1O73A

Tryparedoxin from trypanosoma brucei
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
144
structure length
144
Chain Sequence
MSGLAKYLPGATNLLSKSGEVSLGSLVGKTVFLYFSASWCPPCRGFTPVLAEFYEKHHVAKNFEVVLISWDENESDFHDYYGKMPWLALPFDQRSTVSELGKTFGVESIPTLITINADTGAIIGTQARTRVIEDPDGANFPWPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords TRYPAREDOXIN
publication title Tryparedoxins from Crithidia Fasciculata and Trypanosoma Brucei: Photoreduction of the Redox Disulfide Using Synchrotron Radiation and Evidence for a Conformational Switch Implicated in Function
pubmed doi rcsb
source organism Trypanosoma brucei brucei
total genus 45
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2002-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13905 Thioredoxin_8 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1o73A00
20GSA 1ILOA 3IV4A 2LRNA 4LMVA 2CZ3A 1YDKA 2FCHA 4EUYA 1DE2A 4DSSA 2WZ9A 4FYCA 1QMVA 2CQ9A 2HI7A 5JWRB 4ZIJA 2PPTA 2K8SA 5EVOA 3ZVJD 2CT6A 2M72A 4K2DA 3GIXA 4Q5NA 2F51A 4POKA 3M3MA 3MNGA 2R5GA 1RW1A 1T4YA 4NAXA 3A5WA 4MLYA 3Q18A 3GN3A 4KW6A 4KSOA 3ZLPA 1H4OA 1T1VA 1UA5A 3NZNA 3IXRA 1PD21 2PVOC 4Q5FA 4WETA 5E59A 3TKQA 1XZOA 5HR0A 1M9BA 3I43A 3IC4A 3GTUB 2HZEB 3EWLA 2YV7A 4K7IA 1GSSA 1VF1A 3VWWA 1TI1A 3F63A 2B5XA 4IHUA 5DCHA 2TRCP 3H79A 1MD4A 1EOGA 1GNWA 3IRAA 2IJYA 2XC2A 4DSQA 3LEFA 3DGQA 2K8VA 1NW2A 4KDXA 3UARA 4Q5QA 3TGZA 1B9XC 2YN1A 2AJQB 4HQZA 5G31A 4FIWA 3W6GA 1J0FA 3WYWA 4NWYA 4EDZA 1SKWB 3O3TA 1K0BA 2E0QA 3DWVA 2D2ZA 1AQVA 1TRWA 5FHIA 2JSZA 3P90A 3CSHA 2MMOA 2E7PA 3KM6A 2LJRA 1UC7A 3QCPA 3ZIVA 5A5KA 4WF4A 2L6DA 2YCDA 3O6TA 5HFGA 3H4KA 1GTUA 4QL7A 3EE2A 4GXZA 5B6NA 1KEBA 1FW1A 2PN8A 4ECCA 4GRFA 2H74A 4D73A 3TKRA 5DDLA 2LS5A 4TR4A 1SK1A 2CVDA 3A3TA 1S3CA 3A2WA 2DIZA 3CSJA 1JLWA 4MF6A 4POBA 3GRXA 2HXKA 5IMZA 2JACA 3APOA 2FLSA 2GSSA 1U6TA 5DJMA 2CZ2A 5AGYA 1SJZA 3LJRA 3DVWA 5EY6A 6GSTA 1G6WA 4IQAA 3D4TA 5F06A 2IWTA 4V1Ag 4HZ2A 3ZREA 2H0GA 3BCIA 1GULA 2IPAA 3F4TA 3F4RA 5ECOB 2H6XA 3L9UA 3WGXA 2GQLA 1SENA 2F8AA 3GKNA 3ZFLA 1VF2A 1AUCA 2OBKA 1MD3A 2HFDA 3IAS2 2I81A 1V98A 3KP9A 4KA0A 2HSHA 1GSFA 4H86A 3BD2A 1GWCA 2H73A 2FHEA 1Y6EA 4IJ3A 2B6MA 3GFKA 2FA8A 2MBSA 2AUVA 1ML6A 3DRNA 3W8SA 1JZWA 5GZZB 1VF4A 4HJMA 1BAYA 4G10A 4TXOA 3EU4A 5CYYA 2LUSA 4IQ1A 2VCVA 4HQSA 4AF2A 3HVVA 3U5RE 1LJRA 2VAFA 3C7MA 4MZWA 4QL9A 2VD0A 4FYUA 1FG4A 1O8WA 2RUFA 4XRDA 5IMCA 3VI7A 2VL2C 2WS2A 4ZILA 3US3A 4NHWA 5ENUA 4YQUA 4AGSA 2N5BA 3KMOA 4IKHA 3KH7A 2H75A 2J23A 2V41A 4TRXA 4EDYA 1T00A 1PQNA 1V58A 2JU5A 5H5RA 1DSBA 4ML1A 2B5EA 3VK9A 1Z6MA 4I6XA 4V1Ap 1GLPA 1YKAA 2E2MA 4JRRA 1HNAA 3TRQA 1X5DA 1ABAA 2GZPA 1WPIA 1TP9A 3FZ4A 2GSTA 2XBIA 2LQOA 2XHFA 2TRXA 2KLXA 3QR6A 1Z7PA 4N10A 5ABRA 2NBSA 18GSA 2FUG2 4DEJA 3RDWA 1G7OA 3TKSE 1LU4A 3VWXA 5ELAA 3M8NA 7GSSA 2YJ7A 2R2JA 4QQ7A 2X8CA 3KGKA 2NVLA 4RI7A 2RLIA 4GQCA 3CRUA 5DAKB 4TN8A 3E3EA 5B8AA 1B8XA 1K0OA 1YZXA 1BX9A 5ECPB 3RAZA 2LTKA 1JLVA 3VFIA 2NPBA 4HS1A 4YAPA 2XPEA 5D93A 1THOA 2JSYA 4OWYA 4AJ6A 1Z3EA 5IM9A 4WBRD 4IELA 3CTFA 4GTUA 5JWQB 4IP6A 3D6IA 3FR6A 2JADA 3MDKA 4TR3A 5KN1A 2VM1A 1V2AA 5A4UA 2O8VB 4TR1B 1G0TA 4GSNA 1BQ7A 3JCML 5AIVA 5J3RA 2RM5A 2OE3A 4HOJA 3UAPA 1PGTA 1XWGA 2H0HA 2PVQA 2B7JA 3LWAA 3QAVA 1TW9A 2RUEA 3F0IA 1XXUA 4POMA 4XRAA 3HDCA 2EC4A 4G2EA 5DBQA 2C0GA 4IW9A 2V1MA 3KP8A 5J9BA 2I3YA 5J41A 1JFUA 4OO5A 3ZMKA 2YV9A 4TW5A 3L78A 1A2LA 2HT9A 2QC7A 3I69A 2IMIA 1T7PB 1YF1A 5C00A 3FY7A 2LJAA 3DMLA 4EL1A 1YEXA 1IYHA 3QAGA 4F0BA 2CV4A 1ERWA 1TU7A 1XWBA 4HDEA 1TK0B 4FYBA 3RPNA 1SL1B 6GSUA 2C0DA 4KGIA 5JCUA 2QSIA 2AV4A 4G9HA 3Q74A 1XFLA 3ZITA 11GSA 3ZTLA 1EWXA 2ALBA 2L5OA 2A2SA 2ZUPA 4WXTA 2VCTA 2Z9SA 2L57A 3IDVA 6GSXA 2I1UA 5EPFA 3GURA 3TKPA 2DJKA 3CXGA 2WRTA 3GSTA 4F9ZA 2I4AA 1VGLA 1AIUA 1GTIA 3AY8A 1X9SB 3D21A 3M9JA 5ECKB 4K0NA 4ZXGA 2HRNA 2IFQA 4J2FA 3UOMA 2H1BA 1LBKA 2B3SA 3FR9A 2VD1A 1ERTA 13GSA 2KP2A 2YANA 2I9HA 3F4SA 2LQQA 4N11A 3OR5A 2C3NA 1MDIA 1EEMA 3E0UA 1EEJA 4WBJA 1F9MA 3VPTA 4X43A 3CSIA 2HNLA 5ID2A 5C04A 3DD3A 1K0AA 2C3TA 1FAAA 1K0MA 1RK4A 4GF0A 2H0IA 5AN1A 1R4WA 5IO2A 2VLUA 3UBKA 4ECJA 3ERFA 1DBYA 3IBHA 3EVIA 3TJGA 4K6XA 1OE7A 2HRFA 14GSA 1F6MC 4I2UA 1S3DA 4EVMA 3IPZA 1NHYA 3HHVA 2EIQA 2HYXA 3D0ZA 4PQHA 1TK8B 4I97A 5HFKA 2KHPA 3CMIA 4V2NA 1BEDA 3FKFA 3GA4A 1OE8A 1OKTA 2YZHA 5GAND 4ECIA 5ECLB 4KB3A 3ZYWA 2P0GA 4MA9A 5CRDA 5DALB 1EP7A 3GHAA 1QGVA 4MF5A 2FWGA 1PRXA 3HZ4A 4WEYA 1A0FA 1SU9A 2X64A 3GV1A 4POLA 5L71A 5HFIA 4OCEA 3L0HA 1GSDA 1K0CA 1WRYA 4NMUA 1B4QA 2OJLA 3F9UA 1HNBA 2CAIA 3GTUA 3GX8A 4GSSA 5G5FA 2B1LA 1GP1A 2O85A 5CAXA 4PUFC 1A0RP 3L9VA 1SD9A 4ECBA 5G1LA 4DSRA 1WP0A 1WOUA 3TB2A 4OCFA 2A2RA 3KEBA 4BA7A 1PA3A 1QFNA 2JZSA 4BL7A 2WGRA 5F0GA 3TRPA 1JZDA 1SJIA 3G9BA 4MK3A 1AAZA 5CRWA 3EMPA 1B9YC 2OKAA 4PUAA 1NHOA 3ME8A 1PMTA 4PGTA 4OFMA 5H5SA 1TXXA 2CVKA 5ELGA 4IGJA 3F6FA 2B1KA 1B4PA 3ZIJA 1I5GA 2ES7A 1SK2A 2X99A 4HU9A 4LMWA 2LV3A 2VCZA 2GLRA 3L4NA 2FY6A 5D8IA 2WB9A 2VUPA 4K1FA 3CYNA 4HUAA 3HD5A 4MH2A 5F8BA 1ERUA 2H76A 4D73B 3ME7A 4O7HA 2R6KA 1E2YA 3HKRA 3LORA 5DJLA 1GTAA 4L5LA 1UVZA 1XW6A 4ZBDA 5F07A 4EKZA 1OC9A 2H19A 3GX0A 3LFLA 3FHKA 2GT5A 2GGTA 1XOBA 4BVYA 1GUMA 5HQPA 5IQYA 3HXSA 4RQRA 1MDKA 4JEDA 1XBSA 3IOSA 4I8BA 3UVTA 2L4QA 4YH2A 4WR5A 2HLSA 4E8HA 2M80A 2MYGA 4X0XA 1PL2A 1CQHA 1U3AA 2V32A 2YNXA 5CNWA 2NDOA 1Z5YE 1M0UA 2K6VA 6GSSA 2LRTA 2OE0A 2XPDA 3Q19A 1GLQA 2PMTA 1DE1A 1TRUA 1S3AA 4BWSA 3HY2A 4MF7A 2EIOA 1FVJA 3DIEA 2DLXA 2FNOA 2B7KA 4KH7A 3FW2A 2O7KA 5H5QA 3DEXA 4F2IA 4K7NA 4ZBBA 2H1DA 4EO3A 4J56E 1HD2A 4I2TA 3VWVA 2DJ2A 4TXOB 4K0GA 2OA7A 3TOUA 4CW9A 1GSYA 1T8EB 2MMZA 3TRXA 19GSA 1PX7A 1O6JA 1TRSA 2YJHA 1YQ1A 3IE3A 2IIYA 2HZFA 2NTOA 5ECRB 2YZUA 1GSQA 2DMLA 1SL0B 2C80A 1HYUA 4PX1A 3F3RA 1BYEA 2GDRA 4GQFA 2DMMA 1W89A 2BTOT 1Z9HA 4CDOA 2H30A 1THXA 2EIRA 1M7TA 2IN3A 5GSTA 3Q6OA 5GSSA 3BCKA 1KBNA 1OAZA 1Z7RA 5LNKe 1M2BA 3GL3A 1ZZYA 1F37A 5ECHB 3WT2A 5KN0A 3M0FA 4KNDA 1JHBA 3GYKA 5ECSA 1NM3A 5G1KA 3K8NA 1EGOA 2O89A 1SD8A 4GSTA 4EF0A 4LL4B 4ISDA 3D4MA 1ZOFA 1SYRA 4IS0A 4ZB6A 4ILFA 2VCXA 4BPYA 3RHBA 4KAEA 5IMDA 5HR2A 2PERA 3EMXA 4MPFA 5AISA 5IIZA 2PWJA 3HJPA 4FH8A 3HZ8A 2ZCTA 3IR4A 1ACVA 4DVCA 5IMAA 2V2GA 3WGDA 1GUHA 5B6MA 4EE0A 1G6YA 1M99A 5IOXA 3HVXA 2FWHA 1TDIA 1F2EA 1FHEA 2B5YA 3FEUA 3TKSC 1SJ6A 1ST9A 4XIHA 2C0EA 3QD9A 1O7UA 6GSWA 5A4WA 3J7Yk 5LCZA 4XS4A 3G7YA 5D96A 4MZBA 4XS6A 3WGEA 1R5PA 3ED3A 4NV5A 1OKDA 1J9BA 4N0ZA 1R7HA 2IMEA 1X5EA 2AYTA 1FO5A 2GS3A 4WF5A 3D5JA 3P7XA 4TKYA 1Q4JA 3D22A 3CTGA 2H8LA 3C1SA 2OACA 5IO0A 4LLRA 2P31A 3APSA 2PBJA 3HYPA 5AIXA 2ZNMA 1OYJA 3U6VA 4KCAA 4AJ7A 4WR4A 1GNEA 2VL9A 4JR4A 2C8UA 1ZL9A 1O8XA 1X9WB 6GSYA 1V57A 4O5RA 1XWCA 1TTZA 3PGTA 5IPHA 3KIJA 4V2MA 3BBYA 1K0DA 4KDUA 2P5RA 4BVXA 1AQXA 1X0RA 2X8HA 1CQGA 3MSZA 3M1GA 1F3BA 3ZRDA 4ZL7A 2R37A 2N5AA 4RUVA 1EV9A 1OC8A 3KMNA 1WE0A 1ON4A 4XCSA 4L0UA 1BJXA 3EINA 3UBLA 1ZYEA 2DSAA 3TDGA 4YAVA 1PL1A 4JR6A 3LG6A 1FB0A 3QDNA 4KCEA 1YEPA 2XBQA 3M9KA 5B8BA 2L6CA 2DC5A 2LNSA 4TOPA 1YKCA 1USBA 2MBTA 2KP1A 1WJKA 1SKRB 3J7Yb 1XIYA 3C71A 1PKWA 1E6BA 1GSUA 2F9SA 4KSMA 1M2DA 5COHA 3G7IA 2VCQA 5FT3A 4MJBA 4YQMA 4ML6A 4NHZA 1EV4A 1O85A 5LD0A 5F05A 2WCIA 5EL8A 5DCGA 3KCMA 4PXOA 2OE1A 5JCGA 2IFQB 2IMKA 2LKUA 2VL2A 2H70A 12GSA 5G5EA 3V1WA 4JU5A 2VL3A 1X9MB 1QXHA 5E4WA 4EC0A 5HR1A 2K9FA 3ZFBA 2H1GA 4XHMA 1TRVA 4YQVA 1KNGA 3UL3A 1B48A 3ZMLA 1ERVA 5ID2B 1Q98A 4HEA2 2C1YA 3NIVA 2JZRA 2YWNA 2FWFA 2K18A 1K3LA 2YP6A 1AXDA 2ON5A 4P3YB 4DSSB 3TUEA 2FA4A 1BG5A 3KZQA 3QFAC 3IK7A 1YF0A 1N2AA 4IJIA 1A24A 2A4VA 1PKZA 2H71A 1QK8A 2PU9C 1AC1A 4ACSA 2G2QA 2JZTA 1SK0A 2LNTA 1XOAA 3ERGA 3RHCA 3FK8A 3ZZXA 1TU8A 1K3OA 3KJYA 1M9AA 4MABA 1HNCA 1EOHA 3TKSA 5DQYA 3G7JA 9GSSA 5ECMB 1OVNA 5DALA 1GUKA 1GH2A 1A23A 5J4UA 2V6KA 1O81A 1GRXA 2KOKA 2VLTA 1H75A 1XW5A 2VCWA 3KTBA 3IAM2 2H66A 3FZ5A 2HZEA 4ZL8A 3GKKA 1JZOA 1TI3A 1XCCA 4IBPA 4KX4A 1MTCA 2LJKA 5JWOB 3APQA 5IPGA 4PNGA 2IL3A 2HSYA 17GSA 2L4CA 3GUSA 2VO4A 2AHEA 2FWEA 2GT6A 1FB6A 2VIMA 4XS1A 4V2LA 8GSSA 3DKSA 2JL4A 2RIIA 3ERWA 2OBIA 3H8QA 1V9WA 2L59A 3LGCA 1ZCPA 2REMA 4Q5RA 2V6OA 1VRSD 1Z6NA 1XPVA 1XVWA 3I9V2 1PSQA 4MH3A 3C1RA 3GKXA 2H1AA 2DJJA 2WFCA 1SL2B 1VF3A 3MAKA 4KUNA 2F3MA 1DUGA 5B7CA 1N8JA 5J9CA 1XVQA 3TJFA 3A2VA 4NXIA 2AB6A 1T3BA 4NV2A 4ZB8A 1NSWA 4HU7A 3LSZA 4Z7XA 1T4ZA 3P2AA 4GLTA 1U87A 2HE3A 5ECQB 4FO5A 3GKMA 1QQ2A 3KD0A 3KXOA 2H72A 3NOFA 2PUKC 1EZKA 1AW9A 4MPGA 4J57E 3SBCA 4RI6A 1K0NA 1G7EA 3QAWA 22GSA 3LYKA 1U3IA 4ZL9A 1XWKA 3DVXA 1XW9A 2J9HA 3GH6A 1OC9B 3UVHA 2CA8A 3WT1A 5INYA 5CO3A 1SYXA 3SWLA 1IYIA 2E2GA 2RM6A 2DJ1A 4LL1B 3VURA 2CX4A 5D9XA 2GZZA 3CRTA 1A8YA 2FGXA 1V40A 3I6AA 5G2ZA 2CVBA 1AQWA 16GSA 3FZAA 1GSEA 3P8WA 4O32A 1C72A 3VWUA 5IMFA 1X5CA 3PR8A 3GL5A 4TXVA 2IMFA 1MDJA 4MJAA 2GZYA 2YOIA 3GMFA 4KE3A 2QGVA 3O76A 2R4VA 4NPBA 6GSVA 1OC3A 5J5NA 3F3QA 3UMAA 1R26A 2WJUA 4KDYA 4E8EA 3R2QA 2YWOA 4ULXA 4X1UA 3VPQA 3PH9A 2GQMA 3UIWA 4JBBA 1URMA 5KN3A 3N9JA 3HJMA 2AAWA 4N0VA 3FRCA 4F0CA 1EGRA 3LXTA 1PN9A 1YY7A 4HZ4A 4O92A 3LQ7A 4HJ2A 3ISOA 3EYTA 4GCIA 4IVFA 5G30A 2MMNA 4MJEA 3N5OA 4K9ZA 4OO4A 2GSRA 2YPMA 1A2JA 4MCUA 1K3YA 2L5LA 3GH9A 2MZCA 5KEJA 2BJXA 3FYGA 3C73A 2DBCA 2CAQA 1EP8A 1FVKA 2VM2A 3QFBC 5GAPD 1KTEA 2GVPA 3LYPA 2GSQA 4MMMA 3GNJA 3QPMA 2F8FA 2OADA 4AJ8A 2DIYA 5ECIB 1XWAA 4TR0A 4OFTA 3ZVJA 2X8GA 4K8MA 4TVEA 3RBTA 2BMXA 4CHSA 2WULA 3IHQA 2ON7A 1ZMAA 3GSSA 5D9WA 3TJBA 4IN0A 4ID0A 5CREA 2IMDA 3EC3A 2YWIA 2M46A 2YWMA 5DVBA 5DAKA 2C0FA 1ZYQB 5D9TA 2N5FA 1R5AA 3UJ1A 3WD6A 1MEKA 4K7OA 1TOFA 3L9SA 2G0FA 4XS4B 1F3AA 2C3QA 2QKEA 4RQXA 4LA1A 5A4VA 4I5QA 3EU3A 3PINA 1M2AA 3TOTA 3KTLA 3DYRA 4ZBAA 3FR3A 1RQMA 2GTUA 2PGTA 1U88A 1JZRA 3E9JB 3TJKA 5ECNB 4EXJA 2DJ0A 3MWHA 1A8LA 3LXZA 3HA9A 3F8UA 3EURA 3DXBA 4TR1A 3VLNA 3QOUA 2TIRA 3UEMA 2DJ3A 4MP4A 5KN2A 1A2MA 1J08A 2GQKA 2WDUA 4WKWA 4XTSA 3BOAA 1W4VA 3FZ9A 1PX6A 3CBUA 5CRGA 4PQ1A 3IK9A 4HI7A 4F82A 1WMJA 3HCZA 1HQOA 5D9VA 1UN2A 1TJDA 3ZL5A 5IMVA 5CP1A 1O73A 2CX3A 5DQSA 4L5OA 3VI5A 3S9FA 2MMAA 1I9DA 3IA1A 2C4JA 3QMXA 3H93A 4PNFA 5CRHA 4OD7A 4G19A 5JCWA 1SKSB 2H01A 4F03A 1GL8A 4L0WA 4ZB9A 4OFNA 1GTBA 4GWRA 1Y25A 3C8EA 2VOCA 1WWJA 3HVSA 2LRCA 2H6ZA 4N30A 3TJJA 2KUCA 3RPPA 2R3XA 4L8EA 4OMVA 3A2XA 3W8JA 3F6DA 1TKDB 2VLVA 4JZQA 1TK5B 2FD3A 4IP1A 5D73A 2LSTA 2O87A 10GSA 4BWQA 1ZGNA 3KH9A 3HJOA 4MDCA 1YJ6A 2H6YA 4MJCA 5FWGA 4MZCA 4PQIA 1FOVA 3BJ5A 1QUWA 3TCOA 2LEGA 5HR3A 1WIKA 2P5QA 4JE1A 3H1NA 5IOWA 4PURA
