2FD3A

Crystal structure of thioredoxin mutant p34h
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
108
structure length
108
Chain Sequence
b'SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGHCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin 1
publication title Crystal Structure of Thioredoxin Mutant P34H
rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 30
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2fd3A00
2XHFA 4JZQA 4FH8A 1J0FA 3GH9A 1U87A 4GQCA 5COHA 1PX7A 2GSRA 4EDZA 3LYKA 2WJUA 4JRRA 2V2GA 2OE3A 2MBSA 1SJZA 1SK2A 3M9KA 3KMOA 2FA4A 2X8CA 3F0IA 5D9WA 3ZVJA 4WF5A 4PXOA 3ZREA 3M0FA 3Q18A 1TRSA 1TKDB 1JZRA 2M46A 1VF2A 4ML6A 3HA9A 4IN0A 4WKWA 4TKYA 3HZ4A 1RQMA 2YV7A 1LU4A 2IMDA 2OADA 3LORA 4XRAA 4HQZA 1GH2A 5DJMA 1PX6A 3QPMA 2O89A 2C0DA 3ZIVA 4G19A 4OCFA 2BMXA 4TN8A 5FT3A 1I9DA 4HZ2A 4NAXA 2WFCA 3I6AA 2H0HA 5AIXA 5IPHA 3EWLA 6GSVA 1G0TA 2DJ2A 1HNCA 5B8AA 3WGXA 1ON4A 5G30A 5CP1A 4XS4B 2GGTA 4QL9A 2E2GA 5A5KA 1OKTA 1Q98A 4BPYA 3FZ5A 1TK5B 3ZTLA 3ZIJA 2NDOA 1JZOA 4RI6A 1FO5A 1AC1A 1YQ1A 2DJKA 5F8BA 1O8XA 3GL5A 5DJLA 2HFDA 4JE1A 2IN3A 3GN3A 2IMEA 4N0VA 5ECSA 1HD2A 1TK0B 3F6DA 4POMA 3A5WA 2B5XA 4WR4A 1JLVA 2FA8A 8GSSA 1ERWA 4DSSB 4MA9A 4F9ZA 3ED3A 2E2MA 2QC7A 4D73A 1NHOA 1SKSB 4O32A 1M2BA 2MYGA 5A4VA 2HLSA 1FOVA 4JR6A 4DEJA 1ZYEA 3M3MA 2V6OA 2VCZA 4IJ3A 3TRQA 5DCHA 1TU8A 3CTGA 2WS2A 2GZYA 14GSA 1SL1B 1SK1A 3HY2A 2K6VA 3DWVA 2JSYA 1F37A 2AAWA 3GKXA 3EMXA 4IS0A 4F03A 3FW2A 4MP4A 2H76A 3F8UA 5ECKB 2LTKA 2YWOA 3F9UA 2HI7A 4KNDA 2VUPA 3R2QA 6GSYA 4N30A 2KLXA 3QAVA 2KP1A 2WULA 3BCKA 4I5QA 3G7JA 1XZOA 4J56E 2LNSA 4K2DA 3MDKA 4IBPA 2DJ3A 2IMKA 4HEA2 4JBBA 1TK8B 4DSSA 3BOAA 3EE2A 2PU9C 1W4VA 2O8VB 3C71A 3LGCA 2L6CA 4OFNA 1HYUA 3VWXA 4IELA 4HOJA 3APQA 3FZ4A 2AHEA 3FKFA 3QFAC 4I2UA 5D8IA 2CAQA 4ZB8A 1YDKA 5JCUA 1TRUA 1QK8A 5B8BA 3ZL5A 2LJKA 3D5JA 3TJJA 2LQQA 1GWCA 1VF1A 3WT2A 5IOWA 3VWUA 1XWKA 3F3QA 1PRXA 2WCIA 1GP1A 2C3QA 1BQ7A 4X0XA 1WJKA 1X5EA 2MZCA 3KM6A 1AQVA 5ECIB 3TKQA 4IQAA 4TOPA 5ABRA 1AXDA 4X1UA 3V1WA 3QMXA 4QL7A 1OVNA 3TRPA 3TJKA 2R37A 5CREA 3ZITA 4J2FA 1QGVA 1PKZA 1T1VA 2RUEA 1XW6A 4MF5A 5D9VA 3DIEA 2XBQA 2YWNA 5H5QA 3HXSA 6GSXA 4KB3A 5JWRB 5LCZA 10GSA 5KN3A 1XWAA 4MJBA 3UJ1A 5IO2A 2O85A 4AF2A 1X5DA 1M99A 3DXBA 2CAIA 1K0BA 2C1YA 6GSUA 4IP1A 4RI7A 1Z6MA 2H72A 1V2AA 4PX1A 3KP9A 4Q5NA 11GSA 3J7Yk 5C04A 4KCAA 3M8NA 3A3TA 1USBA 1ZOFA 1S3AA 1GRXA 3H93A 2KHPA 3FEUA 2EIOA 2VOCA 2OBIA 1K3OA 2VCQA 1GUHA 3GFKA 4K1FA 5B6MA 2GVPA 1EV9A 1O73A 2MMZA 2YWIA 1R26A 2M72A 4L5LA 3HD5A 4OMVA 4TRXA 1GTUA 2BJXA 1MTCA 5LNKe 3C1SA 5J9BA 1F3BA 1GTBA 3LQ7A 1IYIA 4NPBA 2H0IA 2YJ7A 3FY7A 3IAM2 3KP8A 3TB2A 3QAGA 4WR5A 4MH2A 5E4WA 5B6NA 3HDCA 4OWYA 1YKAA 1SK0A 3KH7A 2F8FA 3ZYWA 2P5QA 3J7Yb 4Q5QA 1OC8A 4KH7A 5D9XA 1EEJA 3L0HA 4CHSA 1TRVA 4TW5A 4DSQA 3MWHA 5IOXA 1AW9A 3ERFA 2N5AA 5HR0A 1UN2A 3TOUA 5DQYA 3P7XA 2PERA 1HQOA 3QAWA 5H5RA 3GA4A 2HZFA 2X8HA 5J5NA 3KH9A 2GT5A 4GF0A 4OFTA 3GV1A 2WZ9A 2H0GA 2B3SA 2R4VA 3FR6A 1AUCA 1KEBA 2RIIA 1TJDA 3O3TA 3IHQA 4K8MA 1WPIA 3GSSA 3A2WA 1U88A 1YKCA 1GSSA 5JWQB 5DALB 3IE3A 1YEXA 3ZMKA 4ECCA 5F05A 4AJ7A 5G2ZA 4ZB9A 1XW9A 2I81A 1OC9A 3I43A 4N10A 4NHWA 2DIZA 3KEBA 4MLYA 1GSYA 3EVIA 3PR8A 2D2ZA 2EIQA 2QGVA 1T00A 2L6DA 2YOIA 4ECIA 2FNOA 3IK7A 3UMAA 2HXKA 3F4TA 5ECNB 1J08A 4EXJA 4I97A 1EOGA 1SD8A 1SENA 4F2IA 3ZZXA 3TKSA 3D6IA 1QFNA 5G5EA 3UVHA 2DC5A 4K7OA 5ID2B 5D96A 1N2AA 1YF0A 3F3RA 2GZPA 4K7NA 1SD9A 3IXRA 3QDNA 3UBLA 3TCOA 4KUNA 2ZNMA 1GSEA 1VF3A 2VL9A 4PURA 3E0UA 5DALA 3GSTA 1WIKA 5DCGA 4J57E 1A23A 1M9BA 2KP2A 3IC4A 2DSAA 4ZILA 3KZQA 5CAXA 1NHYA 3CMIA 3GKMA 5IMVA 1O6JA 4E8HA 2GS3A 3EU4A 2LRTA 1U3IA 2N5BA 2FGXA 3LG6A 4OCEA 3LXZA 4ULXA 4K0NA 1FW1A 2CA8A 1TOFA 3M9JA 1OE7A 3US3A 1B48A 1SYRA 2HSYA 2FHEA 1MD4A 5GSSA 3GKNA 3I9V2 2JSZA 3TJFA 5KN0A 3UBKA 5IMDA 2OBKA 5GSTA 2L5OA 2O87A 5GAPD 5ID2A 2H19A 3ME8A 2YNXA 3RPPA 1OC3A 2C0FA 5CRHA 1C72A 4ISDA 1W89A 5DAKB 1FHEA 1TP9A 2GDRA 3ME7A 2IIYA 5GZZB 1SKWB 1EP8A 4OO5A 1MEKA 4LL4B 2JU5A 4EE0A 5G1LA 2ZUPA 4BVYA 3DVWA 3C7MA 4IGJA 5HR1A 1XPVA 3O76A 3VURA 3NZNA 1UVZA 2C0GA 1X9MB 2K18A 4MMMA 4KSMA 3GUSA 2F8AA 5E59A 3U5RE 2B5EA 2PMTA 3TJGA 3GX8A 4V1Ap 3GX0A 3DGQA 2XC2A 2YJHA 3ISOA 1THXA 3E3EA 1PKWA 1ST9A 1XVWA 4POKA 2PVQA 4L5OA 1FVJA 2K9FA 4GSNA 2J9HA 4ZL8A 2OACA 3VLNA 4O92A 1G7EA 1GNEA 4K0GA 1F9MA 4ML1A 1H4OA 5EPFA 2H74A 3HYPA 3LSZA 3D22A 1B4PA 3HCZA 3VPTA 1E2YA 3GL3A 2YZHA 4I2TA 1OKDA 1V98A 4G2EA 19GSA 2HZEB 4MPFA 2IWTA 3HVSA 4IJIA 5AIVA 1SU9A 3CRTA 2VIMA 3C73A 3IV4A 5HR3A 1U3AA 3IK9A 4NHZA 1BJXA 3L9SA 5GAND 2E0QA 2HRFA 4AJ8A 3EMPA 2H66A 3CSJA 3TJBA 4KDYA 3PINA 2NTOA 2P5RA 3VI7A 2GSTA 2FWFA 3C8EA 1F6MC 4DSRA 5JCWA 4TXOB 1PMTA 2GZZA 4XS4A 2V41A 5G31A 3TKPA 1XXUA 1PGTA 3FZ9A 2TRCP 4GRFA 2H6YA 4FYUA 4MZWA 3DVXA 4N11A 4PNGA 2VM2A 4G10A 2CX3A 3ZLPA 1BG5A 3APOA 3UVTA 5DDLA 2HZEA 2IL3A 1EEMA 3MNGA 1GSUA 3GNJA 2CZ2A 2X8GA 18GSA 5ECQB 3N5OA 3LXTA 4OFMA 1K0CA 4DVCA 2GQKA 4XHMA 4MDCA 2A2RA 4XRDA 4EC0A 1RK4A 1N8JA 1ZZYA 2NVLA 5CRWA 1O81A 3L4NA 4EL1A 3CXGA 4FYCA 1R5AA 4GLTA 4V2NA 4MJCA 4MJEA 3KXOA 4K9ZA 1A24A 4RUVA 1SJ6A 4OD7A 2TIRA 3LYPA 1XWCA 2VL2C 1RW1A 4HDEA 3GRXA 5D73A 3DD3A 2OE1A 1G6YA 1YY7A 2CVBA 5F0GA 1GSDA 4GWRA 3KCMA 1S3DA 1V58A 3IA1A 3TDGA 3PGTA 1K0AA 5HR2A 5FWGA 1EGOA 4TVEA 4V2MA 2OJLA 1NW2A 2C3NA 2CZ3A 2AUVA 1Y25A 4MF6A 4GSSA 4MABA 5L71A 3QD9A 4YAVA 3GIXA 2IFQB 4WBRD 1Z3EA 3TGZA 2JZTA 2ALBA 3UEMA 1T4ZA 3RPNA 4YQUA 4KX4A 4AJ6A 1YF1A 1TU7A 3FK8A 2VLUA 5ECMB 1G7OA 2YCDA 5IM9A 1H75A 4ILFA 3C1RA 3EYTA 2I9HA 3P90A 1SL0B 4YQVA 3Q74A 1QMVA 5A4UA 4I6XA 4L0UA 5J4UA 3HHVA 2RLIA 2H1BA 1ML6A 4TR0A 3BD2A 1B4QA 3GHAA 3IRAA 1VGLA 4BVXA 4ZIJA 1DE2A 5HFIA 2QSIA 2FWEA 2ZCTA 5ELAA 4KGIA 3RBTA 2XBIA 3RAZA 2TRXA 5ENUA 2NBSA 2AV4A 4F82A 3JCML 4WBJA 2A4VA 3ZFLA 4F0CA 1SL2B 3N9JA 1JZDA 5D93A 1EOHA 5LD0A 3TUEA 5DQSA 5EVOA 3F4SA 3W8SA 2HNLA 2REMA 2IFQA 3KTBA 1QUWA 5HFKA 4JEDA 2C80A 6GSSA 3LFLA 2E7PA 1BX9A 3F63A 3L9VA 4EO3A 4IHUA 2B1KA 5JWOB 1X5CA 1JFUA 2B1LA 2M80A 2HSHA 3EINA 2F51A 2PBJA 2VD0A 1UC7A 4JR4A 5CNWA 5CRGA 1ERVA 3F4RA 1A8LA 20GSA 1XBSA 2L4CA 3EU3A 2YP6A 4ZB6A 4TR3A 1T3BA 4MPGA 4HZ4A 3CRUA 2DJJA 2LS5A 4KE3A 4BA7A 5ECLB 1K3YA 4MK3A 5EL8A 1R7HA 4WXTA 1E6BA 3F6FA 2VLVA 3IR4A 1M7TA 1WOUA 2NPBA 2EC4A 4PNFA 2DBCA 5HQPA 1HNBA 3ERWA 3FRCA 4TR1B 1PN9A 4HJMA 1MDIA 5HFGA 5INYA 2VL3A 3GMFA 3MSZA 1B9YC 4Q5RA 1O85A 3HVXA 2RM5A 2H1AA 1Z7RA 1R5PA 2IJYA 3BCIA 3GTUB 2L4QA 3VWVA 1A2LA 3L78A 4Z7XA 1Y6EA 1K0DA 3TOTA 4WEYA 2WGRA 2FUG2 2OE0A 1T8EB 1A2JA 3A2XA 2IMIA 1SYXA 4HU7A 3RHBA 1KBNA 4NMUA 1AQXA 1TTZA 1IYHA 1WE0A 1JLWA 1DE1A 2I4AA 4Q5FA 2F3MA 3D4TA 1KNGA 3WD6A 3CTFA 4TR1A 4ZBBA 2B7JA 1XWGA 1CQGA 2K8VA 4OO4A 4K7IA 12GSA 1PQNA 5G1KA 1S3CA 1K0OA 1DSBA 1J9BA 1F2EA 3GURA 4EF0A 1GUKA 4ECJA 2FCHA 5IO0A 16GSA 2KOKA 1Z6NA 3ZRDA 3GTUA 4KSOA 1XWBA 1TRWA 4MZBA 1Z9HA 4FO5A 1TXXA 2FD3A 3KIJA 5AGYA 3QR6A 3UAPA 2PN8A 2YZUA 3DMLA 5KN2A 2G2QA 3P8WA 3HJPA 1O7UA 3GH6A 2YN1A 2YWMA 2AYTA 2JL4A 2WDUA 4K6XA 2AB6A 4MZCA 4GQFA 3LEFA 2PVOC 1A8YA 4EDYA 4LL1B 13GSA 5J9CA 1TW9A 3CSHA 5EY6A 3WGEA 4XS1A 1NSWA 4YQMA 1GLQA 2MMAA 2MBTA 1XOBA 2P31A 1V40A 2GSSA 4X43A 4MJAA 1OYJA 4LMVA 4ZL7A 1GUMA 1GULA 3BJ5A 1ACVA 3FZAA 4IVFA 2H73A 2LKUA 1K3LA 1A0RP 4HJ2A 4AGSA 2I3YA 3U6VA 4IP6A 5IMAA 3W8JA 1LBKA 1QXHA 2XPEA 4D73B 1FB6A 2LV3A 1PL1A 1SJIA 1DUGA 3IAS2 2JZSA 3HJMA 3HZ8A 17GSA 2H1GA 1GTIA 1YEPA 1ILOA 5AN1A 1Z5YE 2LJRA 2VM1A 5DAKA 2DIYA 3I69A 3Q6OA 3WT1A 1TDIA 2YPMA 2CV4A 1T7PB 1U6TA 4P3YB 1AIUA 2VCTA 3G9BA 3H8QA 1V9WA 2H70A 4NWYA 3GKKA 3S9FA 3SWLA 1ERTA 2H01A 5IMCA 1M2DA 2FWHA 3TKRA 2EIRA 7GSSA 3ZVJD 4V2LA 3D21A 3HJOA 2FLSA 3BBYA 2FWGA 3O6TA 3FR9A 4IKHA 4ACSA 5IMFA 1WRYA 4FIWA 5ECOB 4JU5A 2L57A 1EZKA 3LWAA 4KDUA 4XIHA 2DMMA 2HRNA 2C0EA 3FHKA 3UL3A 3MAKA 1GSFA 3QFBC 3TKSE 2GSQA 4GSTA 4GCIA 2PUKC 1ZYQB 1THOA 1QQ2A 3NOFA 2V32A 1EV4A 5CO3A 2IMFA 5IMZA 2H8LA 4EUYA 1K0NA 1ZGNA 4IQ1A 2AJQB 2LRCA 2VCXA 2LJAA 5ECRB 1T4YA 3VK9A 3VI5A 2CT6A 2ON5A 1EWXA 2H6ZA 2V1MA 3D0ZA 2DJ1A 3Q19A 1OAZA 2B5YA 3G7IA 2R6KA 1LJRA 2RUFA 4RQRA 5ELGA 3VPQA 1TI3A 2CVDA 1MD3A 1V57A 2LSTA 2VO4A 2VAFA 3LJRA 1M9AA 1XW5A 1FVKA 1M2AA 5KN1A 2HT9A 2CQ9A 2QKEA 1R4WA 1K0MA 4G9HA 3QOUA 4BL7A 2DJ0A 4BWSA 5H5SA 2LNTA 2PWJA 4TXOA 2H6XA 3D4MA 1BYEA 2GQLA 9GSSA 2B7KA 3IBHA 3RHCA 4HS1A 1ABAA 4V1Ag 3VWWA 3E9JB 4MH3A 1ZL9A 1X9WB 4ZBDA 3RDWA 3G7YA 3W6GA 3FYGA 2X99A 2VL2A 1FG4A 4KA0A 5DVBA 2PPTA 2VD1A 5CYYA 1EGRA 5J3RA 1XCCA 4QQ7A 1SKRB 3TRXA 2RM6A 1OE8A 5J41A 4FYBA 2JZRA 4HU9A 2J23A 5AISA 5ECPB 5C00A 2L5LA 2ON7A 4E8EA 2CVKA 3DRNA 2O7KA 3H79A 1GNWA 4GTUA 1AQWA 1DBYA 1NM3A 2VCVA 2IPAA 2MMOA 4XS6A 3HVVA 1ERUA 1GSQA 3CYNA 5A4WA 4ECBA 3FR3A 2GT6A 1FAAA 2N5FA 4NV2A 2DLXA 1Z7PA 1PA3A 2VCWA 3UARA 4NXIA 3ZMLA 3KJYA 3VFIA 2KUCA 3K8NA 5G5FA 1G6WA 1X0RA 3APSA 2PGTA 4XTSA 4L8EA 2R3XA 3PH9A 4O7HA 3ERGA 4HUAA 1A2MA 2YANA 4TR4A 4PGTA 1XVQA 2JADA 5IIZA 3EC3A 5DBQA 1WMJA 1FB0A 1BAYA 1VF4A 4F0BA 1XFLA 4NV5A 1O8WA 4HI7A 1XIYA 2CX4A 4PUAA 3OR5A 3HKRA 1HNAA 5CRDA 3UOMA 5KEJA 5F06A 2OA7A 2L59A 4ZBAA 2K8SA 1WP0A 5B7CA 5ECHB 2ES7A 1OC9B 3KTLA 2GTUA 1JHBA 4ZXGA 4CW9A 4GXZA 2FY6A 3H1NA 2H1DA 4MCUA 2GQMA 2H30A 3WYWA 4TXVA 2OKAA 1WWJA 1GLPA 2VLTA 4PQ1A 4H86A 3DYRA 4RQXA 2MMNA 4POBA 2LUSA 4YAPA 2HYXA 2LQOA 2WRTA 2BTOT 1PSQA 1ZCPA 3ZFBA 4L0WA 2G0FA 3CSIA 3KMNA 1JZWA 2R2JA 1GL8A 4KCEA 1CQHA 3DKSA 4PUFC 2LRNA 1KTEA 2GLRA 1A0FA 2C4JA 2P0GA 1B8XA 4I8BA 4EKZA 1AAZA 2WB9A 2H71A 1B9XC 4ID0A 2LEGA 1PL2A 1XOAA 2C8UA 4WETA 3TKSC 1UA5A 3WGDA 5JCGA 1BEDA 2JACA 1M0UA 3EURA 2R5GA 2H75A 4ZL9A 1TI1A 1EP7A 4WF4A 4CDOA 4KW6A 2XPDA 1VRSD 5F07A 3NIVA 1PD21 1F3AA 2DMLA 3L9UA 4HQSA 3AY8A 5FHIA 2A2SA 4N0ZA 3KGKA 4YH2A 3QCPA 4BWQA 5IPGA 2B6MA 4IW9A 5D9TA 2YV9A 4LA1A 3IOSA 3M1GA 3IDVA 4XCSA 1YZXA 6GSWA 4O5RA 3GYKA 1Q4JA 3DEXA 4LMWA 1URMA 4PQIA 1MDKA 4POLA 1X9SB 2Z9SA 1MDJA 4MF7A 4PQHA 22GSA 5IQYA 3SBCA 4LLRA 2I1UA 3A2VA 3H4KA 3KD0A 4EVMA 3IPZA 2X64A 2HE3A 4KAEA 1ZMAA 6GSTA 1YJ6A 3P2AA 1I5GA 2C3TA 2F9SA 1GTAA 4KDXA 2V6KA 3CBUA 3UIWA
