKA 1EEJA 3R3EA 4ZL8A 1V58A 1JZDA 4TXVA 3FR9A 3GIXA 3MSZA 3KXOA 2D2ZA 2XBQA 2H19A 1OC9B 3N5OA 1Z6NA 1YJ6A 3UEMA 4YQUA 1PL2A 1IYHA 1THOA 1ZGNA 3IPZA 2O85A 3GURA 1G6WA 3GKKA 4BVYB 2C8UA 1TRSA 1G7OA 3KIJA 3GV1A 5ECOB 1M7TA 3MIXA 3RPPA 2E2GA 5G30A 4MJBA 8GSSA 2A2PA 2JACA 4ZIJA 1FOVA 2IPAA 3F0IA 3GYKA 1ACVA 4YH2A 2AV4A 5J3RA 4YKGA 2LQOA 2CVKA 1K0MA 3IE3A 2G2QA 4PURA 4KE3A 5ECLB 4TW5A 4GTUA 3US3A 2DKIA 1FHEA 2V1MA 1WJKA 5KN2A 2JADA 1FB6A 4EL1A 4TXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I69 A;  1F3A A;  3GNJ A;  2I81 A;  2IIY A;  2GSQ A;  1WWJ A;  2DJ3 A;  3UVT A;  2PMT A;  5IOX A;  4HEA 2;  1GTI A;  3I9V 2;  1EV4 A;  1OYJ A;  1TKD B;  3WGE A;  5IM9 A;  5CRG A;  3FRC A;  2MMO A;  4KH7 A;  3RAZ A;  3M3M A;  1GSS A;  2WDU A;  1OC8 A;  4V1A p;  3HZ8 A;  4EF0 A;  3ERG A;  1GNE A;  2B3S A;  5D9X A;  3BBY A;  3ZLP A;  1XW5 A;  2NPB A;  2XPE A;  5DQY A;  2YJH A;  3DD3 A;  2I1U A;  2WJU A;  3ZRE A;  4NHW A;  1U88 A;  2CAQ A;  13GS A;  2LRN A;  4KSM A;  3VWV A;  1JFU A;  2VM1 A;  1F9M A;  2H75 A;  4G10 A;  3DML A;  2GZZ A;  1EP7 A;  5ECH B;  3EMP A;  3DGQ A;  4XS4 B;  1ERW A;  3ERF A;  5CO3 A;  1SK2 A;  2QSI A;  2K18 A;  3ZMK A;  3IA1 A;  2REM A;  1GNW A;  3C8E A;  1SYX A;  3QAG A;  5D96 A;  1U6T A;  2H1D A;  1OC3 A;  1WP0 A;  3D6I A;  1SEN A;  3BD2 A;  3WGX A;  4HQS A;  1GUL A;  1TRW A;  4EE0 A;  2CT6 A;  4EO3 A;  4TR4 A;  4RQR A;  1R4W A;  2CX4 A;  2GDR A;  3SWL A;  3J7Y b;  3W8J A;  4K7O A;  5CRE A;  3FZ4 A;  1TK0 B;  3N9J A;  1NHY A;  5CAX A;  3A2V A;  3ERW A;  2I4A A;  4TR1 A;  4NXI A;  1BX9 A;  1YEP A;  3M8N A;  3D4M A;  2AJQ B;  1I9D A;  1O85 A;  3A3T A;  3P7X A;  3TGZ A;  2HXK A;  4K7I A;  4HJ2 A;  3TOU A;  1M9B A;  3EUR A;  4NHZ A;  1UN2 A;  4JR4 A;  4MK3 A;  1WPI A;  4N11 A;  1TP9 A;  3QFA C;  1B4Q A;  5JCG A;  19GS A;  1XVW A;  1YF0 A;  5DAL B;  3H93 A;  3HA9 A;  3P90 A;  5E4W A;  4MZW A;  2VL2 C;  1PKZ A;  4X1U A;  4KSO A;  1A0F A;  1CQG A;  1PX7 A;  4NPB A;  4ID0 A;  3E9J B;  2HSY A;  1X0R A;  3LSZ A;  2LV3 A;  5IIZ A;  4N30 A;  3TRX A;  2GLR A;  5DVB A;  1GTB A;  1ZCP A;  2VCX A;  2C3T A;  4ZBB A;  3CMI A;  1K3L A;  4ECC A;  3EMX A;  1GSE A;  1FG4 A;  5JWR B;  1EWX A;  5DQS A;  2LEG A;  4GF0 A;  5ECI B;  1M2B A;  17GS A;  3QOU A;  2DBC A;  2C3N A;  2FUG 2;  1SKR B;  1R5P A;  1EEM A;  1GSQ A;  5D8I A;  1GSD A;  1YEX A;  1BYE A;  4TVE A;  4MLY A;  1MD3 A;  3SBC A;  2YN1 A;  4IN0 A;  2PGT A;  2K9F A;  1XCC A;  1FO5 A;  1SYR A;  3TJF A;  2KHP A;  3PIN A;  4HU7 A;  3MDK A;  5KN1 A;  5A4W A;  4JED A;  1G7E A;  6GSX A;  2GSS A;  1V57 A;  4TR1 B;  4MF5 A;  4AGS A;  3VPQ A;  3GH6 A;  1GUK A;  5KN3 A;  2ON7 A;  3HY2 A;  1Z5Y E;  3GKX A;  3UMA A;  1ST9 A;  2B1K A;  2I9H A;  4JBB A;  3RPN A;  1SK0 A;  1YDK A;  2GGT A;  3I6A A;  2H71 A;  5GST A;  14GS A;  5ECQ B;  1T4Z A;  4PGT A;  1ZOF A;  4L8E A;  2CZ2 A;  1M0U A;  2H8L A;  2R4V A;  3ME7 A;  2L5L A;  3Q6O A;  4FYC A;  4JR6 A;  2N5B A;  4PNG A;  4YAP A;  3R2Q A;  5B6N A;  4GXZ A;  1JZO A;  4BPY A;  1ZZY A;  2Z9S A;  3Q19 A;  3UJ1 A;  4KAE A;  3GST A;  22GS A;  4LMV A;  2J9H A;  4XRA A;  2OJL A;  1DSB A;  4HOJ A;  5A4V A;  4IS0 A;  2O89 A;  1GP1 A;  2XC2 A;  2JZT A;  2VL2 A;  2C80 A;  5ECS A;  5F8B A;  5L71 A;  3F4T A;  2VCV A;  4XCS A;  3IOS A;  2DIZ A;  4GQF A;  2YZU A;  2FWG A;  3GTU A;  5CRD A;  4ZXG A;  4FYB A;  2HE3 A;  2LRC A;  2FY6 A;  4WBJ A;  3F6F A;  2WCI A;  5DAK B;  4I5Q A;  2FNO A;  5H5R A;  3KH7 A;  2C0G A;  5J5N A;  2EIQ A;  1PQN A;  4KUN A;  1Z6M A;  1EZK A;  3FR6 A;  3TKP A;  3GUS A;  2MMZ A;  1AQW A;  4K1F A;  3CYN A;  2X8H A;  3QFB C;  2HT9 A;  2H01 A;  4POL A;  4F0C A;  2JSZ A;  1K0O A;  2BMX A;  4L0W A;  2M46 A;  4HZ4 A;  5D73 A;  6GSV A;  1JHB A;  1N2A A;  4YAV A;  5CRH A;  2QC7 A;  1EGR A;  1OKD A;  5KN0 A;  2K8S A;  3J7Y k;  1XWK A;  1GWC A;  1GSY A;  2FWE A;  2TIR A;  5ENU A;  5ELA A;  3TDG A;  2YWN A;  4OO4 A;  4G2E A;  4G19 A;  4I2T A;  1X5E A;  2NBS A;  3GKM A;  4TOP A;  2YWI A;  1ZYE A;  4K2D A;  5F06 A;  2FWF A;  1KEB A;  4XRD A;  3G7J A;  1XOA A;  2LNT A;  12GS A;  3TKS C;  2LJA A;  1OAZ A;  3LJR A;  3MNG A;  3LGC A;  2N5F A;  4ZB9 A;  2LST A;  3MWH A;  4GWR A;  4E8H A;  1A2L A;  6GST A;  4QL9 A;  1THX A;  1Z7P A;  3C1S A;  1HNA A;  3UAP A;  1I5G A;  1A8L A;  5CRW A;  5ECK B;  1PD2 1;  3GX8 A;  3CRU A;  1JZW A;  3UOM A;  1B8X A;  4JE1 A;  3TCO A;  2R2J A;  3HXS A;  1A23 A;  2CAI A;  4I97 A;  1O7U A;  3EE2 A;  4HS1 A;  4RI7 A;  1DBY A;  3CSH A;  2O7K A;  3HVV A;  2FWH A;  4XTS A;  4DVC A;  2TRC P;  2F9S A;  2HI7 A;  3EIN A;  5AN1 A;  4PNF A;  1R5A A;  3ZVJ A;  4BWQ A;  3LFL A;  3IV4 A;  3DIE A;  5IO0 A;  3S9F A;  1E2Y A;  4MZC A;  2A4V A;  2H6X A;  3KP8 A;  3RHC A;  4PXO A;  3KEB A;  2GS3 A;  4ML6 A;  5GAN D;  2I3Y A;  2VCT A;  2O87 A;  4P3Y B;  1XZO A;  4HJM A;  3E0U A;  4JZQ A;  2OBI A;  1TK8 B;  4ISD A;  2P5R A;  5AIS A;  3UVH A;  1FAA A;  2AUV A;  1Q98 A;  1SL0 B;  1K0C A;  2PER A;  2WRT A;  4O7H A;  1HYU A;  3CBU A;  3M9J A;  2FLS A;  4CDO A;  2DMM A;  2FD3 A;  3D21 A;  1OKT A;  1AC1 A;  4RQX A;  3GL5 A;  1Q4J A;  5CYY A;  2L4Q A;  5C04 A;  1J9B A;  3GRX A;  5B7C A;  5JCU A;  2GTU A;  3M9K A;  2H1G A;  1GLP A;  5AGY A;  1B4P A;  3V1W A;  2QGV A;  5H5S A;  4BL7 A;  3H8Q A;  2H66 A;  4KCE A;  4DSS B;  3DWV A;  3CRT A;  1XW9 A;  3VI7 A;  2GT5 A;  5DDL A;  4AJ8 A;  1T4Y A;  2F8A A;  1BJX A;  2OA7 A;  2B5Y A;  3WYW A;  3NZN A;  5ELG A;  10GS A;  4K8M A;  3HD5 A;  1H75 A;  1O8X A;  3FZ5 A;  2H0G A;  3EWL A;  2JZR A;  3TKS A;  2IMI A;  3KMN A;  