chains in the Genus database with same CATH superfamily
20GSA 1ILOA 3IV4A 2LRNA 4LMVA 2CZ3A 1YDKA 2FCHA 4EUYA 1DE2A 4DSSA 2WZ9A 4FYCA 3IHGA 1QMVA 2CQ9A 2HI7A 5JWRB 4ZIJA 2PPTA 2K8SA 5EVOA 3ZVJD 2CT6A 2M72A 4K2DA 3GIXA 4Q5NA 2F51A 4POKA 3M3MA 3MNGA 2R5GA 1RW1A 1T4YA 4K2XA 4NAXA 4G0LA 3A5WA 4MLYA 1PN0A 3Q18A 3GN3A 4KW6A 4KSOA 3ZLPA 1H4OA 1T1VA 1UA5A 3NZNA 3IXRA 1PD21 2PVOC 4Q5FA 4WETA 5E59A 3TKQA 1XZOA 5HR0A 4Z2UA 1M9BA 3I43A 3IC4A 3GTUB 2HZEB 3EWLA 2YV7A 4K7IA 1GSSA 1VF1A 3VWWA 1TI1A 3F63A 4MNNA 2B5XA 4IHUA 5DCHA 2TRCP 3H79A 1MD4A 1EOGA 1GNWA 3IRAA 2IJYA 2XC2A 4DSQA 3LEFA 3DGQA 2K8VA 1NW2A 4KDXA 3UARA 4Q5QA 3TGZA 1B9XC 2YN1A 2AJQB 4HQZA 4BL7B 5G31A 4FIWA 3W6GA 1J0FA 3WYWA 4NWYA 4EDZA 1SKWB 3O3TA 1K0BA 2E0QA 3DWVA 2D2ZA 1AQVA 1TRWA 5FHIA 2JSZA 3P90A 4HSCX 3CSHA 2MMOA 2E7PA 3KM6A 2LJRA 1UC7A 3QCPA 3ZIVA 5BMUA 5A5KA 4WF4A 2L6DA 2YCDA 3O6TA 5HFGA 3H4KA 1GTUA 4QL7A 3EE2A 4GXZA 5B6NA 1KEBA 1FW1A 1PFOA 2PN8A 4ECCA 4GRFA 2H74A 1S3RA 4D73A 3TKRA 5DDLA 2LS5A 4TR4A 1SK1A 2CVDA 3A3TA 1S3CA 3A2WA 2DIZA 3CSJA 1JLWA 4MF6A 4POBA 3GRXA 2HXKA 5IMZA 2JACA 3APOA 2FLSA 2GSSA 2R0CA 1U6TA 5DJMA 2CZ2A 5AGYA 1SJZA 3LJRA 3DVWA 5EY6A 6GSTA 1G6WA 4IQAA 3D4TA 5F06A 2IWTA 4V1Ag 4HZ2A 3ZREA 4CY6A 2H0GA 3BCIA 1GULA 2IPAA 3F4TA 3F4RA 5ECOB 2H6XA 3L9UA 3WGXA 2GQLA 1SENA 2F8AA 3GKNA 3ZFLA 1VF2A 1AUCA 2OBKA 1MD3A 2HFDA 3IAS2 2I81A 1V98A 3KP9A 4KA0A 2HSHA 1GSFA 4H86A 3BD2A 1GWCA 2H73A 2FHEA 1Y6EA 4IJ3A 2B6MA 3GFKA 2FA8A 2MBSA 2AUVA 1ML6A 3DRNA 3W8SA 1JZWA 5GZZB 1VF4A 4HJMA 1BAYA 4G10A 4TXOA 3EU4A 5CYYA 2LUSA 4IQ1A 2VCVA 4HQSA 4AF2A 3HVVA 3U5RE 1LJRA 2VAFA 3C7MA 4MZWA 4QL9A 2VD0A 4FYUA 1FG4A 1O8WA 2RUFA 4XRDA 5IMCA 3VI7A 2VL2C 2WS2A 4ZILA 3US3A 4NHWA 5ENUA 4YQUA 4AGSA 2N5BA 3KMOA 4IKHA 3KH7A 2H75A 2J23A 2V41A 4TRXA 4EDYA 1T00A 1PQNA 1V58A 2JU5A 5H5RA 1DSBA 4ML1A 2B5EA 3VK9A 1Z6MA 4I6XA 3MYDA 4V1Ap 1GLPA 1YKAA 2A2PA 2E2MA 4JRRA 1HNAA 3TRQA 1X5DA 1ABAA 2GZPA 1WPIA 1TP9A 3FZ4A 2GSTA 2XBIA 2LQOA 2XHFA 2TRXA 2KLXA 3QR6A 1Z7PA 4N10A 5ABRA 2NBSA 18GSA 2FUG2 4DEJA 3RDWA 1G7OA 3TKSE 1LU4A 3VWXA 5ELAA 3M8NA 7GSSA 2YJ7A 2R2JA 4QQ7A 2X8CA 3KGKA 2NVLA 4RI7A 2RLIA 4GQCA 3CRUA 5DAKB 4TN8A 3E3EA 5B8AA 1B8XA 1K0OA 1YZXA 1BX9A 5ECPB 3RAZA 2LTKA 1ZYNA 1JLVA 3VFIA 2NPBA 4HS1A 4YAPA 2XPEA 5D93A 1THOA 2JSYA 4OWYA 4AJ6A 1Z3EA 5IM9A 4WBRD 4IELA 3CTFA 4GTUA 5JWQB 4IP6A 3D6IA 3FR6A 2JADA 3MDKA 4TR3A 5KN1A 2VM1A 1V2AA 5A4UA 2O8VB 4TR1B 1G0TA 4GSNA 1BQ7A 3JCML 5AIVA 5J3RA 2RM5A 2OE3A 4HOJA 3UAPA 1PGTA 1XWGA 2H0HA 2PVQA 2B7JA 3LWAA 3QAVA 1TW9A 2RUEA 3F0IA 1XXUA 4POMA 4XRAA 3HDCA 2EC4A 4G2EA 5DBQA 2C0GA 4IW9A 2V1MA 3KP8A 5J9BA 2I3YA 5J41A 1JFUA 4OO5A 3ZMKA 2YV9A 4TW5A 3L78A 4PTSA 1A2LA 2HT9A 2QC7A 3I69A 2IMIA 1T7PB 1YF1A 5C00A 3FY7A 2LJAA 3DMLA 4EL1A 1YEXA 1IYHA 3QAGA 4F0BA 2CV4A 1ERWA 1TU7A 1XWBA 4HDEA 1TK0B 4FYBA 3RPNA 1SL1B 1M3JA 4G0IA 6GSUA 2C0DA 4KGIA 5JCUA 2QSIA 2AV4A 4G9HA 3Q74A 1XFLA 3ZITA 11GSA 3ZTLA 1EWXA 2ALBA 2L5OA 2A2SA 2ZUPA 4WXTA 2VCTA 2Z9SA 2L57A 3IDVA 6GSXA 2I1UA 5EPFA 3GURA 3TKPA 2DJKA 3CXGA 2WRTA 3GSTA 4F9ZA 2I4AA 1VGLA 1AIUA 1GTIA 3AY8A 1X9SB 3D21A 3M9JA 5ECKB 4K0NA 4ZXGA 2HRNA 2IFQA 4J2FA 3UOMA 2H1BA 1LBKA 2B3SA 3FR9A 2VD1A 1ERTA 13GSA 2KP2A 2YANA 2I9HA 3F4SA 2LQQA 4N11A 4A5PA 3OR5A 2C3NA 1MDIA 1EEMA 3E0UA 1EEJA 4WBJA 1F9MA 3VPTA 4X43A 3CSIA 2HNLA 5ID2A 5C04A 3DD3A 1K0AA 2C3TA 1FAAA 1K0MA 1RK4A 4GF0A 2H0IA 5AN1A 1R4WA 5IO2A 2VLUA 3UBKA 4ECJA 3ERFA 1DBYA 3IBHA 3EVIA 3TJGA 4K6XA 1OE7A 2HRFA 14GSA 1F6MC 4I2UA 1S3DA 4EVMA 3IPZA 1NHYA 3HHVA 2EIQA 2HYXA 3D0ZA 4PQHA 1TK8B 4I97A 5HFKA 2KHPA 3CMIA 4V2NA 1BEDA 3FKFA 3GA4A 1OE8A 1OKTA 2UZ8A 2YZHA 5GAND 4ECIA 5ECLB 4KB3A 3ZYWA 2P0GA 4MA9A 5CRDA 5DALB 4X4JA 1EP7A 3GHAA 1QGVA 4MF5A 2FWGA 1PRXA 3HZ4A 4WEYA 1A0FA 1SU9A 2X64A 2QA2A 3GV1A 4POLA 5L71A 5HFIA 4OCEA 3L0HA 1GSDA 1K0CA 1WRYA 4NMUA 1B4QA 2OJLA 3F9UA 1HNBA 2CAIA 3GTUA 3GX8A 4GSSA 5G5FA 2B1LA 3FMWA 1XG8A 1GP1A 2O85A 5CAXA 4PUFC 1A0RP 3L9VA 1SD9A 4ECBA 5G1LA 4DSRA 1WP0A 1WOUA 3TB2A 4OCFA 2A2RA 3KEBA 2X49A 1PA3A 1QFNA 4BA7A 2JZSA 4BL7A 2WGRA 5F0GA 3TRPA 1JZDA 1SJIA 3G9BA 4MK3A 1AAZA 5CRWA 3EMPA 1B9YC 2OKAA 5KOWA 2R0PA 4PUAA 1NHOA 3ME8A 1PMTA 4PGTA 4OFMA 5H5SA 1TXXA 2CVKA 5ELGA 4IGJA 3F6FA 2B1KA 1B4PA 3ZIJA 1I5GA 2ES7A 1SK2A 2X99A 4HU9A 4LMWA 2LV3A 2VCZA 2GLRA 3L4NA 2FY6A 5D8IA 2WB9A 2VUPA 4K1FA 3CYNA 4HUAA 3HD5A 3R3EA 4MH2A 5F8BA 1ERUA 2H76A 4YKGA 1FOHA 4D73B 3ME7A 4O7HA 2R6KA 1E2YA 3HKRA 3LORA 5DJLA 1GTAA 4L5LA 1UVZA 1XW6A 4ZBDA 5F07A 4EKZA 1OC9A 2H19A 3GX0A 3LFLA 3FHKA 5KOXA 2GT5A 2GGTA 1XOBA 4BVYA 1GUMA 5HQPA 5IQYA 3HXSA 4RQRA 1MDKA 4JEDA 1XBSA 3IOSA 4I8BA 3UVTA 2L4QA 4YH2A 4WR5A 2HLSA 4E8HA 2M80A 2MYGA 4X0XA 1PL2A 1CQHA 1U3AA 2V32A 2YNXA 5CNWA 2NDOA 1Z5YE 1M0UA 2K6VA 6GSSA 2LRTA 2OE0A 4USSA 2XPDA 4EIQA 3Q19A 1GLQA 2PMTA 1DE1A 1TRUA 1S3AA 4BWSA 3HY2A 4MF7A 2EIOA 1FVJA 3DIEA 2DLXA 2FNOA 2B7KA 4KH7A 3FW2A 2O7KA 5H5QA 3DEXA 4F2IA 4K7NA 4ZBBA 2H1DA 4EO3A 4J56E 1HD2A 2HSMA 4I2TA 3VWVA 3IC8A 2DJ2A 4TXOB 4K0GA 2OA7A 3TOUA 3PPUA 4CW9A 1GSYA 1T8EB 4YKFA 2MMZA 3TRXA 19GSA 1PX7A 1O6JA 1TRSA 2YJHA 1YQ1A 3IE3A 3A5IA 2IIYA 2HZFA 2NTOA 5ECRB 2YZUA 1GSQA 2DMLA 1SL0B 2C80A 1HYUA 4PX1A 3F3RA 1BYEA 2GDRA 4GQFA 2DMMA 1W89A 2BTOT 1Z9HA 4CDOA 2H30A 1THXA 2EIRA 1M7TA 2IN3A 5GSTA 3Q6OA 5GSSA 3BCKA 1KBNA 1OAZA 1Z7RA 5LNKe 1M2BA 3GL3A 1ZZYA 1F37A 5ECHB 3WT2A 5KN0A 3M0FA 4KNDA 1JHBA 3GYKA 5ECSA 1NM3A 5G1KA 3K8NA 1EGOA 2O89A 1SD8A 4GSTA 4EF0A 4LL4B 4ISDA 3D4MA 1ZOFA 1SYRA 4IS0A 4ZB6A 4ILFA 2VCXA 4BPYA 3RHBA 4KAEA 5IMDA 5HR2A 2PERA 3EMXA 4MPFA 5AISA 5IIZA 2PWJA 3HJPA 4FH8A 3HZ8A 2ZCTA 3IR4A 1ACVA 4DVCA 5IMAA 2V2GA 3WGDA 1GUHA 5B6MA 4EE0A 1G6YA 1M99A 5IOXA 3HVXA 2FWHA 1TDIA 1F2EA 1FHEA 2B5YA 3FEUA 3TKSC 1SJ6A 1ST9A 4XIHA 4K5SA 2C0EA 3QD9A 1O7UA 6GSWA 5A4WA 3J7Yk 5LCZA 4XS4A 3G7YA 5D96A 4MZBA 4XS6A 3WGEA 1R5PA 3ED3A 4NV5A 1OKDA 1J9BA 4N0ZA 1R7HA 2IMEA 1X5EA 2AYTA 1FO5A 2GS3A 4WF5A 3D5JA 4Z2TA 4O5UA 3P7XA 4TKYA 1Q4JA 3D22A 3CTGA 2H8LA 3C1SA 2DKIA 2OACA 5IO0A 4LLRA 2P31A 3APSA 2PBJA 3HYPA 5AIXA 2ZNMA 1OYJA 3U6VA 4KCAA 4AJ7A 4WR4A 1GNEA 2VL9A 4JR4A 2C8UA 1ZL9A 1O8XA 1X9WB 6GSYA 1V57A 4O5RA 4G0KA 1XWCA 1TTZA 3PGTA 5IPHA 3KIJA 4V2MA 3BBYA 1K0DA 4KDUA 2P5RA 4BVXA 1AQXA 1X0RA 2X8HA 1CQGA 3MSZA 3M1GA 1F3BA 3ZRDA 4ZL7A 2R37A 2N5AA 4RUVA 1EV9A 1OC8A 3KMNA 1WE0A 1ON4A 4XCSA 4L0UA 1BJXA 3EINA 3UBLA 2DKHA 1ZYEA 2DSAA 3TDGA 4YAVA 1PL1A 4JR6A 3LG6A 1FB0A 3QDNA 4KCEA 5BRTA 1YEPA 2XBQA 3M9KA 5B8BA 2L6CA 2DC5A 2LNSA 4TOPA 1YKCA 1USBA 2MBTA 2KP1A 1WJKA 1SKRB 3J7Yb 1XIYA 3C71A 1PKWA 3LW9A 1E6BA 1GSUA 2F9SA 4KSMA 1M2DA 5COHA 3G7IA 2VCQA 5FT3A 4MJBA 4YQMA 4ML6A 4NHZA 1EV4A 1O85A 5LD0A 5F05A 1ZYPA 2WCIA 5EL8A 4O5QA 5DCGA 3KCMA 4PXOA 2OE1A 5JCGA 2IFQB 2IMKA 2LKUA 2VL2A 2H70A 3HVNA 12GSA 5G5EA 3V1WA 4JU5A 2VL3A 1X9MB 1QXHA 5E4WA 4EC0A 5HR1A 2K9FA 3ZFBA 2H1GA 4XHMA 1TRVA 4YQVA 1KNGA 3UL3A 1B48A 3ZMLA 1ERVA 5ID2B 1Q98A 4HEA2 2C1YA 3NIVA 2JZRA 2YWNA 2FWFA 2K18A 1K3LA 2YP6A 1AXDA 2ON5A 4P3YB 4DSSB 3TUEA 2FA4A 1BG5A 3KZQA 3QFAC 3IK7A 1YF0A 2R0GA 1N2AA 4IJIA 1A24A 4Z2RA 2A4VA 1PKZA 2H71A 1QK8A 2PU9C 1AC1A 4ACSA 2G2QA 2JZTA 1SK0A 2LNTA 1XOAA 3ERGA 3RHCA 3FK8A 3ZZXA 1TU8A 1K3OA 3KJYA 1M9AA 4MABA 1HNCA 1EOHA 3TKSA 5DQYA 3G7JA 3EPTA 9GSSA 5ECMB 1OVNA 5DALA 1GUKA 1GH2A 1A23A 5J4UA 2V6KA 1O81A 1GRXA 2KOKA 2VLTA 1H75A 1XW5A 2VCWA 3KTBA 3IAM2 2H66A 3FZ5A 2HZEA 4ZL8A 3GKKA 4ICYA 1JZOA 1TI3A 1XCCA 4IBPA 4KX4A 4BIKA 1MTCA 2LJKA 5JWOB 3APQA 5IPGA 4PNGA 2IL3A 2HSYA 17GSA 2L4CA 3GUSA 2VO4A 2AHEA 2FWEA 2X4AA 2GT6A 1FB6A 2VIMA 4XS1A 4V2LA 8GSSA 3DKSA 2JL4A 2RIIA 3ERWA 2OBIA 3H8QA 1V9WA 2L59A 3LGCA 1ZCPA 2REMA 2QA1A 4Q5RA 2V6OA 1VRSD 1Z6NA 1XPVA 1XVWA 3I9V2 1PSQA 4MH3A 3C1RA 3GKXA 2H1AA 2DJJA 2WFCA 1SL2B 1VF3A 3MAKA 4KUNA 2F3MA 1DUGA 5B7CA 1N8JA 5J9CA 1XVQA 3TJFA 3A2VA 4FQUA 4NXIA 2AB6A 1T3BA 4NV2A 4ZB8A 1NSWA 4HU7A 3LSZA 4Z7XA 1T4ZA 3P2AA 4GLTA 1U87A 2HE3A 5ECQB 4FO5A 3GKMA 1QQ2A 3KD0A 3KXOA 2H72A 3NOFA 2PUKC 1EZKA 1AW9A 4MPGA 4J57E 3SBCA 4RI6A 1K0NA 1G7EA 3QAWA 22GSA 3LYKA 1U3IA 4ZL9A 1XWKA 3DVXA 1XW9A 2J9HA 3GH6A 1OC9B 3UVHA 2CA8A 2HRAA 3WT1A 5INYA 5CO3A 4BVYB 1SYXA 3SWLA 1IYIA 2E2GA 2RM6A 2DJ1A 4LL1B 3VURA 2CX4A 5D9XA 2GZZA 3CRTA 1A8YA 2FGXA 1V40A 3I6AA 5G2ZA 2CVBA 1AQWA 16GSA 3FZAA 1GSEA 3P8WA 4O32A 1C72A 3VWUA 5IMFA 1X5CA 3PR8A 3GL5A 4TXVA 2IMFA 