5CRWA

Crystal structure of the b'-a' domain of oxidized protein disulfide isomerase complexed with alpha-synuclein peptide (31-41)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
242
structure length
242
Chain Sequence
PLIGEIGPETYSDYMSAGIPLAYIFAETAEERKELSDKLKPIAEAQRGVINFGTIDAKAFGAHAGNLNLKTDKFPAFAIQEVAKNQKFPFDQEKEITFEAIKAFVDDFVAGKIEPSIKSEPIPEKQEGPVTVVVAKNYNEIVLDDTKDVLIEFYAPWCGHCKALAPKYEELGALYAKSEFKDRVVIAKVDATANDVPDEIQGFPTIKLYPAGAKGQPVTYSGSRTVEDLIKFIAENGKYKAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein disulfide-isomerase
publication title Structural basis of redox-dependent substrate binding of protein disulfide isomerase.
pubmed doi rcsb
source organism Humicola insolens
molecule tags Isomerase/metal binding protein
total genus 70
structure length 242
sequence length 242
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5crwA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5crwA01
5IIZA 4I97A 1PA3A 1V57A 3BCKA 4V2MA 1SL0B 1E2YA 2GZZA 1U87A 3FEUA 3LFLA 1MDKA 5ECNB 5HR1A 2N5BA 5JCWA 10GSA 4TR4A 1EWXA 1FB0A 2F51A 1F3AA 1EOHA 3ERGA 5ECSA 3UIWA 2DJ2A 5ECHB 1GSYA 1KEBA 4IN0A 4FIWA 3IXRA 1C72A 1OYJA 3IV4A 3ZITA 3QDNA 3GKXA 2RM6A 2VCZA 1R4WA 4K8MA 3KZQA 2GT5A 4F0CA 1G7EA 4ZL9A 2IN3A 2EC4A 4ZBDA 4AGSA 4L5LA 3TB2A 3HJPA 3ZVJA 4I2TA 3L0HA 1ZYEA 2CX4A 5EVOA 5GAND 2J23A 5ECOB 5IMCA 3LQ7A 4GLTA 2MMOA 1MD3A 4GQCA 3UAPA 3APOA 4GF0A 1TRUA 5IPGA 1G6WA 3KMOA 5D8IA 4YAVA 2B7JA 2LRTA 4N0ZA 3EMPA 5C00A 3UL3A 2YOIA 4RQXA 4HZ4A 3EINA 1O8WA 1TRVA 1X5EA 3FZ9A 2H73A 1XZOA 2DJ1A 3IA1A 4F82A 2JU5A 5FHIA 4NXIA 4PUAA 4HI7A 4ZB6A 1XOAA 4XRDA 1AUCA 1K0OA 4POKA 1V58A 1VF2A 1Z9HA 2MBTA 4IP6A 1B4PA 2DJKA 1XFLA 2VM2A 1EEMA 2MMAA 1XW6A 2IMKA 1LBKA 1W4VA 3M9KA 5LCZA 2YN1A 4PQHA 2K8SA 4MF7A 1R5PA 3HA9A 4OO4A 5E59A 3DVWA 2KP2A 2XPDA 5J3RA 1TOFA 2FGXA 3GX0A 4MZWA 2FWGA 4MH3A 4CDOA 4V2NA 4X43A 2IJYA 1GP1A 4ZL8A 2LQOA 5IOWA 22GSA 1TK5B 5HR2A 4MF5A 3FR6A 1XPVA 3RHCA 1V9WA 2KOKA 4GCIA 1FB6A 4KAEA 2NTOA 2QKEA 4Q5NA 4XRAA 3G7IA 1FVKA 3GKKA 4G10A 5L71A 5ECIB 2IWTA 3IDVA 5D73A 2J9HA 5LD0A 2VM1A 1TP9A 3GH9A 3VK9A 1U3AA 1YZXA 1FO5A 2L5OA 1ZOFA 3DRNA 4DSRA 1BEDA 2CVBA 3QAGA 1UN2A 1XW5A 3NOFA 2P0GA 3GNJA 4WBJA 6GSTA 2YZHA 2WFCA 4K7NA 1XCCA 3HJMA 4E8EA 2HE3A 4RUVA 1SKRB 2P31A 3W6GA 3QAWA 3QD9A 1WWJA 1TRWA 2OBKA 3IBHA 1GTUA 3G7JA 1A2JA 5J41A 3ZZXA 1GL8A 2YWMA 1SK2A 3LJRA 4HOJA 2V6OA 2CX3A 1KBNA 2C0EA 4GSNA 3LG6A 1HQOA 4D73B 2VL2C 5AIXA 3DVXA 5IQYA 1THXA 1XWKA 5D9XA 2IFQB 4EE0A 3H1NA 4QL7A 5CRGA 3ZRDA 3FZ4A 3WGDA 3GKNA 2DIZA 2LQQA 1MEKA 3F3RA 1NSWA 1DSBA 1GUKA 4ZBBA 4D73A 5KN3A 2H0IA 5B6MA 1WIKA 2NPBA 1HYUA 2IFQA 5IPHA 3P2AA 3IRAA 4FYUA 3SBCA 3UJ1A 2LJKA 3O76A 1YKAA 1OAZA 2WZ9A 2VUPA 3VI5A 3QOUA 2PVOC 5G5EA 3KP8A 2C3NA 1K0CA 2GQKA 4WKWA 1G0TA 1OC3A 4O32A 3VPTA 1DE1A 2K6VA 4MF6A 1SL2B 1EGOA 2OADA 3VWUA 1XWAA 2I81A 5CO3A 1GULA 3WT2A 2LRCA 4FO5A 4PXOA 3ZTLA 3O6TA 2V2GA 2E2MA 1AQVA 1JLWA 2PN8A 3QAVA 1RW1A 1M2BA 3GFKA 1JLVA 1PQNA 2ALBA 4H86A 2GZYA 2DSAA 3FYGA 2E2GA 1IYHA 1PGTA 4FYCA 2GSQA 2D2ZA 4WF5A 1Z6MA 1WE0A 3LORA 4F9ZA 3IPZA 3KIJA 5DJLA 3EVIA 1XVWA 4YQVA 2DIYA 3JCML 4TXVA 4RI6A 1X5DA 1WMJA 4NAXA 5G30A 3HY2A 1O7UA 4J56E 1SJIA 1NHOA 3A2WA 2LV3A 2AHEA 5GZZB 3ZYWA 2I1UA 4K7OA 2ZCTA 5INYA 1NHYA 1AXDA 3F4SA 1U3IA 4OFNA 1BAYA 1EZKA 1SD9A 1YKCA 1GTIA 4ECIA 1MD4A 1QXHA 1QUWA 1I5GA 1QQ2A 1OE8A 1K0BA 1NW2A 3I69A 4HU7A 1AQWA 3Q18A 3ME8A 3A3TA 4KUNA 2KHPA 2B5EA 3EWLA 1V98A 3E9JB 3I9V2 2X8GA 2WDUA 1T4YA 2EIRA 4OFTA 2H19A 5DCHA 2H6YA 3TJBA 1Z6NA 3CRUA 3LYPA 2KLXA 5DVBA 16GSA 5ECKB 2H0GA 3DD3A 5ECPB 1W89A 1M7TA 1GWCA 3H93A 2C0GA 4GRFA 2HSHA 3P90A 3W8SA 1ILOA 4KA0A 4L5OA 3MNGA 4JRRA 1Z3EA 2GDRA 4LL1B 3G7YA 1PKWA 1U6TA 5A5KA 2CA8A 2AJQB 2R37A 1TI1A 2PGTA 1PL2A 4I8BA 1GNEA 5KN1A 2B6MA 2JACA 3D5JA 1AQXA 2CVKA 5IO0A 1ERUA 4NHZA 4HUAA 5H5QA 2OKAA 1EP8A 5GSTA 6GSVA 2JZRA 3LXTA 5J4UA 1OC9B 1SKWB 3IK7A 3L9VA 4BWQA 3UVHA 3KGKA 3CRTA 5G1KA 1O85A 4OMVA 3L9UA 1LU4A 3UEMA 2R3XA 2FHEA 2QSIA 2FWFA 2IPAA 1YY7A 2HSYA 2YV7A 2FD3A 2R6KA 4HEA2 4JR6A 2MMNA 2A2RA 1SKSB 3DGQA 3GL5A 2H1GA 2H8LA 1AIUA 2F3MA 1GTBA 1OC9A 2WGRA 2HI7A 5FT3A 5LNKe 2PWJA 4LMWA 4KW6A 5COHA 4HU9A 1R5AA 4ZBAA 3ERFA 4IGJA 3FR3A 5KN0A 4MK3A 3GUSA 3E0UA 6GSSA 1OKDA 3L9SA 2I9HA 8GSSA 2FLSA 2B1KA 4IP1A 3PH9A 2O7KA 2OA7A 3DWVA 14GSA 5HQPA 19GSA 4MJAA 5F8BA 3PGTA 1GUMA 3TKSA 4TKYA 4K1FA 5EY6A 2C3QA 3PR8A 3ZREA 1FG4A 2YPMA 2HNLA 3HVSA 5C04A 2TRXA 4WETA 1X9SB 3L78A 1BQ7A 2LJAA 2LKUA 3VFIA 5D93A 4POLA 4MMMA 3TKSE 3FR9A 4KB3A 1T00A 3FW2A 4ID0A 3FK8A 1X0RA 3C1RA 1GSQA 4Q5QA 3RHBA 4MABA 1U88A 4EL1A 2HZEA 2K8VA 2VL3A 3O3TA 3RPPA 5IMZA 4XS6A 2PERA 4N0VA 5D9WA 1PX7A 4BVYA 3TOUA 2OE0A 3HZ4A 1SYRA 13GSA 5DQYA 4HDEA 2F9SA 4KDUA 3F8UA 4IVFA 4HJMA 2P5RA 5CRWA 1K0NA 3ERWA 3WT1A 1ZL9A 2A2SA 5CREA 1CQGA 2FA8A 2WJUA 5IO2A 4IQ1A 4ZIJA 1THOA 2H1AA 5J9BA 1ZGNA 3LGCA 1TK0B 3LYKA 3GN3A 1B8XA 2MYGA 1R26A 4YAPA 5FWGA 4POBA 3I43A 1K3LA 4QL9A 3VWWA 4DSSB 5F05A 2MBSA 1XXUA 4YQMA 4BWSA 1ZZYA 2IL3A 5ABRA 4EUYA 1Z7RA 4KNDA 1J0FA 1ZYQB 2N5FA 2AB6A 2V6KA 2LTKA 3D4MA 1XWGA 4DSSA 2YWOA 3VLNA 2V1MA 2YANA 4MCUA 4XCSA 3IAM2 4WR5A 1ERTA 3WGEA 1A2LA 4N30A 1S3CA 1BX9A 1TW9A 4CHSA 1GLPA 1XW9A 4KGIA 2IIYA 2LJRA 4J57E 2O8VB 2L5LA 3ZIVA 5ECLB 4IQAA 3F4TA 1YJ6A 2FNOA 2HZFA 3DXBA 2BTOT 2C1YA 2QGVA 3TJFA 2PUKC 4K0NA 3VI7A 2FWHA 5IMFA 4WF4A 2LRNA 1DBYA 1HNAA 1XWCA 2VD0A 1HNBA 3CYNA 3FZAA 2TIRA 4ML6A 1Y25A 3CSJA 2VCTA 2JZTA 1ERWA 3EE2A 2L59A 5H5SA 2IMEA 3EU3A 2GLRA 2LNTA 4TR3A 1SJ6A 3TOTA 9GSSA 5KN2A 3NZNA 3ZLPA 1M9BA 6GSYA 3GSTA 2VIMA 3HD5A 4ZB9A 5IOXA 3GX8A 2H1DA 4PUFC 5J9CA 4KH7A 1Q98A 1YEPA 5CRHA 4BVXA 3GHAA 5AIVA 5JCGA 3HVXA 3TKQA 1HD2A 2VCWA 1FOVA 3QR6A 4HQSA 4TVEA 1IYIA 2RLIA 2WS2A 3H8QA 1GSUA 2H74A 4TRXA 1XIYA 6GSWA 3A2VA 1V2AA 6GSUA 1EP7A 5HFIA 2V41A 3DKSA 4X0XA 2X8HA 1GLQA 1SK0A 1ML6A 3L4NA 1O8XA 4IHUA 2RIIA 4YH2A 4O92A 4IJIA 3QPMA 3MAKA 3UOMA 4XHMA 3TRXA 1N8JA 3HYPA 4TOPA 3APSA 4KCAA 4EF0A 2VO4A 4ML1A 3ZVJD 1TU8A 5HFKA 4AJ7A 1TI3A 2B1LA 5D96A 3MSZA 4X1UA 5IMAA 1SD8A 4LA1A 2NDOA 1DUGA 3D6IA 1NM3A 3G9BA 2LEGA 1T4ZA 3BD2A 2XHFA 5IMDA 2FCHA 1JZRA 4GXZA 1EOGA 2V32A 2VCVA 3TJKA 1XVQA 1VF4A 2K9FA 1MTCA 1SK1A 2CT6A 1A0RP 5CAXA 1VF3A 4MJEA 4ECJA 3DYRA 4PNGA 2EIQA 2L6DA 1USBA 3DMLA 2XPEA 3FHKA 2H1BA 4QQ7A 1JHBA 4ECCA 2JZSA 2LS5A 4BA7A 2VLUA 4ACSA 2FWEA 1CQHA 2H71A 2CQ9A 3ZIJA 5AGYA 2B7KA 4KX4A 3VURA 3GURA 4L0WA 3Q19A 5JWQB 3RAZA 3HDCA 4AJ8A 2FUG2 1RK4A 1TU7A 2H72A 3HCZA 1QGVA 2VL2A 2O87A 4DVCA 3NIVA 2H6ZA 3LXZA 1B48A 2N5AA 5JWOB 2HRNA 1O6JA 1PKZA 3CTFA 1G7OA 2C0FA 3DEXA 3K8NA 4YQUA 3ISOA 1K0DA 1N2AA 1KNGA 2H75A 4TR1A 3ZFBA 3H79A 5EPFA 2KP1A 1A2MA 3D22A 4XTSA 2HXKA 3KXOA 4OO5A 4PNFA 3QFAC 4AF2A 1YQ1A 2YP6A 1ZMAA 3M3MA 1YF0A 5KEJA 2HLSA 1ACVA 3CSHA 3IR4A 4HS1A 1EEJA 4KDXA 2OACA 4G19A 2M46A 1X5CA 2BMXA 1TKDB 1KTEA 2YWNA 3HHVA 5HFGA 4N10A 3WGXA 2B5XA 4I5QA 3HKRA 1JZDA 4JR4A 1URMA 5F0GA 4JZQA 3CTGA 4Q5RA 3C7MA 2OBIA 5DCGA 2JSYA 1M0UA 5ECMB 3TRQA 4MH2A 1EV9A 1YDKA 4GTUA 3KTBA 5D9TA 4IW9A 4K2DA 4MA9A 3U5RE 4IELA 3BBYA 3UVTA 4NV5A 4IJ3A 4O7HA 1GTAA 4OCFA 4MP4A 4K9ZA 1PRXA 2C8UA 4EKZA 1M2AA 4HZ2A 2VCQA 5D9VA 1LJRA 2VLVA 2ON7A 3M0FA 1YF1A 3AY8A 3EURA 2YNXA 3KH7A 4NV2A 2L6CA 3BJ5A 3F4RA 1OC8A 3EU4A 2Z9SA 4EXJA 1OE7A 3KCMA 5ECRB 1FAAA 1AC1A 2GTUA 3J7Yb 3V1WA 4GSSA 4KE3A 3RPNA 2VOCA 5EL8A 5ENUA 5CP1A 1UVZA 1I9DA 1YEXA 4HJ2A 3EC3A 1PN9A 2ES7A 2YZUA 4CW9A 2R2JA 1O81A 3KM6A 2AUVA 4EDYA 2G0FA 2HZEB 1R7HA 4LLRA 1OKTA 2DLXA 4MZCA 3TGZA 4PURA 3GTUB 4E8HA 1JFUA 4JU5A 4NHWA 2GVPA 1WP0A 2GT6A 2ON5A 4ZL7A 1SJZA 2C4JA 2CAIA 3FKFA 3A5WA 4AJ6A 1T7PB 1F3BA 2E7PA 4JBBA 3DIEA 5IM9A 2GQMA 4TR0A 1JZOA 3F6DA 3GTUA 3BCIA 3BOAA 3M8NA 1X9WB 2I4AA 5JCUA 4ZB8A 4MLYA 5F07A 3A2XA 5ID2B 3APQA 4KCEA 3VWXA 4O5RA 2DMLA 5DAKB 2H76A 3P8WA 4RQRA 1SU9A 3R2QA 4PX1A 2VD1A 4GQFA 1Z7PA 2YV9A 3MDKA 4EDZA 5HR0A 2MZCA 4EC0A 3C8EA 3KP9A 1HNCA 4FH8A 1GSEA 4TN8A 5DDLA 5J5NA 3RDWA 2VAFA 1F9MA 2XC2A 5ID2A 5E4WA 1X9MB 1F37A 5DAKA 2WB9A 2CZ2A 4LMVA 4LL4B 4BPYA 3C71A 5G31A 2CZ3A 1M2DA 2WRTA 5G1LA 1EGRA 2DMMA 2OJLA 1GUHA 1AW9A 3HZ8A 3F6FA 2QC7A 2MMZA 4ZXGA 1WRYA 5AISA 20GSA 4V2LA 1FW1A 1ABAA 3F9UA 1QMVA 3GKMA 2C0DA 2AV4A 3VPQA 1BYEA 2JADA 1Z5YE 3KEBA 1MDIA 2DBCA 2L57A 2GSSA 4N11A 1A8YA 5DALB 5B6NA 2DJ0A 5AN1A 2E0QA 2HYXA 1ST9A 1MDJA 2ZUPA 3MWHA 1ERVA 1T1VA 3GH6A 5JWRB 3CMIA 2R4VA 1K3OA 5ECQB 2RUFA 1DE2A 4MJBA 1XWBA 2C3TA 2L4CA 3C73A 3D0ZA 5DALA 5A4UA 5CRDA 1J9BA 5G2ZA 4NWYA 2FY6A 1PSQA 1ON4A 4GWRA 1QFNA 3N9JA 2X99A 4Z7XA 1G6YA 2B3SA 2A4VA 2PU9C 4KDYA 1PMTA 2GQLA 2YJHA 1UC7A 7GSSA 4PQIA 1WJKA 2NBSA 2CAQA 2PBJA 2B5YA 4WR4A 2ZNMA 3F0IA 4GSTA 2AAWA 2GZPA 1H75A 1S3DA 3ME7A 4KSMA 5A4VA 3TRPA 3W8JA 3UMAA 4OCEA 3TJJA 3QMXA 2GGTA 5DJMA 2XBQA 5B8AA 3D21A 4Q5FA 2JL4A 1VF1A 2TRCP 2AYTA 4HQZA 5GAPD 4F2IA 3VWVA 2O89A 2IMDA 2CV4A 5HR3A 3IOSA 3KH9A 3TUEA 2KUCA 1QK8A 2WCIA 4K7IA 2VCXA 1A0FA 1XOBA 1K0AA 3GSSA 3CBUA 1Q4JA 1Y6EA 3LWAA 4L8EA 3US3A 4EVMA 2M72A 1PD21 3N5OA 3RBTA 3UARA 3EMXA 3TCOA 1K3YA 3HJOA 4NMUA 1A24A 2OE3A 2VL9A 2HT9A 2H30A 4F03A 3ED3A 3CSIA 3GL3A 4V1Ag 2NVLA 4K0GA 5IMVA 2X64A 1UA5A 2YJ7A 1B9XC 4MZBA 2X8CA 1T3BA 1FHEA 2XBIA 4I6XA 4RI7A 4MPFA 2RUEA 2M80A 2VLTA 3Q6OA 1J08A 4OWYA 4NPBA 3HXSA 1A8LA 1OVNA 1GH2A 1ZCPA 2DJJA 2YCDA 2K18A 4XS1A 1EV4A 3IE3A 3GYKA 4DEJA 3OR5A 1RQMA 3Q74A 1GNWA 2C80A 11GSA 3PINA 1F6MC 4OFMA 1VRSD 4WBRD 5CNWA 2I3YA 1SYXA 2IMFA 3HVVA 3LSZA 2HRFA 2YWIA 2CVDA 3U6VA 4TW5A 3J7Yk 3TKPA 2H66A 3CXGA 4I2UA 5H5RA 1GRXA 4V1Ap 2GSTA 3UBLA 3GIXA 3WYWA 1SENA 4JE1A 2F8FA 1S3AA 3ZMLA 3GMFA 1BJXA 2HFDA 3E3EA 4ULXA 2F8AA 2PMTA 1TDIA 4TR1B 1F2EA 4JEDA 4J2FA 1B4QA 3QFBC 6GSXA 2JSZA 3F63A 4TXOB 3GRXA 3D4TA 1GSSA 5GSSA 1SL1B 2DC5A 2PVQA 4K6XA 2R5GA 1TJDA 1XBSA 1GSFA 3FY7A 2H01A 3I6AA 4MJCA 3FRCA 4WXTA 3QCPA 4MDCA 1A23A 4PGTA 3S9FA 1PX6A 2FA4A 2H70A 1WOUA 5ELGA 1B9YC 2H6XA 4TXOA 3TKSC 1V40A 1JZWA 3C1SA 4ISDA 3H4KA 1E6BA 4P3YB 4G2EA 3KJYA 2PPTA 3IK9A 3UBKA 3TJGA 4IS0A 5G5FA 3KMNA 1M99A 1WPIA 4FYBA 2H0HA 3EYTA 2L4QA 18GSA 2OE1A 3KD0A 4ECBA 4L0UA 4XIHA 4OD7A 4DSQA 2WULA 2BJXA 3P7XA 4POMA 3IHQA 3LEFA 3ZL5A 3SWLA 2LNSA 1PL1A 5A4WA 3M1GA 2LSTA 4ZILA 4PQ1A 3TDGA 5B8BA 3IAS2 4KSOA 2O85A 5ELAA 2EIOA 1AAZA 2P5QA 5DBQA 4BL7A 3KTLA 3TKRA 4ILFA 5CYYA 4IBPA 1TXXA 1BG5A 4WEYA 2GSRA 1H4OA 1T8EB 3GV1A 4G9HA 4XS4B 1GSDA 2LUSA 4MPGA 4EO3A 2G2QA 2REMA 3ZFLA 4IKHA 3M9JA 2RM5A 1TTZA 1O73A 2GS3A 3FZ5A 2DJ3A 5F06A 3ZMKA 1VGLA 4F0BA 1M9AA 5B7CA 17GSA 3IC4A 3GA4A 4XS4A 1FVJA 3WD6A 12GSA 3F3QA 1TK8B 2IMIA 5DQSA 1K0MA 1TRSA
