1O73A

Tryparedoxin from trypanosoma brucei
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
144
structure length
144
Chain Sequence
b'MSGLAKYLPGATNLLSKSGEVSLGSLVGKTVFLYFSASWCPPCRGFTPVLAEFYEKHHVAKNFEVVLISWDENESDFHDYYGKMPWLALPFDQRSTVSELGKTFGVESIPTLITINADTGAIIGTQARTRVIEDPDGANFPWPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPAREDOXIN
publication title Tryparedoxins from Crithidia Fasciculata and Trypanosoma Brucei: Photoreduction of the Redox Disulfide Using Synchrotron Radiation and Evidence for a Conformational Switch Implicated in Function
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Electron transport
total genus 45
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2002-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13905 Thioredoxin_8 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1o73A00
1OAZA 1ON4A 1AXDA 3ME8A 4TR4A 2OE3A 3TOTA 2E7PA 3A5WA 4Q5RA 3N9JA 1OE8A 2HE3A 2YV9A 1VRSD 4IGJA 3QR6A 5AISA 3IAM2 5CO3A 1JZOA 1A2MA 2OA7A 3DVWA 3IOSA 1SJIA 1J0FA 4O7HA 1ZGNA 2WCIA 1U87A 1FB0A 5C00A 4EKZA 4MH3A 3HKRA 4O32A 5D9WA 2H66A 4D73A 1GSSA 2K9FA 3KJYA 5CRHA 4XTSA 3EWLA 5HR3A 2VCTA 2C3TA 1FW1A 1ERTA 4EL1A 4H86A 3GKXA 3C73A 4ECJA 3APSA 3U6VA 3IAS2 1Z3EA 1EZKA 4I6XA 4AJ6A 2EC4A 3GA4A 1YF1A 3H8QA 4YQMA 5ECSA 2FLSA 4KA0A 1A2LA 3ZREA 3DRNA 2X8GA 3UAPA 3DKSA 1XWKA 1X5CA 1I9DA 4OD7A 1AUCA 6GSTA 2YWOA 4XS6A 2C0DA 4NPBA 5ECPB 1SKSB 3CTGA 2LQOA 5ECRB 1A0RP 1HQOA 1ZL9A 2YWIA 1OKTA 1XCCA 5ELAA 1N8JA 1GSFA 2D2ZA 3PR8A 2NPBA 1YY7A 3K8NA 1B8XA 4XS4A 3LYPA 3KH7A 4FYCA 1SYRA 3JCML 2GQLA 3TRPA 4YH2A 2VCZA 2H76A 3CMIA 4HDEA 3KEBA 2H73A 4F2IA 3D4TA 4POMA 2AV4A 2C0FA 1A2JA 2J23A 2CZ2A 2AJQB 3W6GA 1R26A 5JCGA 3KM6A 1GL8A 2XPEA 3G7JA 3BBYA 2YNXA 3LYKA 3IHQA 5F06A 3TUEA 3A2VA 4OWYA 3HXSA 3MNGA 1O8WA 5IO0A 3F9UA 4DVCA 1XFLA 3DD3A 4RI6A 3Q6OA 3WD6A 2FWEA 2V2GA 2VUPA 3M0FA 4MZCA 2JZRA 4AJ8A 2CX3A 3TKSA 2QKEA 1V2AA 1SK2A 1MD3A 3UJ1A 3RBTA 1HNAA 1M7TA 4GTUA 1WMJA 3U5RE 4G2EA 2HZFA 4TXOB 1GRXA 1JZDA 4ZB8A 4ZILA 5DVBA 3QDNA 3UL3A 2P5QA 2MMNA 1PSQA 1K0DA 4IP6A 3FW2A 3M1GA 4I2TA 2R5GA 4IELA 2OJLA 1YQ1A 2RLIA 1NHOA 3VPQA 1BAYA 1PMTA 1WPIA 1YF0A 1GLQA 3ZTLA 5IPHA 5B7CA 2HI7A 3CYNA 2PUKC 2I3YA 5IMDA 3US3A 5D73A 5CYYA 2N5AA 2E0QA 3KP8A 3GX8A 2PN8A 2DJ1A 1T00A 1T4ZA 1UC7A 4YAPA 4GSTA 1XWGA 4PURA 3KH9A 2MZCA 1V57A 1TDIA 4MP4A 5KEJA 3C7MA 4ISDA 4OO5A 1M2DA 2CVBA 5FT3A 14GSA 4F03A 1HYUA 5HFIA 2C3QA 2PVOC 1GUKA 1TK8B 4MZBA 3HJOA 4MF7A 3I9V2 2LRNA 3H1NA 1VF1A 3D0ZA 1XXUA 2RM6A 2HZEB 4WETA 4N30A 1K0OA 2LV3A 3C1RA 5JCUA 4I97A 4J2FA 5C04A 3VK9A 4AJ7A 2L6CA 1GSDA 3F4SA 5HR2A 2MMOA 1FO5A 4GSSA 1A8YA 3IBHA 4OFTA 2GSRA 2K8SA 20GSA 2WRTA 4KW6A 4NAXA 2OE1A 3S9FA 2A2RA 2VL2C 1UN2A 2R4VA 3GKKA 5DJLA 1BJXA 3QFAC 3MWHA 3FZ5A 3ZRDA 2LUSA 3EU4A 2X99A 6GSSA 1K3YA 2LNTA 4WEYA 2DMMA 2FUG2 3ZVJD 3HDCA 22GSA 1MD4A 3PGTA 4V2NA 3ERGA 3HVXA 4BPYA 2WFCA 4OFMA 4N0ZA 2DC5A 3EC3A 5D9TA 2ON5A 2REMA 4JBBA 2DIYA 4FH8A 4X0XA 1V9WA 4K7NA 1PKWA 3UOMA 1TW9A 2QC7A 3GL5A 1OC9A 2L6DA 3DXBA 2H1GA 1KEBA 4Q5FA 2NVLA 4EE0A 4MPFA 5ENUA 3IC4A 1UVZA 1V98A 4LMWA 2FD3A 4OMVA 1QMVA 2JACA 1LU4A 4ZL7A 5A5KA 3ZMLA 4IP1A 2HSYA 3C71A 1W89A 3IXRA 2YWNA 2VM1A 2BJXA 2C0EA 4MA9A 2C4JA 3Q74A 3TCOA 5ECHB 2V6KA 2C0GA 2H6YA 4LMVA 2PBJA 2VAFA 4P3YB 3VI5A 2HZEA 3IR4A 3VWVA 1OVNA 1R7HA 1WWJA 4D73B 3GFKA 3TJFA 2K18A 4F0CA 4HEA2 3P8WA 5IMVA 3BD2A 3LSZA 2IMKA 4IQAA 1JLWA 4EVMA 1IYIA 3UEMA 4K6XA 1DE1A 1BG5A 3HA9A 2JSZA 1SD9A 3FHKA 2GZZA 1AIUA 1Z6NA 2VCWA 1T8EB 1SK1A 18GSA 5L71A 3UBKA 4WKWA 1X5DA 4V1Ag 1M0UA 3QCPA 2GDRA 5H5RA 1E2YA 9GSSA 3J7Yk 4K2DA 4DSSA 2DJ2A 3IE3A 1SL0B 3IDVA 2H30A 5DBQA 5G1LA 2HRNA 3QAVA 5COHA 2HSHA 3O6TA 4TKYA 2VLVA 5G1KA 3ZL5A 1B9YC 4IBPA 1K0BA 3TOUA 2F3MA 4XS4B 2PU9C 1TXXA 4KX4A 2LNSA 3HCZA 2M80A 3F3RA 3ZIVA 1YZXA 3GSTA 4JU5A 2FWFA 4WR4A 3ZFBA 5LCZA 1RK4A 4IS0A 5F0GA 1R4WA 3SBCA 2HFDA 1ERWA 2H19A 1ZYEA 1X9MB 4EF0A 3I43A 3P2AA 1A8LA 3ZVJA 2FWHA 3BCIA 5ECOB 3P90A 1Z9HA 2TIRA 5IMZA 3G9BA 5DQYA 2RUFA 3L9UA 3W8JA 2R2JA 3GIXA 2H6ZA 1KBNA 4TR0A 1HNBA 2IMIA 2JSYA 4PXOA 3TJJA 4LL1B 2DIZA 5AIVA 1AQXA 4LA1A 1NW2A 3TGZA 4IJIA 4J57E 4ZBBA 1PX7A 1DE2A 2RM5A 3EE2A 1SU9A 1F9MA 2JL4A 1TU8A 3TRQA 5KN3A 3H93A 1WP0A 1JLVA 3CXGA 1TRUA 3TKRA 1Q4JA 5FHIA 2FNOA 3LXTA 2H71A 3FZ4A 4IVFA 1ZYQB 3W8SA 4O5RA 4G10A 3IK7A 3A2WA 2CAIA 2VIMA 1ZCPA 5ID2A 3ZFLA 5LD0A 1PA3A 1YEXA 1NM3A 2FY6A 1M9BA 2TRXA 2VCVA 4TW5A 1EGOA 2R6KA 2O89A 4EXJA 4NHZA 3EURA 1ERVA 5EPFA 3AY8A 5E4WA 3KTBA 13GSA 4HZ2A 4MDCA 4PUFC 1QGVA 2GSSA 1U6TA 1GSQA 3FR9A 1Z7RA 3TJBA 4JEDA 2PWJA 2EIOA 1O6JA 4DSQA 2IJYA 5EVOA 4BA7A 3EVIA 5IOWA 1EWXA 2DJJA 1B9XC 5CRWA 1B4PA 3J7Yb 4RI7A 2HNLA 2VCQA 4DSRA 1EEMA 2FA8A 3NIVA 1NHYA 1XPVA 4PNGA 3D21A 1B48A 3FYGA 2C80A 1XW6A 5D93A 4K7OA 4IHUA 4F9ZA 2EIRA 1E6BA 4AF2A 3FRCA 3KXOA 5B6NA 1B4QA 2GT6A 4TR3A 3MSZA 1DUGA 1U88A 2IMFA 3EINA 4IW9A 2PERA 4HQSA 1VGLA 2I81A 3GUSA 3CTFA 4J56E 2V32A 2ES7A 5A4UA 2LEGA 5IMAA 2ZUPA 1AQVA 2GZYA 4X43A 1AQWA 5CNWA 2O87A 2X8HA 1EOHA 2XPDA 3LEFA 3D4MA 1CQGA 2YCDA 4ACSA 4BWQA 4KGIA 3GHAA 2V41A 3IA1A 3MDKA 3OR5A 3WYWA 5IMCA 4WF5A 1DBYA 4HUAA 2GTUA 2H0GA 3BCKA 3F3QA 4OCFA 4MMMA 4RQXA 5A4VA 2Z9SA 3M3MA 3QD9A 2XHFA 1OC9B 3FEUA 1TRSA 1WIKA 3TKSC 1F3AA 4MK3A 1USBA 5J3RA 4KB3A 1O7UA 5B8BA 5JCWA 4RQRA 2F9SA 4QL7A 3ZYWA 1PGTA 1SYXA 4K1FA 4CHSA 3CBUA 1MTCA 5GSTA 3FZAA 1SD8A 2B6MA 1ERUA 4I8BA 2IFQB 3RDWA 2E2GA 1K3LA 1WE0A 2FGXA 4KSOA 3LWAA 4MJCA 5CREA 3LXZA 5GZZB 1YKCA 5D8IA 2DSAA 4XCSA 1Z5YE 5IPGA 4EC0A 1M2BA 1TP9A 5HFGA 3RAZA 3QOUA 2DBCA 3E0UA 4Q5NA 2X64A 5ECMB 4NV2A 2LJRA 5JWQB 1AAZA 1M9AA 4IQ1A 4GSNA 2YZHA 2B7KA 1SL1B 3C1SA 4MPGA 3WT1A 3E9JB 2O8VB 2QSIA 5JWOB 2IMDA 1I5GA 2N5FA 1GTAA 4QQ7A 1PL1A 3IPZA 2CVDA 4KAEA 4ZXGA 1TTZA 2OBIA 2LJAA 1G7OA 2WGRA 3QAGA 2KP2A 4ID0A 5H5QA 1ILOA 2HLSA 1XZOA 5JWRB 3KCMA 2J9HA 1SK0A 5D9XA 1SL2B 1BX9A 4DSSB 3FK8A 4TVEA 2YJHA 5HR0A 4QL9A 1Z7PA 6GSWA 1GSYA 4JRRA 3ZZXA 1NSWA 4GQFA 3GKNA 2B1KA 2R3XA 2H75A 2XC2A 2CX4A 1GTBA 3IV4A 2EIQA 3HHVA 1BQ7A 5IMFA 4HZ4A 2I9HA 5DAKA 1GSUA 4JR6A 3CRTA 3R2QA 4OCEA 3VWUA 2AAWA 4EDZA 1EV4A 4KNDA 4RUVA 2LSTA 5J4UA 2O85A 1QXHA 5CRDA 19GSA 3N5OA 4LLRA 3VLNA 3ME7A 1DSBA 1GH2A 4Q5QA 4NXIA 5EY6A 1S3CA 4NV5A 2IFQA 1GTIA 1X0RA 1N2AA 4XHMA 2ZNMA 1PQNA 4L0WA 4TR1A 2P0GA 2L59A 2VLUA 4KCAA 2K6VA 2NTOA 2FWGA 3HVSA 3ISOA 1S3DA 1PN9A 2GLRA 6GSUA 2JADA 3H4KA 3IRAA 3GH9A 5F05A 2H74A 4TN8A 5A4WA 3GKMA 11GSA 2HRFA 2H72A 4IN0A 4PQHA 3GSSA 3RHBA 1TRWA 5IQYA 1QQ2A 2AYTA 3L0HA 2YOIA 4WBRD 3LQ7A 2V6OA 4MABA 1OYJA 4KCEA 4PGTA 3G7IA 3GURA 4O92A 3WGDA 2H1DA 3EMXA 5DJMA 4GXZA 1GP1A 5DDLA 2OADA 1KNGA 2VCXA 4EO3A 4OO4A 5ID2B 5INYA 4HJMA 1TKDB 1ST9A 1EV9A 2ZCTA 1FG4A 5ABRA 1O73A 1TK5B 1G6WA 3O3TA 3ERWA 2GT5A 5HR1A 2MBSA 2GGTA 2ALBA 4HOJA 1QUWA 3NOFA 4N11A 1MEKA 4KE3A 1JHBA 4ECBA 2FCHA 3HVVA 1TU7A 2H1AA 4ILFA 1AC1A 3DMLA 3KTLA 5IOXA 2C8UA 3O76A 1GNEA 5DALB 4V2MA 2KOKA 3F6FA 2M46A 1THXA 4ZIJA 3M9JA 2HT9A 2LKUA 1UA5A 1EGRA 5D96A 4HU9A 8GSSA 3FR6A 4NWYA 1OC8A 3VI7A 1H75A 3UIWA 1JFUA 3LGCA 4ZB9A 1A24A 3TKQA 1T7PB 4HU7A 5D9VA 3GV1A 3FY7A 3GNJA 5IM9A 4L8EA 2LJKA 1M2AA 1K0MA 3TKPA 2X8CA 2G2QA 1T1VA 5HQPA 3QAWA 2GQKA 2MMZA 3FKFA 3CSJA 4PX1A 2BTOT 3BOAA 2K8VA 1G6YA 2C3NA 3M9KA 5J41A 5CP1A 5KN1A 3HJPA 1G7EA 4GWRA 1WJKA 4KSMA 4XRDA 2GS3A 4TOPA 3D5JA 2YJ7A 3GTUA 1R5AA 4POBA 3VFIA 1ML6A 5ECIB 1MDIA 4KDUA 2R37A 1GWCA 1MDKA 2CAQA 2VL9A 1X5EA 2LQQA 5DCGA 3M8NA 1GUHA 4CW9A 1Z6MA 1TK0B 1XWCA 4JR4A 4GRFA 3UVHA 3DGQA 2NDOA 1GULA 5EL8A 3F8UA 2CV4A 1O85A 4MLYA 1XW5A 2WS2A 3GX0A 2OBKA 4GF0A 4YQVA 3KGKA 6GSVA 4WR5A 2VOCA 1YKAA 2GVPA 4FYUA 5G5EA 2B5EA 3D22A 1ZMAA 3QFBC 1S3AA 4BWSA 5CRGA 5KN2A 4AGSA 1FVJA 1TI1A 4K0NA 2I4AA 3DEXA 4MCUA 4MJEA 2WZ9A 3RPNA 3ZLPA 2OACA 3PINA 3EYTA 4F0BA 2YN1A 1BYEA 5HFKA 4YQUA 2LS5A 3ZIJA 4ML1A 3GN3A 5DALA 3RHCA 5GAND 1FOVA 1VF3A 1Y6EA 3LJRA 2PVQA 3L9VA 1FAAA 5ECQB 2B5YA 4MF6A 5F07A 7GSSA 4TRXA 4MZWA 1F6MC 4IKHA 5KN0A 1ACVA 4FYBA 1SJ6A 4LL4B 5FWGA 1HNCA 3UARA 16GSA 2KLXA 1H4OA 1QFNA 2L5OA 1XIYA 3KZQA 3CRUA 1OC3A 2WULA 1YDKA 1GLPA 3UVTA 1HD2A 3FZ9A 1K0NA 1K0CA 2WB9A 4ZL9A 4V1Ap 5GAPD 2L5LA 1TRVA 2JZSA 3UBLA 3ZITA 2IWTA 1EP7A 3ED3A 5IIZA 3F4RA 1SJZA 2WDUA 2DJ0A 3GRXA 5F8BA 3DWVA 3A2XA 4JE1A 1EOGA 3TDGA 2HXKA 1T4YA 2GQMA 1X9SB 3TB2A 2MYGA 1K3OA 2PMTA 1Y25A 3HZ8A 4Z7XA 5B8AA 2H0HA 2L4QA 1PD21 3DYRA 1V40A 3BJ5A 2GSTA 2BMXA 2PPTA 2V1MA 2O7KA 2F51A 2WJUA 3APOA 2L57A 1W4VA 2H70A 3L78A 1JZRA 1F2EA 4WF4A 1J9BA 4G9HA 1SKWB 2GZPA 4K8MA 4N0VA 1K0AA 3VURA 5DAKB 2VM2A 3SWLA 1M99A 5IO2A 1LBKA 2AUVA 4KUNA 2ON7A 2P5RA 1O8XA 5LNKe 5ECNB 1VF4A 2XBIA 3IK9A 2B7JA 2F8AA 2H0IA 1Q98A 2VLTA 4KH7A 2VD1A 2YANA 2KHPA 3E3EA 1ZZYA 5DQSA 2QGVA 2YZUA 1JZWA 3RPPA 2CT6A 2MMAA 1THOA 2GSQA 2CQ9A 5G5FA 2VD0A 4K7IA 1XVWA 3DVXA 4TR1B 12GSA 1PX6A 4DEJA 4KDXA 4NHWA 3D6IA 4ML6A 2H6XA 3F0IA 4EDYA 3V1WA 5J5NA 2F8FA 1AW9A 1TOFA 2RIIA 3PH9A 2VL2A 2JU5A 3APQA 3L4NA 1XOAA 2RUEA 2YWMA 2H1BA 3C8EA 2IPAA 2A2SA 5G30A 1KTEA 1RW1A 3G7YA 2E2MA 2PGTA 1GSEA 1FHEA 1WOUA 3GL3A 5G2ZA 2NBSA 1TI3A 5J9CA 4MH2A 4ZBDA 4TXVA 3F63A 1YEPA 3F4TA 2HYXA 1BEDA 1XWAA 4X1UA 3ZMKA 4ZL8A 5DCHA 5B6MA 2DMLA 5AN1A 2B3SA 3I6AA 4MF5A 3KIJA 1X9WB 4FIWA 4WXTA 2FA4A 3EMPA 3A3TA 4I5QA 6GSYA 2C1YA 4V2LA 1OKDA 1U3IA 4POLA 1R5PA 5G31A 3L9SA 1SENA 17GSA 1ABAA 3I69A 3KMNA 2KP1A 4ULXA 3GH6A 2IMEA 1FVKA 4TXOA 1CQHA 1FB6A 2YV7A 4MJAA 4PQ1A 3VWXA 4E8HA 3HD5A 3QPMA 4XRAA 3P7XA 1GUMA 3TRXA 3DIEA 2VL3A 3FR3A 4JZQA 3LFLA 3HY2A 5E59A 2A4VA 1XWBA 4POKA 3LORA 3LG6A 5GSSA 3VWWA 2G0FA 2FHEA 1WRYA 4PNFA 1EEJA 3Q19A 4G19A 4BVYA 1RQMA 5AGYA 2IN3A 2YPMA 4ECIA 3F6DA 1TJDA 2H8LA 3H79A 2OE0A 1VF2A 5H5SA 5AIXA 2CZ3A 2B5XA 1U3AA 1URMA 2AHEA 3MAKA 1LJRA 4OFNA 4N10A 3KD0A 4BL7A 2CA8A 4K9ZA 1ZOFA 4HQZA 3GTUB 2IIYA 3CSIA 4ZBAA 3NZNA 2I1UA 5ELGA 4PQIA 2B1LA 5ECKB 2YP6A 1A23A 1XVQA 3WGEA 2DJ3A 4HJ2A 1F3BA 1OE7A 3EU3A 2MBTA 4CDOA 2IL3A 1IYHA 3HYPA 1C72A 1T3BA 2H01A 1GNWA 1GTUA 5CAXA 1F37A 3QMXA 1O81A 6GSXA 1EP8A 1XW9A 2KUCA 2VO4A 3HZ4A 4GLTA 3GYKA 1PRXA 2AB6A 3ERFA 4PUAA 2LRCA 3TJKA 4BVXA 2LTKA 2TRCP 1XBSA 2P31A 2CVKA 3TKSE 4XIHA 4HI7A 4I2UA 4NMUA 2DLXA 2M72A 4IJ3A 2N5BA 5J9BA 4FO5A 1MDJA 2XBQA 3HJMA 3WGXA 3KP9A 1XOBA 4GCIA 4YAVA 1J08A 1QK8A 3KMOA 2JZTA 3CSHA 3UMAA 4XS1A 1G0TA 2L4CA 5ECLB 1YJ6A 2OKAA 10GSA 2DJKA 3TJGA 3GMFA 4MJBA 4L5LA 2LRTA 4L5OA 1SKRB 1PKZA 1V58A 3Q18A 4EUYA 4WBJA 4K0GA 4F82A 4L0UA 3WT2A 4E8EA 4HS1A 1PL2A 3VPTA 4ECCA 1A0FA 4KDYA 4ZB6A 4GQCA
