5CRWA

Crystal structure of the b'-a' domain of oxidized protein disulfide isomerase complexed with alpha-synuclein peptide (31-41)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
242
structure length
242
Chain Sequence
PLIGEIGPETYSDYMSAGIPLAYIFAETAEERKELSDKLKPIAEAQRGVINFGTIDAKAFGAHAGNLNLKTDKFPAFAIQEVAKNQKFPFDQEKEITFEAIKAFVDDFVAGKIEPSIKSEPIPEKQEGPVTVVVAKNYNEIVLDDTKDVLIEFYAPWCGHCKALAPKYEELGALYAKSEFKDRVVIAKVDATANDVPDEIQGFPTIKLYPAGAKGQPVTYSGSRTVEDLIKFIAENGKYKAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/metal binding protein
molecule keywords Protein disulfide-isomerase
publication title Structural basis of redox-dependent substrate binding of protein disulfide isomerase.
pubmed doi rcsb
source organism Humicola insolens
total genus 70
structure length 242
sequence length 242
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5crwA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5crwA01
4EKZA 1TU8A 1GULA 1Z6NA 5EY6A 2G0FA 1EGOA 2DLXA 1PD21 5EVOA 2KP1A 3E3EA 4WBJA 2KOKA 1PKZA 3TJJA 4I5QA 2ALBA 2L59A 1USBA 2HXKA 1GLPA 3RPPA 5IO2A 2OACA 3Q18A 4EDZA 17GSA 2HYXA 4TXOB 2IWTA 6GSXA 1PL1A 4EL1A 2Z9SA 3ZZXA 3QOUA 4G9HA 4JR4A 1HNBA 1THOA 3D4TA 2FNOA 2VUPA 3WGXA 1K3LA 4V1Ag 2N5BA 3GURA 19GSA 1MDIA 3WGDA 3FZ9A 3QR6A 3QFAC 3H93A 2C3TA 1SU9A 2VLVA 3DRNA 5CRGA 5IMZA 1VF4A 2K8VA 2PUKC 3FHKA 3PGTA 4MLYA 3W8SA 2YV7A 1MDKA 3WT2A 3F6FA 4BPYA 2H1DA 1SYRA 1YY7A 3CTFA 1XOBA 4KE3A 2HZEA 1B8XA 1WPIA 4Q5RA 1YF0A 5ID2A 1BJXA 4IBPA 1U88A 2C0GA 3IAM2 4AJ8A 2AHEA 3P7XA 1ZMAA 3C1SA 1TRSA 2C3NA 4MA9A 1V40A 4F0BA 4I97A 3CMIA 1OKTA 3G7JA 3RHCA 1WOUA 3A2XA 1DUGA 2WDUA 3LXZA 5IIZA 1QK8A 4TOPA 1OVNA 3ED3A 1B4PA 1YDKA 4YAPA 3QDNA 5J9CA 3LFLA 3UMAA 4K0GA 1PMTA 5D73A 4PNGA 2EIRA 2R5GA 2LRCA 4KW6A 5KN1A 1J9BA 2LQOA 3J7Yb 1XWKA 1EWXA 1TW9A 3GH9A 1OKDA 1BQ7A 2JU5A 2NBSA 5F0GA 1X9MB 2HRNA 4FYBA 5DALB 2F8AA 3GTUB 2FWHA 1GSDA 4PX1A 5IPGA 1FB6A 3WD6A 1ZYEA 2L6CA 1VF1A 1G7EA 4CDOA 4XTSA 6GSUA 5AN1A 1U3AA 1T1VA 2XPDA 1OC9B 4BWSA 1J08A 4LA1A 2AB6A 2FUG2 2FLSA 2K8SA 1SD9A 2H66A 5D8IA 2NDOA 3ZIJA 3FYGA 3VWVA 2P5QA 3A3TA 1SL2B 3BJ5A 3G7YA 4K7NA 3TJFA 1GTBA 1R26A 4ACSA 2YWIA 1JLVA 2QSIA 2IPAA 3UARA 2I9HA 4EUYA 4XHMA 5ECKB 1YZXA 1XWBA 1LJRA 4PGTA 1SD8A 2BJXA 2HSYA 2MYGA 3HZ4A 1R7HA 2I81A 1B48A 2C80A 2AYTA 2VCXA 2VOCA 4TR1A 1EEMA 5G1KA 1XVQA 5L71A 2LNSA 3QD9A 2VO4A 3CYNA 1TK0B 4F03A 1XW5A 4DEJA 4EO3A 4OCEA 5ECOB 2WGRA 1OC9A 1A0RP 2REMA 4PQ1A 5DQSA 4TR3A 4IGJA 5DJMA 3TRPA 3UBLA 3BCKA 2H74A 1ILOA 4WETA 3US3A 1TRVA 2IIYA 5DCHA 4H86A 5ECIB 3TUEA 3ZTLA 3FEUA 1M99A 2HZFA 5EPFA 4KDUA 2YWMA 2MMAA 1WE0A 4WF5A 4MPFA 1Z7PA 1HD2A 1QUWA 4O92A 4RQXA 3ZITA 2CX3A 2VD0A 3GX0A 1NW2A 1AAZA 12GSA 3FR3A 1R5PA 1FVKA 4GWRA 4GXZA 3KMNA 3TRQA 3PR8A 5CRHA 4K2DA 2GQLA 3MDKA 4L8EA 4BA7A 2MMZA 4Q5FA 5EL8A 5ECNB 2FD3A 2X8GA 4RI6A 4L5OA 4FIWA 1RW1A 3E9JB 4ZL8A 3ZLPA 1M9AA 2JZSA 4OFNA 5F07A 1AXDA 1M7TA 1TRUA 3CTGA 2L5OA 5JCGA 5J4UA 3CSIA 4OO5A 2VL9A 3UVHA 5D96A 2B1LA 3CBUA 1T8EB 2CX4A 4MMMA 1W4VA 3TKSE 3F4SA 3F3RA 1SYXA 2L4QA 3HHVA 5B6MA 1SK2A 2DMMA 3KD0A 4EC0A 2OBKA 2LUSA 2GT5A 2K6VA 2YWOA 5IMFA 3L9UA 3LYKA 1MD4A 3O76A 1H75A 5G1LA 2H0GA 4P3YB 3E0UA 3C8EA 1URMA 4IS0A 2H76A 3H79A 3RAZA 3KGKA 4HZ2A 4PXOA 5FT3A 2I1UA 4KB3A 2VCTA 3ME7A 4ZBAA 1EGRA 3DWVA 3MWHA 2P0GA 2PWJA 2GSQA 1S3CA 2KUCA 4HQSA 1O6JA 3LJRA 5CAXA 3LG6A 3GKKA 2IFQB 2H6YA 6GSSA 4D73B 4EDYA 1F9MA 1UVZA 4NAXA 1TOFA 1FOVA 1A23A 5J41A 4PUAA 5CYYA 1XVWA 4XRDA 2NVLA 4POKA 4POBA 3DIEA 3TKQA 4L0WA 2CVKA 4LMVA 3UJ1A 1O81A 5G2ZA 3N9JA 1T00A 1TTZA 2K9FA 3W8JA 1GTUA 3VLNA 4IJIA 1GH2A 4L0UA 5IMAA 4YQVA 4NV5A 3QAWA 3GKMA 2LJRA 16GSA 2C0FA 3D5JA 2E2MA 2L5LA 3DMLA 2H75A 1WJKA 4KDXA 1KEBA 4KCAA 4XS4B 4RUVA 4LMWA 4G19A 2AAWA 3D22A 4ISDA 18GSA 3I9V2 1SENA 1JHBA 1XWAA 1GNEA 3GKNA 3TKSC 4OFMA 2V6KA 2BTOT 1JFUA 6GSTA 2H71A 4D73A 1BX9A 3GSSA 3WT1A 3DGQA 5KEJA 2PVQA 1EOGA 4V2MA 1ERWA 1GSQA 3RDWA 3M9JA 3GYKA 1UN2A 4HI7A 3HKRA 1WMJA 3TJKA 1BEDA 4O32A 5DJLA 2VAFA 3EC3A 1F37A 5ENUA 4MF5A 1ML6A 3CSHA 2IMIA 4ZBDA 1SKSB 4XS4A 1GUHA 4QL9A 5A4VA 2DJJA 4MJAA 1M0UA 4Q5QA 3TRXA 2C0DA 3FW2A 1YKAA 2B5XA 2J23A 3F6DA 1A8YA 3CSJA 1YQ1A 1G7OA 1UA5A 1QGVA 4O7HA 4TVEA 1NM3A 2E7PA 1AQWA 1OE7A 2JSZA 4OCFA 3F4RA 2WJUA 3HA9A 4QQ7A 1JZRA 4KNDA 4TW5A 1FW1A 5IMDA 2H73A 2HZEB 1KBNA 3HZ8A 1ZGNA 2CVBA 1VGLA 5ID2B 3IXRA 1HQOA 2K18A 1U3IA 4MJBA 5DAKA 3FZ4A 3C71A 2NPBA 3P2AA 3CXGA 1M9BA 1Y6EA 4MZCA 2WB9A 1GNWA 2YP6A 3ZFBA 1TRWA 4HJMA 4ZB6A 20GSA 1WP0A 4J2FA 4IVFA 1GL8A 2YJHA 1GRXA 1VF3A 1M2AA 3CRUA 3KIJA 1A8LA 3IDVA 2I3YA 5COHA 4O5RA 2GZZA 3EE2A 4GSNA 3C1RA 2YANA 2FGXA 2JL4A 1X9WB 4GLTA 4KX4A 2J9HA 2GTUA 1Z5YE 5A4WA 3ZREA 4Q5NA 2F9SA 4TR4A 4ZIJA 1PQNA 3QAGA 2X64A 3M3MA 1EZKA 2QGVA 4X43A 2H0HA 1X5CA 1S3AA 3HDCA 2HSHA 5ELGA 4IKHA 3ERFA 5DVBA 2LV3A 2YZUA 2DJ2A 4RI7A 1A2JA 1PKWA 3EYTA 2O7KA 3W6GA 1GUKA 3ZYWA 1ZOFA 2RM6A 3Q74A 1AUCA 4KCEA 2LS5A 1SK0A 5A5KA 6GSWA 4J57E 1J0FA 3GX8A 4NWYA 4K7OA 4ZB8A 4JR6A 5G30A 2F51A 2JZRA 2CVDA 1TI1A 4IW9A 2AUVA 4MPGA 2CZ2A 4IQ1A 2AV4A 1EP8A 4AJ7A 2PMTA 1XZOA 3GIXA 5B6NA 3A2WA 2QC7A 2R4VA 2GVPA 3NOFA 4F0CA 3IOSA 2FWEA 4IHUA 2GZYA 2VL2A 1TK8B 2H72A 1H4OA 1R4WA 3M1GA 4TR1B 4KH7A 2L6DA 2B1KA 3KMOA 3EVIA 4K0NA 1GP1A 2CA8A 2VIMA 2LQQA 3UBKA 1BAYA 1T3BA 1SL0B 1EOHA 4IQAA 2VCZA 1AC1A 3F8UA 1SJIA 4G10A 4AGSA 2LJKA 4YAVA 5GSTA 4CW9A 2KP2A 4V2LA 2M80A 4GSTA 4MK3A 4NMUA 3LEFA 2H1GA 1PX6A 5JCWA 3LXTA 4MP4A 3RPNA 4V2NA 3EMXA 1F6MC 1VRSD 4GSSA 4N10A 4N0ZA 3GMFA 1WRYA 1TJDA 5GAPD 2YJ7A 2C1YA 2H6ZA 2O8VB 2IN3A 3UEMA 1BG5A 2X8HA 3BOAA 1XCCA 3GN3A 3HCZA 1V2AA 2VCQA 1TXXA 1Z9HA 4XCSA 1K3OA 1K0BA 4ULXA 1K0MA 2YCDA 3WGEA 1G0TA 4BVXA 4HS1A 2RUFA 3UOMA 2LNTA 5KN0A 1SKRB 1ABAA 3QAVA 1AW9A 2H8LA 2V41A 5E59A 3EU3A 1MTCA 2B5YA 3TKPA 2RIIA 5KN2A 2PPTA 2C4JA 3LSZA 2FWFA 1YEXA 2H0IA 2HFDA 2KHPA 4MJCA 5ECRB 3EWLA 2YN1A 3NZNA 3IV4A 5JWQB 2C3QA 2X8CA 4MZWA 4LL4B 1SL1B 1O73A 1CQGA 4TN8A 1A2LA 2DBCA 5DQYA 1XIYA 4KGIA 3WYWA 2A4VA 1CQHA 1OC3A 3HVVA 3JCML 1F2EA 4LL1B 1NSWA 1SJZA 4IP1A 1IYIA 5E4WA 1JLWA 4K6XA 1KNGA 4TKYA 3HJOA 4OWYA 2VLUA 2B3SA 2H01A 2OE3A 3TCOA 5CRWA 1ZL9A 2WS2A 4POMA 2DJKA 2VD1A 4CHSA 2D2ZA 4GRFA 3IPZA 2DMLA 3HYPA 1X9SB 3IRAA 1Z3EA 5IPHA 3TDGA 1RQMA 1AQVA 3I43A 3FR6A 5J9BA 2F8FA 6GSYA 1TU7A 2LEGA 4KDYA 1DBYA 3GHAA 1QFNA 2ON7A 4GF0A 2M46A 1Z7RA 3DVXA 1FG4A 1XBSA 2HT9A 2BMXA 2YNXA 4OD7A 3KH7A 6GSVA 4MF6A 3FK8A 1K0CA 5LNKe 3APOA 1FAAA 2PVOC 3HVXA 1GUMA 4WEYA 1B4QA 2RM5A 2O89A 2CAIA 2GQKA 3HJPA 3L9VA 1QXHA 2O85A 3GRXA 4PURA 2XPEA 2FA4A 3AY8A 3D0ZA 2H19A 4N30A 3UL3A 4HU9A 3TJGA 1O85A 3VFIA 1V57A 