1MDJA 4MJAA 2GZYA 2YOIA 3GMFA 4KE3A 2QGVA 3O76A 2R4VA 4NPBA 6GSVA 1OC3A 5J5NA 3F3QA 3UMAA 1R26A 2WJUA 4KDYA 4E8EA 3R2QA 2YWOA 4ULXA 4X1UA 3VPQA 3PH9A 2GQMA 3UIWA 4JBBA 1URMA 4CY8A 5KN3A 3N9JA 3HJMA 2AAWA 4N0VA 3FRCA 4F0CA 1EGRA 3LXTA 1PN9A 1YY7A 4HZ4A 4O92A 3LQ7A 4HJ2A 3ISOA 3EYTA 4GCIA 4IVFA 5G30A 2MMNA 4MJEA 3N5OA 4K9ZA 4OO4A 2GSRA 2YPMA 1A2JA 4MCUA 1K3YA 2L5LA 3GH9A 2MZCA 5KEJA 1M3IA 2BJXA 3FYGA 3C73A 2DBCA 2CAQA 1EP8A 1FVKA 2VM2A 3QFBC 5GAPD 1KTEA 2GVPA 3LYPA 2GSQA 4MMMA 3GNJA 3QPMA 2F8FA 2OADA 4AJ8A 2DIYA 5ECIB 1XWAA 4TR0A 4OFTA 3ZVJA 2X8GA 4K8MA 4TVEA 3RBTA 2BMXA 4CHSA 2WULA 3IHQA 2ON7A 1ZMAA 3GSSA 5D9WA 3TJBA 4IN0A 4ID0A 5CREA 2IMDA 3EC3A 2YWIA 2M46A 2YWMA 5DVBA 5DAKA 2C0FA 1ZYQB 5D9TA 2N5FA 1R5AA 3UJ1A 3WD6A 1MEKA 4K7OA 1TOFA 3MIXA 3L9SA 2G0FA 4XS4B 1F3AA 2C3QA 2QKEA 4RQXA 4LA1A 5A4VA 4I5QA 4EIPA 3EU3A 3PINA 1M2AA 3TOTA 3KTLA 3DYRA 4ZBAA 3FR3A 1RQMA 2GTUA 2PGTA 1U88A 1JZRA 3E9JB 3TJKA 5ECNB 4EXJA 2DJ0A 3MWHA 1A8LA 3LXZA 3HA9A 3F8UA 3EURA 3DXBA 4TR1A 3VLNA 3QOUA 2TIRA 3UEMA 2DJ3A 4MP4A 5KN2A 1A2MA 1J08A 2GQKA 4K5RA 3CQFA 2WDUA 4WKWA 4XTSA 3BOAA 1W4VA 4BVXB 3FZ9A 1PX6A 3CBUA 5CRGA 4PQ1A 3IK9A 4HI7A 4F82A 1WMJA 3HCZA 1HQOA 5D9VA 1UN2A 1TJDA 3ZL5A 5IMVA 5CP1A 1O73A 2CX3A 5DQSA 4L5OA 3VI5A 3S9FA 2MMAA 1I9DA 3IA1A 2C4JA 3QMXA 3H93A 4PNFA 5CRHA 4OD7A 4G19A 5JCWA 1SKSB 2A4HA 2H01A 4F03A 1GL8A 4L0WA 4ZB9A 4KF9A 4OFNA 1GTBA 4GWRA 1Y25A 3C8EA 2VOCA 1WWJA 3HVSA 2LRCA 2H6ZA 4N30A 3TJJA 2KUCA 3RPPA 2R3XA 4L8EA 4OMVA 3A2XA 3W8JA 3F6DA 1TKDB 2VLVA 4JZQA 1TK5B 2FD3A 4IP1A 5D73A 2LSTA 2O87A 10GSA 4BWQA 1ZGNA 3KH9A 3HJOA 4MDCA 2HRKA 1YJ6A 2H6YA 4MJCA 5FWGA 4MZCA 4PQIA 1FOVA 3BJ5A 1QUWA 3TCOA 2LEGA 5HR3A 1WIKA 2P5QA 4JE1A 3H1NA 5IOWA 4PURA
chains in the Genus database with same CATH topology
20GSA 1ILOA 3IV4A 2LRNA 4LMVA 2CZ3A 1YDKA 2FCHA 4EUYA 1DE2A 4DSSA 2WZ9A 4FYCA 3IHGA 1QMVA 2CQ9A 2HI7A 5JWRB 4ZIJA 2PPTA 2K8SA 5EVOA 3ZVJD 2CT6A 2M72A 4K2DA 3GIXA 4Q5NA 2F51A 4POKA 3M3MA 3MNGA 2R5GA 1RW1A 1T4YA 4K2XA 4NAXA 4G0LA 3A5WA 4MLYA 1PN0A 3Q18A 3GN3A 4KW6A 4KSOA 3ZLPA 1H4OA 1T1VA 1UA5A 3NZNA 3IXRA 1PD21 2PVOC 4Q5FA 4WETA 5E59A 3TKQA 1XZOA 5HR0A 4Z2UA 1M9BA 3I43A 3IC4A 3GTUB 2HZEB 3EWLA 2YV7A 4K7IA 1GSSA 1VF1A 3VWWA 1TI1A 3F63A 4MNNA 2B5XA 4IHUA 5DCHA 2TRCP 3H79A 1MD4A 1EOGA 1GNWA 3IRAA 2IJYA 2XC2A 4DSQA 3LEFA 3DGQA 2K8VA 1NW2A 4KDXA 3UARA 4Q5QA 3TGZA 1B9XC 2YN1A 2AJQB 4HQZA 4BL7B 5G31A 4FIWA 3W6GA 1J0FA 3WYWA 4NWYA 4EDZA 1SKWB 3O3TA 1K0BA 2E0QA 3DWVA 2D2ZA 1AQVA 1TRWA 5FHIA 2JSZA 3P90A 3CSHA 2MMOA 2E7PA 3KM6A 2LJRA 1UC7A 3QCPA 3ZIVA 5BMUA 5A5KA 4WF4A 2L6DA 2YCDA 3O6TA 5HFGA 3H4KA 1GTUA 4QL7A 3EE2A 4GXZA 5B6NA 1KEBA 1FW1A 2PN8A 4ECCA 4GRFA 2H74A 4D73A 3TKRA 5DDLA 2LS5A 4TR4A 1SK1A 2CVDA 3A3TA 1S3CA 3A2WA 2DIZA 3CSJA 1JLWA 4MF6A 4POBA 3GRXA 2HXKA 5IMZA 2JACA 3APOA 2FLSA 2GSSA 2R0CA 1U6TA 5DJMA 2CZ2A 5AGYA 1SJZA 3LJRA 3DVWA 5EY6A 6GSTA 1G6WA 4IQAA 3D4TA 5F06A 2IWTA 4V1Ag 4HZ2A 3ZREA 4CY6A 2H0GA 3BCIA 1GULA 2IPAA 3F4TA 3F4RA 5ECOB 2H6XA 3L9UA 3WGXA 2GQLA 1SENA 2F8AA 3GKNA 3ZFLA 1VF2A 1AUCA 2OBKA 1MD3A 2HFDA 3IAS2 2I81A 1V98A 3KP9A 4KA0A 2HSHA 1GSFA 4H86A 3BD2A 1GWCA 2H73A 2FHEA 1Y6EA 4IJ3A 2B6MA 3GFKA 2FA8A 2MBSA 2AUVA 1ML6A 3DRNA 3W8SA 1JZWA 5GZZB 1VF4A 4HJMA 1BAYA 4G10A 4TXOA 3EU4A 5CYYA 2LUSA 4IQ1A 2VCVA 4HQSA 4AF2A 3HVVA 3U5RE 1LJRA 2VAFA 3C7MA 4MZWA 4QL9A 2VD0A 4FYUA 1FG4A 1O8WA 2RUFA 4XRDA 5IMCA 3VI7A 2VL2C 2WS2A 4ZILA 3US3A 4NHWA 5ENUA 4YQUA 4AGSA 2N5BA 3KMOA 4IKHA 3KH7A 2H75A 2J23A 2V41A 4TRXA 4EDYA 1T00A 1PQNA 1V58A 2JU5A 5H5RA 1DSBA 4ML1A 2B5EA 3VK9A 1Z6MA 4I6XA 3MYDA 4V1Ap 1GLPA 1YKAA 2A2PA 2E2MA 4JRRA 1HNAA 3TRQA 1X5DA 1ABAA 2GZPA 1WPIA 1TP9A 3FZ4A 2GSTA 2XBIA 2LQOA 2XHFA 2TRXA 2KLXA 3QR6A 1Z7PA 4N10A 5ABRA 2NBSA 18GSA 2FUG2 4DEJA 3RDWA 1G7OA 3TKSE 1LU4A 3VWXA 5ELAA 3M8NA 7GSSA 2YJ7A 2R2JA 4QQ7A 2X8CA 3KGKA 2NVLA 4RI7A 2RLIA 4GQCA 3CRUA 5DAKB 4TN8A 3E3EA 5B8AA 1B8XA 1K0OA 1YZXA 1BX9A 5ECPB 3RAZA 2LTKA 1ZYNA 1JLVA 3VFIA 2NPBA 4HS1A 4YAPA 2XPEA 5D93A 1THOA 2JSYA 4OWYA 4AJ6A 1Z3EA 5IM9A 4WBRD 4IELA 3CTFA 4GTUA 5JWQB 4IP6A 3D6IA 3FR6A 2JADA 3MDKA 4TR3A 5KN1A 2VM1A 1V2AA 5A4UA 2O8VB 4TR1B 1G0TA 4GSNA 1BQ7A 3JCML 5AIVA 5J3RA 2RM5A 2OE3A 4HOJA 3UAPA 1PGTA 1XWGA 2H0HA 2PVQA 2B7JA 3LWAA 3QAVA 1TW9A 2RUEA 3F0IA 1XXUA 4POMA 4XRAA 3HDCA 2EC4A 4G2EA 5DBQA 2C0GA 4IW9A 2V1MA 3KP8A 5J9BA 2I3YA 5J41A 1JFUA 4OO5A 3ZMKA 2YV9A 4TW5A 3L78A 4PTSA 1A2LA 2HT9A 2QC7A 3I69A 2IMIA 1T7PB 1YF1A 5C00A 3FY7A 2LJAA 3DMLA 4EL1A 1YEXA 1IYHA 3QAGA 4F0BA 2CV4A 1ERWA 1TU7A 1XWBA 4HDEA 1TK0B 4FYBA 3RPNA 1SL1B 4G0IA 6GSUA 2C0DA 4KGIA 5JCUA 2QSIA 2AV4A 4G9HA 3Q74A 1XFLA 3ZITA 11GSA 3ZTLA 1EWXA 2ALBA 2L5OA 2A2SA 2ZUPA 4WXTA 2VCTA 2Z9SA 2L57A 3IDVA 6GSXA 2I1UA 5EPFA 3GURA 3TKPA 2DJKA 3CXGA 2WRTA 3GSTA 4F9ZA 2I4AA 1VGLA 1AIUA 1GTIA 3AY8A 1X9SB 3D21A 3M9JA 5ECKB 4K0NA 4ZXGA 2HRNA 2IFQA 4J2FA 3UOMA 2H1BA 1LBKA 2B3SA 3FR9A 2VD1A 1ERTA 13GSA 2KP2A 2YANA 2I9HA 3F4SA 2LQQA 4N11A 4A5PA 3OR5A 2C3NA 1MDIA 1EEMA 3E0UA 1EEJA 4WBJA 1F9MA 3VPTA 4X43A 3CSIA 2HNLA 5ID2A 5C04A 3DD3A 1K0AA 2C3TA 1FAAA 1K0MA 1RK4A 4GF0A 2H0IA 5AN1A 1R4WA 5IO2A 2VLUA 3UBKA 4ECJA 3ERFA 1DBYA 3IBHA 3EVIA 3TJGA 4K6XA 1OE7A 2HRFA 14GSA 1F6MC 4I2UA 1S3DA 4EVMA 3IPZA 1NHYA 3HHVA 2EIQA 2HYXA 3D0ZA 4PQHA 1TK8B 4I97A 5HFKA 2KHPA 3CMIA 4V2NA 1BEDA 3FKFA 3GA4A 1OE8A 1OKTA 2UZ8A 2YZHA 5GAND 4ECIA 5ECLB 4KB3A 3ZYWA 2P0GA 4MA9A 5CRDA 5DALB 4X4JA 1EP7A 3GHAA 1QGVA 4MF5A 2FWGA 1PRXA 3HZ4A 4WEYA 1A0FA 1SU9A 2X64A 2QA2A 3GV1A 4POLA 5L71A 5HFIA 4OCEA 3L0HA 1GSDA 1K0CA 1WRYA 4NMUA 1B4QA 2OJLA 3F9UA 1HNBA 2CAIA 3GTUA 3GX8A 4GSSA 5G5FA 2B1LA 3FMWA 1GP1A 2O85A 5CAXA 4PUFC 1A0RP 3L9VA 1SD9A 4ECBA 5G1LA 4DSRA 1WP0A 1WOUA 3TB2A 4OCFA 2A2RA 3KEBA 2X49A 1PA3A 1QFNA 4BA7A 2JZSA 4BL7A 2WGRA 5F0GA 3TRPA 1JZDA 1SJIA 3G9BA 4MK3A 1AAZA 5CRWA 3EMPA 1B9YC 2OKAA 5KOWA 2R0PA 4PUAA 1NHOA 3ME8A 1PMTA 4PGTA 4OFMA 5H5SA 1TXXA 2CVKA 5ELGA 4IGJA 3F6FA 2B1KA 1B4PA 3ZIJA 1I5GA 2ES7A 1SK2A 2X99A 4HU9A 4LMWA 2LV3A 2VCZA 2GLRA 3L4NA 2FY6A 5D8IA 2WB9A 2VUPA 4K1FA 3CYNA 4HUAA 3HD5A 3R3EA 4MH2A 5F8BA 1ERUA 2H76A 4YKGA 1FOHA 4D73B 3ME7A 4O7HA 2R6KA 1E2YA 3HKRA 3LORA 5DJLA 1GTAA 4L5LA 1UVZA 1XW6A 4ZBDA 5F07A 4EKZA 1OC9A 2H19A 3GX0A 3LFLA 3FHKA 5KOXA 2GT5A 2GGTA 1XOBA 4BVYA 1GUMA 5HQPA 5IQYA 3HXSA 4RQRA 1MDKA 4JEDA 1XBSA 3IOSA 4I8BA 3UVTA 2L4QA 4YH2A 4WR5A 2HLSA 4E8HA 2M80A 2MYGA 4X0XA 1PL2A 1CQHA 1U3AA 2V32A 2YNXA 5CNWA 2NDOA 1Z5YE 1M0UA 2K6VA 6GSSA 2LRTA 2OE0A 4USSA 2XPDA 4EIQA 3Q19A 1GLQA 2PMTA 1DE1A 1TRUA 1S3AA 4BWSA 3HY2A 4MF7A 2EIOA 1FVJA 3DIEA 2DLXA 2FNOA 2B7KA 4KH7A 3FW2A 2O7KA 5H5QA 3DEXA 4F2IA 4K7NA 4ZBBA 2H1DA 4EO3A 4J56E 1HD2A 2HSMA 4I2TA 3VWVA 3IC8A 2DJ2A 4TXOB 4K0GA 2OA7A 3TOUA 3PPUA 4CW9A 1GSYA 1T8EB 4YKFA 2MMZA 3TRXA 19GSA 1PX7A 1O6JA 1TRSA 2YJHA 1YQ1A 3IE3A 3A5IA 2IIYA 2HZFA 2NTOA 5ECRB 2YZUA 1GSQA 2DMLA 1SL0B 2C80A 1HYUA 4PX1A 3F3RA 1BYEA 2GDRA 4GQFA 2DMMA 1W89A 2BTOT 1Z9HA 4CDOA 2H30A 1THXA 2EIRA 1M7TA 2IN3A 5GSTA 3Q6OA 5GSSA 3BCKA 1KBNA 1OAZA 1Z7RA 5LNKe 1M2BA 3GL3A 1ZZYA 1F37A 5ECHB 3WT2A 5KN0A 3M0FA 4KNDA 1JHBA 3GYKA 5ECSA 1NM3A 5G1KA 3K8NA 1EGOA 2O89A 1SD8A 4GSTA 4EF0A 4LL4B 4ISDA 3D4MA 1ZOFA 1SYRA 4IS0A 4ZB6A 4ILFA 2VCXA 4BPYA 3RHBA 4KAEA 5IMDA 5HR2A 2PERA 3EMXA 4MPFA 5AISA 5IIZA 2PWJA 3HJPA 4FH8A 3HZ8A 2ZCTA 3IR4A 1ACVA 4DVCA 5IMAA 2V2GA 3WGDA 1GUHA 5B6MA 4EE0A 1G6YA 1M99A 5IOXA 3HVXA 2FWHA 1TDIA 1F2EA 1FHEA 2B5YA 3FEUA 3TKSC 1SJ6A 1ST9A 4XIHA 4K5SA 2C0EA 3QD9A 1O7UA 6GSWA 5A4WA 3J7Yk 5LCZA 4XS4A 3G7YA 5D96A 4MZBA 4XS6A 3WGEA 1R5PA 3ED3A 4NV5A 1OKDA 1J9BA 4N0ZA 1R7HA 2IMEA 1X5EA 2AYTA 1FO5A 2GS3A 4WF5A 3D5JA 4Z2TA 4O5UA 3P7XA 4TKYA 1Q4JA 3D22A 3CTGA 2H8LA 3C1SA 2DKIA 2OACA 5IO0A 4LLRA 2P31A 3APSA 2PBJA 3HYPA 5AIXA 2ZNMA 1OYJA 3U6VA 4KCAA 4AJ7A 4WR4A 1GNEA 2VL9A 4JR4A 2C8UA 1ZL9A 1O8XA 1X9WB 6GSYA 1V57A 4O5RA 4G0KA 1XWCA 1TTZA 3PGTA 5IPHA 3KIJA 4V2MA 3BBYA 1K0DA 4KDUA 2P5RA 4BVXA 1AQXA 1X0RA 2X8HA 1CQGA 3MSZA 3M1GA 1F3BA 3ZRDA 4ZL7A 2R37A 2N5AA 4RUVA 1EV9A 1OC8A 3KMNA 1WE0A 1ON4A 4XCSA 4L0UA 1BJXA 3EINA 3UBLA 2DKHA 1ZYEA 2DSAA 3TDGA 4YAVA 1PL1A 4JR6A 3LG6A 1FB0A 3QDNA 4KCEA 5BRTA 1YEPA 2XBQA 3M9KA 5B8BA 2L6CA 2DC5A 2LNSA 4TOPA 1YKCA 1USBA 2MBTA 2KP1A 1WJKA 1SKRB 3J7Yb 1XIYA 3C71A 1PKWA 3LW9A 1E6BA 1GSUA 2F9SA 4KSMA 1M2DA 5COHA 3G7IA 2VCQA 5FT3A 4MJBA 4YQMA 4ML6A 4NHZA 1EV4A 1O85A 5LD0A 5F05A 1ZYPA 2WCIA 5EL8A 4O5QA 5DCGA 3KCMA 4PXOA 2OE1A 5JCGA 2IFQB 2IMKA 2LKUA 2VL2A 2H70A 12GSA 5G5EA 3V1WA 4JU5A 2VL3A 1X9MB 1QXHA 5E4WA 4EC0A 5HR1A 2K9FA 3ZFBA 2H1GA 4XHMA 1TRVA 4YQVA 1KNGA 3UL3A 1B48A 3ZMLA 1ERVA 5ID2B 1Q98A 4HEA2 2C1YA 3NIVA 2JZRA 2YWNA 2FWFA 2K18A 1K3LA 2YP6A 1AXDA 2ON5A 4P3YB 4DSSB 3TUEA 2FA4A 1BG5A 3KZQA 3QFAC 3IK7A 1YF0A 2R0GA 1N2AA 4IJIA 1A24A 4Z2RA 2A4VA 1PKZA 2H71A 1QK8A 2PU9C 1AC1A 4ACSA 2G2QA 2JZTA 1SK0A 2LNTA 1XOAA 3ERGA 3RHCA 3FK8A 3ZZXA 1TU8A 1K3OA 3KJYA 1M9AA 4MABA 1HNCA 1EOHA 3TKSA 5DQYA 3G7JA 3EPTA 9GSSA 5ECMB 1OVNA 5DALA 1GUKA 1GH2A 1A23A 5J4UA 2V6KA 1O81A 1GRXA 2KOKA 2VLTA 1H75A 1XW5A 2VCWA 3KTBA 3IAM2 2H66A 3FZ5A 2HZEA 4ZL8A 3GKKA 4ICYA 1JZOA 1TI3A 1XCCA 4IBPA 4KX4A 1MTCA 2LJKA 5JWOB 3APQA 5IPGA 4PNGA 2IL3A 2HSYA 17GSA 2L4CA 3GUSA 2VO4A 2AHEA 2FWEA 2X4AA 2GT6A 1FB6A 2VIMA 4XS1A 4V2LA 8GSSA 3DKSA 2JL4A 2RIIA 3ERWA 2OBIA 3H8QA 1V9WA 2L59A 3LGCA 1ZCPA 2REMA 2QA1A 4Q5RA 2V6OA 1VRSD 1Z6NA 1XPVA 1XVWA 