chains in the Genus database with same CATH superfamily
1OAZA 1ON4A 1AXDA 3PPUA 3ME8A 4TR4A 2OE3A 3TOTA 2E7PA 3A5WA 4Q5RA 3N9JA 1OE8A 2HE3A 2YV9A 1VRSD 4IGJA 3QR6A 5CO3A 3IAM2 5AISA 1JZOA 1A2MA 2OA7A 3DVWA 3IOSA 1SJIA 1J0FA 4O7HA 1ZGNA 2WCIA 1U87A 1FB0A 5C00A 4EKZA 4MH3A 3HKRA 4O32A 5D9WA 2H66A 4D73A 1GSSA 2K9FA 3KJYA 5CRHA 4XTSA 3EWLA 5HR3A 2VCTA 2C3TA 1FW1A 1ERTA 4EL1A 4H86A 3GKXA 3C73A 4ECJA 3APSA 3U6VA 3IAS2 1Z3EA 1EZKA 4USSA 4I6XA 4AJ6A 2EC4A 2A2PA 3GA4A 1YF1A 3H8QA 4YQMA 5ECSA 2FLSA 4KA0A 1A2LA 3ZREA 3DRNA 1ZYNA 2X8GA 3UAPA 3DKSA 1XWKA 1X5CA 1I9DA 4OD7A 1AUCA 6GSTA 2YWOA 4XS6A 2C0DA 4NPBA 5ECPB 1SKSB 3CTGA 2LQOA 5ECRB 1A0RP 1HQOA 1ZL9A 2YWIA 1OKTA 1XCCA 5ELAA 1N8JA 1GSFA 2D2ZA 3PR8A 2NPBA 1YY7A 3K8NA 1B8XA 4XS4A 3LYPA 3KH7A 4FYCA 1SYRA 3JCML 2GQLA 3TRPA 4YH2A 2VCZA 2H76A 3CMIA 4HDEA 3KEBA 2H73A 4F2IA 3D4TA 4POMA 2AV4A 2C0FA 1A2JA 2J23A 2CZ2A 2AJQB 3W6GA 1R26A 5JCGA 3KM6A 1GL8A 2XPEA 3G7JA 3BBYA 4BIKA 2YNXA 3LYKA 3IHQA 5F06A 3TUEA 3A2VA 1PFOA 4OWYA 3HXSA 3MNGA 1O8WA 5IO0A 3F9UA 4DVCA 1XFLA 3DD3A 4RI6A 3Q6OA 3WD6A 2FWEA 2V2GA 2VUPA 3M0FA 4MZCA 2JZRA 4AJ8A 2CX3A 3TKSA 2QKEA 1V2AA 1SK2A 1MD3A 3UJ1A 3RBTA 1HNAA 1M7TA 4GTUA 1WMJA 3U5RE 4G2EA 2HZFA 4TXOB 1GRXA 1JZDA 4ZB8A 4ZILA 5DVBA 3QDNA 3UL3A 2P5QA 2MMNA 1PSQA 1K0DA 4IP6A 3FW2A 3M1GA 4I2TA 2R5GA 4IELA 2OJLA 1YQ1A 2RLIA 1NHOA 3VPQA 1BAYA 1PMTA 2HRAA 1WPIA 1YF0A 1GLQA 3ZTLA 5IPHA 5B7CA 2HI7A 3CYNA 4BVYB 2PUKC 2I3YA 5IMDA 3US3A 5D73A 5CYYA 2N5AA 2E0QA 3KP8A 3GX8A 2PN8A 2DJ1A 1T00A 1T4ZA 1UC7A 4YAPA 4GSTA 1FOHA 1XWGA 4PURA 3KH9A 2MZCA 4BL7B 1V57A 1TDIA 4MP4A 5KEJA 3C7MA 4ISDA 4OO5A 1M2DA 2CVBA 5FT3A 14GSA 4F03A 1HYUA 5HFIA 2C3QA 2PVOC 1GUKA 1TK8B 4MZBA 3HJOA 4MF7A 3I9V2 2LRNA 3H1NA 1VF1A 3D0ZA 1XXUA 2RM6A 2HZEB 4WETA 4N30A 1K0OA 2LV3A 3C1RA 5JCUA 4I97A 2X4AA 4J2FA 5C04A 3VK9A 1PN0A 4AJ7A 2L6CA 1GSDA 3F4SA 5HR2A 4BVXB 2MMOA 1FO5A 4GSSA 1A8YA 3IBHA 4OFTA 2GSRA 2K8SA 20GSA 2WRTA 4KW6A 4NAXA 2OE1A 5BRTA 3S9FA 2A2RA 2VL2C 1UN2A 2R4VA 3GKKA 5DJLA 1BJXA 3QFAC 3MWHA 3FZ5A 3ZRDA 2LUSA 3EU4A 2X99A 3MIXA 6GSSA 1K3YA 2LNTA 4WEYA 2DMMA 2FUG2 3ZVJD 3HDCA 4EIQA 22GSA 1MD4A 4G0LA 3A5IA 3PGTA 4V2NA 3ERGA 3HVXA 4BPYA 2WFCA 4OFMA 4N0ZA 2DC5A 3EC3A 5D9TA 2ON5A 2REMA 4JBBA 2DIYA 4FH8A 4X0XA 1V9WA 4KF9A 4K7NA 1PKWA 3UOMA 1TW9A 2QC7A 3GL5A 1OC9A 2L6DA 3DXBA 2H1GA 1KEBA 4Q5FA 2NVLA 4EE0A 4MPFA 5ENUA 3IC4A 1UVZA 1V98A 4LMWA 2FD3A 4OMVA 1QMVA 2DKHA 2JACA 1LU4A 4ZL7A 5A5KA 3ZMLA 4IP1A 2HSYA 3C71A 1W89A 3IXRA 4X4JA 2YWNA 2VM1A 2BJXA 2C0EA 4MA9A 2C4JA 3Q74A 3TCOA 5ECHB 2V6KA 2C0GA 2H6YA 4LMVA 2PBJA 2VAFA 4P3YB 3VI5A 2HZEA 3IR4A 3VWVA 1OVNA 1R7HA 1WWJA 2UZ8A 4D73B 3GFKA 3TJFA 2K18A 4F0CA 4HEA2 3P8WA 5IMVA 3BD2A 3LSZA 2IMKA 4IQAA 5BMUA 1JLWA 4EVMA 1IYIA 3UEMA 4K6XA 1DE1A 1BG5A 3HA9A 2JSZA 1SD9A 3FHKA 2GZZA 1AIUA 1Z6NA 2VCWA 2QA2A 1T8EB 1SK1A 18GSA 5L71A 3UBKA 4WKWA 1X5DA 4V1Ag 1M0UA 3QCPA 2GDRA 5H5RA 1E2YA 9GSSA 3J7Yk 4K2DA 4DSSA 2DJ2A 3IE3A 1SL0B 3IC8A 3IDVA 2H30A 5DBQA 5G1LA 2HRNA 3QAVA 5COHA 2HSHA 3O6TA 4TKYA 2VLVA 5G1KA 3ZL5A 1B9YC 4IBPA 1K0BA 3TOUA 2F3MA 4XS4B 2PU9C 1TXXA 4KX4A 2LNSA 3HCZA 2M80A 3F3RA 3ZIVA 1YZXA 3GSTA 4JU5A 2FWFA 4WR4A 3ZFBA 5LCZA 1RK4A 4IS0A 5F0GA 1R4WA 3SBCA 2HFDA 1ERWA 2H19A 1ZYEA 1X9MB 4EF0A 3I43A 2QA1A 3P2AA 1A8LA 3ZVJA 2FWHA 3BCIA 5ECOB 3P90A 1Z9HA 2TIRA 5IMZA 3G9BA 5DQYA 2RUFA 3L9UA 3W8JA 2R2JA 3GIXA 2H6ZA 1KBNA 4TR0A 1HNBA 2IMIA 2JSYA 4PXOA 3TJJA 4LL1B 2DIZA 5AIVA 1AQXA 4LA1A 1NW2A 3TGZA 4IJIA 4J57E 4ZBBA 1PX7A 1DE2A 2RM5A 3EE2A 1SU9A 1F9MA 2JL4A 1TU8A 3TRQA 5KN3A 3H93A 1WP0A 1JLVA 3CXGA 1TRUA 4YKFA 4K5SA 3TKRA 1Q4JA 5FHIA 2FNOA 3LXTA 2H71A 3FZ4A 4IVFA 1ZYQB 3W8SA 4O5RA 4G10A 4YKGA 3IK7A 3A2WA 2CAIA 2VIMA 1ZCPA 5ID2A 3ZFLA 5LD0A 1PA3A 1YEXA 1NM3A 2FY6A 1M9BA 2TRXA 2VCVA 4TW5A 1EGOA 2R6KA 2O89A 4EXJA 3R3EA 4NHZA 3EURA 1ERVA 5EPFA 3AY8A 5E4WA 3KTBA 13GSA 4HZ2A 4MDCA 4PUFC 1QGVA 2GSSA 1U6TA 1GSQA 3FR9A 1Z7RA 3TJBA 4JEDA 2PWJA 2EIOA 1O6JA 4DSQA 2IJYA 5EVOA 4BA7A 3EVIA 5IOWA 1EWXA 2DJJA 1B9XC 5CRWA 1B4PA 3J7Yb 4RI7A 2HNLA 2VCQA 4DSRA 1EEMA 2FA8A 3NIVA 1NHYA 1XPVA 4PNGA 3D21A 1B48A 3FYGA 2C80A 1XW6A 5D93A 4K7OA 4IHUA 4F9ZA 2EIRA 1E6BA 4AF2A 3FRCA 3KXOA 5B6NA 1B4QA 2GT6A 4TR3A 3MSZA 1DUGA 1U88A 2IMFA 3EINA 4IW9A 2PERA 4HQSA 1VGLA 2I81A 3CQFA 3HVNA 3GUSA 3CTFA 4J56E 2V32A 2ES7A 5A4UA 2LEGA 5IMAA 2ZUPA 1AQVA 2GZYA 4X43A 1AQWA 5CNWA 2HSMA 2O87A 2X8HA 1EOHA 2XPDA 3LEFA 3D4MA 1CQGA 2YCDA 4ACSA 4BWQA 4KGIA 3GHAA 2V41A 3IA1A 3MDKA 3OR5A 3WYWA 5IMCA 4WF5A 1DBYA 4G0KA 4HUAA 2GTUA 2H0GA 3BCKA 3F3QA 4OCFA 4MMMA 4RQXA 5A4VA 2Z9SA 3M3MA 3QD9A 2XHFA 1OC9B 3FEUA 1TRSA 1WIKA 3TKSC 1F3AA 4MK3A 4PTSA 1USBA 5J3RA 4KB3A 1O7UA 5B8BA 5JCWA 4RQRA 4EIPA 2F9SA 4QL7A 3ZYWA 1PGTA 1SYXA 4K1FA 4CHSA 3CBUA 1MTCA 5GSTA 3FZAA 1SD8A 2B6MA 1ERUA 4I8BA 2IFQB 3RDWA 2E2GA 1K3LA 1WE0A 2FGXA 4KSOA 3LWAA 4MJCA 5CREA 3LXZA 5GZZB 4K2XA 1YKCA 5D8IA 2DSAA 4XCSA 1Z5YE 5IPGA 4EC0A 1M2BA 1TP9A 5HFGA 3RAZA 3QOUA 2DBCA 3E0UA 4Q5NA 2X64A 5ECMB 4NV2A 2LJRA 1XG8A 5JWQB 1AAZA 1M9AA 4IQ1A 4GSNA 2YZHA 2B7KA 1SL1B 3C1SA 4MPGA 3WT1A 3E9JB 2O8VB 2QSIA 5JWOB 2IMDA 1I5GA 2N5FA 1GTAA 4QQ7A 1PL1A 3IPZA 2CVDA 4KAEA 4ZXGA 1TTZA 2OBIA 2LJAA 1G7OA 2WGRA 3QAGA 2KP2A 4ID0A 5H5QA 1ILOA 2HLSA 1XZOA 5JWRB 3KCMA 2J9HA 1SK0A 5D9XA 1SL2B 1BX9A 4DSSB 3FK8A 4TVEA 2YJHA 4CY6A 5HR0A 4QL9A 1Z7PA 6GSWA 1GSYA 4JRRA 3ZZXA 1NSWA 4GQFA 3GKNA 2B1KA 2R3XA 2H75A 2XC2A 2CX4A 1GTBA 3IV4A 2EIQA 3HHVA 1BQ7A 5IMFA 4HZ4A 2I9HA 5DAKA 1GSUA 4JR6A 3CRTA 3R2QA 4OCEA 3VWUA 2X49A 3EPTA 2AAWA 4EDZA 1EV4A 4KNDA 4RUVA 2LSTA 5J4UA 2O85A 1QXHA 5CRDA 19GSA 3N5OA 4LLRA 3VLNA 3ME7A 1DSBA 1GH2A 4Q5QA 4NXIA 5EY6A 1S3CA 4NV5A 2IFQA 1GTIA 1X0RA 1N2AA 4XHMA 2ZNMA 1PQNA 4L0WA 4TR1A 2P0GA 2L59A 2VLUA 4KCAA 2K6VA 2NTOA 2FWGA 3HVSA 3ISOA 1S3DA 1PN9A 2GLRA 6GSUA 2JADA 3H4KA 3IRAA 4Z2UA 3GH9A 5F05A 2H74A 4TN8A 5A4WA 3GKMA 11GSA 2HRFA 2H72A 4IN0A 4PQHA 3GSSA 3RHBA 1TRWA 5IQYA 1QQ2A 2AYTA 3L0HA 2YOIA 4WBRD 3LQ7A 2V6OA 4MABA 1OYJA 3IHGA 4KCEA 4PGTA 3G7IA 4O92A 3GURA 2R0PA 3WGDA 2H1DA 3EMXA 5DJMA 4GXZA 1GP1A 5DDLA 2OADA 1KNGA 2VCXA 4EO3A 4OO4A 5ID2B 5INYA 4HJMA 1TKDB 1ST9A 1EV9A 2ZCTA 1FG4A 5ABRA 1O73A 1TK5B 1G6WA 3O3TA 3ERWA 2GT5A 5HR1A 2MBSA 2GGTA 2ALBA 4HOJA 1QUWA 3NOFA 4N11A 1MEKA 4KE3A 1JHBA 4ECBA 5KOXA 2FCHA 3HVVA 1TU7A 2H1AA 4ILFA 1AC1A 3DMLA 3KTLA 5IOXA 2C8UA 3O76A 1GNEA 5DALB 4V2MA 2KOKA 3F6FA 2M46A 1THXA 4ZIJA 3M9JA 2HT9A 2LKUA 1UA5A 2A4HA 1EGRA 5D96A 4HU9A 8GSSA 3FR6A 4NWYA 1OC8A 3VI7A 1H75A 3UIWA 1JFUA 4O5UA 3LGCA 4ZB9A 1A24A 3TKQA 1T7PB 4HU7A 5D9VA 3GV1A 3FY7A 3GNJA 5IM9A 4L8EA 2LJKA 1M2AA 1K0MA 3TKPA 2X8CA 2G2QA 1T1VA 5HQPA 3QAWA 2GQKA 2MMZA 3FKFA 3CSJA 4PX1A 2BTOT 3BOAA 2K8VA 1G6YA 2C3NA 3M9KA 5J41A 5CP1A 5KN1A 3HJPA 1G7EA 4GWRA 1WJKA 4KSMA 4XRDA 2GS3A 4TOPA 3D5JA 2YJ7A 3GTUA 1R5AA 4POBA 3VFIA 1ML6A 5ECIB 1MDIA 4KDUA 2R37A 1GWCA 1MDKA 2CAQA 2VL9A 1X5EA 2LQQA 5DCGA 3M8NA 1GUHA 4CW9A 1Z6MA 1TK0B 1XWCA 4JR4A 4ICYA 4GRFA 3UVHA 3DGQA 2NDOA 1GULA 5EL8A 3F8UA 2CV4A 1O85A 4MLYA 1XW5A 2WS2A 3GX0A 2OBKA 4GF0A 4YQVA 2HRKA 1M3JA 3KGKA 6GSVA 4WR5A 2VOCA 1YKAA 2GVPA 4FYUA 5G5EA 2B5EA 3D22A 1ZMAA 3QFBC 1S3AA 4BWSA 5CRGA 5KN2A 4AGSA 1FVJA 4Z2TA 1TI1A 4K0NA 2I4AA 3DEXA 4MCUA 4MJEA 2WZ9A 3RPNA 3ZLPA 2OACA 3PINA 3EYTA 4F0BA 2YN1A 1BYEA 5HFKA 4YQUA 2LS5A 3ZIJA 4ML1A 3GN3A 5DALA 3RHCA 5GAND 1FOVA 1VF3A 1Y6EA 3LJRA 2PVQA 3L9VA 1FAAA 5ECQB 2B5YA 4MF6A 5F07A 7GSSA 4TRXA 4MZWA 1F6MC 4IKHA 5KN0A 1ACVA 4FYBA 1SJ6A 4LL4B 5FWGA 1HNCA 3UARA 16GSA 2KLXA 1H4OA 1QFNA 2L5OA 1XIYA 3KZQA 3CRUA 1OC3A 2WULA 1YDKA 4FQUA 1GLPA 3UVTA 1HD2A 3FZ9A 3LW9A 1K0NA 1K0CA 2WB9A 4ZL9A 4V1Ap 5GAPD 2L5LA 1TRVA 1S3RA 2JZSA 3UBLA 3ZITA 2IWTA 1EP7A 3ED3A 5IIZA 3F4RA 1SJZA 2WDUA 2DJ0A 3GRXA 5F8BA 3DWVA 3A2XA 4JE1A 1EOGA 3TDGA 2HXKA 1T4YA 2GQMA 1X9SB 3TB2A 2MYGA 1K3OA 2PMTA 1Y25A 3HZ8A 4Z7XA 5B8AA 2H0HA 2L4QA 1PD21 3DYRA 1V40A 3FMWA 3BJ5A 2GSTA 2BMXA 2PPTA 2V1MA 2O7KA 5KOWA 2F51A 2WJUA 3APOA 2L57A 1W4VA 2H70A 3L78A 1JZRA 1F2EA 4WF4A 1J9BA 4G9HA 1SKWB 2GZPA 4K8MA 4N0VA 1K0AA 3VURA 5DAKB 2VM2A 3SWLA 1M99A 5IO2A 1LBKA 2AUVA 4KUNA 2ON7A 2P5RA 1O8XA 5LNKe 5ECNB 1VF4A 2XBIA 3IK9A 2B7JA 2F8AA 2H0IA 1Q98A 2VLTA 4KH7A 2VD1A 2YANA 2KHPA 3E3EA 1ZZYA 5DQSA 2QGVA 2YZUA 1JZWA 3RPPA 2CT6A 2MMAA 1THOA 2GSQA 2CQ9A 5G5FA 2VD0A 4K7IA 1XVWA 3DVXA 4K5RA 