1PA3 A;  3KD0 A;  3KCM A;  2R3X A;  5FHI A;  1MEK A;  2H0I A;  3FZ9 A;  2LTK A;  3ISO A;  4V1A g;  1A24 A;  3HVS A;  2AHE A;  2ALB A;  4L5O A;  4Q5F A;  4WR4 A;  3F4S A;  4PQ1 A;  2E7P A;  1JLV A;  1F6M C;  2VCZ A;  1X5D A;  4LA1 A;  5IOW A;  3G7I A;  2CVB A;  2LKU A;  1X5C A;  1XXU A;  3LEF A;  4MCU A;  2IMF A;  2LJR A;  4F03 A;  4I2U A;  2GQK A;  1PGT A;  2F51 A;  2L57 A;  3G7Y A;  4DEJ A;  1NSW A;  2YP6 A;  4GST A;  3IDV A;  1SKW B;  5H5Q A;  1YZX A;  1A8Y A;  5A4U A;  2OKA A;  2A2R A;  1ABA A;  4TXO B;  4KA0 A;  1GTA A;  2L59 A;  1B9Y C;  3CSJ A;  2HRF A;  1O73 A;  5GSS A;  1XW6 A;  2H70 A;  2C4J A;  1PKW A;  3WT1 A;  1MTC A;  2DML A;  4OMV A;  1WRY A;  1FVJ A;  3VPT A;  1ZL9 A;  3F3Q A;  4XS6 A;  5D9V A;  3ME8 A;  1EP8 A;  4FYU A;  2G0F A;  1QK8 A;  2YV9 A;  4O32 A;  4MPG A;  1O8W A;  2IN3 A;  1G0T A;  5LCZ A;  1T8E B;  4OD7 A;  3WT2 A;  1OE7 A;  4I6X A;  4JRR A;  4IHU A;  4KDX A;  4Q5Q A;  1EOH A;  4MJA A;  3VWX A;  2A2S A;  3FK8 A;  1MDI A;  2MZC A;  3KZQ A;  4NWY A;  1TW9 A;  5EPF A;  2RUF A;  3F4R A;  4K7N A;  3TOT A;  3IAM 2;  3ZYW A;  1ZMA A;  3KGK A;  2DLX A;  3IC4 A;  1T3B A;  5DJL A;  6GSS A;  2CA8 A;  1VF4 A;  4IJI A;  3O6T A;  3EVI A;  2VD1 A;  3GH9 A;  3IHQ A;  1XBS A;  3EU3 A;  3BCK A;  5HR2 A;  4MAB A;  4PQI A;  1K0B A;  2GZP A;  4K6X A;  5IPG A;  3D0Z A;  2IL3 A;  3TRQ A;  4EUY A;  11GS A;  5INY A;  3H1N A;  3ZVJ D;  4EC0 A;  5GZZ B;  3QAW A;  2CVD A;  5HFG A;  1A2J A;  4NAX A;  5G31 A;  5LNK e;  4GSS A;  4XHM A;  5G5F A;  2VCW A;  2LJK A;  1HQO A;  2HSH A;  4GCI A;  7GSS A;  4O5R A;  1F2E A;  2PPT A;  2YOI A;  5HR0 A;  2F8F A;  3UBL A;  1BQ7 A;  4IVF A;  2CV4 A;  4MJE A;  2X99 A;  3NOF A;  4BA7 A;  1TDI A;  2GZY A;  2RM6 A;  4MH2 A;  4ULX A;  3VI5 A;  4F9Z A;  2DJ2 A;  3TJG A;  1ON4 A;  1AUC A;  1Z3E A;  1LJR A;  3IK7 A;  4MF6 A;  5FT3 A;  3M0F A;  6GSW A;  2MYG A;  1TTZ A;  4TR0 A;  2H6Z A;  1V98 A;  4KW6 A;  1R7H A;  1QQ2 A;  4MH3 A;  3FY7 A;  3QDN A;  1YKA A;  2VOC A;  1XPV A;  4POK A;  2YNX A;  1TJD A;  1GUH A;  3WD6 A;  4IJ3 A;  2MMN A;  2H0H A;  4AF2 A;  2DC5 A;  1CQH A;  1M2D A;  2BTO T;  2NDO A;  3RBT A;  3KJY A;  4WF5 A;  2GVP A;  3C71 A;  1GSU A;  4HI7 A;  1Z9H A;  1K0A A;  5HQP A;  1YQ1 A;  2XBI A;  4V2M A;  4HDE A;  2FGX A;  4ZBD A;  3O76 A;  4HZ2 A;  3H4K A;  1XWG A;  4J57 E;  5IPH A;  3GA4 A;  2L4C A;  5DBQ A;  2OE1 A;  3LYP A;  5DJM A;  4XS1 A;  4ZIL A;  1J08 A;  2P31 A;  4NV5 A;  2H1B A;  1SL1 B;  1AIU A;  1C72 A;  5JWO B;  1YY7 A;  4F2I A;  4ML1 A;  5EVO A;  3ZFL A;  3D4T A;  2FA4 A;  4KX4 A;  1A0R P;  3QMX A;  2GST A;  3U6V A;  1E6B A;  2JL4 A;  1AQX A;  2R37 A;  3TUE A;  2H30 A;  4EVM A;  1VRS D;  1NW2 A;  4AJ7 A;  1BED A;  5IMC A;  4H86 A;  2YPM A;  2YJ7 A;  4E8E A;  1JZR A;  4LMW A;  2XHF A;  3BCI A;  5J41 A;  3GN3 A;  1DE1 A;  5D9T A;  4IP6 A;  2KP1 A;  2VL3 A;  2R6K A;  4QL7 A;  1S3A A;  3FEU A;  4KND A;  3Q74 A;  4X43 A;  1WOU A;  3P2A A;  3HVX A;  3C73 A;  4NV2 A;  2IMD A;  4BWS A;  1ERT A;  1SJI A;  1YKC A;  2NTO A;  3ZZX A;  4K0N A;  3LXT A;  3HZ4 A;  3DVX A;  5ABR A;  2VO4 A;  2EIR A;  3C1R A;  4PX1 A;  4LLR A;  4Q5N A;  1J0F A;  4ILF A;  2YWO A;  2RUE A;  2B6M A;  5FWG A;  2VIM A;  4DSR A;  2KP2 A;  3KTL A;  1S3D A;  1N8J A;  5ID2 A;  2PBJ A;  2H73 A;  2L6D A;  3F63 A;  3APQ A;  2WUL A;  3Q18 A;  1KNG A;  2LS5 A;  4EXJ A;  1OE8 A;  4X0X A;  3L9U A;  3APS A;  2KUC A;  1ZYQ B;  1UA5 A;  1LBK A;  4ECI A;  3QD9 A;  2L6C A;  3GL3 A;  1WE0 A;  1WIK A;  4XIH A;  3L0H A;  1QUW A;  4V2N A;  1U87 A;  1AW9 A;  3RDW A;  3GTU B;  4L0U A;  3VWW A;  4WXT A;  1S3C A;  3UL3 A;  3L9S A;  4Q5R A;  4HU9 A;  3DEX A;  1JLW A;  2V41 A;  1SU9 A;  4GSN A;  4MA9 A;  3DYR A;  1USB A;  4IQA A;  2AYT A;  3E3E A;  1T1V A;  4ECB A;  3NIV A;  2PWJ A;  2RII A;  2X8C A;  2ZCT A;  3KMO A;  4IEL A;  3OR5 A;  2LUS A;  5F07 A;  1B9X C;  1XOB A;  5JWQ B;  5D9W A;  3H79 A;  3PGT A;  1ERU A;  4GRF A;  3CSI A;  2HFD A;  3A2X A;  5HFI A;  1BG5 A;  1OVN A;  4RUV A;  2F3M A;  2HZE A;  3ZIV A;  2K6V A;  1VF3 A;  4IP1 A;  3LWA A;  5HFK A;  3TB2 A;  3CXG A;  1HNB A;  1QGV A;  3LXZ A;  3C7M A;  4PUA A;  1SKS B;  1TU8 A;  1O6J A;  4XS4 A;  2OE0 A;  3O3T A;  1Y25 A;  1RW1 A;  4WBR D;  5ID2 B;  3IRA A;  1SD8 A;  4D73 A;  1MD4 A;  3VUR A;  1K3O A;  4OO5 A;  20GS A;  9GSS A;  1X9W B;  5IMA A;  5B8A A;  2VAF A;  5ECN B;  1XWC A;  4FO5 A;  2B5X A;  1VF1 A;  4GLT A;  1X9M B;  1TI3 A;  1NM3 A;  3KM6 A;  2VLT A;  1PRX A;  5IO2 A;  5J9C A;  4OCE A;  5EL8 A;  4KB3 A;  4WEY A;  5LD0 A;  1KBN A;  3TKQ A;  4PUF C;  4I8B A;  5C00 A;  1XWA A;  4DSQ A;  1UVZ A;  1RK4 A;  3FW2 A;  2J23 A;  4JU5 A;  2YWM A;  3KP9 A;  1AQV A;  2HYX A;  2JU5 A;  1X9S B;  2KLX A;  2X64 A;  1GH2 A;  1Z7R A;  3PH9 A;  3DKS A;  5F0G A;  2M80 A;  2H6Y A;  3CTG A;  4EDZ A;  2PVQ A;  16GS A;  2GT6 A;  5JCW A;  3IBH A;  4ZB8 A;  4GQC A;  3LOR A;  4HUA A;  1MDJ A;  3IXR A;  3TKR A;  2YCD A;  5DAL A;  2PN8 A;  5IMV A;  2HZE B;  2V6K A;  3LG6 A;  4L5L A;  3P8W A;  3D5J A;  4Z7X A;  4CW9 A;  1GSF A;  4BVX A;  2M72 A;  1GRX A;  1VF2 A;  2E0Q A;  2VUP A;  1DE2 A;  1TK5 B;  1ERV A;  3GSS A;  1TRU A;  2OBK A;  3F6D A;  5ECM B;  5ECR B;  2HNL A;  1DUG A;  5G2Z A;  2VLV A;  4D73 B;  4RI6 A;  3PR8 A;  4FIW A;  1QFN A;  2YZH A;  1GLQ A;  1NHO A;  3IAS 2;  3UAR A;  2LRT A;  4G9H A;  1T7P B;  1QXH A;  3I43 A;  3GFK A;  4WET A;  4MMM A;  1TU7 A;  1H4O A;  3ZML A;  4IGJ A;  4K0G A;  1ILO A;  1O81 A;  3L4N A;  2HLS A;  4MDC A;  4MPF A;  2GSR A;  3EU4 A;  5IMF A;  2KOK A;  18GS A;  