chains in the Genus database with same CATH superfamily
5IIZA 4I97A 1PA3A 1V57A 3BCKA 4V2MA 1SL0B 1E2YA 2GZZA 1U87A 3FEUA 3LFLA 1MDKA 5ECNB 5HR1A 2N5BA 5JCWA 10GSA 4TR4A 1EWXA 1FB0A 2F51A 1F3AA 1EOHA 3ERGA 5ECSA 3UIWA 2DJ2A 5ECHB 1GSYA 1KEBA 4IN0A 4FIWA 3IXRA 1C72A 1OYJA 3IV4A 3ZITA 3QDNA 3GKXA 2RM6A 2VCZA 1R4WA 4K8MA 3KZQA 2GT5A 2A4HA 4F0CA 1G7EA 4ZL9A 2IN3A 2EC4A 4ZBDA 4AGSA 4L5LA 3TB2A 3HJPA 3ZVJA 4I2TA 3L0HA 1ZYEA 2CX4A 5EVOA 5GAND 2J23A 5ECOB 5IMCA 3LQ7A 4GLTA 2MMOA 1MD3A 4GQCA 3UAPA 3APOA 4GF0A 1TRUA 5IPGA 1G6WA 3KMOA 5D8IA 4YAVA 2B7JA 2LRTA 4N0ZA 3EMPA 5C00A 5KOXA 3UL3A 2YOIA 4RQXA 4HZ4A 3EINA 1O8WA 1TRVA 1X5EA 3FZ9A 2H73A 1XZOA 2DJ1A 3IA1A 4F82A 2JU5A 5FHIA 4NXIA 4PUAA 4HI7A 4ZB6A 4BIKA 1XOAA 4XRDA 1AUCA 1K0OA 4POKA 1V58A 1VF2A 1Z9HA 2MBTA 4IP6A 1B4PA 2DJKA 1XFLA 2VM2A 1EEMA 2MMAA 1XW6A 2IMKA 1LBKA 1W4VA 3M9KA 5LCZA 2YN1A 4PQHA 2K8SA 4MF7A 1R5PA 3HA9A 4OO4A 5E59A 3DVWA 2KP2A 2XPDA 5J3RA 1TOFA 2FGXA 3GX0A 4MZWA 2FWGA 4MH3A 4CDOA 4V2NA 4X43A 2IJYA 1GP1A 4ZL8A 2LQOA 5IOWA 22GSA 1TK5B 5HR2A 1M3IA 4MF5A 3FR6A 1XPVA 3RHCA 1V9WA 2KOKA 4GCIA 1FB6A 4KAEA 2NTOA 2QKEA 2R0PA 4Q5NA 4XRAA 3G7IA 1FVKA 3GKKA 4G10A 5L71A 5ECIB 2IWTA 3IDVA 5D73A 2J9HA 5LD0A 4Z2RA 2VM1A 3LW9A 1TP9A 3GH9A 3VK9A 1U3AA 1YZXA 1FO5A 2L5OA 1ZOFA 3DRNA 4DSRA 1BEDA 2CVBA 3QAGA 4YKGA 1UN2A 2DKIA 1XW5A 3NOFA 2P0GA 3GNJA 4WBJA 6GSTA 2YZHA 2WFCA 4K7NA 2UZ8A 1XCCA 3HJMA 4E8EA 2HE3A 4RUVA 1SKRB 2P31A 3W6GA 3QAWA 3QD9A 1WWJA 1TRWA 2OBKA 3IBHA 1GTUA 3G7JA 1A2JA 5J41A 3ZZXA 1GL8A 2YWMA 1SK2A 3LJRA 4K5SA 4HOJA 2V6OA 2CX3A 1KBNA 2C0EA 4GSNA 3LG6A 1HQOA 4D73B 2VL2C 5AIXA 3DVXA 5IQYA 1THXA 1XWKA 5D9XA 2IFQB 4EE0A 3H1NA 4QL7A 3IHGA 5CRGA 3ZRDA 3FZ4A 3WGDA 3GKNA 2DIZA 2LQQA 1MEKA 4EIQA 3F3RA 1NSWA 1DSBA 1GUKA 4ZBBA 4D73A 5KN3A 2H0IA 5B6MA 1WIKA 2NPBA 1HYUA 2IFQA 5IPHA 3P2AA 3IRAA 4FYUA 3SBCA 2X4AA 3UJ1A 2LJKA 3O76A 1YKAA 1OAZA 2WZ9A 2VUPA 3VI5A 3QOUA 2PVOC 5G5EA 3KP8A 2C3NA 1K0CA 2GQKA 4WKWA 1G0TA 1OC3A 4O32A 3VPTA 1DE1A 2K6VA 4MF6A 1SL2B 1EGOA 2OADA 3VWUA 4MNNA 1XWAA 2I81A 5CO3A 1GULA 3WT2A 2LRCA 4FO5A 4PXOA 3ZTLA 3O6TA 2V2GA 2E2MA 1AQVA 1JLWA 2PN8A 3QAVA 1RW1A 1M2BA 3GFKA 1JLVA 1PQNA 2ALBA 4H86A 2GZYA 4HSCX 2DSAA 3FYGA 2E2GA 1IYHA 1PGTA 4FYCA 2GSQA 2D2ZA 4WF5A 1Z6MA 1WE0A 3LORA 4F9ZA 3IPZA 3KIJA 5DJLA 3EVIA 1XVWA 4YQVA 2DIYA 3JCML 4TXVA 4RI6A 1X5DA 1WMJA 4NAXA 5G30A 3HY2A 1O7UA 4J56E 1SJIA 1NHOA 3A2WA 2LV3A 2AHEA 5GZZB 3ZYWA 2I1UA 4K7OA 2ZCTA 5INYA 1NHYA 1AXDA 3F4SA 1U3IA 4OFNA 1BAYA 1EZKA 1SD9A 1YKCA 1GTIA 4ECIA 1MD4A 1QXHA 1QUWA 1I5GA 1QQ2A 1OE8A 1K0BA 1NW2A 3I69A 4HU7A 1AQWA 5BMUA 3Q18A 3ME8A 3A3TA 4KUNA 2KHPA 2B5EA 3EWLA 1V98A 3E9JB 3I9V2 4USSA 2X8GA 2WDUA 1T4YA 2EIRA 4OFTA 2H19A 5DCHA 2H6YA 3TJBA 1Z6NA 3CRUA 3LYPA 2KLXA 5DVBA 16GSA 5ECKB 2H0GA 3DD3A 5ECPB 1W89A 1M7TA 1GWCA 3H93A 2C0GA 4GRFA 2HSHA 3P90A 3W8SA 1ILOA 4KA0A 4L5OA 3MNGA 4JRRA 1Z3EA 2GDRA 4LL1B 3MIXA 3G7YA 1PKWA 1U6TA 5A5KA 2CA8A 2AJQB 2R37A 1TI1A 2PGTA 2X49A 1PN0A 1PL2A 4I8BA 1GNEA 5KN1A 2B6MA 2JACA 3D5JA 1AQXA 2CVKA 5IO0A 1ERUA 4NHZA 4HUAA 4FQUA 5H5QA 2OKAA 1EP8A 5GSTA 6GSVA 2JZRA 3LXTA 5J4UA 1OC9B 1SKWB 3IK7A 3L9VA 4O5QA 4BWQA 3UVHA 3KGKA 3CRTA 5G1KA 1O85A 4OMVA 3L9UA 1LU4A 3UEMA 2R3XA 2FHEA 2QSIA 2FWFA 2IPAA 1YY7A 2HSYA 2YV7A 2FD3A 2R6KA 4HEA2 4JR6A 2MMNA 2HSMA 2A2RA 1SKSB 3DGQA 3GL5A 2H1GA 2H8LA 4EIPA 1AIUA 2F3MA 1GTBA 1OC9A 2WGRA 2HI7A 5FT3A 5LNKe 2PWJA 4LMWA 4KW6A 5COHA 4HU9A 1R5AA 4ZBAA 3ERFA 3R3EA 3FR3A 4IGJA 5KN0A 4MK3A 3GUSA 3E0UA 6GSSA 1OKDA 3L9SA 2I9HA 8GSSA 2FLSA 2B1KA 4IP1A 3PH9A 2O7KA 2OA7A 3DWVA 14GSA 5HQPA 19GSA 4MJAA 5F8BA 3PGTA 1GUMA 3TKSA 4TKYA 4K1FA 5EY6A 2C3QA 3PR8A 3ZREA 1FG4A 2YPMA 2HNLA 3HVSA 5C04A 2TRXA 4WETA 1X9SB 3L78A 1BQ7A 2LJAA 2LKUA 3VFIA 4BVYB 5D93A 4POLA 4MMMA 3TKSE 3FR9A 4KB3A 1T00A 3FW2A 4ID0A 3HVNA 3FK8A 1X0RA 3C1RA 1GSQA 4Q5QA 3RHBA 4MABA 1U88A 4EL1A 2HZEA 2K8VA 2VL3A 3O3TA 3RPPA 5IMZA 4XS6A 2PERA 4N0VA 5D9WA 1PX7A 4BVYA 3TOUA 2OE0A 3HZ4A 1SYRA 13GSA 5DQYA 4HDEA 2F9SA 4KDUA 3F8UA 4IVFA 4HJMA 2P5RA 5CRWA 1K0NA 3ERWA 3WT1A 1ZL9A 2A2SA 5CREA 1CQGA 2FA8A 2WJUA 5IO2A 4IQ1A 4ZIJA 1THOA 2H1AA 5J9BA 1ZGNA 3LGCA 1TK0B 3LYKA 3GN3A 1B8XA 2MYGA 1R26A 4YAPA 5FWGA 1ZYNA 4POBA 3I43A 1K3LA 4QL9A 3VWWA 4DSSB 5F05A 2MBSA 3PPUA 1XXUA 4YQMA 4BWSA 1ZZYA 2IL3A 5ABRA 4EUYA 1Z7RA 4KNDA 1J0FA 1ZYQB 2N5FA 2AB6A 2V6KA 2LTKA 3D4MA 3MYDA 1XWGA 4DSSA 2YWOA 3VLNA 2V1MA 2YANA 4MCUA 4XCSA 3IAM2 4WR5A 1ERTA 3WGEA 1A2LA 4N30A 1S3CA 1BX9A 1TW9A 4CHSA 1GLPA 1XW9A 4KGIA 2IIYA 2LJRA 4J57E 2O8VB 2L5LA 3ZIVA 5ECLB 4IQAA 3F4TA 1YJ6A 2FNOA 2HRAA 2HZFA 3DXBA 2BTOT 2C1YA 2QGVA 3TJFA 2PUKC 4K0NA 3VI7A 2FWHA 5IMFA 4WF4A 2LRNA 1DBYA 1HNAA 1XWCA 2VD0A 1HNBA 3CYNA 3FZAA 2TIRA 4ML6A 1Y25A 3CSJA 2VCTA 2JZTA 1ERWA 3EE2A 2L59A 5H5SA 2IMEA 3EU3A 2GLRA 2LNTA 4TR3A 1SJ6A 3TOTA 9GSSA 5KN2A 3NZNA 3ZLPA 1M9BA 6GSYA 3GSTA 2VIMA 3HD5A 4ZB9A 5IOXA 3GX8A 2H1DA 4PUFC 5J9CA 4KH7A 1Q98A 1YEPA 5CRHA 4BVXA 3GHAA 5AIVA 5JCGA 4G0KA 3HVXA 3TKQA 1HD2A 2VCWA 1FOVA 3QR6A 4HQSA 4TVEA 1IYIA 2RLIA 2WS2A 3H8QA 4KF9A 1GSUA 2H74A 4TRXA 2R0GA 1XIYA 6GSWA 3A2VA 1V2AA 6GSUA 1EP7A 5HFIA 2V41A 3DKSA 4X0XA 2X8HA 1GLQA 1SK0A 1ML6A 3L4NA 1O8XA 4IHUA 2RIIA 4YH2A 4O92A 4IJIA 3QPMA 3MAKA 1S3RA 3UOMA 4XHMA 3TRXA 1N8JA 3HYPA 4TOPA 3APSA 4KCAA 4EF0A 2VO4A 4ML1A 3ZVJD 1TU8A 5HFKA 4AJ7A 1TI3A 2B1LA 5D96A 3MSZA 4X1UA 5IMAA 1SD8A 4LA1A 2NDOA 1DUGA 3D6IA 1NM3A 3G9BA 2LEGA 1T4ZA 3BD2A 2XHFA 5IMDA 2FCHA 1JZRA 4GXZA 1EOGA 2V32A 3IC8A 2VCVA 3TJKA 1XVQA 1VF4A 2K9FA 1MTCA 1SK1A 2CT6A 1A0RP 5CAXA 1VF3A 4MJEA 4ECJA 3DYRA 4PNGA 2EIQA 2L6DA 1USBA 3DMLA 2XPEA 3FHKA 2H1BA 4QQ7A 1JHBA 4ECCA 2JZSA 2LS5A 4BA7A 2VLUA 5BRTA 4ACSA 2FWEA 1CQHA 2H71A 2CQ9A 3ZIJA 5AGYA 2B7KA 4KX4A 3VURA 3GURA 4L0WA 3Q19A 5JWQB 3RAZA 3HDCA 4AJ8A 2FUG2 1RK4A 1TU7A 2H72A 3HCZA 1QGVA 2VL2A 2O87A 4DVCA 3NIVA 2H6ZA 3LXZA 1B48A 2N5AA 5JWOB 2HRNA 1O6JA 1PKZA 2A2PA 3CTFA 1G7OA 2C0FA 3DEXA 3K8NA 4YQUA 3ISOA 1K0DA 1N2AA 1KNGA 2H75A 4TR1A 3ZFBA 3H79A 2KP1A 5EPFA 1A2MA 3D22A 4XTSA 2HXKA 3KXOA 4OO5A 4PNFA 3QFAC 4AF2A 1YQ1A 2YP6A 1ZMAA 3M3MA 1YF0A 5KEJA 2HLSA 1ACVA 3CSHA 3IR4A 4HS1A 5KOWA 1EEJA 4KDXA 2OACA 4G19A 2M46A 1X5CA 3FMWA 2BMXA 1TKDB 4PTSA 1KTEA 2YWNA 3HHVA 5HFGA 4N10A 3WGXA 2B5XA 4I5QA 3HKRA 1JZDA 4JR4A 1URMA 5F0GA 4JZQA 3CTGA 4Q5RA 3C7MA 2OBIA 5DCGA 2JSYA 1M0UA 5ECMB 3TRQA 4MH2A 1EV9A 1YDKA 4GTUA 3KTBA 5D9TA 4IW9A 4K2DA 4MA9A 3U5RE 4IELA 3BBYA 3UVTA 4NV5A 4IJ3A 4O7HA 4A5PA 1GTAA 4OCFA 4MP4A 4K9ZA 1PRXA 2C8UA 4EKZA 1M2AA 4HZ2A 2VCQA 5D9VA 1LJRA 2VLVA 2ON7A 3M0FA 1YF1A 3AY8A 3EURA 4K2XA 2YNXA 3KH7A 4NV2A 2L6CA 3BJ5A 3F4RA 1OC8A 3EU4A 2R0CA 2Z9SA 4EXJA 1OE7A 3KCMA 5ECRB 1FAAA 1AC1A 2GTUA 3J7Yb 1M3JA 3V1WA 4GSSA 4KE3A 3RPNA 2VOCA 5EL8A 5ENUA 5CP1A 1UVZA 1I9DA 1YEXA 4HJ2A 3EC3A 1PN9A 2ES7A 2YZUA 1PFOA 4G0IA 4CW9A 2R2JA 1O81A 3KM6A 2AUVA 4EDYA 2G0FA 4X4JA 2HZEB 1R7HA 4LLRA 1OKTA 2DLXA 4MZCA 3TGZA 4PURA 3GTUB 4E8HA 1JFUA 4JU5A 1FOHA 4NHWA 2GVPA 1WP0A 2GT6A 2ON5A 4ZL7A 1SJZA 2C4JA 2CAIA 3FKFA 3A5WA 4AJ6A 1T7PB 1F3BA 2E7PA 4JBBA 3DIEA 5IM9A 2GQMA 4TR0A 4ICYA 1JZOA 3F6DA 3GTUA 3BCIA 3BOAA 3M8NA 1X9WB 2I4AA 5JCUA 4ZB8A 4MLYA 5F07A 3A2XA 5ID2B 3APQA 4KCEA 3VWXA 4O5RA 2DMLA 5DAKB 2H76A 3P8WA 4RQRA 1SU9A 3R2QA 4PX1A 2VD1A 4GQFA 1Z7PA 2YV9A 3MDKA 4EDZA 5HR0A 2MZCA 4EC0A 3C8EA 3KP9A 1HNCA 4FH8A 1GSEA 4TN8A 5DDLA 5J5NA 3RDWA 2VAFA 1F9MA 2XC2A 5ID2A 5E4WA 1X9MB 1F37A 5DAKA 2WB9A 2CZ2A 4LMVA 4LL4B 4BPYA 3C71A 5G31A 2CZ3A 1M2DA 2WRTA 5G1LA 1EGRA 4K5RA 2DMMA 2OJLA 1GUHA 1AW9A 3HZ8A 3F6FA 2QC7A 2MMZA 4ZXGA 1WRYA 5AISA 20GSA 4V2LA 1FW1A 1ABAA 3F9UA 1QMVA 3GKMA 2C0DA 2AV4A 3VPQA 1BYEA 2JADA 1Z5YE 3KEBA 1MDIA 2DBCA 2L57A 2GSSA 4N11A 1A8YA 5DALB 5B6NA 2DJ0A 5AN1A 2E0QA 2HYXA 1ST9A 1MDJA 2ZUPA 3MWHA 1ERVA 1T1VA 3GH6A 5JWRB 3CMIA 2R4VA 1K3OA 5ECQB 2RUFA 3A5IA 4CY8A 1DE2A 4MJBA 1XWBA 2C3TA 2L4CA 3C73A 3D0ZA 5DALA 5A4UA 4Z2UA 5CRDA 1J9BA 5G2ZA 4NWYA 2FY6A 1PSQA 1ON4A 4GWRA 1QFNA 3N9JA 2X99A 4Z7XA 1G6YA 2B3SA 2A4VA 2PU9C 4KDYA 1PMTA 2GQLA 2YJHA 4BVXB 1UC7A 7GSSA 4PQIA 1WJKA 2NBSA 2CAQA 2PBJA 2B5YA 4WR4A 2ZNMA 3F0IA 4GSTA 2AAWA 2GZPA 1H75A 1S3DA 3ME7A 4KSMA 5A4VA 3TRPA 3W8JA 3UMAA 4OCEA 3TJJA 3QMXA 2GGTA 5DJMA 2XBQA 5B8AA 3D21A 4G0LA 4Q5FA 2JL4A 1VF1A 2TRCP 2AYTA 4HQZA 