4IN0A 1PRXA 2HI7A 3H8QA 3L0HA 5IMCA 2GGTA 2ZUPA 3GUSA 4Z7XA 5ECPB 4GTUA 3MNGA 3M9KA 2OE1A 4RQRA 4DSSA 1GLQA 4LLRA 1M2DA 5ELAA 4EE0A 3KJYA 2IMFA 3LGCA 2YZHA 3DKSA 4HQZA 1EV9A 5HR3A 2VCVA 3IBHA 3ZVJA 3HJMA 4BWQA 1VF2A 5DBQA 3VK9A 5LD0A 4KA0A 3QFBC 1F3AA 3S9FA 3M8NA 2L4CA 3PH9A 3M0FA 1WWJA 4X1UA 3BD2A 1JZOA 5CP1A 3VURA 5IOXA 1A2MA 2H70A 1F3BA 5IO0A 2OA7A 2WULA 5IM9A 3ERWA 3KM6A 10GSA 4PNFA 1XFLA 4GQFA 4PUFC 2A2RA 4ZB9A 2MBSA 3KTLA 1YKCA 5AIXA 3SBCA 1ERVA 4PQHA 2P31A 5H5RA 1GSYA 1LBKA 5DAKB 1XPVA 2IMKA 1THXA 1M2BA 4GCIA 4X0XA 2R6KA 1YEPA 4OMVA 4WF4A 5HR1A 1KTEA 2GS3A 4HEA2 2OADA 4WXTA 4F82A 3L9SA 3VWWA 4WBRD 3KP8A 3ZMLA 2HLSA 3GH6A 2IJYA 2GLRA 4JBBA 3HXSA 1B9YC 1HYUA 3LYPA 3DEXA 2C8UA 1V9WA 2MZCA 3FY7A 4YQMA 2QKEA 5C04A 11GSA 4HOJA 1BYEA 3MSZA 3ZMKA 3GNJA 3C7MA 5CRDA 1XWCA 2R2JA 4WR4A 5C00A 1A24A 22GSA 3R2QA 3IHQA 5AISA 5G31A 4KAEA 1JZWA 2DIZA 4HJ2A 1JZDA 5FWGA 3D21A 3ME8A 4XS1A 1R5AA 2WCIA 1Q4JA 2LRTA 4V1Ap 3EMPA 3L4NA 4DVCA 3J7Yk 1PSQA 1I9DA 5HQPA 1K0OA 2VCWA 1SJ6A 5G5FA 3GL5A 4K7IA 4N0VA 3KTBA 4NHZA 2F3MA 1X5DA 4TRXA 3EU4A 1A0FA 2XHFA 7GSSA 2FCHA 2GSRA 4FO5A 2TRCP 4TR0A 3RBTA 1MD3A 3KH9A 3FZAA 3QCPA 1ON4A 3ZRDA 3GA4A 3IE3A 3D4MA 3CRTA 3PINA 4ECBA 5DCGA 1Y25A 4F9ZA 4TXVA 3VPTA 4JE1A 3Q6OA 4TXOA 3DD3A 5B8AA 2ZNMA 3FZ5A 4AJ6A 4EF0A 2DC5A 1ZCPA 2OJLA 2G2QA 2VL3A 5D9TA 1V98A 2L57A 2X99A 4GQCA 5A4UA 8GSSA 2OE0A 2XBQA 3Q19A 5JCUA 3APSA 3ZFLA 1N2AA 5ABRA 1O7UA 2H30A 2LTKA 3GL3A 1X5EA 1S3DA 1EEJA 1NHOA 2DIYA 5B7CA 5JWRB 2KLXA 2GDRA 2LSTA 1K0DA 2CT6A 1GSFA 4K9ZA 3F0IA 1GTAA 1XW6A 4ECCA 2NTOA 2GQMA 5JWOB 3QMXA 4ZL9A 1GTIA 2ES7A 4ILFA 2GT6A 4E8HA 4J56E 4FH8A 5HR0A 3P8WA 2YWNA 3FKFA 1TKDB 1ZYQB 1U6TA 1OYJA 3GSTA 3LWAA 4I8BA 3H1NA 3SWLA 1I5GA 1ERUA 4ID0A 2JACA 4I6XA 3KZQA 1WIKA 1MEKA 3NIVA 5GSSA 5GZZB 1PL2A 9GSSA 5J3RA 3HVSA 1DE1A 4E8EA 3DXBA 4PQIA 1TI3A 5H5SA 3C73A 1XOAA 2R37A 3LORA 4NV2A 3H4KA 2EIOA 5F06A 3U6VA 5INYA 5IOWA 4BVYA 1ACVA 4KSOA 5LCZA 2GSSA 1O8XA 3KEBA 2XBIA 4HDEA 1Q98A 1G6WA 2MMOA 5DALA 4MZBA 3F3QA 4NPBA 2MBTA 3EINA 3GTUA 3IR4A 3FR9A 1DE2A 2XC2A 4MJEA 2IL3A 3BBYA 4ML1A 4WKWA 5D9XA 1QMVA 5HR2A 1UC7A 2IMEA 4YH2A 2I4AA 5IMVA 1TK5B 5AGYA 2VL2C 1E6BA 3KXOA 4IP6A 2N5FA 3G9BA 5ECHB 1PX7A 1T4YA 1PGTA 5D93A 1NHYA 2CQ9A 1T4ZA 1W89A 2GZPA 1V58A 2DJ1A 2FA8A 3KCMA 4QL7A 2E2GA 3P90A 4KSMA 1ST9A 1AQXA 5G5EA 4YQUA 3UAPA 4ECIA 3QPMA 3A5WA 3V1WA 3TB2A 5CO3A 1SKWB 3IAS2 1IYHA 2AJQB 2B7KA 1HNAA 4N11A 2V1MA 1FVJA 1Z6MA 4JEDA 5ECSA 3LQ7A 3N5OA 4JRRA 2V6OA 1K3YA 3HD5A 1PA3A 3G7IA 2C0EA 1ERTA 4FYUA 4AF2A 3ZIVA 1K0AA 3VI5A 4I2UA 2OKAA 4IELA 4MCUA 1RK4A 2PU9C 2YOIA 4MF7A 1YJ6A 4HU7A 3UVTA 3GV1A 5B8BA 1X0RA 4BL7A 4G2EA 3ERGA 2WZ9A 4XS6A 2CZ3A 1AIUA 2HRFA 1T7PB 2PGTA 3RHBA 2A2SA 1TP9A 2H1BA 4DSSB 5ECQB 2CV4A 1EV4A 2YV9A 3GKXA 4HZ4A 2LJAA 1DSBA 3TKSA 4ZL7A 2N5AA 2WRTA 1E2YA 2B5EA 4ECJA 4DSQA 4OFTA 5GAND 1OAZA 4NXIA 3F9UA 4KUNA 4ML6A 3GFKA 1GSUA 2B7JA 13GSA 1B9XC 3IK7A 1LU4A 2JADA 1O8WA 3UIWA 1FB0A 3EURA 1XWGA 3BCIA 2EC4A 4L5LA 1ZZYA 4JU5A 1K0NA 2E0QA 3TOTA 2PN8A 3IA1A 4K8MA 4XIHA 3L78A 1MDJA 4NHWA 5IQYA 3IK9A 2WFCA 3VPQA 2GSTA 1XXUA 1OC8A 4MDCA 2YPMA 4POLA 2VM1A 2DJ3A 3DYRA 5F05A 2FHEA 2OBIA 2ON5A 3VWXA 4MABA 5H5QA 1FO5A 1GWCA 5AIVA 3ZVJD 3FRCA 2M72A 1TDIA 3APQA 4FYCA 2EIQA 3HY2A 4ZBBA 3DVWA 4F2IA 1FHEA 2CAQA 1EP7A 2DSAA 3TOUA 2VM2A 1PN9A 2V32A 3I69A 2R3XA 4EXJA 5J5NA 2O87A 4XRAA 3U5RE 1QQ2A 3A2VA 3K8NA 5CNWA 3VI7A 4MH2A 2HE3A 2TRXA 1YF1A 3TJBA 3O3TA 2H6XA 5CREA 2V2GA 1GSSA 2FY6A 2IMDA 3IC4A 1C72A 5ECLB 4HUAA 2H1AA 2IFQA 5D9WA 2RLIA 4IJ3A 5ECMB 5KN3A 4WR5A 2LRNA 4OO4A 2PBJA 1OE8A 5DDLA 1N8JA 5HFGA 5HFIA 2B6MA 4MH3A 5FHIA 14GSA 1SK1A 2JSYA 3I6AA 3TKRA 2FWGA 4ZILA 4DSRA 4JZQA 3ZL5A 2PERA 3KP9A 1G6YA 2MMNA 3OR5A 3TGZA 2VLTA 1U87A 2P5RA 1GSEA 3MAKA 4ZXGA 3ISOA 2TIRA 2RUEA 1HNCA 3F4TA 4EVMA 2JZTA 4K1FA 5D9VA 5F8BA 5HFKA 2HNLA 3F63A 3VWUA 4I2TA 2LKUA 2DJ0A 1XW9A 3D6IA 3O6TA 2ZCTA
chains in the Genus database with same CATH superfamily
4EKZA 1TU8A 1GULA 1Z6NA 5EY6A 2G0FA 4KF9A 1EGOA 2DLXA 1PD21 5EVOA 2KP1A 3E3EA 4WBJA 2KOKA 1PKZA 3TJJA 4I5QA 2ALBA 2L59A 1USBA 2HRAA 2HXKA 1GLPA 3RPPA 5IO2A 2OACA 3Q18A 4EDZA 17GSA 2HYXA 4TXOB 2IWTA 6GSXA 1PL1A 4EL1A 2Z9SA 3ZZXA 3QOUA 4G9HA 4JR4A 1HNBA 1THOA 3D4TA 2FNOA 2VUPA 3WGXA 1K3LA 4V1Ag 2N5BA 3GURA 19GSA 1MDIA 3WGDA 3FZ9A 3QR6A 3QFAC 3H93A 2C3TA 1SU9A 2VLVA 3DRNA 5CRGA 5IMZA 1VF4A 2K8VA 2PUKC 3FHKA 3PGTA 4MLYA 3W8SA 2YV7A 1MDKA 3WT2A 3F6FA 4BPYA 2H1DA 1SYRA 1YY7A 3CTFA 1XOBA 4KE3A 1FOHA 2HZEA 1B8XA 1WPIA 4Q5RA 1YF0A 5ID2A 1BJXA 4IBPA 1U88A 2C0GA 3IAM2 4AJ8A 2AHEA 3P7XA 1ZMAA 3C1SA 1TRSA 2C3NA 4MA9A 1V40A 4F0BA 4I97A 3CMIA 1OKTA 3G7JA 3RHCA 1WOUA 3A2XA 1DUGA 2WDUA 3LXZA 5IIZA 1QK8A 4TOPA 1OVNA 3ED3A 1B4PA 1YDKA 4YAPA 3QDNA 5J9CA 3LFLA 3UMAA 4K0GA 1PMTA 5D73A 4PNGA 2EIRA 3PPUA 2R5GA 2LRCA 4KW6A 5KN1A 1J9BA 2LQOA 3J7Yb 1XWKA 4YKGA 1EWXA 1TW9A 3GH9A 1OKDA 1BQ7A 2JU5A 2NBSA 5F0GA 1X9MB 2HRNA 4FYBA 5DALB 2F8AA 3GTUB 2FWHA 1GSDA 4PX1A 5IPGA 1FB6A 3WD6A 1ZYEA 2L6CA 1VF1A 1G7EA 4CDOA 4XTSA 6GSUA 5AN1A 1U3AA 1T1VA 2XPDA 1OC9B 4BWSA 1J08A 4LA1A 2AB6A 2FUG2 2FLSA 2K8SA 1SD9A 2H66A 5D8IA 2NDOA 3ZIJA 3FYGA 3VWVA 2P5QA 3A3TA 1SL2B 3BJ5A 3G7YA 4K7NA 3TJFA 1GTBA 1R26A 2A4HA 4ACSA 2YWIA 1JLVA 2QSIA 2IPAA 3UARA 2I9HA 4EUYA 4XHMA 5ECKB 1YZXA 1XWBA 1LJRA 4PGTA 1SD8A 2BJXA 2HSYA 2MYGA 3HZ4A 1R7HA 2I81A 1B48A 2C80A 2AYTA 2VCXA 2VOCA 4TR1A 1EEMA 5G1KA 1XVQA 5L71A 2LNSA 3QD9A 2VO4A 3CYNA 1TK0B 4F03A 1XW5A 4DEJA 4EO3A 2HRKA 4OCEA 5ECOB 2WGRA 4BL7B 1OC9A 1A0RP 2REMA 4PQ1A 5DQSA 4TR3A 4IGJA 5DJMA 3TRPA 3UBLA 3BCKA 2H74A 1ILOA 4WETA 3US3A 1TRVA 2IIYA 5DCHA 4H86A 5ECIB 3TUEA 3ZTLA 3FEUA 1M99A 2HZFA 5EPFA 4KDUA 2YWMA 1XG8A 2MMAA 2R0GA 1WE0A 4WF5A 4MPFA 1Z7PA 1HD2A 1QUWA 4O92A 4RQXA 3ZITA 2CX3A 2VD0A 3GX0A 1NW2A 1AAZA 12GSA 3FR3A 1R5PA 1FVKA 4GWRA 4GXZA 3KMNA 3TRQA 3PR8A 5CRHA 4K2DA 2GQLA 3MDKA 4L8EA 4BA7A 2MMZA 4Q5FA 5EL8A 5ECNB 2FD3A 2X8GA 4A5PA 4RI6A 4L5OA 4FIWA 1RW1A 3E9JB 4ZL8A 3ZLPA 1M9AA 2JZSA 4OFNA 5F07A 1AXDA 1M7TA 1TRUA 3CTGA 2L5OA 5JCGA 5J4UA 3CSIA 4OO5A 2VL9A 3UVHA 5D96A 2B1LA 3CBUA 1T8EB 2CX4A 4MMMA 1W4VA 3TKSE 3F4SA 3F3RA 1SYXA 2L4QA 3HHVA 5B6MA 1SK2A 2DMMA 3KD0A 4EC0A 2OBKA 2LUSA 2GT5A 2K6VA 2YWOA 5IMFA 3L9UA 3LYKA 2A2PA 1MD4A 2QA1A 3O76A 1H75A 5G1LA 2H0GA 4P3YB 3E0UA 4O5QA 3C8EA 1URMA 4IS0A 2H76A 3H79A 3RAZA 3KGKA 4HZ2A 4PXOA 5FT3A 2I1UA 4KB3A 2VCTA 3ME7A 4ZBAA 1EGRA 3DWVA 3MWHA 2P0GA 2PWJA 2GSQA 1S3CA 2KUCA 4HQSA 1O6JA 3LJRA 5CAXA 3LG6A 3GKKA 2IFQB 2H6YA 6GSSA 4D73B 4EDYA 1F9MA 2DKHA 1UVZA 4NAXA 1TOFA 1FOVA 1A23A 5J41A 4PUAA 5CYYA 1XVWA 4XRDA 