4TR1B 12GSA 1PX6A 4DEJA 4KDXA 4NHWA 3D6IA 4ML6A 2H6XA 3F0IA 4EDYA 3V1WA 5J5NA 2F8FA 1AW9A 1TOFA 2RIIA 3PH9A 2VL2A 2JU5A 3APQA 3L4NA 1XOAA 2RUEA 2YWMA 2H1BA 3C8EA 2IPAA 2A2SA 5G30A 1KTEA 1RW1A 3G7YA 2E2MA 2PGTA 1GSEA 1FHEA 1WOUA 3GL3A 5G2ZA 2NBSA 2R0GA 1TI3A 5J9CA 4MH2A 4ZBDA 4TXVA 3F63A 1YEPA 3F4TA 2HYXA 4CY8A 1BEDA 1XWAA 4X1UA 3ZMKA 4ZL8A 5DCHA 5B6MA 2DMLA 5AN1A 2B3SA 3I6AA 4MF5A 3KIJA 1X9WB 4FIWA 4WXTA 2FA4A 3EMPA 3A3TA 4I5QA 6GSYA 2C1YA 4V2LA 4Z2RA 1OKDA 1U3IA 4POLA 1R5PA 5G31A 3L9SA 1SENA 17GSA 1ABAA 3I69A 3KMNA 2KP1A 4ULXA 3GH6A 2IMEA 1FVKA 4TXOA 4HSCX 1CQHA 1FB6A 2YV7A 4MJAA 4PQ1A 3VWXA 4E8HA 3HD5A 3QPMA 4XRAA 3P7XA 1GUMA 3TRXA 3DIEA 2VL3A 3FR3A 4JZQA 1ZYPA 3LFLA 3HY2A 5E59A 2A4VA 1XWBA 4POKA 3LORA 3LG6A 5GSSA 3VWWA 2G0FA 2FHEA 1WRYA 4PNFA 1EEJA 3Q19A 4G19A 4BVYA 4G0IA 1RQMA 5AGYA 2DKIA 2IN3A 2YPMA 4ECIA 3MYDA 3F6DA 1TJDA 2H8LA 3H79A 2OE0A 1VF2A 5H5SA 5AIXA 2CZ3A 2B5XA 1U3AA 1URMA 2AHEA 3MAKA 1LJRA 4OFNA 4N10A 3KD0A 4BL7A 1M3IA 2CA8A 4K9ZA 1ZOFA 4HQZA 3GTUB 4O5QA 2IIYA 3CSIA 4ZBAA 3NZNA 2I1UA 5ELGA 4PQIA 2B1LA 5ECKB 2YP6A 1A23A 1XVQA 3WGEA 2DJ3A 4HJ2A 1F3BA 1OE7A 3EU3A 2MBTA 4CDOA 2IL3A 1IYHA 3HYPA 1C72A 1T3BA 2H01A 1GNWA 1GTUA 5CAXA 1F37A 3QMXA 1O81A 6GSXA 1EP8A 1XW9A 2KUCA 2VO4A 3HZ4A 4GLTA 3GYKA 1PRXA 2AB6A 3ERFA 4PUAA 2LRCA 3TJKA 4BVXA 2R0CA 2LTKA 2TRCP 1XBSA 2P31A 2CVKA 3TKSE 4XIHA 4HI7A 4I2UA 4NMUA 2DLXA 2M72A 4IJ3A 2N5BA 5J9BA 4FO5A 1MDJA 2XBQA 3HJMA 3WGXA 3KP9A 1XOBA 4GCIA 4YAVA 1J08A 1QK8A 3KMOA 2JZTA 3CSHA 3UMAA 4XS1A 1G0TA 2L4CA 5ECLB 1YJ6A 2OKAA 10GSA 2DJKA 3TJGA 3GMFA 4MJBA 4L5LA 2LRTA 4L5OA 1SKRB 1PKZA 1V58A 3Q18A 4EUYA 4WBJA 4K0GA 4F82A 4L0UA 3WT2A 4E8EA 4HS1A 1PL2A 3VPTA 4MNNA 4ECCA 1A0FA 4KDYA 4ZB6A 4A5PA 4GQCA
chains in the Genus database with same CATH topology
1OAZA 1ON4A 1AXDA 3PPUA 3ME8A 4TR4A 2OE3A 3TOTA 2E7PA 3A5WA 4Q5RA 3N9JA 1OE8A 2HE3A 2YV9A 1VRSD 4IGJA 3QR6A 5AISA 3IAM2 5CO3A 1JZOA 1A2MA 2OA7A 3DVWA 3IOSA 1SJIA 1J0FA 4O7HA 1ZGNA 2WCIA 1U87A 1FB0A 5C00A 4EKZA 4MH3A 3HKRA 4O32A 5D9WA 2H66A 4D73A 1GSSA 2K9FA 3KJYA 5CRHA 4XTSA 3EWLA 5HR3A 2VCTA 2C3TA 1FW1A 1ERTA 4EL1A 4H86A 3GKXA 3C73A 4ECJA 3APSA 3U6VA 3IAS2 1Z3EA 1EZKA 4USSA 4I6XA 4AJ6A 2EC4A 2A2PA 3GA4A 1YF1A 3H8QA 4YQMA 5ECSA 2FLSA 4KA0A 1A2LA 3ZREA 3DRNA 1ZYNA 2X8GA 3UAPA 3DKSA 1XWKA 1X5CA 1I9DA 4OD7A 1AUCA 6GSTA 2YWOA 4XS6A 2C0DA 4NPBA 5ECPB 1SKSB 3CTGA 2LQOA 5ECRB 1A0RP 1HQOA 1ZL9A 2YWIA 1OKTA 1XCCA 5ELAA 1N8JA 1GSFA 2D2ZA 3PR8A 2NPBA 1YY7A 3K8NA 1B8XA 4XS4A 3LYPA 3KH7A 4FYCA 1SYRA 3JCML 2GQLA 3TRPA 4YH2A 2VCZA 2H76A 3CMIA 4HDEA 3KEBA 2H73A 4F2IA 3D4TA 4POMA 2AV4A 2C0FA 1A2JA 2J23A 2CZ2A 2AJQB 3W6GA 1R26A 5JCGA 3KM6A 1GL8A 2XPEA 3G7JA 3BBYA 2YNXA 3LYKA 3IHQA 5F06A 3TUEA 3A2VA 4OWYA 3HXSA 3MNGA 1O8WA 5IO0A 3F9UA 4DVCA 1XFLA 3DD3A 4RI6A 3Q6OA 3WD6A 2FWEA 2V2GA 2VUPA 3M0FA 4MZCA 2JZRA 4AJ8A 2CX3A 3TKSA 2QKEA 1V2AA 1SK2A 1MD3A 3UJ1A 3RBTA 1HNAA 1M7TA 4GTUA 1WMJA 3U5RE 4G2EA 2HZFA 4TXOB 1GRXA 1JZDA 4ZB8A 4ZILA 5DVBA 3QDNA 3UL3A 2P5QA 2MMNA 1PSQA 1K0DA 4IP6A 3FW2A 3M1GA 4I2TA 2R5GA 4IELA 2OJLA 1YQ1A 2RLIA 1NHOA 3VPQA 1BAYA 1PMTA 2HRAA 1WPIA 1YF0A 1GLQA 3ZTLA 5IPHA 5B7CA 2HI7A 3CYNA 4BVYB 2PUKC 2I3YA 5IMDA 3US3A 5D73A 5CYYA 2N5AA 2E0QA 3KP8A 3GX8A 2PN8A 2DJ1A 1T00A 1T4ZA 1UC7A 4YAPA 4GSTA 1FOHA 1XWGA 4PURA 3KH9A 2MZCA 4BL7B 1V57A 1TDIA 4MP4A 5KEJA 3C7MA 4ISDA 4OO5A 1M2DA 2CVBA 5FT3A 14GSA 4F03A 1HYUA 5HFIA 2C3QA 2PVOC 1GUKA 1TK8B 4MZBA 3HJOA 4MF7A 3I9V2 2LRNA 3H1NA 1VF1A 3D0ZA 1XXUA 2RM6A 2HZEB 4WETA 4N30A 1K0OA 2LV3A 3C1RA 5JCUA 4I97A 2X4AA 4J2FA 5C04A 3VK9A 1PN0A 4AJ7A 2L6CA 1GSDA 3F4SA 5HR2A 4BVXB 2MMOA 1FO5A 4GSSA 1A8YA 3IBHA 4OFTA 2GSRA 2K8SA 20GSA 2WRTA 4KW6A 4NAXA 2OE1A 5BRTA 3S9FA 2A2RA 2VL2C 1UN2A 2R4VA 3GKKA 5DJLA 1BJXA 3QFAC 3MWHA 3FZ5A 3ZRDA 2LUSA 3EU4A 2X99A 3MIXA 6GSSA 1K3YA 2LNTA 4WEYA 2DMMA 2FUG2 3ZVJD 3HDCA 4EIQA 22GSA 1MD4A 4G0LA 3A5IA 3PGTA 4V2NA 3ERGA 3HVXA 4BPYA 2WFCA 4OFMA 4N0ZA 2DC5A 3EC3A 5D9TA 2ON5A 2REMA 4JBBA 2DIYA 4FH8A 4X0XA 1V9WA 4KF9A 4K7NA 1PKWA 3UOMA 1TW9A 2QC7A 3GL5A 1OC9A 2L6DA 3DXBA 2H1GA 1KEBA 4Q5FA 2NVLA 4EE0A 4MPFA 5ENUA 3IC4A 1UVZA 1V98A 4LMWA 2FD3A 4OMVA 1QMVA 2DKHA 2JACA 1LU4A 4ZL7A 5A5KA 3ZMLA 4IP1A 2HSYA 3C71A 1W89A 3IXRA 4X4JA 2YWNA 2VM1A 2BJXA 2C0EA 4MA9A 2C4JA 3Q74A 3TCOA 5ECHB 2V6KA 2C0GA 2H6YA 4LMVA 2PBJA 2VAFA 4P3YB 3VI5A 2HZEA 3IR4A 3VWVA 1OVNA 1R7HA 1WWJA 2UZ8A 4D73B 3GFKA 3TJFA 2K18A 4F0CA 4HEA2 3P8WA 5IMVA 3BD2A 3LSZA 2IMKA 4IQAA 5BMUA 1JLWA 4EVMA 1IYIA 3UEMA 4K6XA 1DE1A 1BG5A 3HA9A 2JSZA 1SD9A 3FHKA 2GZZA 1AIUA 1Z6NA 2VCWA 2QA2A 1T8EB 1SK1A 18GSA 5L71A 3UBKA 4WKWA 1X5DA 4V1Ag 1M0UA 3QCPA 2GDRA 5H5RA 1E2YA 9GSSA 3J7Yk 4K2DA 4DSSA 2DJ2A 3IE3A 1SL0B 3IC8A 3IDVA 2H30A 5DBQA 5G1LA 2HRNA 3QAVA 5COHA 2HSHA 3O6TA 4TKYA 2VLVA 5G1KA 3ZL5A 1B9YC 4IBPA 1K0BA 3TOUA 2F3MA 4XS4B 2PU9C 1TXXA 4KX4A 2LNSA 3HCZA 2M80A 3F3RA 3ZIVA 1YZXA 3GSTA 4JU5A 2FWFA 4WR4A 3ZFBA 5LCZA 1RK4A 4IS0A 5F0GA 1R4WA 3SBCA 2HFDA 1ERWA 2H19A 1ZYEA 1X9MB 4EF0A 3I43A 2QA1A 3P2AA 1A8LA 3ZVJA 2FWHA 3BCIA 5ECOB 3P90A 1Z9HA 2TIRA 5IMZA 3G9BA 5DQYA 2RUFA 3L9UA 3W8JA 2R2JA 3GIXA 2H6ZA 1KBNA 4TR0A 1HNBA 2IMIA 2JSYA 4PXOA 3TJJA 4LL1B 2DIZA 5AIVA 1AQXA 4LA1A 1NW2A 3TGZA 4IJIA 4J57E 4ZBBA 1PX7A 1DE2A 2RM5A 3EE2A 1SU9A 1F9MA 2JL4A 1TU8A 3TRQA 5KN3A 3H93A 1WP0A 1JLVA 3CXGA 1TRUA 4YKFA 4K5SA 3TKRA 1Q4JA 5FHIA 2FNOA 3LXTA 2H71A 3FZ4A 4IVFA 1ZYQB 3W8SA 4O5RA 4G10A 4YKGA 3IK7A 3A2WA 2CAIA 2VIMA 1ZCPA 5ID2A 3ZFLA 5LD0A 1PA3A 1YEXA 1NM3A 2FY6A 1M9BA 2TRXA 2VCVA 4TW5A 1EGOA 2R6KA 2O89A 4EXJA 3R3EA 4NHZA 3EURA 1ERVA 5EPFA 3AY8A 5E4WA 3KTBA 13GSA 4HZ2A 4MDCA 4PUFC 1QGVA 2GSSA 1U6TA 1GSQA 3FR9A 1Z7RA 3TJBA 4JEDA 2PWJA 2EIOA 1O6JA 4DSQA 2IJYA 5EVOA 4BA7A 3EVIA 5IOWA 1EWXA 2DJJA 1B9XC 5CRWA 1B4PA 3J7Yb 4RI7A 2HNLA 2VCQA 4DSRA 1EEMA 2FA8A 3NIVA 1NHYA 1XPVA 4PNGA 3D21A 1B48A 3FYGA 2C80A 1XW6A 5D93A 4K7OA 4IHUA 4F9ZA 2EIRA 1E6BA 4AF2A 3FRCA 3KXOA 5B6NA 1B4QA 2GT6A 4TR3A 3MSZA 1DUGA 1U88A 2IMFA 3EINA 4IW9A 2PERA 4HQSA 1VGLA 2I81A 3GUSA 3CTFA 4J56E 2V32A 2ES7A 5A4UA 2LEGA 5IMAA 2ZUPA 1AQVA 2GZYA 4X43A 1AQWA 5CNWA 2HSMA 2O87A 2X8HA 1EOHA 2XPDA 3LEFA 3D4MA 1CQGA 2YCDA 4ACSA 4BWQA 4KGIA 3GHAA 2V41A 3IA1A 3MDKA 3OR5A 3WYWA 5IMCA 4WF5A 1DBYA 4G0KA 4HUAA 2GTUA 2H0GA 3BCKA 3F3QA 4OCFA 4MMMA 4RQXA 5A4VA 2Z9SA 3M3MA 3QD9A 2XHFA 1OC9B 3FEUA 1TRSA 1WIKA 3TKSC 1F3AA 4MK3A 4PTSA 1USBA 5J3RA 4KB3A 1O7UA 5B8BA 5JCWA 4RQRA 4EIPA 2F9SA 4QL7A 3ZYWA 1PGTA 1SYXA 4K1FA 4CHSA 3CBUA 1MTCA 5GSTA 3FZAA 1SD8A 2B6MA 1ERUA 4I8BA 2IFQB 3RDWA 2E2GA 1K3LA 1WE0A 2FGXA 4KSOA 3LWAA 4MJCA 5CREA 3LXZA 5GZZB 4K2XA 1YKCA 5D8IA 2DSAA 4XCSA 1Z5YE 5IPGA 4EC0A 1M2BA 1TP9A 5HFGA 3RAZA 3QOUA 2DBCA 3E0UA 4Q5NA 2X64A 5ECMB 4NV2A 2LJRA 5JWQB 1AAZA 1M9AA 4IQ1A 4GSNA 2YZHA 2B7KA 1SL1B 3C1SA 4MPGA 3WT1A 3E9JB 2O8VB 2QSIA 5JWOB 2IMDA 1I5GA 2N5FA 1GTAA 4QQ7A 1PL1A 3IPZA 2CVDA 4KAEA 4ZXGA 1TTZA 2OBIA 2LJAA 1G7OA 2WGRA 3QAGA 2KP2A 4ID0A 5H5QA 1ILOA 2HLSA 1XZOA 5JWRB 3KCMA 2J9HA 1SK0A 5D9XA 1SL2B 1BX9A 4DSSB 3FK8A 4TVEA 2YJHA 4CY6A 5HR0A 4QL9A 1Z7PA 6GSWA 1GSYA 4JRRA 3ZZXA 1NSWA 4GQFA 3GKNA 2B1KA 2R3XA 2H75A 2XC2A 2CX4A 1GTBA 3IV4A 2EIQA 3HHVA 1BQ7A 5IMFA 4HZ4A 2I9HA 5DAKA 1GSUA 4JR6A 3CRTA 3R2QA 4OCEA 3VWUA 2X49A 3EPTA 2AAWA 4EDZA 1EV4A 4KNDA 4RUVA 2LSTA 5J4UA 2O85A 1QXHA 5CRDA 19GSA 3N5OA 4LLRA 3VLNA 3ME7A 1DSBA 1GH2A 4Q5QA 4NXIA 5EY6A 1S3CA 4NV5A 2IFQA 1GTIA 1X0RA 1N2AA 4XHMA 2ZNMA 1PQNA 4L0WA 4TR1A 2P0GA 2L59A 2VLUA 4KCAA 2K6VA 2NTOA 2FWGA 3HVSA 3ISOA 1S3DA 1PN9A 2GLRA 6GSUA 2JADA 3H4KA 3IRAA 4Z2UA 3GH9A 5F05A 2H74A 4TN8A 5A4WA 3GKMA 11GSA 2HRFA 2H72A 4IN0A 4PQHA 3GSSA 3RHBA 1TRWA 5IQYA 1QQ2A 2AYTA 3L0HA 2YOIA 4WBRD 3LQ7A 2V6OA 4MABA 1OYJA 3IHGA 4KCEA 4PGTA 3G7IA 4O92A 3GURA 2R0PA 3WGDA 2H1DA 3EMXA 5DJMA 4GXZA 1GP1A 5DDLA 2OADA 1KNGA 2VCXA 4EO3A 4OO4A 5ID2B 5INYA 4HJMA 1TKDB 1ST9A 1EV9A 2ZCTA 1FG4A 5ABRA 1O73A 1TK5B 1G6WA 3O3TA 3ERWA 2GT5A 5HR1A 2MBSA 2GGTA 2ALBA 4HOJA 1QUWA 3NOFA 4N11A 1MEKA 4KE3A 1JHBA 4ECBA 5KOXA 2FCHA 3HVVA 1TU7A 2H1AA 4ILFA 1AC1A 3DMLA 3KTLA 5IOXA 2C8UA 3O76A 1GNEA 5DALB 4V2MA 2KOKA 3F6FA 2M46A 1THXA 4ZIJA 3M9JA 2HT9A 2LKUA 1UA5A 2A4HA 1EGRA 5D96A 4HU9A 8GSSA 3FR6A 4NWYA 1OC8A 3VI7A 1H75A 3UIWA 1JFUA 4O5UA 3LGCA 4ZB9A 1A24A 3TKQA 1T7PB 4HU7A 5D9VA 3GV1A 3FY7A 3GNJA 5IM9A 4L8EA 2LJKA 1M2AA 1K0MA 3TKPA 2X8CA 2G2QA 1T1VA 5HQPA 3QAWA 2GQKA 2MMZA 3FKFA 3CSJA 4PX1A 2BTOT 3BOAA 2K8VA 1G6YA 2C3NA 3M9KA 5J41A 5CP1A 5KN1A 3HJPA 1G7EA 4GWRA 1WJKA 4KSMA 4XRDA 2GS3A 4TOPA 3D5JA 2YJ7A 3GTUA 1R5AA 4POBA 3VFIA 1ML6A 5ECIB 1MDIA 4KDUA 2R37A 1GWCA 1MDKA 2CAQA 2VL9A 1X5EA 2LQQA 5DCGA 3M8NA 1GUHA 4CW9A 1Z6MA 1TK0B 1XWCA 4JR4A 4ICYA 4GRFA 3UVHA 3DGQA 2NDOA 1GULA 5EL8A 3F8UA 2CV4A 1O85A 4MLYA 1XW5A 2WS2A 3GX0A 2OBKA 4GF0A 4YQVA 2HRKA 3KGKA 6GSVA 4WR5A 2VOCA 1YKAA 2GVPA 4FYUA 5G5EA 2B5EA 3D22A 1ZMAA 3QFBC 1S3AA 4BWSA 5CRGA 5KN2A 4AGSA 1FVJA 4Z2TA 1TI1A 4K0NA 2I4AA 3DEXA 4MCUA 4MJEA 2WZ9A 3RPNA 3ZLPA 2OACA 3PINA 3EYTA 4F0BA 2YN1A 1BYEA 5HFKA 4YQUA 2LS5A 3ZIJA 4ML1A 3GN3A 5DALA 3RHCA 5GAND 1FOVA 1VF3A 1Y6EA 3LJRA 2PVQA 3L9VA 1FAAA 5ECQB 2B5YA 4MF6A 5F07A 7GSSA 4TRXA 4MZWA 1F6MC 4IKHA 5KN0A 1ACVA 4FYBA 1SJ6A 4LL4B 5FWGA 1HNCA 3UARA 16GSA 2KLXA 1H4OA 1QFNA 2L5OA 1XIYA 3KZQA 3CRUA 1OC3A 2WULA 1YDKA 4FQUA 1GLPA 3UVTA 1HD2A 3FZ9A 3LW9A 1K0NA 1K0CA 2WB9A 4ZL9A 4V1Ap 5GAPD 2L5LA 1TRVA 2JZSA 3UBLA 