1PN9 A;  4N0V A;  3KH9 A;  1PMT A;  2LNS A;  2C3Q A;  2MBS A;  2DIY A;  2C1Y A;  3W6G A;  4FH8 A;  2RLI A;  2B7J A;  4YQV A;  3LQ7 A;  4ACS A;  5DCG A;  1T00 A;  1HNC A;  4OFM A;  3GX0 A;  3VWU A;  4KDY A;  2OAC A;  2O8V B;  2IWT A;  5HR3 A;  1G6Y A;  2C0F A;  2FCH A;  2IFQ A;  4IW9 A;  3A2W A;  2ZUP A;  1GL8 A;  1M99 A;  2MBT A;  5A5K A;  4POB A;  2VCQ A;  4MZB A;  3HJM A;  4MJC A;  1PX6 A;  4WR5 A;  5DCH A;  3HHV A;  3FR3 A;  4V2L A;  1K0N A;  1Y6E A;  2B1L A;  3K8N A;  1R26 A;  1GUM A;  3TJJ A;  4TKY A;  5F05 A;  2BJX A;  6GSU A;  2N5A A;  5D93 A;  4OFT A;  3A5W A;  2EIO A;  5EY6 A;  3UIW A;  4LL4 B;  2RM5 A;  2PVO C;  2CZ3 A;  2AB6 A;  4ZL7 A;  2JZS A;  4AJ6 A;  2MMA A;  3APO A;  2WB9 A;  1F3B A;  2DJK A;  4OWY A;  4LL1 B;  3G9B A;  4TR3 A;  1URM A;  1W4V A;  3W8S A;  2CQ9 A;  3FHK A;  4QQ7 A;  4J2F A;  3JCM L;  3ZL5 A;  3QPM A;  2DSA A;  2WGR A;  3QR6 A;  2TRX A;  5AIX A;  5CP1 A;  3VLN A;  1UC7 A;  5DAK A;  2VL9 A;  3ZIJ A;  2FA8 A;  5IMZ A;  1XIY A;  5J4U A;  4HQZ A;  1V9W A;  3CTF A;  5COH A;  1V40 A;  1AAZ A;  1K3Y A;  3L78 A;  2HRN A;  1XWB A;  3EC3 A;  1W89 A;  1K0D A;  5GAP D;  3FYG A;  6GSY A;  2IFQ B;  1GTU A;  4IBP A;  1V2A A;  1SL2 B;  3DXB A;  2DJ1 A;  2GQM A;  4IKH A;  5J9B A;  1SJ6 A;  2ON5 A;  3QCP A;  3ED3 A;  1HD2 A;  2H76 A;  5B8B A;  4ZL9 A;  2GQL A;  2XPD A;  3ZFB A;  1B48 A;  2P5Q A;  1FB0 A;  4MF7 A;  2C0E A;  2WS2 A;  5B6M A;  2HZF A;  4OCF A;  2X8G A;  2CX3 A;  3EYT A;  3U5R E;  3HDC A;  3ZIT A;  2L5O A;  4F0B A;  1MDK A;  3FKF A;  1QMV A;  1PL1 A;  5AIV A;  1EGO A;  1M2A A;  3F3R A;  3GMF A;  3L9V A;  2QKE A;  2YV7 A;  5G1K A;  3QAV A;  4KCA A;  2H72 A;  3LYK A;  1TRV A;  3F9U A;  4N0Z A;  4ECJ A;  4O92 A;  3ZRD A;  4YQM A;  1M9A A;  2V6O A;  5E59 A;  1BAY A;  3TJK A;  4KGI A;  1TI1 A;  1TOF A;  3MAK A;  2R5G A;  2AAW A;  3M1G A;  4CHS A;  4EKZ A;  2DJJ A;  1SD9 A;  1SK1 A;  2IJY A;  1OC9 A;  1XFL A;  1EV9 A;  4F82 A;  1VGL A;  2K8V A;  3DVW A;  3IR4 A;  2FHE A;  4BVY A;  2V32 A;  3TRP A;  4PQH A;  2LQQ A;  1RQM A;  2ES7 A;  1AXD A;  2OAD A;  2EC4 A;  2H1A A;  5ECP B;  2P0G A;  4IQ1 A;  4POM A;  3RHB A;  2PUK C;  3VFI A;  2H74 A;  4N10 A;  2B7K A;  3IK9 A;  5HR1 A;  3WGD A;  2VM2 A;  1F37 A;  1PSQ A;  2ZNM A;  4KDU A;  2WZ9 A;  3TKS E;  1U3A A;  3BOA A;  5IQY A;  4K9Z A;  1XVQ A;  1FW1 A;  2OE3 A;  2DJ0 A;  2JSY A;  2VLU A;  2V2G A;  4TRX A;  1EOG A;  1KTE A;  1ML6 A;  2WFC A;  3VK9 A;  4EDY A;  1TXX A;  5CNW A;  3ZTL A;  3HYP A;  3TJB A;  3GHA A;  4NMU A;  3DRN A;  3HCZ A;  1YF1 A;  4OFN A;  2E2M A;  2IMK A;  1IYI A;  2PU9 C;  5KEJ A;  3FZA A;  1LU4 A;  2C0D A;  4MP4 A;  4DSS A;  1WMJ A;  3HKR A;  3KTB A;  2VD0 A;  3D22 A;  4ZBA A;  4WF4 A;  4TN8 A;  1SJZ A;  5G5E A;  3HJO A;  1U3I A;  4WKW A;  3F8U A;  5IMD A;  1A2M A;  3BJ5 A;  4ZB6 A;  4J56 E;  3UBK A;  2NVL A;  3AY8 A;  3GKN A;  3HJP A;  2B5E A;  2IME A;  2YAN A;  5G1L A;  1FVK A;  1EEJ A;  4ZL8 A;  1V58 A;  1JZD A;  4TXV A;  3FR9 A;  3GIX A;  3MSZ A;  3KXO A;  2D2Z A;  2XBQ A;  2H19 A;  1OC9 B;  3N5O A;  1Z6N A;  1YJ6 A;  3UEM A;  4YQU A;  1PL2 A;  1IYH A;  1THO A;  1ZGN A;  3IPZ A;  2O85 A;  3GUR A;  1G6W A;  3GKK A;  2C8U A;  1TRS A;  1G7O A;  3KIJ A;  3GV1 A;  5ECO B;  1M7T A;  3RPP A;  2E2G A;  5G30 A;  4MJB A;  8GSS A;  2JAC A;  4ZIJ A;  1FOV A;  2IPA A;  3F0I A;  3GYK A;  1ACV A;  4YH2 A;  2AV4 A;  5J3R A;  2LQO A;  2CVK A;  1K0M A;  3IE3 A;  2G2Q A;  4PUR A;  4KE3 A;  5ECL B;  4TW5 A;  4GTU A;  3US3 A;  1FHE A;  2V1M A;  1WJK A;  5KN2 A;  2JAD A;  1FB6 A;  4EL1 A;  4TXO A; 
#chains in the Genus database with same CATH topology
 3I69 A;  1F3A A;  3GNJ A;  2I81 A;  2IIY A;  2GSQ A;  1WWJ A;  2DJ3 A;  3UVT A;  2PMT A;  5IOX A;  4HEA 2;  1GTI A;  3I9V 2;  1EV4 A;  1OYJ A;  1TKD B;  3WGE A;  5IM9 A;  5CRG A;  3FRC A;  2MMO A;  4KH7 A;  3RAZ A;  3M3M A;  1GSS A;  2WDU A;  1OC8 A;  4V1A p;  3HZ8 A;  4EF0 A;  3ERG A;  1GNE A;  2B3S A;  5D9X A;  4K5R A;  3BBY A;  3ZLP A;  1XW5 A;  2NPB A;  2XPE A;  3PPU A;  5DQY A;  2YJH A;  3DD3 A;  2I1U A;  2WJU A;  3ZRE A;  3HVN A;  4NHW A;  1U88 A;  2CAQ A;  13GS A;  2LRN A;  4KSM A;  3VWV A;  1JFU A;  2VM1 A;  1F9M A;  2H75 A;  4G10 A;  3DML A;  2GZZ A;  1EP7 A;  5ECH B;  3EMP A;  3DGQ A;  4XS4 B;  5BMU A;  1ERW A;  3ERF A;  5CO3 A;  1SK2 A;  2QSI A;  2K18 A;  3ZMK A;  3IA1 A;  2REM A;  1GNW A;  3C8E A;  1SYX A;  3QAG A;  5D96 A;  1U6T A;  2H1D A;  1OC3 A;  1WP0 A;  3D6I A;  1SEN A;  3BD2 A;  3WGX A;  4HQS A;  1GUL A;  1TRW A;  4EE0 A;  2CT6 A;  4EO3 A;  4TR4 A;  4RQR A;  1R4W A;  2CX4 A;  2GDR A;  3SWL A;  3J7Y b;  3W8J A;  4K7O A;  5CRE A;  3FZ4 A;  1TK0 B;  3N9J A;  1NHY A;  5CAX A;  3A2V A;  3ERW A;  2I4A A;  4TR1 A;  4NXI A;  1BX9 A;  1YEP A;  3M8N A;  3D4M A;  2AJQ B;  1I9D A;  1O85 A;  3A3T A;  3P7X A;  3TGZ A;  2HXK A;  4K7I A;  4HJ2 A;  3TOU A;  2X49 A;  1M9B A;  5KOX A;  3EUR A;  4NHZ A;  1UN2 A;  4JR4 A;  4MK3 A;  1WPI A;  4N11 A;  1TP9 A;  3QFA C;  1B4Q A;  5JCG A;  19GS A;  1XVW A;  1YF0 A;  5DAL B;  3H93 A;  3HA9 A;  3P90 A;  5E4W A;  4MZW A;  2VL2 C;  1PKZ A;  4X1U A;  4KSO A;  1A0F A;  1CQG A;  1PX7 A;  4NPB A;  4ID0 A;  3E9J B;  2HSY A;  4BVX B;  1X0R A;  3LSZ A;  2LV3 A;  5IIZ A;  4N30 A;  3TRX A;  2GLR A;  5DVB A;  1GTB A;  1ZCP A;  2VCX A;  2C3T A;  4ZBB A;  4O5Q A;  3CMI A;  1K3L A;  4ECC A;  3EMX A;  1GSE A;  1FG4 A;  5JWR B;  1EWX A;  5DQS A;  2LEG A;  4GF0 A;  5ECI B;  4Z2U A;  1M2B A;  17GS A;  3QOU A;  2DBC A;  2C3N A;  2FUG 2;  1SKR B;  1R5P A;  1EEM A;  1GSQ A;  5D8I