2NVLA 4POKA 4POBA 3DIEA 3TKQA 4L0WA 2CVKA 4LMVA 3UJ1A 1O81A 5G2ZA 3N9JA 1T00A 1TTZA 2K9FA 3W8JA 1GTUA 3VLNA 4IJIA 1GH2A 4L0UA 5IMAA 4YQVA 4NV5A 3QAWA 3GKMA 2LJRA 16GSA 2C0FA 3D5JA 2E2MA 2L5LA 3DMLA 2H75A 1WJKA 4KDXA 1KEBA 4KCAA 4XS4B 4RUVA 4LMWA 3FMWA 4G19A 2AAWA 3D22A 4ISDA 18GSA 3I9V2 1SENA 1JHBA 1XWAA 1GNEA 3GKNA 3TKSC 4OFMA 2V6KA 4Z2UA 2BTOT 1JFUA 6GSTA 2H71A 4D73A 5BMUA 1BX9A 3GSSA 3WT1A 3DGQA 5KEJA 2PVQA 1EOGA 4V2MA 5KOXA 1ERWA 1GSQA 3RDWA 3M9JA 3GYKA 1UN2A 4HI7A 3HKRA 1WMJA 3TJKA 1BEDA 4O32A 5DJLA 2VAFA 3EC3A 1F37A 5ENUA 4MF5A 1ML6A 3CSHA 2IMIA 4ZBDA 1SKSB 4XS4A 1GUHA 4QL9A 5A4VA 2DJJA 4MJAA 1M0UA 4Q5QA 3TRXA 2C0DA 3FW2A 1YKAA 2B5XA 2J23A 3F6DA 1A8YA 3CSJA 1YQ1A 1G7OA 1UA5A 1QGVA 4O7HA 4TVEA 1NM3A 2E7PA 1AQWA 1OE7A 2JSZA 4OCFA 3F4RA 2WJUA 3HA9A 4QQ7A 1JZRA 4KNDA 4TW5A 1FW1A 5IMDA 2H73A 2HZEB 1KBNA 3HZ8A 4MNNA 1ZGNA 2CVBA 1VGLA 5ID2B 3IXRA 1HQOA 2K18A 1ZYPA 1U3IA 4MJBA 4YKFA 5DAKA 3FZ4A 3C71A 2NPBA 3P2AA 3CXGA 1M9BA 1Y6EA 4MZCA 2WB9A 1GNWA 2YP6A 3ZFBA 1TRWA 4HJMA 4ZB6A 20GSA 1WP0A 4J2FA 4IVFA 1GL8A 2YJHA 1GRXA 1VF3A 1M2AA 4K2XA 3CRUA 3KIJA 2DKIA 1A8LA 3IDVA 2I3YA 5COHA 4O5RA 2GZZA 3EE2A 4GSNA 3C1RA 2YANA 2FGXA 2JL4A 1X9WB 4GLTA 4KX4A 2J9HA 2GTUA 1Z5YE 5A4WA 3ZREA 4Q5NA 2F9SA 4TR4A 4ZIJA 1PQNA 3QAGA 2X64A 3M3MA 1EZKA 2QGVA 4X43A 2H0HA 1X5CA 1S3AA 3HDCA 2HSHA 5ELGA 4IKHA 3ERFA 5DVBA 2LV3A 2YZUA 2DJ2A 4RI7A 1A2JA 1PKWA 3EYTA 2O7KA 3W6GA 4EIPA 1GUKA 3ZYWA 1ZOFA 2RM6A 3Q74A 1AUCA 4KCEA 2LS5A 1SK0A 5A5KA 6GSWA 4J57E 1J0FA 3GX8A 4NWYA 4K7OA 4ZB8A 4JR6A 5G30A 2F51A 2JZRA 2CVDA 1TI1A 4IW9A 2AUVA 4MPGA 2CZ2A 4IQ1A 2AV4A 1EP8A 4AJ7A 2PMTA 1XZOA 3GIXA 5B6NA 3A2WA 2QC7A 2R4VA 2GVPA 3NOFA 4F0CA 3IOSA 2FWEA 4IHUA 2GZYA 3A5IA 2VL2A 1TK8B 2H72A 1H4OA 1R4WA 3M1GA 4TR1B 4KH7A 2L6DA 2B1KA 3KMOA 3EVIA 4K0NA 1GP1A 2CA8A 2VIMA 2LQQA 3UBKA 1BAYA 1T3BA 1SL0B 1EOHA 4IQAA 2VCZA 1AC1A 3F8UA 1SJIA 4G10A 4AGSA 2LJKA 4YAVA 5GSTA 4CW9A 2KP2A 4V2LA 2M80A 3MIXA 4GSTA 4MK3A 4NMUA 3LEFA 2H1GA 1PX6A 5JCWA 3LXTA 4MP4A 3RPNA 4V2NA 3EMXA 1F6MC 1VRSD 4GSSA 4N10A 4N0ZA 3GMFA 1WRYA 1TJDA 5GAPD 2YJ7A 2C1YA 2H6ZA 2O8VB 2IN3A 3UEMA 1BG5A 2X8HA 3BOAA 1XCCA 3GN3A 3HCZA 1V2AA 2VCQA 1TXXA 1Z9HA 4XCSA 1K3OA 1K0BA 4ULXA 1K0MA 2YCDA 3WGEA 1G0TA 4BVXA 4HS1A 2RUFA 3UOMA 2LNTA 5KN0A 1SKRB 1ABAA 3QAVA 1AW9A 2H8LA 2V41A 5E59A 3EU3A 1MTCA 4EIQA 2B5YA 1M3IA 3TKPA 2RIIA 5KN2A 2PPTA 4O5UA 2C4JA 3LSZA 2FWFA 1YEXA 2H0IA 2HFDA 2KHPA 4MJCA 5ECRB 3EWLA 2YN1A 3NZNA 3IV4A 5JWQB 2C3QA 2X8CA 4MZWA 4LL4B 1SL1B 1O73A 1CQGA 4TN8A 1A2LA 2DBCA 5DQYA 1XIYA 4KGIA 3WYWA 2A4VA 1CQHA 1OC3A 3HVVA 3JCML 1F2EA 4LL1B 2X49A 1NSWA 1SJZA 4IP1A 1IYIA 5E4WA 1JLWA 4K6XA 1KNGA 4TKYA 3HJOA 4OWYA 2VLUA 2B3SA 2H01A 2OE3A 3TCOA 5CRWA 1ZL9A 2WS2A 4POMA 2DJKA 2VD1A 4CHSA 2D2ZA 4GRFA 3IPZA 2DMLA 3HYPA 1X9SB 3IRAA 1Z3EA 5IPHA 3TDGA 1RQMA 1AQVA 3I43A 3FR6A 5J9BA 2F8FA 6GSYA 1TU7A 1PFOA 2LEGA 4KDYA 1DBYA 3GHAA 1QFNA 2ON7A 4GF0A 2M46A 1Z7RA 3DVXA 1FG4A 1XBSA 2HT9A 2BMXA 2YNXA 4OD7A 3KH7A 4PTSA 6GSVA 4MF6A 3FK8A 1K0CA 5LNKe 3APOA 1FAAA 2PVOC 3HVXA 1GUMA 4WEYA 1B4QA 2RM5A 1M3JA 2O89A 2CAIA 2GQKA 3HJPA 3L9VA 1QXHA 2O85A 3GRXA 4PURA 2XPEA 2FA4A 3AY8A 3D0ZA 2H19A 4ICYA 4N30A 3IC8A 3UL3A 4HU9A 3TJGA 1O85A 3VFIA 1V57A 4IN0A 1PRXA 2HI7A 3H8QA 3L0HA 5IMCA 2GGTA 2ZUPA 3GUSA 4Z7XA 5ECPB 4GTUA 2R0CA 3MNGA 3M9KA 2OE1A 4RQRA 4DSSA 1GLQA 4LLRA 1M2DA 5ELAA 4K5SA 4EE0A 3KJYA 2IMFA 3LGCA 2YZHA 3DKSA 4HQZA 1EV9A 5HR3A 2VCVA 3IBHA 3ZVJA 3HJMA 4BWQA 1VF2A 4X4JA 3LW9A 5DBQA 3VK9A 5LD0A 4KA0A 3QFBC 1F3AA 3S9FA 3M8NA 4USSA 2L4CA 4G0IA 3PH9A 3IHGA 3M0FA 1WWJA 4X1UA 3BD2A 1JZOA 5CP1A 3VURA 5IOXA 1A2MA 2H70A 1F3BA 5IO0A 2OA7A 2WULA 5IM9A 3ERWA 3KM6A 10GSA 4PNFA 2HSMA 1XFLA 4GQFA 4PUFC 2A2RA 4ZB9A 2MBSA 3KTLA 1YKCA 5AIXA 3SBCA 1ERVA 4PQHA 2P31A 5H5RA 1GSYA 1LBKA 5DAKB 1XPVA 2IMKA 1THXA 1M2BA 4GCIA 4X0XA 2R6KA 1YEPA 4OMVA 4WF4A 5HR1A 1KTEA 2GS3A 4HEA2 2OADA 4WXTA 4F82A 3L9SA 3VWWA 4WBRD 3KP8A 3ZMLA 2HLSA 3GH6A 2IJYA 2GLRA 4JBBA 3HXSA 1B9YC 1HYUA 3LYPA 3DEXA 2C8UA 1V9WA 2MZCA 3FY7A 4YQMA 2QKEA 5C04A 11GSA 4HOJA 1BYEA 3MSZA 3ZMKA 3GNJA 3C7MA 5CRDA 1XWCA 2R2JA 4WR4A 5C00A 1A24A 22GSA 3R2QA 3IHQA 5AISA 5G31A 4KAEA 1JZWA 2DIZA 4HJ2A 1JZDA 5FWGA 3D21A 3ME8A 4XS1A 1R5AA 2WCIA 1Q4JA 2LRTA 4V1Ap 3EMPA 3L4NA 4HSCX 3MYDA 4DVCA 3J7Yk 1PSQA 1I9DA 5HQPA 1K0OA 2VCWA 1SJ6A 5G5FA 3GL5A 4K7IA 4N0VA 3KTBA 4NHZA 2F3MA 1X5DA 4TRXA 3EU4A 1A0FA 2XHFA 7GSSA 2FCHA 2GSRA 4FO5A 2TRCP 4Z2RA 4TR0A 3RBTA 1MD3A 3KH9A 3FZAA 3QCPA 1ON4A 3ZRDA 3GA4A 3IE3A 3D4MA 3R3EA 3CRTA 3PINA 4ECBA 5DCGA 1Y25A 2UZ8A 4F9ZA 4TXVA 3VPTA 4JE1A 3HVNA 3Q6OA 4G0LA 4TXOA 3DD3A 1PN0A 5B8AA 2ZNMA 3FZ5A 4AJ6A 4EF0A 2DC5A 1ZCPA 1ZYNA 2OJLA 2G2QA 2VL3A 5D9TA 1V98A 2L57A 2X99A 4GQCA 5A4UA 8GSSA 2OE0A 2XBQA 3Q19A 5JCUA 3APSA 3ZFLA 1N2AA 5ABRA 1O7UA 2H30A 2LTKA 3GL3A 1X5EA 1S3DA 1EEJA 1NHOA 2DIYA 5B7CA 5JWRB 2KLXA 2GDRA 2LSTA 1K0DA 2CT6A 4BIKA 1GSFA 4K9ZA 4BVYB 3F0IA 1GTAA 1XW6A 4ECCA 2NTOA 2GQMA 5JWOB 3QMXA 4ZL9A 1GTIA 2ES7A 4ILFA 2GT6A 4E8HA 4J56E 4FH8A 5HR0A 3P8WA 2YWNA 3FKFA 1TKDB 1ZYQB 1U6TA 1OYJA 3GSTA 3LWAA 4BVXB 4I8BA 3H1NA 3SWLA 4Z2TA 1I5GA 1ERUA 4ID0A 2JACA 4I6XA 3KZQA 4CY6A 1WIKA 1MEKA 3NIVA 5GSSA 5GZZB 1PL2A 9GSSA 5J3RA 3HVSA 1DE1A 4E8EA 3DXBA 4PQIA 1TI3A 5H5SA 3C73A 1XOAA 2R37A 3LORA 4NV2A 3H4KA 2EIOA 5F06A 3U6VA 5INYA 5IOWA 4BVYA 1ACVA 4KSOA 5LCZA 2GSSA 1O8XA 3KEBA 2XBIA 4HDEA 1Q98A 1G6WA 2MMOA 4MZBA 5DALA 3F3QA 4NPBA 2MBTA 3EINA 3GTUA 3IR4A 3FR9A 1DE2A 2XC2A 4MJEA 2IL3A 3BBYA 4ML1A 4WKWA 5D9XA 1QMVA 5HR2A 1UC7A 2IMEA 4YH2A 2I4AA 5IMVA 1TK5B 5AGYA 2VL2C 1E6BA 3KXOA 4IP6A 2N5FA 3G9BA 5ECHB 1PX7A 1T4YA 1PGTA 5D93A 1NHYA 2CQ9A 2QA2A 1T4ZA 1W89A 2GZPA 1V58A 2DJ1A 2FA8A 3KCMA 4QL7A 2E2GA 3P90A 4KSMA 1ST9A 1AQXA 5G5EA 4YQUA 3UAPA 4ECIA 3QPMA 3A5WA 3V1WA 3TB2A 5CO3A 1SKWB 3IAS2 1IYHA 2AJQB 2B7KA 1HNAA 4N11A 2V1MA 1FVJA 1Z6MA 4JEDA 5ECSA 3LQ7A 3N5OA 4JRRA 2V6OA 1K3YA 3HD5A 1PA3A 3G7IA 2C0EA 1ERTA 4FYUA 4AF2A 3ZIVA 1K0AA 3VI5A 4I2UA 2OKAA 4IELA 4MCUA 1RK4A 2PU9C 2YOIA 4MF7A 1YJ6A 4HU7A 3UVTA 3GV1A 5B8BA 1X0RA 4BL7A 4G2EA 3ERGA 2WZ9A 4XS6A 2CZ3A 1AIUA 2HRFA 1T7PB 2PGTA 3EPTA 3RHBA 2A2SA 1TP9A 2H1BA 4DSSB 5ECQB 2CV4A 1EV4A 2YV9A 3GKXA 4HZ4A 2LJAA 1DSBA 3TKSA 4ZL7A 2N5AA 2WRTA 1E2YA 2B5EA 4ECJA 4DSQA 4OFTA 5GAND 2R0PA 1OAZA 4NXIA 3F9UA 4KUNA 4ML6A 5KOWA 3GFKA 1GSUA 2B7JA 13GSA 1B9XC 2X4AA 3IK7A 1LU4A 2JADA 1O8WA 3UIWA 1FB0A 3EURA 1XWGA 3BCIA 2EC4A 4L5LA 1ZZYA 4JU5A 4CY8A 1K0NA 2E0QA 3TOTA 2PN8A 3IA1A 4K8MA 4XIHA 3L78A 1MDJA 4NHWA 5IQYA 3IK9A 2WFCA 3VPQA 2GSTA 1XXUA 1OC8A 4MDCA 2YPMA 4POLA 2VM1A 2DJ3A 3DYRA 5F05A 2FHEA 1S3RA 2OBIA 2ON5A 3VWXA 4MABA 5H5QA 1FO5A 1GWCA 5AIVA 3ZVJD 3FRCA 2M72A 1TDIA 3APQA 4FYCA 2EIQA 3HY2A 4ZBBA 3DVWA 4F2IA 1FHEA 2CAQA 1EP7A 2DSAA 3TOUA 2VM2A 1PN9A 2V32A 3I69A 2R3XA 4FQUA 4EXJA 5J5NA 2O87A 4XRAA 3U5RE 1QQ2A 3A2VA 3K8NA 5CNWA 3VI7A 3CQFA 4MH2A 2HE3A 2TRXA 1YF1A 3TJBA 3O3TA 4G0KA 2H6XA 5CREA 2V2GA 1GSSA 2FY6A 2IMDA 3IC4A 1C72A 4HUAA 5ECLB 2H1AA 2IFQA 5D9WA 2RLIA 5BRTA 4IJ3A 5ECMB 5KN3A 4WR5A 2LRNA 4OO4A 2PBJA 1OE8A 5DDLA 1N8JA 5HFGA 5HFIA 2B6MA 4MH3A 5FHIA 14GSA 1SK1A 2JSYA 3I6AA 3TKRA 2FWGA 4ZILA 4DSRA 4JZQA 3ZL5A 2PERA 3KP9A 1G6YA 2MMNA 3OR5A 3TGZA 2VLTA 1U87A 2P5RA 1GSEA 4K5RA 3MAKA 4ZXGA 3ISOA 2TIRA 2RUEA 1HNCA 3F4TA 4EVMA 2JZTA 4K1FA 5D9VA 5F8BA 5HFKA 2HNLA 3F63A 3VWUA 4I2TA 2LKUA 2DJ0A 1XW9A 3D6IA 3O6TA 2ZCTA