5GAPD 1XG8A 4F2IA 3VWVA 2O89A 2IMDA 2CV4A 5HR3A 3IOSA 3KH9A 3TUEA 2KUCA 1QK8A 2WCIA 4K7IA 2VCXA 1A0FA 1XOBA 1K0AA 3GSSA 3CBUA 1Q4JA 1Y6EA 3LWAA 4L8EA 3US3A 4EVMA 2M72A 1PD21 3N5OA 3RBTA 3UARA 3EMXA 3TCOA 1K3YA 3HJOA 4NMUA 1A24A 2OE3A 2VL9A 2HT9A 2H30A 4F03A 3ED3A 3CSIA 3GL3A 4V1Ag 2NVLA 2DKHA 4K0GA 5IMVA 3EPTA 2X64A 1UA5A 2YJ7A 1B9XC 4MZBA 2X8CA 1T3BA 1FHEA 2XBIA 4I6XA 4RI7A 4MPFA 2RUEA 2M80A 2VLTA 3Q6OA 1J08A 4OWYA 4NPBA 3HXSA 1A8LA 1OVNA 1GH2A 1ZCPA 2DJJA 4YKFA 2YCDA 2K18A 4XS1A 1EV4A 3IE3A 4Z2TA 3GYKA 4DEJA 3OR5A 1RQMA 3Q74A 1GNWA 2C80A 11GSA 3PINA 1F6MC 4OFMA 1VRSD 4WBRD 5CNWA 2I3YA 1SYXA 2IMFA 3HVVA 3LSZA 2HRFA 2YWIA 2CVDA 3U6VA 4TW5A 3J7Yk 3TKPA 2H66A 3CXGA 4I2UA 5H5RA 1GRXA 4V1Ap 2GSTA 3UBLA 3GIXA 3WYWA 1SENA 4JE1A 2F8FA 1S3AA 3ZMLA 3GMFA 1BJXA 2HFDA 3E3EA 4ULXA 2F8AA 2PMTA 1TDIA 4TR1B 1F2EA 4JEDA 4J2FA 1B4QA 3QFBC 6GSXA 2JSZA 3CQFA 3F63A 4TXOB 3GRXA 3D4TA 1GSSA 5GSSA 1SL1B 2DC5A 2PVQA 4K6XA 2R5GA 4O5UA 1TJDA 1XBSA 1GSFA 3FY7A 2H01A 3I6AA 4MJCA 3FRCA 4WXTA 3QCPA 4MDCA 1A23A 4PGTA 3S9FA 1PX6A 2FA4A 2H70A 1WOUA 5ELGA 1B9YC 2H6XA 4TXOA 3TKSC 1V40A 1JZWA 3C1SA 4ISDA 3H4KA 1E6BA 4P3YB 4G2EA 3KJYA 2PPTA 3IK9A 3UBKA 3TJGA 4IS0A 5G5FA 3KMNA 1M99A 1ZYPA 1WPIA 4FYBA 2H0HA 3EYTA 2L4QA 18GSA 2OE1A 3KD0A 4ECBA 4L0UA 4XIHA 4OD7A 4DSQA 4BL7B 2WULA 2BJXA 3P7XA 4POMA 3IHQA 3LEFA 3ZL5A 3SWLA 2LNSA 1PL1A 5A4WA 3M1GA 2LSTA 2HRKA 4ZILA 4PQ1A 3TDGA 5B8BA 3IAS2 4KSOA 2O85A 5ELAA 2EIOA 1AAZA 2P5QA 5DBQA 4BL7A 3KTLA 2QA2A 3TKRA 4ILFA 5CYYA 4IBPA 1TXXA 1BG5A 4WEYA 2GSRA 1H4OA 1T8EB 3GV1A 4G9HA 4XS4B 1GSDA 4CY6A 2LUSA 4MPGA 2QA1A 4EO3A 2G2QA 2REMA 3ZFLA 4IKHA 3M9JA 2RM5A 1TTZA 1O73A 2GS3A 3FZ5A 2DJ3A 5F06A 3ZMKA 1VGLA 4F0BA 1M9AA 5B7CA 17GSA 3IC4A 3GA4A 4XS4A 1FVJA 3WD6A 12GSA 3F3QA 1TK8B 2IMIA 5DQSA 1K0MA 1TRSA
chains in the Genus database with same CATH topology
5IIZA 4I97A 1PA3A 1V57A 3BCKA 4V2MA 1SL0B 1E2YA 2GZZA 1U87A 3FEUA 3LFLA 1MDKA 5ECNB 5HR1A 2N5BA 5JCWA 10GSA 4TR4A 1EWXA 1FB0A 2F51A 1F3AA 1EOHA 3ERGA 5ECSA 3UIWA 2DJ2A 5ECHB 1GSYA 1KEBA 4IN0A 4FIWA 3IXRA 1C72A 1OYJA 3IV4A 3ZITA 3QDNA 3GKXA 2RM6A 2VCZA 1R4WA 4K8MA 3KZQA 2GT5A 2A4HA 4F0CA 1G7EA 4ZL9A 2IN3A 2EC4A 4ZBDA 4AGSA 4L5LA 3TB2A 3HJPA 3ZVJA 4I2TA 3L0HA 1ZYEA 2CX4A 5EVOA 5GAND 2J23A 5ECOB 5IMCA 3LQ7A 4GLTA 2MMOA 1MD3A 4GQCA 3UAPA 3APOA 4GF0A 1TRUA 5IPGA 1G6WA 3KMOA 5D8IA 4YAVA 2B7JA 2LRTA 4N0ZA 3EMPA 5C00A 5KOXA 3UL3A 2YOIA 4RQXA 4HZ4A 3EINA 1O8WA 1TRVA 1X5EA 3FZ9A 2H73A 1XZOA 2DJ1A 3IA1A 4F82A 2JU5A 5FHIA 4NXIA 4PUAA 4HI7A 4ZB6A 1XOAA 4XRDA 1AUCA 1K0OA 4POKA 1V58A 1VF2A 1Z9HA 2MBTA 4IP6A 1B4PA 2DJKA 1XFLA 2VM2A 1EEMA 2MMAA 1XW6A 2IMKA 1LBKA 1W4VA 3M9KA 5LCZA 2YN1A 4PQHA 2K8SA 4MF7A 1R5PA 3HA9A 4OO4A 5E59A 3DVWA 2KP2A 2XPDA 5J3RA 1TOFA 2FGXA 3GX0A 4MZWA 2FWGA 4MH3A 4CDOA 4V2NA 4X43A 2IJYA 1GP1A 4ZL8A 2LQOA 5IOWA 22GSA 1TK5B 5HR2A 4MF5A 3FR6A 1XPVA 3RHCA 1V9WA 2KOKA 4GCIA 1FB6A 4KAEA 2NTOA 2QKEA 2R0PA 4Q5NA 4XRAA 3G7IA 1FVKA 3GKKA 4G10A 5L71A 5ECIB 2IWTA 3IDVA 5D73A 2J9HA 5LD0A 4Z2RA 2VM1A 3LW9A 1TP9A 3GH9A 3VK9A 1U3AA 1YZXA 1FO5A 2L5OA 1ZOFA 3DRNA 4DSRA 1BEDA 2CVBA 3QAGA 4YKGA 1UN2A 2DKIA 1XW5A 3NOFA 2P0GA 3GNJA 4WBJA 6GSTA 2YZHA 2WFCA 4K7NA 2UZ8A 1XCCA 3HJMA 4E8EA 2HE3A 4RUVA 1SKRB 2P31A 3W6GA 3QAWA 3QD9A 1WWJA 1TRWA 2OBKA 3IBHA 1GTUA 3G7JA 1A2JA 5J41A 3ZZXA 1GL8A 2YWMA 1SK2A 3LJRA 4K5SA 4HOJA 2V6OA 2CX3A 1KBNA 2C0EA 4GSNA 3LG6A 1HQOA 4D73B 2VL2C 5AIXA 3DVXA 5IQYA 1THXA 1XWKA 5D9XA 2IFQB 4EE0A 3H1NA 4QL7A 3IHGA 5CRGA 3ZRDA 3FZ4A 3WGDA 3GKNA 2DIZA 2LQQA 1MEKA 4EIQA 3F3RA 1NSWA 1DSBA 1GUKA 4ZBBA 4D73A 5KN3A 2H0IA 5B6MA 1WIKA 2NPBA 1HYUA 2IFQA 5IPHA 3P2AA 3IRAA 4FYUA 3SBCA 2X4AA 3UJ1A 2LJKA 3O76A 1YKAA 1OAZA 2WZ9A 2VUPA 3VI5A 3QOUA 2PVOC 5G5EA 3KP8A 2C3NA 1K0CA 2GQKA 4WKWA 1G0TA 1OC3A 4O32A 3VPTA 1DE1A 2K6VA 4MF6A 1SL2B 1EGOA 2OADA 3VWUA 4MNNA 1XWAA 2I81A 5CO3A 1GULA 3WT2A 2LRCA 4FO5A 4PXOA 3ZTLA 3O6TA 2V2GA 2E2MA 1AQVA 1JLWA 2PN8A 3QAVA 1RW1A 1M2BA 3GFKA 1JLVA 1PQNA 2ALBA 4H86A 2GZYA 2DSAA 3FYGA 2E2GA 1IYHA 1PGTA 4FYCA 2GSQA 2D2ZA 4WF5A 1Z6MA 1WE0A 3LORA 4F9ZA 3IPZA 3KIJA 5DJLA 3EVIA 1XVWA 4YQVA 2DIYA 3JCML 4TXVA 4RI6A 1X5DA 1WMJA 4NAXA 5G30A 3HY2A 1O7UA 4J56E 1SJIA 1NHOA 3A2WA 2LV3A 2AHEA 5GZZB 3ZYWA 2I1UA 4K7OA 2ZCTA 5INYA 1NHYA 1AXDA 3F4SA 1U3IA 4OFNA 1BAYA 1EZKA 1SD9A 1YKCA 1GTIA 4ECIA 1MD4A 1QXHA 1QUWA 1I5GA 1QQ2A 1OE8A 1K0BA 1NW2A 3I69A 4HU7A 1AQWA 5BMUA 3Q18A 3ME8A 3A3TA 4KUNA 2KHPA 2B5EA 3EWLA 1V98A 3E9JB 3I9V2 4USSA 2X8GA 2WDUA 1T4YA 2EIRA 4OFTA 2H19A 5DCHA 2H6YA 3TJBA 1Z6NA 3CRUA 3LYPA 2KLXA 5DVBA 16GSA 5ECKB 2H0GA 3DD3A 5ECPB 1W89A 1M7TA 1GWCA 3H93A 2C0GA 4GRFA 2HSHA 3P90A 3W8SA 1ILOA 4KA0A 4L5OA 3MNGA 4JRRA 1Z3EA 2GDRA 4LL1B 3MIXA 3G7YA 1PKWA 1U6TA 5A5KA 2CA8A 2AJQB 2R37A 1TI1A 2PGTA 2X49A 1PN0A 1PL2A 4I8BA 1GNEA 5KN1A 2B6MA 2JACA 3D5JA 1AQXA 2CVKA 5IO0A 1ERUA 4NHZA 4HUAA 4FQUA 5H5QA 2OKAA 1EP8A 5GSTA 6GSVA 2JZRA 3LXTA 5J4UA 1OC9B 1SKWB 3IK7A 3L9VA 4O5QA 4BWQA 3UVHA 3KGKA 3CRTA 5G1KA 1O85A 4OMVA 3L9UA 1LU4A 3UEMA 2R3XA 2FHEA 2QSIA 2FWFA 2IPAA 1YY7A 2HSYA 2YV7A 2FD3A 2R6KA 4HEA2 4JR6A 2MMNA 2HSMA 2A2RA 1SKSB 3DGQA 3GL5A 2H1GA 2H8LA 4EIPA 1AIUA 2F3MA 1GTBA 1OC9A 2WGRA 2HI7A 5FT3A 5LNKe 2PWJA 4LMWA 4KW6A 5COHA 4HU9A 1R5AA 4ZBAA 3ERFA 3R3EA 3FR3A 4IGJA 5KN0A 4MK3A 3GUSA 3E0UA 6GSSA 1OKDA 3L9SA 2I9HA 8GSSA 2FLSA 2B1KA 4IP1A 3PH9A 2O7KA 2OA7A 3DWVA 14GSA 5HQPA 19GSA 4MJAA 5F8BA 3PGTA 1GUMA 3TKSA 4TKYA 4K1FA 5EY6A 2C3QA 3PR8A 3ZREA 1FG4A 2YPMA 2HNLA 3HVSA 5C04A 2TRXA 4WETA 1X9SB 3L78A 1BQ7A 2LJAA 2LKUA 3VFIA 4BVYB 5D93A 4POLA 4MMMA 3TKSE 3FR9A 4KB3A 1T00A 3FW2A 4ID0A 3FK8A 1X0RA 3C1RA 1GSQA 4Q5QA 3RHBA 4MABA 1U88A 4EL1A 2HZEA 2K8VA 2VL3A 3O3TA 3RPPA 5IMZA 4XS6A 2PERA 4N0VA 5D9WA 1PX7A 4BVYA 3TOUA 2OE0A 3HZ4A 1SYRA 13GSA 5DQYA 4HDEA 2F9SA 4KDUA 3F8UA 4IVFA 4HJMA 2P5RA 5CRWA 1K0NA 3ERWA 3WT1A 1ZL9A 2A2SA 5CREA 1CQGA 2FA8A 2WJUA 5IO2A 4IQ1A 4ZIJA 1THOA 2H1AA 5J9BA 1ZGNA 3LGCA 1TK0B 3LYKA 3GN3A 1B8XA 2MYGA 1R26A 4YAPA 5FWGA 1ZYNA 4POBA 3I43A 1K3LA 4QL9A 3VWWA 4DSSB 5F05A 2MBSA 3PPUA 1XXUA 4YQMA 4BWSA 1ZZYA 2IL3A 5ABRA 4EUYA 1Z7RA 4KNDA 1J0FA 1ZYQB 2N5FA 2AB6A 2V6KA 2LTKA 3D4MA 3MYDA 1XWGA 4DSSA 2YWOA 3VLNA 2V1MA 2YANA 4MCUA 4XCSA 3IAM2 4WR5A 1ERTA 3WGEA 1A2LA 4N30A 1S3CA 1BX9A 1TW9A 4CHSA 1GLPA 1XW9A 4KGIA 2IIYA 2LJRA 4J57E 2O8VB 2L5LA 3ZIVA 5ECLB 4IQAA 3F4TA 1YJ6A 2FNOA 2HRAA 2HZFA 3DXBA 2BTOT 2C1YA 2QGVA 3TJFA 2PUKC 4K0NA 3VI7A 2FWHA 5IMFA 4WF4A 2LRNA 1DBYA 1HNAA 1XWCA 2VD0A 1HNBA 3CYNA 3FZAA 2TIRA 4ML6A 1Y25A 3CSJA 2VCTA 2JZTA 1ERWA 3EE2A 2L59A 5H5SA 2IMEA 3EU3A 2GLRA 2LNTA 4TR3A 1SJ6A 3TOTA 9GSSA 5KN2A 3NZNA 3ZLPA 1M9BA 6GSYA 3GSTA 2VIMA 3HD5A 4ZB9A 5IOXA 3GX8A 2H1DA 4PUFC 5J9CA 4KH7A 1Q98A 1YEPA 5CRHA 4BVXA 3GHAA 5AIVA 5JCGA 4G0KA 3HVXA 3TKQA 1HD2A 2VCWA 1FOVA 3QR6A 4HQSA 4TVEA 1IYIA 2RLIA 2WS2A 3H8QA 4KF9A 1GSUA 2H74A 4TRXA 2R0GA 1XIYA 6GSWA 3A2VA 1V2AA 6GSUA 1EP7A 5HFIA 2V41A 3DKSA 4X0XA 2X8HA 1GLQA 1SK0A 1ML6A 3L4NA 1O8XA 4IHUA 2RIIA 4YH2A 4O92A 4IJIA 3QPMA 3MAKA 3UOMA 4XHMA 3TRXA 1N8JA 3HYPA 4TOPA 3APSA 4KCAA 4EF0A 2VO4A 4ML1A 3ZVJD 1TU8A 5HFKA 4AJ7A 1TI3A 2B1LA 5D96A 3MSZA 4X1UA 5IMAA 1SD8A 4LA1A 2NDOA 1DUGA 3D6IA 1NM3A 3G9BA 2LEGA 1T4ZA 3BD2A 2XHFA 5IMDA 2FCHA 1JZRA 4GXZA 1EOGA 2V32A 3IC8A 2VCVA 3TJKA 1XVQA 1VF4A 2K9FA 1MTCA 1SK1A 2CT6A 1A0RP 5CAXA 1VF3A 4MJEA 4ECJA 3DYRA 4PNGA 2EIQA 2L6DA 1USBA 3DMLA 2XPEA 3FHKA 2H1BA 4QQ7A 1JHBA 4ECCA 2JZSA 2LS5A 4BA7A 2VLUA 5BRTA 4ACSA 2FWEA 1CQHA 2H71A 2CQ9A 3ZIJA 5AGYA 2B7KA 4KX4A 3VURA 3GURA 4L0WA 3Q19A 5JWQB 3RAZA 3HDCA 4AJ8A 2FUG2 1RK4A 1TU7A 2H72A 3HCZA 1QGVA 2VL2A 2O87A 4DVCA 3NIVA 2H6ZA 3LXZA 1B48A 2N5AA 5JWOB 2HRNA 1O6JA 1PKZA 2A2PA 3CTFA 1G7OA 2C0FA 3DEXA 3K8NA 4YQUA 3ISOA 1K0DA 1N2AA 1KNGA 2H75A 4TR1A 3ZFBA 3H79A 2KP1A 5EPFA 1A2MA 3D22A 4XTSA 2HXKA 3KXOA 4OO5A 4PNFA 3QFAC 4AF2A 1YQ1A 2YP6A 1ZMAA 3M3MA 1YF0A 5KEJA 2HLSA 1ACVA 3CSHA 3IR4A 4HS1A 5KOWA 1EEJA 4KDXA 2OACA 4G19A 2M46A 1X5CA 3FMWA 2BMXA 1TKDB 4PTSA 1KTEA 2YWNA 3HHVA 5HFGA 4N10A 3WGXA 2B5XA 4I5QA 3HKRA 1JZDA 4JR4A 1URMA 5F0GA 4JZQA 3CTGA 4Q5RA 3C7MA 2OBIA 5DCGA 2JSYA 1M0UA 5ECMB 3TRQA 4MH2A 1EV9A 1YDKA 4GTUA 3KTBA 5D9TA 4IW9A 4K2DA 4MA9A 3U5RE 4IELA 3BBYA 3UVTA 4NV5A 4IJ3A 4O7HA 4A5PA 1GTAA 4OCFA 4MP4A 4K9ZA 1PRXA 2C8UA 4EKZA 1M2AA 4HZ2A 2VCQA 5D9VA 1LJRA 2VLVA 2ON7A 3M0FA 1YF1A 3AY8A 3EURA 4K2XA 2YNXA 3KH7A 4NV2A 2L6CA 3BJ5A 3F4RA 1OC8A 3EU4A 2R0CA 2Z9SA 4EXJA 1OE7A 3KCMA 5ECRB 1FAAA 1AC1A 2GTUA 3J7Yb 3V1WA 4GSSA 4KE3A 3RPNA 2VOCA 5EL8A 5ENUA 5CP1A 1UVZA 1I9DA 1YEXA 4HJ2A 3EC3A 1PN9A 2ES7A 2YZUA 4G0IA 4CW9A 2R2JA 1O81A 3KM6A 2AUVA 4EDYA 2G0FA 4X4JA 2HZEB 1R7HA 4LLRA 1OKTA 2DLXA 4MZCA 3TGZA 4PURA 3GTUB 4E8HA 1JFUA 4JU5A 1FOHA 4NHWA 2GVPA 1WP0A 2GT6A 2ON5A 4ZL7A 1SJZA 2C4JA 2CAIA 3FKFA 3A5WA 4AJ6A 1T7PB 1F3BA 2E7PA 4JBBA 3DIEA 5IM9A 2GQMA 4TR0A 4ICYA 1JZOA 3F6DA 3GTUA 3BCIA 3BOAA 3M8NA 1X9WB 2I4AA 5JCUA 4ZB8A 4MLYA 5F07A 3A2XA 5ID2B 3APQA 4KCEA 3VWXA 4O5RA 2DMLA 5DAKB 2H76A 3P8WA 4RQRA 1SU9A 3R2QA 4PX1A 2VD1A 4GQFA 1Z7PA 2YV9A 3MDKA 4EDZA 5HR0A 2MZCA 4EC0A 3C8EA 3KP9A 1HNCA 4FH8A 1GSEA 4TN8A 5DDLA 5J5NA 3RDWA 2VAFA 1F9MA 2XC2A 5ID2A 5E4WA 1X9MB 1F37A 5DAKA 2WB9A 2CZ2A 4LMVA 4LL4B 4BPYA 3C71A 5G31A 2CZ3A 1M2DA 2WRTA 5G1LA 1EGRA 4K5RA 2DMMA 2OJLA 1GUHA 1AW9A 3HZ8A 3F6FA 2QC7A 2MMZA 4ZXGA 1WRYA 5AISA 20GSA 4V2LA 1FW1A 1ABAA 3F9UA 1QMVA 3GKMA 2C0DA 2AV4A 