3I9V2 1PSQA 4MH3A 3C1RA 3GKXA 2H1AA 2DJJA 2WFCA 1SL2B 1VF3A 3MAKA 4KUNA 2F3MA 1DUGA 5B7CA 1N8JA 5J9CA 1XVQA 3TJFA 3A2VA 4FQUA 4NXIA 2AB6A 1T3BA 4NV2A 4ZB8A 1NSWA 4HU7A 3LSZA 4Z7XA 1T4ZA 3P2AA 4GLTA 1U87A 2HE3A 5ECQB 4FO5A 3GKMA 1QQ2A 3KD0A 3KXOA 2H72A 3NOFA 2PUKC 1EZKA 1AW9A 4MPGA 4J57E 3SBCA 4RI6A 1K0NA 1G7EA 3QAWA 22GSA 3LYKA 1U3IA 4ZL9A 1XWKA 3DVXA 1XW9A 2J9HA 3GH6A 1OC9B 3UVHA 2CA8A 2HRAA 3WT1A 5INYA 5CO3A 4BVYB 1SYXA 3SWLA 1IYIA 2E2GA 2RM6A 2DJ1A 4LL1B 3VURA 2CX4A 5D9XA 2GZZA 3CRTA 1A8YA 2FGXA 1V40A 3I6AA 5G2ZA 2CVBA 1AQWA 16GSA 3FZAA 1GSEA 3P8WA 4O32A 1C72A 3VWUA 5IMFA 1X5CA 3PR8A 3GL5A 4TXVA 2IMFA 1MDJA 4MJAA 2GZYA 2YOIA 3GMFA 4KE3A 2QGVA 3O76A 2R4VA 4NPBA 6GSVA 1OC3A 5J5NA 3F3QA 3UMAA 1R26A 2WJUA 4KDYA 4E8EA 3R2QA 2YWOA 4ULXA 4X1UA 3VPQA 3PH9A 2GQMA 3UIWA 4JBBA 1URMA 4CY8A 5KN3A 3N9JA 3HJMA 2AAWA 4N0VA 3FRCA 4F0CA 1EGRA 3LXTA 1PN9A 1YY7A 4HZ4A 4O92A 3LQ7A 4HJ2A 3ISOA 3EYTA 4GCIA 4IVFA 5G30A 2MMNA 4MJEA 3N5OA 4K9ZA 4OO4A 2GSRA 2YPMA 1A2JA 4MCUA 1K3YA 2L5LA 3GH9A 2MZCA 5KEJA 2BJXA 3FYGA 3C73A 2DBCA 2CAQA 1EP8A 1FVKA 2VM2A 3QFBC 5GAPD 1KTEA 2GVPA 3LYPA 2GSQA 4MMMA 3GNJA 3QPMA 2F8FA 2OADA 4AJ8A 2DIYA 5ECIB 1XWAA 4TR0A 4OFTA 3ZVJA 2X8GA 4K8MA 4TVEA 3RBTA 2BMXA 4CHSA 2WULA 3IHQA 2ON7A 1ZMAA 3GSSA 5D9WA 3TJBA 4IN0A 4ID0A 5CREA 2IMDA 3EC3A 2YWIA 2M46A 2YWMA 5DVBA 5DAKA 2C0FA 1ZYQB 5D9TA 2N5FA 1R5AA 3UJ1A 3WD6A 1MEKA 4K7OA 1TOFA 3MIXA 3L9SA 2G0FA 4XS4B 1F3AA 2C3QA 2QKEA 4RQXA 4LA1A 5A4VA 4I5QA 4EIPA 3EU3A 3PINA 1M2AA 3TOTA 3KTLA 3DYRA 4ZBAA 3FR3A 1RQMA 2GTUA 2PGTA 1U88A 1JZRA 3E9JB 3TJKA 5ECNB 4EXJA 2DJ0A 3MWHA 1A8LA 3LXZA 3HA9A 3F8UA 3EURA 3DXBA 4TR1A 3VLNA 3QOUA 2TIRA 3UEMA 2DJ3A 4MP4A 5KN2A 1A2MA 1J08A 2GQKA 4K5RA 2WDUA 4WKWA 4XTSA 3BOAA 1W4VA 4BVXB 3FZ9A 1PX6A 3CBUA 5CRGA 4PQ1A 3IK9A 4HI7A 4F82A 1WMJA 3HCZA 1HQOA 5D9VA 1UN2A 1TJDA 3ZL5A 5IMVA 5CP1A 1O73A 2CX3A 5DQSA 4L5OA 3VI5A 3S9FA 2MMAA 1I9DA 3IA1A 2C4JA 3QMXA 3H93A 4PNFA 5CRHA 4OD7A 4G19A 5JCWA 1SKSB 2A4HA 2H01A 4F03A 1GL8A 4L0WA 4ZB9A 4KF9A 4OFNA 1GTBA 4GWRA 1Y25A 3C8EA 2VOCA 1WWJA 3HVSA 2LRCA 2H6ZA 4N30A 3TJJA 2KUCA 3RPPA 2R3XA 4L8EA 4OMVA 3A2XA 3W8JA 3F6DA 1TKDB 2VLVA 4JZQA 1TK5B 2FD3A 4IP1A 5D73A 2LSTA 2O87A 10GSA 4BWQA 1ZGNA 3KH9A 3HJOA 4MDCA 2HRKA 1YJ6A 2H6YA 4MJCA 5FWGA 4MZCA 4PQIA 1FOVA 3BJ5A 1QUWA 3TCOA 2LEGA 5HR3A 1WIKA 2P5QA 4JE1A 3H1NA 5IOWA 4PURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 20GS A;  1ILO A;  3IV4 A;  2LRN A;  4LMV A;  2CZ3 A;  1YDK A;  2FCH A;  4EUY A;  1DE2 A;  4DSS A;  2WZ9 A;  4FYC A;  1QMV A;  2CQ9 A;  2HI7 A;  5JWR B;  4ZIJ A;  2PPT A;  2K8S A;  5EVO A;  3ZVJ D;  2CT6 A;  2M72 A;  4K2D A;  3GIX A;  4Q5N A;  2F51 A;  4POK A;  3M3M A;  3MNG A;  2R5G A;  1RW1 A;  1T4Y A;  4NAX A;  3A5W A;  4MLY A;  3Q18 A;  3GN3 A;  4KW6 A;  4KSO A;  3ZLP A;  1H4O A;  1T1V A;  1UA5 A;  3NZN A;  3IXR A;  1PD2 1;  2PVO C;  4Q5F A;  4WET A;  5E59 A;  3TKQ A;  1XZO A;  5HR0 A;  1M9B A;  3I43 A;  3IC4 A;  3GTU B;  2HZE B;  3EWL A;  2YV7 A;  4K7I A;  1GSS A;  1VF1 A;  3VWW A;  1TI1 A;  3F63 A;  2B5X A;  4IHU A;  5DCH A;  2TRC P;  3H79 A;  1MD4 A;  1EOG A;  1GNW A;  3IRA A;  2IJY A;  2XC2 A;  4DSQ A;  3LEF A;  3DGQ A;  2K8V A;  1NW2 A;  4KDX A;  3UAR A;  4Q5Q A;  3TGZ A;  1B9X C;  2YN1 A;  2AJQ B;  4HQZ A;  5G31 A;  4FIW A;  3W6G A;  1J0F A;  3WYW A;  4NWY A;  4EDZ A;  1SKW B;  3O3T A;  1K0B A;  2E0Q A;  3DWV A;  2D2Z A;  1AQV A;  1TRW A;  5FHI A;  2JSZ A;  3P90 A;  3CSH A;  2MMO A;  2E7P A;  3KM6 A;  2LJR A;  1UC7 A;  3QCP A;  3ZIV A;  5A5K A;  4WF4 A;  2L6D A;  2YCD A;  3O6T A;  5HFG A;  3H4K A;  1GTU A;  4QL7 A;  3EE2 A;  4GXZ A;  5B6N A;  1KEB A;  1FW1 A;  2PN8 A;  4ECC A;  4GRF A;  2H74 A;  4D73 A;  3TKR A;  5DDL A;  2LS5 A;  4TR4 A;  1SK1 A;  2CVD A;  3A3T A;  1S3C A;  3A2W A;  2DIZ A;  3CSJ A;  1JLW A;  4MF6 A;  4POB A;  3GRX A;  2HXK A;  5IMZ A;  2JAC A;  3APO A;  2FLS A;  2GSS A;  1U6T A;  5DJM A;  2CZ2 A;  5AGY A;  1SJZ A;  3LJR A;  3DVW A;  5EY6 A;  6GST A;  1G6W A;  4IQA A;  3D4T A;  5F06 A;  2IWT A;  4V1A g;  4HZ2 A;  3ZRE A;  2H0G A;  3BCI A;  1GUL A;  2IPA A;  3F4T A;  3F4R A;  5ECO B;  2H6X A;  3L9U A;  3WGX A;  2GQL A;  1SEN A;  2F8A A;  3GKN A;  3ZFL A;  1VF2 A;  1AUC A;  2OBK A;  1MD3 A;  2HFD A;  3IAS 2;  2I81 A;  1V98 A;  3KP9 A;  4KA0 A;  2HSH A;  1GSF A;  4H86 A;  3BD2 A;  1GWC A;  2H73 A;  2FHE A;  1Y6E A;  4IJ3 A;  2B6M A;  3GFK A;  2FA8 A;  2MBS A;  2AUV A;  1ML6 A;  3DRN A;  3W8S A;  1JZW A;  5GZZ B;  1VF4 A;  4HJM A;  1BAY A;  4G10 A;  4TXO A;  3EU4 A;  5CYY A;  2LUS A;  4IQ1 A;  2VCV A;  4HQS A;  4AF2 A;  3HVV A;  3U5R E;  1LJR A;  2VAF A;  3C7M A;  4MZW A;  4QL9 A;  2VD0 A;  4FYU A;  1FG4 A;  1O8W A;  2RUF A;  4XRD A;  5IMC A;  3VI7 A;  2VL2 C;  2WS2 A;  4ZIL A;  3US3 A;  4NHW A;  5ENU A;  4YQU A;  4AGS A;  2N5B A;  3KMO A;  4IKH A;  3KH7 A;  2H75 A;  2J23 A;  2V41 A;  4TRX A;  4EDY A;  1T00 A;  1PQN A;  1V58 A;  2JU5 A;  5H5R A;  1DSB A;  4ML1 A;  2B5E A;  3VK9 A;  1Z6M A;  4I6X A;  4V1A p;  1GLP A;  1YKA A;  2E2M A;  4JRR A;  1HNA A;  3TRQ A;  1X5D A;  1ABA A;  2GZP A;  1WPI A;  1TP9 A;  3FZ4 A;  2GST A;  2XBI A;  2LQO A;  2XHF A;  2TRX A;  2KLX A;  3QR6 A;  1Z7P A;  4N10 A;  5ABR A;  2NBS A;  18GS A;  2FUG 2;  4DEJ A;  3RDW A;  1G7O A;  3TKS E;  1LU4 A;  3VWX A;  5ELA A;  3M8N A;  7GSS A;  2YJ7 A;  2R2J A;  4QQ7 A;  2X8C A;  3KGK A;  2NVL A;  4RI7 A;  2RLI A;  4GQC A;  3CRU A;  5DAK B;  4TN8 A;  3E3E A;  5B8A A;  1B8X A;  1K0O A;  1YZX A;  1BX9 A;  5ECP B;  3RAZ A;  2LTK A;  1JLV A;  3VFI A;  2NPB A;  4HS1 A;  4YAP A;  2XPE A;  5D93 A;  1THO A;  2JSY A;  4OWY A;  4AJ6 A;  1Z3E A;  5IM9 A;  4WBR D;  4IEL A;  3CTF A;  4GTU A;  5JWQ B;  4IP6 A;  3D6I A;  3FR6 A;  2JAD A;  3MDK A;  4TR3 A;  5KN1 A;  2VM1 A;  1V2A A;  5A4U A;  2O8V B;  4TR1 B;  1G0T A;  4GSN A;  1BQ7 A;  3JCM L;  5AIV A;  5J3R A;  2RM5 A;  2OE3 A;  4HOJ A;  3UAP A;  1PGT A;  1XWG A;  2H0H A;  2PVQ A;  2B7J A;  3LWA A;  3QAV A;  1TW9 A;  2RUE A;  3F0I A;  1XXU A;  4POM A;  4XRA A;  3HDC A;  2EC4 A;  4G2E A;  5DBQ A;  2C0G A;  4IW9 A;  2V1M A;  3KP8 A;  5J9B A;  2I3Y A;  5J41 A;  1JFU A;  4OO5 A;  3ZMK A;  2YV9 A;  4TW5 A;  3L78 A;  1A2L A;  2HT9 A;  2QC7 A;  3I69 A;  2IMI A;  1T7P B;  1YF1 A;  5C00 A;  3FY7 A;  2LJA A;  3DML A;  4EL1 A;  1YEX A;  1IYH A;  3QAG A;  4F0B A;  2CV4 A;  1ERW A;  1TU7 A;  1XWB A;  4HDE A;  1TK0 B;  4FYB A;  3RPN A;  1SL1 B;  6GSU A;  2C0D A;  4KGI A;  5JCU A;  2QSI A;  2AV4 A;  4G9H A;  3Q74 A;  1XFL A;  3ZIT A;  11GS A;  3ZTL A;  1EWX A;  2ALB A;  2L5O A;  2A2S A;  2ZUP A;  4WXT A;  2VCT A;  2Z9S A;  2L57 A;  3IDV A;  6GSX A;  2I1U A;  5EPF A;  3GUR A;  3TKP A;  2DJK A;  3CXG A;  2WRT A;  3GST A;  4F9Z A;  2I4A A;  1VGL A;  1AIU A;  1GTI A;  3AY8 A;  1X9S B;  3D21 A;  3M9J A;  5ECK B;  4K0N A;  4ZXG A;  2HRN A;  2IFQ A;  4J2F A;  3UOM A;  2H1B A;  1LBK A;  2B3S A;  3FR9 A;  2VD1 A;  1ERT A;  13GS A;  2KP2 A;  2YAN A;  2I9H A;  3F4S A;  2LQQ A;  4N11 A;  3OR5 A;  2C3N A;  1MDI A;  1EEM A;  3E0U A;  1EEJ A;  4WBJ A;  1F9M A;  3VPT A;  4X43 A;  3CSI A;  2HNL A;  5ID2 A;  5C04 A;  3DD3 A;  1K0A A;  2C3T A;  1FAA A;  1K0M A;  1RK4 A;  4GF0 A;  2H0I A;  5AN1 A;  1R4W A;  5IO2 A;  2VLU A;  3UBK A;  4ECJ A;  3ERF A;  1DBY A;  3IBH A;  3EVI A;  3TJG A;  4K6X A;  1OE7 A;  2HRF A;  14GS A;  1F6M C;  4I2U A;  1S3D A;  4EVM A;  3IPZ A;  1NHY A;  3HHV A;  2EIQ A;  2HYX A;  3D0Z A;  4PQH A;  1TK8 B;  4I97 A;  5HFK A;  2KHP A;  3CMI A;  4V2N A;  1BED A;  3FKF A;  3GA4 A;  1OE8 A;  1OKT A;  2YZH A;  5GAN D;  4ECI A;  5ECL B;  4KB3 A;  3ZYW A;  2P0G A;  4MA9 A;  5CRD A;  5DAL B;  1EP7 A;  3GHA A;  1QGV A;  4MF5 A;  2FWG A;  1PRX A;  3HZ4 A;  4WEY A;  1A0F A;  1SU9 A;  2X64 A;  3GV1 A;  4POL A;  5L71 A;  5HFI A;  4OCE A;  3L0H A;  1GSD A;  1K0C A;  1WRY A;  4NMU A;  1B4Q A;  2OJL A;  3F9U A;  1HNB A;  2CAI A;  3GTU A;  3GX8 A;  4GSS A;  5G5F A;  2B1L A;  1GP1 A;  2O85 A;  5CAX A;  4PUF C;  1A0R P;  3L9V A;  1SD9 A;  4ECB A;  5G1L A;  4DSR A;  1WP0 A;  1WOU A;  3TB2 A;  4OCF A;  2A2R A;  3KEB A;  4BA7 A;  1PA3 A;  1QFN A;  2JZS A;  4BL7 A;  2WGR A;  5F0G A;  3TRP A;  1JZD A;  1SJI A;  3G9B A;  4MK3 A;  1AAZ A;  5CRW A;  3EMP A;  1B9Y C;  2OKA A;  4PUA A;  1NHO A;  3ME8 A;  1PMT A;  4PGT A;  4OFM A;  5H5S A;  1TXX A;  2CVK A;  5ELG A;  4IGJ A;  3F6F A;  2B1K A;  1B4P A;  3ZIJ A;  1I5G A;  2ES7 A;  1SK2 A;  2X99 A;  4HU9 A;  4LMW A;  2LV3 A;  2VCZ A;  2GLR A;  3L4N A;  2FY6 A;  5D8I A;  2WB9 A;  2VUP A;  4K1F A;  3CYN A;  4HUA A;  3HD5 A;  4MH2 A;  5F8B A;  1ERU A;  2H76 A;  4D73 B;  3ME7 A;  4O7H A;  2R6K A;  1E2Y A;  3HKR A;  3LOR A;  5DJL A;  1GTA A;  4L5L A;  1UVZ A;  1XW6 A;  4ZBD A;  5F07 A;  4EKZ A;  1OC9 A;  2H19 A;  3GX0 A;  3LFL A;  3FHK A;  2GT5 A;  2GGT A;  1XOB A;  4BVY A;  1GUM A;  5HQP A;  5IQY A;  3HXS A;  4RQR A;  1MDK A;  4JED A;  1XBS A;  3IOS A;  4I8B A;  3UVT A;  2L4Q A;  4YH2 A;  4WR5 A;  2HLS A;  4E8H A;  2M80 A;  2MYG A;  4X0X A;  1PL2 A;  1CQH A;  1U3A A;  2V32 A;  2YNX A;  5CNW A;  2NDO A;  1Z5Y E;  1M0U A;  2K6V A;  6GSS A;  2LRT A;  2OE0 A;  2XPD A;  3Q19 A;  1GLQ A;  2PMT A;  1DE1 A;  1TRU A;  1S3A A;  4BWS A;  3HY2 A;  4MF7 A;  2EIO A;  1FVJ A;  3DIE A;  2DLX A;  2FNO A;  2B7K A;  4KH7 A;  3FW2 A;  2O7K