chains in the Genus database with same CATH topology
4EKZA 1TU8A 1GULA 1Z6NA 5EY6A 2G0FA 4KF9A 1EGOA 2DLXA 1PD21 5EVOA 2KP1A 3E3EA 4WBJA 2KOKA 1PKZA 3TJJA 4I5QA 2ALBA 2L59A 1USBA 2HRAA 2HXKA 1GLPA 3RPPA 5IO2A 2OACA 3Q18A 4EDZA 17GSA 2HYXA 4TXOB 2IWTA 6GSXA 1PL1A 4EL1A 2Z9SA 3ZZXA 3QOUA 4G9HA 4JR4A 1HNBA 1THOA 3D4TA 2FNOA 2VUPA 3WGXA 1K3LA 4V1Ag 2N5BA 3GURA 19GSA 1MDIA 3WGDA 3FZ9A 3QR6A 3QFAC 3H93A 2C3TA 1SU9A 2VLVA 3DRNA 5CRGA 5IMZA 1VF4A 2K8VA 2PUKC 3FHKA 3PGTA 4MLYA 3W8SA 2YV7A 1MDKA 3WT2A 3F6FA 4BPYA 2H1DA 1SYRA 1YY7A 3CTFA 1XOBA 4KE3A 1FOHA 2HZEA 1B8XA 1WPIA 4Q5RA 1YF0A 5ID2A 1BJXA 4IBPA 1U88A 2C0GA 3IAM2 4AJ8A 2AHEA 3P7XA 1ZMAA 3C1SA 1TRSA 2C3NA 4MA9A 1V40A 4F0BA 4I97A 3CMIA 1OKTA 3G7JA 3RHCA 1WOUA 3A2XA 1DUGA 2WDUA 3LXZA 5IIZA 1QK8A 4TOPA 1OVNA 3ED3A 1B4PA 1YDKA 4YAPA 3QDNA 5J9CA 3LFLA 3UMAA 4K0GA 1PMTA 5D73A 4PNGA 2EIRA 3PPUA 2R5GA 2LRCA 4KW6A 5KN1A 1J9BA 2LQOA 3J7Yb 1XWKA 4YKGA 1EWXA 1TW9A 3GH9A 1OKDA 1BQ7A 2JU5A 2NBSA 5F0GA 1X9MB 2HRNA 4FYBA 5DALB 2F8AA 3GTUB 2FWHA 1GSDA 4PX1A 5IPGA 1FB6A 3WD6A 1ZYEA 2L6CA 1VF1A 1G7EA 4CDOA 4XTSA 6GSUA 5AN1A 1U3AA 1T1VA 2XPDA 1OC9B 4BWSA 1J08A 4LA1A 2AB6A 2FUG2 2FLSA 2K8SA 1SD9A 2H66A 5D8IA 2NDOA 3ZIJA 3FYGA 3VWVA 2P5QA 3A3TA 1SL2B 3BJ5A 3G7YA 4K7NA 3TJFA 1GTBA 1R26A 2A4HA 4ACSA 2YWIA 1JLVA 2QSIA 2IPAA 3UARA 2I9HA 4EUYA 4XHMA 5ECKB 1YZXA 1XWBA 1LJRA 4PGTA 1SD8A 2BJXA 2HSYA 2MYGA 3HZ4A 1R7HA 2I81A 1B48A 2C80A 2AYTA 2VCXA 2VOCA 4TR1A 1EEMA 5G1KA 1XVQA 5L71A 2LNSA 3QD9A 2VO4A 3CYNA 1TK0B 4F03A 1XW5A 4DEJA 4EO3A 2HRKA 4OCEA 5ECOB 2WGRA 4BL7B 1OC9A 1A0RP 2REMA 4PQ1A 5DQSA 4TR3A 4IGJA 5DJMA 3TRPA 3UBLA 3BCKA 2H74A 1ILOA 4WETA 3US3A 1TRVA 2IIYA 5DCHA 4H86A 5ECIB 3TUEA 3ZTLA 3FEUA 1M99A 2HZFA 5EPFA 4KDUA 2YWMA 2MMAA 2R0GA 1WE0A 4WF5A 4MPFA 1Z7PA 1HD2A 1QUWA 4O92A 4RQXA 3ZITA 2CX3A 2VD0A 3GX0A 1NW2A 1AAZA 12GSA 3FR3A 1R5PA 1FVKA 4GWRA 4GXZA 3KMNA 3TRQA 3PR8A 5CRHA 4K2DA 2GQLA 3MDKA 4L8EA 4BA7A 2MMZA 4Q5FA 5EL8A 5ECNB 2FD3A 2X8GA 4A5PA 4RI6A 4L5OA 4FIWA 1RW1A 3E9JB 4ZL8A 3ZLPA 1M9AA 2JZSA 4OFNA 5F07A 1AXDA 1M7TA 1TRUA 3CTGA 2L5OA 5JCGA 5J4UA 3CSIA 4OO5A 2VL9A 3UVHA 5D96A 2B1LA 3CBUA 1T8EB 2CX4A 4MMMA 1W4VA 3TKSE 3F4SA 3F3RA 1SYXA 2L4QA 3HHVA 5B6MA 1SK2A 2DMMA 3KD0A 4EC0A 2OBKA 2LUSA 2GT5A 2K6VA 2YWOA 5IMFA 3L9UA 3LYKA 2A2PA 1MD4A 2QA1A 3O76A 1H75A 5G1LA 2H0GA 4P3YB 3E0UA 4O5QA 3C8EA 1URMA 4IS0A 2H76A 3H79A 3RAZA 3KGKA 4HZ2A 4PXOA 5FT3A 2I1UA 4KB3A 2VCTA 3ME7A 4ZBAA 1EGRA 3DWVA 3MWHA 2P0GA 2PWJA 2GSQA 1S3CA 2KUCA 4HQSA 1O6JA 3LJRA 5CAXA 3LG6A 3GKKA 2IFQB 2H6YA 6GSSA 4D73B 4EDYA 1F9MA 2DKHA 1UVZA 4NAXA 1TOFA 1FOVA 1A23A 5J41A 4PUAA 5CYYA 1XVWA 4XRDA 2NVLA 4POKA 4POBA 3DIEA 3TKQA 4L0WA 2CVKA 4LMVA 3UJ1A 1O81A 5G2ZA 3N9JA 1T00A 1TTZA 2K9FA 3W8JA 1GTUA 3VLNA 4IJIA 1GH2A 4L0UA 5IMAA 4YQVA 4NV5A 3QAWA 3GKMA 2LJRA 16GSA 2C0FA 3D5JA 2E2MA 2L5LA 3DMLA 2H75A 1WJKA 4KDXA 1KEBA 4KCAA 4XS4B 4RUVA 4LMWA 3FMWA 4G19A 2AAWA 3D22A 4ISDA 18GSA 3I9V2 1SENA 1JHBA 1XWAA 1GNEA 3GKNA 3TKSC 4OFMA 2V6KA 4Z2UA 2BTOT 1JFUA 6GSTA 2H71A 4D73A 5BMUA 1BX9A 3GSSA 3WT1A 3DGQA 5KEJA 2PVQA 1EOGA 4V2MA 5KOXA 1ERWA 1GSQA 3RDWA 3M9JA 3GYKA 1UN2A 4HI7A 3HKRA 1WMJA 3TJKA 1BEDA 4O32A 5DJLA 2VAFA 3EC3A 1F37A 5ENUA 4MF5A 1ML6A 3CSHA 2IMIA 4ZBDA 1SKSB 4XS4A 1GUHA 4QL9A 5A4VA 2DJJA 4MJAA 1M0UA 4Q5QA 3TRXA 2C0DA 3FW2A 1YKAA 2B5XA 2J23A 3F6DA 1A8YA 3CSJA 1YQ1A 1G7OA 1UA5A 1QGVA 4O7HA 4TVEA 1NM3A 2E7PA 1AQWA 1OE7A 2JSZA 4OCFA 3F4RA 2WJUA 3HA9A 4QQ7A 1JZRA 4KNDA 4TW5A 1FW1A 5IMDA 2H73A 2HZEB 1KBNA 3HZ8A 4MNNA 1ZGNA 2CVBA 1VGLA 5ID2B 3IXRA 1HQOA 2K18A 1ZYPA 1U3IA 4MJBA 4YKFA 5DAKA 3FZ4A 3C71A 2NPBA 3P2AA 3CXGA 1M9BA 1Y6EA 4MZCA 2WB9A 1GNWA 2YP6A 3ZFBA 1TRWA 4HJMA 4ZB6A 20GSA 1WP0A 4J2FA 4IVFA 1GL8A 2YJHA 1GRXA 1VF3A 1M2AA 4K2XA 3CRUA 3KIJA 2DKIA 1A8LA 3IDVA 2I3YA 5COHA 4O5RA 2GZZA 3EE2A 4GSNA 3C1RA 2YANA 2FGXA 2JL4A 1X9WB 4GLTA 4KX4A 2J9HA 2GTUA 1Z5YE 5A4WA 3ZREA 4Q5NA 2F9SA 4TR4A 4ZIJA 1PQNA 3QAGA 2X64A 3M3MA 1EZKA 2QGVA 4X43A 2H0HA 1X5CA 1S3AA 3HDCA 2HSHA 5ELGA 4IKHA 3ERFA 5DVBA 2LV3A 2YZUA 2DJ2A 4RI7A 1A2JA 1PKWA 3EYTA 2O7KA 3W6GA 4EIPA 1GUKA 3ZYWA 1ZOFA 2RM6A 3Q74A 1AUCA 4KCEA 2LS5A 1SK0A 5A5KA 6GSWA 4J57E 1J0FA 3GX8A 4NWYA 4K7OA 4ZB8A 4JR6A 5G30A 2F51A 2JZRA 2CVDA 1TI1A 4IW9A 2AUVA 4MPGA 2CZ2A 4IQ1A 2AV4A 1EP8A 4AJ7A 2PMTA 1XZOA 3GIXA 5B6NA 3A2WA 2QC7A 2R4VA 2GVPA 3NOFA 4F0CA 3IOSA 2FWEA 4IHUA 2GZYA 3A5IA 2VL2A 1TK8B 2H72A 1H4OA 1R4WA 3M1GA 4TR1B 4KH7A 2L6DA 2B1KA 3KMOA 3EVIA 4K0NA 1GP1A 2CA8A 2VIMA 2LQQA 3UBKA 1BAYA 1T3BA 1SL0B 1EOHA 4IQAA 2VCZA 1AC1A 3F8UA 1SJIA 4G10A 4AGSA 2LJKA 4YAVA 5GSTA 4CW9A 2KP2A 4V2LA 2M80A 3MIXA 4GSTA 4MK3A 4NMUA 3LEFA 2H1GA 1PX6A 5JCWA 3LXTA 4MP4A 3RPNA 4V2NA 3EMXA 1F6MC 1VRSD 4GSSA 4N10A 4N0ZA 3GMFA 1WRYA 1TJDA 5GAPD 2YJ7A 2C1YA 2H6ZA 2O8VB 2IN3A 3UEMA 1BG5A 2X8HA 3BOAA 1XCCA 3GN3A 3HCZA 1V2AA 2VCQA 1TXXA 1Z9HA 4XCSA 1K3OA 1K0BA 4ULXA 1K0MA 2YCDA 3WGEA 1G0TA 4BVXA 4HS1A 2RUFA 3UOMA 2LNTA 5KN0A 1SKRB 1ABAA 3QAVA 1AW9A 2H8LA 2V41A 5E59A 3EU3A 1MTCA 4EIQA 2B5YA 3TKPA 2RIIA 5KN2A 2PPTA 4O5UA 2C4JA 3LSZA 2FWFA 1YEXA 2H0IA 2HFDA 2KHPA 4MJCA 5ECRB 3EWLA 2YN1A 3NZNA 3IV4A 5JWQB 2C3QA 2X8CA 4MZWA 4LL4B 1SL1B 1O73A 1CQGA 4TN8A 1A2LA 2DBCA 5DQYA 1XIYA 4KGIA 3WYWA 2A4VA 1CQHA 1OC3A 3HVVA 3JCML 1F2EA 4LL1B 2X49A 1NSWA 1SJZA 4IP1A 1IYIA 5E4WA 1JLWA 4K6XA 1KNGA 4TKYA 3HJOA 4OWYA 2VLUA 2B3SA 2H01A 2OE3A 3TCOA 5CRWA 1ZL9A 2WS2A 4POMA 2DJKA 2VD1A 4CHSA 2D2ZA 4GRFA 3IPZA 2DMLA 3HYPA 1X9SB 3IRAA 1Z3EA 5IPHA 3TDGA 1RQMA 1AQVA 3I43A 3FR6A 5J9BA 2F8FA 6GSYA 1TU7A 2LEGA 4KDYA 1DBYA 3GHAA 1QFNA 2ON7A 4GF0A 2M46A 1Z7RA 3DVXA 1FG4A 1XBSA 2HT9A 2BMXA 2YNXA 4OD7A 3KH7A 4PTSA 6GSVA 4MF6A 3FK8A 1K0CA 5LNKe 3APOA 1FAAA 2PVOC 3HVXA 1GUMA 4WEYA 1B4QA 2RM5A 2O89A 2CAIA 2GQKA 3HJPA 3L9VA 1QXHA 2O85A 3GRXA 4PURA 2XPEA 2FA4A 3AY8A 