chains in the Genus database with same CATH superfamily
2XHFA 4JZQA 4FH8A 1J0FA 3GH9A 1U87A 4GQCA 5COHA 1PX7A 2GSRA 4EDZA 3LYKA 2WJUA 4JRRA 2V2GA 2OE3A 2MBSA 1SJZA 1SK2A 3M9KA 3KMOA 2FA4A 2X8CA 3F0IA 5D9WA 3ZVJA 4WF5A 4PXOA 3ZREA 3M0FA 4YKFA 3Q18A 1TRSA 1TKDB 1JZRA 2M46A 1VF2A 4ML6A 3HA9A 4IN0A 4WKWA 4TKYA 3HZ4A 1RQMA 2YV7A 1LU4A 2IMDA 2OADA 3LORA 4XRAA 4HQZA 1GH2A 5DJMA 1PX6A 3QPMA 2O89A 2C0DA 3ZIVA 4G19A 4OCFA 2BMXA 4TN8A 5FT3A 1I9DA 4HZ2A 4NAXA 2WFCA 3I6AA 2H0HA 5AIXA 5IPHA 3EWLA 6GSVA 1G0TA 2DJ2A 2DKHA 1HNCA 5B8AA 3WGXA 1ON4A 5G30A 5CP1A 4XS4B 2GGTA 4QL9A 2E2GA 5A5KA 1OKTA 1Q98A 4BPYA 3FZ5A 1TK5B 3ZTLA 3ZIJA 2NDOA 1JZOA 4RI6A 1FO5A 1AC1A 1YQ1A 2DJKA 5F8BA 1O8XA 3GL5A 5DJLA 2HFDA 4JE1A 2IN3A 3GN3A 2IMEA 4N0VA 5ECSA 1HD2A 1TK0B 3F6DA 4POMA 3A5WA 2B5XA 3IC8A 4WR4A 1JLVA 2FA8A 8GSSA 1ERWA 4DSSB 4MA9A 4F9ZA 3ED3A 2E2MA 2QC7A 4D73A 1NHOA 1SKSB 4O32A 1M2BA 2MYGA 5A4VA 2HLSA 1FOVA 4JR6A 4DEJA 1ZYEA 3M3MA 2V6OA 2VCZA 4IJ3A 3TRQA 5DCHA 1TU8A 3CTGA 2HRKA 2WS2A 2GZYA 14GSA 1SL1B 1SK1A 3HY2A 2K6VA 5BMUA 3DWVA 2JSYA 1F37A 2AAWA 3GKXA 3EMXA 4IS0A 4F03A 3FW2A 4MP4A 2H76A 3F8UA 5ECKB 2LTKA 2YWOA 3F9UA 2HI7A 4KNDA 2VUPA 3R2QA 6GSYA 4N30A 2KLXA 3QAVA 2KP1A 2WULA 3BCKA 4I5QA 3G7JA 4USSA 1XZOA 4J56E 2LNSA 4K2DA 3MDKA 4IBPA 2DJ3A 2IMKA 4HEA2 4JBBA 1TK8B 4DSSA 3BOAA 3EE2A 2PU9C 1W4VA 2O8VB 3C71A 3LGCA 2L6CA 4OFNA 1HYUA 3VWXA 4IELA 4HOJA 3APQA 3FZ4A 2AHEA 3FKFA 3QFAC 4I2UA 5D8IA 2CAQA 4ZB8A 1YDKA 5JCUA 1TRUA 1QK8A 5B8BA 3ZL5A 2LJKA 3D5JA 3TJJA 2LQQA 1GWCA 1VF1A 3WT2A 5IOWA 3VWUA 1XWKA 3F3QA 1PRXA 2WCIA 1GP1A 2C3QA 1BQ7A 4X0XA 1WJKA 1X5EA 2MZCA 3KM6A 1AQVA 5ECIB 3TKQA 4IQAA 4TOPA 5ABRA 1AXDA 4X1UA 3V1WA 3QMXA 4QL7A 1OVNA 3TRPA 3TJKA 2R37A 5CREA 3ZITA 4J2FA 1QGVA 1PKZA 1T1VA 2RUEA 1XW6A 4MF5A 5D9VA 3DIEA 2XBQA 2YWNA 5H5QA 3HXSA 6GSXA 4KB3A 5JWRB 5LCZA 10GSA 5KN3A 1XWAA 5KOXA 4MJBA 3UJ1A 5IO2A 3PPUA 2O85A 4AF2A 1X5DA 1M99A 3DXBA 2CAIA 1K0BA 2C1YA 6GSUA 3EPTA 4IP1A 4RI7A 1Z6MA 2H72A 1V2AA 4PX1A 3KP9A 4X4JA 4Q5NA 11GSA 3J7Yk 5C04A 4KCAA 3M8NA 3A3TA 1USBA 1ZOFA 1S3AA 1GRXA 3H93A 2KHPA 3FEUA 2EIOA 2VOCA 3MIXA 2OBIA 1K3OA 1XG8A 2VCQA 1GUHA 3GFKA 4K1FA 5B6MA 2GVPA 1EV9A 1O73A 2MMZA 2YWIA 1R26A 2M72A 4K5RA 4L5LA 3HD5A 4OMVA 4TRXA 1GTUA 2BJXA 1MTCA 5LNKe 3C1SA 5J9BA 1F3BA 1GTBA 3LQ7A 1IYIA 4NPBA 2H0IA 2YJ7A 3FY7A 3IAM2 3KP8A 3TB2A 3QAGA 4WR5A 4MH2A 5E4WA 5B6NA 3HDCA 4OWYA 1YKAA 1SK0A 3KH7A 2F8FA 3ZYWA 2P5QA 3J7Yb 4Q5QA 1OC8A 4KH7A 5D9XA 1EEJA 3L0HA 4CHSA 1TRVA 4TW5A 4CY8A 4DSQA 3MWHA 5IOXA 1AW9A 3ERFA 2N5AA 5HR0A 1UN2A 3TOUA 5DQYA 3P7XA 2PERA 1HQOA 3QAWA 5H5RA 3GA4A 2HZFA 2X8HA 5J5NA 3KH9A 2GT5A 4GF0A 4OFTA 3GV1A 2WZ9A 2H0GA 2B3SA 2R4VA 3FR6A 1AUCA 1KEBA 2RIIA 1TJDA 3O3TA 3IHQA 4K8MA 1WPIA 3GSSA 3A2WA 1U88A 1YKCA 1GSSA 5JWQB 5DALB 3IE3A 1YEXA 3ZMKA 4ECCA 5F05A 4AJ7A 5G2ZA 4ZB9A 1XW9A 2I81A 1OC9A 3I43A 4N10A 4NHWA 2DIZA 3KEBA 4MLYA 1GSYA 3EVIA 3PR8A 2D2ZA 2EIQA 2QGVA 1T00A 2L6DA 2YOIA 3FMWA 4ECIA 2FNOA 4G0KA 3IK7A 3UMAA 2HXKA 3F4TA 5ECNB 4ICYA 1J08A 4EXJA 4I97A 1EOGA 1SD8A 1SENA 4F2IA 3ZZXA 3TKSA 3D6IA 1QFNA 5G5EA 3UVHA 2DC5A 4K7OA 5ID2B 5D96A 1N2AA 1YF0A 3F3RA 1M3JA 2GZPA 4K7NA 1SD9A 3IXRA 3QDNA 3UBLA 3TCOA 4KUNA 2ZNMA 1GSEA 1VF3A 2VL9A 4PURA 3E0UA 5DALA 3GSTA 1WIKA 5DCGA 4J57E 1A23A 1M9BA 2KP2A 3IC4A 2DSAA 4ZILA 3KZQA 5CAXA 1NHYA 3CMIA 3GKMA 5IMVA 1O6JA 4E8HA 2GS3A 3EU4A 2LRTA 1U3IA 2N5BA 2FGXA 3LG6A 4OCEA 3LXZA 4ULXA 4K0NA 1FW1A 2CA8A 1TOFA 3M9JA 1OE7A 3US3A 1B48A 1SYRA 2HSYA 2FHEA 1MD4A 5GSSA 3GKNA 3I9V2 2JSZA 3LW9A 3TJFA 5KN0A 3UBKA 5IMDA 2OBKA 5GSTA 2L5OA 2O87A 5GAPD 5ID2A 2H19A 3ME8A 2YNXA 3RPPA 1OC3A 2C0FA 5CRHA 1C72A 4ISDA 1W89A 5DAKB 1FHEA 1TP9A 2GDRA 3ME7A 2IIYA 5GZZB 4KF9A 1SKWB 1EP8A 4OO5A 1MEKA 4LL4B 2JU5A 4EE0A 5G1LA 2ZUPA 4BVYA 3DVWA 3C7MA 4IGJA 5HR1A 1XPVA 3O76A 3VURA 3NZNA 1UVZA 2C0GA 1X9MB 2K18A 4MMMA 4KSMA 4PTSA 3GUSA 2F8AA 2UZ8A 5E59A 3U5RE 2B5EA 2PMTA 3TJGA 3GX8A 4V1Ap 3GX0A 3DGQA 2XC2A 2YJHA 3ISOA 1THXA 3E3EA 4FQUA 1PKWA 1ST9A 1XVWA 4POKA 2PVQA 4L5OA 1FVJA 2K9FA 4GSNA 2J9HA 4ZL8A 2OACA 3VLNA 4O92A 1G7EA 1GNEA 4K0GA 1F9MA 4ML1A 1H4OA 5EPFA 2H74A 3HYPA 3LSZA 3D22A 1B4PA 3HCZA 3VPTA 1E2YA 2R0GA 2YZHA 3GL3A 4I2TA 1OKDA 1V98A 4G2EA 19GSA 2HZEB 4MPFA 2IWTA 3HVSA 4IJIA 5AIVA 1SU9A 3CRTA 2VIMA 3C73A 3IV4A 4BIKA 5HR3A 1U3AA 3IK9A 4NHZA 1BJXA 3L9SA 5GAND 2E0QA 2HRFA 4AJ8A 3EMPA 2H66A 3CSJA 3TJBA 4KDYA 3PINA 2NTOA 2P5RA 2R0PA 3VI7A 2GSTA 2FWFA 3C8EA 1F6MC 4DSRA 5JCWA 4TXOB 1PMTA 2GZZA 4K5SA 4XS4A 2V41A 5G31A 3TKPA 1XXUA 1PGTA 3FZ9A 2TRCP 4GRFA 2H6YA 4FYUA 4MZWA 3DVXA 4N11A 4PNGA 2VM2A 4G10A 2CX3A 3ZLPA 1BG5A 3APOA 3UVTA 5DDLA 2HZEA 2IL3A 1EEMA 3MNGA 1GSUA 3GNJA 2CZ2A 2X8GA 18GSA 5ECQB 3N5OA 3LXTA 4OFMA 1K0CA 4DVCA 3A5IA 2GQKA 4XHMA 4MDCA 2A2RA 4XRDA 4EC0A 1RK4A 1N8JA 1ZZYA 2NVLA 5CRWA 1O81A 3MYDA 3L4NA 4EL1A 3CXGA 4FYCA 1R5AA 4GLTA 4V2NA 4MJCA 4MJEA 3KXOA 4K9ZA 1A24A 4RUVA 1SJ6A 4OD7A 2TIRA 3LYPA 1XWCA 2VL2C 1RW1A 4HDEA 3GRXA 5D73A 3DD3A 2OE1A 1G6YA 1YY7A 2CVBA 1GSDA 4GWRA 5F0GA 3KCMA 4BVXB 1S3DA 1V58A 3IA1A 3TDGA 3PGTA 1K0AA 5HR2A 5FWGA 1EGOA 4TVEA 4V2MA 2OJLA 1NW2A 2C3NA 2CZ3A 2AUVA 1Y25A 4MF6A 4GSSA 4MABA 3HVNA 5L71A 3QD9A 4YAVA 3GIXA 2IFQB 4WBRD 1Z3EA 3TGZA 2JZTA 2ALBA 4O5UA 3UEMA 1T4ZA 3RPNA 4YQUA 4KX4A 4AJ6A 1YF1A 1TU7A 3FK8A 2VLUA 5ECMB 1G7OA 2YCDA 5IM9A 1H75A 4ILFA 4O5QA 3C1RA 3EYTA 2I9HA 3P90A 1SL0B 4YQVA 3Q74A 1QMVA 5A4UA 4HSCX 4I6XA 4L0UA 5J4UA 3HHVA 2RLIA 2H1BA 1ML6A 4TR0A 3BD2A 1B4QA 3GHAA 3IRAA 1VGLA 4BVXA 4ZIJA 1DE2A 5HFIA 2QSIA 2FWEA 2ZCTA 5ELAA 4KGIA 3RBTA 2XBIA 3RAZA 2TRXA 5ENUA 2NBSA 2AV4A 4F82A 3JCML 4WBJA 2A4VA 3ZFLA 4F0CA 1SL2B 3N9JA 1JZDA 5D93A 4G0LA 1EOHA 5LD0A 3TUEA 5DQSA 5EVOA 3F4SA 3W8SA 2HNLA 2REMA 2IFQA 3KTBA 1QUWA 5HFKA 4JEDA 2C80A 6GSSA 3LFLA 2E7PA 1BX9A 3F63A 3L9VA 4EO3A 4IHUA 2B1KA 5JWOB 4MNNA 1X5CA 1JFUA 2B1LA 2M80A 2HSHA 3EINA 2F51A 2PBJA 2VD0A 1UC7A 4JR4A 5CNWA 5CRGA 1ERVA 3F4RA 1A8LA 20GSA 1XBSA 2L4CA 3EU3A 2YP6A 4ZB6A 4TR3A 1T3BA 4MPGA 4HZ4A 3CRUA 2DJJA 2LS5A 4KE3A 4BA7A 5ECLB 1K3YA 4MK3A 5EL8A 1R7HA 4WXTA 1E6BA 4Z2RA 3F6FA 2VLVA 3IR4A 1M7TA 1WOUA 2NPBA 2EC4A 4PNFA 2DBCA 1ZYPA 5HQPA 1HNBA 3ERWA 3FRCA 4TR1B 1PN9A 4HJMA 1MDIA 2X49A 5HFGA 5INYA 2VL3A 3GMFA 3MSZA 4Q5RA 1B9YC 1O85A 3HVXA 2RM5A 2H1AA 1Z7RA 1R5PA 2IJYA 3BCIA 3GTUB 2L4QA 3VWVA 1A2LA 3L78A 4Z7XA 1Y6EA 1K0DA 3TOTA 4WEYA 2WGRA 2FUG2 2OE0A 1T8EB 1A2JA 3A2XA 2IMIA 1SYXA 4HU7A 3RHBA 1KBNA 4NMUA 1AQXA 1TTZA 1IYHA 1WE0A 1JLWA 1DE1A 2I4AA 4Q5FA 2F3MA 3D4TA 1KNGA 3WD6A 3CTFA 4TR1A 4ZBBA 2B7JA 1XWGA 1CQGA 2K8VA 4OO4A 4K7IA 12GSA 1PQNA 5G1KA 1S3CA 1K0OA 1DSBA 1J9BA 1F2EA 3GURA 4EF0A 1GUKA 4ECJA 2FCHA 5IO0A 16GSA 2KOKA 1Z6NA 3ZRDA 3GTUA 4KSOA 1XWBA 1TRWA 4MZBA 1Z9HA 4FO5A 1TXXA 2FD3A 3KIJA 5AGYA 3QR6A 3UAPA 2PN8A 2YZUA 3DMLA 5KN2A 2G2QA 3P8WA 3HJPA 1O7UA 3GH6A 2YN1A 2YWMA 2AYTA 2JL4A 1FOHA 2WDUA 4K6XA 2AB6A 4MZCA 4GQFA 3LEFA 2PVOC 1A8YA 4EDYA 4LL1B 13GSA 5J9CA 1TW9A 3CSHA 5EY6A 3WGEA 4XS1A 1NSWA 4YQMA 1GLQA 2MMAA 2MBTA 1XOBA 2P31A 1V40A 2GSSA 4X43A 4MJAA 1OYJA 4LMVA 4ZL7A 1GUMA 1GULA 3BJ5A 1ACVA 3FZAA 4IVFA 2H73A 2LKUA 1K3LA 1A0RP 4HJ2A 4AGSA 2I3YA 2QA1A 4IP6A 3U6VA 5IMAA 3W8JA 1LBKA 1QXHA 2XPEA 4D73B 1FB6A 2LV3A 1PL1A 1SJIA 1DUGA 3IAS2 2JZSA 3HJMA 3HZ8A 17GSA 1PFOA 2H1GA 1GTIA 1YEPA 1ILOA 5AN1A 1Z5YE 2LJRA 2VM1A 5DAKA 2DIYA 3I69A 3Q6OA 3WT1A 1TDIA 2YPMA 2CV4A 1T7PB 1U6TA 4P3YB 1AIUA 2VCTA 3G9BA 3H8QA 1V9WA 2H70A 4NWYA 3GKKA 3S9FA 3SWLA 1ERTA 2H01A 5IMCA 1M2DA 2FWHA 3TKRA 2EIRA 7GSSA 3ZVJD 4V2LA 3D21A 3HJOA 2FLSA 3BBYA 2FWGA 3O6TA 3FR9A 4IKHA 4ACSA 5IMFA 2X4AA 5KOWA 1WRYA 4FIWA 5ECOB 4JU5A 2L57A 2QA2A 4BL7B 1EZKA 3LWAA 4KDUA 4XIHA 2DMMA 2HRNA 2C0EA 3FHKA 2R0CA 3UL3A 3MAKA 1GSFA 3QFBC 3TKSE 2GSQA 4GSTA 4GCIA 2PUKC 1ZYQB 1S3RA 1THOA 1QQ2A 3NOFA 2V32A 1EV4A 5CO3A 2IMFA 5IMZA 2H8LA 4EUYA 1K0NA 1ZGNA 4IQ1A 4G0IA 2AJQB 2LRCA 2VCXA 2LJAA 5ECRB 1T4YA 3VK9A 3VI5A 2CT6A 2ON5A 1EWXA 2H6ZA 2V1MA 3D0ZA 2DJ1A 3Q19A 1OAZA 4A5PA 2B5YA 3G7IA 2R6KA 1LJRA 3CQFA 2RUFA 4RQRA 5ELGA 3VPQA 1TI3A 2CVDA 1MD3A 1V57A 2LSTA 2VO4A 2VAFA 3LJRA 1M9AA 1XW5A 1FVKA 1M2AA 5KN1A 2HT9A 2CQ9A 2QKEA 1R4WA 1K0MA 4G9HA 3QOUA 4BL7A 2DJ0A 4BWSA 5H5SA 2LNTA 2PWJA 4TXOA 2H6XA 3D4MA 1BYEA 2GQLA 9GSSA 2B7KA 3IBHA 3RHCA 4HS1A 1ABAA 4V1Ag 3VWWA 3E9JB 4MH3A 1ZL9A 1X9WB 4ZBDA 3RDWA 3G7YA 3W6GA 3FYGA 2X99A 2VL2A 1FG4A 4KA0A 5DVBA 2PPTA 2VD1A 5CYYA 4EIPA 1EGRA 4Z2TA 5J3RA 1XCCA 4QQ7A 1SKRB 3TRXA 2RM6A 1OE8A 5J41A 4FYBA 2JZRA 4HU9A 2J23A 5AISA 5ECPB 5C00A 2L5LA 2HSMA 2ON7A 4E8EA 2CVKA 3DRNA 2O7KA 3H79A 1GNWA 4GTUA 1AQWA 1DBYA 1NM3A 2VCVA 2IPAA 2MMOA 4XS6A 3HVVA 1ERUA 1GSQA 3CYNA 5A4WA 4ECBA 