3VPQA 1BYEA 2JADA 1Z5YE 3KEBA 1MDIA 2DBCA 2L57A 2GSSA 4N11A 1A8YA 5DALB 5B6NA 2DJ0A 5AN1A 2E0QA 2HYXA 1ST9A 1MDJA 2ZUPA 3MWHA 1ERVA 1T1VA 3GH6A 5JWRB 3CMIA 2R4VA 1K3OA 5ECQB 2RUFA 3A5IA 4CY8A 1DE2A 4MJBA 1XWBA 2C3TA 2L4CA 3C73A 3D0ZA 5DALA 5A4UA 4Z2UA 5CRDA 1J9BA 5G2ZA 4NWYA 2FY6A 1PSQA 1ON4A 4GWRA 1QFNA 3N9JA 2X99A 4Z7XA 1G6YA 2B3SA 2A4VA 2PU9C 4KDYA 1PMTA 2GQLA 2YJHA 4BVXB 1UC7A 7GSSA 4PQIA 1WJKA 2NBSA 2CAQA 2PBJA 2B5YA 4WR4A 2ZNMA 3F0IA 4GSTA 2AAWA 2GZPA 1H75A 1S3DA 3ME7A 4KSMA 5A4VA 3TRPA 3W8JA 3UMAA 4OCEA 3TJJA 3QMXA 2GGTA 5DJMA 2XBQA 5B8AA 3D21A 4G0LA 4Q5FA 2JL4A 1VF1A 2TRCP 2AYTA 4HQZA 5GAPD 4F2IA 3VWVA 2O89A 2IMDA 2CV4A 5HR3A 3IOSA 3KH9A 3TUEA 2KUCA 1QK8A 2WCIA 4K7IA 2VCXA 1A0FA 1XOBA 1K0AA 3GSSA 3CBUA 1Q4JA 1Y6EA 3LWAA 4L8EA 3US3A 4EVMA 2M72A 1PD21 3N5OA 3RBTA 3UARA 3EMXA 3TCOA 1K3YA 3HJOA 4NMUA 1A24A 2OE3A 2VL9A 2HT9A 2H30A 4F03A 3ED3A 3CSIA 3GL3A 4V1Ag 2NVLA 2DKHA 4K0GA 5IMVA 3EPTA 2X64A 1UA5A 2YJ7A 1B9XC 4MZBA 2X8CA 1T3BA 1FHEA 2XBIA 4I6XA 4RI7A 4MPFA 2RUEA 2M80A 2VLTA 3Q6OA 1J08A 4OWYA 4NPBA 3HXSA 1A8LA 1OVNA 1GH2A 1ZCPA 2DJJA 4YKFA 2YCDA 2K18A 4XS1A 1EV4A 3IE3A 4Z2TA 3GYKA 4DEJA 3OR5A 1RQMA 3Q74A 1GNWA 2C80A 11GSA 3PINA 1F6MC 4OFMA 1VRSD 4WBRD 5CNWA 2I3YA 1SYXA 2IMFA 3HVVA 3LSZA 2HRFA 2YWIA 2CVDA 3U6VA 4TW5A 3J7Yk 3TKPA 2H66A 3CXGA 4I2UA 5H5RA 1GRXA 4V1Ap 2GSTA 3UBLA 3GIXA 3WYWA 1SENA 4JE1A 2F8FA 1S3AA 3ZMLA 3GMFA 1BJXA 2HFDA 3E3EA 4ULXA 2F8AA 2PMTA 1TDIA 4TR1B 1F2EA 4JEDA 4J2FA 1B4QA 3QFBC 6GSXA 2JSZA 3F63A 4TXOB 3GRXA 3D4TA 1GSSA 5GSSA 1SL1B 2DC5A 2PVQA 4K6XA 2R5GA 4O5UA 1TJDA 1XBSA 1GSFA 3FY7A 2H01A 3I6AA 4MJCA 3FRCA 4WXTA 3QCPA 4MDCA 1A23A 4PGTA 3S9FA 1PX6A 2FA4A 2H70A 1WOUA 5ELGA 1B9YC 2H6XA 4TXOA 3TKSC 1V40A 1JZWA 3C1SA 4ISDA 3H4KA 1E6BA 4P3YB 4G2EA 3KJYA 2PPTA 3IK9A 3UBKA 3TJGA 4IS0A 5G5FA 3KMNA 1M99A 1ZYPA 1WPIA 4FYBA 2H0HA 3EYTA 2L4QA 18GSA 2OE1A 3KD0A 4ECBA 4L0UA 4XIHA 4OD7A 4DSQA 4BL7B 2WULA 2BJXA 3P7XA 4POMA 3IHQA 3LEFA 3ZL5A 3SWLA 2LNSA 1PL1A 5A4WA 3M1GA 2LSTA 2HRKA 4ZILA 4PQ1A 3TDGA 5B8BA 3IAS2 4KSOA 2O85A 5ELAA 2EIOA 1AAZA 2P5QA 5DBQA 4BL7A 3KTLA 2QA2A 3TKRA 4ILFA 5CYYA 4IBPA 1TXXA 1BG5A 4WEYA 2GSRA 1H4OA 1T8EB 3GV1A 4G9HA 4XS4B 1GSDA 4CY6A 2LUSA 4MPGA 2QA1A 4EO3A 2G2QA 2REMA 3ZFLA 4IKHA 3M9JA 2RM5A 1TTZA 1O73A 2GS3A 3FZ5A 2DJ3A 5F06A 3ZMKA 1VGLA 4F0BA 1M9AA 5B7CA 17GSA 3IC4A 3GA4A 4XS4A 1FVJA 3WD6A 12GSA 3F3QA 1TK8B 2IMIA 5DQSA 1K0MA 1TRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IIZ A;  4I97 A;  1PA3 A;  1V57 A;  3BCK A;  4V2M A;  1SL0 B;  1E2Y A;  2GZZ A;  1U87 A;  3FEU A;  3LFL A;  1MDK A;  5ECN B;  5HR1 A;  2N5B A;  5JCW A;  10GS A;  4TR4 A;  1EWX A;  1FB0 A;  2F51 A;  1F3A A;  1EOH A;  3ERG A;  5ECS A;  3UIW A;  2DJ2 A;  5ECH B;  1GSY A;  1KEB A;  4IN0 A;  4FIW A;  3IXR A;  1C72 A;  1OYJ A;  3IV4 A;  3ZIT A;  3QDN A;  3GKX A;  2RM6 A;  2VCZ A;  1R4W A;  4K8M A;  3KZQ A;  2GT5 A;  4F0C A;  1G7E A;  4ZL9 A;  2IN3 A;  2EC4 A;  4ZBD A;  4AGS A;  4L5L A;  3TB2 A;  3HJP A;  3ZVJ A;  4I2T A;  3L0H A;  1ZYE A;  2CX4 A;  5EVO A;  5GAN D;  2J23 A;  5ECO B;  5IMC A;  3LQ7 A;  4GLT A;  2MMO A;  1MD3 A;  4GQC A;  3UAP A;  3APO A;  4GF0 A;  1TRU A;  5IPG A;  1G6W A;  3KMO A;  5D8I A;  4YAV A;  2B7J A;  2LRT A;  4N0Z A;  3EMP A;  5C00 A;  3UL3 A;  2YOI A;  4RQX A;  4HZ4 A;  3EIN A;  1O8W A;  1TRV A;  1X5E A;  3FZ9 A;  2H73 A;  1XZO A;  2DJ1 A;  3IA1 A;  4F82 A;  2JU5 A;  5FHI A;  4NXI A;  4PUA A;  4HI7 A;  4ZB6 A;  1XOA A;  4XRD A;  1AUC A;  1K0O A;  4POK A;  1V58 A;  1VF2 A;  1Z9H A;  2MBT A;  4IP6 A;  1B4P A;  2DJK A;  1XFL A;  2VM2 A;  1EEM A;  2MMA A;  1XW6 A;  2IMK A;  1LBK A;  1W4V A;  3M9K A;  5LCZ A;  2YN1 A;  4PQH A;  2K8S A;  4MF7 A;  1R5P A;  3HA9 A;  4OO4 A;  5E59 A;  3DVW A;  2KP2 A;  2XPD A;  5J3R A;  1TOF A;  2FGX A;  3GX0 A;  4MZW A;  2FWG A;  4MH3 A;  4CDO A;  4V2N A;  4X43 A;  2IJY A;  1GP1 A;  4ZL8 A;  2LQO A;  5IOW A;  22GS A;  1TK5 B;  5HR2 A;  4MF5 A;  3FR6 A;  1XPV A;  3RHC A;  1V9W A;  2KOK A;  4GCI A;  1FB6 A;  4KAE A;  2NTO A;  2QKE A;  4Q5N A;  4XRA A;  3G7I A;  1FVK A;  3GKK A;  4G10 A;  5L71 A;  5ECI B;  2IWT A;  3IDV A;  5D73 A;  2J9H A;  5LD0 A;  2VM1 A;  1TP9 A;  3GH9 A;  3VK9 A;  1U3A A;  1YZX A;  1FO5 A;  2L5O A;  1ZOF A;  3DRN A;  4DSR A;  1BED A;  2CVB A;  3QAG A;  1UN2 A;  1XW5 A;  3NOF A;  2P0G A;  3GNJ A;  4WBJ A;  6GST A;  2YZH A;  2WFC A;  4K7N A;  1XCC A;  3HJM A;  4E8E A;  2HE3 A;  4RUV A;  1SKR B;  2P31 A;  3W6G A;  3QAW A;  3QD9 A;  1WWJ A;  1TRW A;  2OBK A;  3IBH A;  1GTU A;  3G7J A;  1A2J A;  5J41 A;  3ZZX A;  1GL8 A;  2YWM A;  1SK2 A;  3LJR A;  4HOJ A;  2V6O A;  2CX3 A;  1KBN A;  2C0E A;  4GSN A;  3LG6 A;  1HQO A;  4D73 B;  2VL2 C;  5AIX A;  3DVX A;  5IQY A;  1THX A;  1XWK A;  5D9X A;  2IFQ B;  4EE0 A;  3H1N A;  4QL7 A;  5CRG A;  3ZRD A;  3FZ4 A;  3WGD A;  3GKN A;  2DIZ A;  2LQQ A;  1MEK A;  3F3R A;  1NSW A;  1DSB A;  1GUK A;  4ZBB A;  4D73 A;  5KN3 A;  2H0I A;  5B6M A;  1WIK A;  2NPB A;  1HYU A;  2IFQ A;  5IPH A;  3P2A A;  3IRA A;  4FYU A;  3SBC A;  3UJ1 A;  2LJK A;  3O76 A;  1YKA A;  1OAZ A;  2WZ9 A;  2VUP A;  3VI5 A;  3QOU A;  2PVO C;  5G5E A;  3KP8 A;  2C3N A;  1K0C A;  2GQK A;  4WKW A;  1G0T A;  1OC3 A;  4O32 A;  3VPT A;  1DE1 A;  2K6V A;  4MF6 A;  1SL2 B;  1EGO A;  2OAD A;  3VWU A;  1XWA A;  2I81 A;  5CO3 A;  1GUL A;  3WT2 A;  2LRC A;  4FO5 A;  4PXO A;  3ZTL A;  3O6T A;  2V2G A;  2E2M A;  1AQV A;  1JLW A;  2PN8 A;  3QAV A;  1RW1 A;  1M2B A;  3GFK A;  1JLV A;  1PQN A;  2ALB A;  4H86 A;  2GZY A;  2DSA A;  3FYG A;  2E2G A;  1IYH A;  1PGT A;  4FYC A;  2GSQ A;  2D2Z A;  4WF5 A;  1Z6M A;  1WE0 A;  3LOR A;  4F9Z A;  3IPZ A;  3KIJ A;  5DJL A;  3EVI A;  1XVW A;  4YQV A;  2DIY A;  3JCM L;  4TXV A;  4RI6 A;  1X5D A;  1WMJ A;  4NAX A;  5G30 A;  3HY2 A;  1O7U A;  4J56 E;  1SJI A;  1NHO A;  3A2W A;  2LV3 A;  2AHE A;  5GZZ B;  3ZYW A;  2I1U A;  4K7O A;  2ZCT A;  5INY A;  1NHY A;  1AXD A;  3F4S A;  1U3I A;  4OFN A;  1BAY A;  1EZK A;  1SD9 A;  1YKC A;  1GTI A;  4ECI A;  1MD4 A;  1QXH A;  1QUW A;  1I5G A;  1QQ2 A;  1OE8 A;  1K0B A;  1NW2 A;  3I69 A;  4HU7 A;  1AQW A;  3Q18 A;  3ME8 A;  3A3T A;  4KUN A;  2KHP A;  2B5E A;  3EWL A;  1V98 A;  3E9J B;  3I9V 2;  2X8G A;  2WDU A;  1T4Y A;  2EIR A;  4OFT A;  2H19 A;  5DCH A;  2H6Y A;  3TJB A;  1Z6N A;  3CRU A;  3LYP A;  2KLX A;  5DVB A;  16GS A;  5ECK B;  2H0G A;  3DD3 A;  5ECP B;  1W89 A;  1M7T A;  1GWC A;  3H93 A;  2C0G A;  4GRF A;  2HSH A;  3P90 A;  3W8S A;  1ILO A;  4KA0 A;  4L5O A;  3MNG A;  4JRR A;  1Z3E A;  2GDR A;  4LL1 B;  3G7Y A;  1PKW A;  1U6T A;  5A5K A;  2CA8 A;  2AJQ B;  2R37 A;  1TI1 A;  2PGT A;  1PL2 A;  4I8B A;  1GNE A;  5KN1 A;  2B6M A;  2JAC A;  3D5J A;  1AQX A;  2CVK A;  5IO0 A;  1ERU A;  4NHZ A;  4HUA A;  5H5Q A;  2OKA A;  1EP8 A;  5GST A;  6GSV A;  2JZR A;  3LXT A;  5J4U A;  1OC9 B;  1SKW B;  3IK7 A;  3L9V A;  4BWQ A;  3UVH A;  3KGK A;  3CRT A;  5G1K A;  1O85 A;  4OMV A;  3L9U A;  1LU4 A;  3UEM A;  2R3X A;  2FHE A;  2QSI A;  2FWF A;  2IPA A;  1YY7 A;  2HSY A;  2YV7 A;  2FD3 A;  2R6K A;  4HEA 2;  4JR6 A;  2MMN A;  2A2R A;  1SKS B;  3DGQ A;  3GL5 A;  2H1G A;  2H8L A;  1AIU A;  2F3M A;  1GTB A;  1OC9 A;  2WGR A;  2HI7 A;  5FT3 A;  5LNK e;  2PWJ A;  4LMW A;  4KW6 A;  5COH A;  4HU9 A;  1R5A A;  4ZBA A;  3ERF A;  4IGJ A;  3FR3 A;  5KN0 A;  4MK3 A;  3GUS A;  3E0U A;  6GSS A;  1OKD A;  3L9S A;  2I9H A;  8GSS A;  2FLS A;  2B1K A;  4IP1 A;  3PH9 A;  2O7K A;  2OA7 A;  3DWV A;  14GS A;  5HQP A;  19GS A;  4MJA A;  5F8B A;  3PGT A;  1GUM A;  3TKS A;  4TKY A;  4K1F A;  5EY6 A;  2C3Q A;  3PR8 A;  3ZRE A;  1FG4 A;  2YPM A;  2HNL A;  3HVS A;  5C04 A;  2TRX A;  4WET A;  1X9S B;  3L78 A;  1BQ7 A;  2LJA A;  2LKU A;  3VFI A;  5D93 A;  4POL A;  4MMM A;  3TKS E;  3FR9 A;  4KB3 A;  1T00 A;  3FW2 A;  4ID0 A;  3FK8 A;  1X0R A;  3C1R A;  1GSQ A;  4Q5Q A;  3RHB A;  4MAB A;  1U88 A;  4EL1 A;  2HZE A;  2K8V A;  2VL3 A;  3O3T A;  3RPP A;  5IMZ A;  4XS6 A;  2PER A;  4N0V A;  5D9W A;  1PX7 A;  4BVY A;  3TOU A;  2OE0 A;  3HZ4 A;  1SYR A;  13GS A;  5DQY A;  4HDE A;  2F9S A;  4KDU A;  3F8U A;  4IVF A;  4HJM A;  2P5R A;  5CRW A;  1K0N A;  3ERW A;  3WT1 A;  1ZL9 A;  2A2S A;  5CRE A;  1CQG A;  2FA8 A;  2WJU A;  5IO2 A;  4IQ1 A;  4ZIJ A;  1THO A;  2H1A A;  5J9B A;  1ZGN A;  3LGC A;  1TK0 B;  3LYK A;  3GN3 A;  1B8X A;  2MYG A;  1R26 A;  4YAP A;  5FWG A;  4POB A;  3I43 A;  1K3L A;  4QL9 A;  3VWW A;  4DSS B;  5F05 A;  2MBS A;  1XXU A;  4YQM A;  4BWS A;  1ZZY A;  2IL3 A;  5ABR A;  4EUY A;  1Z7R A;  4KND A;  1J0F A;  1ZYQ B;  2N5F A;  2AB6 A;  2V6K A;  2LTK A;  3D4M A;  1XWG A;  4DSS A;  2YWO A;  3VLN A;  2V1M A;  2YAN A;  4MCU A;  4XCS A;  3IAM 2;  4WR5 A;  1ERT A;  3WGE A;  1A2L A;  4N30 A;  1S3C A;  1BX9 A;  1TW9 A;  4CHS A;  1GLP A;  1XW9 A;  4KGI A;  2IIY A;  2LJR A;  4J57 E;  2O8V B;  2L5L A;  3ZIV A;  5ECL B;  4IQA A;  3F4T A;  1YJ6 A;  2FNO A;  2HZF A;  3DXB A;  2BTO T;  2C1Y A;  2QGV A;  3TJF A;  2PUK C;  4K0N A;  3VI7 A;  2FWH A;  5IMF A;  4WF4 A;  2LRN A;  1DBY A;  1HNA A;  1XWC A;  2VD0 A;  1HNB A;  3CYN A;  3FZA A;  2TIR A;  4ML6 A;  1Y25 A;  3CSJ A;  2VCT A;  2JZT A;  1ERW A;  3EE2 A;  2L59 A;  5H5S A;  2IME A;  3EU3 A;  2GLR A;  2LNT A;  4TR3 A;  1SJ6 A;  3TOT A;  9GSS A;  5KN2 A;  3NZN A;  3ZLP A;  1M9B A;  6GSY A;  