A;  5H5Q A;  3DEX A;  4F2I A;  4K7N A;  4ZBB A;  2H1D A;  4EO3 A;  4J56 E;  1HD2 A;  4I2T A;  3VWV A;  2DJ2 A;  4TXO B;  4K0G A;  2OA7 A;  3TOU A;  4CW9 A;  1GSY A;  1T8E B;  2MMZ A;  3TRX A;  19GS A;  1PX7 A;  1O6J A;  1TRS A;  2YJH A;  1YQ1 A;  3IE3 A;  2IIY A;  2HZF A;  2NTO A;  5ECR B;  2YZU A;  1GSQ A;  2DML A;  1SL0 B;  2C80 A;  1HYU A;  4PX1 A;  3F3R A;  1BYE A;  2GDR A;  4GQF A;  2DMM A;  1W89 A;  2BTO T;  1Z9H A;  4CDO A;  2H30 A;  1THX A;  2EIR A;  1M7T A;  2IN3 A;  5GST A;  3Q6O A;  5GSS A;  3BCK A;  1KBN A;  1OAZ A;  1Z7R A;  5LNK e;  1M2B A;  3GL3 A;  1ZZY A;  1F37 A;  5ECH B;  3WT2 A;  5KN0 A;  3M0F A;  4KND A;  1JHB A;  3GYK A;  5ECS A;  1NM3 A;  5G1K A;  3K8N A;  1EGO A;  2O89 A;  1SD8 A;  4GST A;  4EF0 A;  4LL4 B;  4ISD A;  3D4M A;  1ZOF A;  1SYR A;  4IS0 A;  4ZB6 A;  4ILF A;  2VCX A;  4BPY A;  3RHB A;  4KAE A;  5IMD A;  5HR2 A;  2PER A;  3EMX A;  4MPF A;  5AIS A;  5IIZ A;  2PWJ A;  3HJP A;  4FH8 A;  3HZ8 A;  2ZCT A;  3IR4 A;  1ACV A;  4DVC A;  5IMA A;  2V2G A;  3WGD A;  1GUH A;  5B6M A;  4EE0 A;  1G6Y A;  1M99 A;  5IOX A;  3HVX A;  2FWH A;  1TDI A;  1F2E A;  1FHE A;  2B5Y A;  3FEU A;  3TKS C;  1SJ6 A;  1ST9 A;  4XIH A;  2C0E A;  3QD9 A;  1O7U A;  6GSW A;  5A4W A;  3J7Y k;  5LCZ A;  4XS4 A;  3G7Y A;  5D96 A;  4MZB A;  4XS6 A;  3WGE A;  1R5P A;  3ED3 A;  4NV5 A;  1OKD A;  1J9B A;  4N0Z A;  1R7H A;  2IME A;  1X5E A;  2AYT A;  1FO5 A;  2GS3 A;  4WF5 A;  3D5J A;  3P7X A;  4TKY A;  1Q4J A;  3D22 A;  3CTG A;  2H8L A;  3C1S A;  2OAC A;  5IO0 A;  4LLR A;  2P31 A;  3APS A;  2PBJ A;  3HYP A;  5AIX A;  2ZNM A;  1OYJ A;  3U6V A;  4KCA A;  4AJ7 A;  4WR4 A;  1GNE A;  2VL9 A;  4JR4 A;  2C8U A;  1ZL9 A;  1O8X A;  1X9W B;  6GSY A;  1V57 A;  4O5R A;  1XWC A;  1TTZ A;  3PGT A;  5IPH A;  3KIJ A;  4V2M A;  3BBY A;  1K0D A;  4KDU A;  2P5R A;  4BVX A;  1AQX A;  1X0R A;  2X8H A;  1CQG A;  3MSZ A;  3M1G A;  1F3B A;  3ZRD A;  4ZL7 A;  2R37 A;  2N5A A;  4RUV A;  1EV9 A;  1OC8 A;  3KMN A;  1WE0 A;  1ON4 A;  4XCS A;  4L0U A;  1BJX A;  3EIN A;  3UBL A;  1ZYE A;  2DSA A;  3TDG A;  4YAV A;  1PL1 A;  4JR6 A;  3LG6 A;  1FB0 A;  3QDN A;  4KCE A;  1YEP A;  2XBQ A;  3M9K A;  5B8B A;  2L6C A;  2DC5 A;  2LNS A;  4TOP A;  1YKC A;  1USB A;  2MBT A;  2KP1 A;  1WJK A;  1SKR B;  3J7Y b;  1XIY A;  3C71 A;  1PKW A;  1E6B A;  1GSU A;  2F9S A;  4KSM A;  1M2D A;  5COH A;  3G7I A;  2VCQ A;  5FT3 A;  4MJB A;  4YQM A;  4ML6 A;  4NHZ A;  1EV4 A;  1O85 A;  5LD0 A;  5F05 A;  2WCI A;  5EL8 A;  5DCG A;  3KCM A;  4PXO A;  2OE1 A;  5JCG A;  2IFQ B;  2IMK A;  2LKU A;  2VL2 A;  2H70 A;  12GS A;  5G5E A;  3V1W A;  4JU5 A;  2VL3 A;  1X9M B;  1QXH A;  5E4W A;  4EC0 A;  5HR1 A;  2K9F A;  3ZFB A;  2H1G A;  4XHM A;  1TRV A;  4YQV A;  1KNG A;  3UL3 A;  1B48 A;  3ZML A;  1ERV A;  5ID2 B;  1Q98 A;  4HEA 2;  2C1Y A;  3NIV A;  2JZR A;  2YWN A;  2FWF A;  2K18 A;  1K3L A;  2YP6 A;  1AXD A;  2ON5 A;  4P3Y B;  4DSS B;  3TUE A;  2FA4 A;  1BG5 A;  3KZQ A;  3QFA C;  3IK7 A;  1YF0 A;  1N2A A;  4IJI A;  1A24 A;  2A4V A;  1PKZ A;  2H71 A;  1QK8 A;  2PU9 C;  1AC1 A;  4ACS A;  2G2Q A;  2JZT A;  1SK0 A;  2LNT A;  1XOA A;  3ERG A;  3RHC A;  3FK8 A;  3ZZX A;  1TU8 A;  1K3O A;  3KJY A;  1M9A A;  4MAB A;  1HNC A;  1EOH A;  3TKS A;  5DQY A;  3G7J A;  9GSS A;  5ECM B;  1OVN A;  5DAL A;  1GUK A;  1GH2 A;  1A23 A;  5J4U A;  2V6K A;  1O81 A;  1GRX A;  2KOK A;  2VLT A;  1H75 A;  1XW5 A;  2VCW A;  3KTB A;  3IAM 2;  2H66 A;  3FZ5 A;  2HZE A;  4ZL8 A;  3GKK A;  1JZO A;  1TI3 A;  1XCC A;  4IBP A;  4KX4 A;  1MTC A;  2LJK A;  5JWO B;  3APQ A;  5IPG A;  4PNG A;  2IL3 A;  2HSY A;  17GS A;  2L4C A;  3GUS A;  2VO4 A;  2AHE A;  2FWE A;  2GT6 A;  1FB6 A;  2VIM A;  4XS1 A;  4V2L A;  8GSS A;  3DKS A;  2JL4 A;  2RII A;  3ERW A;  2OBI A;  3H8Q A;  1V9W A;  2L59 A;  3LGC A;  1ZCP A;  2REM A;  4Q5R A;  2V6O A;  1VRS D;  1Z6N A;  1XPV A;  1XVW A;  3I9V 2;  1PSQ A;  4MH3 A;  3C1R A;  3GKX A;  2H1A A;  2DJJ A;  2WFC A;  1SL2 B;  1VF3 A;  3MAK A;  4KUN A;  2F3M A;  1DUG A;  5B7C A;  1N8J A;  5J9C A;  1XVQ A;  3TJF A;  3A2V A;  4NXI A;  2AB6 A;  1T3B A;  4NV2 A;  4ZB8 A;  1NSW A;  4HU7 A;  3LSZ A;  4Z7X A;  1T4Z A;  3P2A A;  4GLT A;  1U87 A;  2HE3 A;  5ECQ B;  4FO5 A;  3GKM A;  1QQ2 A;  3KD0 A;  3KXO A;  2H72 A;  3NOF A;  2PUK C;  1EZK A;  1AW9 A;  4MPG A;  4J57 E;  3SBC A;  4RI6 A;  1K0N A;  1G7E A;  3QAW A;  22GS A;  3LYK A;  1U3I A;  4ZL9 A;  1XWK A;  3DVX A;  1XW9 A;  2J9H A;  3GH6 A;  1OC9 B;  3UVH A;  2CA8 A;  3WT1 A;  5INY A;  5CO3 A;  1SYX A;  3SWL A;  1IYI A;  2E2G A;  2RM6 A;  2DJ1 A;  4LL1 B;  3VUR A;  2CX4 A;  5D9X A;  2GZZ A;  3CRT A;  1A8Y A;  2FGX A;  1V40 A;  3I6A A;  5G2Z A;  2CVB A;  1AQW A;  16GS A;  3FZA A;  1GSE A;  3P8W A;  4O32 A;  1C72 A;  3VWU A;  5IMF A;  1X5C A;  3PR8 A;  3GL5 A;  4TXV A;  2IMF A;  1MDJ A;  4MJA A;  2GZY A;  2YOI A;  3GMF A;  4KE3 A;  2QGV A;  3O76 A;  2R4V A;  4NPB A;  6GSV A;  1OC3 A;  5J5N A;  3F3Q A;  3UMA A;  1R26 A;  2WJU A;  4KDY A;  4E8E A;  3R2Q A;  2YWO A;  4ULX A;  4X1U A;  3VPQ A;  3PH9 A;  2GQM A;  3UIW A;  4JBB A;  1URM A;  5KN3 A;  3N9J A;  3HJM A;  2AAW A;  4N0V A;  3FRC A;  4F0C A;  1EGR A;  3LXT A;  1PN9 A;  1YY7 A;  4HZ4 A;  4O92 A;  3LQ7 A;  4HJ2 A;  3ISO A;  3EYT A;  4GCI A;  4IVF A;  5G30 A;  2MMN A;  4MJE A;  3N5O A;  4K9Z A;  4OO4 A;  2GSR A;  2YPM A;  1A2J A;  4MCU A;  1K3Y A;  2L5L A;  3GH9 A;  2MZC A;  5KEJ A;  2BJX A;  3FYG A;  3C73 A;  2DBC A;  2CAQ A;  1EP8 A;  1FVK A;  2VM2 A;  3QFB C;  5GAP D;  1KTE A;  2GVP A;  3LYP A;  2GSQ A;  4MMM A;  3GNJ A;  3QPM A;  2F8F A;  2OAD A;  4AJ8 A;  2DIY A;  5ECI B;  1XWA A;  4TR0 A;  4OFT A;  3ZVJ A;  2X8G A;  4K8M A;  4TVE A;  3RBT A;  2BMX A;  4CHS A;  2WUL A;  3IHQ A;  2ON7 A;  1ZMA A;  3GSS A;  5D9W A;  3TJB A;  4IN0 A;  4ID0 A;  5CRE A;  2IMD A;  3EC3 A;  2YWI A;  2M46 A;  2YWM A;  5DVB A;  5DAK A;  2C0F A;  1ZYQ B;  5D9T A;  2N5F A;  1R5A A;  3UJ1 A;  3WD6 A;  1MEK A;  4K7O A;  1TOF A;  3L9S A;  2G0F A;  4XS4 B;  1F3A A;  2C3Q A;  2QKE A;  4RQX A;  4LA1 A;  5A4V A;  4I5Q A;  3EU3 A;  3PIN A;  1M2A A;  3TOT A;  3KTL A;  3DYR A;  4ZBA A;  3FR3 A;  1RQM A;  2GTU A;  2PGT A;  1U88 A;  1JZR A;  3E9J B;  3TJK A;  5ECN B;  4EXJ A;  2DJ0 A;  3MWH A;  1A8L A;  3LXZ A;  3HA9 A;  3F8U A;  3EUR A;  3DXB A;  4TR1 A;  3VLN A;  3QOU A;  2TIR A;  3UEM A;  2DJ3 A;  4MP4 A;  5KN2 A;  1A2M A;  1J08 A;  2GQK A;  2WDU A;  4WKW A;  4XTS A;  3BOA A;  1W4V A;  3FZ9 A;  1PX6 A;  3CBU A;  5CRG A;  4PQ1 A;  3IK9 A;  4HI7 A;  4F82 A;  1WMJ A;  3HCZ A;  1HQO A;  5D9V A;  1UN2 A;  1TJD A;  3ZL5 A;  5IMV A;  5CP1 A;  1O73 A;  2CX3 A;  5DQS A;  4L5O A;  3VI5 A;  3S9F A;  2MMA A;  1I9D A;  3IA1 A;  2C4J A;  3QMX A;  3H93 A;  4PNF A;  5CRH A;  4OD7 A;  4G19 A;  5JCW A;  1SKS B;  2H01 A;  4F03 A;  1GL8 A;  4L0W A;  4ZB9 A;  4OFN A;  1GTB A;  4GWR A;  1Y25 A;  3C8E A;  2VOC A;  1WWJ A;  3HVS A;  2LRC A;  2H6Z A;  4N30 A;  3TJJ A;  2KUC A;  3RPP A;  2R3X A;  4L8E A;  4OMV A;  3A2X A;  3W8J A;  3F6D A;  1TKD B;  2VLV A;  4JZQ A;  1TK5 B;  2FD3 A;  4IP1 A;  5D73 A;  2LST A;  2O87 A;  10GS A;  4BWQ A;  1ZGN A;  3KH9 A;  3HJO A;  4MDC A;  1YJ6 A;  2H6Y A;  4MJC A;  5FWG A;  4MZC A;  4PQI A;  1FOV A;  3BJ5 A;  1QUW A;  3TCO A;  2LEG A;  5HR3 A;  1WIK A;  2P5Q A;  4JE1 A;  3H1N A;  5IOW A;  4PUR A; 
#chains in the Genus database with same CATH topology
 20GS A;  1ILO A;  3IV4 A;  2LRN A;  4LMV A;  2CZ3 A;  1YDK A;  2FCH A;  4EUY A;  1DE2 A;  4DSS A;  2WZ9 A;  4FYC A;  3IHG A;  1QMV A;  2CQ9 A;  2HI7 A;  5JWR B;  4ZIJ A;  2PPT A;  2K8S A;  5EVO A;  3ZVJ D;  2CT6 A;  2M72 A;  4K2D A;  3GIX A;  4Q5N A;  2F51 A;  4POK A;  3M3M A;  3MNG A;  2R5G A;  1RW1 A;  1T4Y A;  4K2X A;  4NAX A;  4G0L A;  3A5W A;  4MLY A;  1PN0 A;  3Q18 A;  3GN3 A;  4KW6 A;  4KSO A;  3ZLP A;  1H4O A;  1T1V A;  1UA5 A;  3NZN A;  3IXR A;  1PD2 1;  2PVO C;  4Q5F A;  4WET A;  5E59 A;  3TKQ A;  1XZO A;  5HR0 A;  4Z2U A;  1M9B A;  3I43 A;  3IC4 A;  3GTU B;  2HZE B;  3EWL A;  2YV7 A;  4K7I A;  1GSS A;  1VF1 A;  3VWW A;  1TI1 A;  3F63 A;  4MNN A;  2B5X A;  4IHU A;  5DCH A;  2TRC P;  3H79 A;  1MD4 A;  1EOG A;  1GNW A;  3IRA A;  2IJY A;  2XC2 A;  4DSQ A;  3LEF A;  3DGQ A;  2K8V A;  1NW2 A;  4KDX A;  3UAR A;  4Q5Q A;  3TGZ A;  1B9X C;  2YN1 A;  2AJQ B;  4HQZ A;  4BL7 B;  5G31 A;  4FIW A;  3W6G A;  1J0F A;  3WYW A;  4NWY A;  4EDZ A;  1SKW B;  3O3T A;  1K0B A;  2E0Q A;  3DWV A;  2D2Z A;  1AQV A;  1TRW A;  5FHI A;  2JSZ A;  3P90 A;  4HSC X;  3CSH A;  2MMO A;  2E7P A;  3KM6 A;  2LJR A;  1UC7 A;  3QCP A;  3ZIV A;  5BMU A;  5A5K A;  4WF4 A;  2L6D A;  2YCD A;  3O6T A;  5HFG A;  3H4K A;  1GTU A;  4QL7 A;  3EE2 A;  4GXZ A;  5B6N A;  1KEB A;  1FW1 A;  1PFO A;  2PN8 A;  4ECC A;  4GRF A;  2H74 A;  1S3R A;  4D73 A;  3TKR A;  5DDL A;  2LS5 A;  4TR4 A;  1SK1 A;  2CVD A;  3A3T A;  1S3C A;  3A2W A;  2DIZ A;  3CSJ A;  1JLW A;  4MF6 A;  4POB A;  3GRX A;  2HXK A;  5IMZ A;  2JAC A;  3APO A;  2FLS A;  2GSS A;  2R0C A;  1U6T A;  5DJM A;  2CZ2 A;  5AGY A;  1SJZ A;  3LJR A;  3DVW A;  5EY6 A;  6GST A;  1G6W A;  4IQA A;  3D4T A;  5F06 A;  2IWT A;  4V1A g;  4HZ2 A;  3ZRE A;  4CY6 A;  2H0G A;  3BCI A;  1GUL A;  2IPA A;  3F4T A;  3F4R A;  5ECO B;  2H6X A;  3L9U A;  3WGX A;  2GQL A;  1SEN A;  2F8A A;  3GKN