3FR3A 2GT6A 1FAAA 2N5FA 4NV2A 2DLXA 1Z7PA 1PA3A 2VCWA 3UARA 4NXIA 3ZMLA 3KJYA 3VFIA 2KUCA 3K8NA 4YKGA 5G5FA 1G6WA 1X0RA 3APSA 2PGTA 4XTSA 4L8EA 2R3XA 3PH9A 4O7HA 3ERGA 4HUAA 1A2MA 2YANA 4TR4A 4PGTA 1XVQA 2JADA 5IIZA 3EC3A 5DBQA 1WMJA 1FB0A 1BAYA 1VF4A 4F0BA 1XFLA 4NV5A 1O8WA 4HI7A 1XIYA 2CX4A 4PUAA 3OR5A 3R3EA 3HKRA 1M3IA 1HNAA 5CRDA 3UOMA 5KEJA 5BRTA 5F06A 2OA7A 2L59A 4ZBAA 2K8SA 1WP0A 5B7CA 5ECHB 2ES7A 1OC9B 3KTLA 2GTUA 1JHBA 4ZXGA 4CW9A 4GXZA 2FY6A 3H1NA 2H1DA 4MCUA 2GQMA 2H30A 3WYWA 4TXVA 2OKAA 1WWJA 1GLPA 2VLTA 4Z2UA 4PQ1A 4H86A 3DYRA 4RQXA 2MMNA 4POBA 2LUSA 4YAPA 2HYXA 2LQOA 2WRTA 2BTOT 1PSQA 1ZCPA 3ZFBA 4L0WA 2G0FA 3CSIA 2A4HA 3KMNA 1JZWA 2R2JA 1GL8A 4KCEA 1CQHA 3DKSA 4PUFC 2LRNA 1KTEA 2GLRA 1A0FA 2C4JA 2P0GA 1B8XA 4EIQA 4I8BA 4EKZA 1AAZA 2WB9A 2H71A 1B9XC 4ID0A 2LEGA 1PL2A 1XOAA 2C8UA 4WETA 2HRAA 3TKSC 1UA5A 3WGDA 5JCGA 2DKIA 1BEDA 2JACA 1M0UA 3EURA 2R5GA 2H75A 4ZL9A 1TI1A 1EP7A 4WF4A 4CY6A 4CDOA 4KW6A 2XPDA 1VRSD 5F07A 3NIVA 1PD21 1F3AA 2DMLA 3L9UA 4HQSA 3AY8A 5FHIA 2A2SA 4N0ZA 3KGKA 4YH2A 3QCPA 2A2PA 4BWQA 5IPGA 2B6MA 4IW9A 5D9TA 2YV9A 4LA1A 3IOSA 3M1GA 3IDVA 4K2XA 4XCSA 1YZXA 6GSWA 4O5RA 3GYKA 1Q4JA 3DEXA 4LMWA 1URMA 4PQIA 1MDKA 4POLA 4BVYB 1X9SB 2Z9SA 1MDJA 4MF7A 4PQHA 22GSA 1PN0A 5IQYA 3SBCA 4LLRA 2I1UA 3IHGA 3A2VA 3H4KA 1ZYNA 3KD0A 4EVMA 3IPZA 2X64A 2HE3A 4KAEA 1ZMAA 6GSTA 1YJ6A 3P2AA 1I5GA 2C3TA 2F9SA 1GTAA 4KDXA 2V6KA 3CBUA 3UIWA
chains in the Genus database with same CATH topology
2XHFA 4JZQA 4FH8A 1J0FA 3GH9A 1U87A 4GQCA 5COHA 1PX7A 2GSRA 4EDZA 3LYKA 2WJUA 4JRRA 2V2GA 2OE3A 2MBSA 1SJZA 1SK2A 3M9KA 3KMOA 2FA4A 2X8CA 3F0IA 5D9WA 3ZVJA 4WF5A 4PXOA 3ZREA 3M0FA 4YKFA 3Q18A 1TRSA 1TKDB 1JZRA 2M46A 1VF2A 4ML6A 3HA9A 4IN0A 4WKWA 4TKYA 3HZ4A 1RQMA 2YV7A 1LU4A 2IMDA 2OADA 3LORA 4XRAA 4HQZA 1GH2A 5DJMA 1PX6A 3QPMA 2O89A 2C0DA 3ZIVA 4G19A 4OCFA 2BMXA 4TN8A 5FT3A 1I9DA 4HZ2A 4NAXA 2WFCA 3I6AA 2H0HA 5AIXA 5IPHA 3EWLA 6GSVA 1G0TA 2DJ2A 2DKHA 1HNCA 5B8AA 3WGXA 1ON4A 5G30A 5CP1A 4XS4B 2GGTA 4QL9A 2E2GA 5A5KA 1OKTA 1Q98A 4BPYA 3FZ5A 1TK5B 3ZTLA 3ZIJA 2NDOA 1JZOA 4RI6A 1FO5A 1AC1A 1YQ1A 2DJKA 5F8BA 1O8XA 3GL5A 5DJLA 2HFDA 4JE1A 2IN3A 3GN3A 2IMEA 4N0VA 5ECSA 1HD2A 1TK0B 3F6DA 4POMA 3A5WA 2B5XA 3IC8A 4WR4A 1JLVA 2FA8A 8GSSA 1ERWA 4DSSB 4MA9A 4F9ZA 3ED3A 2E2MA 2QC7A 4D73A 1NHOA 1SKSB 4O32A 1M2BA 2MYGA 5A4VA 2HLSA 1FOVA 4JR6A 4DEJA 1ZYEA 3M3MA 2V6OA 2VCZA 4IJ3A 3TRQA 5DCHA 1TU8A 3CTGA 2HRKA 2WS2A 2GZYA 14GSA 1SL1B 1SK1A 3HY2A 2K6VA 5BMUA 3DWVA 2JSYA 1F37A 2AAWA 3GKXA 3EMXA 4IS0A 4F03A 3FW2A 4MP4A 2H76A 3F8UA 5ECKB 2LTKA 2YWOA 3F9UA 2HI7A 4KNDA 2VUPA 3R2QA 6GSYA 4N30A 2KLXA 3QAVA 2KP1A 2WULA 3BCKA 4I5QA 3G7JA 4USSA 1XZOA 4J56E 2LNSA 4K2DA 3MDKA 4IBPA 2DJ3A 2IMKA 4HEA2 4JBBA 1TK8B 4DSSA 3BOAA 3EE2A 2PU9C 1W4VA 2O8VB 3C71A 3LGCA 2L6CA 4OFNA 1HYUA 3VWXA 4IELA 4HOJA 3APQA 3FZ4A 2AHEA 3FKFA 3QFAC 4I2UA 5D8IA 2CAQA 4ZB8A 1YDKA 5JCUA 1TRUA 1QK8A 5B8BA 3ZL5A 2LJKA 3D5JA 3TJJA 2LQQA 1GWCA 1VF1A 3WT2A 5IOWA 3VWUA 1XWKA 3F3QA 1PRXA 2WCIA 1GP1A 2C3QA 1BQ7A 4X0XA 1WJKA 1X5EA 2MZCA 3KM6A 1AQVA 5ECIB 3TKQA 4IQAA 4TOPA 5ABRA 1AXDA 4X1UA 3V1WA 3QMXA 4QL7A 1OVNA 3TRPA 3TJKA 2R37A 5CREA 3ZITA 4J2FA 1QGVA 1PKZA 1T1VA 2RUEA 1XW6A 4MF5A 5D9VA 3DIEA 2XBQA 2YWNA 5H5QA 3HXSA 6GSXA 4KB3A 5JWRB 5LCZA 10GSA 5KN3A 1XWAA 5KOXA 4MJBA 3UJ1A 5IO2A 3PPUA 2O85A 4AF2A 1X5DA 1M99A 3DXBA 2CAIA 1K0BA 2C1YA 6GSUA 3EPTA 4IP1A 4RI7A 1Z6MA 2H72A 1V2AA 4PX1A 3KP9A 4X4JA 4Q5NA 11GSA 3J7Yk 5C04A 4KCAA 3M8NA 3A3TA 1USBA 1ZOFA 1S3AA 1GRXA 3H93A 2KHPA 3FEUA 2EIOA 2VOCA 3MIXA 2OBIA 1K3OA 2VCQA 1GUHA 3GFKA 4K1FA 5B6MA 2GVPA 1EV9A 1O73A 2MMZA 2YWIA 1R26A 2M72A 4K5RA 4L5LA 3HD5A 4OMVA 4TRXA 1GTUA 2BJXA 1MTCA 5LNKe 3C1SA 5J9BA 1F3BA 1GTBA 3LQ7A 1IYIA 4NPBA 2H0IA 2YJ7A 3FY7A 3IAM2 3KP8A 3TB2A 3QAGA 4WR5A 4MH2A 5E4WA 5B6NA 3HDCA 4OWYA 1YKAA 1SK0A 3KH7A 2F8FA 3ZYWA 2P5QA 3J7Yb 4Q5QA 1OC8A 4KH7A 5D9XA 1EEJA 3L0HA 4CHSA 1TRVA 4TW5A 4CY8A 4DSQA 3MWHA 5IOXA 1AW9A 3ERFA 2N5AA 5HR0A 1UN2A 3TOUA 5DQYA 3P7XA 2PERA 1HQOA 3QAWA 5H5RA 3GA4A 2HZFA 2X8HA 5J5NA 3KH9A 2GT5A 4GF0A 4OFTA 3GV1A 2WZ9A 2H0GA 2B3SA 2R4VA 3FR6A 1AUCA 1KEBA 2RIIA 1TJDA 3O3TA 3IHQA 4K8MA 1WPIA 3GSSA 3A2WA 1U88A 1YKCA 1GSSA 5JWQB 5DALB 3IE3A 1YEXA 3ZMKA 4ECCA 5F05A 4AJ7A 5G2ZA 4ZB9A 1XW9A 2I81A 1OC9A 3I43A 4N10A 4NHWA 2DIZA 3KEBA 4MLYA 1GSYA 3EVIA 3PR8A 2D2ZA 2EIQA 2QGVA 1T00A 2L6DA 2YOIA 3FMWA 4ECIA 2FNOA 4G0KA 3IK7A 3UMAA 2HXKA 3F4TA 5ECNB 4ICYA 1J08A 4EXJA 4I97A 1EOGA 1SD8A 1SENA 4F2IA 3ZZXA 3TKSA 3D6IA 1QFNA 5G5EA 3UVHA 2DC5A 4K7OA 5ID2B 5D96A 1N2AA 1YF0A 3F3RA 2GZPA 4K7NA 1SD9A 3IXRA 3QDNA 3UBLA 3TCOA 4KUNA 2ZNMA 1GSEA 1VF3A 2VL9A 4PURA 3E0UA 5DALA 3GSTA 1WIKA 5DCGA 4J57E 1A23A 1M9BA 2KP2A 3IC4A 2DSAA 4ZILA 3KZQA 5CAXA 1NHYA 3CMIA 3GKMA 5IMVA 1O6JA 4E8HA 2GS3A 3EU4A 2LRTA 1U3IA 2N5BA 2FGXA 3LG6A 4OCEA 3LXZA 4ULXA 4K0NA 1FW1A 2CA8A 1TOFA 3M9JA 1OE7A 3US3A 1B48A 1SYRA 2HSYA 2FHEA 1MD4A 5GSSA 3GKNA 3I9V2 2JSZA 3LW9A 3TJFA 5KN0A 3UBKA 5IMDA 2OBKA 5GSTA 2L5OA 2O87A 5GAPD 5ID2A 2H19A 3ME8A 2YNXA 3RPPA 1OC3A 2C0FA 5CRHA 1C72A 4ISDA 1W89A 5DAKB 1FHEA 1TP9A 2GDRA 3ME7A 2IIYA 5GZZB 4KF9A 1SKWB 1EP8A 4OO5A 1MEKA 4LL4B 2JU5A 4EE0A 5G1LA 2ZUPA 4BVYA 3DVWA 3C7MA 4IGJA 5HR1A 1XPVA 3O76A 3VURA 3NZNA 1UVZA 2C0GA 1X9MB 2K18A 4MMMA 4KSMA 4PTSA 3GUSA 2F8AA 2UZ8A 5E59A 3U5RE 2B5EA 2PMTA 3TJGA 3GX8A 4V1Ap 3GX0A 3DGQA 2XC2A 2YJHA 3ISOA 1THXA 3E3EA 4FQUA 1PKWA 1ST9A 1XVWA 4POKA 2PVQA 4L5OA 1FVJA 2K9FA 4GSNA 2J9HA 4ZL8A 2OACA 3VLNA 4O92A 1G7EA 1GNEA 4K0GA 1F9MA 4ML1A 1H4OA 5EPFA 2H74A 3HYPA 3LSZA 3D22A 1B4PA 3HCZA 3VPTA 1E2YA 2R0GA 2YZHA 3GL3A 4I2TA 1OKDA 1V98A 4G2EA 19GSA 2HZEB 4MPFA 2IWTA 3HVSA 4IJIA 5AIVA 1SU9A 3CRTA 2VIMA 3C73A 3IV4A 5HR3A 1U3AA 3IK9A 4NHZA 1BJXA 3L9SA 5GAND 2E0QA 2HRFA 4AJ8A 3EMPA 2H66A 3CSJA 3TJBA 4KDYA 3PINA 2NTOA 2P5RA 2R0PA 3VI7A 2GSTA 2FWFA 3C8EA 1F6MC 4DSRA 5JCWA 4TXOB 1PMTA 2GZZA 4K5SA 4XS4A 2V41A 5G31A 3TKPA 1XXUA 1PGTA 3FZ9A 2TRCP 4GRFA 2H6YA 4FYUA 4MZWA 3DVXA 4N11A 4PNGA 2VM2A 4G10A 2CX3A 3ZLPA 1BG5A 3APOA 3UVTA 5DDLA 2HZEA 2IL3A 1EEMA 3MNGA 1GSUA 3GNJA 2CZ2A 2X8GA 18GSA 5ECQB 3N5OA 3LXTA 4OFMA 1K0CA 4DVCA 3A5IA 2GQKA 4XHMA 4MDCA 2A2RA 4XRDA 4EC0A 1RK4A 1N8JA 1ZZYA 2NVLA 5CRWA 1O81A 3MYDA 3L4NA 4EL1A 3CXGA 4FYCA 1R5AA 4GLTA 4V2NA 4MJCA 4MJEA 3KXOA 4K9ZA 1A24A 4RUVA 1SJ6A 4OD7A 2TIRA 3LYPA 1XWCA 2VL2C 1RW1A 4HDEA 3GRXA 5D73A 3DD3A 2OE1A 1G6YA 1YY7A 2CVBA 1GSDA 4GWRA 5F0GA 3KCMA 4BVXB 1S3DA 1V58A 3IA1A 3TDGA 3PGTA 1K0AA 5HR2A 5FWGA 1EGOA 4TVEA 4V2MA 2OJLA 1NW2A 2C3NA 2CZ3A 2AUVA 1Y25A 4MF6A 4GSSA 4MABA 5L71A 3QD9A 4YAVA 3GIXA 2IFQB 4WBRD 1Z3EA 3TGZA 2JZTA 2ALBA 4O5UA 3UEMA 1T4ZA 3RPNA 4YQUA 4KX4A 4AJ6A 1YF1A 1TU7A 3FK8A 2VLUA 5ECMB 1G7OA 2YCDA 5IM9A 1H75A 4ILFA 4O5QA 3C1RA 3EYTA 2I9HA 3P90A 1SL0B 4YQVA 3Q74A 1QMVA 5A4UA 4I6XA 4L0UA 5J4UA 3HHVA 2RLIA 2H1BA 1ML6A 4TR0A 3BD2A 1B4QA 3GHAA 3IRAA 1VGLA 4BVXA 4ZIJA 1DE2A 5HFIA 2QSIA 2FWEA 2ZCTA 5ELAA 4KGIA 3RBTA 2XBIA 3RAZA 2TRXA 5ENUA 2NBSA 2AV4A 4F82A 3JCML 4WBJA 2A4VA 3ZFLA 4F0CA 1SL2B 3N9JA 1JZDA 5D93A 4G0LA 1EOHA 5LD0A 3TUEA 5DQSA 5EVOA 3F4SA 3W8SA 2HNLA 2REMA 2IFQA 3KTBA 1QUWA 5HFKA 4JEDA 2C80A 6GSSA 3LFLA 2E7PA 1BX9A 3F63A 3L9VA 4EO3A 4IHUA 2B1KA 5JWOB 4MNNA 1X5CA 1JFUA 2B1LA 2M80A 2HSHA 3EINA 2F51A 2PBJA 2VD0A 1UC7A 4JR4A 5CNWA 5CRGA 1ERVA 3F4RA 1A8LA 20GSA 1XBSA 2L4CA 3EU3A 2YP6A 4ZB6A 4TR3A 1T3BA 4MPGA 4HZ4A 3CRUA 2DJJA 2LS5A 4KE3A 4BA7A 5ECLB 1K3YA 4MK3A 5EL8A 1R7HA 4WXTA 1E6BA 4Z2RA 3F6FA 2VLVA 3IR4A 1M7TA 1WOUA 2NPBA 2EC4A 4PNFA 2DBCA 1ZYPA 5HQPA 1HNBA 3ERWA 3FRCA 4TR1B 1PN9A 4HJMA 1MDIA 2X49A 5HFGA 5INYA 2VL3A 3GMFA 3MSZA 4Q5RA 1B9YC 1O85A 3HVXA 2RM5A 2H1AA 1Z7RA 1R5PA 2IJYA 3BCIA 3GTUB 2L4QA 3VWVA 1A2LA 3L78A 4Z7XA 1Y6EA 1K0DA 3TOTA 4WEYA 2WGRA 2FUG2 2OE0A 1T8EB 1A2JA 3A2XA 2IMIA 1SYXA 4HU7A 3RHBA 1KBNA 4NMUA 1AQXA 1TTZA 1IYHA 1WE0A 1JLWA 1DE1A 2I4AA 4Q5FA 2F3MA 3D4TA 1KNGA 3WD6A 3CTFA 4TR1A 4ZBBA 2B7JA 1XWGA 1CQGA 2K8VA 4OO4A 4K7IA 12GSA 1PQNA 5G1KA 1S3CA 1K0OA 1DSBA 1J9BA 1F2EA 3GURA 4EF0A 1GUKA 4ECJA 2FCHA 5IO0A 16GSA 2KOKA 1Z6NA 3ZRDA 3GTUA 4KSOA 1XWBA 1TRWA 4MZBA 1Z9HA 4FO5A 1TXXA 2FD3A 3KIJA 5AGYA 3QR6A 3UAPA 2PN8A 2YZUA 3DMLA 5KN2A 2G2QA 3P8WA 3HJPA 1O7UA 3GH6A 2YN1A 2YWMA 2AYTA 2JL4A 1FOHA 2WDUA 4K6XA 2AB6A 4MZCA 4GQFA 3LEFA 2PVOC 1A8YA 4EDYA 4LL1B 13GSA 5J9CA 1TW9A 3CSHA 5EY6A 3WGEA 4XS1A 1NSWA 4YQMA 1GLQA 2MMAA 2MBTA 1XOBA 2P31A 1V40A 2GSSA 4X43A 4MJAA 1OYJA 4LMVA 4ZL7A 1GUMA 1GULA 3BJ5A 1ACVA 3FZAA 4IVFA 2H73A 2LKUA 1K3LA 1A0RP 4HJ2A 4AGSA 2I3YA 2QA1A 4IP6A 3U6VA 5IMAA 3W8JA 1LBKA 1QXHA 2XPEA 4D73B 1FB6A 2LV3A 1PL1A 1SJIA 1DUGA 3IAS2 2JZSA 3HJMA 3HZ8A 17GSA 2H1GA 1GTIA 1YEPA 1ILOA 5AN1A 1Z5YE 2LJRA 2VM1A 5DAKA 2DIYA 3I69A 3Q6OA 3WT1A 1TDIA 2YPMA 2CV4A 1T7PB 1U6TA 4P3YB 1AIUA 2VCTA 3G9BA 3H8QA 1V9WA 2H70A 4NWYA 3GKKA 3S9FA 3SWLA 1ERTA 2H01A 5IMCA 1M2DA 2FWHA 3TKRA 2EIRA 7GSSA 3ZVJD 4V2LA 3D21A 3HJOA 2FLSA 3BBYA 2FWGA 3O6TA 3FR9A 4IKHA 4ACSA 5IMFA 2X4AA 5KOWA 1WRYA 4FIWA 5ECOB 4JU5A 2L57A 2QA2A 4BL7B 1EZKA 3LWAA 4KDUA 4XIHA 2DMMA 2HRNA 2C0EA 3FHKA 2R0CA 3UL3A 3MAKA 1GSFA 3QFBC 3TKSE 2GSQA 4GSTA 4GCIA 2PUKC 1ZYQB 1THOA 1QQ2A 3NOFA 2V32A 1EV4A 5CO3A 2IMFA 5IMZA 2H8LA 4EUYA 1K0NA 1ZGNA 4IQ1A 4G0IA 2AJQB 2LRCA 2VCXA 2LJAA 5ECRB 1T4YA 3VK9A 3VI5A 2CT6A 2ON5A 1EWXA 2H6ZA 2V1MA 3D0ZA 