A;  1GSD A;  1YEX A;  1BYE A;  4TVE A;  4MLY A;  1MD3 A;  3SBC A;  2YN1 A;  4IN0 A;  2PGT A;  2K9F A;  1XCC A;  1FO5 A;  1SYR A;  3TJF A;  2KHP A;  3PIN A;  4HU7 A;  2UZ8 A;  3MDK A;  5KN1 A;  5A4W A;  4JED A;  1G7E A;  6GSX A;  2GSS A;  1V57 A;  4TR1 B;  4MF5 A;  4AGS A;  3VPQ A;  3GH6 A;  1GUK A;  5KN3 A;  2ON7 A;  3HY2 A;  1Z5Y E;  3GKX A;  3UMA A;  1ST9 A;  2B1K A;  2I9H A;  4JBB A;  3RPN A;  1SK0 A;  1YDK A;  2GGT A;  3I6A A;  2H71 A;  5GST A;  14GS A;  5ECQ B;  1T4Z A;  4PGT A;  1ZOF A;  4L8E A;  2CZ2 A;  1M0U A;  2H8L A;  2R4V A;  3ME7 A;  2L5L A;  3Q6O A;  4FYC A;  4O5U A;  4JR6 A;  2N5B A;  4PNG A;  4YAP A;  3R2Q A;  5B6N A;  4A5P A;  4GXZ A;  1JZO A;  4BPY A;  1ZZY A;  2Z9S A;  4ICY A;  3Q19 A;  3UJ1 A;  4KAE A;  3GST A;  22GS A;  4LMV A;  2J9H A;  4XRA A;  2OJL A;  1DSB A;  4HOJ A;  5A4V A;  4IS0 A;  4Z2T A;  2O89 A;  1GP1 A;  2XC2 A;  2JZT A;  2VL2 A;  2C80 A;  5ECS A;  5F8B A;  5L71 A;  3F4T A;  2VCV A;  4XCS A;  3IOS A;  2DIZ A;  4GQF A;  2YZU A;  2FWG A;  3GTU A;  2QA1 A;  5CRD A;  4ZXG A;  4FYB A;  2HE3 A;  2LRC A;  2FY6 A;  4WBJ A;  3F6F A;  4CY6 A;  2WCI A;  5DAK B;  4I5Q A;  2FNO A;  5H5R A;  3KH7 A;  2C0G A;  5J5N A;  2EIQ A;  1PQN A;  4KUN A;  1Z6M A;  1EZK A;  3FR6 A;  3TKP A;  3GUS A;  2MMZ A;  1AQW A;  4K1F A;  3CYN A;  2X8H A;  3QFB C;  2HT9 A;  2H01 A;  4POL A;  4F0C A;  2JSZ A;  1K0O A;  2BMX A;  4L0W A;  2M46 A;  4HZ4 A;  5D73 A;  6GSV A;  1JHB A;  1N2A A;  4YAV A;  5CRH A;  2QC7 A;  4KF9 A;  1EGR A;  1OKD A;  4BIK A;  5KN0 A;  2K8S A;  3J7Y k;  1XWK A;  1GWC A;  1GSY A;  4G0K A;  2FWE A;  2TIR A;  5ENU A;  5ELA A;  3TDG A;  2YWN A;  4OO4 A;  4G2E A;  4G19 A;  4I2T A;  1X5E A;  1FOH A;  2NBS A;  3GKM A;  4TOP A;  2YWI A;  1ZYE A;  4K2D A;  5F06 A;  2FWF A;  1KEB A;  4XRD A;  3G7J A;  1XOA A;  2LNT A;  12GS A;  3TKS C;  2LJA A;  1OAZ A;  3LJR A;  3MNG A;  3LGC A;  2N5F A;  4ZB9 A;  2LST A;  3MWH A;  4GWR A;  4E8H A;  1A2L A;  6GST A;  4QL9 A;  1THX A;  1Z7P A;  3C1S A;  1HNA A;  3UAP A;  1I5G A;  1A8L A;  5CRW A;  5ECK B;  1PD2 1;  3GX8 A;  3CRU A;  1JZW A;  3UOM A;  1B8X A;  4JE1 A;  3TCO A;  2R2J A;  3HXS A;  1A23 A;  2CAI A;  4I97 A;  1O7U A;  3EE2 A;  4HS1 A;  4RI7 A;  1DBY A;  3CSH A;  2HRK A;  4K5S A;  2O7K A;  3HVV A;  2FWH A;  4XTS A;  4DVC A;  2TRC P;  2F9S A;  2HI7 A;  3EIN A;  5AN1 A;  4PNF A;  1R5A A;  3ZVJ A;  4BWQ A;  3LFL A;  3IV4 A;  3DIE A;  5IO0 A;  3S9F A;  1E2Y A;  4MZC A;  2A4V A;  2H6X A;  3KP8 A;  3RHC A;  4PXO A;  3KEB A;  2GS3 A;  4ML6 A;  5GAN D;  2I3Y A;  2VCT A;  2O87 A;  4P3Y B;  1XZO A;  4HJM A;  3E0U A;  4JZQ A;  2OBI A;  1TK8 B;  4G0I A;  4ISD A;  2P5R A;  5AIS A;  3UVH A;  1FAA A;  2AUV A;  1Q98 A;  1SL0 B;  1K0C A;  2PER A;  2WRT A;  4O7H A;  1HYU A;  3CBU A;  3M9J A;  2FLS A;  4CDO A;  2DMM A;  2FD3 A;  4EIP A;  3D21 A;  1OKT A;  1AC1 A;  4RQX A;  3GL5 A;  1Q4J A;  5CYY A;  2L4Q A;  5C04 A;  1J9B A;  3GRX A;  5B7C A;  5JCU A;  2GTU A;  3M9K A;  2H1G A;  1GLP A;  5AGY A;  1B4P A;  3V1W A;  2QGV A;  5H5S A;  4BL7 A;  3H8Q A;  2H66 A;  4KCE A;  4DSS B;  3DWV A;  3CRT A;  1XW9 A;  3VI7 A;  2GT5 A;  5DDL A;  4AJ8 A;  1T4Y A;  2F8A A;  1BJX A;  2OA7 A;  2B5Y A;  3WYW A;  3NZN A;  5ELG A;  10GS A;  4K8M A;  3HD5 A;  1H75 A;  1O8X A;  3FZ5 A;  2H0G A;  3EWL A;  2JZR A;  3TKS A;  2IMI A;  3KMN A;  1PA3 A;  3KD0 A;  3KCM A;  2R3X A;  5FHI A;  1MEK A;  2H0I A;  3FZ9 A;  2LTK A;  3ISO A;  4V1A g;  1A24 A;  3HVS A;  2AHE A;  2ALB A;  4L5O A;  4Q5F A;  4WR4 A;  3F4S A;  4PQ1 A;  2E7P A;  1JLV A;  1F6M C;  2VCZ A;  1X5D A;  4LA1 A;  5IOW A;  3G7I A;  2A4H A;  2CVB A;  2LKU A;  1X5C A;  1XXU A;  3LEF A;  4MCU A;  2IMF A;  2LJR A;  4F03 A;  4I2U A;  2GQK A;  1PGT A;  2F51 A;  2L57 A;  3G7Y A;  4DEJ A;  1NSW A;  2YP6 A;  4GST A;  3IDV A;  1SKW B;  5H5Q A;  1YZX A;  1A8Y A;  5A4U A;  2OKA A;  3IC8 A;  2A2R A;  1ABA A;  4TXO B;  4KA0 A;  1GTA A;  2L59 A;  1B9Y C;  3CSJ A;  2HRF A;  1O73 A;  5GSS A;  1XW6 A;  2H70 A;  2C4J A;  1PKW A;  3WT1 A;  1MTC A;  2DML A;  4OMV A;  1WRY A;  1FVJ A;  3VPT A;  1ZL9 A;  3F3Q A;  4XS6 A;  5D9V A;  3ME8 A;  1EP8 A;  4FYU A;  3IHG A;  2G0F A;  1QK8 A;  2YV9 A;  5BRT A;  4O32 A;  1XG8 A;  4MPG A;  1O8W A;  2IN3 A;  1G0T A;  5LCZ A;  1T8E B;  4OD7 A;  3WT2 A;  1OE7 A;  4I6X A;  4JRR A;  4IHU A;  4KDX A;  4Q5Q A;  1EOH A;  4MJA A;  3VWX A;  2A2S A;  3FK8 A;  1MDI A;  4X4J A;  2MZC A;  3KZQ A;  4NWY A;  1TW9 A;  5EPF A;  2RUF A;  3F4R A;  4K7N A;  3TOT A;  3IAM 2;  3ZYW A;  1ZMA A;  3KGK A;  2DLX A;  3IC4 A;  1T3B A;  5DJL A;  6GSS A;  2CA8 A;  1VF4 A;  4IJI A;  1ZYP A;  3O6T A;  3EVI A;  2VD1 A;  3GH9 A;  3IHQ A;  1XBS A;  3EU3 A;  3BCK A;  5HR2 A;  4MAB A;  4PQI A;  1K0B A;  2GZP A;  4K6X A;  5IPG A;  3D0Z A;  2IL3 A;  3TRQ A;  4EUY A;  11GS A;  5INY A;  3H1N A;  3ZVJ D;  4EC0 A;  4USS A;  5GZZ B;  3QAW A;  2CVD A;  5HFG A;  1A2J A;  4NAX A;  5G31 A;  5LNK e;  4GSS A;  4XHM A;  5G5F A;  2VCW A;  2LJK A;  1HQO A;  2HSH A;  4GCI A;  7GSS A;  4O5R A;  1F2E A;  2PPT A;  2YOI A;  5HR0 A;  2F8F A;  3UBL A;  1BQ7 A;  4IVF A;  2CV4 A;  4MJE A;  2X99 A;  3NOF A;  4BA7 A;  1TDI A;  2GZY A;  2RM6 A;  4MH2 A;  4ULX A;  3VI5 A;  4F9Z A;  2DJ2 A;  3TJG A;  1ON4 A;  1AUC A;  1Z3E A;  1LJR A;  3IK7 A;  4MF6 A;  5FT3 A;  2R0G A;  3M0F A;  6GSW A;  2MYG A;  1TTZ A;  4TR0 A;  2H6Z A;  1V98 A;  4KW6 A;  1R7H A;  1QQ2 A;  4MH3 A;  3FY7 A;  3QDN A;  1YKA A;  2VOC A;  1XPV A;  4POK A;  2YNX A;  1TJD A;  1GUH A;  3WD6 A;  4IJ3 A;  2MMN A;  2H0H A;  4AF2 A;  2DC5 A;  1CQH