A;  3ZFL A;  1VF2 A;  1AUC A;  2OBK A;  1MD3 A;  2HFD A;  3IAS 2;  2I81 A;  1V98 A;  3KP9 A;  4KA0 A;  2HSH A;  1GSF A;  4H86 A;  3BD2 A;  1GWC A;  2H73 A;  2FHE A;  1Y6E A;  4IJ3 A;  2B6M A;  3GFK A;  2FA8 A;  2MBS A;  2AUV A;  1ML6 A;  3DRN A;  3W8S A;  1JZW A;  5GZZ B;  1VF4 A;  4HJM A;  1BAY A;  4G10 A;  4TXO A;  3EU4 A;  5CYY A;  2LUS A;  4IQ1 A;  2VCV A;  4HQS A;  4AF2 A;  3HVV A;  3U5R E;  1LJR A;  2VAF A;  3C7M A;  4MZW A;  4QL9 A;  2VD0 A;  4FYU A;  1FG4 A;  1O8W A;  2RUF A;  4XRD A;  5IMC A;  3VI7 A;  2VL2 C;  2WS2 A;  4ZIL A;  3US3 A;  4NHW A;  5ENU A;  4YQU A;  4AGS A;  2N5B A;  3KMO A;  4IKH A;  3KH7 A;  2H75 A;  2J23 A;  2V41 A;  4TRX A;  4EDY A;  1T00 A;  1PQN A;  1V58 A;  2JU5 A;  5H5R A;  1DSB A;  4ML1 A;  2B5E A;  3VK9 A;  1Z6M A;  4I6X A;  3MYD A;  4V1A p;  1GLP A;  1YKA A;  2A2P A;  2E2M A;  4JRR A;  1HNA A;  3TRQ A;  1X5D A;  1ABA A;  2GZP A;  1WPI A;  1TP9 A;  3FZ4 A;  2GST A;  2XBI A;  2LQO A;  2XHF A;  2TRX A;  2KLX A;  3QR6 A;  1Z7P A;  4N10 A;  5ABR A;  2NBS A;  18GS A;  2FUG 2;  4DEJ A;  3RDW A;  1G7O A;  3TKS E;  1LU4 A;  3VWX A;  5ELA A;  3M8N A;  7GSS A;  2YJ7 A;  2R2J A;  4QQ7 A;  2X8C A;  3KGK A;  2NVL A;  4RI7 A;  2RLI A;  4GQC A;  3CRU A;  5DAK B;  4TN8 A;  3E3E A;  5B8A A;  1B8X A;  1K0O A;  1YZX A;  1BX9 A;  5ECP B;  3RAZ A;  2LTK A;  1ZYN A;  1JLV A;  3VFI A;  2NPB A;  4HS1 A;  4YAP A;  2XPE A;  5D93 A;  1THO A;  2JSY A;  4OWY A;  4AJ6 A;  1Z3E A;  5IM9 A;  4WBR D;  4IEL A;  3CTF A;  4GTU A;  5JWQ B;  4IP6 A;  3D6I A;  3FR6 A;  2JAD A;  3MDK A;  4TR3 A;  5KN1 A;  2VM1 A;  1V2A A;  5A4U A;  2O8V B;  4TR1 B;  1G0T A;  4GSN A;  1BQ7 A;  3JCM L;  5AIV A;  5J3R A;  2RM5 A;  2OE3 A;  4HOJ A;  3UAP A;  1PGT A;  1XWG A;  2H0H A;  2PVQ A;  2B7J A;  3LWA A;  3QAV A;  1TW9 A;  2RUE A;  3F0I A;  1XXU A;  4POM A;  4XRA A;  3HDC A;  2EC4 A;  4G2E A;  5DBQ A;  2C0G A;  4IW9 A;  2V1M A;  3KP8 A;  5J9B A;  2I3Y A;  5J41 A;  1JFU A;  4OO5 A;  3ZMK A;  2YV9 A;  4TW5 A;  3L78 A;  4PTS A;  1A2L A;  2HT9 A;  2QC7 A;  3I69 A;  2IMI A;  1T7P B;  1YF1 A;  5C00 A;  3FY7 A;  2LJA A;  3DML A;  4EL1 A;  1YEX A;  1IYH A;  3QAG A;  4F0B A;  2CV4 A;  1ERW A;  1TU7 A;  1XWB A;  4HDE A;  1TK0 B;  4FYB A;  3RPN A;  1SL1 B;  1M3J A;  4G0I A;  6GSU A;  2C0D A;  4KGI A;  5JCU A;  2QSI A;  2AV4 A;  4G9H A;  3Q74 A;  1XFL A;  3ZIT A;  11GS A;  3ZTL A;  1EWX A;  2ALB A;  2L5O A;  2A2S A;  2ZUP A;  4WXT A;  2VCT A;  2Z9S A;  2L57 A;  3IDV A;  6GSX A;  2I1U A;  5EPF A;  3GUR A;  3TKP A;  2DJK A;  3CXG A;  2WRT A;  3GST A;  4F9Z A;  2I4A A;  1VGL A;  1AIU A;  1GTI A;  3AY8 A;  1X9S B;  3D21 A;  3M9J A;  5ECK B;  4K0N A;  4ZXG A;  2HRN A;  2IFQ A;  4J2F A;  3UOM A;  2H1B A;  1LBK A;  2B3S A;  3FR9 A;  2VD1 A;  1ERT A;  13GS A;  2KP2 A;  2YAN A;  2I9H A;  3F4S A;  2LQQ A;  4N11 A;  4A5P A;  3OR5 A;  2C3N A;  1MDI A;  1EEM A;  3E0U A;  1EEJ A;  4WBJ A;  1F9M A;  3VPT A;  4X43 A;  3CSI A;  2HNL A;  5ID2 A;  5C04 A;  3DD3 A;  1K0A A;  2C3T A;  1FAA A;  1K0M A;  1RK4 A;  4GF0 A;  2H0I A;  5AN1 A;  1R4W A;  5IO2 A;  2VLU A;  3UBK A;  4ECJ A;  3ERF A;  1DBY A;  3IBH A;  3EVI A;  3TJG A;  4K6X A;  1OE7 A;  2HRF A;  14GS A;  1F6M C;  4I2U A;  1S3D A;  4EVM A;  3IPZ A;  1NHY A;  3HHV A;  2EIQ A;  2HYX A;  3D0Z A;  4PQH A;  1TK8 B;  4I97 A;  5HFK A;  2KHP A;  3CMI A;  4V2N A;  1BED A;  3FKF A;  3GA4 A;  1OE8 A;  1OKT A;  2UZ8 A;  2YZH A;  5GAN D;  4ECI A;  5ECL B;  4KB3 A;  3ZYW A;  2P0G A;  4MA9 A;  5CRD A;  5DAL B;  4X4J A;  1EP7 A;  3GHA A;  1QGV A;  4MF5 A;  2FWG A;  1PRX A;  3HZ4 A;  4WEY A;  1A0F A;  1SU9 A;  2X64 A;  2QA2 A;  3GV1 A;  4POL A;  5L71 A;  5HFI A;  4OCE A;  3L0H A;  1GSD A;  1K0C A;  1WRY A;  4NMU A;  1B4Q A;  2OJL A;  3F9U A;  1HNB A;  2CAI A;  3GTU A;  3GX8 A;  4GSS A;  5G5F A;  2B1L A;  3FMW A;  1XG8 A;  1GP1 A;  2O85 A;  5CAX A;  4PUF C;  1A0R P;  3L9V A;  1SD9 A;  4ECB A;  5G1L A;  4DSR A;  1WP0 A;  1WOU A;  3TB2 A;  4OCF A;  2A2R A;  3KEB A;  2X49 A;  1PA3 A;  1QFN A;  4BA7 A;  2JZS A;  4BL7 A;  2WGR A;  5F0G A;  3TRP A;  1JZD A;  1SJI A;  3G9B A;  4MK3 A;  1AAZ A;  5CRW A;  3EMP A;  1B9Y C;  2OKA A;  5KOW A;  2R0P A;  4PUA A;  1NHO A;  3ME8 A;  1PMT A;  4PGT A;  4OFM A;  5H5S A;  1TXX A;  2CVK A;  5ELG A;  4IGJ A;  3F6F A;  2B1K A;  1B4P A;  3ZIJ A;  1I5G A;  2ES7 A;  1SK2 A;  2X99 A;  4HU9 A;  4LMW A;  2LV3 A;  2VCZ A;  2GLR A;  3L4N A;  2FY6 A;  5D8I A;  2WB9 A;  2VUP A;  4K1F A;  3CYN A;  4HUA A;  3HD5 A;  3R3E A;  4MH2 A;  5F8B A;  1ERU A;  2H76 A;  4YKG A;  1FOH A;  4D73 B;  3ME7 A;  4O7H A;  2R6K A;  1E2Y A;  3HKR A;  3LOR A;  5DJL A;  1GTA A;  4L5L A;  1UVZ A;  1XW6 A;  4ZBD A;  5F07 A;  4EKZ A;  1OC9 A;  2H19 A;  3GX0 A;  3LFL A;  3FHK A;  5KOX A;  2GT5 A;  2GGT A;  1XOB A;  4BVY A;  1GUM A;  5HQP A;  5IQY A;  3HXS A;  4RQR A;  1MDK A;  4JED A;  1XBS A;  3IOS A;  4I8B A;  3UVT A;  2L4Q A;  4YH2 A;  4WR5 A;  2HLS A;  4E8H A;  2M80 A;  2MYG A;  4X0X A;  1PL2 A;  1CQH A;  1U3A A;  2V32 A;  2YNX A;  5CNW A;  2NDO A;  1Z5Y E;  1M0U A;  2K6V A;  6GSS A;  2LRT A;  2OE0 A;  4USS A;  2XPD A;  4EIQ A;  3Q19 A;  1GLQ A;  2PMT A;  1DE1 A;  1TRU A;  1S3A A;  4BWS A;  3HY2 A;  4MF7 A;  2EIO A;  1FVJ A;  3DIE A;  2DLX A;  2FNO A;  2B7K A;  4KH7 A;  3FW2 A;  2O7K A;  5H5Q A;  3DEX A;  4F2I A;  4K7N A;  4ZBB A;  2H1D A;  4EO3 A;  4J56 E;  1HD2 A;  2HSM A;  4I2T A;  3VWV A;  3IC8 A;  2DJ2 A;  4TXO B;  4K0G A;  2OA7 A;  3TOU A;  3PPU A;  4CW9 A;  1GSY A;  1T8E B;  4YKF A;  2MMZ A;  3TRX A;  19GS A;  1PX7 A;  1O6J A;  1TRS A;  2YJH A;  1YQ1 A;  3IE3 A;  3A5I A;  2IIY A;  2HZF A;  2NTO A;  5ECR B;  2YZU A;  1GSQ A;  2DML A;  1SL0 B;  2C80 A;  1HYU A;  4PX1 A;  3F3R A;  1BYE A;  2GDR A;  4GQF A;  2DMM A;  1W89 A;  2BTO T;  1Z9H A;  4CDO A;  2H30 A;  1THX A;  2EIR A;  1M7T A;  2IN3 A;  5GST A;  3Q6O A;  5GSS A;  3BCK A;  1KBN A;  1OAZ A;  1Z7R A;  5LNK e;  1M2B A;  3GL3 A;  1ZZY A;  1F37 A;  5ECH B;  3WT2 A;  5KN0 A;  3M0F A;  4KND A;  1JHB A;  3GYK A;  5ECS A;  1NM3 A;  5G1K A;  3K8N A;  1EGO A;  2O89 A;  1SD8 A;  4GST A;  4EF0 A;  4LL4 B;  4ISD A;  3D4M A;  1ZOF A;  1SYR A;  4IS0 A;  4ZB6 A;  4ILF A;  2VCX A;  4BPY A;  3RHB A;  4KAE A;  5IMD A;  5HR2 A;  2PER A;  3EMX A;  4MPF A;  5AIS A;  5IIZ A;  2PWJ A;  3HJP A;  4FH8 A;  3HZ8 A;  2ZCT A;  3IR4 A;  1ACV A;  4DVC A;  5IMA A;  2V2G A;  3WGD A;  1GUH A;  5B6M A;  4EE0 A;  1G6Y A;  1M99 A;  5IOX A;  3HVX A;  2FWH A;  1TDI A;  1F2E A;  1FHE A;  2B5Y A;  3FEU A;  3TKS C;  1SJ6 A;  1ST9 A;  4XIH A;  4K5S A;  2C0E A;  3QD9 A;  1O7U A;  6GSW A;  5A4W A;  3J7Y k;  5LCZ A;  4XS4 A;  3G7Y A;  5D96 A;  4MZB A;  4XS6 A;  3WGE A;  1R5P A;  3ED3 A;  4NV5 A;  1OKD A;  1J9B A;  4N0Z A;  1R7H A;  2IME A;  1X5E A;  2AYT A;  1FO5 A;  2GS3 A;  4WF5 A;  3D5J A;  4Z2T A;  4O5U A;  3P7X A;  4TKY A;  1Q4J A;  3D22 A;  3CTG A;  2H8L A;  3C1S A;  2DKI A;  2OAC A;  5IO0 A;  4LLR A;  2P31 A;  3APS A;  2PBJ A;  3HYP A;  5AIX A;  2ZNM A;  1OYJ A;  3U6V A;  4KCA A;  4AJ7 A;  4WR4 A;  1GNE A;  2VL9 A;  4JR4 A;  2C8U A;  1ZL9 A;  1O8X A;  1X9W B;  6GSY A;  1V57 A;  4O5R A;  4G0K A;  1XWC A;  1TTZ A;  3PGT A;  5IPH A;  3KIJ A;  4V2M A;  3BBY A;  1K0D A;  4KDU A;  2P5R A;  4BVX A;  1AQX A;  1X0R A;  2X8H A;  1CQG A;  3MSZ A;  3M1G A;  1F3B A;  3ZRD A;  4ZL7 A;  2R37 A;  2N5A A;  4RUV A;  1EV9 A;  1OC8 A;  3KMN A;  1WE0 A;  1ON4 A;  4XCS A;  4L0U A;  1BJX A;  3EIN A;  3UBL A;  2DKH A;  1ZYE A;  2DSA A;  3TDG A;  4YAV A;  1PL1 A;  4JR6 A;  3LG6 A;  1FB0 A;  3QDN A;  4KCE A;  5BRT A;  1YEP A;  2XBQ A;  3M9K A;  5B8B A;  2L6C A;  2DC5 A;  2LNS A;  4TOP A;  1YKC A;  1USB A;  2MBT A;  2KP1 A;  1WJK A;  1SKR B;  3J7Y b;  1XIY A;  3C71 A;  1PKW A;  3LW9 A;  1E6B A;  1GSU A;  2F9S A;  4KSM A;  1M2D A;  5COH A;  3G7I A;  2VCQ A;  5FT3 A;  4MJB A;  4YQM A;  4ML6 A;  4NHZ A;  1EV4 A;  1O85 A;  5LD0 A;  5F05 A;  1ZYP A;  2WCI A;  5EL8 A;  4O5Q A;  5DCG A;  3KCM A;  4PXO A;  2OE1 A;  5JCG A;  2IFQ B;  2IMK A;  2LKU A;  2VL2 A;  2H70 A;  3HVN A;  12GS A;  5G5E A;  3V1W A;  4JU5 A;  2VL3 A;  1X9M B;  1QXH A;  5E4W A;  4EC0 A;  5HR1 A;  2K9F A;  3ZFB A;  2H1G A;  4XHM A;  1TRV A;  4YQV A;  1KNG A;  3UL3 A;  1B48 A;  3ZML A;  1ERV A;  5ID2 B;  1Q98 A;  4HEA 2;  2C1Y A;  3NIV A;  2JZR A;  2YWN A;  2FWF A;  2K18 A;  1K3L A;  2YP6 A;  1AXD A;  2ON5 A;  4P3Y B;  4DSS B;  3TUE A;  2FA4 A;  1BG5 A;  3KZQ A;  3QFA C;  3IK7 A;  1YF0 A;  2R0G A;  1N2A A;  4IJI A;  1A24 A;  4Z2R A;  2A4V A;  1PKZ A;  2H71 A;  1QK8 A;  2PU9 C;  1AC1 A;  4ACS A;  2G2Q A;  2JZT A;  1SK0 A;  2LNT A;  1XOA A;  3ERG A;  3RHC A;  3FK8 A;  3ZZX A;  1TU8 A;  1K3O A;  3KJY A;  1M9A A;  4MAB A;  1HNC A;  1EOH A;  3TKS A;  5DQY A;  3G7J A;  3EPT A;  9GSS A;  5ECM B;  1OVN A;  5DAL A;  1GUK A;  1GH2 A;  1A23 A;  5J4U A;  2V6K A;  1O81 A;  1GRX A;  2KOK A;  2VLT A;  1H75 A;  1XW5 A;  2VCW A;  3KTB A;  3IAM 2;  2H66 A;  3FZ5 A;  2HZE A;  4ZL8 A;  3GKK A;  4ICY A;  1JZO A;  1TI3 A;  1XCC A;  4IBP A;  4KX4 A;  4BIK A;  1MTC A;  2LJK A;  5JWO B;  3APQ A;  5IPG A;  4PNG A;  2IL3 A;  2HSY A;  17GS A;  2L4C A;  3GUS A;  2VO4 A;  2AHE A;  2FWE A;  2X4A A;  2GT6 A;  1FB6 A;  2VIM A;  4XS1 A;  4V2L A;  8GSS A;  3DKS A;  2JL4 A;  2RII A;  3ERW A;  2OBI A;  