2DJ1A 3Q19A 1OAZA 4A5PA 2B5YA 3G7IA 2R6KA 1LJRA 2RUFA 4RQRA 5ELGA 3VPQA 1TI3A 2CVDA 1MD3A 1V57A 2LSTA 2VO4A 2VAFA 3LJRA 1M9AA 1XW5A 1FVKA 1M2AA 5KN1A 2HT9A 2CQ9A 2QKEA 1R4WA 1K0MA 4G9HA 3QOUA 4BL7A 2DJ0A 4BWSA 5H5SA 2LNTA 2PWJA 4TXOA 2H6XA 3D4MA 1BYEA 2GQLA 9GSSA 2B7KA 3IBHA 3RHCA 4HS1A 1ABAA 4V1Ag 3VWWA 3E9JB 4MH3A 1ZL9A 1X9WB 4ZBDA 3RDWA 3G7YA 3W6GA 3FYGA 2X99A 2VL2A 1FG4A 4KA0A 5DVBA 2PPTA 2VD1A 5CYYA 4EIPA 1EGRA 4Z2TA 5J3RA 1XCCA 4QQ7A 1SKRB 3TRXA 2RM6A 1OE8A 5J41A 4FYBA 2JZRA 4HU9A 2J23A 5AISA 5ECPB 5C00A 2L5LA 2HSMA 2ON7A 4E8EA 2CVKA 3DRNA 2O7KA 3H79A 1GNWA 4GTUA 1AQWA 1DBYA 1NM3A 2VCVA 2IPAA 2MMOA 4XS6A 3HVVA 1ERUA 1GSQA 3CYNA 5A4WA 4ECBA 3FR3A 2GT6A 1FAAA 2N5FA 4NV2A 2DLXA 1Z7PA 1PA3A 2VCWA 3UARA 4NXIA 3ZMLA 3KJYA 3VFIA 2KUCA 3K8NA 4YKGA 5G5FA 1G6WA 1X0RA 3APSA 2PGTA 4XTSA 4L8EA 2R3XA 3PH9A 4O7HA 3ERGA 4HUAA 1A2MA 2YANA 4TR4A 4PGTA 1XVQA 2JADA 5IIZA 3EC3A 5DBQA 1WMJA 1FB0A 1BAYA 1VF4A 4F0BA 1XFLA 4NV5A 1O8WA 4HI7A 1XIYA 2CX4A 4PUAA 3OR5A 3R3EA 3HKRA 1HNAA 5CRDA 3UOMA 5KEJA 5BRTA 5F06A 2OA7A 2L59A 4ZBAA 2K8SA 1WP0A 5B7CA 5ECHB 2ES7A 1OC9B 3KTLA 2GTUA 1JHBA 4ZXGA 4CW9A 4GXZA 2FY6A 3H1NA 2H1DA 4MCUA 2GQMA 2H30A 3WYWA 4TXVA 2OKAA 1WWJA 1GLPA 2VLTA 4Z2UA 4PQ1A 4H86A 3DYRA 4RQXA 2MMNA 4POBA 2LUSA 4YAPA 2HYXA 2LQOA 2WRTA 2BTOT 1PSQA 1ZCPA 3ZFBA 4L0WA 2G0FA 3CSIA 2A4HA 3KMNA 1JZWA 2R2JA 1GL8A 4KCEA 1CQHA 3DKSA 4PUFC 2LRNA 1KTEA 2GLRA 1A0FA 2C4JA 2P0GA 1B8XA 4EIQA 4I8BA 4EKZA 1AAZA 2WB9A 2H71A 1B9XC 4ID0A 2LEGA 1PL2A 1XOAA 2C8UA 4WETA 2HRAA 3TKSC 1UA5A 3WGDA 5JCGA 2DKIA 1BEDA 2JACA 1M0UA 3EURA 2R5GA 2H75A 4ZL9A 1TI1A 1EP7A 4WF4A 4CY6A 4CDOA 4KW6A 2XPDA 1VRSD 5F07A 3NIVA 1PD21 1F3AA 2DMLA 3L9UA 4HQSA 3AY8A 5FHIA 2A2SA 4N0ZA 3KGKA 4YH2A 3QCPA 2A2PA 4BWQA 5IPGA 2B6MA 4IW9A 5D9TA 2YV9A 4LA1A 3IOSA 3M1GA 3IDVA 4K2XA 4XCSA 1YZXA 6GSWA 4O5RA 3GYKA 1Q4JA 3DEXA 4LMWA 1URMA 4PQIA 1MDKA 4POLA 4BVYB 1X9SB 2Z9SA 1MDJA 4MF7A 4PQHA 22GSA 1PN0A 5IQYA 3SBCA 4LLRA 2I1UA 3IHGA 3A2VA 3H4KA 1ZYNA 3KD0A 4EVMA 3IPZA 2X64A 2HE3A 4KAEA 1ZMAA 6GSTA 1YJ6A 3P2AA 1I5GA 2C3TA 2F9SA 1GTAA 4KDXA 2V6KA 3CBUA 3UIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XHF A;  4JZQ A;  4FH8 A;  1J0F A;  3GH9 A;  1U87 A;  4GQC A;  5COH A;  1PX7 A;  2GSR A;  4EDZ A;  3LYK A;  2WJU A;  4JRR A;  2V2G A;  2OE3 A;  2MBS A;  1SJZ A;  1SK2 A;  3M9K A;  3KMO A;  2FA4 A;  2X8C A;  3F0I A;  5D9W A;  3ZVJ A;  4WF5 A;  4PXO A;  3ZRE A;  3M0F A;  3Q18 A;  1TRS A;  1TKD B;  1JZR A;  2M46 A;  1VF2 A;  4ML6 A;  3HA9 A;  4IN0 A;  4WKW A;  4TKY A;  3HZ4 A;  1RQM A;  2YV7 A;  1LU4 A;  2IMD A;  2OAD A;  3LOR A;  4XRA A;  4HQZ A;  1GH2 A;  5DJM A;  1PX6 A;  3QPM A;  2O89 A;  2C0D A;  3ZIV A;  4G19 A;  4OCF A;  2BMX A;  4TN8 A;  5FT3 A;  1I9D A;  4HZ2 A;  4NAX A;  2WFC A;  3I6A A;  2H0H A;  5AIX A;  5IPH A;  3EWL A;  6GSV A;  1G0T A;  2DJ2 A;  1HNC A;  5B8A A;  3WGX A;  1ON4 A;  5G30 A;  5CP1 A;  4XS4 B;  2GGT A;  4QL9 A;  2E2G A;  5A5K A;  1OKT A;  1Q98 A;  4BPY A;  3FZ5 A;  1TK5 B;  3ZTL A;  3ZIJ A;  2NDO A;  1JZO A;  4RI6 A;  1FO5 A;  1AC1 A;  1YQ1 A;  2DJK A;  5F8B A;  1O8X A;  3GL5 A;  5DJL A;  2HFD A;  4JE1 A;  2IN3 A;  3GN3 A;  2IME A;  4N0V A;  5ECS A;  1HD2 A;  1TK0 B;  3F6D A;  4POM A;  3A5W A;  2B5X A;  4WR4 A;  1JLV A;  2FA8 A;  8GSS A;  1ERW A;  4DSS B;  4MA9 A;  4F9Z A;  3ED3 A;  2E2M A;  2QC7 A;  4D73 A;  1NHO A;  1SKS B;  4O32 A;  1M2B A;  2MYG A;  5A4V A;  2HLS A;  1FOV A;  4JR6 A;  4DEJ A;  1ZYE A;  3M3M A;  2V6O A;  2VCZ A;  4IJ3 A;  3TRQ A;  5DCH A;  1TU8 A;  3CTG A;  2WS2 A;  2GZY A;  14GS A;  1SL1 B;  1SK1 A;  3HY2 A;  2K6V A;  3DWV A;  2JSY A;  1F37 A;  2AAW A;  3GKX A;  3EMX A;  4IS0 A;  4F03 A;  3FW2 A;  4MP4 A;  2H76 A;  3F8U A;  5ECK B;  2LTK A;  2YWO A;  3F9U A;  2HI7 A;  4KND A;  2VUP A;  3R2Q A;  6GSY A;  4N30 A;  2KLX A;  3QAV A;  2KP1 A;  2WUL A;  3BCK A;  4I5Q A;  3G7J A;  1XZO A;  4J56 E;  2LNS A;  4K2D A;  3MDK A;  4IBP A;  2DJ3 A;  2IMK A;  4HEA 2;  4JBB A;  1TK8 B;  4DSS A;  3BOA A;  3EE2 A;  2PU9 C;  1W4V A;  2O8V B;  3C71 A;  3LGC A;  2L6C A;  4OFN A;  1HYU A;  3VWX A;  4IEL A;  4HOJ A;  3APQ A;  3FZ4 A;  2AHE A;  3FKF A;  3QFA C;  4I2U A;  5D8I A;  2CAQ A;  4ZB8 A;  1YDK A;  5JCU A;  1TRU A;  1QK8 A;  5B8B A;  3ZL5 A;  2LJK A;  3D5J A;  3TJJ A;  2LQQ A;  1GWC A;  1VF1 A;  3WT2 A;  5IOW A;  3VWU A;  1XWK A;  3F3Q A;  1PRX A;  2WCI A;  1GP1 A;  2C3Q A;  1BQ7 A;  4X0X A;  1WJK A;  1X5E A;  2MZC A;  3KM6 A;  1AQV A;  5ECI B;  3TKQ A;  4IQA A;  4TOP A;  5ABR A;  1AXD A;  4X1U A;  3V1W A;  3QMX A;  4QL7 A;  1OVN A;  3TRP A;  3TJK A;  2R37 A;  5CRE A;  3ZIT A;  4J2F A;  1QGV A;  1PKZ A;  1T1V A;  2RUE A;  1XW6 A;  4MF5 A;  5D9V A;  3DIE A;  2XBQ A;  2YWN A;  5H5Q A;  3HXS A;  6GSX A;  4KB3 A;  5JWR B;  5LCZ A;  10GS A;  5KN3 A;  1XWA A;  4MJB A;  3UJ1 A;  5IO2 A;  2O85 A;  4AF2 A;  1X5D A;  1M99 A;  3DXB A;  2CAI A;  1K0B A;  2C1Y A;  6GSU A;  4IP1 A;  4RI7 A;  1Z6M A;  2H72 A;  1V2A A;  4PX1 A;  3KP9 A;  4Q5N A;  11GS A;  3J7Y k;  5C04 A;  4KCA A;  3M8N A;  3A3T A;  1USB A;  1ZOF A;  1S3A A;  1GRX A;  3H93 A;  2KHP A;  3FEU A;  2EIO A;  2VOC A;  2OBI A;  1K3O A;  2VCQ A;  1GUH A;  3GFK A;  4K1F A;  5B6M A;  2GVP A;  1EV9 A;  1O73 A;  2MMZ A;  2YWI A;  1R26 A;  2M72 A;  4L5L A;  3HD5 A;  4OMV A;  4TRX A;  1GTU A;  2BJX A;  1MTC A;  5LNK e;  3C1S A;  5J9B A;  1F3B A;  1GTB A;  3LQ7 A;  1IYI A;  4NPB A;  2H0I A;  2YJ7 A;  3FY7 A;  3IAM 2;  3KP8 A;  3TB2 A;  3QAG A;  4WR5 A;  4MH2 A;  5E4W A;  5B6N A;  3HDC A;  4OWY A;  1YKA A;  1SK0 A;  3KH7 A;  2F8F A;  3ZYW A;  2P5Q A;  3J7Y b;  4Q5Q A;  1OC8 A;  4KH7 A;  5D9X A;  1EEJ A;  3L0H A;  4CHS A;  1TRV A;  4TW5 A;  4DSQ A;  3MWH A;  5IOX A;  1AW9 A;  3ERF A;  2N5A A;  5HR0 A;  1UN2 A;  3TOU A;  5DQY A;  3P7X A;  2PER A;  1HQO A;  3QAW A;  5H5R A;  3GA4 A;  2HZF A;  2X8H A;  5J5N A;  3KH9 A;  2GT5 A;  4GF0 A;  4OFT A;  3GV1 A;  2WZ9 A;  2H0G A;  2B3S A;  2R4V A;  3FR6 A;  1AUC A;  1KEB A;  2RII A;  1TJD A;  3O3T A;  3IHQ A;  4K8M A;  1WPI A;  3GSS A;  3A2W A;  1U88 A;  1YKC A;  1GSS A;  5JWQ B;  5DAL B;  3IE3 A;  1YEX A;  3ZMK A;  4ECC A;  5F05 A;  4AJ7 A;  5G2Z A;  4ZB9 A;  1XW9 A;  2I81 A;  1OC9 A;  3I43 A;  4N10 A;  4NHW A;  2DIZ A;  3KEB A;  4MLY A;  1GSY A;  3EVI A;  3PR8 A;  2D2Z A;  2EIQ A;  2QGV A;  1T00 A;  2L6D A;  2YOI A;  4ECI A;  2FNO A;  3IK7 A;  3UMA A;  2HXK A;  3F4T A;  5ECN B;  1J08 A;  4EXJ A;  4I97 A;  1EOG A;  1SD8 A;  1SEN A;  4F2I A;  3ZZX A;  3TKS A;  3D6I A;  1QFN A;  5G5E A;  3UVH A;  2DC5 A;  4K7O A;  5ID2 B;  5D96 A;  1N2A A;  1YF0 A;  3F3R A;  2GZP A;  4K7N A;  1SD9 A;  3IXR A;  3QDN A;  3UBL A;  3TCO A;  4KUN A;  2ZNM A;  1GSE A;  1VF3 A;  2VL9 A;  4PUR A;  3E0U A;  5DAL A;  3GST A;  1WIK A;  5DCG A;  4J57 E;  1A23 A;  1M9B A;  2KP2 A;  3IC4 A;  2DSA A;  4ZIL A;  3KZQ A;  5CAX A;  1NHY A;  3CMI A;  3GKM A;  5IMV A;  1O6J A;  4E8H A;  2GS3 A;  3EU4 A;  2LRT A;  1U3I A;  2N5B A;  2FGX A;  3LG6 A;  4OCE A;  3LXZ A;  4ULX A;  4K0N A;  1FW1 A;  2CA8 A;  1TOF A;  3M9J A;  1OE7 A;  3US3 A;  1B48 A;  1SYR A;  2HSY A;  2FHE A;  1MD4 A;  5GSS A;  3GKN A;  3I9V 2;  2JSZ A;  3TJF A;  5KN0 A;  3UBK A;  5IMD A;  2OBK A;  5GST A;  2L5O A;  2O87 A;  5GAP D;  5ID2 A;  2H19 A;  3ME8 A;  2YNX A;  3RPP A;  1OC3 A;  2C0F A;  5CRH A;  1C72 A;  4ISD A;  1W89 A;  5DAK B;  1FHE A;  1TP9 A;  2GDR A;  3ME7 A;  2IIY A;  5GZZ B;  1SKW B;  1EP8 A;  4OO5 A;  1MEK A;  4LL4 B;  2JU5 A;  4EE0 A;  5G1L A;  2ZUP A;  4BVY A;  3DVW A;  3C7M A;  4IGJ A;  5HR1 A;  1XPV A;  3O76 A;  3VUR A;  3NZN A;  1UVZ A;  2C0G A;  1X9M B;  2K18 A;  4MMM A;  4KSM A;  3GUS A;  2F8A A;  5E59 A;  3U5R E;  2B5E A;  2PMT A;  3TJG A;  3GX8 A;  4V1A p;  3GX0 A;  3DGQ A;  2XC2 A;  2YJH A;  3ISO A;  1THX A;  3E3E A;  1PKW A;  1ST9 A;  1XVW A;  4POK A;  2PVQ A;  4L5O A;  1FVJ A;  2K9F A;  4GSN A;  2J9H A;  4ZL8 A;  2OAC A;  3VLN A;  4O92 A;  1G7E A;  1GNE A;  4K0G A;  1F9M A;  4ML1 A;  1H4O A;  5EPF A;  2H74 A;  3HYP A;  3LSZ A;  3D22 A;  1B4P A;  3HCZ A;  3VPT A;  1E2Y A;  3GL3 A;  2YZH A;  4I2T A;  1OKD A;  1V98 A;  4G2E A;  19GS A;  2HZE B;  4MPF A;  2IWT A;  3HVS A;  4IJI A;  5AIV A;  1SU9 A;  3CRT A;  2VIM A;  3C73 A;  3IV4 A;  5HR3 A;  1U3A A;  3IK9 A;  4NHZ A;  1BJX A;  3L9S A;  5GAN D;  2E0Q A;  2HRF A;  4AJ8 A;  3EMP A;  2H66 A;  3CSJ A;  3TJB A;  4KDY A;  3PIN A;  2NTO A;  2P5R A;  3VI7 A;  2GST A;  2FWF A;  3C8E A;  1F6M C;  4DSR A;  5JCW A;  4TXO B;  1PMT A;  2GZZ A;  4XS4 A;  2V41 A;  5G31 A;  3TKP A;  1XXU A;  1PGT A;  3FZ9 A;  2TRC P;  4GRF A;  2H6Y A;  4FYU A;  4MZW A;  3DVX A;  4N11 A;  4PNG A;  2VM2 A;  4G10 A;  2CX3 A;  3ZLP A;  1BG5 A;  3APO A;  3UVT A;  5DDL A;  2HZE A;  2IL3 A;  1EEM A;  3MNG A;  1GSU A;  3GNJ A;  2CZ2 A;  2X8G A;  18GS A;  5ECQ B;  3N5O A;  3LXT A;  4OFM A;  1K0C A;  4DVC A;  2GQK A;  4XHM A;  4MDC A;  2A2R A;  4XRD A;  4EC0 A;  1RK4 A;  1N8J A;  1ZZY A;  2NVL A;  5CRW A;  1O81 A;  3L4N A;  4EL1 A;  3CXG A;  4FYC A;  1R5A A;  4GLT A;  4V2N A;  4MJC A;  4MJE A;  3KXO A;  4K9Z A;  1A24 A;  4RUV A;  1SJ6 A;  4OD7 A;  2TIR A;  3LYP A;  1XWC A;  2VL2 C;  1RW1 A;  4HDE A;  3GRX A;  5D73 A;  3DD3 A;  2OE1 A;  1G6Y A;  1YY7 A;  2CVB A;  5F0G A;  