3GST A;  2VIM A;  3HD5 A;  4ZB9 A;  5IOX A;  3GX8 A;  2H1D A;  4PUF C;  5J9C A;  4KH7 A;  1Q98 A;  1YEP A;  5CRH A;  4BVX A;  3GHA A;  5AIV A;  5JCG A;  3HVX A;  3TKQ A;  1HD2 A;  2VCW A;  1FOV A;  3QR6 A;  4HQS A;  4TVE A;  1IYI A;  2RLI A;  2WS2 A;  3H8Q A;  1GSU A;  2H74 A;  4TRX A;  1XIY A;  6GSW A;  3A2V A;  1V2A A;  6GSU A;  1EP7 A;  5HFI A;  2V41 A;  3DKS A;  4X0X A;  2X8H A;  1GLQ A;  1SK0 A;  1ML6 A;  3L4N A;  1O8X A;  4IHU A;  2RII A;  4YH2 A;  4O92 A;  4IJI A;  3QPM A;  3MAK A;  3UOM A;  4XHM A;  3TRX A;  1N8J A;  3HYP A;  4TOP A;  3APS A;  4KCA A;  4EF0 A;  2VO4 A;  4ML1 A;  3ZVJ D;  1TU8 A;  5HFK A;  4AJ7 A;  1TI3 A;  2B1L A;  5D96 A;  3MSZ A;  4X1U A;  5IMA A;  1SD8 A;  4LA1 A;  2NDO A;  1DUG A;  3D6I A;  1NM3 A;  3G9B A;  2LEG A;  1T4Z A;  3BD2 A;  2XHF A;  5IMD A;  2FCH A;  1JZR A;  4GXZ A;  1EOG A;  2V32 A;  2VCV A;  3TJK A;  1XVQ A;  1VF4 A;  2K9F A;  1MTC A;  1SK1 A;  2CT6 A;  1A0R P;  5CAX A;  1VF3 A;  4MJE A;  4ECJ A;  3DYR A;  4PNG A;  2EIQ A;  2L6D A;  1USB A;  3DML A;  2XPE A;  3FHK A;  2H1B A;  4QQ7 A;  1JHB A;  4ECC A;  2JZS A;  2LS5 A;  4BA7 A;  2VLU A;  4ACS A;  2FWE A;  1CQH A;  2H71 A;  2CQ9 A;  3ZIJ A;  5AGY A;  2B7K A;  4KX4 A;  3VUR A;  3GUR A;  4L0W A;  3Q19 A;  5JWQ B;  3RAZ A;  3HDC A;  4AJ8 A;  2FUG 2;  1RK4 A;  1TU7 A;  2H72 A;  3HCZ A;  1QGV A;  2VL2 A;  2O87 A;  4DVC A;  3NIV A;  2H6Z A;  3LXZ A;  1B48 A;  2N5A A;  5JWO B;  2HRN A;  1O6J A;  1PKZ A;  3CTF A;  1G7O A;  2C0F A;  3DEX A;  3K8N A;  4YQU A;  3ISO A;  1K0D A;  1N2A A;  1KNG A;  2H75 A;  4TR1 A;  3ZFB A;  3H79 A;  5EPF A;  2KP1 A;  1A2M A;  3D22 A;  4XTS A;  2HXK A;  3KXO A;  4OO5 A;  4PNF A;  3QFA C;  4AF2 A;  1YQ1 A;  2YP6 A;  1ZMA A;  3M3M A;  1YF0 A;  5KEJ A;  2HLS A;  1ACV A;  3CSH A;  3IR4 A;  4HS1 A;  1EEJ A;  4KDX A;  2OAC A;  4G19 A;  2M46 A;  1X5C A;  2BMX A;  1TKD B;  1KTE A;  2YWN A;  3HHV A;  5HFG A;  4N10 A;  3WGX A;  2B5X A;  4I5Q A;  3HKR A;  1JZD A;  4JR4 A;  1URM A;  5F0G A;  4JZQ A;  3CTG A;  4Q5R A;  3C7M A;  2OBI A;  5DCG A;  2JSY A;  1M0U A;  5ECM B;  3TRQ A;  4MH2 A;  1EV9 A;  1YDK A;  4GTU A;  3KTB A;  5D9T A;  4IW9 A;  4K2D A;  4MA9 A;  3U5R E;  4IEL A;  3BBY A;  3UVT A;  4NV5 A;  4IJ3 A;  4O7H A;  1GTA A;  4OCF A;  4MP4 A;  4K9Z A;  1PRX A;  2C8U A;  4EKZ A;  1M2A A;  4HZ2 A;  2VCQ A;  5D9V A;  1LJR A;  2VLV A;  2ON7 A;  3M0F A;  1YF1 A;  3AY8 A;  3EUR A;  2YNX A;  3KH7 A;  4NV2 A;  2L6C A;  3BJ5 A;  3F4R A;  1OC8 A;  3EU4 A;  2Z9S A;  4EXJ A;  1OE7 A;  3KCM A;  5ECR B;  1FAA A;  1AC1 A;  2GTU A;  3J7Y b;  3V1W A;  4GSS A;  4KE3 A;  3RPN A;  2VOC A;  5EL8 A;  5ENU A;  5CP1 A;  1UVZ A;  1I9D A;  1YEX A;  4HJ2 A;  3EC3 A;  1PN9 A;  2ES7 A;  2YZU A;  4CW9 A;  2R2J A;  1O81 A;  3KM6 A;  2AUV A;  4EDY A;  2G0F A;  2HZE B;  1R7H A;  4LLR A;  1OKT A;  2DLX A;  4MZC A;  3TGZ A;  4PUR A;  3GTU B;  4E8H A;  1JFU A;  4JU5 A;  4NHW A;  2GVP A;  1WP0 A;  2GT6 A;  2ON5 A;  4ZL7 A;  1SJZ A;  2C4J A;  2CAI A;  3FKF A;  3A5W A;  4AJ6 A;  1T7P B;  1F3B A;  2E7P A;  4JBB A;  3DIE A;  5IM9 A;  2GQM A;  4TR0 A;  1JZO A;  3F6D A;  3GTU A;  3BCI A;  3BOA A;  3M8N A;  1X9W B;  2I4A A;  5JCU A;  4ZB8 A;  4MLY A;  5F07 A;  3A2X A;  5ID2 B;  3APQ A;  4KCE A;  3VWX A;  4O5R A;  2DML A;  5DAK B;  2H76 A;  3P8W A;  4RQR A;  1SU9 A;  3R2Q A;  4PX1 A;  2VD1 A;  4GQF A;  1Z7P A;  2YV9 A;  3MDK A;  4EDZ A;  5HR0 A;  2MZC A;  4EC0 A;  3C8E A;  3KP9 A;  1HNC A;  4FH8 A;  1GSE A;  4TN8 A;  5DDL A;  5J5N A;  3RDW A;  2VAF A;  1F9M A;  2XC2 A;  5ID2 A;  5E4W A;  1X9M B;  1F37 A;  5DAK A;  2WB9 A;  2CZ2 A;  4LMV A;  4LL4 B;  4BPY A;  3C71 A;  5G31 A;  2CZ3 A;  1M2D A;  2WRT A;  5G1L A;  1EGR A;  2DMM A;  2OJL A;  1GUH A;  1AW9 A;  3HZ8 A;  3F6F A;  2QC7 A;  2MMZ A;  4ZXG A;  1WRY A;  5AIS A;  20GS A;  4V2L A;  1FW1 A;  1ABA A;  3F9U A;  1QMV A;  3GKM A;  2C0D A;  2AV4 A;  3VPQ A;  1BYE A;  2JAD A;  1Z5Y E;  3KEB A;  1MDI A;  2DBC A;  2L57 A;  2GSS A;  4N11 A;  1A8Y A;  5DAL B;  5B6N A;  2DJ0 A;  5AN1 A;  2E0Q A;  2HYX A;  1ST9 A;  1MDJ A;  2ZUP A;  3MWH A;  1ERV A;  1T1V A;  3GH6 A;  5JWR B;  3CMI A;  2R4V A;  1K3O A;  5ECQ B;  2RUF A;  1DE2 A;  4MJB A;  1XWB A;  2C3T A;  2L4C A;  3C73 A;  3D0Z A;  5DAL A;  5A4U A;  5CRD A;  1J9B A;  5G2Z A;  4NWY A;  2FY6 A;  1PSQ A;  1ON4 A;  4GWR A;  1QFN A;  3N9J A;  2X99 A;  4Z7X A;  1G6Y A;  2B3S A;  2A4V A;  2PU9 C;  4KDY A;  1PMT A;  2GQL A;  2YJH A;  1UC7 A;  7GSS A;  4PQI A;  1WJK A;  2NBS A;  2CAQ A;  2PBJ A;  2B5Y A;  4WR4 A;  2ZNM A;  3F0I A;  4GST A;  2AAW A;  2GZP A;  1H75 A;  1S3D A;  3ME7 A;  4KSM A;  5A4V A;  3TRP A;  3W8J A;  3UMA A;  4OCE A;  3TJJ A;  3QMX A;  2GGT A;  5DJM A;  2XBQ A;  5B8A A;  3D21 A;  4Q5F A;  2JL4 A;  1VF1 A;  2TRC P;  2AYT A;  4HQZ A;  5GAP D;  4F2I A;  3VWV A;  2O89 A;  2IMD A;  2CV4 A;  5HR3 A;  3IOS A;  3KH9 A;  3TUE A;  2KUC A;  1QK8 A;  2WCI A;  4K7I A;  2VCX A;  1A0F A;  1XOB A;  1K0A A;  3GSS A;  3CBU A;  1Q4J A;  1Y6E A;  3LWA A;  4L8E A;  3US3 A;  4EVM A;  2M72 A;  1PD2 1;  3N5O A;  3RBT A;  3UAR A;  3EMX A;  3TCO A;  1K3Y A;  3HJO A;  4NMU A;  1A24 A;  2OE3 A;  2VL9 A;  2HT9 A;  2H30 A;  4F03 A;  3ED3 A;  3CSI A;  3GL3 A;  4V1A g;  2NVL A;  4K0G A;  5IMV A;  2X64 A;  1UA5 A;  2YJ7 A;  1B9X C;  4MZB A;  2X8C A;  1T3B A;  1FHE A;  2XBI A;  4I6X A;  4RI7 A;  4MPF A;  2RUE A;  2M80 A;  2VLT A;  3Q6O A;  1J08 A;  4OWY A;  4NPB A;  3HXS A;  1A8L A;  1OVN A;  1GH2 A;  1ZCP A;  2DJJ A;  2YCD A;  2K18 A;  4XS1 A;  1EV4 A;  3IE3 A;  3GYK A;  4DEJ A;  3OR5 A;  1RQM A;  3Q74 A;  1GNW A;  2C80 A;  11GS A;  3PIN A;  1F6M C;  4OFM A;  1VRS D;  4WBR D;  5CNW A;  2I3Y A;  1SYX A;  2IMF A;  3HVV A;  3LSZ A;  2HRF A;  2YWI A;  2CVD A;  3U6V A;  4TW5 A;  3J7Y k;  3TKP A;  2H66 A;  3CXG A;  4I2U A;  5H5R A;  1GRX A;  4V1A p;  2GST A;  3UBL A;  3GIX A;  3WYW A;  1SEN A;  4JE1 A;  2F8F A;  1S3A A;  3ZML A;  3GMF A;  1BJX A;  2HFD A;  3E3E A;  4ULX A;  2F8A A;  2PMT A;  1TDI A;  4TR1 B;  1F2E A;  4JED A;  4J2F A;  1B4Q A;  3QFB C;  6GSX A;  2JSZ A;  3F63 A;  4TXO B;  3GRX A;  3D4T A;  1GSS A;  5GSS A;  1SL1 B;  2DC5 A;  2PVQ A;  4K6X A;  2R5G A;  1TJD A;  1XBS A;  1GSF A;  3FY7 A;  2H01 A;  3I6A A;  4MJC A;  3FRC A;  4WXT A;  3QCP A;  4MDC A;  1A23 A;  4PGT A;  3S9F A;  1PX6 A;  2FA4 A;  2H70 A;  1WOU A;  5ELG A;  1B9Y C;  2H6X A;  4TXO A;  3TKS C;  1V40 A;  1JZW A;  3C1S A;  4ISD A;  3H4K A;  1E6B A;  4P3Y B;  4G2E A;  3KJY A;  2PPT A;  3IK9 A;  3UBK A;  3TJG A;  4IS0 A;  5G5F A;  3KMN A;  1M99 A;  1WPI A;  4FYB A;  2H0H A;  3EYT A;  2L4Q A;  18GS A;  2OE1 A;  3KD0 A;  4ECB A;  4L0U A;  4XIH A;  4OD7 A;  4DSQ A;  2WUL A;  2BJX A;  3P7X A;  4POM A;  3IHQ A;  3LEF A;  3ZL5 A;  3SWL A;  2LNS A;  1PL1 A;  5A4W A;  3M1G A;  2LST A;  4ZIL A;  4PQ1 A;  3TDG A;  5B8B A;  3IAS 2;  4KSO A;  2O85 A;  5ELA A;  2EIO A;  1AAZ A;  2P5Q A;  5DBQ A;  4BL7 A;  3KTL A;  3TKR A;  4ILF A;  5CYY A;  4IBP A;  1TXX A;  1BG5 A;  4WEY A;  2GSR A;  1H4O A;  1T8E B;  3GV1 A;  4G9H A;  4XS4 B;  1GSD A;  2LUS A;  4MPG A;  4EO3 A;  2G2Q A;  2REM A;  3ZFL A;  4IKH A;  3M9J A;  2RM5 A;  1TTZ A;  1O73 A;  2GS3 A;  3FZ5 A;  2DJ3 A;  5F06 A;  3ZMK A;  1VGL A;  4F0B A;  1M9A A;  5B7C A;  17GS A;  3IC4 A;  3GA4 A;  4XS4 A;  1FVJ A;  3WD6 A;  12GS A;  3F3Q A;  1TK8 B;  2IMI A;  5DQS A;  1K0M A;  1TRS A; 
#chains in the Genus database with same CATH topology
 5IIZ A;  4I97 A;  1PA3 A;  1V57 A;  3BCK A;  4V2M A;  1SL0 B;  1E2Y A;  2GZZ A;  1U87 A;  3FEU A;  3LFL A;  1MDK A;  5ECN B;  5HR1 A;  2N5B A;  5JCW A;  10GS A;  4TR4 A;  1EWX A;  1FB0 A;  2F51 A;  1F3A A;  1EOH A;  3ERG A;  5ECS A;  3UIW A;  2DJ2 A;  5ECH B;  1GSY A;  1KEB A;  4IN0 A;  4FIW A;  3IXR A;  1C72 A;  1OYJ A;  3IV4 A;  3ZIT A;  3QDN A;  3GKX A;  2RM6 A;  2VCZ A;  1R4W A;  4K8M A;  3KZQ A;  2GT5 A;  2A4H A;  4F0C A;  1G7E A;  4ZL9 A;  2IN3 A;  2EC4 A;  4ZBD A;  4AGS A;  4L5L A;  3TB2 A;  3HJP A;  3ZVJ A;  4I2T A;  3L0H A;  1ZYE A;  2CX4 A;  5EVO A;  5GAN D;  2J23 A;  5ECO B;  5IMC A;  3LQ7 A;  4GLT A;  2MMO A;  1MD3 A;  4GQC A;  3UAP A;  3APO A;  4GF0 A;  1TRU A;  5IPG A;  1G6W A;  3KMO A;  5D8I A;  4YAV A;  2B7J A;  2LRT A;  4N0Z A;  3EMP A;  5C00 A;  5KOX A;  3UL3 A;  2YOI A;  4RQX A;  4HZ4 A;  3EIN A;  1O8W A;  1TRV A;  1X5E A;  3FZ9 A;  2H73 A;  1XZO A;  2DJ1 A;  3IA1 A;  4F82 A;  2JU5 A;  5FHI A;  4NXI A;  4PUA A;  4HI7 A;  4ZB6 A;  4BIK A;  1XOA A;  4XRD A;  1AUC A;  1K0O A;  4POK A;  1V58 A;  1VF2 A;  1Z9H A;  2MBT A;  4IP6 A;  1B4P A;  2DJK A;  1XFL A;  2VM2 A;  1EEM A;  2MMA A;  1XW6 A;  2IMK A;  1LBK A;  1W4V A;  3M9K A;  5LCZ A;  2YN1 A;  4PQH A;  2K8S A;  4MF7 A;  1R5P A;  3HA9 A;  4OO4 A;  5E59 A;  3DVW A;  2KP2 A;  2XPD A;  5J3R A;  1TOF A;  2FGX A;  3GX0 A;  4MZW A;  2FWG A;  4MH3 A;  4CDO A;  4V2N A;  4X43 A;  2IJY A;  1GP1 A;  4ZL8 A;  2LQO A;  5IOW A;  22GS A;  1TK5 B;  5HR2 A;  1M3I A;  4MF5 A;  3FR6 A;  1XPV A;  3RHC A;  1V9W A;  2KOK A;  4GCI A;  1FB6 A;  4KAE A;  2NTO A;  2QKE A;  2R0P A;  4Q5N A;  4XRA A;  3G7I A;  1FVK A;  3GKK A;  4G10 A;  5L71 A;  5ECI B;  2IWT A;  3IDV A;  5D73 A;  2J9H A;  5LD0 A;  4Z2R A;  2VM1 A;  3LW9 A;  1TP9 A;  3GH9 A;  3VK9 A;  1U3A A;  1YZX A;  1FO5 A;  2L5O A;  1ZOF A;  3DRN A;  4DSR A;  