3H8Q A;  1V9W A;  2L59 A;  3LGC A;  1ZCP A;  2REM A;  2QA1 A;  4Q5R A;  2V6O A;  1VRS D;  1Z6N A;  1XPV A;  1XVW A;  3I9V 2;  1PSQ A;  4MH3 A;  3C1R A;  3GKX A;  2H1A A;  2DJJ A;  2WFC A;  1SL2 B;  1VF3 A;  3MAK A;  4KUN A;  2F3M A;  1DUG A;  5B7C A;  1N8J A;  5J9C A;  1XVQ A;  3TJF A;  3A2V A;  4FQU A;  4NXI A;  2AB6 A;  1T3B A;  4NV2 A;  4ZB8 A;  1NSW A;  4HU7 A;  3LSZ A;  4Z7X A;  1T4Z A;  3P2A A;  4GLT A;  1U87 A;  2HE3 A;  5ECQ B;  4FO5 A;  3GKM A;  1QQ2 A;  3KD0 A;  3KXO A;  2H72 A;  3NOF A;  2PUK C;  1EZK A;  1AW9 A;  4MPG A;  4J57 E;  3SBC A;  4RI6 A;  1K0N A;  1G7E A;  3QAW A;  22GS A;  3LYK A;  1U3I A;  4ZL9 A;  1XWK A;  3DVX A;  1XW9 A;  2J9H A;  3GH6 A;  1OC9 B;  3UVH A;  2CA8 A;  2HRA A;  3WT1 A;  5INY A;  5CO3 A;  4BVY B;  1SYX A;  3SWL A;  1IYI A;  2E2G A;  2RM6 A;  2DJ1 A;  4LL1 B;  3VUR A;  2CX4 A;  5D9X A;  2GZZ A;  3CRT A;  1A8Y A;  2FGX A;  1V40 A;  3I6A A;  5G2Z A;  2CVB A;  1AQW A;  16GS A;  3FZA A;  1GSE A;  3P8W A;  4O32 A;  1C72 A;  3VWU A;  5IMF A;  1X5C A;  3PR8 A;  3GL5 A;  4TXV A;  2IMF A;  1MDJ A;  4MJA A;  2GZY A;  2YOI A;  3GMF A;  4KE3 A;  2QGV A;  3O76 A;  2R4V A;  4NPB A;  6GSV A;  1OC3 A;  5J5N A;  3F3Q A;  3UMA A;  1R26 A;  2WJU A;  4KDY A;  4E8E A;  3R2Q A;  2YWO A;  4ULX A;  4X1U A;  3VPQ A;  3PH9 A;  2GQM A;  3UIW A;  4JBB A;  1URM A;  4CY8 A;  5KN3 A;  3N9J A;  3HJM A;  2AAW A;  4N0V A;  3FRC A;  4F0C A;  1EGR A;  3LXT A;  1PN9 A;  1YY7 A;  4HZ4 A;  4O92 A;  3LQ7 A;  4HJ2 A;  3ISO A;  3EYT A;  4GCI A;  4IVF A;  5G30 A;  2MMN A;  4MJE A;  3N5O A;  4K9Z A;  4OO4 A;  2GSR A;  2YPM A;  1A2J A;  4MCU A;  1K3Y A;  2L5L A;  3GH9 A;  2MZC A;  5KEJ A;  1M3I A;  2BJX A;  3FYG A;  3C73 A;  2DBC A;  2CAQ A;  1EP8 A;  1FVK A;  2VM2 A;  3QFB C;  5GAP D;  1KTE A;  2GVP A;  3LYP A;  2GSQ A;  4MMM A;  3GNJ A;  3QPM A;  2F8F A;  2OAD A;  4AJ8 A;  2DIY A;  5ECI B;  1XWA A;  4TR0 A;  4OFT A;  3ZVJ A;  2X8G A;  4K8M A;  4TVE A;  3RBT A;  2BMX A;  4CHS A;  2WUL A;  3IHQ A;  2ON7 A;  1ZMA A;  3GSS A;  5D9W A;  3TJB A;  4IN0 A;  4ID0 A;  5CRE A;  2IMD A;  3EC3 A;  2YWI A;  2M46 A;  2YWM A;  5DVB A;  5DAK A;  2C0F A;  1ZYQ B;  5D9T A;  2N5F A;  1R5A A;  3UJ1 A;  3WD6 A;  1MEK A;  4K7O A;  1TOF A;  3MIX A;  3L9S A;  2G0F A;  4XS4 B;  1F3A A;  2C3Q A;  2QKE A;  4RQX A;  4LA1 A;  5A4V A;  4I5Q A;  4EIP A;  3EU3 A;  3PIN A;  1M2A A;  3TOT A;  3KTL A;  3DYR A;  4ZBA A;  3FR3 A;  1RQM A;  2GTU A;  2PGT A;  1U88 A;  1JZR A;  3E9J B;  3TJK A;  5ECN B;  4EXJ A;  2DJ0 A;  3MWH A;  1A8L A;  3LXZ A;  3HA9 A;  3F8U A;  3EUR A;  3DXB A;  4TR1 A;  3VLN A;  3QOU A;  2TIR A;  3UEM A;  2DJ3 A;  4MP4 A;  5KN2 A;  1A2M A;  1J08 A;  2GQK A;  4K5R A;  3CQF A;  2WDU A;  4WKW A;  4XTS A;  3BOA A;  1W4V A;  4BVX B;  3FZ9 A;  1PX6 A;  3CBU A;  5CRG A;  4PQ1 A;  3IK9 A;  4HI7 A;  4F82 A;  1WMJ A;  3HCZ A;  1HQO A;  5D9V A;  1UN2 A;  1TJD A;  3ZL5 A;  5IMV A;  5CP1 A;  1O73 A;  2CX3 A;  5DQS A;  4L5O A;  3VI5 A;  3S9F A;  2MMA A;  1I9D A;  3IA1 A;  2C4J A;  3QMX A;  3H93 A;  4PNF A;  5CRH A;  4OD7 A;  4G19 A;  5JCW A;  1SKS B;  2A4H A;  2H01 A;  4F03 A;  1GL8 A;  4L0W A;  4ZB9 A;  4KF9 A;  4OFN A;  1GTB A;  4GWR A;  1Y25 A;  3C8E A;  2VOC A;  1WWJ A;  3HVS A;  2LRC A;  2H6Z A;  4N30 A;  3TJJ A;  2KUC A;  3RPP A;  2R3X A;  4L8E A;  4OMV A;  3A2X A;  3W8J A;  3F6D A;  1TKD B;  2VLV A;  4JZQ A;  1TK5 B;  2FD3 A;  4IP1 A;  5D73 A;  2LST A;  2O87 A;  10GS A;  4BWQ A;  1ZGN A;  3KH9 A;  3HJO A;  4MDC A;  2HRK A;  1YJ6 A;  2H6Y A;  4MJC A;  5FWG A;  4MZC A;  4PQI A;  1FOV A;  3BJ5 A;  1QUW A;  3TCO A;  2LEG A;  5HR3 A;  1WIK A;  2P5Q A;  4JE1 A;  3H1N A;  5IOW A;  4PUR A; 
#chains in the Genus database with same CATH homology
 20GS A;  1ILO A;  3IV4 A;  2LRN A;  4LMV A;  2CZ3 A;  1YDK A;  2FCH A;  4EUY A;  1DE2 A;  4DSS A;  2WZ9 A;  4FYC A;  3IHG A;  1QMV A;  2CQ9 A;  2HI7 A;  5JWR B;  4ZIJ A;  2PPT A;  2K8S A;  5EVO A;  3ZVJ D;  2CT6 A;  2M72 A;  4K2D A;  3GIX A;  4Q5N A;  2F51 A;  4POK A;  3M3M A;  3MNG A;  2R5G A;  1RW1 A;  1T4Y A;  4K2X A;  4NAX A;  4G0L A;  3A5W A;  4MLY A;  1PN0 A;  3Q18 A;  3GN3 A;  4KW6 A;  4KSO A;  3ZLP A;  1H4O A;  1T1V A;  1UA5 A;  3NZN A;  3IXR A;  1PD2 1;  2PVO C;  4Q5F A;  4WET A;  5E59 A;  3TKQ A;  1XZO A;  5HR0 A;  4Z2U A;  1M9B A;  3I43 A;  3IC4 A;  3GTU B;  2HZE B;  3EWL A;  2YV7 A;  4K7I A;  1GSS A;  1VF1 A;  3VWW A;  1TI1 A;  3F63 A;  4MNN A;  2B5X A;  4IHU A;  5DCH A;  2TRC P;  3H79 A;  1MD4 A;  1EOG A;  1GNW A;  3IRA A;  2IJY A;  2XC2 A;  4DSQ A;  3LEF A;  3DGQ A;  2K8V A;  1NW2 A;  4KDX A;  3UAR A;  4Q5Q A;  3TGZ A;  1B9X C;  2YN1 A;  2AJQ B;  4HQZ A;  4BL7 B;  5G31 A;  4FIW A;  3W6G A;  1J0F A;  3WYW A;  4NWY A;  4EDZ A;  1SKW B;  3O3T A;  1K0B A;  2E0Q A;  3DWV A;  2D2Z A;  1AQV A;  1TRW A;  5FHI A;  2JSZ A;  3P90 A;  3CSH A;  2MMO A;  2E7P A;  3KM6 A;  2LJR A;  1UC7 A;  3QCP A;  3ZIV A;  5BMU A;  5A5K A;  4WF4 A;  2L6D A;  2YCD A;  3O6T A;  5HFG A;  3H4K A;  1GTU A;  4QL7 A;  3EE2 A;  4GXZ A;  5B6N A;  1KEB A;  1FW1 A;  2PN8 A;  4ECC A;  4GRF A;  2H74 A;  4D73 A;  3TKR A;  5DDL A;  2LS5 A;  4TR4 A;  1SK1 A;  2CVD A;  3A3T A;  1S3C A;  3A2W A;  2DIZ A;  3CSJ A;  1JLW A;  4MF6 A;  4POB A;  3GRX A;  2HXK A;  5IMZ A;  2JAC A;  3APO A;  2FLS A;  2GSS A;  2R0C A;  1U6T A;  5DJM A;  2CZ2 A;  5AGY A;  1SJZ A;  3LJR A;  3DVW A;  5EY6 A;  6GST A;  1G6W A;  4IQA A;  3D4T A;  5F06 A;  2IWT A;  4V1A g;  4HZ2 A;  3ZRE A;  4CY6 A;  2H0G A;  3BCI A;  1GUL A;  2IPA A;  3F4T A;  3F4R A;  5ECO B;  2H6X A;  3L9U A;  3WGX A;  2GQL A;  1SEN A;  2F8A A;  3GKN A;  3ZFL A;  1VF2 A;  1AUC A;  2OBK A;  1MD3 A;  2HFD A;  3IAS 2;  2I81 A;  1V98 A;  3KP9 A;  4KA0 A;  2HSH A;  1GSF A;  4H86 A;  3BD2 A;  1GWC A;  2H73 A;  2FHE A;  1Y6E A;  4IJ3 A;  2B6M A;  3GFK A;  2FA8 A;  2MBS A;  2AUV A;  1ML6 A;  3DRN A;  3W8S A;  1JZW A;  5GZZ B;  1VF4 A;  4HJM A;  1BAY A;  4G10 A;  4TXO A;  3EU4 A;  5CYY A;  2LUS A;  4IQ1 A;  2VCV A;  4HQS A;  4AF2 A;  3HVV A;  3U5R E;  1LJR A;  2VAF A;  3C7M A;  4MZW A;  4QL9 A;  2VD0 A;  4FYU A;  1FG4 A;  1O8W A;  2RUF A;  4XRD A;  5IMC A;  3VI7 A;  2VL2 C;  2WS2 A;  4ZIL A;  3US3 A;  4NHW A;  5ENU A;  4YQU A;  4AGS A;  2N5B A;  3KMO A;  4IKH A;  3KH7 A;  2H75 A;  2J23 A;  2V41 A;  4TRX A;  4EDY A;  1T00 A;  1PQN A;  1V58 A;  2JU5 A;  5H5R A;  1DSB A;  4ML1 A;  2B5E A;  3VK9 A;  1Z6M A;  4I6X A;  3MYD A;  4V1A p;  1GLP A;  1YKA A;  2A2P A;  2E2M A;  4JRR A;  1HNA A;  3TRQ A;  1X5D A;  1ABA A;  2GZP A;  1WPI A;  1TP9 A;  3FZ4 A;  2GST A;  2XBI A;  2LQO A;  2XHF A;  2TRX A;  2KLX A;  3QR6 A;  1Z7P A;  4N10 A;  5ABR A;  2NBS A;  18GS A;  2FUG 2;  4DEJ A;  3RDW A;  1G7O A;  3TKS E;  1LU4 A;  3VWX A;  5ELA A;  3M8N A;  7GSS A;  2YJ7 A;  2R2J A;  4QQ7 A;  2X8C A;  3KGK A;  2NVL A;  4RI7 A;  2RLI A;  4GQC A;  3CRU A;  5DAK B;  4TN8 A;  3E3E A;  5B8A A;  1B8X A;  1K0O A;  1YZX A;  1BX9 A;  5ECP B;  3RAZ A;  2LTK A;  1ZYN A;  1JLV A;  3VFI A;  2NPB A;  4HS1 A;  4YAP A;  2XPE A;  5D93 A;  1THO A;  2JSY A;  4OWY A;  4AJ6 A;  1Z3E A;  5IM9 A;  4WBR D;  4IEL A;  3CTF A;  4GTU A;  5JWQ B;  4IP6 A;  3D6I A;  3FR6 A;  2JAD A;  3MDK A;  4TR3 A;  5KN1 A;  2VM1 A;  1V2A A;  5A4U A;  2O8V B;  4TR1 B;  1G0T A;  4GSN A;  1BQ7 A;  3JCM L;  5AIV A;  5J3R A;  2RM5 A;  2OE3 A;  4HOJ A;  3UAP A;  1PGT A;  1XWG A;  2H0H A;  2PVQ A;  2B7J A;  3LWA A;  3QAV A;  1TW9 A;  2RUE A;  3F0I A;  1XXU A;  4POM A;  4XRA A;  3HDC A;  2EC4 A;  4G2E A;  5DBQ A;  2C0G A;  4IW9 A;  2V1M A;  3KP8 A;  5J9B A;  2I3Y A;  5J41 A;  1JFU A;  4OO5 A;  3ZMK A;  2YV9 A;  4TW5 A;  3L78 A;  4PTS A;  1A2L A;  2HT9 A;  2QC7 A;  3I69 A;  2IMI A;  1T7P B;  1YF1 A;  5C00 A;  3FY7 A;  2LJA A;  3DML A;  4EL1 A;  1YEX A;  1IYH A;  3QAG A;  4F0B A;  2CV4 A;  1ERW A;  1TU7 A;  1XWB A;  4HDE A;  1TK0 B;  4FYB A;  3RPN A;  1SL1 B;  4G0I A;  6GSU A;  2C0D A;  4KGI A;  5JCU A;  2QSI A;  2AV4 A;  4G9H A;  3Q74 A;  1XFL A;  3ZIT A;  11GS A;  3ZTL A;  1EWX A;  2ALB A;  2L5O A;  2A2S A;  2ZUP A;  4WXT A;  2VCT A;  2Z9S A;  2L57 A;  3IDV A;  6GSX A;  2I1U A;  5EPF A;  3GUR A;  3TKP A;  2DJK A;  3CXG A;  2WRT A;  3GST A;  4F9Z A;  2I4A A;  1VGL A;  1AIU A;  1GTI A;  3AY8 A;  1X9S B;  3D21 A;  3M9J A;  5ECK B;  4K0N A;  4ZXG A;  2HRN A;  2IFQ A;  4J2F A;  3UOM A;  2H1B A;  1LBK A;  2B3S A;  3FR9 A;  2VD1 A;  1ERT A;  13GS A;  2KP2 A;  2YAN A;  2I9H A;  3F4S A;  2LQQ A;  4N11 A;  4A5P A;  3OR5 A;  2C3N A;  1MDI A;  1EEM A;  3E0U A;  1EEJ A;  4WBJ A;  1F9M A;  3VPT A;  4X43 A;  3CSI A;  2HNL A;  5ID2 A;  5C04 A;  3DD3 A;  1K0A A;  2C3T A;  1FAA A;  1K0M A;  1RK4 A;  4GF0 A;  2H0I A;  5AN1 A;  1R4W A;  5IO2 A;  2VLU A;  3UBK A;  4ECJ A;  3ERF A;  1DBY A;  3IBH A;  3EVI A;  3TJG A;  4K6X A;  1OE7 A;  2HRF A;  14GS A;  1F6M C;  4I2U A;  1S3D A;  4EVM A;  3IPZ A;  1NHY A;  3HHV A;  2EIQ A;  2HYX A;  3D0Z A;  4PQH A;  1TK8 B;  4I97 A;  5HFK A;  2KHP A;  3CMI A;  4V2N A;  1BED A;  3FKF A;  3GA4 A;  1OE8 A;  1OKT A;  2UZ8 A;  2YZH A;  5GAN D;  4ECI A;  5ECL B;  4KB3 A;  3ZYW A;  2P0G A;  4MA9 A;  5CRD A;  5DAL B;  4X4J A;  1EP7 A;  3GHA A;  1QGV A;  4MF5 A;  2FWG A;  1PRX A;  3HZ4 A;  4WEY A;  1A0F A;  1SU9 A;  2X64 A;  2QA2 A;  3GV1 A;  4POL A;  5L71 A;  5HFI A;  4OCE