1GSD A;  4GWR A;  3KCM A;  1S3D A;  1V58 A;  3IA1 A;  3TDG A;  3PGT A;  1K0A A;  5HR2 A;  5FWG A;  1EGO A;  4TVE A;  4V2M A;  2OJL A;  1NW2 A;  2C3N A;  2CZ3 A;  2AUV A;  1Y25 A;  4MF6 A;  4GSS A;  4MAB A;  5L71 A;  3QD9 A;  4YAV A;  3GIX A;  2IFQ B;  4WBR D;  1Z3E A;  3TGZ A;  2JZT A;  2ALB A;  3UEM A;  1T4Z A;  3RPN A;  4YQU A;  4KX4 A;  4AJ6 A;  1YF1 A;  1TU7 A;  3FK8 A;  2VLU A;  5ECM B;  1G7O A;  2YCD A;  5IM9 A;  1H75 A;  4ILF A;  3C1R A;  3EYT A;  2I9H A;  3P90 A;  1SL0 B;  4YQV A;  3Q74 A;  1QMV A;  5A4U A;  4I6X A;  4L0U A;  5J4U A;  3HHV A;  2RLI A;  2H1B A;  1ML6 A;  4TR0 A;  3BD2 A;  1B4Q A;  3GHA A;  3IRA A;  1VGL A;  4BVX A;  4ZIJ A;  1DE2 A;  5HFI A;  2QSI A;  2FWE A;  2ZCT A;  5ELA A;  4KGI A;  3RBT A;  2XBI A;  3RAZ A;  2TRX A;  5ENU A;  2NBS A;  2AV4 A;  4F82 A;  3JCM L;  4WBJ A;  2A4V A;  3ZFL A;  4F0C A;  1SL2 B;  3N9J A;  1JZD A;  5D93 A;  1EOH A;  5LD0 A;  3TUE A;  5DQS A;  5EVO A;  3F4S A;  3W8S A;  2HNL A;  2REM A;  2IFQ A;  3KTB A;  1QUW A;  5HFK A;  4JED A;  2C80 A;  6GSS A;  3LFL A;  2E7P A;  1BX9 A;  3F63 A;  3L9V A;  4EO3 A;  4IHU A;  2B1K A;  5JWO B;  1X5C A;  1JFU A;  2B1L A;  2M80 A;  2HSH A;  3EIN A;  2F51 A;  2PBJ A;  2VD0 A;  1UC7 A;  4JR4 A;  5CNW A;  5CRG A;  1ERV A;  3F4R A;  1A8L A;  20GS A;  1XBS A;  2L4C A;  3EU3 A;  2YP6 A;  4ZB6 A;  4TR3 A;  1T3B A;  4MPG A;  4HZ4 A;  3CRU A;  2DJJ A;  2LS5 A;  4KE3 A;  4BA7 A;  5ECL B;  1K3Y A;  4MK3 A;  5EL8 A;  1R7H A;  4WXT A;  1E6B A;  3F6F A;  2VLV A;  3IR4 A;  1M7T A;  1WOU A;  2NPB A;  2EC4 A;  4PNF A;  2DBC A;  5HQP A;  1HNB A;  3ERW A;  3FRC A;  4TR1 B;  1PN9 A;  4HJM A;  1MDI A;  5HFG A;  5INY A;  2VL3 A;  3GMF A;  3MSZ A;  1B9Y C;  4Q5R A;  1O85 A;  3HVX A;  2RM5 A;  2H1A A;  1Z7R A;  1R5P A;  2IJY A;  3BCI A;  3GTU B;  2L4Q A;  3VWV A;  1A2L A;  3L78 A;  4Z7X A;  1Y6E A;  1K0D A;  3TOT A;  4WEY A;  2WGR A;  2FUG 2;  2OE0 A;  1T8E B;  1A2J A;  3A2X A;  2IMI A;  1SYX A;  4HU7 A;  3RHB A;  1KBN A;  4NMU A;  1AQX A;  1TTZ A;  1IYH A;  1WE0 A;  1JLW A;  1DE1 A;  2I4A A;  4Q5F A;  2F3M A;  3D4T A;  1KNG A;  3WD6 A;  3CTF A;  4TR1 A;  4ZBB A;  2B7J A;  1XWG A;  1CQG A;  2K8V A;  4OO4 A;  4K7I A;  12GS A;  1PQN A;  5G1K A;  1S3C A;  1K0O A;  1DSB A;  1J9B A;  1F2E A;  3GUR A;  4EF0 A;  1GUK A;  4ECJ A;  2FCH A;  5IO0 A;  16GS A;  2KOK A;  1Z6N A;  3ZRD A;  3GTU A;  4KSO A;  1XWB A;  1TRW A;  4MZB A;  1Z9H A;  4FO5 A;  1TXX A;  2FD3 A;  3KIJ A;  5AGY A;  3QR6 A;  3UAP A;  2PN8 A;  2YZU A;  3DML A;  5KN2 A;  2G2Q A;  3P8W A;  3HJP A;  1O7U A;  3GH6 A;  2YN1 A;  2YWM A;  2AYT A;  2JL4 A;  2WDU A;  4K6X A;  2AB6 A;  4MZC A;  4GQF A;  3LEF A;  2PVO C;  1A8Y A;  4EDY A;  4LL1 B;  13GS A;  5J9C A;  1TW9 A;  3CSH A;  5EY6 A;  3WGE A;  4XS1 A;  1NSW A;  4YQM A;  1GLQ A;  2MMA A;  2MBT A;  1XOB A;  2P31 A;  1V40 A;  2GSS A;  4X43 A;  4MJA A;  1OYJ A;  4LMV A;  4ZL7 A;  1GUM A;  1GUL A;  3BJ5 A;  1ACV A;  3FZA A;  4IVF A;  2H73 A;  2LKU A;  1K3L A;  1A0R P;  4HJ2 A;  4AGS A;  2I3Y A;  3U6V A;  4IP6 A;  5IMA A;  3W8J A;  1LBK A;  1QXH A;  2XPE A;  4D73 B;  1FB6 A;  2LV3 A;  1PL1 A;  1SJI A;  1DUG A;  3IAS 2;  2JZS A;  3HJM A;  3HZ8 A;  17GS A;  2H1G A;  1GTI A;  1YEP A;  1ILO A;  5AN1 A;  1Z5Y E;  2LJR A;  2VM1 A;  5DAK A;  2DIY A;  3I69 A;  3Q6O A;  3WT1 A;  1TDI A;  2YPM A;  2CV4 A;  1T7P B;  1U6T A;  4P3Y B;  1AIU A;  2VCT A;  3G9B A;  3H8Q A;  1V9W A;  2H70 A;  4NWY A;  3GKK A;  3S9F A;  3SWL A;  1ERT A;  2H01 A;  5IMC A;  1M2D A;  2FWH A;  3TKR A;  2EIR A;  7GSS A;  3ZVJ D;  4V2L A;  3D21 A;  3HJO A;  2FLS A;  3BBY A;  2FWG A;  3O6T A;  3FR9 A;  4IKH A;  4ACS A;  5IMF A;  1WRY A;  4FIW A;  5ECO B;  4JU5 A;  2L57 A;  1EZK A;  3LWA A;  4KDU A;  4XIH A;  2DMM A;  2HRN A;  2C0E A;  3FHK A;  3UL3 A;  3MAK A;  1GSF A;  3QFB C;  3TKS E;  2GSQ A;  4GST A;  4GCI A;  2PUK C;  1ZYQ B;  1THO A;  1QQ2 A;  3NOF A;  2V32 A;  1EV4 A;  5CO3 A;  2IMF A;  5IMZ A;  2H8L A;  4EUY A;  1K0N A;  1ZGN A;  4IQ1 A;  2AJQ B;  2LRC A;  2VCX A;  2LJA A;  5ECR B;  1T4Y A;  3VK9 A;  3VI5 A;  2CT6 A;  2ON5 A;  1EWX A;  2H6Z A;  2V1M A;  3D0Z A;  2DJ1 A;  3Q19 A;  1OAZ A;  2B5Y A;  3G7I A;  2R6K A;  1LJR A;  2RUF A;  4RQR A;  5ELG A;  3VPQ A;  1TI3 A;  2CVD A;  1MD3 A;  1V57 A;  2LST A;  2VO4 A;  2VAF A;  3LJR A;  1M9A A;  1XW5 A;  1FVK A;  1M2A A;  5KN1 A;  2HT9 A;  2CQ9 A;  2QKE A;  1R4W A;  1K0M A;  4G9H A;  3QOU A;  4BL7 A;  2DJ0 A;  4BWS A;  5H5S A;  2LNT A;  2PWJ A;  4TXO A;  2H6X A;  3D4M A;  1BYE A;  2GQL A;  9GSS A;  2B7K A;  3IBH A;  3RHC A;  4HS1 A;  1ABA A;  4V1A g;  3VWW A;  3E9J B;  4MH3 A;  1ZL9 A;  1X9W B;  4ZBD A;  3RDW A;  3G7Y A;  3W6G A;  3FYG A;  2X99 A;  2VL2 A;  1FG4 A;  4KA0 A;  5DVB A;  2PPT A;  2VD1 A;  5CYY A;  1EGR A;  5J3R A;  1XCC A;  4QQ7 A;  1SKR B;  3TRX A;  2RM6 A;  1OE8 A;  5J41 A;  4FYB A;  2JZR A;  4HU9 A;  2J23 A;  5AIS A;  5ECP B;  5C00 A;  2L5L A;  2ON7 A;  4E8E A;  2CVK A;  3DRN A;  2O7K A;  3H79 A;  1GNW A;  4GTU A;  1AQW A;  1DBY A;  1NM3 A;  2VCV A;  2IPA A;  2MMO A;  4XS6 A;  3HVV A;  1ERU A;  1GSQ A;  3CYN A;  5A4W A;  4ECB A;  3FR3 A;  2GT6 A;  1FAA A;  2N5F A;  4NV2 A;  2DLX A;  1Z7P A;  1PA3 A;  2VCW A;  3UAR A;  4NXI A;  3ZML A;  3KJY A;  3VFI A;  2KUC A;  3K8N A;  5G5F A;  1G6W A;  1X0R A;  3APS A;  2PGT A;  4XTS A;  4L8E A;  2R3X A;  3PH9 A;  4O7H A;  3ERG A;  4HUA A;  1A2M A;  2YAN A;  4TR4 A;  4PGT A;  1XVQ A;  2JAD A;  5IIZ A;  3EC3 A;  5DBQ A;  1WMJ A;  1FB0 A;  1BAY A;  1VF4 A;  4F0B A;  1XFL A;  4NV5 A;  1O8W A;  4HI7 A;  1XIY A;  2CX4 A;  4PUA A;  3OR5 A;  3HKR A;  1HNA A;  5CRD A;  3UOM A;  5KEJ A;  5F06 A;  2OA7 A;  2L59 A;  4ZBA A;  2K8S A;  1WP0 A;  5B7C A;  5ECH B;  2ES7 A;  1OC9 B;  3KTL A;  2GTU A;  1JHB A;  4ZXG A;  4CW9 A;  4GXZ A;  2FY6 A;  3H1N A;  2H1D A;  4MCU A;  2GQM A;  2H30 A;  3WYW A;  4TXV A;  2OKA A;  1WWJ A;  1GLP A;  2VLT A;  4PQ1 A;  4H86 A;  3DYR A;  4RQX A;  2MMN A;  4POB A;  2LUS A;  4YAP A;  2HYX A;  2LQO A;  2WRT A;  2BTO T;  1PSQ A;  1ZCP A;  3ZFB A;  4L0W A;  2G0F A;  3CSI A;  3KMN A;  1JZW A;  2R2J A;  1GL8 A;  4KCE A;  1CQH A;  3DKS A;  4PUF C;  2LRN A;  1KTE A;  2GLR A;  1A0F A;  2C4J A;  2P0G A;  1B8X A;  4I8B A;  4EKZ A;  1AAZ A;  2WB9 A;  2H71 A;  1B9X C;  4ID0 A;  2LEG A;  1PL2 A;  1XOA A;  2C8U A;  4WET A;  3TKS C;  1UA5 A;  3WGD A;  5JCG A;  1BED A;  2JAC A;  1M0U A;  3EUR A;  2R5G A;  2H75 A;  4ZL9 A;  1TI1 A;  1EP7 A;  4WF4 A;  4CDO A;  4KW6 A;  2XPD A;  1VRS D;  5F07 A;  3NIV A;  1PD2 1;  1F3A A;  2DML A;  3L9U A;  4HQS A;  3AY8 A;  5FHI A;  2A2S A;  4N0Z A;  3KGK A;  4YH2 A;  3QCP A;  4BWQ A;  5IPG A;  2B6M A;  4IW9 A;  5D9T A;  2YV9 A;  4LA1 A;  3IOS A;  3M1G A;  3IDV A;  4XCS A;  1YZX A;  6GSW A;  4O5R A;  3GYK A;  1Q4J A;  3DEX A;  4LMW A;  1URM A;  4PQI A;  1MDK A;  4POL A;  1X9S B;  2Z9S A;  1MDJ A;  4MF7 A;  4PQH A;  22GS A;  5IQY A;  3SBC A;  4LLR A;  2I1U A;  3A2V A;  3H4K A;  3KD0 A;  4EVM A;  3IPZ A;  2X64 A;  2HE3 A;  4KAE A;  1ZMA A;  6GST A;  1YJ6 A;  3P2A A;  1I5G A;  2C3T A;  2F9S A;  1GTA A;  4KDX A;  2V6K A;  3CBU A;  3UIW A; 
#chains in the Genus database with same CATH topology
 2XHF A;  4JZQ A;  4FH8 A;  1J0F A;  3GH9 A;  1U87 A;  4GQC A;  5COH A;  1PX7 A;  2GSR A;  4EDZ A;  3LYK A;  2WJU A;  4JRR A;  2V2G A;  2OE3 A;  2MBS A;  1SJZ A;  1SK2 A;  3M9K A;  3KMO A;  2FA4 A;  2X8C A;  3F0I A;  5D9W A;  3ZVJ A;  4WF5 A;  4PXO A;  3ZRE A;  3M0F A;  4YKF A;  3Q18 A;  1TRS A;  1TKD B;  1JZR A;  2M46 A;  1VF2 A;  4ML6 A;  3HA9 A;  4IN0 A;  4WKW A;  4TKY A;  3HZ4 A;  1RQM A;  2YV7 A;  1LU4 A;  2IMD A;  2OAD A;  3LOR A;  4XRA A;  4HQZ A;  1GH2 A;  5DJM A;  1PX6 A;  3QPM A;  2O89 A;  2C0D A;  3ZIV A;  4G19 A;  4OCF A;  2BMX A;  4TN8 A;  5FT3 A;  1I9D A;  4HZ2 A;  4NAX A;  2WFC A;  3I6A A;  2H0H A;  5AIX A;  5IPH A;  3EWL A;  6GSV A;  1G0T A;  2DJ2 A;  2DKH A;  1HNC A;  5B8A A;  3WGX A;  1ON4 A;  5G30 A;  5CP1 A;  4XS4 B;  2GGT A;  4QL9 A;  2E2G A;  5A5K A;  1OKT A;  1Q98 A;  4BPY A;  3FZ5 A;  1TK5 B;  3ZTL A;  3ZIJ A;  2NDO A;  1JZO A;  4RI6 A;  1FO5 A;  1AC1 A;  1YQ1 A;  2DJK A;  5F8B A;  1O8X A;  3GL5 A;  5DJL A;  2HFD A;  4JE1 A;  2IN3 A;  3GN3 A;  2IME A;  4N0V A;  5ECS A;  1HD2 A;  1TK0 B;  3F6D A;  4POM A;  3A5W A;  2B5X A;  3IC8 A;  4WR4 A;  1JLV A;  2FA8 A;  8GSS A;  1ERW A;  4DSS B;  4MA9 A;  4F9Z A;  3ED3 A;  2E2M A;  2QC7 A;  4D73 A;  1NHO A;  1SKS B;  4O32 A;  1M2B A;  2MYG A;  5A4V A;  2HLS A;  1FOV A;  4JR6 A;  4DEJ A;  1ZYE A;  3M3M A;  2V6O A;  2VCZ A;  4IJ3 A;  3TRQ A;  5DCH A;  1TU8 A;  3CTG A;  2HRK A;  2WS2 A;  2GZY A;  14GS A;  1SL1 B;  1SK1 A;  3HY2 A;  2K6V A;  5BMU A;  3DWV A;  2JSY A;  1F37 A;  2AAW A;  3GKX A;  3EMX A;  4IS0 A;  4F03 A;  3FW2 A;  4MP4 A;  2H76 A;  3F8U A;  5ECK B;  2LTK A;  2YWO A;  3F9U A;  2HI7 A;  4KND A;  2VUP A;  3R2Q A;  6GSY A;  4N30 A;  2KLX A;  3QAV A;  2KP1 A;  2WUL A;  3BCK A;  4I5Q A;  3G7J A;  4USS A;  1XZO A;  4J56 E;  2LNS A;  4K2D A;  3MDK A;  4IBP A;  2DJ3 A;  2IMK A;  4HEA 2;  4JBB A;  1TK8 B;  4DSS A;  3BOA A;  3EE2 A;  2PU9 C;  1W4V A;  2O8V B;  3C71 A;  3LGC A;  2L6C A;  4OFN A;  1HYU A;  3VWX A;  4IEL A;  4HOJ A;  3APQ A;  3FZ4 A;  2AHE A;  3FKF