1BED A;  2CVB A;  3QAG A;  4YKG A;  1UN2 A;  2DKI A;  1XW5 A;  3NOF A;  2P0G A;  3GNJ A;  4WBJ A;  6GST A;  2YZH A;  2WFC A;  4K7N A;  2UZ8 A;  1XCC A;  3HJM A;  4E8E A;  2HE3 A;  4RUV A;  1SKR B;  2P31 A;  3W6G A;  3QAW A;  3QD9 A;  1WWJ A;  1TRW A;  2OBK A;  3IBH A;  1GTU A;  3G7J A;  1A2J A;  5J41 A;  3ZZX A;  1GL8 A;  2YWM A;  1SK2 A;  3LJR A;  4K5S A;  4HOJ A;  2V6O A;  2CX3 A;  1KBN A;  2C0E A;  4GSN A;  3LG6 A;  1HQO A;  4D73 B;  2VL2 C;  5AIX A;  3DVX A;  5IQY A;  1THX A;  1XWK A;  5D9X A;  2IFQ B;  4EE0 A;  3H1N A;  4QL7 A;  3IHG A;  5CRG A;  3ZRD A;  3FZ4 A;  3WGD A;  3GKN A;  2DIZ A;  2LQQ A;  1MEK A;  4EIQ A;  3F3R A;  1NSW A;  1DSB A;  1GUK A;  4ZBB A;  4D73 A;  5KN3 A;  2H0I A;  5B6M A;  1WIK A;  2NPB A;  1HYU A;  2IFQ A;  5IPH A;  3P2A A;  3IRA A;  4FYU A;  3SBC A;  2X4A A;  3UJ1 A;  2LJK A;  3O76 A;  1YKA A;  1OAZ A;  2WZ9 A;  2VUP A;  3VI5 A;  3QOU A;  2PVO C;  5G5E A;  3KP8 A;  2C3N A;  1K0C A;  2GQK A;  4WKW A;  1G0T A;  1OC3 A;  4O32 A;  3VPT A;  1DE1 A;  2K6V A;  4MF6 A;  1SL2 B;  1EGO A;  2OAD A;  3VWU A;  4MNN A;  1XWA A;  2I81 A;  5CO3 A;  1GUL A;  3WT2 A;  2LRC A;  4FO5 A;  4PXO A;  3ZTL A;  3O6T A;  2V2G A;  2E2M A;  1AQV A;  1JLW A;  2PN8 A;  3QAV A;  1RW1 A;  1M2B A;  3GFK A;  1JLV A;  1PQN A;  2ALB A;  4H86 A;  2GZY A;  4HSC X;  2DSA A;  3FYG A;  2E2G A;  1IYH A;  1PGT A;  4FYC A;  2GSQ A;  2D2Z A;  4WF5 A;  1Z6M A;  1WE0 A;  3LOR A;  4F9Z A;  3IPZ A;  3KIJ A;  5DJL A;  3EVI A;  1XVW A;  4YQV A;  2DIY A;  3JCM L;  4TXV A;  4RI6 A;  1X5D A;  1WMJ A;  4NAX A;  5G30 A;  3HY2 A;  1O7U A;  4J56 E;  1SJI A;  1NHO A;  3A2W A;  2LV3 A;  2AHE A;  5GZZ B;  3ZYW A;  2I1U A;  4K7O A;  2ZCT A;  5INY A;  1NHY A;  1AXD A;  3F4S A;  1U3I A;  4OFN A;  1BAY A;  1EZK A;  1SD9 A;  1YKC A;  1GTI A;  4ECI A;  1MD4 A;  1QXH A;  1QUW A;  1I5G A;  1QQ2 A;  1OE8 A;  1K0B A;  1NW2 A;  3I69 A;  4HU7 A;  1AQW A;  5BMU A;  3Q18 A;  3ME8 A;  3A3T A;  4KUN A;  2KHP A;  2B5E A;  3EWL A;  1V98 A;  3E9J B;  3I9V 2;  4USS A;  2X8G A;  2WDU A;  1T4Y A;  2EIR A;  4OFT A;  2H19 A;  5DCH A;  2H6Y A;  3TJB A;  1Z6N A;  3CRU A;  3LYP A;  2KLX A;  5DVB A;  16GS A;  5ECK B;  2H0G A;  3DD3 A;  5ECP B;  1W89 A;  1M7T A;  1GWC A;  3H93 A;  2C0G A;  4GRF A;  2HSH A;  3P90 A;  3W8S A;  1ILO A;  4KA0 A;  4L5O A;  3MNG A;  4JRR A;  1Z3E A;  2GDR A;  4LL1 B;  3MIX A;  3G7Y A;  1PKW A;  1U6T A;  5A5K A;  2CA8 A;  2AJQ B;  2R37 A;  1TI1 A;  2PGT A;  2X49 A;  1PN0 A;  1PL2 A;  4I8B A;  1GNE A;  5KN1 A;  2B6M A;  2JAC A;  3D5J A;  1AQX A;  2CVK A;  5IO0 A;  1ERU A;  4NHZ A;  4HUA A;  4FQU A;  5H5Q A;  2OKA A;  1EP8 A;  5GST A;  6GSV A;  2JZR A;  3LXT A;  5J4U A;  1OC9 B;  1SKW B;  3IK7 A;  3L9V A;  4O5Q A;  4BWQ A;  3UVH A;  3KGK A;  3CRT A;  5G1K A;  1O85 A;  4OMV A;  3L9U A;  1LU4 A;  3UEM A;  2R3X A;  2FHE A;  2QSI A;  2FWF A;  2IPA A;  1YY7 A;  2HSY A;  2YV7 A;  2FD3 A;  2R6K A;  4HEA 2;  4JR6 A;  2MMN A;  2HSM A;  2A2R A;  1SKS B;  3DGQ A;  3GL5 A;  2H1G A;  2H8L A;  4EIP A;  1AIU A;  2F3M A;  1GTB A;  1OC9 A;  2WGR A;  2HI7 A;  5FT3 A;  5LNK e;  2PWJ A;  4LMW A;  4KW6 A;  5COH A;  4HU9 A;  1R5A A;  4ZBA A;  3ERF A;  3R3E A;  3FR3 A;  4IGJ A;  5KN0 A;  4MK3 A;  3GUS A;  3E0U A;  6GSS A;  1OKD A;  3L9S A;  2I9H A;  8GSS A;  2FLS A;  2B1K A;  4IP1 A;  3PH9 A;  2O7K A;  2OA7 A;  3DWV A;  14GS A;  5HQP A;  19GS A;  4MJA A;  5F8B A;  3PGT A;  1GUM A;  3TKS A;  4TKY A;  4K1F A;  5EY6 A;  2C3Q A;  3PR8 A;  3ZRE A;  1FG4 A;  2YPM A;  2HNL A;  3HVS A;  5C04 A;  2TRX A;  4WET A;  1X9S B;  3L78 A;  1BQ7 A;  2LJA A;  2LKU A;  3VFI A;  4BVY B;  5D93 A;  4POL A;  4MMM A;  3TKS E;  3FR9 A;  4KB3 A;  1T00 A;  3FW2 A;  4ID0 A;  3HVN A;  3FK8 A;  1X0R A;  3C1R A;  1GSQ A;  4Q5Q A;  3RHB A;  4MAB A;  1U88 A;  4EL1 A;  2HZE A;  2K8V A;  2VL3 A;  3O3T A;  3RPP A;  5IMZ A;  4XS6 A;  2PER A;  4N0V A;  5D9W A;  1PX7 A;  4BVY A;  3TOU A;  2OE0 A;  3HZ4 A;  1SYR A;  13GS A;  5DQY A;  4HDE A;  2F9S A;  4KDU A;  3F8U A;  4IVF A;  4HJM A;  2P5R A;  5CRW A;  1K0N A;  3ERW A;  3WT1 A;  1ZL9 A;  2A2S A;  5CRE A;  1CQG A;  2FA8 A;  2WJU A;  5IO2 A;  4IQ1 A;  4ZIJ A;  1THO A;  2H1A A;  5J9B A;  1ZGN A;  3LGC A;  1TK0 B;  3LYK A;  3GN3 A;  1B8X A;  2MYG A;  1R26 A;  4YAP A;  5FWG A;  1ZYN A;  4POB A;  3I43 A;  1K3L A;  4QL9 A;  3VWW A;  4DSS B;  5F05 A;  2MBS A;  3PPU A;  1XXU A;  4YQM A;  4BWS A;  1ZZY A;  2IL3 A;  5ABR A;  4EUY A;  1Z7R A;  4KND A;  1J0F A;  1ZYQ B;  2N5F A;  2AB6 A;  2V6K A;  2LTK A;  3D4M A;  3MYD A;  1XWG A;  4DSS A;  2YWO A;  3VLN A;  2V1M A;  2YAN A;  4MCU A;  4XCS A;  3IAM 2;  4WR5 A;  1ERT A;  3WGE A;  1A2L A;  4N30 A;  1S3C A;  1BX9 A;  1TW9 A;  4CHS A;  1GLP A;  1XW9 A;  4KGI A;  2IIY A;  2LJR A;  4J57 E;  2O8V B;  2L5L A;  3ZIV A;  5ECL B;  4IQA A;  3F4T A;  1YJ6 A;  2FNO A;  2HRA A;  2HZF A;  3DXB A;  2BTO T;  2C1Y A;  2QGV A;  3TJF A;  2PUK C;  4K0N A;  3VI7 A;  2FWH A;  5IMF A;  4WF4 A;  2LRN A;  1DBY A;  1HNA A;  1XWC A;  2VD0 A;  1HNB A;  3CYN A;  3FZA A;  2TIR A;  4ML6 A;  1Y25 A;  3CSJ A;  2VCT A;  2JZT A;  1ERW A;  3EE2 A;  2L59 A;  5H5S A;  2IME A;  3EU3 A;  2GLR A;  2LNT A;  4TR3 A;  1SJ6 A;  3TOT A;  9GSS A;  5KN2 A;  3NZN A;  3ZLP A;  1M9B A;  6GSY A;  3GST A;  2VIM A;  3HD5 A;  4ZB9 A;  5IOX A;  3GX8 A;  2H1D A;  4PUF C;  5J9C A;  4KH7 A;  1Q98 A;  1YEP A;  5CRH A;  4BVX A;  3GHA A;  5AIV A;  5JCG A;  4G0K A;  3HVX A;  3TKQ A;  1HD2 A;  2VCW A;  1FOV A;  3QR6 A;  4HQS A;  4TVE A;  1IYI A;  2RLI A;  2WS2 A;  3H8Q A;  4KF9 A;  1GSU A;  2H74 A;  4TRX A;  2R0G A;  1XIY A;  6GSW A;  3A2V A;  1V2A A;  6GSU A;  1EP7 A;  5HFI A;  2V41 A;  3DKS A;  4X0X A;  2X8H A;  1GLQ A;  1SK0 A;  1ML6 A;  3L4N A;  1O8X A;  4IHU A;  2RII A;  4YH2 A;  4O92 A;  4IJI A;  3QPM A;  3MAK A;  1S3R A;  3UOM A;  4XHM A;  3TRX A;  1N8J A;  3HYP A;  4TOP A;  3APS A;  4KCA A;  4EF0 A;  2VO4 A;  4ML1 A;  3ZVJ D;  1TU8 A;  5HFK A;  4AJ7 A;  1TI3 A;  2B1L A;  5D96 A;  3MSZ A;  4X1U A;  5IMA A;  1SD8 A;  4LA1 A;  2NDO A;  1DUG A;  3D6I A;  1NM3 A;  3G9B A;  2LEG A;  1T4Z A;  3BD2 A;  2XHF A;  5IMD A;  2FCH A;  1JZR A;  4GXZ A;  1EOG A;  2V32 A;  3IC8 A;  2VCV A;  3TJK A;  1XVQ A;  1VF4 A;  2K9F A;  1MTC A;  1SK1 A;  2CT6 A;  1A0R P;  5CAX A;  1VF3 A;  4MJE A;  4ECJ A;  3DYR A;  4PNG A;  2EIQ A;  2L6D A;  1USB A;  3DML A;  2XPE A;  3FHK A;  2H1B A;  4QQ7 A;  1JHB A;  4ECC A;  2JZS A;  2LS5 A;  4BA7 A;  2VLU A;  5BRT A;  4ACS A;  2FWE A;  1CQH A;  2H71 A;  2CQ9 A;  3ZIJ A;  5AGY A;  2B7K A;  4KX4 A;  3VUR A;  3GUR A;  4L0W A;  3Q19 A;  5JWQ B;  3RAZ A;  3HDC A;  4AJ8 A;  2FUG 2;  1RK4 A;  1TU7 A;  2H72 A;  3HCZ A;  1QGV A;  2VL2 A;  2O87 A;  4DVC A;  3NIV A;  2H6Z A;  3LXZ A;  1B48 A;  2N5A A;  5JWO B;  2HRN A;  1O6J A;  1PKZ A;  2A2P A;  3CTF A;  1G7O A;  2C0F A;  3DEX A;  3K8N A;  4YQU A;  3ISO A;  1K0D A;  1N2A A;  1KNG A;  2H75 A;  4TR1 A;  3ZFB A;  3H79 A;  2KP1 A;  5EPF A;  1A2M A;  3D22 A;  4XTS A;  2HXK A;  3KXO A;  4OO5 A;  4PNF A;  3QFA C;  4AF2 A;  1YQ1 A;  2YP6 A;  1ZMA A;  3M3M A;  1YF0 A;  5KEJ A;  2HLS A;  1ACV A;  3CSH A;  3IR4 A;  4HS1 A;  5KOW A;  1EEJ A;  4KDX A;  2OAC A;  4G19 A;  2M46 A;  1X5C A;  3FMW A;  2BMX A;  1TKD B;  4PTS A;  1KTE A;  2YWN A;  3HHV A;  5HFG A;  4N10 A;  3WGX A;  2B5X A;  4I5Q A;  3HKR A;  1JZD A;  4JR4 A;  1URM A;  5F0G A;  4JZQ A;  3CTG A;  4Q5R A;  3C7M A;  2OBI A;  5DCG A;  2JSY A;  1M0U A;  5ECM B;  3TRQ A;  4MH2 A;  1EV9 A;  1YDK A;  4GTU A;  3KTB A;  5D9T A;  4IW9 A;  4K2D A;  4MA9 A;  3U5R E;  4IEL A;  3BBY A;  3UVT A;  4NV5 A;  4IJ3 A;  4O7H A;  4A5P A;  1GTA A;  4OCF A;  4MP4 A;  4K9Z A;  1PRX A;  2C8U A;  4EKZ A;  1M2A A;  4HZ2 A;  2VCQ A;  5D9V A;  1LJR A;  2VLV A;  2ON7 A;  3M0F A;  1YF1 A;  3AY8 A;  3EUR A;  4K2X A;  2YNX A;  3KH7 A;  4NV2 A;  2L6C A;  3BJ5 A;  3F4R A;  1OC8 A;  3EU4 A;  2R0C A;  2Z9S A;  4EXJ A;  1OE7 A;  3KCM A;  5ECR B;  1FAA A;  1AC1 A;  2GTU A;  3J7Y b;  1M3J A;  3V1W A;  4GSS A;  4KE3 A;  3RPN A;  2VOC A;  5EL8 A;  5ENU A;  5CP1 A;  1UVZ A;  1I9D A;  1YEX A;  4HJ2 A;  3EC3 A;  1PN9 A;  2ES7 A;  2YZU A;  1PFO A;  4G0I A;  4CW9 A;  2R2J A;  1O81 A;  3KM6 A;  2AUV A;  4EDY A;  2G0F A;  4X4J A;  2HZE B;  1R7H A;  4LLR A;  1OKT A;  2DLX A;  4MZC A;  3TGZ A;  4PUR A;  3GTU B;  4E8H A;  1JFU A;  4JU5 A;  1FOH A;  4NHW A;  2GVP A;  1WP0 A;  2GT6 A;  2ON5 A;  4ZL7 A;  1SJZ A;  2C4J A;  2CAI A;  3FKF A;  3A5W A;  4AJ6 A;  1T7P B;  1F3B A;  2E7P A;  4JBB A;  3DIE A;  5IM9 A;  2GQM A;  4TR0 A;  4ICY A;  1JZO A;  3F6D A;  3GTU A;  3BCI A;  3BOA A;  3M8N A;  1X9W B;  2I4A A;  5JCU A;  4ZB8 A;  4MLY A;  5F07 A;  3A2X A;  5ID2 B;  3APQ A;  4KCE A;  3VWX A;  4O5R A;  2DML A;  5DAK B;  2H76 A;  3P8W A;  4RQR A;  1SU9 A;  3R2Q A;  4PX1 A;  2VD1 A;  4GQF A;  1Z7P A;  2YV9 A;  3MDK A;  4EDZ A;  5HR0 A;  2MZC A;  4EC0 A;  3C8E A;  3KP9 A;  1HNC A;  4FH8 A;  1GSE A;  4TN8 A;  5DDL A;  5J5N A;  3RDW A;  2VAF A;  1F9M A;  2XC2 A;  5ID2 A;  5E4W A;  1X9M B;  1F37 A;  5DAK A;  2WB9 A;  2CZ2 A;  4LMV A;  4LL4 B;  4BPY A;  3C71 A;  5G31 A;  2CZ3 A;  1M2D A;  2WRT A;  5G1L A;  1EGR A;  4K5R A;  2DMM A;  2OJL A;  1GUH A;  1AW9 A;  3HZ8 A;  3F6F A;  2QC7 A;  2MMZ A;  4ZXG A;  1WRY A;  5AIS A;  20GS A;  4V2L A;  1FW1 