3D0ZA 2H19A 4ICYA 4N30A 3IC8A 3UL3A 4HU9A 3TJGA 1O85A 3VFIA 1V57A 4IN0A 1PRXA 2HI7A 3H8QA 3L0HA 5IMCA 2GGTA 2ZUPA 3GUSA 4Z7XA 5ECPB 4GTUA 2R0CA 3MNGA 3M9KA 2OE1A 4RQRA 4DSSA 1GLQA 4LLRA 1M2DA 5ELAA 4K5SA 4EE0A 3KJYA 2IMFA 3LGCA 2YZHA 3DKSA 4HQZA 1EV9A 5HR3A 2VCVA 3IBHA 3ZVJA 3HJMA 4BWQA 1VF2A 4X4JA 3LW9A 5DBQA 3VK9A 5LD0A 4KA0A 3QFBC 1F3AA 3S9FA 3M8NA 4USSA 2L4CA 4G0IA 3PH9A 3IHGA 3M0FA 1WWJA 4X1UA 3BD2A 1JZOA 5CP1A 3VURA 5IOXA 1A2MA 2H70A 1F3BA 5IO0A 2OA7A 2WULA 5IM9A 3ERWA 3KM6A 10GSA 4PNFA 2HSMA 1XFLA 4GQFA 4PUFC 2A2RA 4ZB9A 2MBSA 3KTLA 1YKCA 5AIXA 3SBCA 1ERVA 4PQHA 2P31A 5H5RA 1GSYA 1LBKA 5DAKB 1XPVA 2IMKA 1THXA 1M2BA 4GCIA 4X0XA 2R6KA 1YEPA 4OMVA 4WF4A 5HR1A 1KTEA 2GS3A 4HEA2 2OADA 4WXTA 4F82A 3L9SA 3VWWA 4WBRD 3KP8A 3ZMLA 2HLSA 3GH6A 2IJYA 2GLRA 4JBBA 3HXSA 1B9YC 1HYUA 3LYPA 3DEXA 2C8UA 1V9WA 2MZCA 3FY7A 4YQMA 2QKEA 5C04A 11GSA 4HOJA 1BYEA 3MSZA 3ZMKA 3GNJA 3C7MA 5CRDA 1XWCA 2R2JA 4WR4A 5C00A 1A24A 22GSA 3R2QA 3IHQA 5AISA 5G31A 4KAEA 1JZWA 2DIZA 4HJ2A 1JZDA 5FWGA 3D21A 3ME8A 4XS1A 1R5AA 2WCIA 1Q4JA 2LRTA 4V1Ap 3EMPA 3L4NA 3MYDA 4DVCA 3J7Yk 1PSQA 1I9DA 5HQPA 1K0OA 2VCWA 1SJ6A 5G5FA 3GL5A 4K7IA 4N0VA 3KTBA 4NHZA 2F3MA 1X5DA 4TRXA 3EU4A 1A0FA 2XHFA 7GSSA 2FCHA 2GSRA 4FO5A 2TRCP 4Z2RA 4TR0A 3RBTA 1MD3A 3KH9A 3FZAA 3QCPA 1ON4A 3ZRDA 3GA4A 3IE3A 3D4MA 3R3EA 3CRTA 3PINA 4ECBA 5DCGA 1Y25A 2UZ8A 4F9ZA 4TXVA 3VPTA 4JE1A 3Q6OA 4G0LA 4TXOA 3DD3A 1PN0A 5B8AA 2ZNMA 3FZ5A 4AJ6A 4EF0A 2DC5A 1ZCPA 1ZYNA 2OJLA 2G2QA 2VL3A 5D9TA 1V98A 2L57A 2X99A 4GQCA 5A4UA 8GSSA 2OE0A 2XBQA 3Q19A 5JCUA 3APSA 3ZFLA 1N2AA 5ABRA 1O7UA 2H30A 2LTKA 3GL3A 1X5EA 1S3DA 1EEJA 1NHOA 2DIYA 5B7CA 5JWRB 2KLXA 2GDRA 2LSTA 1K0DA 2CT6A 1GSFA 4K9ZA 4BVYB 3F0IA 1GTAA 1XW6A 4ECCA 2NTOA 2GQMA 5JWOB 3QMXA 4ZL9A 1GTIA 2ES7A 4ILFA 2GT6A 4E8HA 4J56E 4FH8A 5HR0A 3P8WA 2YWNA 3FKFA 1TKDB 1ZYQB 1U6TA 1OYJA 3GSTA 3LWAA 4BVXB 4I8BA 3H1NA 3SWLA 4Z2TA 1I5GA 1ERUA 4ID0A 2JACA 4I6XA 3KZQA 4CY6A 1WIKA 1MEKA 3NIVA 5GSSA 5GZZB 1PL2A 9GSSA 5J3RA 3HVSA 1DE1A 4E8EA 3DXBA 4PQIA 1TI3A 5H5SA 3C73A 1XOAA 2R37A 3LORA 4NV2A 3H4KA 2EIOA 5F06A 3U6VA 5INYA 5IOWA 4BVYA 1ACVA 4KSOA 5LCZA 2GSSA 1O8XA 3KEBA 2XBIA 4HDEA 1Q98A 1G6WA 2MMOA 4MZBA 5DALA 3F3QA 4NPBA 2MBTA 3EINA 3GTUA 3IR4A 3FR9A 1DE2A 2XC2A 4MJEA 2IL3A 3BBYA 4ML1A 4WKWA 5D9XA 1QMVA 5HR2A 1UC7A 2IMEA 4YH2A 2I4AA 5IMVA 1TK5B 5AGYA 2VL2C 1E6BA 3KXOA 4IP6A 2N5FA 3G9BA 5ECHB 1PX7A 1T4YA 1PGTA 5D93A 1NHYA 2CQ9A 2QA2A 1T4ZA 1W89A 2GZPA 1V58A 2DJ1A 2FA8A 3KCMA 4QL7A 2E2GA 3P90A 4KSMA 1ST9A 1AQXA 5G5EA 4YQUA 3UAPA 4ECIA 3QPMA 3A5WA 3V1WA 3TB2A 5CO3A 1SKWB 3IAS2 1IYHA 2AJQB 2B7KA 1HNAA 4N11A 2V1MA 1FVJA 1Z6MA 4JEDA 5ECSA 3LQ7A 3N5OA 4JRRA 2V6OA 1K3YA 3HD5A 1PA3A 3G7IA 2C0EA 1ERTA 4FYUA 4AF2A 3ZIVA 1K0AA 3VI5A 4I2UA 2OKAA 4IELA 4MCUA 1RK4A 2PU9C 2YOIA 4MF7A 1YJ6A 4HU7A 3UVTA 3GV1A 5B8BA 1X0RA 4BL7A 4G2EA 3ERGA 2WZ9A 4XS6A 2CZ3A 1AIUA 2HRFA 1T7PB 2PGTA 3EPTA 3RHBA 2A2SA 1TP9A 2H1BA 4DSSB 5ECQB 2CV4A 1EV4A 2YV9A 3GKXA 4HZ4A 2LJAA 1DSBA 3TKSA 4ZL7A 2N5AA 2WRTA 1E2YA 2B5EA 4ECJA 4DSQA 4OFTA 5GAND 2R0PA 1OAZA 4NXIA 3F9UA 4KUNA 4ML6A 5KOWA 3GFKA 1GSUA 2B7JA 13GSA 1B9XC 2X4AA 3IK7A 1LU4A 2JADA 1O8WA 3UIWA 1FB0A 3EURA 1XWGA 3BCIA 2EC4A 4L5LA 1ZZYA 4JU5A 4CY8A 1K0NA 2E0QA 3TOTA 2PN8A 3IA1A 4K8MA 4XIHA 3L78A 1MDJA 4NHWA 5IQYA 3IK9A 2WFCA 3VPQA 2GSTA 1XXUA 1OC8A 4MDCA 2YPMA 4POLA 2VM1A 2DJ3A 3DYRA 5F05A 2FHEA 2OBIA 2ON5A 3VWXA 4MABA 5H5QA 1FO5A 1GWCA 5AIVA 3ZVJD 3FRCA 2M72A 1TDIA 3APQA 4FYCA 2EIQA 3HY2A 4ZBBA 3DVWA 4F2IA 1FHEA 2CAQA 1EP7A 2DSAA 3TOUA 2VM2A 1PN9A 2V32A 3I69A 2R3XA 4FQUA 4EXJA 5J5NA 2O87A 4XRAA 3U5RE 1QQ2A 3A2VA 3K8NA 5CNWA 3VI7A 4MH2A 2HE3A 2TRXA 1YF1A 3TJBA 3O3TA 4G0KA 2H6XA 5CREA 2V2GA 1GSSA 2FY6A 2IMDA 3IC4A 1C72A 4HUAA 5ECLB 2H1AA 2IFQA 5D9WA 2RLIA 5BRTA 4IJ3A 5ECMB 5KN3A 4WR5A 2LRNA 4OO4A 2PBJA 1OE8A 5DDLA 1N8JA 5HFGA 5HFIA 2B6MA 4MH3A 5FHIA 14GSA 1SK1A 2JSYA 3I6AA 3TKRA 2FWGA 4ZILA 4DSRA 4JZQA 3ZL5A 2PERA 3KP9A 1G6YA 2MMNA 3OR5A 3TGZA 2VLTA 1U87A 2P5RA 1GSEA 4K5RA 3MAKA 4ZXGA 3ISOA 2TIRA 2RUEA 1HNCA 3F4TA 4EVMA 2JZTA 4K1FA 5D9VA 5F8BA 5HFKA 2HNLA 3F63A 3VWUA 4I2TA 2LKUA 2DJ0A 1XW9A 3D6IA 3O6TA 2ZCTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EKZ A;  1TU8 A;  1GUL A;  1Z6N A;  5EY6 A;  2G0F A;  1EGO A;  2DLX A;  1PD2 1;  5EVO A;  2KP1 A;  3E3E A;  4WBJ A;  2KOK A;  1PKZ A;  3TJJ A;  4I5Q A;  2ALB A;  2L59 A;  1USB A;  2HXK A;  1GLP A;  3RPP A;  5IO2 A;  2OAC A;  3Q18 A;  4EDZ A;  17GS A;  2HYX A;  4TXO B;  2IWT A;  6GSX A;  1PL1 A;  4EL1 A;  2Z9S A;  3ZZX A;  3QOU A;  4G9H A;  4JR4 A;  1HNB A;  1THO A;  3D4T A;  2FNO A;  2VUP A;  3WGX A;  1K3L A;  4V1A g;  2N5B A;  3GUR A;  19GS A;  1MDI A;  3WGD A;  3FZ9 A;  3QR6 A;  3QFA C;  3H93 A;  2C3T A;  1SU9 A;  2VLV A;  3DRN A;  5CRG A;  5IMZ A;  1VF4 A;  2K8V A;  2PUK C;  3FHK A;  3PGT A;  4MLY A;  3W8S A;  2YV7 A;  1MDK A;  3WT2 A;  3F6F A;  4BPY A;  2H1D A;  1SYR A;  1YY7 A;  3CTF A;  1XOB A;  4KE3 A;  2HZE A;  1B8X A;  1WPI A;  4Q5R A;  1YF0 A;  5ID2 A;  1BJX A;  4IBP A;  1U88 A;  2C0G A;  3IAM 2;  4AJ8 A;  2AHE A;  3P7X A;  1ZMA A;  3C1S A;  1TRS A;  2C3N A;  4MA9 A;  1V40 A;  4F0B A;  4I97 A;  3CMI A;  1OKT A;  3G7J A;  3RHC A;  1WOU A;  3A2X A;  1DUG A;  2WDU A;  3LXZ A;  5IIZ A;  1QK8 A;  4TOP A;  1OVN A;  3ED3 A;  1B4P A;  1YDK A;  4YAP A;  3QDN A;  5J9C A;  3LFL A;  3UMA A;  4K0G A;  1PMT A;  5D73 A;  4PNG A;  2EIR A;  2R5G A;  2LRC A;  4KW6 A;  5KN1 A;  1J9B A;  2LQO A;  3J7Y b;  1XWK A;  1EWX A;  1TW9 A;  3GH9 A;  1OKD A;  1BQ7 A;  2JU5 A;  2NBS A;  5F0G A;  1X9M B;  2HRN A;  4FYB A;  5DAL B;  2F8A A;  3GTU B;  2FWH A;  1GSD A;  4PX1 A;  5IPG A;  1FB6 A;  3WD6 A;  1ZYE A;  2L6C A;  1VF1 A;  1G7E A;  4CDO A;  4XTS A;  6GSU A;  5AN1 A;  1U3A A;  1T1V A;  2XPD A;  1OC9 B;  4BWS A;  1J08 A;  4LA1 A;  2AB6 A;  2FUG 2;  2FLS A;  2K8S A;  1SD9 A;  2H66 A;  5D8I A;  2NDO A;  3ZIJ A;  3FYG A;  3VWV A;  2P5Q A;  3A3T A;  1SL2 B;  3BJ5 A;  3G7Y A;  4K7N A;  3TJF A;  1GTB A;  1R26 A;  4ACS A;  2YWI A;  1JLV A;  2QSI A;  2IPA A;  3UAR A;  2I9H A;  4EUY A;  4XHM A;  5ECK B;  1YZX A;  1XWB A;  1LJR A;  4PGT A;  1SD8 A;  2BJX A;  2HSY A;  2MYG A;  3HZ4 A;  1R7H A;  2I81 A;  1B48 A;  2C80 A;  2AYT A;  2VCX A;  2VOC A;  4TR1 A;  1EEM A;  5G1K A;  1XVQ A;  5L71 A;  2LNS A;  3QD9 A;  2VO4 A;  3CYN A;  1TK0 B;  4F03 A;  1XW5 A;  4DEJ A;  4EO3 A;  4OCE A;  5ECO B;  2WGR A;  1OC9 A;  1A0R P;  2REM A;  4PQ1 A;  5DQS A;  4TR3 A;  4IGJ A;  5DJM A;  3TRP A;  3UBL A;  3BCK A;  2H74 A;  1ILO A;  4WET A;  3US3 A;  