A;  1M2D A;  2BTO T;  2NDO A;  3RBT A;  3KJY A;  4WF5 A;  2GVP A;  3C71 A;  1GSU A;  4HI7 A;  1Z9H A;  1K0A A;  5HQP A;  1YQ1 A;  2XBI A;  4V2M A;  4HDE A;  2FGX A;  4ZBD A;  3O76 A;  4HZ2 A;  3H4K A;  1XWG A;  4J57 E;  5IPH A;  3GA4 A;  2L4C A;  5DBQ A;  2OE1 A;  3LYP A;  5DJM A;  4XS1 A;  4ZIL A;  1J08 A;  2P31 A;  4NV5 A;  2H1B A;  1SL1 B;  1AIU A;  1C72 A;  5JWO B;  1YY7 A;  4F2I A;  4ML1 A;  5EVO A;  3ZFL A;  3D4T A;  2FA4 A;  4KX4 A;  1A0R P;  3QMX A;  2GST A;  3U6V A;  1E6B A;  2JL4 A;  1AQX A;  2R37 A;  3TUE A;  2H30 A;  4EVM A;  1VRS D;  1NW2 A;  4AJ7 A;  1BED A;  5IMC A;  4H86 A;  2HSM A;  2YPM A;  2YJ7 A;  4E8E A;  1JZR A;  4LMW A;  2XHF A;  3BCI A;  5J41 A;  3GN3 A;  1DE1 A;  5D9T A;  4IP6 A;  2KP1 A;  2VL3 A;  2R6K A;  3EPT A;  4QL7 A;  1S3A A;  3FEU A;  4KND A;  3Q74 A;  4X43 A;  1WOU A;  3P2A A;  3HVX A;  3C73 A;  4NV2 A;  2IMD A;  4BWS A;  2R0P A;  1ERT A;  1SJI A;  4K2X A;  1YKC A;  2NTO A;  3ZZX A;  4K0N A;  3LXT A;  3HZ4 A;  3DVX A;  5ABR A;  2VO4 A;  2EIR A;  3C1R A;  4PX1 A;  4LLR A;  4Q5N A;  4PTS A;  1J0F A;  4ILF A;  2HRA A;  2YWO A;  2RUE A;  2B6M A;  5FWG A;  2VIM A;  4DSR A;  4EIQ A;  2KP2 A;  3KTL A;  1S3D A;  1N8J A;  5ID2 A;  2PBJ A;  2H73 A;  2L6D A;  3F63 A;  3APQ A;  2WUL A;  3Q18 A;  1KNG A;  2LS5 A;  4EXJ A;  1OE8 A;  4X0X A;  3L9U A;  3APS A;  2KUC A;  1ZYQ B;  1UA5 A;  1LBK A;  4ECI A;  3QD9 A;  2R0C A;  2L6C A;  3GL3 A;  1WE0 A;  1WIK A;  4XIH A;  3L0H A;  1QUW A;  4V2N A;  1U87 A;  1AW9 A;  3RDW A;  3GTU B;  4L0U A;  3VWW A;  4WXT A;  1S3C A;  3UL3 A;  3L9S A;  4Q5R A;  4HU9 A;  3DEX A;  3A5I A;  1JLW A;  2V41 A;  1SU9 A;  4GSN A;  4MA9 A;  3DYR A;  1USB A;  4IQA A;  2AYT A;  3E3E A;  1T1V A;  4ECB A;  3NIV A;  2PWJ A;  2RII A;  2X8C A;  2ZCT A;  3KMO A;  4IEL A;  3OR5 A;  2LUS A;  5F07 A;  1B9X C;  1XOB A;  5JWQ B;  5D9W A;  3H79 A;  3PGT A;  1ERU A;  4GRF A;  3CSI A;  2HFD A;  3A2X A;  5HFI A;  3MYD A;  1BG5 A;  1OVN A;  4RUV A;  2F3M A;  2HZE A;  3ZIV A;  2K6V A;  1VF3 A;  4IP1 A;  3LWA A;  4HSC X;  5HFK A;  3TB2 A;  3CXG A;  1HNB A;  1QGV A;  3LXZ A;  3C7M A;  4PUA A;  1SKS B;  1TU8 A;  1O6J A;  4XS4 A;  1PFO A;  2OE0 A;  3O3T A;  1Y25 A;  1RW1 A;  4WBR D;  5ID2 B;  3IRA A;  1SD8 A;  4D73 A;  1MD4 A;  3VUR A;  1K3O A;  4OO5 A;  20GS A;  9GSS A;  1X9W B;  5IMA A;  5B8A A;  2VAF A;  5ECN B;  1XWC A;  4FO5 A;  2B5X A;  1VF1 A;  4GLT A;  1X9M B;  1TI3 A;  1NM3 A;  3KM6 A;  2VLT A;  1PRX A;  5IO2 A;  5J9C A;  4OCE A;  5EL8 A;  4KB3 A;  4WEY A;  5LD0 A;  1KBN A;  3TKQ A;  3CQF A;  4PUF C;  5KOW A;  4I8B A;  5C00 A;  1XWA A;  4DSQ A;  4FQU A;  1UVZ A;  1RK4 A;  3FW2 A;  2J23 A;  4JU5 A;  2YWM A;  3KP9 A;  1AQV A;  2HYX A;  2JU5 A;  1X9S B;  2KLX A;  2X64 A;  1GH2 A;  1Z7R A;  3PH9 A;  3DKS A;  5F0G A;  2M80 A;  2H6Y A;  3CTG A;  4EDZ A;  2PVQ A;  16GS A;  2GT6 A;  5JCW A;  3IBH A;  4ZB8 A;  4GQC A;  3LOR A;  4HUA A;  1MDJ A;  3IXR A;  3TKR A;  2YCD A;  5DAL A;  2PN8 A;  5IMV A;  2HZE B;  2V6K A;  3LG6 A;  4L5L A;  3P8W A;  3D5J A;  4Z7X A;  4CW9 A;  1GSF A;  4BVX A;  2M72 A;  1GRX A;  1VF2 A;  2E0Q A;  2VUP A;  1DE2 A;  1TK5 B;  1ERV A;  3GSS A;  1TRU A;  2OBK A;  3F6D A;  5ECM B;  5ECR B;  2HNL A;  1DUG A;  5G2Z A;  2VLV A;  4D73 B;  4RI6 A;  3PR8 A;  4FIW A;  1QFN A;  2YZH A;  1GLQ A;  1NHO A;  3IAS 2;  3UAR A;  2LRT A;  4G9H A;  1T7P B;  1QXH A;  3I43 A;  3GFK A;  4WET A;  4BL7 B;  4MMM A;  1TU7 A;  1H4O A;  3ZML A;  4IGJ A;  4K0G A;  1ILO A;  1O81 A;  3L4N A;  2HLS A;  4MDC A;  4MPF A;  2GSR A;  3EU4 A;  1M3I A;  3LW9 A;  5IMF A;  2KOK A;  18GS A;  4YKF A;  1PN9 A;  4N0V A;  3KH9 A;  1PMT A;  2LNS A;  2C3Q A;  2MBS A;  2DIY A;  2C1Y A;  3W6G A;  4FH8 A;  2RLI A;  2B7J A;  4YQV A;  3LQ7 A;  4ACS A;  5DCG A;  1T00 A;  1HNC A;  4OFM A;  3GX0 A;  3VWU A;  4KDY A;  2OAC A;  2O8V B;  2IWT A;  5HR3 A;  1G6Y A;  2C0F A;  2FCH A;  2IFQ A;  4IW9 A;  3A2W A;  2ZUP A;  1GL8 A;  1M99 A;  2MBT A;  5A5K A;  4POB A;  2VCQ A;  4MZB A;  3HJM A;  4MJC A;  1PX6 A;  4WR5 A;  5DCH A;  3HHV A;  1M3J A;  3FR3 A;  4V2L A;  1K0N A;  1Y6E A;  1S3R A;  2B1L A;  3K8N A;  1PN0 A;  1R26 A;  1GUM A;  3TJJ A;  4TKY A;  5F05 A;  2BJX A;  6GSU A;  2N5A A;  5D93 A;  4OFT A;  3A5W A;  2EIO A;  5EY6 A;  3UIW A;  4LL4 B;  2RM5 A;  2PVO C;  2CZ3 A;  2AB6 A;  4ZL7 A;  2JZS A;  4AJ6 A;  2MMA A;  3APO A;  2WB9 A;  1F3B A;  2DJK A;  4OWY A;  4LL1 B;  3G9B A;  4TR3 A;  1URM A;  1W4V A;  3W8S A;  2CQ9 A;  3FHK A;  4QQ7 A;  4J2F A;  3JCM L;  3ZL5 A;  3QPM A;  2DSA A;  2WGR A;  4G0L A;  3QR6 A;  2TRX A;  5AIX A;  5CP1 A;  3VLN A;  1UC7 A;  4MNN A;  5DAK A;  2VL9 A;  3ZIJ A;  2FA8 A;  5IMZ A;  1XIY A;  5J4U A;  4HQZ A;  1V9W A;  3CTF A;  5COH A;  1V40 A;  1AAZ A;  1K3Y A;  3L78 A;  2HRN A;  1XWB A;  3EC3 A;  1W89 A;  1K0D A;  5GAP D;  3FYG A;  6GSY A;  2IFQ B;  1GTU A;  3FMW A;  4IBP A;  1V2A A;  1SL2 B;  3DXB A;  2DJ1 A;  2GQM A;  4IKH A;  5J9B A;  1SJ6 A;  2ON5 A;  3QCP A;  3ED3 A;  1HD2 A;  2H76 A;  5B8B A;  2QA2 A;  4ZL9 A;  2GQL A;  2XPD A;  3ZFB A;  1B48 A;  2P5Q A;  1FB0 A;  4MF7 A;  2C0E A;  2WS2 A;  5B6M A;  2HZF A;  4OCF A;  2X8G A;  2CX3 A;  4CY8 A;  2DKH A;  3EYT A;  3U5R E;  3HDC A;  3ZIT A;  2L5O A;  4F0B A;  1MDK A;  3FKF A;  1QMV A;  1PL1 A;  5AIV A;  1EGO A;  1M2A A;  3F3R A;  3GMF A;  3L9V A;  2QKE A;  2YV7 A;  5G1K A;  3QAV A;  4KCA A;  2H72 A;  3LYK A;  1TRV A;  3F9U A;  4N0Z A;  4ECJ A;  4O92 A;  3ZRD A;  4YQM A;  1M9A A;  2V6O A;  1ZYN A;  1BAY A;  5E59 A;  3TJK A;  4KGI A;  1TI1 A;  1TOF A;  3MAK A;  2R5G