A;  3L0H A;  1GSD A;  1K0C A;  1WRY A;  4NMU A;  1B4Q A;  2OJL A;  3F9U A;  1HNB A;  2CAI A;  3GTU A;  3GX8 A;  4GSS A;  5G5F A;  2B1L A;  3FMW A;  1GP1 A;  2O85 A;  5CAX A;  4PUF C;  1A0R P;  3L9V A;  1SD9 A;  4ECB A;  5G1L A;  4DSR A;  1WP0 A;  1WOU A;  3TB2 A;  4OCF A;  2A2R A;  3KEB A;  2X49 A;  1PA3 A;  1QFN A;  4BA7 A;  2JZS A;  4BL7 A;  2WGR A;  5F0G A;  3TRP A;  1JZD A;  1SJI A;  3G9B A;  4MK3 A;  1AAZ A;  5CRW A;  3EMP A;  1B9Y C;  2OKA A;  5KOW A;  2R0P A;  4PUA A;  1NHO A;  3ME8 A;  1PMT A;  4PGT A;  4OFM A;  5H5S A;  1TXX A;  2CVK A;  5ELG A;  4IGJ A;  3F6F A;  2B1K A;  1B4P A;  3ZIJ A;  1I5G A;  2ES7 A;  1SK2 A;  2X99 A;  4HU9 A;  4LMW A;  2LV3 A;  2VCZ A;  2GLR A;  3L4N A;  2FY6 A;  5D8I A;  2WB9 A;  2VUP A;  4K1F A;  3CYN A;  4HUA A;  3HD5 A;  3R3E A;  4MH2 A;  5F8B A;  1ERU A;  2H76 A;  4YKG A;  1FOH A;  4D73 B;  3ME7 A;  4O7H A;  2R6K A;  1E2Y A;  3HKR A;  3LOR A;  5DJL A;  1GTA A;  4L5L A;  1UVZ A;  1XW6 A;  4ZBD A;  5F07 A;  4EKZ A;  1OC9 A;  2H19 A;  3GX0 A;  3LFL A;  3FHK A;  5KOX A;  2GT5 A;  2GGT A;  1XOB A;  4BVY A;  1GUM A;  5HQP A;  5IQY A;  3HXS A;  4RQR A;  1MDK A;  4JED A;  1XBS A;  3IOS A;  4I8B A;  3UVT A;  2L4Q A;  4YH2 A;  4WR5 A;  2HLS A;  4E8H A;  2M80 A;  2MYG A;  4X0X A;  1PL2 A;  1CQH A;  1U3A A;  2V32 A;  2YNX A;  5CNW A;  2NDO A;  1Z5Y E;  1M0U A;  2K6V A;  6GSS A;  2LRT A;  2OE0 A;  4USS A;  2XPD A;  4EIQ A;  3Q19 A;  1GLQ A;  2PMT A;  1DE1 A;  1TRU A;  1S3A A;  4BWS A;  3HY2 A;  4MF7 A;  2EIO A;  1FVJ A;  3DIE A;  2DLX A;  2FNO A;  2B7K A;  4KH7 A;  3FW2 A;  2O7K A;  5H5Q A;  3DEX A;  4F2I A;  4K7N A;  4ZBB A;  2H1D A;  4EO3 A;  4J56 E;  1HD2 A;  2HSM A;  4I2T A;  3VWV A;  3IC8 A;  2DJ2 A;  4TXO B;  4K0G A;  2OA7 A;  3TOU A;  3PPU A;  4CW9 A;  1GSY A;  1T8E B;  4YKF A;  2MMZ A;  3TRX A;  19GS A;  1PX7 A;  1O6J A;  1TRS A;  2YJH A;  1YQ1 A;  3IE3 A;  3A5I A;  2IIY A;  2HZF A;  2NTO A;  5ECR B;  2YZU A;  1GSQ A;  2DML A;  1SL0 B;  2C80 A;  1HYU A;  4PX1 A;  3F3R A;  1BYE A;  2GDR A;  4GQF A;  2DMM A;  1W89 A;  2BTO T;  1Z9H A;  4CDO A;  2H30 A;  1THX A;  2EIR A;  1M7T A;  2IN3 A;  5GST A;  3Q6O A;  5GSS A;  3BCK A;  1KBN A;  1OAZ A;  1Z7R A;  5LNK e;  1M2B A;  3GL3 A;  1ZZY A;  1F37 A;  5ECH B;  3WT2 A;  5KN0 A;  3M0F A;  4KND A;  1JHB A;  3GYK A;  5ECS A;  1NM3 A;  5G1K A;  3K8N A;  1EGO A;  2O89 A;  1SD8 A;  4GST A;  4EF0 A;  4LL4 B;  4ISD A;  3D4M A;  1ZOF A;  1SYR A;  4IS0 A;  4ZB6 A;  4ILF A;  2VCX A;  4BPY A;  3RHB A;  4KAE A;  5IMD A;  5HR2 A;  2PER A;  3EMX A;  4MPF A;  5AIS A;  5IIZ A;  2PWJ A;  3HJP A;  4FH8 A;  3HZ8 A;  2ZCT A;  3IR4 A;  1ACV A;  4DVC A;  5IMA A;  2V2G A;  3WGD A;  1GUH A;  5B6M A;  4EE0 A;  1G6Y A;  1M99 A;  5IOX A;  3HVX A;  2FWH A;  1TDI A;  1F2E A;  1FHE A;  2B5Y A;  3FEU A;  3TKS C;  1SJ6 A;  1ST9 A;  4XIH A;  4K5S A;  2C0E A;  3QD9 A;  1O7U A;  6GSW A;  5A4W A;  3J7Y k;  5LCZ A;  4XS4 A;  3G7Y A;  5D96 A;  4MZB A;  4XS6 A;  3WGE A;  1R5P A;  3ED3 A;  4NV5 A;  1OKD A;  1J9B A;  4N0Z A;  1R7H A;  2IME A;  1X5E A;  2AYT A;  1FO5 A;  2GS3 A;  4WF5 A;  3D5J A;  4Z2T A;  4O5U A;  3P7X A;  4TKY A;  1Q4J A;  3D22 A;  3CTG A;  2H8L A;  3C1S A;  2DKI A;  2OAC A;  5IO0 A;  4LLR A;  2P31 A;  3APS A;  2PBJ A;  3HYP A;  5AIX A;  2ZNM A;  1OYJ A;  3U6V A;  4KCA A;  4AJ7 A;  4WR4 A;  1GNE A;  2VL9 A;  4JR4 A;  2C8U A;  1ZL9 A;  1O8X A;  1X9W B;  6GSY A;  1V57 A;  4O5R A;  4G0K A;  1XWC A;  1TTZ A;  3PGT A;  5IPH A;  3KIJ A;  4V2M A;  3BBY A;  1K0D A;  4KDU A;  2P5R A;  4BVX A;  1AQX A;  1X0R A;  2X8H A;  1CQG A;  3MSZ A;  3M1G A;  1F3B A;  3ZRD A;  4ZL7 A;  2R37 A;  2N5A A;  4RUV A;  1EV9 A;  1OC8 A;  3KMN A;  1WE0 A;  1ON4 A;  4XCS A;  4L0U A;  1BJX A;  3EIN A;  3UBL A;  2DKH A;  1ZYE A;  2DSA A;  3TDG A;  4YAV A;  1PL1 A;  4JR6 A;  3LG6 A;  1FB0 A;  3QDN A;  4KCE A;  5BRT A;  1YEP A;  2XBQ A;  3M9K A;  5B8B A;  2L6C A;  2DC5 A;  2LNS A;  4TOP A;  1YKC A;  1USB A;  2MBT A;  2KP1 A;  1WJK A;  1SKR B;  3J7Y b;  1XIY A;  3C71 A;  1PKW A;  3LW9 A;  1E6B A;  1GSU A;  2F9S A;  4KSM A;  1M2D A;  5COH A;  3G7I A;  2VCQ A;  5FT3 A;  4MJB A;  4YQM A;  4ML6 A;  4NHZ A;  1EV4 A;  1O85 A;  5LD0 A;  5F05 A;  1ZYP A;  2WCI A;  5EL8 A;  4O5Q A;  5DCG A;  3KCM A;  4PXO A;  2OE1 A;  5JCG A;  2IFQ B;  2IMK A;  2LKU A;  2VL2 A;  2H70 A;  12GS A;  5G5E A;  3V1W A;  4JU5 A;  2VL3 A;  1X9M B;  1QXH A;  5E4W A;  4EC0 A;  5HR1 A;  2K9F A;  3ZFB A;  2H1G A;  4XHM A;  1TRV A;  4YQV A;  1KNG A;  3UL3 A;  1B48 A;  3ZML A;  1ERV A;  5ID2 B;  1Q98 A;  4HEA 2;  2C1Y A;  3NIV A;  2JZR A;  2YWN A;  2FWF A;  2K18 A;  1K3L A;  2YP6 A;  1AXD A;  2ON5 A;  4P3Y B;  4DSS B;  3TUE A;  2FA4 A;  1BG5 A;  3KZQ A;  3QFA C;  3IK7 A;  1YF0 A;  2R0G A;  1N2A A;  4IJI A;  1A24 A;  4Z2R A;  2A4V A;  1PKZ A;  2H71 A;  1QK8 A;  2PU9 C;  1AC1 A;  4ACS A;  2G2Q A;  2JZT A;  1SK0 A;  2LNT A;  1XOA A;  3ERG A;  3RHC A;  3FK8 A;  3ZZX A;  1TU8 A;  1K3O A;  3KJY A;  1M9A A;  4MAB A;  1HNC A;  1EOH A;  3TKS A;  5DQY A;  3G7J A;  3EPT A;  9GSS A;  5ECM B;  1OVN A;  5DAL A;  1GUK A;  1GH2 A;  1A23 A;  5J4U A;  2V6K A;  1O81 A;  1GRX A;  2KOK A;  2VLT A;  1H75 A;  1XW5 A;  2VCW A;  3KTB A;  3IAM 2;  2H66 A;  3FZ5 A;  2HZE A;  4ZL8 A;  3GKK A;  4ICY A;  1JZO A;  1TI3 A;  1XCC A;  4IBP A;  4KX4 A;  1MTC A;  2LJK A;  5JWO B;  3APQ A;  5IPG A;  4PNG A;  2IL3 A;  2HSY A;  17GS A;  2L4C A;  3GUS A;  2VO4 A;  2AHE A;  2FWE A;  2X4A A;  2GT6 A;  1FB6 A;  2VIM A;  4XS1 A;  4V2L A;  8GSS A;  3DKS A;  2JL4 A;  2RII A;  3ERW A;  2OBI A;  3H8Q A;  1V9W A;  2L59 A;  3LGC A;  1ZCP A;  2REM A;  2QA1 A;  4Q5R A;  2V6O A;  1VRS D;  1Z6N A;  1XPV A;  1XVW A;  3I9V 2;  1PSQ A;  4MH3 A;  3C1R A;  3GKX A;  2H1A A;  2DJJ A;  2WFC A;  1SL2 B;  1VF3 A;  3MAK A;  4KUN A;  2F3M A;  1DUG A;  5B7C A;  1N8J A;  5J9C A;  1XVQ A;  3TJF A;  3A2V A;  4FQU A;  4NXI A;  2AB6 A;  1T3B A;  4NV2 A;  4ZB8 A;  1NSW A;  4HU7 A;  3LSZ A;  4Z7X A;  1T4Z A;  3P2A A;  4GLT A;  1U87 A;  2HE3 A;  5ECQ B;  4FO5 A;  3GKM A;  1QQ2 A;  3KD0 A;  3KXO A;  2H72 A;  3NOF A;  2PUK C;  1EZK A;  1AW9 A;  4MPG A;  4J57 E;  3SBC A;  4RI6 A;  1K0N A;  1G7E A;  3QAW A;  22GS A;  3LYK A;  1U3I A;  4ZL9 A;  1XWK A;  3DVX A;  1XW9 A;  2J9H A;  3GH6 A;  1OC9 B;  3UVH A;  2CA8 A;  2HRA A;  3WT1 A;  5INY A;  5CO3 A;  4BVY B;  1SYX A;  3SWL A;  1IYI A;  2E2G A;  2RM6 A;  2DJ1 A;  4LL1 B;  3VUR A;  2CX4 A;  5D9X A;  2GZZ A;  3CRT A;  1A8Y A;  2FGX A;  1V40 A;  3I6A A;  5G2Z A;  2CVB A;  1AQW A;  16GS A;  3FZA A;  1GSE A;  3P8W A;  4O32 A;  1C72 A;  3VWU A;  5IMF A;  1X5C A;  3PR8 A;  3GL5 A;  4TXV A;  2IMF A;  1MDJ A;  4MJA A;  2GZY A;  2YOI A;  3GMF A;  4KE3 A;  2QGV A;  3O76 A;  2R4V A;  4NPB A;  6GSV A;  1OC3 A;  5J5N A;  3F3Q A;  3UMA A;  1R26 A;  2WJU A;  4KDY A;  4E8E A;  3R2Q A;  2YWO A;  4ULX A;  4X1U A;  3VPQ A;  3PH9 A;  2GQM A;  3UIW A;  4JBB A;  1URM A;  4CY8 A;  5KN3 A;  3N9J A;  3HJM A;  2AAW A;  4N0V A;  3FRC A;  4F0C A;  1EGR A;  3LXT A;  1PN9 A;  1YY7 A;  4HZ4 A;  4O92 A;  3LQ7 A;  4HJ2 A;  3ISO A;  3EYT A;  4GCI A;  4IVF A;  5G30 A;  2MMN A;  4MJE A;  3N5O A;  4K9Z A;  4OO4 A;  2GSR A;  2YPM A;  1A2J A;  4MCU A;  1K3Y A;  2L5L A;  3GH9 A;  2MZC A;  5KEJ A;  2BJX A;  3FYG A;  3C73 A;  2DBC A;  2CAQ A;  1EP8 A;  1FVK A;  2VM2 A;  3QFB C;  5GAP D;  1KTE A;  2GVP A;  3LYP A;  2GSQ A;  4MMM A;  3GNJ A;  3QPM A;  2F8F A;  2OAD A;  4AJ8 A;  2DIY A;  5ECI B;  1XWA A;  4TR0 A;  4OFT A;  3ZVJ A;  2X8G A;  4K8M A;  4TVE A;  3RBT A;  2BMX A;  4CHS A;  2WUL A;  3IHQ A;  2ON7 A;  1ZMA A;  3GSS A;  5D9W A;  3TJB A;  4IN0 A;  4ID0 A;  5CRE A;  2IMD A;  3EC3 A;  2YWI A;  2M46 A;  2YWM A;  5DVB A;  5DAK A;  2C0F A;  1ZYQ B;  5D9T A;  2N5F A;  1R5A A;  3UJ1 A;  3WD6 A;  1MEK A;  4K7O A;  1TOF A;  3MIX A;  3L9S A;  2G0F A;  4XS4 B;  1F3A A;  2C3Q A;  2QKE A;  4RQX A;  4LA1 A;  5A4V A;  4I5Q A;  4EIP A;  3EU3 A;  3PIN A;  1M2A A;  3TOT A;  3KTL A;  3DYR A;  4ZBA A;  3FR3 A;  1RQM A;  2GTU A;  2PGT A;  1U88 A;  1JZR A;  3E9J B;  3TJK A;  5ECN B;  4EXJ A;  2DJ0 A;  3MWH A;  1A8L A;  3LXZ A;  3HA9 A;  3F8U A;  3EUR A;  3DXB A;  4TR1 A;  3VLN A;  3QOU A;  2TIR A;  3UEM A;  2DJ3 A;  4MP4 A;  5KN2 A;  1A2M A;  1J08 A;  2GQK A;  4K5R A;  2WDU A;  4WKW A;  4XTS A;  3BOA A;  1W4V A;  4BVX B;  3FZ9 A;  1PX6 A;  3CBU A;  5CRG A;  4PQ1 A;  3IK9 A;  4HI7 A;  4F82 A;  1WMJ A;  3HCZ A;  1HQO A;  5D9V A;  1UN2 A;  1TJD A;  3ZL5 A;  5IMV A;  5CP1 A;  1O73 A;  2CX3 A;  5DQS A;  4L5O A;  3VI5 A;  3S9F A;  2MMA A;  1I9D A;  3IA1 A;  2C4J A;  3QMX A;  3H93 A;  4PNF A;  5CRH A;  4OD7 A;  4G19 A;  5JCW A;  1SKS B;  2A4H A;  2H01 A;  4F03 A;  1GL8 A;  4L0W A;  4ZB9 A;  4KF9 A;  4OFN A;  1GTB A;  4GWR A;  1Y25 A;  3C8E A;  2VOC A;  1WWJ A;  3HVS A;  2LRC A;  2H6Z A;  4N30 A;  3TJJ A;  2KUC A;  3RPP A;  2R3X A;  4L8E A;  4OMV A;  3A2X A;  3W8J A;  3F6D A;  1TKD B;  2VLV A;  4JZQ A;  1TK5 B;  2FD3 A;  4IP1 A;  5D73 A;  2LST A;  2O87 A;  10GS A;  4BWQ A;  1ZGN A;  3KH9 A;  3HJO A;  4MDC A;  2HRK A;  1YJ6 A;  2H6Y A;  4MJC A;  5FWG A;  4MZC A;  4PQI A;  1FOV A;  3BJ5 A;  1QUW A;  3TCO A;  2LEG A;  5HR3 A;  1WIK A;  2P5Q A;  4JE1 A;  3H1N A;  5IOW A;  4PUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...