3ZITA 2IWTA 1EP7A 3ED3A 5IIZA 3F4RA 1SJZA 2WDUA 2DJ0A 3GRXA 5F8BA 3DWVA 3A2XA 4JE1A 1EOGA 3TDGA 2HXKA 1T4YA 2GQMA 1X9SB 3TB2A 2MYGA 1K3OA 2PMTA 1Y25A 3HZ8A 4Z7XA 5B8AA 2H0HA 2L4QA 1PD21 3DYRA 1V40A 3FMWA 3BJ5A 2GSTA 2BMXA 2PPTA 2V1MA 2O7KA 5KOWA 2F51A 2WJUA 3APOA 2L57A 1W4VA 2H70A 3L78A 1JZRA 1F2EA 4WF4A 1J9BA 4G9HA 1SKWB 2GZPA 4K8MA 4N0VA 1K0AA 3VURA 5DAKB 2VM2A 3SWLA 1M99A 5IO2A 1LBKA 2AUVA 4KUNA 2ON7A 2P5RA 1O8XA 5LNKe 5ECNB 1VF4A 2XBIA 3IK9A 2B7JA 2F8AA 2H0IA 1Q98A 2VLTA 4KH7A 2VD1A 2YANA 2KHPA 3E3EA 1ZZYA 5DQSA 2QGVA 2YZUA 1JZWA 3RPPA 2CT6A 2MMAA 1THOA 2GSQA 2CQ9A 5G5FA 2VD0A 4K7IA 1XVWA 3DVXA 4K5RA 4TR1B 12GSA 1PX6A 4DEJA 4KDXA 4NHWA 3D6IA 4ML6A 2H6XA 3F0IA 4EDYA 3V1WA 5J5NA 2F8FA 1AW9A 1TOFA 2RIIA 3PH9A 2VL2A 2JU5A 3APQA 3L4NA 1XOAA 2RUEA 2YWMA 2H1BA 3C8EA 2IPAA 2A2SA 5G30A 1KTEA 1RW1A 3G7YA 2E2MA 2PGTA 1GSEA 1FHEA 1WOUA 3GL3A 5G2ZA 2NBSA 2R0GA 1TI3A 5J9CA 4MH2A 4ZBDA 4TXVA 3F63A 1YEPA 3F4TA 2HYXA 4CY8A 1BEDA 1XWAA 4X1UA 3ZMKA 4ZL8A 5DCHA 5B6MA 2DMLA 5AN1A 2B3SA 3I6AA 4MF5A 3KIJA 1X9WB 4FIWA 4WXTA 2FA4A 3EMPA 3A3TA 4I5QA 6GSYA 2C1YA 4V2LA 4Z2RA 1OKDA 1U3IA 4POLA 1R5PA 5G31A 3L9SA 1SENA 17GSA 1ABAA 3I69A 3KMNA 2KP1A 4ULXA 3GH6A 2IMEA 1FVKA 4TXOA 1CQHA 1FB6A 2YV7A 4MJAA 4PQ1A 3VWXA 4E8HA 3HD5A 3QPMA 4XRAA 3P7XA 1GUMA 3TRXA 3DIEA 2VL3A 3FR3A 4JZQA 1ZYPA 3LFLA 3HY2A 5E59A 2A4VA 1XWBA 4POKA 3LORA 3LG6A 5GSSA 3VWWA 2G0FA 2FHEA 1WRYA 4PNFA 1EEJA 3Q19A 4G19A 4BVYA 4G0IA 1RQMA 5AGYA 2DKIA 2IN3A 2YPMA 4ECIA 3MYDA 3F6DA 1TJDA 2H8LA 3H79A 2OE0A 1VF2A 5H5SA 5AIXA 2CZ3A 2B5XA 1U3AA 1URMA 2AHEA 3MAKA 1LJRA 4OFNA 4N10A 3KD0A 4BL7A 2CA8A 4K9ZA 1ZOFA 4HQZA 3GTUB 4O5QA 2IIYA 3CSIA 4ZBAA 3NZNA 2I1UA 5ELGA 4PQIA 2B1LA 5ECKB 2YP6A 1A23A 1XVQA 3WGEA 2DJ3A 4HJ2A 1F3BA 1OE7A 3EU3A 2MBTA 4CDOA 2IL3A 1IYHA 3HYPA 1C72A 1T3BA 2H01A 1GNWA 1GTUA 5CAXA 1F37A 3QMXA 1O81A 6GSXA 1EP8A 1XW9A 2KUCA 2VO4A 3HZ4A 4GLTA 3GYKA 1PRXA 2AB6A 3ERFA 4PUAA 2LRCA 3TJKA 4BVXA 2R0CA 2LTKA 2TRCP 1XBSA 2P31A 2CVKA 3TKSE 4XIHA 4HI7A 4I2UA 4NMUA 2DLXA 2M72A 4IJ3A 2N5BA 5J9BA 4FO5A 1MDJA 2XBQA 3HJMA 3WGXA 3KP9A 1XOBA 4GCIA 4YAVA 1J08A 1QK8A 3KMOA 2JZTA 3CSHA 3UMAA 4XS1A 1G0TA 2L4CA 5ECLB 1YJ6A 2OKAA 10GSA 2DJKA 3TJGA 3GMFA 4MJBA 4L5LA 2LRTA 4L5OA 1SKRB 1PKZA 1V58A 3Q18A 4EUYA 4WBJA 4K0GA 4F82A 4L0UA 3WT2A 4E8EA 4HS1A 1PL2A 3VPTA 4MNNA 4ECCA 1A0FA 4KDYA 4ZB6A 4A5PA 4GQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OAZ A;  1ON4 A;  1AXD A;  3ME8 A;  4TR4 A;  2OE3 A;  3TOT A;  2E7P A;  3A5W A;  4Q5R A;  3N9J A;  1OE8 A;  2HE3 A;  2YV9 A;  1VRS D;  4IGJ A;  3QR6 A;  5AIS A;  3IAM 2;  5CO3 A;  1JZO A;  1A2M A;  2OA7 A;  3DVW A;  3IOS A;  1SJI A;  1J0F A;  4O7H A;  1ZGN A;  2WCI A;  1U87 A;  1FB0 A;  5C00 A;  4EKZ A;  4MH3 A;  3HKR A;  4O32 A;  5D9W A;  2H66 A;  4D73 A;  1GSS A;  2K9F A;  3KJY A;  5CRH A;  4XTS A;  3EWL A;  5HR3 A;  2VCT A;  2C3T A;  1FW1 A;  1ERT A;  4EL1 A;  4H86 A;  3GKX A;  3C73 A;  4ECJ A;  3APS A;  3U6V A;  3IAS 2;  1Z3E A;  1EZK A;  4I6X A;  4AJ6 A;  2EC4 A;  3GA4 A;  1YF1 A;  3H8Q A;  4YQM A;  5ECS A;  2FLS A;  4KA0 A;  1A2L A;  3ZRE A;  3DRN A;  2X8G A;  3UAP A;  3DKS A;  1XWK A;  1X5C A;  1I9D A;  4OD7 A;  1AUC A;  6GST A;  2YWO A;  4XS6 A;  2C0D A;  4NPB A;  5ECP B;  1SKS B;  3CTG A;  2LQO A;  5ECR B;  1A0R P;  1HQO A;  1ZL9 A;  2YWI A;  1OKT A;  1XCC A;  5ELA A;  1N8J A;  1GSF A;  2D2Z A;  3PR8 A;  2NPB A;  1YY7 A;  3K8N A;  1B8X A;  4XS4 A;  3LYP A;  3KH7 A;  4FYC A;  1SYR A;  3JCM L;  2GQL A;  3TRP A;  4YH2 A;  2VCZ A;  2H76 A;  3CMI A;  4HDE A;  3KEB A;  2H73 A;  4F2I A;  3D4T A;  4POM A;  2AV4 A;  2C0F A;  1A2J A;  2J23 A;  2CZ2 A;  2AJQ B;  3W6G A;  1R26 A;  5JCG A;  3KM6 A;  1GL8 A;  2XPE A;  3G7J A;  3BBY A;  2YNX A;  3LYK A;  3IHQ A;  5F06 A;  3TUE A;  3A2V A;  4OWY A;  3HXS A;  3MNG A;  1O8W A;  5IO0 A;  3F9U A;  4DVC A;  1XFL A;  3DD3 A;  4RI6 A;  3Q6O A;  3WD6 A;  2FWE A;  2V2G A;  2VUP A;  3M0F A;  4MZC A;  2JZR A;  4AJ8 A;  2CX3 A;  3TKS A;  2QKE A;  1V2A A;  1SK2 A;  1MD3 A;  3UJ1 A;  3RBT A;  1HNA A;  1M7T A;  4GTU A;  1WMJ A;  3U5R E;  4G2E A;  2HZF A;  4TXO B;  1GRX A;  1JZD A;  4ZB8 A;  4ZIL A;  5DVB A;  3QDN A;  3UL3 A;  2P5Q A;  2MMN A;  1PSQ A;  1K0D A;  4IP6 A;  3FW2 A;  3M1G A;  4I2T A;  2R5G A;  4IEL A;  2OJL A;  1YQ1 A;  2RLI A;  1NHO A;  3VPQ A;  1BAY A;  1PMT A;  1WPI A;  1YF0 A;  1GLQ A;  3ZTL A;  5IPH A;  5B7C A;  2HI7 A;  3CYN A;  2PUK C;  2I3Y A;  5IMD A;  3US3 A;  5D73 A;  5CYY A;  2N5A A;  2E0Q A;  3KP8 A;  3GX8 A;  2PN8 A;  2DJ1 A;  1T00 A;  1T4Z A;  1UC7 A;  4YAP A;  4GST A;  1XWG A;  4PUR A;  3KH9 A;  2MZC A;  1V57 A;  1TDI A;  4MP4 A;  5KEJ A;  3C7M A;  4ISD A;  4OO5 A;  1M2D A;  2CVB A;  5FT3 A;  14GS A;  4F03 A;  1HYU A;  5HFI A;  2C3Q A;  2PVO C;  1GUK A;  1TK8 B;  4MZB A;  3HJO A;  4MF7 A;  3I9V 2;  2LRN A;  3H1N A;  1VF1 A;  3D0Z A;  1XXU A;  2RM6 A;  2HZE B;  4WET A;  4N30 A;  1K0O A;  2LV3 A;  3C1R A;  5JCU A;  4I97 A;  4J2F A;  5C04 A;  3VK9 A;  4AJ7 A;  2L6C A;  1GSD A;  3F4S A;  5HR2 A;  2MMO A;  1FO5 A;  4GSS A;  1A8Y A;  3IBH A;  4OFT A;  2GSR A;  2K8S A;  20GS A;  2WRT A;  4KW6 A;  4NAX A;  2OE1 A;  3S9F A;  2A2R A;  2VL2 C;  1UN2 A;  2R4V A;  3GKK A;  5DJL A;  1BJX A;  3QFA C;  3MWH A;  3FZ5 A;  3ZRD A;  2LUS A;  3EU4 A;  2X99 A;  6GSS A;  1K3Y A;  2LNT A;  4WEY A;  2DMM A;  2FUG 2;  3ZVJ D;  3HDC A;  22GS A;  1MD4 A;  3PGT A;  4V2N A;  3ERG A;  3HVX A;  4BPY A;  2WFC A;  4OFM A;  4N0Z A;  2DC5 A;  3EC3 A;  5D9T A;  2ON5 A;  2REM A;  4JBB A;  2DIY A;  4FH8 A;  4X0X A;  1V9W A;  4K7N A;  1PKW A;  3UOM A;  1TW9 A;  2QC7 A;  3GL5 A;  1OC9 A;  2L6D A;  3DXB A;  2H1G A;  1KEB A;  4Q5F A;  2NVL A;  4EE0 A;  4MPF A;  5ENU A;  3IC4 A;  1UVZ A;  1V98 A;  4LMW A;  2FD3 A;  4OMV A;  1QMV A;  2JAC A;  1LU4 A;  4ZL7 A;  5A5K A;  3ZML A;  4IP1 A;  2HSY A;  3C71 A;  1W89 A;  3IXR A;  2YWN A;  2VM1 A;  2BJX A;  2C0E A;  4MA9 A;  2C4J A;  3Q74 A;  3TCO A;  5ECH B;  2V6K A;  2C0G A;  2H6Y A;  4LMV A;  2PBJ A;  2VAF A;  4P3Y B;  3VI5 A;  2HZE A;  3IR4 A;  3VWV A;  1OVN A;  1R7H A;  1WWJ A;  4D73 B;  3GFK A;  3TJF A;  2K18 A;  4F0C A;  4HEA 2;  3P8W A;  5IMV A;  3BD2 A;  3LSZ A;  2IMK A;  4IQA A;  1JLW A;  4EVM A;  1IYI A;  3UEM A;  4K6X A;  1DE1 A;  1BG5 A;  3HA9 A;  2JSZ A;  1SD9 A;  3FHK A;  2GZZ A;  1AIU A;  1Z6N A;  2VCW A;  1T8E B;  1SK1 A;  18GS A;  5L71 A;  3UBK A;  4WKW A;  1X5D A;  4V1A g;  1M0U A;  3QCP A;  2GDR A;  5H5R A;  1E2Y A;  9GSS A;  3J7Y k;  4K2D A;  4DSS A;  2DJ2 A;  3IE3 A;  1SL0 B;  3IDV A;  2H30 A;  5DBQ A;  5G1L A;  2HRN A;  3QAV A;  5COH A;  2HSH A;  3O6T A;  4TKY A;  2VLV A;  5G1K A;  3ZL5 A;  1B9Y C;  4IBP A;  1K0B A;  3TOU A;  2F3M A;  4XS4 B;  2PU9 C;  1TXX A;  4KX4 A;  2LNS A;  3HCZ A;  2M80 A;  3F3R A;  3ZIV A;  1YZX A;  3GST A;  4JU5 A;  2FWF A;  4WR4 A;  3ZFB A;  5LCZ A;  1RK4 A;  4IS0 A;  5F0G A;  1R4W A;  3SBC A;  2HFD A;  1ERW A;  2H19 A;  1ZYE A;  1X9M B;  4EF0 A;  3I43 A;  3P2A A;  1A8L A;  3ZVJ A;  2FWH A;  3BCI A;  5ECO B;  3P90 A;  1Z9H A;  2TIR A;  5IMZ A;  3G9B A;  5DQY A;  2RUF A;  3L9U A;  3W8J A;  2R2J A;  3GIX A;  2H6Z A;  1KBN A;  4TR0 A;  1HNB A;  2IMI A;  2JSY A;  4PXO A;  3TJJ A;  4LL1 B;  2DIZ A;  5AIV A;  1AQX A;  4LA1 A;  1NW2 A;  3TGZ A;  4IJI A;  4J57 E;  4ZBB A;  1PX7 A;  1DE2 A;  2RM5 A;  3EE2 A;  1SU9 A;  1F9M A;  2JL4 A;  1TU8 A;  3TRQ A;  5KN3 A;  3H93 A;  1WP0 A;  1JLV A;  3CXG A;  1TRU A;  3TKR A;  1Q4J A;  5FHI A;  2FNO A;  3LXT A;  2H71 A;  3FZ4 A;  4IVF A;  1ZYQ B;  3W8S A;  4O5R A;  4G10 A;  3IK7 A;  3A2W A;  2CAI A;  2VIM A;  1ZCP A;  5ID2 A;  3ZFL A;  5LD0 A;  1PA3 A;  1YEX A;  1NM3 A;  2FY6 A;  1M9B A;  2TRX A;  2VCV A;  4TW5 A;  1EGO A;  2R6K A;  2O89 A;  4EXJ A;  4NHZ A;  3EUR A;  1ERV A;  5EPF A;  3AY8 A;  5E4W A;  3KTB A;  13GS A;  4HZ2 A;  4MDC A;  4PUF C;  1QGV A;  2GSS A;  1U6T A;  1GSQ A;  3FR9 A;  1Z7R A;  3TJB A;  4JED A;  2PWJ A;  2EIO A;  1O6J A;  4DSQ A;  2IJY A;  5EVO A;  4BA7 A;  3EVI A;  5IOW A;  1EWX A;  2DJJ A;  1B9X C;  5CRW A;  1B4P A;  3J7Y b;  4RI7 A;  2HNL A;  2VCQ A;  4DSR A;  1EEM A;  2FA8 A;  3NIV A;  1NHY A;  1XPV A;  4PNG A;  3D21 A;  1B48 A;  3FYG A;  2C80 A;  1XW6 A;  5D93 A;  4K7O A;  4IHU A;  4F9Z A;  2EIR A;  1E6B A;  4AF2 A;  3FRC A;  3KXO A;  5B6N A;  1B4Q A;  2GT6 A;  4TR3 A;  3MSZ A;  1DUG A;  1U88 A;  2IMF A;  3EIN A;  4IW9 A;  2PER A;  4HQS A;  1VGL A;  2I81 A;  3GUS A;  3CTF A;  4J56 E;  2V32 A;  2ES7 A;  5A4U A;  2LEG A;  5IMA A;  2ZUP A;  1AQV A;  2GZY A;  4X43 A;  1AQW A;  5CNW A;  2O87 A;  2X8H A;  1EOH A;  2XPD A;  3LEF A;  3D4M A;  1CQG A;  2YCD A;  4ACS A;  4BWQ A;  4KGI A;  3GHA A;  2V41 A;  3IA1 A;  3MDK A;  3OR5 A;  3WYW A;  5IMC A;  4WF5 A;  1DBY A;  4HUA A;  2GTU A;  2H0G A;  3BCK A;  3F3Q A;  4OCF A;  4MMM A;  4RQX A;  5A4V A;  2Z9S A;  3M3M A;  3QD9 A;  2XHF A;  1OC9 B;  3FEU A;  1TRS A;  1WIK A;  3TKS C;  1F3A A;  4MK3 A;  1USB A;  5J3R A;  4KB3 A;  1O7U A;  5B8B A;  5JCW A;  4RQR A;  2F9S A;  4QL7 A;  3ZYW A;  1PGT A;  1SYX A;  4K1F A;  4CHS A;  3CBU A;  1MTC A;  5GST A;  3FZA A;  1SD8 A;  2B6M A;  1ERU A;  4I8B A;  2IFQ B;  3RDW A;  2E2G A;  1K3L A;  1WE0 A;  2FGX A;  4KSO A;  3LWA A;  4MJC A;  5CRE A;  3LXZ A;  5GZZ B;  1YKC A;  5D8I A;  2DSA A;  4XCS A;  1Z5Y E;  5IPG