A;  3QFA C;  4I2U A;  5D8I A;  2CAQ A;  4ZB8 A;  1YDK A;  5JCU A;  1TRU A;  1QK8 A;  5B8B A;  3ZL5 A;  2LJK A;  3D5J A;  3TJJ A;  2LQQ A;  1GWC A;  1VF1 A;  3WT2 A;  5IOW A;  3VWU A;  1XWK A;  3F3Q A;  1PRX A;  2WCI A;  1GP1 A;  2C3Q A;  1BQ7 A;  4X0X A;  1WJK A;  1X5E A;  2MZC A;  3KM6 A;  1AQV A;  5ECI B;  3TKQ A;  4IQA A;  4TOP A;  5ABR A;  1AXD A;  4X1U A;  3V1W A;  3QMX A;  4QL7 A;  1OVN A;  3TRP A;  3TJK A;  2R37 A;  5CRE A;  3ZIT A;  4J2F A;  1QGV A;  1PKZ A;  1T1V A;  2RUE A;  1XW6 A;  4MF5 A;  5D9V A;  3DIE A;  2XBQ A;  2YWN A;  5H5Q A;  3HXS A;  6GSX A;  4KB3 A;  5JWR B;  5LCZ A;  10GS A;  5KN3 A;  1XWA A;  5KOX A;  4MJB A;  3UJ1 A;  5IO2 A;  3PPU A;  2O85 A;  4AF2 A;  1X5D A;  1M99 A;  3DXB A;  2CAI A;  1K0B A;  2C1Y A;  6GSU A;  3EPT A;  4IP1 A;  4RI7 A;  1Z6M A;  2H72 A;  1V2A A;  4PX1 A;  3KP9 A;  4X4J A;  4Q5N A;  11GS A;  3J7Y k;  5C04 A;  4KCA A;  3M8N A;  3A3T A;  1USB A;  1ZOF A;  1S3A A;  1GRX A;  3H93 A;  2KHP A;  3FEU A;  2EIO A;  2VOC A;  3MIX A;  2OBI A;  1K3O A;  1XG8 A;  2VCQ A;  1GUH A;  3GFK A;  4K1F A;  5B6M A;  2GVP A;  1EV9 A;  1O73 A;  2MMZ A;  2YWI A;  1R26 A;  2M72 A;  4K5R A;  4L5L A;  3HD5 A;  4OMV A;  4TRX A;  1GTU A;  2BJX A;  1MTC A;  5LNK e;  3C1S A;  5J9B A;  1F3B A;  1GTB A;  3LQ7 A;  1IYI A;  4NPB A;  2H0I A;  2YJ7 A;  3FY7 A;  3IAM 2;  3KP8 A;  3TB2 A;  3QAG A;  4WR5 A;  4MH2 A;  5E4W A;  5B6N A;  3HDC A;  4OWY A;  1YKA A;  1SK0 A;  3KH7 A;  2F8F A;  3ZYW A;  2P5Q A;  3J7Y b;  4Q5Q A;  1OC8 A;  4KH7 A;  5D9X A;  1EEJ A;  3L0H A;  4CHS A;  1TRV A;  4TW5 A;  4CY8 A;  4DSQ A;  3MWH A;  5IOX A;  1AW9 A;  3ERF A;  2N5A A;  5HR0 A;  1UN2 A;  3TOU A;  5DQY A;  3P7X A;  2PER A;  1HQO A;  3QAW A;  5H5R A;  3GA4 A;  2HZF A;  2X8H A;  5J5N A;  3KH9 A;  2GT5 A;  4GF0 A;  4OFT A;  3GV1 A;  2WZ9 A;  2H0G A;  2B3S A;  2R4V A;  3FR6 A;  1AUC A;  1KEB A;  2RII A;  1TJD A;  3O3T A;  3IHQ A;  4K8M A;  1WPI A;  3GSS A;  3A2W A;  1U88 A;  1YKC A;  1GSS A;  5JWQ B;  5DAL B;  3IE3 A;  1YEX A;  3ZMK A;  4ECC A;  5F05 A;  4AJ7 A;  5G2Z A;  4ZB9 A;  1XW9 A;  2I81 A;  1OC9 A;  3I43 A;  4N10 A;  4NHW A;  2DIZ A;  3KEB A;  4MLY A;  1GSY A;  3EVI A;  3PR8 A;  2D2Z A;  2EIQ A;  2QGV A;  1T00 A;  2L6D A;  2YOI A;  3FMW A;  4ECI A;  2FNO A;  4G0K A;  3IK7 A;  3UMA A;  2HXK A;  3F4T A;  5ECN B;  4ICY A;  1J08 A;  4EXJ A;  4I97 A;  1EOG A;  1SD8 A;  1SEN A;  4F2I A;  3ZZX A;  3TKS A;  3D6I A;  1QFN A;  5G5E A;  3UVH A;  2DC5 A;  4K7O A;  5ID2 B;  5D96 A;  1N2A A;  1YF0 A;  3F3R A;  1M3J A;  2GZP A;  4K7N A;  1SD9 A;  3IXR A;  3QDN A;  3UBL A;  3TCO A;  4KUN A;  2ZNM A;  1GSE A;  1VF3 A;  2VL9 A;  4PUR A;  3E0U A;  5DAL A;  3GST A;  1WIK A;  5DCG A;  4J57 E;  1A23 A;  1M9B A;  2KP2 A;  3IC4 A;  2DSA A;  4ZIL A;  3KZQ A;  5CAX A;  1NHY A;  3CMI A;  3GKM A;  5IMV A;  1O6J A;  4E8H A;  2GS3 A;  3EU4 A;  2LRT A;  1U3I A;  2N5B A;  2FGX A;  3LG6 A;  4OCE A;  3LXZ A;  4ULX A;  4K0N A;  1FW1 A;  2CA8 A;  1TOF A;  3M9J A;  1OE7 A;  3US3 A;  1B48 A;  1SYR A;  2HSY A;  2FHE A;  1MD4 A;  5GSS A;  3GKN A;  3I9V 2;  2JSZ A;  3LW9 A;  3TJF A;  5KN0 A;  3UBK A;  5IMD A;  2OBK A;  5GST A;  2L5O A;  2O87 A;  5GAP D;  5ID2 A;  2H19 A;  3ME8 A;  2YNX A;  3RPP A;  1OC3 A;  2C0F A;  5CRH A;  1C72 A;  4ISD A;  1W89 A;  5DAK B;  1FHE A;  1TP9 A;  2GDR A;  3ME7 A;  2IIY A;  5GZZ B;  4KF9 A;  1SKW B;  1EP8 A;  4OO5 A;  1MEK A;  4LL4 B;  2JU5 A;  4EE0 A;  5G1L A;  2ZUP A;  4BVY A;  3DVW A;  3C7M A;  4IGJ A;  5HR1 A;  1XPV A;  3O76 A;  3VUR A;  3NZN A;  1UVZ A;  2C0G A;  1X9M B;  2K18 A;  4MMM A;  4KSM A;  4PTS A;  3GUS A;  2F8A A;  2UZ8 A;  5E59 A;  3U5R E;  2B5E A;  2PMT A;  3TJG A;  3GX8 A;  4V1A p;  3GX0 A;  3DGQ A;  2XC2 A;  2YJH A;  3ISO A;  1THX A;  3E3E A;  4FQU A;  1PKW A;  1ST9 A;  1XVW A;  4POK A;  2PVQ A;  4L5O A;  1FVJ A;  2K9F A;  4GSN A;  2J9H A;  4ZL8 A;  2OAC A;  3VLN A;  4O92 A;  1G7E A;  1GNE A;  4K0G A;  1F9M A;  4ML1 A;  1H4O A;  5EPF A;  2H74 A;  3HYP A;  3LSZ A;  3D22 A;  1B4P A;  3HCZ A;  3VPT A;  1E2Y A;  2R0G A;  2YZH A;  3GL3 A;  4I2T A;  1OKD A;  1V98 A;  4G2E A;  19GS A;  2HZE B;  4MPF A;  2IWT A;  3HVS A;  4IJI A;  5AIV A;  1SU9 A;  3CRT A;  2VIM A;  3C73 A;  3IV4 A;  4BIK A;  5HR3 A;  1U3A A;  3IK9 A;  4NHZ A;  1BJX A;  3L9S A;  5GAN D;  2E0Q A;  2HRF A;  4AJ8 A;  3EMP A;  2H66 A;  3CSJ A;  3TJB A;  4KDY A;  3PIN A;  2NTO A;  2P5R A;  2R0P A;  3VI7 A;  2GST A;  2FWF A;  3C8E A;  1F6M C;  4DSR A;  5JCW A;  4TXO B;  1PMT A;  2GZZ A;  4K5S A;  4XS4 A;  2V41 A;  5G31 A;  3TKP A;  1XXU A;  1PGT A;  3FZ9 A;  2TRC P;  4GRF A;  2H6Y A;  4FYU A;  4MZW A;  3DVX A;  4N11 A;  4PNG A;  2VM2 A;  4G10 A;  2CX3 A;  3ZLP A;  1BG5 A;  3APO A;  3UVT A;  5DDL A;  2HZE A;  2IL3 A;  1EEM A;  3MNG A;  1GSU A;  3GNJ A;  2CZ2 A;  2X8G A;  18GS A;  5ECQ B;  3N5O A;  3LXT A;  4OFM A;  1K0C A;  4DVC A;  3A5I A;  2GQK A;  4XHM A;  4MDC A;  2A2R A;  4XRD A;  4EC0 A;  1RK4 A;  1N8J A;  1ZZY A;  2NVL A;  5CRW A;  1O81 A;  3MYD A;  3L4N A;  4EL1 A;  3CXG A;  4FYC A;  1R5A A;  4GLT A;  4V2N A;  4MJC A;  4MJE A;  3KXO A;  4K9Z A;  1A24 A;  4RUV A;  1SJ6 A;  4OD7 A;  2TIR A;  3LYP A;  1XWC A;  2VL2 C;  1RW1 A;  4HDE A;  3GRX A;  5D73 A;  3DD3 A;  2OE1 A;  1G6Y A;  1YY7 A;  2CVB A;  1GSD A;  4GWR A;  5F0G A;  3KCM A;  4BVX B;  1S3D A;  1V58 A;  3IA1 A;  3TDG A;  3PGT A;  1K0A A;  5HR2 A;  5FWG A;  1EGO A;  4TVE A;  4V2M A;  2OJL A;  1NW2 A;  2C3N A;  2CZ3 A;  2AUV A;  1Y25 A;  4MF6 A;  4GSS A;  4MAB A;  3HVN A;  5L71 A;  3QD9 A;  4YAV A;  3GIX A;  2IFQ B;  4WBR D;  1Z3E A;  3TGZ A;  2JZT A;  2ALB A;  4O5U A;  3UEM A;  1T4Z A;  3RPN A;  4YQU A;  4KX4 A;  4AJ6 A;  1YF1 A;  1TU7 A;  3FK8 A;  2VLU A;  5ECM B;  1G7O A;  2YCD A;  5IM9 A;  1H75 A;  4ILF A;  4O5Q A;  3C1R A;  3EYT A;  2I9H A;  3P90 A;  1SL0 B;  4YQV A;  3Q74 A;  1QMV A;  5A4U A;  4HSC X;  4I6X A;  4L0U A;  5J4U A;  3HHV A;  2RLI A;  2H1B A;  1ML6 A;  4TR0 A;  3BD2 A;  1B4Q A;  3GHA A;  3IRA A;  1VGL A;  4BVX A;  4ZIJ A;  1DE2 A;  5HFI A;  2QSI A;  2FWE A;  2ZCT A;  5ELA A;  4KGI A;  3RBT A;  2XBI A;  3RAZ A;  2TRX A;  5ENU A;  2NBS A;  2AV4 A;  4F82 A;  3JCM L;  4WBJ A;  2A4V A;  3ZFL A;  4F0C A;  1SL2 B;  3N9J A;  1JZD A;  5D93 A;  4G0L A;  1EOH A;  5LD0 A;  3TUE A;  5DQS A;  5EVO A;  3F4S A;  3W8S A;  2HNL A;  2REM A;  2IFQ A;  3KTB A;  1QUW A;  5HFK A;  4JED A;  2C80 A;  6GSS A;  3LFL A;  2E7P A;  1BX9 A;  3F63 A;  3L9V A;  4EO3 A;  4IHU A;  2B1K A;  5JWO B;  4MNN A;  1X5C A;  1JFU A;  2B1L A;  2M80 A;  2HSH A;  3EIN A;  2F51 A;  2PBJ A;  2VD0 A;  1UC7 A;  4JR4 A;  5CNW A;  5CRG A;  1ERV A;  3F4R A;  1A8L A;  20GS A;  1XBS A;  2L4C A;  3EU3 A;  2YP6 A;  4ZB6 A;  4TR3 A;  1T3B A;  4MPG A;  4HZ4 A;  3CRU A;  2DJJ A;  2LS5 A;  4KE3 A;  4BA7 A;  5ECL B;  1K3Y A;  4MK3 A;  5EL8 A;  1R7H A;  4WXT A;  1E6B A;  4Z2R A;  3F6F A;  2VLV A;  3IR4 A;  1M7T A;  1WOU A;  2NPB A;  2EC4 A;  4PNF A;  2DBC A;  1ZYP A;  5HQP A;  1HNB A;  3ERW A;  3FRC A;  4TR1 B;  1PN9 A;  4HJM A;  1MDI A;  2X49 A;  5HFG A;  5INY A;  2VL3 A;  3GMF A;  3MSZ A;  4Q5R A;  1B9Y C;  1O85 A;  3HVX A;  2RM5 A;  2H1A A;  1Z7R A;  1R5P A;  2IJY A;  3BCI A;  3GTU B;  2L4Q A;  3VWV A;  1A2L A;  3L78 A;  4Z7X A;  1Y6E A;  1K0D A;  3TOT A;  4WEY A;  2WGR A;  2FUG 2;  2OE0 A;  1T8E B;  1A2J A;  3A2X A;  2IMI A;  1SYX A;  4HU7 A;  3RHB A;  1KBN A;  4NMU A;  1AQX A;  1TTZ A;  1IYH A;  1WE0 A;  1JLW A;  1DE1 A;  2I4A A;  4Q5F A;  2F3M A;  3D4T A;  1KNG A;  3WD6 A;  3CTF A;  4TR1 A;  4ZBB A;  2B7J A;  1XWG A;  1CQG A;  2K8V A;  4OO4 A;  4K7I A;  12GS A;  1PQN A;  5G1K A;  1S3C A;  1K0O A;  1DSB A;  1J9B A;  1F2E A;  3GUR A;  4EF0 A;  1GUK A;  4ECJ A;  2FCH A;  5IO0 A;  16GS A;  2KOK A;  1Z6N A;  3ZRD A;  3GTU A;  4KSO A;  1XWB A;  1TRW A;  4MZB A;  1Z9H A;  4FO5 A;  1TXX A;  2FD3 A;  3KIJ A;  5AGY A;  3QR6 A;  3UAP A;  2PN8 A;  2YZU A;  3DML A;  5KN2 A;  2G2Q A;  3P8W A;  3HJP A;  1O7U A;  3GH6 A;  2YN1 A;  2YWM A;  2AYT A;  2JL4 A;  1FOH A;  2WDU A;  4K6X A;  2AB6 A;  4MZC A;  4GQF A;  3LEF A;  2PVO C;  1A8Y A;  4EDY A;  4LL1 B;  13GS A;  5J9C A;  1TW9 A;  3CSH A;  5EY6 A;  3WGE A;  4XS1 A;  1NSW A;  4YQM A;  1GLQ A;  2MMA A;  2MBT A;  1XOB A;  2P31 A;  1V40 A;  2GSS A;  4X43 A;  4MJA A;  1OYJ A;  4LMV A;  4ZL7 A;  1GUM A;  1GUL A;  3BJ5 A;  1ACV A;  3FZA A;  4IVF A;  2H73 A;  2LKU A;  1K3L A;  1A0R P;  4HJ2 A;  4AGS A;  2I3Y A;  2QA1 A;  4IP6 A;  3U6V A;  5IMA A;  3W8J A;  1LBK A;  1QXH A;  2XPE A;  4D73 B;  1FB6 A;  2LV3 A;  1PL1 A;  1SJI A;  1DUG A;  3IAS 2;  2JZS A;  3HJM A;  3HZ8 A;  17GS A;  1PFO A;  2H1G A;  1GTI A;  1YEP A;  1ILO A;  5AN1 A;  1Z5Y E;  2LJR A;  2VM1 A;  5DAK A;  2DIY A;  3I69 A;  3Q6O A;  3WT1 A;  1TDI A;  2YPM A;  2CV4 A;  1T7P B;  1U6T A;  4P3Y B;  1AIU A;  2VCT A;  3G9B A;  3H8Q A;  1V9W A;  2H70 A;  4NWY A;  3GKK A;  3S9F A;  3SWL A;  1ERT A;  2H01 A;  5IMC A;  1M2D A;  2FWH A;  3TKR A;  2EIR A;  7GSS A;  3ZVJ D;  4V2L A;  3D21 A;  3HJO A;  2FLS A;  3BBY A;  2FWG A;  3O6T A;  3FR9 A;  4IKH A;  4ACS A;  5IMF A;  2X4A A;  5KOW A;  1WRY A;  4FIW A;  5ECO B;  4JU5 A;  2L57 A;  2QA2 A;  4BL7 B;  1EZK A;  3LWA A;  4KDU A;  4XIH A;  2DMM A;  2HRN A;  