A;  2AAW A;  3M1G A;  2X4A A;  4CHS A;  4EKZ A;  2DJJ A;  1SD9 A;  1SK1 A;  2IJY A;  1OC9 A;  1XFL A;  1EV9 A;  4F82 A;  1VGL A;  2K8V A;  3DVW A;  3IR4 A;  2FHE A;  4BVY A;  2V32 A;  3TRP A;  4PQH A;  2LQQ A;  1RQM A;  2ES7 A;  1AXD A;  2OAD A;  2EC4 A;  2H1A A;  5ECP B;  2P0G A;  4IQ1 A;  4POM A;  3RHB A;  2PUK C;  3VFI A;  2H74 A;  4N10 A;  2B7K A;  3IK9 A;  5HR1 A;  4Z2R A;  3WGD A;  2VM2 A;  1F37 A;  1PSQ A;  2ZNM A;  4KDU A;  2WZ9 A;  3TKS E;  1U3A A;  3BOA A;  5IQY A;  4K9Z A;  1XVQ A;  1FW1 A;  2OE3 A;  2DJ0 A;  2JSY A;  2VLU A;  2V2G A;  4TRX A;  1EOG A;  1KTE A;  1ML6 A;  2WFC A;  3VK9 A;  4EDY A;  1TXX A;  5CNW A;  3ZTL A;  3HYP A;  3TJB A;  3GHA A;  4NMU A;  3DRN A;  3HCZ A;  1YF1 A;  4OFN A;  2E2M A;  2IMK A;  1IYI A;  2PU9 C;  5KEJ A;  3FZA A;  1LU4 A;  2C0D A;  4MP4 A;  4DSS A;  1WMJ A;  3HKR A;  3KTB A;  2VD0 A;  3D22 A;  4ZBA A;  4WF4 A;  4TN8 A;  1SJZ A;  5G5E A;  3HJO A;  1U3I A;  4WKW A;  3F8U A;  5IMD A;  1A2M A;  3BJ5 A;  4ZB6 A;  4J56 E;  3UBK A;  2NVL A;  3AY8 A;  3GKN A;  3HJP A;  2B5E A;  2IME A;  2YAN A;  5G1L A;  1FVK A;  1EEJ A;  3R3E A;  4ZL8 A;  1V58 A;  1JZD A;  4TXV A;  3FR9 A;  3GIX A;  3MSZ A;  3KXO A;  2D2Z A;  2XBQ A;  2H19 A;  1OC9 B;  3N5O A;  1Z6N A;  1YJ6 A;  3UEM A;  4YQU A;  1PL2 A;  1IYH A;  1THO A;  1ZGN A;  3IPZ A;  2O85 A;  3GUR A;  1G6W A;  3GKK A;  4BVY B;  2C8U A;  1TRS A;  1G7O A;  3KIJ A;  3GV1 A;  5ECO B;  1M7T A;  3MIX A;  3RPP A;  2E2G A;  5G30 A;  4MJB A;  8GSS A;  2A2P A;  2JAC A;  4ZIJ A;  1FOV A;  2IPA A;  3F0I A;  3GYK A;  1ACV A;  4YH2 A;  2AV4 A;  5J3R A;  4YKG A;  2LQO A;  2CVK A;  1K0M A;  3IE3 A;  2G2Q A;  4PUR A;  4KE3 A;  5ECL B;  4TW5 A;  4GTU A;  3US3 A;  2DKI A;  1FHE A;  2V1M A;  1WJK A;  5KN2 A;  2JAD A;  1FB6 A;  4EL1 A;  4TXO A; 
#chains in the Genus database with same CATH homology
 3I69 A;  1F3A A;  3GNJ A;  2I81 A;  2IIY A;  2GSQ A;  1WWJ A;  2DJ3 A;  3UVT A;  2PMT A;  5IOX A;  4HEA 2;  1GTI A;  3I9V 2;  1EV4 A;  1OYJ A;  1TKD B;  3WGE A;  5IM9 A;  5CRG A;  3FRC A;  2MMO A;  4KH7 A;  3RAZ A;  3M3M A;  1GSS A;  2WDU A;  1OC8 A;  4V1A p;  3HZ8 A;  4EF0 A;  3ERG A;  1GNE A;  2B3S A;  5D9X A;  4K5R A;  3BBY A;  3ZLP A;  1XW5 A;  2NPB A;  2XPE A;  3PPU A;  5DQY A;  2YJH A;  3DD3 A;  2I1U A;  2WJU A;  3ZRE A;  4NHW A;  1U88 A;  2CAQ A;  13GS A;  2LRN A;  4KSM A;  3VWV A;  1JFU A;  2VM1 A;  1F9M A;  2H75 A;  4G10 A;  3DML A;  2GZZ A;  1EP7 A;  5ECH B;  3EMP A;  3DGQ A;  4XS4 B;  5BMU A;  1ERW A;  3ERF A;  5CO3 A;  1SK2 A;  2QSI A;  2K18 A;  3ZMK A;  3IA1 A;  2REM A;  1GNW A;  3C8E A;  1SYX A;  3QAG A;  5D96 A;  1U6T A;  2H1D A;  1OC3 A;  1WP0 A;  3D6I A;  1SEN A;  3BD2 A;  3WGX A;  4HQS A;  1GUL A;  1TRW A;  4EE0 A;  2CT6 A;  4EO3 A;  4TR4 A;  4RQR A;  1R4W A;  2CX4 A;  2GDR A;  3SWL A;  3J7Y b;  3W8J A;  4K7O A;  5CRE A;  3FZ4 A;  1TK0 B;  3N9J A;  1NHY A;  5CAX A;  3A2V A;  3ERW A;  2I4A A;  4TR1 A;  4NXI A;  1BX9 A;  1YEP A;  3M8N A;  3D4M A;  2AJQ B;  1I9D A;  1O85 A;  3A3T A;  3P7X A;  3TGZ A;  2HXK A;  4K7I A;  4HJ2 A;  3TOU A;  2X49 A;  1M9B A;  5KOX A;  3EUR A;  4NHZ A;  1UN2 A;  4JR4 A;  4MK3 A;  1WPI A;  4N11 A;  1TP9 A;  3QFA C;  1B4Q A;  5JCG A;  19GS A;  1XVW A;  1YF0 A;  5DAL B;  3H93 A;  3HA9 A;  3P90 A;  5E4W A;  4MZW A;  2VL2 C;  1PKZ A;  4X1U A;  4KSO A;  1A0F A;  1CQG A;  1PX7 A;  4NPB A;  4ID0 A;  3E9J B;  2HSY A;  4BVX B;  1X0R A;  3LSZ A;  2LV3 A;  5IIZ A;  4N30 A;  3TRX A;  2GLR A;  5DVB A;  1GTB A;  1ZCP A;  2VCX A;  2C3T A;  4ZBB A;  4O5Q A;  3CMI A;  1K3L A;  4ECC A;  3EMX A;  1GSE A;  1FG4 A;  5JWR B;  1EWX A;  5DQS A;  2LEG A;  4GF0 A;  5ECI B;  4Z2U A;  1M2B A;  17GS A;  3QOU A;  2DBC A;  2C3N A;  2FUG 2;  1SKR B;  1R5P A;  1EEM A;  1GSQ A;  5D8I A;  1GSD A;  1YEX A;  1BYE A;  4TVE A;  4MLY A;  1MD3 A;  3SBC A;  2YN1 A;  4IN0 A;  2PGT A;  2K9F A;  1XCC A;  1FO5 A;  1SYR A;  3TJF A;  2KHP A;  3PIN A;  4HU7 A;  2UZ8 A;  3MDK A;  5KN1 A;  5A4W A;  4JED A;  1G7E A;  6GSX A;  2GSS A;  1V57 A;  4TR1 B;  4MF5 A;  4AGS A;  3VPQ A;  3GH6 A;  1GUK A;  5KN3 A;  2ON7 A;  3HY2 A;  1Z5Y E;  3GKX A;  3UMA A;  1ST9 A;  2B1K A;  2I9H A;  4JBB A;  3RPN A;  1SK0 A;  1YDK A;  2GGT A;  3I6A A;  2H71 A;  5GST A;  14GS A;  5ECQ B;  1T4Z A;  4PGT A;  1ZOF A;  4L8E A;  2CZ2 A;  1M0U A;  2H8L A;  2R4V A;  3ME7 A;  2L5L A;  3Q6O A;  4FYC A;  4O5U A;  4JR6 A;  2N5B A;  4PNG A;  4YAP A;  3R2Q A;  5B6N A;  4A5P A;  4GXZ A;  1JZO A;  4BPY A;  1ZZY A;  2Z9S A;  4ICY A;  3Q19 A;  3UJ1 A;  4KAE A;  3GST A;  22GS A;  4LMV A;  2J9H A;  4XRA A;  2OJL A;  1DSB A;  4HOJ A;  5A4V A;  4IS0 A;  4Z2T A;  2O89 A;  1GP1 A;  2XC2 A;  2JZT A;  2VL2 A;  2C80 A;  5ECS A;  5F8B A;  5L71 A;  3F4T A;  2VCV A;  4XCS A;  3IOS A;  2DIZ A;  4GQF A;  2YZU A;  2FWG A;  3GTU A;  2QA1 A;  5CRD A;  4ZXG A;  4FYB A;  2HE3 A;  2LRC A;  2FY6 A;  4WBJ A;  3F6F A;  4CY6 A;  2WCI A;  5DAK B;  4I5Q A;  2FNO A;  5H5R A;  3KH7 A;  2C0G A;  5J5N A;  2EIQ A;  1PQN A;  4KUN A;  1Z6M A;  1EZK A;  3FR6 A;  3TKP A;  3GUS A;  2MMZ A;  1AQW A;  4K1F A;  3CYN A;  2X8H A;  3QFB C;  2HT9 A;  2H01 A;  4POL A;  4F0C A;  2JSZ A;  1K0O A;  2BMX A;  4L0W A;  2M46 A;  4HZ4 A;  5D73 A;  6GSV A;  1JHB A;  1N2A A;  4YAV A;  5CRH A;  2QC7 A;  4KF9 A;  1EGR A;  1OKD A;  5KN0 A;  2K8S A;  3J7Y k;  1XWK A;  1GWC A;  1GSY A;  4G0K A;  2FWE A;  2TIR A;  5ENU A;  5ELA A;  3TDG A;  2YWN A;  4OO4 A;  4G2E A;  4G19 A;  4I2T A;  1X5E A;  1FOH A;  2NBS A;  3GKM A;  4TOP A;  2YWI A;  1ZYE A;  4K2D A;  5F06 A;  2FWF A;  1KEB