A;  4EC0 A;  1M2B A;  1TP9 A;  5HFG A;  3RAZ A;  3QOU A;  2DBC A;  3E0U A;  4Q5N A;  2X64 A;  5ECM B;  4NV2 A;  2LJR A;  5JWQ B;  1AAZ A;  1M9A A;  4IQ1 A;  4GSN A;  2YZH A;  2B7K A;  1SL1 B;  3C1S A;  4MPG A;  3WT1 A;  3E9J B;  2O8V B;  2QSI A;  5JWO B;  2IMD A;  1I5G A;  2N5F A;  1GTA A;  4QQ7 A;  1PL1 A;  3IPZ A;  2CVD A;  4KAE A;  4ZXG A;  1TTZ A;  2OBI A;  2LJA A;  1G7O A;  2WGR A;  3QAG A;  2KP2 A;  4ID0 A;  5H5Q A;  1ILO A;  2HLS A;  1XZO A;  5JWR B;  3KCM A;  2J9H A;  1SK0 A;  5D9X A;  1SL2 B;  1BX9 A;  4DSS B;  3FK8 A;  4TVE A;  2YJH A;  5HR0 A;  4QL9 A;  1Z7P A;  6GSW A;  1GSY A;  4JRR A;  3ZZX A;  1NSW A;  4GQF A;  3GKN A;  2B1K A;  2R3X A;  2H75 A;  2XC2 A;  2CX4 A;  1GTB A;  3IV4 A;  2EIQ A;  3HHV A;  1BQ7 A;  5IMF A;  4HZ4 A;  2I9H A;  5DAK A;  1GSU A;  4JR6 A;  3CRT A;  3R2Q A;  4OCE A;  3VWU A;  2AAW A;  4EDZ A;  1EV4 A;  4KND A;  4RUV A;  2LST A;  5J4U A;  2O85 A;  1QXH A;  5CRD A;  19GS A;  3N5O A;  4LLR A;  3VLN A;  3ME7 A;  1DSB A;  1GH2 A;  4Q5Q A;  4NXI A;  5EY6 A;  1S3C A;  4NV5 A;  2IFQ A;  1GTI A;  1X0R A;  1N2A A;  4XHM A;  2ZNM A;  1PQN A;  4L0W A;  4TR1 A;  2P0G A;  2L59 A;  2VLU A;  4KCA A;  2K6V A;  2NTO A;  2FWG A;  3HVS A;  3ISO A;  1S3D A;  1PN9 A;  2GLR A;  6GSU A;  2JAD A;  3H4K A;  3IRA A;  3GH9 A;  5F05 A;  2H74 A;  4TN8 A;  5A4W A;  3GKM A;  11GS A;  2HRF A;  2H72 A;  4IN0 A;  4PQH A;  3GSS A;  3RHB A;  1TRW A;  5IQY A;  1QQ2 A;  2AYT A;  3L0H A;  2YOI A;  4WBR D;  3LQ7 A;  2V6O A;  4MAB A;  1OYJ A;  4KCE A;  4PGT A;  3G7I A;  3GUR A;  4O92 A;  3WGD A;  2H1D A;  3EMX A;  5DJM A;  4GXZ A;  1GP1 A;  5DDL A;  2OAD A;  1KNG A;  2VCX A;  4EO3 A;  4OO4 A;  5ID2 B;  5INY A;  4HJM A;  1TKD B;  1ST9 A;  1EV9 A;  2ZCT A;  1FG4 A;  5ABR A;  1O73 A;  1TK5 B;  1G6W A;  3O3T A;  3ERW A;  2GT5 A;  5HR1 A;  2MBS A;  2GGT A;  2ALB A;  4HOJ A;  1QUW A;  3NOF A;  4N11 A;  1MEK A;  4KE3 A;  1JHB A;  4ECB A;  2FCH A;  3HVV A;  1TU7 A;  2H1A A;  4ILF A;  1AC1 A;  3DML A;  3KTL A;  5IOX A;  2C8U A;  3O76 A;  1GNE A;  5DAL B;  4V2M A;  2KOK A;  3F6F A;  2M46 A;  1THX A;  4ZIJ A;  3M9J A;  2HT9 A;  2LKU A;  1UA5 A;  1EGR A;  5D96 A;  4HU9 A;  8GSS A;  3FR6 A;  4NWY A;  1OC8 A;  3VI7 A;  1H75 A;  3UIW A;  1JFU A;  3LGC A;  4ZB9 A;  1A24 A;  3TKQ A;  1T7P B;  4HU7 A;  5D9V A;  3GV1 A;  3FY7 A;  3GNJ A;  5IM9 A;  4L8E A;  2LJK A;  1M2A A;  1K0M A;  3TKP A;  2X8C A;  2G2Q A;  1T1V A;  5HQP A;  3QAW A;  2GQK A;  2MMZ A;  3FKF A;  3CSJ A;  4PX1 A;  2BTO T;  3BOA A;  2K8V A;  1G6Y A;  2C3N A;  3M9K A;  5J41 A;  5CP1 A;  5KN1 A;  3HJP A;  1G7E A;  4GWR A;  1WJK A;  4KSM A;  4XRD A;  2GS3 A;  4TOP A;  3D5J A;  2YJ7 A;  3GTU A;  1R5A A;  4POB A;  3VFI A;  1ML6 A;  5ECI B;  1MDI A;  4KDU A;  2R37 A;  1GWC A;  1MDK A;  2CAQ A;  2VL9 A;  1X5E A;  2LQQ A;  5DCG A;  3M8N A;  1GUH A;  4CW9 A;  1Z6M A;  1TK0 B;  1XWC A;  4JR4 A;  4GRF A;  3UVH A;  3DGQ A;  2NDO A;  1GUL A;  5EL8 A;  3F8U A;  2CV4 A;  1O85 A;  4MLY A;  1XW5 A;  2WS2 A;  3GX0 A;  2OBK A;  4GF0 A;  4YQV A;  3KGK A;  6GSV A;  4WR5 A;  2VOC A;  1YKA A;  2GVP A;  4FYU A;  5G5E A;  2B5E A;  3D22 A;  1ZMA A;  3QFB C;  1S3A A;  4BWS A;  5CRG A;  5KN2 A;  4AGS A;  1FVJ A;  1TI1 A;  4K0N A;  2I4A A;  3DEX A;  4MCU A;  4MJE A;  2WZ9 A;  3RPN A;  3ZLP A;  2OAC A;  3PIN A;  3EYT A;  4F0B A;  2YN1 A;  1BYE A;  5HFK A;  4YQU A;  2LS5 A;  3ZIJ A;  4ML1 A;  3GN3 A;  5DAL A;  3RHC A;  5GAN D;  1FOV A;  1VF3 A;  1Y6E A;  3LJR A;  2PVQ A;  3L9V A;  1FAA A;  5ECQ B;  2B5Y A;  4MF6 A;  5F07 A;  7GSS A;  4TRX A;  4MZW A;  1F6M C;  4IKH A;  5KN0 A;  1ACV A;  4FYB A;  1SJ6 A;  4LL4 B;  5FWG A;  1HNC A;  3UAR A;  16GS A;  2KLX A;  1H4O A;  1QFN A;  2L5O A;  1XIY A;  3KZQ A;  3CRU A;  1OC3 A;  2WUL A;  1YDK A;  1GLP A;  3UVT A;  1HD2 A;  3FZ9 A;  1K0N A;  1K0C A;  2WB9 A;  4ZL9 A;  4V1A p;  5GAP D;  2L5L A;  1TRV A;  2JZS A;  3UBL A;  3ZIT A;  2IWT A;  1EP7 A;  3ED3 A;  5IIZ A;  3F4R A;  1SJZ A;  2WDU A;  2DJ0 A;  3GRX A;  5F8B A;  3DWV A;  3A2X A;  4JE1 A;  1EOG A;  3TDG A;  2HXK A;  1T4Y A;  2GQM A;  1X9S B;  3TB2 A;  2MYG A;  1K3O A;  2PMT A;  1Y25 A;  3HZ8 A;  4Z7X A;  5B8A A;  2H0H A;  2L4Q A;  1PD2 1;  3DYR A;  1V40 A;  3BJ5 A;  2GST A;  2BMX A;  2PPT A;  2V1M A;  2O7K A;  2F51 A;  2WJU A;  3APO A;  2L57 A;  1W4V A;  2H70 A;  3L78 A;  1JZR A;  1F2E A;  4WF4 A;  1J9B A;  4G9H A;  1SKW B;  2GZP A;  4K8M A;  4N0V A;  1K0A A;  3VUR A;  5DAK B;  2VM2 A;  3SWL A;  1M99 A;  5IO2 A;  1LBK A;  2AUV A;  4KUN A;  2ON7 A;  2P5R A;  1O8X A;  5LNK e;  5ECN B;  1VF4 A;  2XBI A;  3IK9 A;  2B7J A;  2F8A A;  2H0I A;  1Q98 A;  2VLT A;  4KH7 A;  2VD1 A;  2YAN A;  2KHP A;  3E3E A;  1ZZY A;  5DQS A;  2QGV A;  2YZU A;  1JZW A;  3RPP A;  2CT6 A;  2MMA A;  1THO A;  2GSQ A;  2CQ9 A;  5G5F A;  2VD0 A;  4K7I A;  1XVW A;  3DVX A;  4TR1 B;  12GS A;  1PX6 A;  4DEJ A;  4KDX A;  4NHW A;  3D6I A;  4ML6 A;  2H6X A;  3F0I A;  4EDY A;  3V1W A;  5J5N A;  2F8F A;  1AW9 A;  1TOF A;  2RII A;  3PH9 A;  2VL2 A;  2JU5 A;  3APQ A;  3L4N A;  1XOA A;  2RUE A;  2YWM A;  2H1B A;  3C8E A;  2IPA A;  2A2S A;  5G30 A;  1KTE A;  1RW1 A;  3G7Y A;  2E2M A;  2PGT A;  1GSE A;  1FHE A;  1WOU A;  3GL3 A;  5G2Z A;  2NBS A;  1TI3 A;  5J9C A;  4MH2 A;  4ZBD A;  4TXV A;  3F63 A;  1YEP A;  3F4T A;  2HYX A;  1BED A;  1XWA A;  4X1U A;  3ZMK A;  4ZL8 A;  5DCH A;  5B6M A;  2DML A;  5AN1 A;  2B3S A;  3I6A A;  4MF5 A;  3KIJ A;  1X9W B;  4FIW A;  4WXT A;  2FA4 A;  3EMP A;  3A3T A;  4I5Q A;  6GSY A;  2C1Y A;  4V2L A;  1OKD A;  1U3I A;  4POL A;  1R5P A;  5G31 A;  3L9S A;  1SEN A;  17GS A;  1ABA A;  3I69 A;  3KMN A;  2KP1 A;  4ULX A;  3GH6 A;  2IME A;  1FVK A;  4TXO A;  1CQH A;  1FB6 A;  2YV7 A;  4MJA A;  4PQ1 A;  3VWX A;  4E8H A;  3HD5 A;  3QPM A;  4XRA A;  3P7X A;  1GUM A;  3TRX A;  3DIE A;  2VL3 A;  3FR3 A;  4JZQ A;  3LFL A;  3HY2 A;  5E59 A;  2A4V A;  1XWB A;  4POK A;  3LOR A;  3LG6 A;  5GSS A;  3VWW A;  2G0F A;  2FHE A;  1WRY A;  4PNF A;  1EEJ A;  3Q19 A;  4G19 A;  4BVY A;  1RQM A;  5AGY A;  2IN3 A;  2YPM A;  4ECI A;  3F6D A;  1TJD A;  2H8L A;  3H79 A;  2OE0 A;  1VF2 A;  5H5S A;  5AIX A;  2CZ3 A;  2B5X A;  1U3A A;  1URM A;  2AHE A;  3MAK A;  1LJR A;  4OFN A;  4N10 A;  3KD0 A;  4BL7 A;  2CA8 A;  4K9Z A;  1ZOF A;  4HQZ A;  3GTU B;  2IIY A;  3CSI A;  4ZBA A;  3NZN A;  2I1U A;  5ELG A;  4PQI A;  2B1L A;  5ECK B;  2YP6 A;  1A23 A;  1XVQ A;  3WGE A;  2DJ3 A;  4HJ2 A;  1F3B A;  1OE7 A;  3EU3 A;  2MBT A;  4CDO A;  2IL3 A;  1IYH A;  3HYP A;  1C72 A;  1T3B A;  2H01 A;  1GNW A;  1GTU A;  5CAX A;  1F37 A;  3QMX A;  1O81 A;  6GSX A;  1EP8 A;  1XW9 A;  2KUC A;  2VO4 A;  3HZ4 A;  4GLT A;  3GYK A;  1PRX A;  2AB6 A;  3ERF A;  4PUA A;  2LRC A;  3TJK A;  4BVX A;  2LTK A;  2TRC P;  1XBS A;  2P31 A;  2CVK A;  3TKS E;  4XIH A;  4HI7 A;  4I2U A;  4NMU A;  2DLX A;  2M72 A;  4IJ3 A;  2N5B A;  5J9B A;  4FO5 A;  1MDJ A;  2XBQ A;  3HJM A;  3WGX A;  3KP9 A;  1XOB A;  4GCI A;  4YAV A;  1J08 A;  1QK8 A;  3KMO A;  2JZT A;  3CSH A;  3UMA A;  4XS1 A;  1G0T A;  2L4C A;  5ECL B;  1YJ6 A;  2OKA A;  10GS A;  2DJK A;  3TJG A;  3GMF A;  4MJB A;  4L5L A;  2LRT A;  4L5O A;  1SKR B;  1PKZ A;  1V58 A;  3Q18 A;  4EUY A;  4WBJ A;  4K0G A;  4F82 A;  4L0U A;  3WT2 A;  4E8E A;  4HS1 A;  1PL2 A;  3VPT A;  4ECC A;  1A0F A;  4KDY A;  4ZB6 A;  4GQC A; 
#chains in the Genus database with same CATH topology
 1OAZ A;  1ON4 A;  1AXD A;  3PPU A;  3ME8 A;  4TR4 A;  2OE3 A;  3TOT A;  2E7P A;  3A5W A;  4Q5R A;  3N9J A;  1OE8 A;  2HE3 A;  2YV9 A;  1VRS D;  4IGJ A;  3QR6 A;  5CO3 A;  3IAM 2;  5AIS A;  1JZO A;  1A2M A;  2OA7 A;  3DVW A;  3IOS A;  1SJI A;  1J0F A;  4O7H A;  1ZGN A;  2WCI A;  1U87 A;  1FB0 A;  5C00 A;  4EKZ A;  4MH3 A;  3HKR A;  4O32 A;  5D9W A;  2H66 A;  4D73 A;  1GSS A;  2K9F A;  3KJY A;  5CRH A;  4XTS A;  3EWL A;  5HR3 A;  2VCT A;  2C3T A;  1FW1 A;  1ERT A;  4EL1 A;  4H86 A;  3GKX A;  3C73 A;  4ECJ A;  3APS A;  3U6V A;  3IAS 2;  1Z3E A;  1EZK A;  4USS A;  4I6X A;  4AJ6 A;  2EC4 A;  2A2P A;  3GA4 A;  1YF1 A;  3H8Q A;  4YQM A;  5ECS A;  2FLS A;  4KA0 A;  1A2L A;  3ZRE A;  3DRN A;  1ZYN A;  2X8G A;  3UAP A;  3DKS A;  1XWK A;  1X5C A;  1I9D A;  4OD7 A;  1AUC A;  6GST A;  2YWO A;  4XS6 A;  2C0D A;  4NPB A;  5ECP B;  1SKS B;  3CTG A;  2LQO A;  5ECR B;  1A0R P;  1HQO A;  1ZL9 A;  2YWI A;  1OKT A;  1XCC A;  5ELA A;  1N8J A;  1GSF A;  2D2Z A;  3PR8 A;  2NPB A;  1YY7 A;  3K8N A;  1B8X A;  4XS4 A;  3LYP A;  3KH7 A;  4FYC A;  1SYR A;  3JCM L;  2GQL A;  3TRP A;  4YH2 A;  2VCZ A;  2H76 A;  3CMI A;  4HDE A;  3KEB A;  2H73 A;  4F2I A;  3D4T A;  4POM A;  2AV4 A;  2C0F A;  1A2J A;  2J23 A;  2CZ2 A;  2AJQ B;  3W6G A;  1R26 A;  5JCG A;  3KM6 A;  1GL8 A;  2XPE A;  3G7J A;  3BBY A;  4BIK A;  2YNX A;  3LYK A;  3IHQ A;  5F06 A;  3TUE A;  3A2V A;  1PFO A;  4OWY A;  3HXS A;  3MNG A;  1O8W A;  5IO0 A;  3F9U A;  4DVC A;  1XFL A;  3DD3 A;  4RI6 A;  3Q6O A;  3WD6 A;  2FWE A;  2V2G A;  2VUP A;  3M0F A;  4MZC A;  2JZR A;  4AJ8 A;  2CX3 A;  3TKS A;  2QKE A;  1V2A A;  1SK2 A;  1MD3 A;  3UJ1 A;  3RBT A;  1HNA A;  1M7T A;  4GTU A;  1WMJ A;  3U5R E;  4G2E A;  2HZF A;  4TXO B;  1GRX A;  1JZD A;  4ZB8 A;  4ZIL A;  5DVB A;  3QDN A;  3UL3 A;  2P5Q A;  2MMN A;  1PSQ A;  1K0D A;  4IP6 A;  3FW2 A;  3M1G A;  4I2T A;  