2C0E A;  3FHK A;  2R0C A;  3UL3 A;  3MAK A;  1GSF A;  3QFB C;  3TKS E;  2GSQ A;  4GST A;  4GCI A;  2PUK C;  1ZYQ B;  1S3R A;  1THO A;  1QQ2 A;  3NOF A;  2V32 A;  1EV4 A;  5CO3 A;  2IMF A;  5IMZ A;  2H8L A;  4EUY A;  1K0N A;  1ZGN A;  4IQ1 A;  4G0I A;  2AJQ B;  2LRC A;  2VCX A;  2LJA A;  5ECR B;  1T4Y A;  3VK9 A;  3VI5 A;  2CT6 A;  2ON5 A;  1EWX A;  2H6Z A;  2V1M A;  3D0Z A;  2DJ1 A;  3Q19 A;  1OAZ A;  4A5P A;  2B5Y A;  3G7I A;  2R6K A;  1LJR A;  3CQF A;  2RUF A;  4RQR A;  5ELG A;  3VPQ A;  1TI3 A;  2CVD A;  1MD3 A;  1V57 A;  2LST A;  2VO4 A;  2VAF A;  3LJR A;  1M9A A;  1XW5 A;  1FVK A;  1M2A A;  5KN1 A;  2HT9 A;  2CQ9 A;  2QKE A;  1R4W A;  1K0M A;  4G9H A;  3QOU A;  4BL7 A;  2DJ0 A;  4BWS A;  5H5S A;  2LNT A;  2PWJ A;  4TXO A;  2H6X A;  3D4M A;  1BYE A;  2GQL A;  9GSS A;  2B7K A;  3IBH A;  3RHC A;  4HS1 A;  1ABA A;  4V1A g;  3VWW A;  3E9J B;  4MH3 A;  1ZL9 A;  1X9W B;  4ZBD A;  3RDW A;  3G7Y A;  3W6G A;  3FYG A;  2X99 A;  2VL2 A;  1FG4 A;  4KA0 A;  5DVB A;  2PPT A;  2VD1 A;  5CYY A;  4EIP A;  1EGR A;  4Z2T A;  5J3R A;  1XCC A;  4QQ7 A;  1SKR B;  3TRX A;  2RM6 A;  1OE8 A;  5J41 A;  4FYB A;  2JZR A;  4HU9 A;  2J23 A;  5AIS A;  5ECP B;  5C00 A;  2L5L A;  2HSM A;  2ON7 A;  4E8E A;  2CVK A;  3DRN A;  2O7K A;  3H79 A;  1GNW A;  4GTU A;  1AQW A;  1DBY A;  1NM3 A;  2VCV A;  2IPA A;  2MMO A;  4XS6 A;  3HVV A;  1ERU A;  1GSQ A;  3CYN A;  5A4W A;  4ECB A;  3FR3 A;  2GT6 A;  1FAA A;  2N5F A;  4NV2 A;  2DLX A;  1Z7P A;  1PA3 A;  2VCW A;  3UAR A;  4NXI A;  3ZML A;  3KJY A;  3VFI A;  2KUC A;  3K8N A;  4YKG A;  5G5F A;  1G6W A;  1X0R A;  3APS A;  2PGT A;  4XTS A;  4L8E A;  2R3X A;  3PH9 A;  4O7H A;  3ERG A;  4HUA A;  1A2M A;  2YAN A;  4TR4 A;  4PGT A;  1XVQ A;  2JAD A;  5IIZ A;  3EC3 A;  5DBQ A;  1WMJ A;  1FB0 A;  1BAY A;  1VF4 A;  4F0B A;  1XFL A;  4NV5 A;  1O8W A;  4HI7 A;  1XIY A;  2CX4 A;  4PUA A;  3OR5 A;  3R3E A;  3HKR A;  1M3I A;  1HNA A;  5CRD A;  3UOM A;  5KEJ A;  5BRT A;  5F06 A;  2OA7 A;  2L59 A;  4ZBA A;  2K8S A;  1WP0 A;  5B7C A;  5ECH B;  2ES7 A;  1OC9 B;  3KTL A;  2GTU A;  1JHB A;  4ZXG A;  4CW9 A;  4GXZ A;  2FY6 A;  3H1N A;  2H1D A;  4MCU A;  2GQM A;  2H30 A;  3WYW A;  4TXV A;  2OKA A;  1WWJ A;  1GLP A;  2VLT A;  4Z2U A;  4PQ1 A;  4H86 A;  3DYR A;  4RQX A;  2MMN A;  4POB A;  2LUS A;  4YAP A;  2HYX A;  2LQO A;  2WRT A;  2BTO T;  1PSQ A;  1ZCP A;  3ZFB A;  4L0W A;  2G0F A;  3CSI A;  2A4H A;  3KMN A;  1JZW A;  2R2J A;  1GL8 A;  4KCE A;  1CQH A;  3DKS A;  4PUF C;  2LRN A;  1KTE A;  2GLR A;  1A0F A;  2C4J A;  2P0G A;  1B8X A;  4EIQ A;  4I8B A;  4EKZ A;  1AAZ A;  2WB9 A;  2H71 A;  1B9X C;  4ID0 A;  2LEG A;  1PL2 A;  1XOA A;  2C8U A;  4WET A;  2HRA A;  3TKS C;  1UA5 A;  3WGD A;  5JCG A;  2DKI A;  1BED A;  2JAC A;  1M0U A;  3EUR A;  2R5G A;  2H75 A;  4ZL9 A;  1TI1 A;  1EP7 A;  4WF4 A;  4CY6 A;  4CDO A;  4KW6 A;  2XPD A;  1VRS D;  5F07 A;  3NIV A;  1PD2 1;  1F3A A;  2DML A;  3L9U A;  4HQS A;  3AY8 A;  5FHI A;  2A2S A;  4N0Z A;  3KGK A;  4YH2 A;  3QCP A;  2A2P A;  4BWQ A;  5IPG A;  2B6M A;  4IW9 A;  5D9T A;  2YV9 A;  4LA1 A;  3IOS A;  3M1G A;  3IDV A;  4K2X A;  4XCS A;  1YZX A;  6GSW A;  4O5R A;  3GYK A;  1Q4J A;  3DEX A;  4LMW A;  1URM A;  4PQI A;  1MDK A;  4POL A;  4BVY B;  1X9S B;  2Z9S A;  1MDJ A;  4MF7 A;  4PQH A;  22GS A;  1PN0 A;  5IQY A;  3SBC A;  4LLR A;  2I1U A;  3IHG A;  3A2V A;  3H4K A;  1ZYN A;  3KD0 A;  4EVM A;  3IPZ A;  2X64 A;  2HE3 A;  4KAE A;  1ZMA A;  6GST A;  1YJ6 A;  3P2A A;  1I5G A;  2C3T A;  2F9S A;  1GTA A;  4KDX A;  2V6K A;  3CBU A;  3UIW A; 
#chains in the Genus database with same CATH homology
 2XHF A;  4JZQ A;  4FH8 A;  1J0F A;  3GH9 A;  1U87 A;  4GQC A;  5COH A;  1PX7 A;  2GSR A;  4EDZ A;  3LYK A;  2WJU A;  4JRR A;  2V2G A;  2OE3 A;  2MBS A;  1SJZ A;  1SK2 A;  3M9K A;  3KMO A;  2FA4 A;  2X8C A;  3F0I A;  5D9W A;  3ZVJ A;  4WF5 A;  4PXO A;  3ZRE A;  3M0F A;  4YKF A;  3Q18 A;  1TRS A;  1TKD B;  1JZR A;  2M46 A;  1VF2 A;  4ML6 A;  3HA9 A;  4IN0 A;  4WKW A;  4TKY A;  3HZ4 A;  1RQM A;  2YV7 A;  1LU4 A;  2IMD A;  2OAD A;  3LOR A;  4XRA A;  4HQZ A;  1GH2 A;  5DJM A;  1PX6 A;  3QPM A;  2O89 A;  2C0D A;  3ZIV A;  4G19 A;  4OCF A;  2BMX A;  4TN8 A;  5FT3 A;  1I9D A;  4HZ2 A;  4NAX A;  2WFC A;  3I6A A;  2H0H A;  5AIX A;  5IPH A;  3EWL A;  6GSV A;  1G0T A;  2DJ2 A;  2DKH A;  1HNC A;  5B8A A;  3WGX A;  1ON4 A;  5G30 A;  5CP1 A;  4XS4 B;  2GGT A;  4QL9 A;  2E2G A;  5A5K A;  1OKT A;  1Q98 A;  4BPY A;  3FZ5 A;  1TK5 B;  3ZTL A;  3ZIJ A;  2NDO A;  1JZO A;  4RI6 A;  1FO5 A;  1AC1 A;  1YQ1 A;  2DJK A;  5F8B A;  1O8X A;  3GL5 A;  5DJL A;  2HFD A;  4JE1 A;  2IN3 A;  3GN3 A;  2IME A;  4N0V A;  5ECS A;  1HD2 A;  1TK0 B;  3F6D A;  4POM A;  3A5W A;  2B5X A;  3IC8 A;  4WR4 A;  1JLV A;  2FA8 A;  8GSS A;  1ERW A;  4DSS B;  4MA9 A;  4F9Z A;  3ED3 A;  2E2M A;  2QC7 A;  4D73 A;  1NHO A;  1SKS B;  4O32 A;  1M2B A;  2MYG A;  5A4V A;  2HLS A;  1FOV A;  4JR6 A;  4DEJ A;  1ZYE A;  3M3M A;  2V6O A;  2VCZ A;  4IJ3 A;  3TRQ A;  5DCH A;  1TU8 A;  3CTG A;  2HRK A;  2WS2 A;  2GZY A;  14GS A;  1SL1 B;  1SK1 A;  3HY2 A;  2K6V A;  5BMU A;  3DWV A;  2JSY A;  1F37 A;  2AAW A;  3GKX A;  3EMX A;  4IS0 A;  4F03 A;  3FW2 A;  4MP4 A;  2H76 A;  3F8U A;  5ECK B;  2LTK A;  2YWO A;  3F9U A;  2HI7 A;  4KND A;  2VUP A;  3R2Q A;  6GSY A;  4N30 A;  2KLX A;  3QAV A;  2KP1 A;  2WUL A;  3BCK A;  4I5Q A;  3G7J A;  4USS A;  1XZO A;  4J56 E;  2LNS A;  4K2D A;  3MDK A;  4IBP A;  2DJ3 A;  2IMK A;  4HEA 2;  4JBB A;  1TK8 B;  4DSS A;  3BOA A;  3EE2 A;  2PU9 C;  1W4V A;  2O8V B;  3C71 A;  3LGC A;  2L6C A;  4OFN A;  1HYU A;  3VWX A;  4IEL A;  4HOJ A;  3APQ A;  3FZ4 A;  2AHE A;  3FKF A;  3QFA C;  4I2U A;  5D8I A;  2CAQ A;  4ZB8 A;  1YDK A;  5JCU A;  1TRU A;  1QK8 A;  5B8B A;  3ZL5 A;  2LJK A;  3D5J A;  3TJJ A;  2LQQ A;  1GWC A;  1VF1 A;  3WT2 A;  5IOW A;  3VWU A;  1XWK A;  3F3Q A;  1PRX A;  2WCI A;  1GP1 A;  2C3Q A;  1BQ7 A;  4X0X A;  1WJK A;  1X5E A;  2MZC A;  3KM6 A;  1AQV A;  5ECI B;  3TKQ A;  4IQA A;  4TOP A;  5ABR A;  1AXD A;  4X1U A;  3V1W A;  3QMX A;  4QL7 A;  1OVN A;  3TRP A;  3TJK A;  2R37 A;  5CRE A;  3ZIT A;  4J2F A;  1QGV A;  1PKZ A;  1T1V A;  2RUE A;  1XW6 A;  4MF5 A;  5D9V A;  3DIE A;  2XBQ A;  2YWN A;  5H5Q A;  3HXS A;  6GSX A;  4KB3 A;  5JWR B;  5LCZ A;  10GS A;  5KN3 A;  1XWA A;  5KOX A;  4MJB A;  3UJ1 A;  5IO2 A;  3PPU A;  2O85 A;  4AF2 A;  1X5D A;  1M99 A;  3DXB A;  2CAI A;  1K0B A;  2C1Y A;  6GSU A;  3EPT A;  4IP1 A;  4RI7 A;  1Z6M A;  2H72 A;  1V2A A;  4PX1 A;  3KP9 A;  4X4J A;  4Q5N A;  11GS A;  3J7Y k;  5C04 A;  4KCA A;  3M8N A;  3A3T A;  1USB A;  1ZOF A;  1S3A A;  1GRX A;  3H93 A;  2KHP A;  3FEU A;  2EIO A;  2VOC A;  3MIX A;  2OBI A;  1K3O A;  2VCQ A;  1GUH A;  3GFK A;  4K1F A;  5B6M A;  2GVP A;  1EV9 A;  1O73 A;  2MMZ A;  2YWI A;  1R26 A;  2M72 A;  4K5R A;  4L5L A;  3HD5 A;  4OMV A;  4TRX A;  1GTU A;  2BJX A;  1MTC A;  5LNK e;  3C1S A;  5J9B A;  1F3B A;  1GTB A;  3LQ7 A;  1IYI A;  4NPB A;  2H0I A;  2YJ7 A;  3FY7 A;  3IAM 2;  3KP8 A;  3TB2 A;  3QAG A;  4WR5 A;  4MH2 A;  5E4W A;  5B6N A;  3HDC A;  4OWY A;  1YKA A;  1SK0 A;  3KH7 A;  2F8F A;  3ZYW A;  2P5Q A;  3J7Y b;  4Q5Q A;  1OC8 A;  4KH7 A;  5D9X A;  1EEJ A;  3L0H A;  4CHS A;  1TRV A;  4TW5 A;  4CY8 A;  4DSQ A;  3MWH A;  5IOX A;  1AW9 A;  3ERF A;  2N5A A;  5HR0 A;  1UN2 A;  3TOU A;  5DQY A;  3P7X A;  2PER A;  1HQO A;  3QAW A;  5H5R A;  3GA4 A;  2HZF A;  2X8H A;  5J5N A;  3KH9 A;  2GT5 A;  4GF0 A;  4OFT A;  3GV1 A;  2WZ9 A;  2H0G A;  2B3S A;  2R4V A;  3FR6 A;  1AUC A;  1KEB A;  2RII A;  1TJD A;  3O3T A;  3IHQ A;  4K8M A;  1WPI A;  3GSS A;  3A2W A;  1U88 A;  1YKC A;  1GSS A;  5JWQ B;  5DAL B;  3IE3 A;  1YEX A;  3ZMK A;  4ECC A;  5F05 A;  4AJ7 A;  5G2Z A;  4ZB9 A;  1XW9 A;  2I81 A;  1OC9 A;  3I43 A;  4N10 A;  4NHW A;  2DIZ A;  3KEB A;  4MLY A;  1GSY A;  3EVI A;  3PR8 A;  2D2Z A;  2EIQ A;  2QGV A;  1T00 A;  2L6D A;  2YOI A;  3FMW A;  4ECI A;  2FNO A;  4G0K A;  3IK7 A;  3UMA A;  2HXK A;  3F4T A;  5ECN B;  4ICY A;  1J08 A;  4EXJ A;  4I97 A;  1EOG A;  1SD8 A;  1SEN A;  4F2I A;  3ZZX A;  3TKS A;  3D6I A;  1QFN A;  5G5E A;  3UVH A;  2DC5 A;  4K7O A;  5ID2 B;  5D96 A;  1N2A A;  1YF0 A;  3F3R A;  2GZP A;  4K7N A;  1SD9 A;  3IXR A;  3QDN A;  3UBL A;  3TCO A;  4KUN A;  2ZNM A;  1GSE A;  1VF3 A;  2VL9 A;  4PUR A;  3E0U A;  5DAL A;  3GST A;  1WIK A;  5DCG A;  4J57 E;  1A23 A;  1M9B A;  2KP2 A;  3IC4 A;  2DSA A;  4ZIL A;  3KZQ A;  5CAX A;  1NHY A;  3CMI A;  3GKM A;  5IMV A;  1O6J A;  4E8H A;  2GS3 A;  3EU4 A;  2LRT A;  1U3I A;  2N5B A;  2FGX A;  3LG6 A;  4OCE A;  3LXZ A;  4ULX A;  4K0N A;  1FW1 A;  2CA8 A;  1TOF A;  3M9J A;  1OE7 A;  3US3 A;  1B48 A;  1SYR A;  2HSY A;  2FHE A;  1MD4 A;  5GSS A;  3GKN A;  3I9V 2;  2JSZ A;  3LW9 A;  3TJF A;  5KN0 A;  3UBK A;  5IMD A;  2OBK A;  5GST A;  2L5O A;  2O87 A;  5GAP D;  5ID2 A;  2H19 A;  3ME8 A;  2YNX A;  3RPP A;  1OC3 A;  2C0F A;  5CRH A;  1C72 A;  4ISD A;  1W89 A;  5DAK B;  1FHE A;  1TP9 A;  2GDR A;  3ME7 A;  2IIY A;  5GZZ B;  4KF9 A;  1SKW B;  1EP8 A;  4OO5 A;  1MEK A;  4LL4 B;  2JU5 A;  4EE0 A;  5G1L A;  2ZUP A;  4BVY A;  3DVW A;  3C7M A;  4IGJ A;  5HR1 A;  1XPV A;  3O76 A;  3VUR A;  3NZN A;  1UVZ A;  