1TRV A;  2IIY A;  5DCH A;  4H86 A;  5ECI B;  3TUE A;  3ZTL A;  3FEU A;  1M99 A;  2HZF A;  5EPF A;  4KDU A;  2YWM A;  2MMA A;  1WE0 A;  4WF5 A;  4MPF A;  1Z7P A;  1HD2 A;  1QUW A;  4O92 A;  4RQX A;  3ZIT A;  2CX3 A;  2VD0 A;  3GX0 A;  1NW2 A;  1AAZ A;  12GS A;  3FR3 A;  1R5P A;  1FVK A;  4GWR A;  4GXZ A;  3KMN A;  3TRQ A;  3PR8 A;  5CRH A;  4K2D A;  2GQL A;  3MDK A;  4L8E A;  4BA7 A;  2MMZ A;  4Q5F A;  5EL8 A;  5ECN B;  2FD3 A;  2X8G A;  4RI6 A;  4L5O A;  4FIW A;  1RW1 A;  3E9J B;  4ZL8 A;  3ZLP A;  1M9A A;  2JZS A;  4OFN A;  5F07 A;  1AXD A;  1M7T A;  1TRU A;  3CTG A;  2L5O A;  5JCG A;  5J4U A;  3CSI A;  4OO5 A;  2VL9 A;  3UVH A;  5D96 A;  2B1L A;  3CBU A;  1T8E B;  2CX4 A;  4MMM A;  1W4V A;  3TKS E;  3F4S A;  3F3R A;  1SYX A;  2L4Q A;  3HHV A;  5B6M A;  1SK2 A;  2DMM A;  3KD0 A;  4EC0 A;  2OBK A;  2LUS A;  2GT5 A;  2K6V A;  2YWO A;  5IMF A;  3L9U A;  3LYK A;  1MD4 A;  3O76 A;  1H75 A;  5G1L A;  2H0G A;  4P3Y B;  3E0U A;  3C8E A;  1URM A;  4IS0 A;  2H76 A;  3H79 A;  3RAZ A;  3KGK A;  4HZ2 A;  4PXO A;  5FT3 A;  2I1U A;  4KB3 A;  2VCT A;  3ME7 A;  4ZBA A;  1EGR A;  3DWV A;  3MWH A;  2P0G A;  2PWJ A;  2GSQ A;  1S3C A;  2KUC A;  4HQS A;  1O6J A;  3LJR A;  5CAX A;  3LG6 A;  3GKK A;  2IFQ B;  2H6Y A;  6GSS A;  4D73 B;  4EDY A;  1F9M A;  1UVZ A;  4NAX A;  1TOF A;  1FOV A;  1A23 A;  5J41 A;  4PUA A;  5CYY A;  1XVW A;  4XRD A;  2NVL A;  4POK A;  4POB A;  3DIE A;  3TKQ A;  4L0W A;  2CVK A;  4LMV A;  3UJ1 A;  1O81 A;  5G2Z A;  3N9J A;  1T00 A;  1TTZ A;  2K9F A;  3W8J A;  1GTU A;  3VLN A;  4IJI A;  1GH2 A;  4L0U A;  5IMA A;  4YQV A;  4NV5 A;  3QAW A;  3GKM A;  2LJR A;  16GS A;  2C0F A;  3D5J A;  2E2M A;  2L5L A;  3DML A;  2H75 A;  1WJK A;  4KDX A;  1KEB A;  4KCA A;  4XS4 B;  4RUV A;  4LMW A;  4G19 A;  2AAW A;  3D22 A;  4ISD A;  18GS A;  3I9V 2;  1SEN A;  1JHB A;  1XWA A;  1GNE A;  3GKN A;  3TKS C;  4OFM A;  2V6K A;  2BTO T;  1JFU A;  6GST A;  2H71 A;  4D73 A;  1BX9 A;  3GSS A;  3WT1 A;  3DGQ A;  5KEJ A;  2PVQ A;  1EOG A;  4V2M A;  1ERW A;  1GSQ A;  3RDW A;  3M9J A;  3GYK A;  1UN2 A;  4HI7 A;  3HKR A;  1WMJ A;  3TJK A;  1BED A;  4O32 A;  5DJL A;  2VAF A;  3EC3 A;  1F37 A;  5ENU A;  4MF5 A;  1ML6 A;  3CSH A;  2IMI A;  4ZBD A;  1SKS B;  4XS4 A;  1GUH A;  4QL9 A;  5A4V A;  2DJJ A;  4MJA A;  1M0U A;  4Q5Q A;  3TRX A;  2C0D A;  3FW2 A;  1YKA A;  2B5X A;  2J23 A;  3F6D A;  1A8Y A;  3CSJ A;  1YQ1 A;  1G7O A;  1UA5 A;  1QGV A;  4O7H A;  4TVE A;  1NM3 A;  2E7P A;  1AQW A;  1OE7 A;  2JSZ A;  4OCF A;  3F4R A;  2WJU A;  3HA9 A;  4QQ7 A;  1JZR A;  4KND A;  4TW5 A;  1FW1 A;  5IMD A;  2H73 A;  2HZE B;  1KBN A;  3HZ8 A;  1ZGN A;  2CVB A;  1VGL A;  5ID2 B;  3IXR A;  1HQO A;  2K18 A;  1U3I A;  4MJB A;  5DAK A;  3FZ4 A;  3C71 A;  2NPB A;  3P2A A;  3CXG A;  1M9B A;  1Y6E A;  4MZC A;  2WB9 A;  1GNW A;  2YP6 A;  3ZFB A;  1TRW A;  4HJM A;  4ZB6 A;  20GS A;  1WP0 A;  4J2F A;  4IVF A;  1GL8 A;  2YJH A;  1GRX A;  1VF3 A;  1M2A A;  3CRU A;  3KIJ A;  1A8L A;  3IDV A;  2I3Y A;  5COH A;  4O5R A;  2GZZ A;  3EE2 A;  4GSN A;  3C1R A;  2YAN A;  2FGX A;  2JL4 A;  1X9W B;  4GLT A;  4KX4 A;  2J9H A;  2GTU A;  1Z5Y E;  5A4W A;  3ZRE A;  4Q5N A;  2F9S A;  4TR4 A;  4ZIJ A;  1PQN A;  3QAG A;  2X64 A;  3M3M A;  1EZK A;  2QGV A;  4X43 A;  2H0H A;  1X5C A;  1S3A A;  3HDC A;  2HSH A;  5ELG A;  4IKH A;  3ERF A;  5DVB A;  2LV3 A;  2YZU A;  2DJ2 A;  4RI7 A;  1A2J A;  1PKW A;  3EYT A;  2O7K A;  3W6G A;  1GUK A;  3ZYW A;  1ZOF A;  2RM6 A;  3Q74 A;  1AUC A;  4KCE A;  2LS5 A;  1SK0 A;  5A5K A;  6GSW A;  4J57 E;  1J0F A;  3GX8 A;  4NWY A;  4K7O A;  4ZB8 A;  4JR6 A;  5G30 A;  2F51 A;  2JZR A;  2CVD A;  1TI1 A;  4IW9 A;  2AUV A;  4MPG A;  2CZ2 A;  4IQ1 A;  2AV4 A;  1EP8 A;  4AJ7 A;  2PMT A;  1XZO A;  3GIX A;  5B6N A;  3A2W A;  2QC7 A;  2R4V A;  2GVP A;  3NOF A;  4F0C A;  3IOS A;  2FWE A;  4IHU A;  2GZY A;  2VL2 A;  1TK8 B;  2H72 A;  1H4O A;  1R4W A;  3M1G A;  4TR1 B;  4KH7 A;  2L6D A;  2B1K A;  3KMO A;  3EVI A;  4K0N A;  1GP1 A;  2CA8 A;  2VIM A;  2LQQ A;  3UBK A;  1BAY A;  1T3B A;  1SL0 B;  1EOH A;  4IQA A;  2VCZ A;  1AC1 A;  3F8U A;  1SJI A;  4G10 A;  4AGS A;  2LJK A;  4YAV A;  5GST A;  4CW9 A;  2KP2 A;  4V2L A;  2M80 A;  4GST A;  4MK3 A;  4NMU A;  3LEF A;  2H1G A;  1PX6 A;  5JCW A;  3LXT A;  4MP4 A;  3RPN A;  4V2N A;  3EMX A;  1F6M C;  1VRS D;  4GSS A;  4N10 A;  4N0Z A;  3GMF A;  1WRY A;  1TJD A;  5GAP D;  2YJ7 A;  2C1Y A;  2H6Z A;  2O8V B;  2IN3 A;  3UEM A;  1BG5 A;  2X8H A;  3BOA A;  1XCC A;  3GN3 A;  3HCZ A;  1V2A A;  2VCQ A;  1TXX A;  1Z9H A;  4XCS A;  1K3O A;  1K0B A;  4ULX A;  1K0M A;  2YCD A;  3WGE A;  1G0T A;  4BVX A;  4HS1 A;  2RUF A;  3UOM A;  2LNT A;  5KN0 A;  1SKR B;  1ABA A;  3QAV A;  1AW9 A;  2H8L A;  2V41 A;  5E59 A;  3EU3 A;  1MTC A;  2B5Y A;  3TKP A;  2RII A;  5KN2 A;  2PPT A;  2C4J A;  3LSZ A;  2FWF A;  1YEX A;  2H0I A;  2HFD A;  2KHP A;  4MJC A;  5ECR B;  3EWL A;  2YN1 A;  3NZN A;  3IV4 A;  5JWQ B;  2C3Q A;  2X8C A;  4MZW A;  4LL4 B;  1SL1 B;  1O73 A;  1CQG A;  4TN8 A;  1A2L A;  2DBC A;  5DQY A;  1XIY A;  4KGI A;  3WYW A;  2A4V A;  1CQH A;  1OC3 A;  3HVV A;  3JCM L;  1F2E A;  4LL1 B;  1NSW A;  1SJZ A;  4IP1 A;  1IYI A;  5E4W A;  1JLW A;  4K6X A;  1KNG A;  4TKY A;  3HJO A;  4OWY A;  2VLU A;  2B3S A;  2H01 A;  2OE3 A;  3TCO A;  5CRW A;  1ZL9 A;  2WS2 A;  4POM A;  2DJK A;  2VD1 A;  4CHS A;  2D2Z A;  4GRF A;  3IPZ A;  2DML A;  3HYP A;  1X9S B;  3IRA A;  1Z3E A;  5IPH A;  3TDG A;  1RQM A;  1AQV A;  3I43 A;  3FR6 A;  5J9B A;  2F8F A;  6GSY A;  1TU7 A;  2LEG A;  4KDY A;  1DBY A;  3GHA A;  1QFN A;  2ON7 A;  4GF0 A;  2M46 A;  1Z7R A;  3DVX A;  1FG4 A;  1XBS A;  2HT9 A;  2BMX A;  2YNX A;  4OD7 A;  3KH7 A;  6GSV A;  4MF6 A;  3FK8 A;  1K0C A;  5LNK e;  3APO A;  1FAA A;  2PVO C;  3HVX A;  1GUM A;  4WEY A;  1B4Q A;  2RM5 A;  2O89 A;  2CAI A;  2GQK A;  3HJP A;  3L9V A;  1QXH A;  2O85 A;  3GRX A;  4PUR A;  2XPE A;  2FA4 A;  3AY8 A;  3D0Z A;  2H19 A;  4N30 A;  3UL3 A;  4HU9 A;  3TJG A;  1O85 A;  3VFI A;  1V57 A;  4IN0 A;  1PRX A;  2HI7 A;  3H8Q A;  3L0H A;  5IMC A;  2GGT A;  2ZUP A;  3GUS A;  4Z7X A;  5ECP B;  4GTU A;  3MNG A;  3M9K A;  2OE1 A;  4RQR A;  4DSS A;  1GLQ A;  4LLR A;  1M2D A;  5ELA A;  4EE0 A;  3KJY A;  2IMF A;  3LGC A;  2YZH A;  3DKS A;  4HQZ A;  1EV9 A;  5HR3 A;  2VCV A;  3IBH A;  3ZVJ A;  3HJM A;  4BWQ A;  1VF2 A;  5DBQ A;  3VK9 A;  5LD0 A;  4KA0 A;  3QFB C;  1F3A A;  3S9F A;  3M8N A;  2L4C A;  3PH9 A;  3M0F A;  1WWJ A;  4X1U A;  3BD2 A;  1JZO A;  5CP1 A;  3VUR A;  5IOX A;  1A2M