2R5G A;  4IEL A;  2OJL A;  1YQ1 A;  2RLI A;  1NHO A;  3VPQ A;  1BAY A;  1PMT A;  2HRA A;  1WPI A;  1YF0 A;  1GLQ A;  3ZTL A;  5IPH A;  5B7C A;  2HI7 A;  3CYN A;  4BVY B;  2PUK C;  2I3Y A;  5IMD A;  3US3 A;  5D73 A;  5CYY A;  2N5A A;  2E0Q A;  3KP8 A;  3GX8 A;  2PN8 A;  2DJ1 A;  1T00 A;  1T4Z A;  1UC7 A;  4YAP A;  4GST A;  1FOH A;  1XWG A;  4PUR A;  3KH9 A;  2MZC A;  4BL7 B;  1V57 A;  1TDI A;  4MP4 A;  5KEJ A;  3C7M A;  4ISD A;  4OO5 A;  1M2D A;  2CVB A;  5FT3 A;  14GS A;  4F03 A;  1HYU A;  5HFI A;  2C3Q A;  2PVO C;  1GUK A;  1TK8 B;  4MZB A;  3HJO A;  4MF7 A;  3I9V 2;  2LRN A;  3H1N A;  1VF1 A;  3D0Z A;  1XXU A;  2RM6 A;  2HZE B;  4WET A;  4N30 A;  1K0O A;  2LV3 A;  3C1R A;  5JCU A;  4I97 A;  2X4A A;  4J2F A;  5C04 A;  3VK9 A;  1PN0 A;  4AJ7 A;  2L6C A;  1GSD A;  3F4S A;  5HR2 A;  4BVX B;  2MMO A;  1FO5 A;  4GSS A;  1A8Y A;  3IBH A;  4OFT A;  2GSR A;  2K8S A;  20GS A;  2WRT A;  4KW6 A;  4NAX A;  2OE1 A;  5BRT A;  3S9F A;  2A2R A;  2VL2 C;  1UN2 A;  2R4V A;  3GKK A;  5DJL A;  1BJX A;  3QFA C;  3MWH A;  3FZ5 A;  3ZRD A;  2LUS A;  3EU4 A;  2X99 A;  3MIX A;  6GSS A;  1K3Y A;  2LNT A;  4WEY A;  2DMM A;  2FUG 2;  3ZVJ D;  3HDC A;  4EIQ A;  22GS A;  1MD4 A;  4G0L A;  3A5I A;  3PGT A;  4V2N A;  3ERG A;  3HVX A;  4BPY A;  2WFC A;  4OFM A;  4N0Z A;  2DC5 A;  3EC3 A;  5D9T A;  2ON5 A;  2REM A;  4JBB A;  2DIY A;  4FH8 A;  4X0X A;  1V9W A;  4KF9 A;  4K7N A;  1PKW A;  3UOM A;  1TW9 A;  2QC7 A;  3GL5 A;  1OC9 A;  2L6D A;  3DXB A;  2H1G A;  1KEB A;  4Q5F A;  2NVL A;  4EE0 A;  4MPF A;  5ENU A;  3IC4 A;  1UVZ A;  1V98 A;  4LMW A;  2FD3 A;  4OMV A;  1QMV A;  2DKH A;  2JAC A;  1LU4 A;  4ZL7 A;  5A5K A;  3ZML A;  4IP1 A;  2HSY A;  3C71 A;  1W89 A;  3IXR A;  4X4J A;  2YWN A;  2VM1 A;  2BJX A;  2C0E A;  4MA9 A;  2C4J A;  3Q74 A;  3TCO A;  5ECH B;  2V6K A;  2C0G A;  2H6Y A;  4LMV A;  2PBJ A;  2VAF A;  4P3Y B;  3VI5 A;  2HZE A;  3IR4 A;  3VWV A;  1OVN A;  1R7H A;  1WWJ A;  2UZ8 A;  4D73 B;  3GFK A;  3TJF A;  2K18 A;  4F0C A;  4HEA 2;  3P8W A;  5IMV A;  3BD2 A;  3LSZ A;  2IMK A;  4IQA A;  5BMU A;  1JLW A;  4EVM A;  1IYI A;  3UEM A;  4K6X A;  1DE1 A;  1BG5 A;  3HA9 A;  2JSZ A;  1SD9 A;  3FHK A;  2GZZ A;  1AIU A;  1Z6N A;  2VCW A;  2QA2 A;  1T8E B;  1SK1 A;  18GS A;  5L71 A;  3UBK A;  4WKW A;  1X5D A;  4V1A g;  1M0U A;  3QCP A;  2GDR A;  5H5R A;  1E2Y A;  9GSS A;  3J7Y k;  4K2D A;  4DSS A;  2DJ2 A;  3IE3 A;  1SL0 B;  3IC8 A;  3IDV A;  2H30 A;  5DBQ A;  5G1L A;  2HRN A;  3QAV A;  5COH A;  2HSH A;  3O6T A;  4TKY A;  2VLV A;  5G1K A;  3ZL5 A;  1B9Y C;  4IBP A;  1K0B A;  3TOU A;  2F3M A;  4XS4 B;  2PU9 C;  1TXX A;  4KX4 A;  2LNS A;  3HCZ A;  2M80 A;  3F3R A;  3ZIV A;  1YZX A;  3GST A;  4JU5 A;  2FWF A;  4WR4 A;  3ZFB A;  5LCZ A;  1RK4 A;  4IS0 A;  5F0G A;  1R4W A;  3SBC A;  2HFD A;  1ERW A;  2H19 A;  1ZYE A;  1X9M B;  4EF0 A;  3I43 A;  2QA1 A;  3P2A A;  1A8L A;  3ZVJ A;  2FWH A;  3BCI A;  5ECO B;  3P90 A;  1Z9H A;  2TIR A;  5IMZ A;  3G9B A;  5DQY A;  2RUF A;  3L9U A;  3W8J A;  2R2J A;  3GIX A;  2H6Z A;  1KBN A;  4TR0 A;  1HNB A;  2IMI A;  2JSY A;  4PXO A;  3TJJ A;  4LL1 B;  2DIZ A;  5AIV A;  1AQX A;  4LA1 A;  1NW2 A;  3TGZ A;  4IJI A;  4J57 E;  4ZBB A;  1PX7 A;  1DE2 A;  2RM5 A;  3EE2 A;  1SU9 A;  1F9M A;  2JL4 A;  1TU8 A;  3TRQ A;  5KN3 A;  3H93 A;  1WP0 A;  1JLV A;  3CXG A;  1TRU A;  4YKF A;  4K5S A;  3TKR A;  1Q4J A;  5FHI A;  2FNO A;  3LXT A;  2H71 A;  3FZ4 A;  4IVF A;  1ZYQ B;  3W8S A;  4O5R A;  4G10 A;  4YKG A;  3IK7 A;  3A2W A;  2CAI A;  2VIM A;  1ZCP A;  5ID2 A;  3ZFL A;  5LD0 A;  1PA3 A;  1YEX A;  1NM3 A;  2FY6 A;  1M9B A;  2TRX A;  2VCV A;  4TW5 A;  1EGO A;  2R6K A;  2O89 A;  4EXJ A;  3R3E A;  4NHZ A;  3EUR A;  1ERV A;  5EPF A;  3AY8 A;  5E4W A;  3KTB A;  13GS A;  4HZ2 A;  4MDC A;  4PUF C;  1QGV A;  2GSS A;  1U6T A;  1GSQ A;  3FR9 A;  1Z7R A;  3TJB A;  4JED A;  2PWJ A;  2EIO A;  1O6J A;  4DSQ A;  2IJY A;  5EVO A;  4BA7 A;  3EVI A;  5IOW A;  1EWX A;  2DJJ A;  1B9X C;  5CRW A;  1B4P A;  3J7Y b;  4RI7 A;  2HNL A;  2VCQ A;  4DSR A;  1EEM A;  2FA8 A;  3NIV A;  1NHY A;  1XPV A;  4PNG A;  3D21 A;  1B48 A;  3FYG A;  2C80 A;  1XW6 A;  5D93 A;  4K7O A;  4IHU A;  4F9Z A;  2EIR A;  1E6B A;  4AF2 A;  3FRC A;  3KXO A;  5B6N A;  1B4Q A;  2GT6 A;  4TR3 A;  3MSZ A;  1DUG A;  1U88 A;  2IMF A;  3EIN A;  4IW9 A;  2PER A;  4HQS A;  1VGL A;  2I81 A;  3CQF A;  3HVN A;  3GUS A;  3CTF A;  4J56 E;  2V32 A;  2ES7 A;  5A4U A;  2LEG A;  5IMA A;  2ZUP A;  1AQV A;  2GZY A;  4X43 A;  1AQW A;  5CNW A;  2HSM A;  2O87 A;  2X8H A;  1EOH A;  2XPD A;  3LEF A;  3D4M A;  1CQG A;  2YCD A;  4ACS A;  4BWQ A;  4KGI A;  3GHA A;  2V41 A;  3IA1 A;  3MDK A;  3OR5 A;  3WYW A;  5IMC A;  4WF5 A;  1DBY A;  4G0K A;  4HUA A;  2GTU A;  2H0G A;  3BCK A;  3F3Q A;  4OCF A;  4MMM A;  4RQX A;  5A4V A;  2Z9S A;  3M3M A;  3QD9 A;  2XHF A;  1OC9 B;  3FEU A;  1TRS A;  1WIK A;  3TKS C;  1F3A A;  4MK3 A;  4PTS A;  1USB A;  5J3R A;  4KB3 A;  1O7U A;  5B8B A;  5JCW A;  4RQR A;  4EIP A;  2F9S A;  4QL7 A;  3ZYW A;  1PGT A;  1SYX A;  4K1F A;  4CHS A;  3CBU A;  1MTC A;  5GST A;  3FZA A;  1SD8 A;  2B6M A;  1ERU A;  4I8B A;  2IFQ B;  3RDW A;  2E2G A;  1K3L A;  1WE0 A;  2FGX A;  4KSO A;  3LWA A;  4MJC A;  5CRE A;  3LXZ A;  5GZZ B;  4K2X A;  1YKC A;  5D8I A;  2DSA A;  4XCS A;  1Z5Y E;  5IPG A;  4EC0 A;  1M2B A;  1TP9 A;  5HFG A;  3RAZ A;  3QOU A;  2DBC A;  3E0U A;  4Q5N A;  2X64 A;  5ECM B;  4NV2 A;  2LJR A;  1XG8 A;  5JWQ B;  1AAZ A;  1M9A A;  4IQ1 A;  4GSN A;  2YZH A;  2B7K A;  1SL1 B;  3C1S A;  4MPG A;  3WT1 A;  3E9J B;  2O8V B;  2QSI A;  5JWO B;  2IMD A;  1I5G A;  2N5F A;  1GTA A;  4QQ7 A;  1PL1 A;  3IPZ A;  2CVD A;  4KAE A;  4ZXG A;  1TTZ A;  2OBI A;  2LJA A;  1G7O A;  2WGR A;  3QAG A;  2KP2 A;  4ID0 A;  5H5Q A;  1ILO A;  2HLS A;  1XZO A;  5JWR B;  3KCM A;  2J9H A;  1SK0 A;  5D9X A;  1SL2 B;  1BX9 A;  4DSS B;  3FK8 A;  4TVE A;  2YJH A;  4CY6 A;  5HR0 A;  4QL9 A;  1Z7P A;  6GSW A;  1GSY A;  4JRR A;  3ZZX A;  1NSW A;  4GQF A;  3GKN A;  2B1K A;  2R3X A;  2H75 A;  2XC2 A;  2CX4 A;  1GTB A;  3IV4 A;  2EIQ A;  3HHV A;  1BQ7 A;  5IMF A;  4HZ4 A;  2I9H A;  5DAK A;  1GSU A;  4JR6 A;  3CRT A;  3R2Q A;  4OCE A;  3VWU A;  2X49 A;  3EPT A;  2AAW A;  4EDZ A;  1EV4 A;  4KND A;  4RUV A;  2LST A;  5J4U A;  2O85 A;  1QXH A;  5CRD A;  19GS A;  3N5O A;  4LLR A;  3VLN A;  3ME7 A;  1DSB A;  1GH2 A;  4Q5Q A;  4NXI A;  5EY6 A;  1S3C A;  4NV5 A;  2IFQ A;  1GTI A;  1X0R A;  1N2A A;  4XHM A;  2ZNM A;  1PQN A;  4L0W A;  4TR1 A;  2P0G A;  2L59 A;  2VLU A;  4KCA A;  2K6V A;  2NTO A;  2FWG A;  3HVS A;  3ISO A;  1S3D A;  1PN9 A;  2GLR A;  6GSU A;  2JAD A;  3H4K A;  3IRA A;  4Z2U A;  3GH9 A;  5F05 A;  2H74 A;  4TN8 A;  5A4W A;  3GKM A;  11GS A;  2HRF A;  2H72 A;  4IN0 A;  4PQH A;  3GSS A;  3RHB A;  1TRW A;  5IQY A;  1QQ2 A;  2AYT A;  3L0H A;  2YOI A;  4WBR D;  3LQ7 A;  2V6O A;  4MAB A;  1OYJ A;  3IHG A;  4KCE A;  4PGT A;  3G7I A;  4O92 A;  3GUR A;  2R0P A;  3WGD A;  2H1D A;  3EMX A;  5DJM A;  4GXZ A;  1GP1 A;  5DDL A;  2OAD A;  1KNG A;  2VCX A;  4EO3 A;  4OO4 A;  5ID2 B;  5INY A;  4HJM A;  1TKD B;  1ST9 A;  1EV9 A;  2ZCT A;  1FG4 A;  5ABR A;  1O73 A;  1TK5 B;  1G6W A;  3O3T A;  3ERW A;  2GT5 A;  5HR1 A;  2MBS A;  2GGT A;  2ALB A;  4HOJ A;  1QUW A;  3NOF A;  4N11 A;  1MEK A;  4KE3 A;  1JHB A;  4ECB A;  5KOX A;  2FCH A;  3HVV A;  1TU7 A;  2H1A A;  4ILF A;  1AC1 A;  3DML A;  3KTL A;  5IOX A;  2C8U A;  3O76 A;  1GNE A;  5DAL B;  4V2M A;  2KOK A;  3F6F A;  2M46 A;  1THX A;  4ZIJ A;  3M9J A;  2HT9 A;  2LKU A;  1UA5 A;  2A4H A;  1EGR A;  5D96 A;  4HU9 A;  8GSS A;  3FR6 A;  4NWY A;  1OC8 A;  3VI7 A;  1H75 A;  3UIW A;  1JFU A;  4O5U A;  3LGC A;  4ZB9 A;  1A24 A;  3TKQ A;  1T7P B;  4HU7 A;  5D9V A;  3GV1 A;  3FY7 A;  3GNJ A;  5IM9 A;  4L8E A;  2LJK A;  1M2A A;  1K0M A;  3TKP A;  2X8C A;  2G2Q A;  1T1V A;  5HQP A;  3QAW A;  2GQK A;  2MMZ A;  3FKF A;  3CSJ A;  4PX1 A;  2BTO T;  3BOA A;  2K8V A;  1G6Y A;  2C3N A;  3M9K A;  5J41 A;  5CP1 A;  5KN1 A;  3HJP A;  1G7E A;  4GWR A;  1WJK A;  4KSM A;  4XRD A;  2GS3 A;  4TOP A;  3D5J A;  2YJ7 A;  3GTU A;  1R5A A;  4POB A;  3VFI A;  1ML6 A;  5ECI B;  1MDI A;  4KDU A;  2R37 A;  1GWC A;  1MDK A;  2CAQ A;  2VL9 A;  1X5E A;  2LQQ A;  5DCG A;  3M8N A;  1GUH A;  4CW9 A;  1Z6M A;  1TK0 B;  1XWC A;  4JR4 A;  4ICY A;  4GRF A;  3UVH A;  3DGQ A;  2NDO A;  1GUL A;  5EL8 A;  3F8U A;  2CV4 A;  1O85 A;  4MLY A;  1XW5 A;  2WS2 A;  3GX0 A;  2OBK A;  4GF0 A;  4YQV A;  2HRK A;  1M3J A;  3KGK A;  6GSV A;  4WR5 A;  2VOC A;  1YKA A;  2GVP A;  4FYU A;  5G5E A;  2B5E A;  3D22 A;  1ZMA A;  3QFB C;  1S3A A;  4BWS A;  5CRG A;  5KN2 A;  4AGS A;  1FVJ A;  4Z2T A;  1TI1 A;  4K0N A;  2I4A A;  3DEX A;  4MCU A;  4MJE A;  2WZ9 A;  3RPN A;  3ZLP A;  2OAC A;  3PIN A;  3EYT A;  4F0B A;  2YN1 A;  1BYE A;  5HFK A;  4YQU A;  2LS5 A;  3ZIJ A;  4ML1 A;  3GN3 A;  5DAL A;  3RHC A;  5GAN D;  1FOV A;  1VF3 A;  1Y6E A;  3LJR A;  2PVQ A;  3L9V A;  1FAA A;  5ECQ B;  2B5Y A;  4MF6 A;  5F07 A;  7GSS A;  4TRX A;  4MZW A;  1F6M C;  4IKH A;  5KN0 A;  1ACV A;  4FYB A;  1SJ6 A;  4LL4 B;  5FWG A;  1HNC A;  3UAR A;  16GS A;  2KLX A;  1H4O A;  1QFN A;  2L5O A;  1XIY A;  3KZQ A;  3CRU A;  1OC3 A;  2WUL A;  1YDK A;  4FQU A;  1GLP A;  3UVT A;  1HD2 A;  3FZ9 A;  