2C0G A;  1X9M B;  2K18 A;  4MMM A;  4KSM A;  4PTS A;  3GUS A;  2F8A A;  2UZ8 A;  5E59 A;  3U5R E;  2B5E A;  2PMT A;  3TJG A;  3GX8 A;  4V1A p;  3GX0 A;  3DGQ A;  2XC2 A;  2YJH A;  3ISO A;  1THX A;  3E3E A;  4FQU A;  1PKW A;  1ST9 A;  1XVW A;  4POK A;  2PVQ A;  4L5O A;  1FVJ A;  2K9F A;  4GSN A;  2J9H A;  4ZL8 A;  2OAC A;  3VLN A;  4O92 A;  1G7E A;  1GNE A;  4K0G A;  1F9M A;  4ML1 A;  1H4O A;  5EPF A;  2H74 A;  3HYP A;  3LSZ A;  3D22 A;  1B4P A;  3HCZ A;  3VPT A;  1E2Y A;  2R0G A;  2YZH A;  3GL3 A;  4I2T A;  1OKD A;  1V98 A;  4G2E A;  19GS A;  2HZE B;  4MPF A;  2IWT A;  3HVS A;  4IJI A;  5AIV A;  1SU9 A;  3CRT A;  2VIM A;  3C73 A;  3IV4 A;  5HR3 A;  1U3A A;  3IK9 A;  4NHZ A;  1BJX A;  3L9S A;  5GAN D;  2E0Q A;  2HRF A;  4AJ8 A;  3EMP A;  2H66 A;  3CSJ A;  3TJB A;  4KDY A;  3PIN A;  2NTO A;  2P5R A;  2R0P A;  3VI7 A;  2GST A;  2FWF A;  3C8E A;  1F6M C;  4DSR A;  5JCW A;  4TXO B;  1PMT A;  2GZZ A;  4K5S A;  4XS4 A;  2V41 A;  5G31 A;  3TKP A;  1XXU A;  1PGT A;  3FZ9 A;  2TRC P;  4GRF A;  2H6Y A;  4FYU A;  4MZW A;  3DVX A;  4N11 A;  4PNG A;  2VM2 A;  4G10 A;  2CX3 A;  3ZLP A;  1BG5 A;  3APO A;  3UVT A;  5DDL A;  2HZE A;  2IL3 A;  1EEM A;  3MNG A;  1GSU A;  3GNJ A;  2CZ2 A;  2X8G A;  18GS A;  5ECQ B;  3N5O A;  3LXT A;  4OFM A;  1K0C A;  4DVC A;  3A5I A;  2GQK A;  4XHM A;  4MDC A;  2A2R A;  4XRD A;  4EC0 A;  1RK4 A;  1N8J A;  1ZZY A;  2NVL A;  5CRW A;  1O81 A;  3MYD A;  3L4N A;  4EL1 A;  3CXG A;  4FYC A;  1R5A A;  4GLT A;  4V2N A;  4MJC A;  4MJE A;  3KXO A;  4K9Z A;  1A24 A;  4RUV A;  1SJ6 A;  4OD7 A;  2TIR A;  3LYP A;  1XWC A;  2VL2 C;  1RW1 A;  4HDE A;  3GRX A;  5D73 A;  3DD3 A;  2OE1 A;  1G6Y A;  1YY7 A;  2CVB A;  1GSD A;  4GWR A;  5F0G A;  3KCM A;  4BVX B;  1S3D A;  1V58 A;  3IA1 A;  3TDG A;  3PGT A;  1K0A A;  5HR2 A;  5FWG A;  1EGO A;  4TVE A;  4V2M A;  2OJL A;  1NW2 A;  2C3N A;  2CZ3 A;  2AUV A;  1Y25 A;  4MF6 A;  4GSS A;  4MAB A;  5L71 A;  3QD9 A;  4YAV A;  3GIX A;  2IFQ B;  4WBR D;  1Z3E A;  3TGZ A;  2JZT A;  2ALB A;  4O5U A;  3UEM A;  1T4Z A;  3RPN A;  4YQU A;  4KX4 A;  4AJ6 A;  1YF1 A;  1TU7 A;  3FK8 A;  2VLU A;  5ECM B;  1G7O A;  2YCD A;  5IM9 A;  1H75 A;  4ILF A;  4O5Q A;  3C1R A;  3EYT A;  2I9H A;  3P90 A;  1SL0 B;  4YQV A;  3Q74 A;  1QMV A;  5A4U A;  4I6X A;  4L0U A;  5J4U A;  3HHV A;  2RLI A;  2H1B A;  1ML6 A;  4TR0 A;  3BD2 A;  1B4Q A;  3GHA A;  3IRA A;  1VGL A;  4BVX A;  4ZIJ A;  1DE2 A;  5HFI A;  2QSI A;  2FWE A;  2ZCT A;  5ELA A;  4KGI A;  3RBT A;  2XBI A;  3RAZ A;  2TRX A;  5ENU A;  2NBS A;  2AV4 A;  4F82 A;  3JCM L;  4WBJ A;  2A4V A;  3ZFL A;  4F0C A;  1SL2 B;  3N9J A;  1JZD A;  5D93 A;  4G0L A;  1EOH A;  5LD0 A;  3TUE A;  5DQS A;  5EVO A;  3F4S A;  3W8S A;  2HNL A;  2REM A;  2IFQ A;  3KTB A;  1QUW A;  5HFK A;  4JED A;  2C80 A;  6GSS A;  3LFL A;  2E7P A;  1BX9 A;  3F63 A;  3L9V A;  4EO3 A;  4IHU A;  2B1K A;  5JWO B;  4MNN A;  1X5C A;  1JFU A;  2B1L A;  2M80 A;  2HSH A;  3EIN A;  2F51 A;  2PBJ A;  2VD0 A;  1UC7 A;  4JR4 A;  5CNW A;  5CRG A;  1ERV A;  3F4R A;  1A8L A;  20GS A;  1XBS A;  2L4C A;  3EU3 A;  2YP6 A;  4ZB6 A;  4TR3 A;  1T3B A;  4MPG A;  4HZ4 A;  3CRU A;  2DJJ A;  2LS5 A;  4KE3 A;  4BA7 A;  5ECL B;  1K3Y A;  4MK3 A;  5EL8 A;  1R7H A;  4WXT A;  1E6B A;  4Z2R A;  3F6F A;  2VLV A;  3IR4 A;  1M7T A;  1WOU A;  2NPB A;  2EC4 A;  4PNF A;  2DBC A;  1ZYP A;  5HQP A;  1HNB A;  3ERW A;  3FRC A;  4TR1 B;  1PN9 A;  4HJM A;  1MDI A;  2X49 A;  5HFG A;  5INY A;  2VL3 A;  3GMF A;  3MSZ A;  4Q5R A;  1B9Y C;  1O85 A;  3HVX A;  2RM5 A;  2H1A A;  1Z7R A;  1R5P A;  2IJY A;  3BCI A;  3GTU B;  2L4Q A;  3VWV A;  1A2L A;  3L78 A;  4Z7X A;  1Y6E A;  1K0D A;  3TOT A;  4WEY A;  2WGR A;  2FUG 2;  2OE0 A;  1T8E B;  1A2J A;  3A2X A;  2IMI A;  1SYX A;  4HU7 A;  3RHB A;  1KBN A;  4NMU A;  1AQX A;  1TTZ A;  1IYH A;  1WE0 A;  1JLW A;  1DE1 A;  2I4A A;  4Q5F A;  2F3M A;  3D4T A;  1KNG A;  3WD6 A;  3CTF A;  4TR1 A;  4ZBB A;  2B7J A;  1XWG A;  1CQG A;  2K8V A;  4OO4 A;  4K7I A;  12GS A;  1PQN A;  5G1K A;  1S3C A;  1K0O A;  1DSB A;  1J9B A;  1F2E A;  3GUR A;  4EF0 A;  1GUK A;  4ECJ A;  2FCH A;  5IO0 A;  16GS A;  2KOK A;  1Z6N A;  3ZRD A;  3GTU A;  4KSO A;  1XWB A;  1TRW A;  4MZB A;  1Z9H A;  4FO5 A;  1TXX A;  2FD3 A;  3KIJ A;  5AGY A;  3QR6 A;  3UAP A;  2PN8 A;  2YZU A;  3DML A;  5KN2 A;  2G2Q A;  3P8W A;  3HJP A;  1O7U A;  3GH6 A;  2YN1 A;  2YWM A;  2AYT A;  2JL4 A;  1FOH A;  2WDU A;  4K6X A;  2AB6 A;  4MZC A;  4GQF A;  3LEF A;  2PVO C;  1A8Y A;  4EDY A;  4LL1 B;  13GS A;  5J9C A;  1TW9 A;  3CSH A;  5EY6 A;  3WGE A;  4XS1 A;  1NSW A;  4YQM A;  1GLQ A;  2MMA A;  2MBT A;  1XOB A;  2P31 A;  1V40 A;  2GSS A;  4X43 A;  4MJA A;  1OYJ A;  4LMV A;  4ZL7 A;  1GUM A;  1GUL A;  3BJ5 A;  1ACV A;  3FZA A;  4IVF A;  2H73 A;  2LKU A;  1K3L A;  1A0R P;  4HJ2 A;  4AGS A;  2I3Y A;  2QA1 A;  4IP6 A;  3U6V A;  5IMA A;  3W8J A;  1LBK A;  1QXH A;  2XPE A;  4D73 B;  1FB6 A;  2LV3 A;  1PL1 A;  1SJI A;  1DUG A;  3IAS 2;  2JZS A;  3HJM A;  3HZ8 A;  17GS A;  2H1G A;  1GTI A;  1YEP A;  1ILO A;  5AN1 A;  1Z5Y E;  2LJR A;  2VM1 A;  5DAK A;  2DIY A;  3I69 A;  3Q6O A;  3WT1 A;  1TDI A;  2YPM A;  2CV4 A;  1T7P B;  1U6T A;  4P3Y B;  1AIU A;  2VCT A;  3G9B A;  3H8Q A;  1V9W A;  2H70 A;  4NWY A;  3GKK A;  3S9F A;  3SWL A;  1ERT A;  2H01 A;  5IMC A;  1M2D A;  2FWH A;  3TKR A;  2EIR A;  7GSS A;  3ZVJ D;  4V2L A;  3D21 A;  3HJO A;  2FLS A;  3BBY A;  2FWG A;  3O6T A;  3FR9 A;  4IKH A;  4ACS A;  5IMF A;  2X4A A;  5KOW A;  1WRY A;  4FIW A;  5ECO B;  4JU5 A;  2L57 A;  2QA2 A;  4BL7 B;  1EZK A;  3LWA A;  4KDU A;  4XIH A;  2DMM A;  2HRN A;  2C0E A;  3FHK A;  2R0C A;  3UL3 A;  3MAK A;  1GSF A;  3QFB C;  3TKS E;  2GSQ A;  4GST A;  4GCI A;  2PUK C;  1ZYQ B;  1THO A;  1QQ2 A;  3NOF A;  2V32 A;  1EV4 A;  5CO3 A;  2IMF A;  5IMZ A;  2H8L A;  4EUY A;  1K0N A;  1ZGN A;  4IQ1 A;  4G0I A;  2AJQ B;  2LRC A;  2VCX A;  2LJA A;  5ECR B;  1T4Y A;  3VK9 A;  3VI5 A;  2CT6 A;  2ON5 A;  1EWX A;  2H6Z A;  2V1M A;  3D0Z A;  2DJ1 A;  3Q19 A;  1OAZ A;  4A5P A;  2B5Y A;  3G7I A;  2R6K A;  1LJR A;  2RUF A;  4RQR A;  5ELG A;  3VPQ A;  1TI3 A;  2CVD A;  1MD3 A;  1V57 A;  2LST A;  2VO4 A;  2VAF A;  3LJR A;  1M9A A;  1XW5 A;  1FVK A;  1M2A A;  5KN1 A;  2HT9 A;  2CQ9 A;  2QKE A;  1R4W A;  1K0M A;  4G9H A;  3QOU A;  4BL7 A;  2DJ0 A;  4BWS A;  5H5S A;  2LNT A;  2PWJ A;  4TXO A;  2H6X A;  3D4M A;  1BYE A;  2GQL A;  9GSS A;  2B7K A;  3IBH A;  3RHC A;  4HS1 A;  1ABA A;  4V1A g;  3VWW A;  3E9J B;  4MH3 A;  1ZL9 A;  1X9W B;  4ZBD A;  3RDW A;  3G7Y A;  3W6G A;  3FYG A;  2X99 A;  2VL2 A;  1FG4 A;  4KA0 A;  5DVB A;  2PPT A;  2VD1 A;  5CYY A;  4EIP A;  1EGR A;  4Z2T A;  5J3R A;  1XCC A;  4QQ7 A;  1SKR B;  3TRX A;  2RM6 A;  1OE8 A;  5J41 A;  4FYB A;  2JZR A;  4HU9 A;  2J23 A;  5AIS A;  5ECP B;  5C00 A;  2L5L A;  2HSM A;  2ON7 A;  4E8E A;  2CVK A;  3DRN A;  2O7K A;  3H79 A;  1GNW A;  4GTU A;  1AQW A;  1DBY A;  1NM3 A;  2VCV A;  2IPA A;  2MMO A;  4XS6 A;  3HVV A;  1ERU A;  1GSQ A;  3CYN A;  5A4W A;  4ECB A;  3FR3 A;  2GT6 A;  1FAA A;  2N5F A;  4NV2 A;  2DLX A;  1Z7P A;  1PA3 A;  2VCW A;  3UAR A;  4NXI A;  3ZML A;  3KJY A;  3VFI A;  2KUC A;  3K8N A;  4YKG A;  5G5F A;  1G6W A;  1X0R A;  3APS A;  2PGT A;  4XTS A;  4L8E A;  2R3X A;  3PH9 A;  4O7H A;  3ERG A;  4HUA A;  1A2M A;  2YAN A;  4TR4 A;  4PGT A;  1XVQ A;  2JAD A;  5IIZ A;  3EC3 A;  5DBQ A;  1WMJ A;  1FB0 A;  1BAY A;  1VF4 A;  4F0B A;  1XFL A;  4NV5 A;  1O8W A;  4HI7 A;  1XIY A;  2CX4 A;  4PUA A;  3OR5 A;  3R3E A;  3HKR A;  1HNA A;  5CRD A;  3UOM A;  5KEJ A;  5BRT A;  5F06 A;  2OA7 A;  2L59 A;  4ZBA A;  2K8S A;  1WP0 A;  5B7C A;  5ECH B;  2ES7 A;  1OC9 B;  3KTL A;  2GTU A;  1JHB A;  4ZXG A;  4CW9 A;  4GXZ A;  2FY6 A;  3H1N A;  2H1D A;  4MCU A;  2GQM A;  2H30 A;  3WYW A;  4TXV A;  2OKA A;  1WWJ A;  1GLP A;  2VLT A;  4Z2U A;  4PQ1 A;  4H86 A;  3DYR A;  4RQX A;  2MMN A;  4POB A;  2LUS A;  4YAP A;  2HYX A;  2LQO A;  2WRT A;  2BTO T;  1PSQ A;  1ZCP A;  3ZFB A;  4L0W A;  2G0F A;  3CSI A;  2A4H A;  3KMN A;  1JZW A;  2R2J A;  1GL8 A;  4KCE A;  1CQH A;  3DKS A;  4PUF C;  2LRN A;  1KTE A;  2GLR A;  1A0F A;  2C4J A;  2P0G A;  1B8X A;  4EIQ A;  4I8B A;  4EKZ A;  1AAZ A;  2WB9 A;  2H71 A;  1B9X C;  4ID0 A;  2LEG A;  1PL2 A;  1XOA A;  2C8U A;  4WET A;  2HRA A;  3TKS C;  1UA5 A;  3WGD A;  5JCG A;  2DKI A;  1BED A;  2JAC A;  1M0U A;  3EUR A;  2R5G A;  2H75 A;  4ZL9 A;  1TI1 A;  1EP7 A;  4WF4 A;  4CY6 A;  4CDO A;  4KW6 A;  2XPD A;  1VRS D;  5F07 A;  3NIV A;  1PD2 1;  1F3A A;  2DML A;  3L9U A;  4HQS A;  3AY8 A;  5FHI A;  2A2S A;  4N0Z A;  3KGK A;  4YH2 A;  3QCP A;  2A2P A;  4BWQ A;  5IPG A;  2B6M A;  4IW9 A;  5D9T A;  2YV9 A;  4LA1 A;  3IOS A;  3M1G A;  3IDV A;  4K2X A;  4XCS A;  1YZX A;  6GSW A;  4O5R A;  3GYK A;  1Q4J A;  3DEX A;  4LMW A;  1URM A;  4PQI A;  1MDK A;  4POL A;  4BVY B;  1X9S B;  2Z9S A;  1MDJ A;  4MF7 A;  4PQH A;  22GS A;  1PN0 A;  5IQY A;  3SBC A;  4LLR A;  2I1U A;  3IHG A;  3A2V A;  3H4K A;  1ZYN A;  3KD0 A;  4EVM A;  3IPZ A;  2X64 A;  2HE3 A;  4KAE A;  1ZMA A;  6GST A;  1YJ6 A;  3P2A A;  1I5G A;  2C3T A;  2F9S A;  1GTA A;  4KDX A;  2V6K A;  3CBU A;  3UIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...