A;  1ABA A;  3F9U A;  1QMV A;  3GKM A;  2C0D A;  2AV4 A;  3VPQ A;  1BYE A;  2JAD A;  1Z5Y E;  3KEB A;  1MDI A;  2DBC A;  2L57 A;  2GSS A;  4N11 A;  1A8Y A;  5DAL B;  5B6N A;  2DJ0 A;  5AN1 A;  2E0Q A;  2HYX A;  1ST9 A;  1MDJ A;  2ZUP A;  3MWH A;  1ERV A;  1T1V A;  3GH6 A;  5JWR B;  3CMI A;  2R4V A;  1K3O A;  5ECQ B;  2RUF A;  3A5I A;  4CY8 A;  1DE2 A;  4MJB A;  1XWB A;  2C3T A;  2L4C A;  3C73 A;  3D0Z A;  5DAL A;  5A4U A;  4Z2U A;  5CRD A;  1J9B A;  5G2Z A;  4NWY A;  2FY6 A;  1PSQ A;  1ON4 A;  4GWR A;  1QFN A;  3N9J A;  2X99 A;  4Z7X A;  1G6Y A;  2B3S A;  2A4V A;  2PU9 C;  4KDY A;  1PMT A;  2GQL A;  2YJH A;  4BVX B;  1UC7 A;  7GSS A;  4PQI A;  1WJK A;  2NBS A;  2CAQ A;  2PBJ A;  2B5Y A;  4WR4 A;  2ZNM A;  3F0I A;  4GST A;  2AAW A;  2GZP A;  1H75 A;  1S3D A;  3ME7 A;  4KSM A;  5A4V A;  3TRP A;  3W8J A;  3UMA A;  4OCE A;  3TJJ A;  3QMX A;  2GGT A;  5DJM A;  2XBQ A;  5B8A A;  3D21 A;  4G0L A;  4Q5F A;  2JL4 A;  1VF1 A;  2TRC P;  2AYT A;  4HQZ A;  5GAP D;  1XG8 A;  4F2I A;  3VWV A;  2O89 A;  2IMD A;  2CV4 A;  5HR3 A;  3IOS A;  3KH9 A;  3TUE A;  2KUC A;  1QK8 A;  2WCI A;  4K7I A;  2VCX A;  1A0F A;  1XOB A;  1K0A A;  3GSS A;  3CBU A;  1Q4J A;  1Y6E A;  3LWA A;  4L8E A;  3US3 A;  4EVM A;  2M72 A;  1PD2 1;  3N5O A;  3RBT A;  3UAR A;  3EMX A;  3TCO A;  1K3Y A;  3HJO A;  4NMU A;  1A24 A;  2OE3 A;  2VL9 A;  2HT9 A;  2H30 A;  4F03 A;  3ED3 A;  3CSI A;  3GL3 A;  4V1A g;  2NVL A;  2DKH A;  4K0G A;  5IMV A;  3EPT A;  2X64 A;  1UA5 A;  2YJ7 A;  1B9X C;  4MZB A;  2X8C A;  1T3B A;  1FHE A;  2XBI A;  4I6X A;  4RI7 A;  4MPF A;  2RUE A;  2M80 A;  2VLT A;  3Q6O A;  1J08 A;  4OWY A;  4NPB A;  3HXS A;  1A8L A;  1OVN A;  1GH2 A;  1ZCP A;  2DJJ A;  4YKF A;  2YCD A;  2K18 A;  4XS1 A;  1EV4 A;  3IE3 A;  4Z2T A;  3GYK A;  4DEJ A;  3OR5 A;  1RQM A;  3Q74 A;  1GNW A;  2C80 A;  11GS A;  3PIN A;  1F6M C;  4OFM A;  1VRS D;  4WBR D;  5CNW A;  2I3Y A;  1SYX A;  2IMF A;  3HVV A;  3LSZ A;  2HRF A;  2YWI A;  2CVD A;  3U6V A;  4TW5 A;  3J7Y k;  3TKP A;  2H66 A;  3CXG A;  4I2U A;  5H5R A;  1GRX A;  4V1A p;  2GST A;  3UBL A;  3GIX A;  3WYW A;  1SEN A;  4JE1 A;  2F8F A;  1S3A A;  3ZML A;  3GMF A;  1BJX A;  2HFD A;  3E3E A;  4ULX A;  2F8A A;  2PMT A;  1TDI A;  4TR1 B;  1F2E A;  4JED A;  4J2F A;  1B4Q A;  3QFB C;  6GSX A;  2JSZ A;  3CQF A;  3F63 A;  4TXO B;  3GRX A;  3D4T A;  1GSS A;  5GSS A;  1SL1 B;  2DC5 A;  2PVQ A;  4K6X A;  2R5G A;  4O5U A;  1TJD A;  1XBS A;  1GSF A;  3FY7 A;  2H01 A;  3I6A A;  4MJC A;  3FRC A;  4WXT A;  3QCP A;  4MDC A;  1A23 A;  4PGT A;  3S9F A;  1PX6 A;  2FA4 A;  2H70 A;  1WOU A;  5ELG A;  1B9Y C;  2H6X A;  4TXO A;  3TKS C;  1V40 A;  1JZW A;  3C1S A;  4ISD A;  3H4K A;  1E6B A;  4P3Y B;  4G2E A;  3KJY A;  2PPT A;  3IK9 A;  3UBK A;  3TJG A;  4IS0 A;  5G5F A;  3KMN A;  1M99 A;  1ZYP A;  1WPI A;  4FYB A;  2H0H A;  3EYT A;  2L4Q A;  18GS A;  2OE1 A;  3KD0 A;  4ECB A;  4L0U A;  4XIH A;  4OD7 A;  4DSQ A;  4BL7 B;  2WUL A;  2BJX A;  3P7X A;  4POM A;  3IHQ A;  3LEF A;  3ZL5 A;  3SWL A;  2LNS A;  1PL1 A;  5A4W A;  3M1G A;  2LST A;  2HRK A;  4ZIL A;  4PQ1 A;  3TDG A;  5B8B A;  3IAS 2;  4KSO A;  2O85 A;  5ELA A;  2EIO A;  1AAZ A;  2P5Q A;  5DBQ A;  4BL7 A;  3KTL A;  2QA2 A;  3TKR A;  4ILF A;  5CYY A;  4IBP A;  1TXX A;  1BG5 A;  4WEY A;  2GSR A;  1H4O A;  1T8E B;  3GV1 A;  4G9H A;  4XS4 B;  1GSD A;  4CY6 A;  2LUS A;  4MPG A;  2QA1 A;  4EO3 A;  2G2Q A;  2REM A;  3ZFL A;  4IKH A;  3M9J A;  2RM5 A;  1TTZ A;  1O73 A;  2GS3 A;  3FZ5 A;  2DJ3 A;  5F06 A;  3ZMK A;  1VGL A;  4F0B A;  1M9A A;  5B7C A;  17GS A;  3IC4 A;  3GA4 A;  4XS4 A;  1FVJ A;  3WD6 A;  12GS A;  3F3Q A;  1TK8 B;  2IMI A;  5DQS A;  1K0M A;  1TRS A; 
#chains in the Genus database with same CATH homology
 5IIZ A;  4I97 A;  1PA3 A;  1V57 A;  3BCK A;  4V2M A;  1SL0 B;  1E2Y A;  2GZZ A;  1U87 A;  3FEU A;  3LFL A;  1MDK A;  5ECN B;  5HR1 A;  2N5B A;  5JCW A;  10GS A;  4TR4 A;  1EWX A;  1FB0 A;  2F51 A;  1F3A A;  1EOH A;  3ERG A;  5ECS A;  3UIW A;  2DJ2 A;  5ECH B;  1GSY A;  1KEB A;  4IN0 A;  4FIW A;  3IXR A;  1C72 A;  1OYJ A;  3IV4 A;  3ZIT A;  3QDN A;  3GKX A;  2RM6 A;  2VCZ A;  1R4W A;  4K8M A;  3KZQ A;  2GT5 A;  2A4H A;  4F0C A;  1G7E A;  4ZL9 A;  2IN3 A;  2EC4 A;  4ZBD A;  4AGS A;  4L5L A;  3TB2 A;  3HJP A;  3ZVJ A;  4I2T A;  3L0H A;  1ZYE A;  2CX4 A;  5EVO A;  5GAN D;  2J23 A;  5ECO B;  5IMC A;  3LQ7 A;  4GLT A;  2MMO A;  1MD3 A;  4GQC A;  3UAP A;  3APO A;  4GF0 A;  1TRU A;  5IPG A;  1G6W A;  3KMO A;  5D8I A;  4YAV A;  2B7J A;  2LRT A;  4N0Z A;  3EMP A;  5C00 A;  5KOX A;  3UL3 A;  2YOI A;  4RQX A;  4HZ4 A;  3EIN A;  1O8W A;  1TRV A;  1X5E A;  3FZ9 A;  2H73 A;  1XZO A;  2DJ1 A;  3IA1 A;  4F82 A;  2JU5 A;  5FHI A;  4NXI A;  4PUA A;  4HI7 A;  4ZB6 A;  1XOA A;  4XRD A;  1AUC A;  1K0O A;  4POK A;  1V58 A;  1VF2 A;  1Z9H A;  2MBT A;  4IP6 A;  1B4P A;  2DJK A;  1XFL A;  2VM2 A;  1EEM A;  2MMA A;  1XW6 A;  2IMK A;  1LBK A;  1W4V A;  3M9K A;  5LCZ A;  2YN1 A;  4PQH A;  2K8S A;  4MF7 A;  1R5P A;  3HA9 A;  4OO4 A;  5E59 A;  3DVW A;  2KP2 A;  2XPD A;  5J3R A;  1TOF A;  2FGX A;  3GX0 A;  4MZW A;  2FWG A;  4MH3 A;  4CDO A;  4V2N A;  4X43 A;  2IJY A;  1GP1 A;  4ZL8 A;  2LQO A;  5IOW A;  22GS A;  1TK5 B;  5HR2 A;  4MF5 A;  3FR6 A;  1XPV A;  3RHC A;  1V9W A;  2KOK A;  4GCI A;  1FB6 A;  4KAE A;  2NTO A;  2QKE A;  2R0P A;  4Q5N A;  4XRA A;  3G7I A;  1FVK A;  3GKK A;  4G10 A;  5L71 A;  5ECI B;  2IWT A;  3IDV A;  5D73 A;  2J9H A;  5LD0 A;  4Z2R A;  2VM1 A;  3LW9 A;  1TP9 A;  3GH9 A;  3VK9 A;  1U3A A;  1YZX A;  1FO5 A;  2L5O A;  1ZOF A;  3DRN A;  4DSR A;  1BED A;  2CVB A;  3QAG A;  4YKG A;  1UN2 A;  2DKI A;  1XW5 A;  3NOF A;  2P0G A;  3GNJ A;  4WBJ A;  6GST A;  2YZH A;  2WFC A;  4K7N A;  2UZ8 A;  1XCC A;  3HJM A;  4E8E A;  2HE3 A;  4RUV A;  1SKR B;  2P31 A;  3W6G A;  3QAW A;  3QD9 A;  1WWJ A;  1TRW A;  2OBK A;  3IBH A;  1GTU A;  3G7J A;  1A2J A;  5J41 A;  3ZZX A;  1GL8 A;  2YWM A;  1SK2 A;  3LJR A;  4K5S A;  4HOJ A;  2V6O A;  2CX3 A;  1KBN A;  2C0E A;  4GSN A;  3LG6 A;  1HQO A;  4D73 B;  2VL2 C;  5AIX A;  3DVX A;  5IQY A;  1THX A;  1XWK A;  5D9X A;  2IFQ B;  4EE0 A;  3H1N A;  4QL7 A;  3IHG A;  5CRG A;  3ZRD A;  3FZ4 A;  3WGD A;  3GKN A;  2DIZ A;  2LQQ A;  1MEK A;  4EIQ A;  3F3R A;  1NSW A;  1DSB A;  1GUK A;  4ZBB A;  4D73 A;  5KN3 A;  2H0I A;  5B6M A;  1WIK A;  2NPB A;  1HYU A;  2IFQ A;  5IPH A;  3P2A A;  3IRA A;  4FYU A;  3SBC A;  2X4A A;  3UJ1 A;  2LJK A;  3O76 A;  1YKA A;  1OAZ A;  2WZ9 A;  2VUP A;  3VI5 A;  3QOU A;  2PVO C;  5G5E A;  3KP8 A;  2C3N A;  1K0C A;  2GQK A;  4WKW A;  1G0T A;  1OC3 A;  4O32 A;  3VPT A;  1DE1 A;  2K6V A;  4MF6 A;  1SL2 B;  1EGO A;  2OAD A;  3VWU A;  4MNN A;  1XWA A;  2I81 A;  5CO3 A;  1GUL A;  3WT2 A;  2LRC A;  4FO5 A;  4PXO A;  3ZTL A;  3O6T A;  2V2G A;  2E2M A;  1AQV A;  1JLW A;  2PN8 A;  3QAV A;  1RW1 A;  1M2B A;  3GFK A;  1JLV A;  1PQN A;  2ALB A;  4H86 A;  2GZY A;  2DSA A;  3FYG A;  2E2G A;  1IYH A;  1PGT A;  4FYC A;  2GSQ A;  2D2Z A;  4WF5 A;  1Z6M A;  1WE0 A;  3LOR A;  4F9Z A;  3IPZ A;  3KIJ A;  5DJL A;  3EVI A;  1XVW A;  4YQV A;  2DIY A;  3JCM L;  4TXV A;  4RI6 A;  1X5D A;  1WMJ A;  4NAX A;  5G30 A;  3HY2 A;  1O7U A;  4J56 E;  1SJI A;  1NHO A;  3A2W A;  2LV3 A;  2AHE A;  5GZZ B;  3ZYW A;  2I1U A;  4K7O A;  2ZCT A;  5INY A;  1NHY A;  1AXD A;  3F4S A;  1U3I A;  4OFN A;  1BAY A;  1EZK A;  1SD9 A;  1YKC A;  1GTI A;  4ECI A;  1MD4 A;  1QXH A;  1QUW A;  1I5G A;  1QQ2 A;  1OE8 A;  1K0B A;  1NW2 A;  3I69 A;  4HU7 A;  1AQW A;  5BMU A;  3Q18 A;  3ME8 A;  3A3T A;  4KUN A;  2KHP A;  2B5E A;  3EWL A;  1V98 A;  3E9J B;  3I9V 2;  4USS A;  2X8G A;  2WDU A;  1T4Y A;  2EIR A;  4OFT A;  2H19 A;  5DCH A;  2H6Y A;  3TJB A;  1Z6N A;  3CRU A;  3LYP A;  2KLX A;  5DVB A;  16GS A;  5ECK B;  2H0G A;  3DD3 A;  5ECP B;  1W89 A;  1M7T A;  1GWC A;  3H93 A;  2C0G A;  4GRF A;  2HSH A;  3P90 A;  3W8S A;  1ILO A;  4KA0 A;  4L5O A;  3MNG A;  4JRR A;  1Z3E A;  2GDR A;  4LL1 B;  3MIX A;  3G7Y A;  1PKW A;  1U6T A;  5A5K A;  2CA8 A;  2AJQ B;  2R37 A;  1TI1 A;  2PGT A;  2X49 A;  1PN0 A;  1PL2 A;  4I8B A;  1GNE A;  5KN1 A;  2B6M A;  2JAC A;  3D5J A;  1AQX A;  2CVK A;  5IO0 A;  1ERU A;  4NHZ A;  4HUA A;  4FQU A;  5H5Q A;  2OKA A;  1EP8 A;  5GST A;  6GSV A;  2JZR A;  3LXT A;  5J4U A;  1OC9 B;  1SKW B;  3IK7 A;  3L9V A;  4O5Q A;  4BWQ A;  3UVH A;  3KGK A;  3CRT A;  5G1K A;  1O85 A;  4OMV A;  3L9U A;  1LU4 A;  3UEM A;  2R3X A;  2FHE A;  2QSI A;  2FWF A;  2IPA A;  1YY7 A;  2HSY A;  2YV7 A;  2FD3 A;  2R6K A;  4HEA 2;  4JR6 A;  2MMN A;  2HSM A;  2A2R A;  1SKS B;  3DGQ A;  3GL5 A;  2H1G A;  2H8L A;  4EIP A;  1AIU A;  2F3M A;  1GTB A;  1OC9 A;  2WGR A;  2HI7 A;  5FT3 A;  5LNK e;  2PWJ A;  4LMW A;  4KW6 A;  5COH A;  4HU9 A;  1R5A A;  4ZBA A;  3ERF A;  3R3E A;  3FR3 A;  4IGJ A;  5KN0 A;  4MK3 A;  3GUS A;  3E0U A;  6GSS A;  1OKD A;  3L9S A;  2I9H A;  8GSS A;  2FLS A;  2B1K A;  4IP1 A;  3PH9 A;  2O7K A;  2OA7 A;  3DWV A;  14GS A;  5HQP A;  19GS A;  4MJA A;  5F8B A;  3PGT A;  1GUM A;  3TKS A;  4TKY A;  4K1F A;  5EY6 A;  2C3Q A;  3PR8 A;  3ZRE A;  1FG4 A;  2YPM A;  2HNL A;  3HVS A;  5C04 A;  2TRX A;  4WET A;  1X9S B;  3L78 A;  1BQ7 A;  2LJA A;  2LKU A;  3VFI A;  4BVY B;  5D93 A;  4POL A;  4MMM A;  3TKS E;  3FR9 A;  4KB3 A;  1T00 