3LW9 A;  1K0N A;  1K0C A;  2WB9 A;  4ZL9 A;  4V1A p;  5GAP D;  2L5L A;  1TRV A;  1S3R A;  2JZS A;  3UBL A;  3ZIT A;  2IWT A;  1EP7 A;  3ED3 A;  5IIZ A;  3F4R A;  1SJZ A;  2WDU A;  2DJ0 A;  3GRX A;  5F8B A;  3DWV A;  3A2X A;  4JE1 A;  1EOG A;  3TDG A;  2HXK A;  1T4Y A;  2GQM A;  1X9S B;  3TB2 A;  2MYG A;  1K3O A;  2PMT A;  1Y25 A;  3HZ8 A;  4Z7X A;  5B8A A;  2H0H A;  2L4Q A;  1PD2 1;  3DYR A;  1V40 A;  3FMW A;  3BJ5 A;  2GST A;  2BMX A;  2PPT A;  2V1M A;  2O7K A;  5KOW A;  2F51 A;  2WJU A;  3APO A;  2L57 A;  1W4V A;  2H70 A;  3L78 A;  1JZR A;  1F2E A;  4WF4 A;  1J9B A;  4G9H A;  1SKW B;  2GZP A;  4K8M A;  4N0V A;  1K0A A;  3VUR A;  5DAK B;  2VM2 A;  3SWL A;  1M99 A;  5IO2 A;  1LBK A;  2AUV A;  4KUN A;  2ON7 A;  2P5R A;  1O8X A;  5LNK e;  5ECN B;  1VF4 A;  2XBI A;  3IK9 A;  2B7J A;  2F8A A;  2H0I A;  1Q98 A;  2VLT A;  4KH7 A;  2VD1 A;  2YAN A;  2KHP A;  3E3E A;  1ZZY A;  5DQS A;  2QGV A;  2YZU A;  1JZW A;  3RPP A;  2CT6 A;  2MMA A;  1THO A;  2GSQ A;  2CQ9 A;  5G5F A;  2VD0 A;  4K7I A;  1XVW A;  3DVX A;  4K5R A;  4TR1 B;  12GS A;  1PX6 A;  4DEJ A;  4KDX A;  4NHW A;  3D6I A;  4ML6 A;  2H6X A;  3F0I A;  4EDY A;  3V1W A;  5J5N A;  2F8F A;  1AW9 A;  1TOF A;  2RII A;  3PH9 A;  2VL2 A;  2JU5 A;  3APQ A;  3L4N A;  1XOA A;  2RUE A;  2YWM A;  2H1B A;  3C8E A;  2IPA A;  2A2S A;  5G30 A;  1KTE A;  1RW1 A;  3G7Y A;  2E2M A;  2PGT A;  1GSE A;  1FHE A;  1WOU A;  3GL3 A;  5G2Z A;  2NBS A;  2R0G A;  1TI3 A;  5J9C A;  4MH2 A;  4ZBD A;  4TXV A;  3F63 A;  1YEP A;  3F4T A;  2HYX A;  4CY8 A;  1BED A;  1XWA A;  4X1U A;  3ZMK A;  4ZL8 A;  5DCH A;  5B6M A;  2DML A;  5AN1 A;  2B3S A;  3I6A A;  4MF5 A;  3KIJ A;  1X9W B;  4FIW A;  4WXT A;  2FA4 A;  3EMP A;  3A3T A;  4I5Q A;  6GSY A;  2C1Y A;  4V2L A;  4Z2R A;  1OKD A;  1U3I A;  4POL A;  1R5P A;  5G31 A;  3L9S A;  1SEN A;  17GS A;  1ABA A;  3I69 A;  3KMN A;  2KP1 A;  4ULX A;  3GH6 A;  2IME A;  1FVK A;  4TXO A;  4HSC X;  1CQH A;  1FB6 A;  2YV7 A;  4MJA A;  4PQ1 A;  3VWX A;  4E8H A;  3HD5 A;  3QPM A;  4XRA A;  3P7X A;  1GUM A;  3TRX A;  3DIE A;  2VL3 A;  3FR3 A;  4JZQ A;  1ZYP A;  3LFL A;  3HY2 A;  5E59 A;  2A4V A;  1XWB A;  4POK A;  3LOR A;  3LG6 A;  5GSS A;  3VWW A;  2G0F A;  2FHE A;  1WRY A;  4PNF A;  1EEJ A;  3Q19 A;  4G19 A;  4BVY A;  4G0I A;  1RQM A;  5AGY A;  2DKI A;  2IN3 A;  2YPM A;  4ECI A;  3MYD A;  3F6D A;  1TJD A;  2H8L A;  3H79 A;  2OE0 A;  1VF2 A;  5H5S A;  5AIX A;  2CZ3 A;  2B5X A;  1U3A A;  1URM A;  2AHE A;  3MAK A;  1LJR A;  4OFN A;  4N10 A;  3KD0 A;  4BL7 A;  1M3I A;  2CA8 A;  4K9Z A;  1ZOF A;  4HQZ A;  3GTU B;  4O5Q A;  2IIY A;  3CSI A;  4ZBA A;  3NZN A;  2I1U A;  5ELG A;  4PQI A;  2B1L A;  5ECK B;  2YP6 A;  1A23 A;  1XVQ A;  3WGE A;  2DJ3 A;  4HJ2 A;  1F3B A;  1OE7 A;  3EU3 A;  2MBT A;  4CDO A;  2IL3 A;  1IYH A;  3HYP A;  1C72 A;  1T3B A;  2H01 A;  1GNW A;  1GTU A;  5CAX A;  1F37 A;  3QMX A;  1O81 A;  6GSX A;  1EP8 A;  1XW9 A;  2KUC A;  2VO4 A;  3HZ4 A;  4GLT A;  3GYK A;  1PRX A;  2AB6 A;  3ERF A;  4PUA A;  2LRC A;  3TJK A;  4BVX A;  2R0C A;  2LTK A;  2TRC P;  1XBS A;  2P31 A;  2CVK A;  3TKS E;  4XIH A;  4HI7 A;  4I2U A;  4NMU A;  2DLX A;  2M72 A;  4IJ3 A;  2N5B A;  5J9B A;  4FO5 A;  1MDJ A;  2XBQ A;  3HJM A;  3WGX A;  3KP9 A;  1XOB A;  4GCI A;  4YAV A;  1J08 A;  1QK8 A;  3KMO A;  2JZT A;  3CSH A;  3UMA A;  4XS1 A;  1G0T A;  2L4C A;  5ECL B;  1YJ6 A;  2OKA A;  10GS A;  2DJK A;  3TJG A;  3GMF A;  4MJB A;  4L5L A;  2LRT A;  4L5O A;  1SKR B;  1PKZ A;  1V58 A;  3Q18 A;  4EUY A;  4WBJ A;  4K0G A;  4F82 A;  4L0U A;  3WT2 A;  4E8E A;  4HS1 A;  1PL2 A;  3VPT A;  4MNN A;  4ECC A;  1A0F A;  4KDY A;  4ZB6 A;  4A5P A;  4GQC A; 
#chains in the Genus database with same CATH homology
 1OAZ A;  1ON4 A;  1AXD A;  3PPU A;  3ME8 A;  4TR4 A;  2OE3 A;  3TOT A;  2E7P A;  3A5W A;  4Q5R A;  3N9J A;  1OE8 A;  2HE3 A;  2YV9 A;  1VRS D;  4IGJ A;  3QR6 A;  5AIS A;  3IAM 2;  5CO3 A;  1JZO A;  1A2M A;  2OA7 A;  3DVW A;  3IOS A;  1SJI A;  1J0F A;  4O7H A;  1ZGN A;  2WCI A;  1U87 A;  1FB0 A;  5C00 A;  4EKZ A;  4MH3 A;  3HKR A;  4O32 A;  5D9W A;  2H66 A;  4D73 A;  1GSS A;  2K9F A;  3KJY A;  5CRH A;  4XTS A;  3EWL A;  5HR3 A;  2VCT A;  2C3T A;  1FW1 A;  1ERT A;  4EL1 A;  4H86 A;  3GKX A;  3C73 A;  4ECJ A;  3APS A;  3U6V A;  3IAS 2;  1Z3E A;  1EZK A;  4USS A;  4I6X A;  4AJ6 A;  2EC4 A;  2A2P A;  3GA4 A;  1YF1 A;  3H8Q A;  4YQM A;  5ECS A;  2FLS A;  4KA0 A;  1A2L A;  3ZRE A;  3DRN A;  1ZYN A;  2X8G A;  3UAP A;  3DKS A;  1XWK A;  1X5C A;  1I9D A;  4OD7 A;  1AUC A;  6GST A;  2YWO A;  4XS6 A;  2C0D A;  4NPB A;  5ECP B;  1SKS B;  3CTG A;  2LQO A;  5ECR B;  1A0R P;  1HQO A;  1ZL9 A;  2YWI A;  1OKT A;  1XCC A;  5ELA A;  1N8J A;  1GSF A;  2D2Z A;  3PR8 A;  2NPB A;  1YY7 A;  3K8N A;  1B8X A;  4XS4 A;  3LYP A;  3KH7 A;  4FYC A;  1SYR A;  3JCM L;  2GQL A;  3TRP A;  4YH2 A;  2VCZ A;  2H76 A;  3CMI A;  4HDE A;  3KEB A;  2H73 A;  4F2I A;  3D4T A;  4POM A;  2AV4 A;  2C0F A;  1A2J A;  2J23 A;  2CZ2 A;  2AJQ B;  3W6G A;  1R26 A;  5JCG A;  3KM6 A;  1GL8 A;  2XPE A;  3G7J A;  3BBY A;  2YNX A;  3LYK A;  3IHQ A;  5F06 A;  3TUE A;  3A2V A;  4OWY A;  3HXS A;  3MNG A;  1O8W A;  5IO0 A;  3F9U A;  4DVC A;  1XFL A;  3DD3 A;  4RI6 A;  3Q6O A;  3WD6 A;  2FWE A;  2V2G A;  2VUP A;  3M0F A;  4MZC A;  2JZR A;  4AJ8 A;  2CX3 A;  3TKS A;  2QKE A;  1V2A A;  1SK2 A;  1MD3 A;  3UJ1 A;  3RBT A;  1HNA A;  1M7T A;  4GTU A;  1WMJ A;  3U5R E;  4G2E A;  2HZF A;  4TXO B;  1GRX A;  1JZD A;  4ZB8 A;  4ZIL A;  5DVB A;  3QDN A;  3UL3 A;  2P5Q A;  2MMN A;  1PSQ A;  1K0D A;  4IP6 A;  3FW2 A;  3M1G A;  4I2T A;  2R5G A;  4IEL A;  2OJL A;  1YQ1 A;  2RLI A;  1NHO A;  3VPQ A;  1BAY A;  1PMT A;  2HRA A;  1WPI A;  1YF0 A;  1GLQ A;  3ZTL A;  5IPH A;  5B7C A;  2HI7 A;  3CYN A;  4BVY B;  2PUK C;  2I3Y A;  5IMD A;  3US3 A;  5D73 A;  5CYY A;  2N5A A;  2E0Q A;  3KP8 A;  3GX8 A;  2PN8 A;  2DJ1 A;  1T00 A;  1T4Z A;  1UC7 A;  4YAP A;  4GST A;  1FOH A;  1XWG A;  4PUR A;  3KH9 A;  2MZC A;  4BL7 B;  1V57 A;  1TDI A;  4MP4 A;  5KEJ A;  3C7M A;  4ISD A;  4OO5 A;  1M2D A;  2CVB A;  5FT3 A;  14GS A;  4F03 A;  1HYU A;  5HFI A;  2C3Q A;  2PVO C;  1GUK A;  1TK8 B;  4MZB A;  3HJO A;  4MF7 A;  3I9V 2;  2LRN A;  3H1N A;  1VF1 A;  3D0Z A;  1XXU A;  2RM6 A;  2HZE B;  4WET A;  4N30 A;  1K0O A;  2LV3 A;  3C1R A;  5JCU A;  4I97 A;  2X4A A;  4J2F A;  5C04 A;  3VK9 A;  1PN0 A;  4AJ7 A;  2L6C A;  1GSD A;  3F4S A;  5HR2 A;  4BVX B;  2MMO A;  1FO5 A;  4GSS A;  1A8Y A;  3IBH A;  4OFT A;  2GSR A;  2K8S A;  20GS A;  2WRT A;  4KW6 A;  4NAX A;  2OE1 A;  5BRT A;  3S9F A;  2A2R A;  2VL2 C;  1UN2 A;  2R4V A;  3GKK A;  5DJL A;  1BJX A;  3QFA C;  3MWH A;  3FZ5 A;  3ZRD A;  2LUS A;  3EU4 A;  2X99 A;  3MIX A;  6GSS A;  1K3Y A;  2LNT A;  4WEY A;  2DMM A;  2FUG 2;  3ZVJ D;  3HDC A;  4EIQ A;  22GS A;  1MD4 A;  4G0L A;  3A5I A;  3PGT A;  4V2N A;  3ERG A;  3HVX A;  4BPY A;  2WFC A;  4OFM A;  4N0Z A;  2DC5 A;  3EC3 A;  5D9T A;  2ON5 A;  2REM A;  4JBB A;  2DIY A;  4FH8 A;  4X0X A;  1V9W A;  4KF9 A;  4K7N A;  1PKW A;  3UOM A;  1TW9 A;  2QC7 A;  3GL5 A;  1OC9 A;  2L6D A;  3DXB A;  2H1G A;  1KEB A;  4Q5F A;  2NVL A;  4EE0 A;  4MPF A;  5ENU A;  3IC4 A;  1UVZ A;  1V98 A;  4LMW A;  2FD3 A;  4OMV A;  1QMV A;  2DKH A;  2JAC A;  1LU4 A;  4ZL7 A;  5A5K A;  3ZML A;  4IP1 A;  2HSY A;  3C71 A;  1W89 A;  3IXR A;  4X4J A;  2YWN A;  2VM1 A;  2BJX A;  2C0E A;  4MA9 A;  2C4J A;  3Q74 A;  3TCO A;  5ECH B;  2V6K A;  2C0G A;  2H6Y A;  4LMV A;  2PBJ A;  2VAF A;  4P3Y B;  3VI5 A;  2HZE A;  3IR4 A;  3VWV A;  1OVN A;  1R7H A;  1WWJ A;  2UZ8 A;  4D73 B;  3GFK A;  3TJF A;  2K18 A;  4F0C A;  4HEA 2;  3P8W A;  5IMV A;  3BD2 A;  3LSZ A;  2IMK A;  4IQA A;  5BMU A;  1JLW A;  4EVM A;  1IYI A;  3UEM A;  4K6X A;  1DE1 A;  1BG5 A;  3HA9 A;  2JSZ A;  1SD9 A;  3FHK A;  2GZZ A;  1AIU A;  1Z6N A;  2VCW A;  2QA2 A;  1T8E B;  1SK1 A;  18GS A;  5L71 A;  3UBK A;  4WKW A;  1X5D A;  4V1A g;  1M0U A;  3QCP A;  2GDR A;  5H5R A;  1E2Y A;  9GSS A;  3J7Y k;  4K2D A;  4DSS A;  2DJ2 A;  3IE3 A;  1SL0 B;  3IC8 A;  3IDV A;  2H30 A;  5DBQ A;  5G1L A;  2HRN A;  3QAV A;  5COH A;  2HSH A;  3O6T A;  4TKY A;  2VLV A;  5G1K A;  3ZL5 A;  1B9Y C;  4IBP A;  1K0B A;  3TOU A;  2F3M A;  4XS4 B;  2PU9 C;  1TXX A;  4KX4 A;  2LNS A;  3HCZ A;  2M80 A;  3F3R A;  3ZIV A;  1YZX A;  3GST A;  4JU5 A;  2FWF A;  4WR4 A;  3ZFB A;  5LCZ A;  1RK4 A;  4IS0 A;  5F0G A;  1R4W A;  3SBC A;  2HFD A;  1ERW A;  2H19 A;  1ZYE A;  1X9M B;  4EF0 A;  3I43 A;  2QA1 A;  3P2A A;  1A8L A;  3ZVJ A;  2FWH A;  3BCI A;  5ECO B;  3P90 A;  1Z9H A;  2TIR A;  5IMZ A;  3G9B A;  5DQY A;  2RUF A;  3L9U A;  3W8J A;  2R2J A;  3GIX A;  2H6Z A;  1KBN A;  4TR0 A;  1HNB A;  2IMI A;  2JSY A;  4PXO A;  3TJJ A;  4LL1 B;  2DIZ A;  5AIV A;  1AQX A;  4LA1 A;  1NW2 A;  3TGZ A;  4IJI A;  4J57 E;  4ZBB A;  1PX7 A;  1DE2 A;  2RM5 A;  3EE2 A;  1SU9 A;  1F9M A;  2JL4 A;  1TU8 A;  3TRQ A;  5KN3 A;  3H93 A;  1WP0 A;  1JLV A;  3CXG A;  1TRU A;  4YKF A;  4K5S A;  3TKR A;  1Q4J A;  5FHI A;  2FNO A;  3LXT A;  2H71 A;  3FZ4 A;  4IVF A;  1ZYQ B;  3W8S A;  4O5R A;  4G10 A;  4YKG A;  3IK7 A;  3A2W A;  2CAI A;  2VIM A;  1ZCP A;  5ID2 A;  3ZFL A;  5LD0 A;  1PA3 A;  1YEX A;  1NM3 A;  2FY6 A;  1M9B A;  2TRX A;  2VCV A;  4TW5 A;  1EGO A;  2R6K