A;  4XRD A;  3G7J A;  1XOA A;  2LNT A;  12GS A;  3TKS C;  2LJA A;  1OAZ A;  3LJR A;  3MNG A;  3LGC A;  2N5F A;  4ZB9 A;  2LST A;  3MWH A;  4GWR A;  4E8H A;  1A2L A;  6GST A;  4QL9 A;  1THX A;  1Z7P A;  3C1S A;  1HNA A;  3UAP A;  1I5G A;  1A8L A;  5CRW A;  5ECK B;  1PD2 1;  3GX8 A;  3CRU A;  1JZW A;  3UOM A;  1B8X A;  4JE1 A;  3TCO A;  2R2J A;  3HXS A;  1A23 A;  2CAI A;  4I97 A;  1O7U A;  3EE2 A;  4HS1 A;  4RI7 A;  1DBY A;  3CSH A;  2HRK A;  4K5S A;  2O7K A;  3HVV A;  2FWH A;  4XTS A;  4DVC A;  2TRC P;  2F9S A;  2HI7 A;  3EIN A;  5AN1 A;  4PNF A;  1R5A A;  3ZVJ A;  4BWQ A;  3LFL A;  3IV4 A;  3DIE A;  5IO0 A;  3S9F A;  1E2Y A;  4MZC A;  2A4V A;  2H6X A;  3KP8 A;  3RHC A;  4PXO A;  3KEB A;  2GS3 A;  4ML6 A;  5GAN D;  2I3Y A;  2VCT A;  2O87 A;  4P3Y B;  1XZO A;  4HJM A;  3E0U A;  4JZQ A;  2OBI A;  1TK8 B;  4G0I A;  4ISD A;  2P5R A;  5AIS A;  3UVH A;  1FAA A;  2AUV A;  1Q98 A;  1SL0 B;  1K0C A;  2PER A;  2WRT A;  4O7H A;  1HYU A;  3CBU A;  3M9J A;  2FLS A;  4CDO A;  2DMM A;  2FD3 A;  4EIP A;  3D21 A;  1OKT A;  1AC1 A;  4RQX A;  3GL5 A;  1Q4J A;  5CYY A;  2L4Q A;  5C04 A;  1J9B A;  3GRX A;  5B7C A;  5JCU A;  2GTU A;  3M9K A;  2H1G A;  1GLP A;  5AGY A;  1B4P A;  3V1W A;  2QGV A;  5H5S A;  4BL7 A;  3H8Q A;  2H66 A;  4KCE A;  4DSS B;  3DWV A;  3CRT A;  1XW9 A;  3VI7 A;  2GT5 A;  5DDL A;  4AJ8 A;  1T4Y A;  2F8A A;  1BJX A;  2OA7 A;  2B5Y A;  3WYW A;  3NZN A;  5ELG A;  10GS A;  4K8M A;  3HD5 A;  1H75 A;  1O8X A;  3FZ5 A;  2H0G A;  3EWL A;  2JZR A;  3TKS A;  2IMI A;  3KMN A;  1PA3 A;  3KD0 A;  3KCM A;  2R3X A;  5FHI A;  1MEK A;  2H0I A;  3FZ9 A;  2LTK A;  3ISO A;  4V1A g;  1A24 A;  3HVS A;  2AHE A;  2ALB A;  4L5O A;  4Q5F A;  4WR4 A;  3F4S A;  4PQ1 A;  2E7P A;  1JLV A;  1F6M C;  2VCZ A;  1X5D A;  4LA1 A;  5IOW A;  3G7I A;  2A4H A;  2CVB A;  2LKU A;  1X5C A;  1XXU A;  3LEF A;  4MCU A;  2IMF A;  2LJR A;  4F03 A;  4I2U A;  2GQK A;  1PGT A;  2F51 A;  2L57 A;  3G7Y A;  4DEJ A;  1NSW A;  2YP6 A;  4GST A;  3IDV A;  1SKW B;  5H5Q A;  1YZX A;  1A8Y A;  5A4U A;  2OKA A;  3IC8 A;  2A2R A;  1ABA A;  4TXO B;  4KA0 A;  1GTA A;  2L59 A;  1B9Y C;  3CSJ A;  2HRF A;  1O73 A;  5GSS A;  1XW6 A;  2H70 A;  2C4J A;  1PKW A;  3WT1 A;  1MTC A;  2DML A;  4OMV A;  1WRY A;  1FVJ A;  3VPT A;  1ZL9 A;  3F3Q A;  4XS6 A;  5D9V A;  3ME8 A;  1EP8 A;  4FYU A;  3IHG A;  2G0F A;  1QK8 A;  2YV9 A;  5BRT A;  4O32 A;  4MPG A;  1O8W A;  2IN3 A;  1G0T A;  5LCZ A;  1T8E B;  4OD7 A;  3WT2 A;  1OE7 A;  4I6X A;  4JRR A;  4IHU A;  4KDX A;  4Q5Q A;  1EOH A;  4MJA A;  3VWX A;  2A2S A;  3FK8 A;  1MDI A;  4X4J A;  2MZC A;  3KZQ A;  4NWY A;  1TW9 A;  5EPF A;  2RUF A;  3F4R A;  4K7N A;  3TOT A;  3IAM 2;  3ZYW A;  1ZMA A;  3KGK A;  2DLX A;  3IC4 A;  1T3B A;  5DJL A;  6GSS A;  2CA8 A;  1VF4 A;  4IJI A;  1ZYP A;  3O6T A;  3EVI A;  2VD1 A;  3GH9 A;  3IHQ A;  1XBS A;  3EU3 A;  3BCK A;  5HR2 A;  4MAB A;  4PQI A;  1K0B A;  2GZP A;  4K6X A;  5IPG A;  3D0Z A;  2IL3 A;  3TRQ A;  4EUY A;  11GS A;  5INY A;  3H1N A;  3ZVJ D;  4EC0 A;  4USS A;  5GZZ B;  3QAW A;  2CVD A;  5HFG A;  1A2J A;  4NAX A;  5G31 A;  5LNK e;  4GSS A;  4XHM A;  5G5F A;  2VCW A;  2LJK A;  1HQO A;  2HSH A;  4GCI A;  7GSS A;  4O5R A;  1F2E A;  2PPT A;  2YOI A;  5HR0 A;  2F8F A;  3UBL A;  1BQ7 A;  4IVF A;  2CV4 A;  4MJE A;  2X99 A;  3NOF A;  4BA7 A;  1TDI A;  2GZY A;  2RM6 A;  4MH2 A;  4ULX A;  3VI5 A;  4F9Z A;  2DJ2 A;  3TJG A;  1ON4 A;  1AUC A;  1Z3E A;  1LJR A;  3IK7 A;  4MF6 A;  5FT3 A;  2R0G A;  3M0F A;  6GSW A;  2MYG A;  1TTZ A;  4TR0 A;  2H6Z A;  1V98 A;  4KW6 A;  1R7H A;  1QQ2 A;  4MH3 A;  3FY7 A;  3QDN A;  1YKA A;  2VOC A;  1XPV A;  4POK A;  2YNX A;  1TJD A;  1GUH A;  3WD6 A;  4IJ3 A;  2MMN A;  2H0H A;  4AF2 A;  2DC5 A;  1CQH A;  1M2D A;  2BTO T;  2NDO A;  3RBT A;  3KJY A;  4WF5 A;  2GVP A;  3C71 A;  1GSU A;  4HI7 A;  1Z9H A;  1K0A A;  5HQP A;  1YQ1 A;  2XBI A;  4V2M A;  4HDE A;  2FGX A;  4ZBD A;  3O76 A;  4HZ2 A;  3H4K A;  1XWG A;  4J57 E;  5IPH A;  3GA4 A;  2L4C A;  5DBQ A;  2OE1 A;  3LYP A;  5DJM A;  4XS1 A;  4ZIL A;  1J08 A;  2P31 A;  4NV5 A;  2H1B A;  1SL1 B;  1AIU A;  1C72 A;  5JWO B;  1YY7 A;  4F2I A;  4ML1 A;  5EVO A;  3ZFL A;  3D4T A;  2FA4 A;  4KX4 A;  1A0R P;  3QMX A;  2GST A;  3U6V A;  1E6B A;  2JL4 A;  1AQX A;  2R37 A;  3TUE A;  2H30 A;  4EVM A;  1VRS D;  1NW2 A;  4AJ7 A;  1BED A;  5IMC A;  4H86 A;  2HSM A;  2YPM A;  2YJ7 A;  4E8E A;  1JZR A;  4LMW A;  2XHF A;  3BCI A;  5J41 A;  3GN3 A;  1DE1 A;  5D9T A;  4IP6 A;  2KP1 A;  2VL3 A;  2R6K A;  3EPT A;  4QL7 A;  1S3A A;  3FEU A;  4KND A;  3Q74 A;  4X43 A;  1WOU A;  3P2A A;  3HVX A;  3C73 A;  4NV2 A;  2IMD A;  4BWS A;  2R0P A;  1ERT A;  1SJI A;  4K2X A;  1YKC A;  2NTO A;  3ZZX A;  4K0N A;  3LXT A;  3HZ4 A;  3DVX A;  5ABR A;  2VO4 A;  2EIR A;  3C1R A;  4PX1 A;  4LLR A;  4Q5N A;  4PTS A;  1J0F A;  4ILF A;  2HRA A;  2YWO A;  2RUE A;  2B6M A;  5FWG A;  2VIM A;  4DSR A;  4EIQ A;  2KP2 A;  3KTL A;  1S3D A;  1N8J A;  5ID2 A;  2PBJ A;  2H73 A;  2L6D A;  3F63 A;  3APQ A;  2WUL A;  3Q18 A;  1KNG A;  2LS5 A;  4EXJ A;  1OE8 A;  4X0X A;  3L9U A;  3APS A;  2KUC A;  1ZYQ B;  1UA5 A;  1LBK A;  4ECI A;  3QD9 A;  2R0C A;  2L6C A;  3GL3 A;  1WE0 A;  1WIK A;  4XIH A;  3L0H A;  1QUW A;  4V2N A;  1U87 A;  1AW9 A;  3RDW A;  3GTU B;  4L0U A;  3VWW A;  4WXT A;  1S3C A;  3UL3 A;  3L9S A;  4Q5R A;  4HU9 A;  3DEX A;  3A5I A;  1JLW A;  2V41 A;  1SU9 A;  4GSN A;  4MA9 A;  3DYR A;  1USB A;  4IQA A;  2AYT A;  3E3E A;  1T1V A;  4ECB A;  3NIV A;  2PWJ A;  2RII A;  2X8C A;  2ZCT A;  3KMO A;  4IEL