A;  3FW2 A;  4ID0 A;  3FK8 A;  1X0R A;  3C1R A;  1GSQ A;  4Q5Q A;  3RHB A;  4MAB A;  1U88 A;  4EL1 A;  2HZE A;  2K8V A;  2VL3 A;  3O3T A;  3RPP A;  5IMZ A;  4XS6 A;  2PER A;  4N0V A;  5D9W A;  1PX7 A;  4BVY A;  3TOU A;  2OE0 A;  3HZ4 A;  1SYR A;  13GS A;  5DQY A;  4HDE A;  2F9S A;  4KDU A;  3F8U A;  4IVF A;  4HJM A;  2P5R A;  5CRW A;  1K0N A;  3ERW A;  3WT1 A;  1ZL9 A;  2A2S A;  5CRE A;  1CQG A;  2FA8 A;  2WJU A;  5IO2 A;  4IQ1 A;  4ZIJ A;  1THO A;  2H1A A;  5J9B A;  1ZGN A;  3LGC A;  1TK0 B;  3LYK A;  3GN3 A;  1B8X A;  2MYG A;  1R26 A;  4YAP A;  5FWG A;  1ZYN A;  4POB A;  3I43 A;  1K3L A;  4QL9 A;  3VWW A;  4DSS B;  5F05 A;  2MBS A;  3PPU A;  1XXU A;  4YQM A;  4BWS A;  1ZZY A;  2IL3 A;  5ABR A;  4EUY A;  1Z7R A;  4KND A;  1J0F A;  1ZYQ B;  2N5F A;  2AB6 A;  2V6K A;  2LTK A;  3D4M A;  3MYD A;  1XWG A;  4DSS A;  2YWO A;  3VLN A;  2V1M A;  2YAN A;  4MCU A;  4XCS A;  3IAM 2;  4WR5 A;  1ERT A;  3WGE A;  1A2L A;  4N30 A;  1S3C A;  1BX9 A;  1TW9 A;  4CHS A;  1GLP A;  1XW9 A;  4KGI A;  2IIY A;  2LJR A;  4J57 E;  2O8V B;  2L5L A;  3ZIV A;  5ECL B;  4IQA A;  3F4T A;  1YJ6 A;  2FNO A;  2HRA A;  2HZF A;  3DXB A;  2BTO T;  2C1Y A;  2QGV A;  3TJF A;  2PUK C;  4K0N A;  3VI7 A;  2FWH A;  5IMF A;  4WF4 A;  2LRN A;  1DBY A;  1HNA A;  1XWC A;  2VD0 A;  1HNB A;  3CYN A;  3FZA A;  2TIR A;  4ML6 A;  1Y25 A;  3CSJ A;  2VCT A;  2JZT A;  1ERW A;  3EE2 A;  2L59 A;  5H5S A;  2IME A;  3EU3 A;  2GLR A;  2LNT A;  4TR3 A;  1SJ6 A;  3TOT A;  9GSS A;  5KN2 A;  3NZN A;  3ZLP A;  1M9B A;  6GSY A;  3GST A;  2VIM A;  3HD5 A;  4ZB9 A;  5IOX A;  3GX8 A;  2H1D A;  4PUF C;  5J9C A;  4KH7 A;  1Q98 A;  1YEP A;  5CRH A;  4BVX A;  3GHA A;  5AIV A;  5JCG A;  4G0K A;  3HVX A;  3TKQ A;  1HD2 A;  2VCW A;  1FOV A;  3QR6 A;  4HQS A;  4TVE A;  1IYI A;  2RLI A;  2WS2 A;  3H8Q A;  4KF9 A;  1GSU A;  2H74 A;  4TRX A;  2R0G A;  1XIY A;  6GSW A;  3A2V A;  1V2A A;  6GSU A;  1EP7 A;  5HFI A;  2V41 A;  3DKS A;  4X0X A;  2X8H A;  1GLQ A;  1SK0 A;  1ML6 A;  3L4N A;  1O8X A;  4IHU A;  2RII A;  4YH2 A;  4O92 A;  4IJI A;  3QPM A;  3MAK A;  3UOM A;  4XHM A;  3TRX A;  1N8J A;  3HYP A;  4TOP A;  3APS A;  4KCA A;  4EF0 A;  2VO4 A;  4ML1 A;  3ZVJ D;  1TU8 A;  5HFK A;  4AJ7 A;  1TI3 A;  2B1L A;  5D96 A;  3MSZ A;  4X1U A;  5IMA A;  1SD8 A;  4LA1 A;  2NDO A;  1DUG A;  3D6I A;  1NM3 A;  3G9B A;  2LEG A;  1T4Z A;  3BD2 A;  2XHF A;  5IMD A;  2FCH A;  1JZR A;  4GXZ A;  1EOG A;  2V32 A;  3IC8 A;  2VCV A;  3TJK A;  1XVQ A;  1VF4 A;  2K9F A;  1MTC A;  1SK1 A;  2CT6 A;  1A0R P;  5CAX A;  1VF3 A;  4MJE A;  4ECJ A;  3DYR A;  4PNG A;  2EIQ A;  2L6D A;  1USB A;  3DML A;  2XPE A;  3FHK A;  2H1B A;  4QQ7 A;  1JHB A;  4ECC A;  2JZS A;  2LS5 A;  4BA7 A;  2VLU A;  5BRT A;  4ACS A;  2FWE A;  1CQH A;  2H71 A;  2CQ9 A;  3ZIJ A;  5AGY A;  2B7K A;  4KX4 A;  3VUR A;  3GUR A;  4L0W A;  3Q19 A;  5JWQ B;  3RAZ A;  3HDC A;  4AJ8 A;  2FUG 2;  1RK4 A;  1TU7 A;  2H72 A;  3HCZ A;  1QGV A;  2VL2 A;  2O87 A;  4DVC A;  3NIV A;  2H6Z A;  3LXZ A;  1B48 A;  2N5A A;  5JWO B;  2HRN A;  1O6J A;  1PKZ A;  2A2P A;  3CTF A;  1G7O A;  2C0F A;  3DEX A;  3K8N A;  4YQU A;  3ISO A;  1K0D A;  1N2A A;  1KNG A;  2H75 A;  4TR1 A;  3ZFB A;  3H79 A;  2KP1 A;  5EPF A;  1A2M A;  3D22 A;  4XTS A;  2HXK A;  3KXO A;  4OO5 A;  4PNF A;  3QFA C;  4AF2 A;  1YQ1 A;  2YP6 A;  1ZMA A;  3M3M A;  1YF0 A;  5KEJ A;  2HLS A;  1ACV A;  3CSH A;  3IR4 A;  4HS1 A;  5KOW A;  1EEJ A;  4KDX A;  2OAC A;  4G19 A;  2M46 A;  1X5C A;  3FMW A;  2BMX A;  1TKD B;  4PTS A;  1KTE A;  2YWN A;  3HHV A;  5HFG A;  4N10 A;  3WGX A;  2B5X A;  4I5Q A;  3HKR A;  1JZD A;  4JR4 A;  1URM A;  5F0G A;  4JZQ A;  3CTG A;  4Q5R A;  3C7M A;  2OBI A;  5DCG A;  2JSY A;  1M0U A;  5ECM B;  3TRQ A;  4MH2 A;  1EV9 A;  1YDK A;  4GTU A;  3KTB A;  5D9T A;  4IW9 A;  4K2D A;  4MA9 A;  3U5R E;  4IEL A;  3BBY A;  3UVT A;  4NV5 A;  4IJ3 A;  4O7H A;  4A5P A;  1GTA A;  4OCF A;  4MP4 A;  4K9Z A;  1PRX A;  2C8U A;  4EKZ A;  1M2A A;  4HZ2 A;  2VCQ A;  5D9V A;  1LJR A;  2VLV A;  2ON7 A;  3M0F A;  1YF1 A;  3AY8 A;  3EUR A;  4K2X A;  2YNX A;  3KH7 A;  4NV2 A;  2L6C A;  3BJ5 A;  3F4R A;  1OC8 A;  3EU4 A;  2R0C A;  2Z9S A;  4EXJ A;  1OE7 A;  3KCM A;  5ECR B;  1FAA A;  1AC1 A;  2GTU A;  3J7Y b;  3V1W A;  4GSS A;  4KE3 A;  3RPN A;  2VOC A;  5EL8 A;  5ENU A;  5CP1 A;  1UVZ A;  1I9D A;  1YEX A;  4HJ2 A;  3EC3 A;  1PN9 A;  2ES7 A;  2YZU A;  4G0I A;  4CW9 A;  2R2J A;  1O81 A;  3KM6 A;  2AUV A;  4EDY A;  2G0F A;  4X4J A;  2HZE B;  1R7H A;  4LLR A;  1OKT A;  2DLX A;  4MZC A;  3TGZ A;  4PUR A;  3GTU B;  4E8H A;  1JFU A;  4JU5 A;  1FOH A;  4NHW A;  2GVP A;  1WP0 A;  2GT6 A;  2ON5 A;  4ZL7 A;  1SJZ A;  2C4J A;  2CAI A;  3FKF A;  3A5W A;  4AJ6 A;  1T7P B;  1F3B A;  2E7P A;  4JBB A;  3DIE A;  5IM9 A;  2GQM A;  4TR0 A;  4ICY A;  1JZO A;  3F6D A;  3GTU A;  3BCI A;  3BOA A;  3M8N A;  1X9W B;  2I4A A;  5JCU A;  4ZB8 A;  4MLY A;  5F07 A;  3A2X A;  5ID2 B;  3APQ A;  4KCE A;  3VWX A;  4O5R A;  2DML A;  5DAK B;  2H76 A;  3P8W A;  4RQR A;  1SU9 A;  3R2Q A;  4PX1 A;  2VD1 A;  4GQF A;  1Z7P A;  2YV9 A;  3MDK A;  4EDZ A;  5HR0 A;  2MZC A;  4EC0 A;  3C8E A;  3KP9 A;  1HNC A;  4FH8 A;  1GSE A;  4TN8 A;  5DDL A;  5J5N A;  3RDW A;  2VAF A;  1F9M A;  2XC2 A;  5ID2 A;  5E4W A;  1X9M B;  1F37 A;  5DAK A;  2WB9 A;  2CZ2 A;  4LMV A;  4LL4 B;  4BPY A;  3C71 A;  5G31 A;  2CZ3 A;  1M2D A;  2WRT A;  5G1L A;  1EGR A;  4K5R A;  2DMM A;  2OJL A;  1GUH A;  1AW9 A;  3HZ8 A;  3F6F A;  2QC7 A;  2MMZ A;  4ZXG A;  1WRY A;  5AIS A;  20GS A;  4V2L A;  1FW1 A;  1ABA A;  3F9U A;  1QMV A;  3GKM A;  2C0D A;  2AV4 A;  3VPQ A;  1BYE A;  2JAD A;  1Z5Y E;  3KEB A;  1MDI A;  2DBC A;  2L57 A;  2GSS A;  4N11 A;  1A8Y A;  5DAL B;  5B6N A;  2DJ0 A;  5AN1 A;  2E0Q A;  2HYX A;  1ST9 A;  1MDJ A;  2ZUP A;  3MWH A;  1ERV A;  1T1V A;  3GH6 A;  5JWR B;  3CMI A;  2R4V A;  1K3O A;  5ECQ B;  2RUF A;  3A5I A;  4CY8 A;  1DE2 A;  4MJB A;  1XWB A;  2C3T A;  2L4C A;  3C73 A;  3D0Z A;  5DAL A;  5A4U A;  4Z2U A;  5CRD A;  1J9B A;  5G2Z A;  4NWY A;  2FY6 A;  1PSQ A;  1ON4 A;  4GWR A;  1QFN A;  3N9J A;  2X99 A;  4Z7X A;  1G6Y A;  2B3S A;  2A4V A;  2PU9 C;  4KDY A;  1PMT A;  2GQL A;  2YJH A;  4BVX B;  1UC7 A;  7GSS A;  4PQI A;  1WJK A;  2NBS A;  2CAQ A;  2PBJ A;  2B5Y A;  4WR4 A;  2ZNM A;  3F0I A;  4GST A;  2AAW A;  2GZP A;  1H75 A;  1S3D A;  3ME7 A;  4KSM A;  5A4V A;  3TRP A;  3W8J A;  3UMA A;  4OCE A;  3TJJ A;  3QMX A;  2GGT A;  5DJM A;  2XBQ A;  5B8A A;  3D21 A;  4G0L A;  4Q5F A;  2JL4 A;  1VF1 A;  2TRC P;  2AYT A;  4HQZ A;  5GAP D;  4F2I A;  3VWV A;  2O89 A;  2IMD A;  2CV4 A;  5HR3 A;  3IOS A;  3KH9 A;  3TUE A;  2KUC A;  1QK8 A;  2WCI A;  4K7I A;  2VCX A;  1A0F A;  1XOB A;  1K0A A;  3GSS A;  3CBU A;  1Q4J A;  1Y6E A;  3LWA A;  4L8E A;  3US3 A;  4EVM A;  2M72 A;  1PD2 1;  3N5O A;  3RBT A;  3UAR A;  3EMX A;  3TCO A;  1K3Y A;  3HJO A;  4NMU A;  1A24 A;  2OE3 A;  2VL9 A;  2HT9 A;  2H30 A;  4F03 A;  3ED3 A;  3CSI A;  3GL3 A;  4V1A g;  2NVL A;  2DKH A;  4K0G A;  5IMV A;  3EPT A;  2X64 A;  1UA5 A;  2YJ7 A;  1B9X C;  4MZB A;  2X8C A;  1T3B A;  1FHE A;  2XBI A;  4I6X A;  4RI7 A;  4MPF A;  2RUE A;  2M80 A;  2VLT A;  3Q6O A;  1J08 A;  4OWY A;  4NPB A;  3HXS A;  1A8L A;  1OVN A;  1GH2 A;  1ZCP A;  2DJJ A;  4YKF A;  2YCD A;  2K18 A;  4XS1 A;  1EV4 A;  3IE3 A;  4Z2T A;  3GYK A;  4DEJ A;  3OR5 A;  1RQM A;  3Q74 A;  1GNW A;  2C80 A;  11GS A;  3PIN A;  1F6M C;  4OFM A;  1VRS D;  4WBR D;  5CNW A;  2I3Y A;  1SYX A;  2IMF A;  3HVV A;  3LSZ A;  2HRF A;  2YWI A;  2CVD A;  3U6V A;  4TW5 A;  3J7Y k;  3TKP A;  2H66 A;  3CXG A;  4I2U A;  5H5R A;  1GRX A;  4V1A p;  2GST A;  3UBL A;  3GIX A;  3WYW A;  1SEN A;  4JE1 A;  2F8F A;  1S3A A;  3ZML A;  3GMF A;  1BJX A;  2HFD A;  3E3E A;  4ULX A;  2F8A A;  2PMT A;  1TDI A;  4TR1 B;  1F2E A;  4JED A;  4J2F A;  1B4Q A;  3QFB C;  6GSX A;  2JSZ A;  3F63 A;  4TXO B;  3GRX A;  3D4T A;  1GSS A;  5GSS A;  1SL1 B;  2DC5 A;  2PVQ A;  4K6X A;  2R5G A;  4O5U A;  1TJD A;  1XBS A;  1GSF A;  3FY7 A;  2H01 A;  3I6A A;  4MJC A;  3FRC A;  4WXT A;  3QCP A;  4MDC A;  1A23 A;  4PGT A;  3S9F A;  1PX6 A;  2FA4 A;  2H70 A;  1WOU A;  5ELG A;  1B9Y C;  2H6X A;  4TXO A;  3TKS C;  1V40 A;  1JZW A;  3C1S A;  4ISD A;  3H4K A;  1E6B A;  4P3Y B;  4G2E A;  3KJY A;  2PPT A;  3IK9 A;  3UBK A;  3TJG A;  4IS0 A;  5G5F A;  3KMN A;  1M99 A;  1ZYP A;  1WPI A;  4FYB A;  2H0H A;  3EYT A;  2L4Q A;  18GS A;  2OE1 A;  3KD0 A;  4ECB A;  4L0U A;  4XIH A;  4OD7 A;  4DSQ A;  4BL7 B;  2WUL A;  2BJX A;  3P7X A;  4POM A;  3IHQ A;  3LEF A;  3ZL5 A;  3SWL A;  2LNS A;  1PL1 A;  5A4W A;  3M1G A;  2LST A;  2HRK A;  4ZIL A;  4PQ1 A;  3TDG A;  5B8B A;  3IAS 2;  4KSO A;  2O85 A;  5ELA A;  2EIO A;  1AAZ A;  2P5Q A;  5DBQ A;  4BL7 A;  3KTL A;  2QA2 A;  3TKR A;  4ILF A;  5CYY A;  4IBP A;  1TXX A;  1BG5 A;  4WEY A;  2GSR A;  1H4O A;  1T8E B;  3GV1 A;  4G9H A;  4XS4 B;  1GSD A;  4CY6 A;  2LUS A;  4MPG A;  2QA1 A;  4EO3 A;  2G2Q A;  2REM A;  3ZFL A;  4IKH A;  3M9J A;  2RM5 A;  1TTZ A;  1O73 A;  2GS3 A;  3FZ5 A;  2DJ3 A;  5F06 A;  3ZMK A;  1VGL A;  4F0B A;  1M9A A;  5B7C A;  17GS A;  3IC4 A;  3GA4 A;  4XS4 A;  1FVJ A;  3WD6 A;  12GS A;  3F3Q A;  1TK8 B;  2IMI A;  5DQS A;  1K0M A;  1TRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...