A;  2O89 A;  4EXJ A;  3R3E A;  4NHZ A;  3EUR A;  1ERV A;  5EPF A;  3AY8 A;  5E4W A;  3KTB A;  13GS A;  4HZ2 A;  4MDC A;  4PUF C;  1QGV A;  2GSS A;  1U6T A;  1GSQ A;  3FR9 A;  1Z7R A;  3TJB A;  4JED A;  2PWJ A;  2EIO A;  1O6J A;  4DSQ A;  2IJY A;  5EVO A;  4BA7 A;  3EVI A;  5IOW A;  1EWX A;  2DJJ A;  1B9X C;  5CRW A;  1B4P A;  3J7Y b;  4RI7 A;  2HNL A;  2VCQ A;  4DSR A;  1EEM A;  2FA8 A;  3NIV A;  1NHY A;  1XPV A;  4PNG A;  3D21 A;  1B48 A;  3FYG A;  2C80 A;  1XW6 A;  5D93 A;  4K7O A;  4IHU A;  4F9Z A;  2EIR A;  1E6B A;  4AF2 A;  3FRC A;  3KXO A;  5B6N A;  1B4Q A;  2GT6 A;  4TR3 A;  3MSZ A;  1DUG A;  1U88 A;  2IMF A;  3EIN A;  4IW9 A;  2PER A;  4HQS A;  1VGL A;  2I81 A;  3GUS A;  3CTF A;  4J56 E;  2V32 A;  2ES7 A;  5A4U A;  2LEG A;  5IMA A;  2ZUP A;  1AQV A;  2GZY A;  4X43 A;  1AQW A;  5CNW A;  2HSM A;  2O87 A;  2X8H A;  1EOH A;  2XPD A;  3LEF A;  3D4M A;  1CQG A;  2YCD A;  4ACS A;  4BWQ A;  4KGI A;  3GHA A;  2V41 A;  3IA1 A;  3MDK A;  3OR5 A;  3WYW A;  5IMC A;  4WF5 A;  1DBY A;  4G0K A;  4HUA A;  2GTU A;  2H0G A;  3BCK A;  3F3Q A;  4OCF A;  4MMM A;  4RQX A;  5A4V A;  2Z9S A;  3M3M A;  3QD9 A;  2XHF A;  1OC9 B;  3FEU A;  1TRS A;  1WIK A;  3TKS C;  1F3A A;  4MK3 A;  4PTS A;  1USB A;  5J3R A;  4KB3 A;  1O7U A;  5B8B A;  5JCW A;  4RQR A;  4EIP A;  2F9S A;  4QL7 A;  3ZYW A;  1PGT A;  1SYX A;  4K1F A;  4CHS A;  3CBU A;  1MTC A;  5GST A;  3FZA A;  1SD8 A;  2B6M A;  1ERU A;  4I8B A;  2IFQ B;  3RDW A;  2E2G A;  1K3L A;  1WE0 A;  2FGX A;  4KSO A;  3LWA A;  4MJC A;  5CRE A;  3LXZ A;  5GZZ B;  4K2X A;  1YKC A;  5D8I A;  2DSA A;  4XCS A;  1Z5Y E;  5IPG A;  4EC0 A;  1M2B A;  1TP9 A;  5HFG A;  3RAZ A;  3QOU A;  2DBC A;  3E0U A;  4Q5N A;  2X64 A;  5ECM B;  4NV2 A;  2LJR A;  5JWQ B;  1AAZ A;  1M9A A;  4IQ1 A;  4GSN A;  2YZH A;  2B7K A;  1SL1 B;  3C1S A;  4MPG A;  3WT1 A;  3E9J B;  2O8V B;  2QSI A;  5JWO B;  2IMD A;  1I5G A;  2N5F A;  1GTA A;  4QQ7 A;  1PL1 A;  3IPZ A;  2CVD A;  4KAE A;  4ZXG A;  1TTZ A;  2OBI A;  2LJA A;  1G7O A;  2WGR A;  3QAG A;  2KP2 A;  4ID0 A;  5H5Q A;  1ILO A;  2HLS A;  1XZO A;  5JWR B;  3KCM A;  2J9H A;  1SK0 A;  5D9X A;  1SL2 B;  1BX9 A;  4DSS B;  3FK8 A;  4TVE A;  2YJH A;  4CY6 A;  5HR0 A;  4QL9 A;  1Z7P A;  6GSW A;  1GSY A;  4JRR A;  3ZZX A;  1NSW A;  4GQF A;  3GKN A;  2B1K A;  2R3X A;  2H75 A;  2XC2 A;  2CX4 A;  1GTB A;  3IV4 A;  2EIQ A;  3HHV A;  1BQ7 A;  5IMF A;  4HZ4 A;  2I9H A;  5DAK A;  1GSU A;  4JR6 A;  3CRT A;  3R2Q A;  4OCE A;  3VWU A;  2X49 A;  3EPT A;  2AAW A;  4EDZ A;  1EV4 A;  4KND A;  4RUV A;  2LST A;  5J4U A;  2O85 A;  1QXH A;  5CRD A;  19GS A;  3N5O A;  4LLR A;  3VLN A;  3ME7 A;  1DSB A;  1GH2 A;  4Q5Q A;  4NXI A;  5EY6 A;  1S3C A;  4NV5 A;  2IFQ A;  1GTI A;  1X0R A;  1N2A A;  4XHM A;  2ZNM A;  1PQN A;  4L0W A;  4TR1 A;  2P0G A;  2L59 A;  2VLU A;  4KCA A;  2K6V A;  2NTO A;  2FWG A;  3HVS A;  3ISO A;  1S3D A;  1PN9 A;  2GLR A;  6GSU A;  2JAD A;  3H4K A;  3IRA A;  4Z2U A;  3GH9 A;  5F05 A;  2H74 A;  4TN8 A;  5A4W A;  3GKM A;  11GS A;  2HRF A;  2H72 A;  4IN0 A;  4PQH A;  3GSS A;  3RHB A;  1TRW A;  5IQY A;  1QQ2 A;  2AYT A;  3L0H A;  2YOI A;  4WBR D;  3LQ7 A;  2V6O A;  4MAB A;  1OYJ A;  3IHG A;  4KCE A;  4PGT A;  3G7I A;  4O92 A;  3GUR A;  2R0P A;  3WGD A;  2H1D A;  3EMX A;  5DJM A;  4GXZ A;  1GP1 A;  5DDL A;  2OAD A;  1KNG A;  2VCX A;  4EO3 A;  4OO4 A;  5ID2 B;  5INY A;  4HJM A;  1TKD B;  1ST9 A;  1EV9 A;  2ZCT A;  1FG4 A;  5ABR A;  1O73 A;  1TK5 B;  1G6W A;  3O3T A;  3ERW A;  2GT5 A;  5HR1 A;  2MBS A;  2GGT A;  2ALB A;  4HOJ A;  1QUW A;  3NOF A;  4N11 A;  1MEK A;  4KE3 A;  1JHB A;  4ECB A;  5KOX A;  2FCH A;  3HVV A;  1TU7 A;  2H1A A;  4ILF A;  1AC1 A;  3DML A;  3KTL A;  5IOX A;  2C8U A;  3O76 A;  1GNE A;  5DAL B;  4V2M A;  2KOK A;  3F6F A;  2M46 A;  1THX A;  4ZIJ A;  3M9J A;  2HT9 A;  2LKU A;  1UA5 A;  2A4H A;  1EGR A;  5D96 A;  4HU9 A;  8GSS A;  3FR6 A;  4NWY A;  1OC8 A;  3VI7 A;  1H75 A;  3UIW A;  1JFU A;  4O5U A;  3LGC A;  4ZB9 A;  1A24 A;  3TKQ A;  1T7P B;  4HU7 A;  5D9V A;  3GV1 A;  3FY7 A;  3GNJ A;  5IM9 A;  4L8E A;  2LJK A;  1M2A A;  1K0M A;  3TKP A;  2X8C A;  2G2Q A;  1T1V A;  5HQP A;  3QAW A;  2GQK A;  2MMZ A;  3FKF A;  3CSJ A;  4PX1 A;  2BTO T;  3BOA A;  2K8V A;  1G6Y A;  2C3N A;  3M9K A;  5J41 A;  5CP1 A;  5KN1 A;  3HJP A;  1G7E A;  4GWR A;  1WJK A;  4KSM A;  4XRD A;  2GS3 A;  4TOP A;  3D5J A;  2YJ7 A;  3GTU A;  1R5A A;  4POB A;  3VFI A;  1ML6 A;  5ECI B;  1MDI A;  4KDU A;  2R37 A;  1GWC A;  1MDK A;  2CAQ A;  2VL9 A;  1X5E A;  2LQQ A;  5DCG A;  3M8N A;  1GUH A;  4CW9 A;  1Z6M A;  1TK0 B;  1XWC A;  4JR4 A;  4ICY A;  4GRF A;  3UVH A;  3DGQ A;  2NDO A;  1GUL A;  5EL8 A;  3F8U A;  2CV4 A;  1O85 A;  4MLY A;  1XW5 A;  2WS2 A;  3GX0 A;  2OBK A;  4GF0 A;  4YQV A;  2HRK A;  3KGK A;  6GSV A;  4WR5 A;  2VOC A;  1YKA A;  2GVP A;  4FYU A;  5G5E A;  2B5E A;  3D22 A;  1ZMA A;  3QFB C;  1S3A A;  4BWS A;  5CRG A;  5KN2 A;  4AGS A;  1FVJ A;  4Z2T A;  1TI1 A;  4K0N A;  2I4A A;  3DEX A;  4MCU A;  4MJE A;  2WZ9 A;  3RPN A;  3ZLP A;  2OAC A;  3PIN A;  3EYT A;  4F0B A;  2YN1 A;  1BYE A;  5HFK A;  4YQU A;  2LS5 A;  3ZIJ A;  4ML1 A;  3GN3 A;  5DAL A;  3RHC A;  5GAN D;  1FOV A;  1VF3 A;  1Y6E A;  3LJR A;  2PVQ A;  3L9V A;  1FAA A;  5ECQ B;  2B5Y A;  4MF6 A;  5F07 A;  7GSS A;  4TRX A;  4MZW A;  1F6M C;  4IKH A;  5KN0 A;  1ACV A;  4FYB A;  1SJ6 A;  4LL4 B;  5FWG A;  1HNC A;  3UAR A;  16GS A;  2KLX A;  1H4O A;  1QFN A;  2L5O A;  1XIY A;  3KZQ A;  3CRU A;  1OC3 A;  2WUL A;  1YDK A;  4FQU A;  1GLP A;  3UVT A;  1HD2 A;  3FZ9 A;  3LW9 A;  1K0N A;  1K0C A;  2WB9 A;  4ZL9 A;  4V1A p;  5GAP D;  2L5L A;  1TRV A;  2JZS A;  3UBL A;  3ZIT A;  2IWT A;  1EP7 A;  3ED3 A;  5IIZ A;  3F4R A;  1SJZ A;  2WDU A;  2DJ0 A;  3GRX A;  5F8B A;  3DWV A;  3A2X A;  4JE1 A;  1EOG A;  3TDG A;  2HXK A;  1T4Y A;  2GQM A;  1X9S B;  3TB2 A;  2MYG A;  1K3O A;  2PMT A;  1Y25 A;  3HZ8 A;  4Z7X A;  5B8A A;  2H0H A;  2L4Q A;  1PD2 1;  3DYR A;  1V40 A;  3FMW A;  3BJ5 A;  2GST A;  2BMX A;  2PPT A;  2V1M A;  2O7K A;  5KOW A;  2F51 A;  2WJU A;  3APO A;  2L57 A;  1W4V A;  2H70 A;  3L78 A;  1JZR A;  1F2E A;  4WF4 A;  1J9B A;  4G9H A;  1SKW B;  2GZP A;  4K8M A;  4N0V A;  1K0A A;  3VUR A;  5DAK B;  2VM2 A;  3SWL A;  1M99 A;  5IO2 A;  1LBK A;  2AUV A;  4KUN A;  2ON7 A;  2P5R A;  1O8X A;  5LNK e;  5ECN B;  1VF4 A;  2XBI A;  3IK9 A;  2B7J A;  2F8A A;  2H0I A;  1Q98 A;  2VLT A;  4KH7 A;  2VD1 A;  2YAN A;  2KHP A;  3E3E A;  1ZZY A;  5DQS A;  2QGV A;  2YZU A;  1JZW A;  3RPP A;  2CT6 A;  2MMA A;  1THO A;  2GSQ A;  2CQ9 A;  5G5F A;  2VD0 A;  4K7I A;  1XVW A;  3DVX A;  4K5R A;  4TR1 B;  12GS A;  1PX6 A;  4DEJ A;  4KDX A;  4NHW A;  3D6I A;  4ML6 A;  2H6X A;  3F0I A;  4EDY A;  3V1W A;  5J5N A;  2F8F A;  1AW9 A;  1TOF A;  2RII A;  3PH9 A;  2VL2 A;  2JU5 A;  3APQ A;  3L4N A;  1XOA A;  2RUE A;  2YWM A;  2H1B A;  3C8E A;  2IPA A;  2A2S A;  5G30 A;  1KTE A;  1RW1 A;  3G7Y A;  2E2M A;  2PGT A;  1GSE A;  1FHE A;  1WOU A;  3GL3 A;  5G2Z A;  2NBS A;  2R0G A;  1TI3 A;  5J9C A;  4MH2 A;  4ZBD A;  4TXV A;  3F63 A;  1YEP A;  3F4T A;  2HYX A;  4CY8 A;  1BED A;  1XWA A;  4X1U A;  3ZMK A;  4ZL8 A;  5DCH A;  5B6M A;  2DML A;  5AN1 A;  2B3S A;  3I6A A;  4MF5 A;  3KIJ A;  1X9W B;  4FIW A;  4WXT A;  2FA4 A;  3EMP A;  3A3T A;  4I5Q A;  6GSY A;  2C1Y A;  4V2L A;  4Z2R A;  1OKD A;  1U3I A;  4POL A;  1R5P A;  5G31 A;  3L9S A;  1SEN A;  17GS A;  1ABA A;  3I69 A;  3KMN A;  2KP1 A;  4ULX A;  3GH6 A;  2IME A;  1FVK A;  4TXO A;  1CQH A;  1FB6 A;  2YV7 A;  4MJA A;  4PQ1 A;  3VWX A;  4E8H A;  3HD5 A;  3QPM A;  4XRA A;  3P7X A;  1GUM A;  3TRX A;  3DIE A;  2VL3 A;  3FR3 A;  4JZQ A;  1ZYP A;  3LFL A;  3HY2 A;  5E59 A;  2A4V A;  1XWB A;  4POK A;  3LOR A;  3LG6 A;  5GSS A;  3VWW A;  2G0F A;  2FHE A;  1WRY A;  4PNF A;  1EEJ A;  3Q19 A;  4G19 A;  4BVY A;  4G0I A;  1RQM A;  5AGY A;  2DKI A;  2IN3 A;  2YPM A;  4ECI A;  3MYD A;  3F6D A;  1TJD A;  2H8L A;  3H79 A;  2OE0 A;  1VF2 A;  5H5S A;  5AIX A;  2CZ3 A;  2B5X A;  1U3A A;  1URM A;  2AHE A;  3MAK A;  1LJR A;  4OFN A;  4N10 A;  3KD0 A;  4BL7 A;  2CA8 A;  4K9Z A;  1ZOF A;  4HQZ A;  3GTU B;  4O5Q A;  2IIY A;  3CSI A;  4ZBA A;  3NZN A;  2I1U A;  5ELG A;  4PQI A;  2B1L A;  5ECK B;  2YP6 A;  1A23 A;  1XVQ A;  3WGE A;  2DJ3 A;  4HJ2 A;  1F3B A;  1OE7 A;  3EU3 A;  2MBT A;  4CDO A;  2IL3 A;  1IYH A;  3HYP A;  1C72 A;  1T3B A;  2H01 A;  1GNW A;  1GTU A;  5CAX A;  1F37 A;  3QMX A;  1O81 A;  6GSX A;  1EP8 A;  1XW9 A;  2KUC A;  2VO4 A;  3HZ4 A;  4GLT A;  3GYK A;  1PRX A;  2AB6 A;  3ERF A;  4PUA A;  2LRC A;  3TJK A;  4BVX A;  2R0C A;  2LTK A;  2TRC P;  1XBS A;  2P31 A;  2CVK A;  3TKS E;  4XIH A;  4HI7 A;  4I2U A;  4NMU A;  2DLX A;  2M72 A;  4IJ3 A;  2N5B A;  5J9B A;  4FO5 A;  1MDJ A;  2XBQ A;  3HJM A;  3WGX A;  3KP9 A;  1XOB A;  4GCI A;  4YAV A;  1J08 A;  1QK8 A;  3KMO A;  2JZT A;  3CSH A;  3UMA A;  4XS1 A;  1G0T A;  2L4C A;  5ECL B;  1YJ6 A;  2OKA A;  10GS A;  2DJK A;  3TJG A;  3GMF A;  4MJB A;  4L5L A;  2LRT A;  4L5O A;  1SKR B;  1PKZ A;  1V58 A;  3Q18 A;  4EUY A;  4WBJ A;  4K0G A;  4F82 A;  4L0U A;  3WT2 A;  4E8E A;  4HS1 A;  1PL2 A;  3VPT A;  4MNN A;  4ECC A;  1A0F A;  4KDY A;  4ZB6 A;  4A5P A;  4GQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...