A;  2H70 A;  1F3B A;  5IO0 A;  2OA7 A;  2WUL A;  5IM9 A;  3ERW A;  3KM6 A;  10GS A;  4PNF A;  1XFL A;  4GQF A;  4PUF C;  2A2R A;  4ZB9 A;  2MBS A;  3KTL A;  1YKC A;  5AIX A;  3SBC A;  1ERV A;  4PQH A;  2P31 A;  5H5R A;  1GSY A;  1LBK A;  5DAK B;  1XPV A;  2IMK A;  1THX A;  1M2B A;  4GCI A;  4X0X A;  2R6K A;  1YEP A;  4OMV A;  4WF4 A;  5HR1 A;  1KTE A;  2GS3 A;  4HEA 2;  2OAD A;  4WXT A;  4F82 A;  3L9S A;  3VWW A;  4WBR D;  3KP8 A;  3ZML A;  2HLS A;  3GH6 A;  2IJY A;  2GLR A;  4JBB A;  3HXS A;  1B9Y C;  1HYU A;  3LYP A;  3DEX A;  2C8U A;  1V9W A;  2MZC A;  3FY7 A;  4YQM A;  2QKE A;  5C04 A;  11GS A;  4HOJ A;  1BYE A;  3MSZ A;  3ZMK A;  3GNJ A;  3C7M A;  5CRD A;  1XWC A;  2R2J A;  4WR4 A;  5C00 A;  1A24 A;  22GS A;  3R2Q A;  3IHQ A;  5AIS A;  5G31 A;  4KAE A;  1JZW A;  2DIZ A;  4HJ2 A;  1JZD A;  5FWG A;  3D21 A;  3ME8 A;  4XS1 A;  1R5A A;  2WCI A;  1Q4J A;  2LRT A;  4V1A p;  3EMP A;  3L4N A;  4DVC A;  3J7Y k;  1PSQ A;  1I9D A;  5HQP A;  1K0O A;  2VCW A;  1SJ6 A;  5G5F A;  3GL5 A;  4K7I A;  4N0V A;  3KTB A;  4NHZ A;  2F3M A;  1X5D A;  4TRX A;  3EU4 A;  1A0F A;  2XHF A;  7GSS A;  2FCH A;  2GSR A;  4FO5 A;  2TRC P;  4TR0 A;  3RBT A;  1MD3 A;  3KH9 A;  3FZA A;  3QCP A;  1ON4 A;  3ZRD A;  3GA4 A;  3IE3 A;  3D4M A;  3CRT A;  3PIN A;  4ECB A;  5DCG A;  1Y25 A;  4F9Z A;  4TXV A;  3VPT A;  4JE1 A;  3Q6O A;  4TXO A;  3DD3 A;  5B8A A;  2ZNM A;  3FZ5 A;  4AJ6 A;  4EF0 A;  2DC5 A;  1ZCP A;  2OJL A;  2G2Q A;  2VL3 A;  5D9T A;  1V98 A;  2L57 A;  2X99 A;  4GQC A;  5A4U A;  8GSS A;  2OE0 A;  2XBQ A;  3Q19 A;  5JCU A;  3APS A;  3ZFL A;  1N2A A;  5ABR A;  1O7U A;  2H30 A;  2LTK A;  3GL3 A;  1X5E A;  1S3D A;  1EEJ A;  1NHO A;  2DIY A;  5B7C A;  5JWR B;  2KLX A;  2GDR A;  2LST A;  1K0D A;  2CT6 A;  1GSF A;  4K9Z A;  3F0I A;  1GTA A;  1XW6 A;  4ECC A;  2NTO A;  2GQM A;  5JWO B;  3QMX A;  4ZL9 A;  1GTI A;  2ES7 A;  4ILF A;  2GT6 A;  4E8H A;  4J56 E;  4FH8 A;  5HR0 A;  3P8W A;  2YWN A;  3FKF A;  1TKD B;  1ZYQ B;  1U6T A;  1OYJ A;  3GST A;  3LWA A;  4I8B A;  3H1N A;  3SWL A;  1I5G A;  1ERU A;  4ID0 A;  2JAC A;  4I6X A;  3KZQ A;  1WIK A;  1MEK A;  3NIV A;  5GSS A;  5GZZ B;  1PL2 A;  9GSS A;  5J3R A;  3HVS A;  1DE1 A;  4E8E A;  3DXB A;  4PQI A;  1TI3 A;  5H5S A;  3C73 A;  1XOA A;  2R37 A;  3LOR A;  4NV2 A;  3H4K A;  2EIO A;  5F06 A;  3U6V A;  5INY A;  5IOW A;  4BVY A;  1ACV A;  4KSO A;  5LCZ A;  2GSS A;  1O8X A;  3KEB A;  2XBI A;  4HDE A;  1Q98 A;  1G6W A;  2MMO A;  5DAL A;  4MZB A;  3F3Q A;  4NPB A;  2MBT A;  3EIN A;  3GTU A;  3IR4 A;  3FR9 A;  1DE2 A;  2XC2 A;  4MJE A;  2IL3 A;  3BBY A;  4ML1 A;  4WKW A;  5D9X A;  1QMV A;  5HR2 A;  1UC7 A;  2IME A;  4YH2 A;  2I4A A;  5IMV A;  1TK5 B;  5AGY A;  2VL2 C;  1E6B A;  3KXO A;  4IP6 A;  2N5F A;  3G9B A;  5ECH B;  1PX7 A;  1T4Y A;  1PGT A;  5D93 A;  1NHY A;  2CQ9 A;  1T4Z A;  1W89 A;  2GZP A;  1V58 A;  2DJ1 A;  2FA8 A;  3KCM A;  4QL7 A;  2E2G A;  3P90 A;  4KSM A;  1ST9 A;  1AQX A;  5G5E A;  4YQU A;  3UAP A;  4ECI A;  3QPM A;  3A5W A;  3V1W A;  3TB2 A;  5CO3 A;  1SKW B;  3IAS 2;  1IYH A;  2AJQ B;  2B7K A;  1HNA A;  4N11 A;  2V1M A;  1FVJ A;  1Z6M A;  4JED A;  5ECS A;  3LQ7 A;  3N5O A;  4JRR A;  2V6O A;  1K3Y A;  3HD5 A;  1PA3 A;  3G7I A;  2C0E A;  1ERT A;  4FYU A;  4AF2 A;  3ZIV A;  1K0A A;  3VI5 A;  4I2U A;  2OKA A;  4IEL A;  4MCU A;  1RK4 A;  2PU9 C;  2YOI A;  4MF7 A;  1YJ6 A;  4HU7 A;  3UVT A;  3GV1 A;  5B8B A;  1X0R A;  4BL7 A;  4G2E A;  3ERG A;  2WZ9 A;  4XS6 A;  2CZ3 A;  1AIU A;  2HRF A;  1T7P B;  2PGT A;  3RHB A;  2A2S A;  1TP9 A;  2H1B A;  4DSS B;  5ECQ B;  2CV4 A;  1EV4 A;  2YV9 A;  3GKX A;  4HZ4 A;  2LJA A;  1DSB A;  3TKS A;  4ZL7 A;  2N5A A;  2WRT A;  1E2Y A;  2B5E A;  4ECJ A;  4DSQ A;  4OFT A;  5GAN D;  1OAZ A;  4NXI A;  3F9U A;  4KUN A;  4ML6 A;  3GFK A;  1GSU A;  2B7J A;  13GS A;  1B9X C;  3IK7 A;  1LU4 A;  2JAD A;  1O8W A;  3UIW A;  1FB0 A;  3EUR A;  1XWG A;  3BCI A;  2EC4 A;  4L5L A;  1ZZY A;  4JU5 A;  1K0N A;  2E0Q A;  3TOT A;  2PN8 A;  3IA1 A;  4K8M A;  4XIH A;  3L78 A;  1MDJ A;  4NHW A;  5IQY A;  3IK9 A;  2WFC A;  3VPQ A;  2GST A;  1XXU A;  1OC8 A;  4MDC A;  2YPM A;  4POL A;  2VM1 A;  2DJ3 A;  3DYR A;  5F05 A;  2FHE A;  2OBI A;  2ON5 A;  3VWX A;  4MAB A;  5H5Q A;  1FO5 A;  1GWC A;  5AIV A;  3ZVJ D;  3FRC A;  2M72 A;  1TDI A;  3APQ A;  4FYC A;  2EIQ A;  3HY2 A;  4ZBB A;  3DVW A;  4F2I A;  1FHE A;  2CAQ A;  1EP7 A;  2DSA A;  3TOU A;  2VM2 A;  1PN9 A;  2V32 A;  3I69 A;  2R3X A;  4EXJ A;  5J5N A;  2O87 A;  4XRA A;  3U5R E;  1QQ2 A;  3A2V A;  3K8N A;  5CNW A;  3VI7 A;  4MH2 A;  2HE3 A;  2TRX A;  1YF1 A;  3TJB A;  3O3T A;  2H6X A;  5CRE A;  2V2G A;  1GSS A;  2FY6 A;  2IMD A;  3IC4 A;  1C72 A;  5ECL B;  4HUA A;  2H1A A;  2IFQ A;  5D9W A;  2RLI A;  4IJ3 A;  5ECM B;  5KN3 A;  4WR5 A;  2LRN A;  4OO4 A;  2PBJ A;  1OE8 A;  5DDL A;  1N8J A;  5HFG A;  5HFI A;  2B6M A;  4MH3 A;  5FHI A;  14GS A;  1SK1 A;  2JSY A;  3I6A A;  3TKR A;  2FWG A;  4ZIL A;  4DSR A;  4JZQ A;  3ZL5 A;  2PER A;  3KP9 A;  1G6Y A;  2MMN A;  3OR5 A;  3TGZ A;  2VLT A;  1U87 A;  2P5R A;  1GSE A;  3MAK A;  4ZXG A;  3ISO A;  2TIR A;  2RUE A;  1HNC A;  3F4T A;  4EVM A;  2JZT A;  4K1F A;  5D9V A;  5F8B A;  5HFK A;  2HNL A;  3F63 A;  3VWU A;  4I2T A;  2LKU A;  2DJ0 A;  1XW9 A;  3D6I A;  3O6T A;  2ZCT A; 
#chains in the Genus database with same CATH topology
 4EKZ A;  1TU8 A;  1GUL A;  1Z6N A;  5EY6 A;  2G0F A;  4KF9 A;  1EGO A;  2DLX A;  1PD2 1;  5EVO A;  2KP1 A;  3E3E A;  4WBJ A;  2KOK A;  1PKZ A;  3TJJ A;  4I5Q A;  2ALB A;  2L59 A;  1USB A;  2HRA A;  2HXK A;  1GLP A;  3RPP A;  5IO2 A;  2OAC A;  3Q18 A;  4EDZ A;  17GS A;  2HYX A;  4TXO B;  2IWT A;  6GSX A;  1PL1 A;  4EL1 A;  2Z9S A;  3ZZX A;  3QOU A;  4G9H A;  4JR4 A;  1HNB A;  1THO A;  3D4T A;  2FNO A;  2VUP A;  3WGX A;  1K3L A;  4V1A g;  2N5B A;  3GUR A;  19GS A;  1MDI A;  3WGD A;  3FZ9 A;  3QR6 A;  3QFA C;  3H93 A;  2C3T A;  1SU9 A;  2VLV A;  3DRN A;  5CRG A;  5IMZ A;  1VF4 A;  2K8V A;  2PUK C;  3FHK A;  3PGT A;  4MLY A;  3W8S A;  2YV7 A;  1MDK A;  3WT2 A;  3F6F A;  4BPY A;  2H1D A;  1SYR A;  1YY7 A;  3CTF A;  1XOB A;  4KE3 A;  1FOH A;  2HZE A;  1B8X A;  1WPI A;  4Q5R A;  1YF0 A;  5ID2 A;  1BJX A;  4IBP A;  1U88 A;  2C0G A;  3IAM 2;  4AJ8 A;  2AHE A;  3P7X A;  1ZMA A;  3C1S A;  1TRS A;  2C3N A;  4MA9 A;  1V40 A;  4F0B A;  4I97 A;  3CMI A;  1OKT A;  3G7J A;  3RHC A;  1WOU A;  3A2X A;  1DUG A;  2WDU A;  3LXZ A;  5IIZ A;  1QK8 A;  4TOP A;  1OVN A;  3ED3 A;  1B4P A;  1YDK A;  4YAP A;  3QDN A;  5J9C A;  