A;  3OR5 A;  2LUS A;  5F07 A;  1B9X C;  1XOB A;  5JWQ B;  5D9W A;  3H79 A;  3PGT A;  1ERU A;  4GRF A;  3CSI A;  2HFD A;  3A2X A;  5HFI A;  3MYD A;  1BG5 A;  1OVN A;  4RUV A;  2F3M A;  2HZE A;  3ZIV A;  2K6V A;  1VF3 A;  4IP1 A;  3LWA A;  5HFK A;  3TB2 A;  3CXG A;  1HNB A;  1QGV A;  3LXZ A;  3C7M A;  4PUA A;  1SKS B;  1TU8 A;  1O6J A;  4XS4 A;  2OE0 A;  3O3T A;  1Y25 A;  1RW1 A;  4WBR D;  5ID2 B;  3IRA A;  1SD8 A;  4D73 A;  1MD4 A;  3VUR A;  1K3O A;  4OO5 A;  20GS A;  9GSS A;  1X9W B;  5IMA A;  5B8A A;  2VAF A;  5ECN B;  1XWC A;  4FO5 A;  2B5X A;  1VF1 A;  4GLT A;  1X9M B;  1TI3 A;  1NM3 A;  3KM6 A;  2VLT A;  1PRX A;  5IO2 A;  5J9C A;  4OCE A;  5EL8 A;  4KB3 A;  4WEY A;  5LD0 A;  1KBN A;  3TKQ A;  4PUF C;  5KOW A;  4I8B A;  5C00 A;  1XWA A;  4DSQ A;  4FQU A;  1UVZ A;  1RK4 A;  3FW2 A;  2J23 A;  4JU5 A;  2YWM A;  3KP9 A;  1AQV A;  2HYX A;  2JU5 A;  1X9S B;  2KLX A;  2X64 A;  1GH2 A;  1Z7R A;  3PH9 A;  3DKS A;  5F0G A;  2M80 A;  2H6Y A;  3CTG A;  4EDZ A;  2PVQ A;  16GS A;  2GT6 A;  5JCW A;  3IBH A;  4ZB8 A;  4GQC A;  3LOR A;  4HUA A;  1MDJ A;  3IXR A;  3TKR A;  2YCD A;  5DAL A;  2PN8 A;  5IMV A;  2HZE B;  2V6K A;  3LG6 A;  4L5L A;  3P8W A;  3D5J A;  4Z7X A;  4CW9 A;  1GSF A;  4BVX A;  2M72 A;  1GRX A;  1VF2 A;  2E0Q A;  2VUP A;  1DE2 A;  1TK5 B;  1ERV A;  3GSS A;  1TRU A;  2OBK A;  3F6D A;  5ECM B;  5ECR B;  2HNL A;  1DUG A;  5G2Z A;  2VLV A;  4D73 B;  4RI6 A;  3PR8 A;  4FIW A;  1QFN A;  2YZH A;  1GLQ A;  1NHO A;  3IAS 2;  3UAR A;  2LRT A;  4G9H A;  1T7P B;  1QXH A;  3I43 A;  3GFK A;  4WET A;  4BL7 B;  4MMM A;  1TU7 A;  1H4O A;  3ZML A;  4IGJ A;  4K0G A;  1ILO A;  1O81 A;  3L4N A;  2HLS A;  4MDC A;  4MPF A;  2GSR A;  3EU4 A;  3LW9 A;  5IMF A;  2KOK A;  18GS A;  4YKF A;  1PN9 A;  4N0V A;  3KH9 A;  1PMT A;  2LNS A;  2C3Q A;  2MBS A;  2DIY A;  2C1Y A;  3W6G A;  4FH8 A;  2RLI A;  2B7J A;  4YQV A;  3LQ7 A;  4ACS A;  5DCG A;  1T00 A;  1HNC A;  4OFM A;  3GX0 A;  3VWU A;  4KDY A;  2OAC A;  2O8V B;  2IWT A;  5HR3 A;  1G6Y A;  2C0F A;  2FCH A;  2IFQ A;  4IW9 A;  3A2W A;  2ZUP A;  1GL8 A;  1M99 A;  2MBT A;  5A5K A;  4POB A;  2VCQ A;  4MZB A;  3HJM A;  4MJC A;  1PX6 A;  4WR5 A;  5DCH A;  3HHV A;  3FR3 A;  4V2L A;  1K0N A;  1Y6E A;  2B1L A;  3K8N A;  1PN0 A;  1R26 A;  1GUM A;  3TJJ A;  4TKY A;  5F05 A;  2BJX A;  6GSU A;  2N5A A;  5D93 A;  4OFT A;  3A5W A;  2EIO A;  5EY6 A;  3UIW A;  4LL4 B;  2RM5 A;  2PVO C;  2CZ3 A;  2AB6 A;  4ZL7 A;  2JZS A;  4AJ6 A;  2MMA A;  3APO A;  2WB9 A;  1F3B A;  2DJK A;  4OWY A;  4LL1 B;  3G9B A;  4TR3 A;  1URM A;  1W4V A;  3W8S A;  2CQ9 A;  3FHK A;  4QQ7 A;  4J2F A;  3JCM L;  3ZL5 A;  3QPM A;  2DSA A;  2WGR A;  4G0L A;  3QR6 A;  2TRX A;  5AIX A;  5CP1 A;  3VLN A;  1UC7 A;  4MNN A;  5DAK A;  2VL9 A;  3ZIJ A;  2FA8 A;  5IMZ A;  1XIY A;  5J4U A;  4HQZ A;  1V9W A;  3CTF A;  5COH A;  1V40 A;  1AAZ A;  1K3Y A;  3L78 A;  2HRN A;  1XWB A;  3EC3 A;  1W89 A;  1K0D A;  5GAP D;  3FYG A;  6GSY A;  2IFQ B;  1GTU A;  3FMW A;  4IBP A;  1V2A A;  1SL2 B;  3DXB A;  2DJ1 A;  2GQM A;  4IKH A;  5J9B A;  1SJ6 A;  2ON5 A;  3QCP A;  3ED3 A;  1HD2 A;  2H76 A;  5B8B A;  2QA2 A;  4ZL9 A;  2GQL A;  2XPD A;  3ZFB A;  1B48 A;  2P5Q A;  1FB0 A;  4MF7 A;  2C0E A;  2WS2 A;  5B6M A;  2HZF A;  4OCF A;  2X8G A;  2CX3 A;  4CY8 A;  2DKH A;  3EYT A;  3U5R E;  3HDC A;  3ZIT A;  2L5O A;  4F0B A;  1MDK A;  3FKF A;  1QMV A;  1PL1 A;  5AIV A;  1EGO A;  1M2A A;  3F3R A;  3GMF A;  3L9V A;  2QKE A;  2YV7 A;  5G1K A;  3QAV A;  4KCA A;  2H72 A;  3LYK A;  1TRV A;  3F9U A;  4N0Z A;  4ECJ A;  4O92 A;  3ZRD A;  4YQM A;  1M9A A;  2V6O A;  1ZYN A;  1BAY A;  5E59 A;  3TJK A;  4KGI A;  1TI1 A;  1TOF A;  3MAK A;  2R5G A;  2AAW A;  3M1G A;  2X4A A;  4CHS A;  4EKZ A;  2DJJ A;  1SD9 A;  1SK1 A;  2IJY A;  1OC9 A;  1XFL A;  1EV9 A;  4F82 A;  1VGL A;  2K8V A;  3DVW A;  3IR4 A;  2FHE A;  4BVY A;  2V32 A;  3TRP A;  4PQH A;  2LQQ A;  1RQM A;  2ES7 A;  1AXD A;  2OAD A;  2EC4 A;  2H1A A;  5ECP B;  2P0G A;  4IQ1 A;  4POM A;  3RHB A;  2PUK C;  3VFI A;  2H74 A;  4N10 A;  2B7K A;  3IK9 A;  5HR1 A;  4Z2R A;  3WGD A;  2VM2 A;  1F37 A;  1PSQ A;  2ZNM A;  4KDU A;  2WZ9 A;  3TKS E;  1U3A A;  3BOA A;  5IQY A;  4K9Z A;  1XVQ A;  1FW1 A;  2OE3 A;  2DJ0 A;  2JSY A;  2VLU A;  2V2G A;  4TRX A;  1EOG A;  1KTE A;  1ML6 A;  2WFC A;  3VK9 A;  4EDY A;  1TXX A;  5CNW A;  3ZTL A;  3HYP A;  3TJB A;  3GHA A;  4NMU A;  3DRN A;  3HCZ A;  1YF1 A;  4OFN A;  2E2M A;  2IMK A;  1IYI A;  2PU9 C;  5KEJ A;  3FZA A;  1LU4 A;  2C0D A;  4MP4 A;  4DSS A;  1WMJ A;  3HKR A;  3KTB A;  2VD0 A;  3D22 A;  4ZBA A;  4WF4 A;  4TN8 A;  1SJZ A;  5G5E A;  3HJO A;  1U3I A;  4WKW A;  3F8U A;  5IMD A;  1A2M A;  3BJ5 A;  4ZB6 A;  4J56 E;  3UBK A;  2NVL A;  3AY8 A;  3GKN A;  3HJP A;  2B5E A;  2IME A;  2YAN A;  5G1L A;  1FVK A;  1EEJ A;  3R3E A;  4ZL8 A;  1V58 A;  1JZD A;  4TXV A;  3FR9 A;  3GIX A;  3MSZ A;  3KXO A;  2D2Z A;  2XBQ A;  2H19 A;  1OC9 B;  3N5O A;  1Z6N A;  1YJ6 A;  3UEM A;  4YQU A;  1PL2 A;  1IYH A;  1THO A;  1ZGN A;  3IPZ A;  2O85 A;  3GUR A;  1G6W A;  3GKK A;  4BVY B;  2C8U A;  1TRS A;  1G7O A;  3KIJ A;  3GV1 A;  5ECO B;  1M7T A;  3MIX A;  3RPP A;  2E2G A;  5G30 A;  4MJB A;  8GSS A;  2A2P A;  2JAC A;  4ZIJ A;  1FOV A;  2IPA A;  3F0I A;  3GYK A;  1ACV A;  4YH2 A;  2AV4 A;  5J3R A;  4YKG A;  2LQO A;  2CVK A;  1K0M A;  3IE3 A;  2G2Q A;  4PUR A;  4KE3 A;  5ECL B;  4TW5 A;  4GTU A;  3US3 A;  2DKI A;  1FHE A;  2V1M A;  1WJK A;  5KN2 A;  2JAD A;  1FB6 A;  4EL1 A;  4TXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...