3LFL A;  3UMA A;  4K0G A;  1PMT A;  5D73 A;  4PNG A;  2EIR A;  3PPU A;  2R5G A;  2LRC A;  4KW6 A;  5KN1 A;  1J9B A;  2LQO A;  3J7Y b;  1XWK A;  4YKG A;  1EWX A;  1TW9 A;  3GH9 A;  1OKD A;  1BQ7 A;  2JU5 A;  2NBS A;  5F0G A;  1X9M B;  2HRN A;  4FYB A;  5DAL B;  2F8A A;  3GTU B;  2FWH A;  1GSD A;  4PX1 A;  5IPG A;  1FB6 A;  3WD6 A;  1ZYE A;  2L6C A;  1VF1 A;  1G7E A;  4CDO A;  4XTS A;  6GSU A;  5AN1 A;  1U3A A;  1T1V A;  2XPD A;  1OC9 B;  4BWS A;  1J08 A;  4LA1 A;  2AB6 A;  2FUG 2;  2FLS A;  2K8S A;  1SD9 A;  2H66 A;  5D8I A;  2NDO A;  3ZIJ A;  3FYG A;  3VWV A;  2P5Q A;  3A3T A;  1SL2 B;  3BJ5 A;  3G7Y A;  4K7N A;  3TJF A;  1GTB A;  1R26 A;  2A4H A;  4ACS A;  2YWI A;  1JLV A;  2QSI A;  2IPA A;  3UAR A;  2I9H A;  4EUY A;  4XHM A;  5ECK B;  1YZX A;  1XWB A;  1LJR A;  4PGT A;  1SD8 A;  2BJX A;  2HSY A;  2MYG A;  3HZ4 A;  1R7H A;  2I81 A;  1B48 A;  2C80 A;  2AYT A;  2VCX A;  2VOC A;  4TR1 A;  1EEM A;  5G1K A;  1XVQ A;  5L71 A;  2LNS A;  3QD9 A;  2VO4 A;  3CYN A;  1TK0 B;  4F03 A;  1XW5 A;  4DEJ A;  4EO3 A;  2HRK A;  4OCE A;  5ECO B;  2WGR A;  4BL7 B;  1OC9 A;  1A0R P;  2REM A;  4PQ1 A;  5DQS A;  4TR3 A;  4IGJ A;  5DJM A;  3TRP A;  3UBL A;  3BCK A;  2H74 A;  1ILO A;  4WET A;  3US3 A;  1TRV A;  2IIY A;  5DCH A;  4H86 A;  5ECI B;  3TUE A;  3ZTL A;  3FEU A;  1M99 A;  2HZF A;  5EPF A;  4KDU A;  2YWM A;  1XG8 A;  2MMA A;  2R0G A;  1WE0 A;  4WF5 A;  4MPF A;  1Z7P A;  1HD2 A;  1QUW A;  4O92 A;  4RQX A;  3ZIT A;  2CX3 A;  2VD0 A;  3GX0 A;  1NW2 A;  1AAZ A;  12GS A;  3FR3 A;  1R5P A;  1FVK A;  4GWR A;  4GXZ A;  3KMN A;  3TRQ A;  3PR8 A;  5CRH A;  4K2D A;  2GQL A;  3MDK A;  4L8E A;  4BA7 A;  2MMZ A;  4Q5F A;  5EL8 A;  5ECN B;  2FD3 A;  2X8G A;  4A5P A;  4RI6 A;  4L5O A;  4FIW A;  1RW1 A;  3E9J B;  4ZL8 A;  3ZLP A;  1M9A A;  2JZS A;  4OFN A;  5F07 A;  1AXD A;  1M7T A;  1TRU A;  3CTG A;  2L5O A;  5JCG A;  5J4U A;  3CSI A;  4OO5 A;  2VL9 A;  3UVH A;  5D96 A;  2B1L A;  3CBU A;  1T8E B;  2CX4 A;  4MMM A;  1W4V A;  3TKS E;  3F4S A;  3F3R A;  1SYX A;  2L4Q A;  3HHV A;  5B6M A;  1SK2 A;  2DMM A;  3KD0 A;  4EC0 A;  2OBK A;  2LUS A;  2GT5 A;  2K6V A;  2YWO A;  5IMF A;  3L9U A;  3LYK A;  2A2P A;  1MD4 A;  2QA1 A;  3O76 A;  1H75 A;  5G1L A;  2H0G A;  4P3Y B;  3E0U A;  4O5Q A;  3C8E A;  1URM A;  4IS0 A;  2H76 A;  3H79 A;  3RAZ A;  3KGK A;  4HZ2 A;  4PXO A;  5FT3 A;  2I1U A;  4KB3 A;  2VCT A;  3ME7 A;  4ZBA A;  1EGR A;  3DWV A;  3MWH A;  2P0G A;  2PWJ A;  2GSQ A;  1S3C A;  2KUC A;  4HQS A;  1O6J A;  3LJR A;  5CAX A;  3LG6 A;  3GKK A;  2IFQ B;  2H6Y A;  6GSS A;  4D73 B;  4EDY A;  1F9M A;  2DKH A;  1UVZ A;  4NAX A;  1TOF A;  1FOV A;  1A23 A;  5J41 A;  4PUA A;  5CYY A;  1XVW A;  4XRD A;  2NVL A;  4POK A;  4POB A;  3DIE A;  3TKQ A;  4L0W A;  2CVK A;  4LMV A;  3UJ1 A;  1O81 A;  5G2Z A;  3N9J A;  1T00 A;  1TTZ A;  2K9F A;  3W8J A;  1GTU A;  3VLN A;  4IJI A;  1GH2 A;  4L0U A;  5IMA A;  4YQV A;  4NV5 A;  3QAW A;  3GKM A;  2LJR A;  16GS A;  2C0F A;  3D5J A;  2E2M A;  2L5L A;  3DML A;  2H75 A;  1WJK A;  4KDX A;  1KEB A;  4KCA A;  4XS4 B;  4RUV A;  4LMW A;  3FMW A;  4G19 A;  2AAW A;  3D22 A;  4ISD A;  18GS A;  3I9V 2;  1SEN A;  1JHB A;  1XWA A;  1GNE A;  3GKN A;  3TKS C;  4OFM A;  2V6K A;  4Z2U A;  2BTO T;  1JFU A;  6GST A;  2H71 A;  4D73 A;  5BMU A;  1BX9 A;  3GSS A;  3WT1 A;  3DGQ A;  5KEJ A;  2PVQ A;  1EOG A;  4V2M A;  5KOX A;  1ERW A;  1GSQ A;  3RDW A;  3M9J A;  3GYK A;  1UN2 A;  4HI7 A;  3HKR A;  1WMJ A;  3TJK A;  1BED A;  4O32 A;  5DJL A;  2VAF A;  3EC3 A;  1F37 A;  5ENU A;  4MF5 A;  1ML6 A;  3CSH A;  2IMI A;  4ZBD A;  1SKS B;  4XS4 A;  1GUH A;  4QL9 A;  5A4V A;  2DJJ A;  4MJA A;  1M0U A;  4Q5Q A;  3TRX A;  2C0D A;  3FW2 A;  1YKA A;  2B5X A;  2J23 A;  3F6D A;  1A8Y A;  3CSJ A;  1YQ1 A;  1G7O A;  1UA5 A;  1QGV A;  4O7H A;  4TVE A;  1NM3 A;  2E7P A;  1AQW A;  1OE7 A;  2JSZ A;  4OCF A;  3F4R A;  2WJU A;  3HA9 A;  4QQ7 A;  1JZR A;  4KND A;  4TW5 A;  1FW1 A;  5IMD A;  2H73 A;  2HZE B;  1KBN A;  3HZ8 A;  4MNN A;  1ZGN A;  2CVB A;  1VGL A;  5ID2 B;  3IXR A;  1HQO A;  2K18 A;  1ZYP A;  1U3I A;  4MJB A;  4YKF A;  5DAK A;  3FZ4 A;  3C71 A;  2NPB A;  3P2A A;  3CXG A;  1M9B A;  1Y6E A;  4MZC A;  2WB9 A;  1GNW A;  2YP6 A;  3ZFB A;  1TRW A;  4HJM A;  4ZB6 A;  20GS A;  1WP0 A;  4J2F A;  4IVF A;  1GL8 A;  2YJH A;  1GRX A;  1VF3 A;  1M2A A;  4K2X A;  3CRU A;  3KIJ A;  2DKI A;  1A8L A;  3IDV A;  2I3Y A;  5COH A;  4O5R A;  2GZZ A;  3EE2 A;  4GSN A;  3C1R A;  2YAN A;  2FGX A;  2JL4 A;  1X9W B;  4GLT A;  4KX4 A;  2J9H A;  2GTU A;  1Z5Y E;  5A4W A;  3ZRE A;  4Q5N A;  2F9S A;  4TR4 A;  4ZIJ A;  1PQN A;  3QAG A;  2X64 A;  3M3M A;  1EZK A;  2QGV A;  4X43 A;  2H0H A;  1X5C A;  1S3A A;  3HDC A;  2HSH A;  5ELG A;  4IKH A;  3ERF A;  5DVB A;  2LV3 A;  2YZU A;  2DJ2 A;  4RI7 A;  1A2J A;  1PKW A;  3EYT A;  2O7K A;  3W6G A;  4EIP A;  1GUK A;  3ZYW A;  1ZOF A;  2RM6 A;  3Q74 A;  1AUC A;  4KCE A;  2LS5 A;  1SK0 A;  5A5K A;  6GSW A;  4J57 E;  1J0F A;  3GX8 A;  4NWY A;  4K7O A;  4ZB8 A;  4JR6 A;  5G30 A;  2F51 A;  2JZR A;  2CVD A;  1TI1 A;  4IW9 A;  2AUV A;  4MPG A;  2CZ2 A;  4IQ1 A;  2AV4 A;  1EP8 A;  4AJ7 A;  2PMT A;  1XZO A;  3GIX A;  5B6N A;  3A2W A;  2QC7 A;  2R4V A;  2GVP A;  3NOF A;  4F0C A;  3IOS A;  2FWE A;  4IHU A;  2GZY A;  3A5I A;  2VL2 A;  1TK8 B;  2H72 A;  1H4O A;  1R4W A;  3M1G A;  4TR1 B;  4KH7 A;  2L6D A;  2B1K A;  3KMO A;  3EVI A;  4K0N A;  1GP1 A;  2CA8 A;  2VIM A;  2LQQ A;  3UBK A;  1BAY A;  1T3B A;  1SL0 B;  1EOH A;  4IQA A;  2VCZ A;  1AC1 A;  3F8U A;  1SJI A;  4G10 A;  4AGS A;  2LJK A;  4YAV A;  5GST A;  4CW9 A;  2KP2 A;  4V2L A;  2M80 A;  3MIX A;  4GST A;  4MK3 A;  4NMU A;  3LEF A;  2H1G A;  1PX6 A;  5JCW A;  3LXT A;  4MP4 A;  3RPN A;  4V2N A;  3EMX A;  1F6M C;  1VRS D;  4GSS A;  4N10 A;  4N0Z A;  3GMF A;  1WRY A;  1TJD A;  5GAP D;  2YJ7 A;  2C1Y A;  2H6Z A;  2O8V B;  2IN3 A;  3UEM A;  1BG5 A;  2X8H A;  3BOA A;  1XCC A;  3GN3 A;  3HCZ A;  1V2A A;  2VCQ A;  1TXX A;  1Z9H A;  4XCS A;  1K3O A;  1K0B A;  4ULX A;  1K0M A;  2YCD A;  3WGE A;  1G0T A;  4BVX A;  4HS1 A;  2RUF A;  3UOM A;  2LNT A;  5KN0 A;  1SKR B;  1ABA A;  3QAV A;  1AW9 A;  2H8L A;  2V41 A;  5E59 A;  3EU3 A;  1MTC A;  4EIQ A;  2B5Y A;  1M3I A;  3TKP A;  2RII A;  5KN2 A;  2PPT A;  4O5U A;  2C4J A;  3LSZ A;  2FWF A;  1YEX A;  2H0I A;  2HFD A;  2KHP A;  4MJC A;  5ECR B;  3EWL A;  2YN1 A;  3NZN A;  3IV4 A;  5JWQ B;  2C3Q A;  2X8C A;  4MZW A;  4LL4 B;  1SL1 B;  1O73 A;  1CQG A;  4TN8 A;  1A2L A;  2DBC A;  5DQY A;  1XIY A;  4KGI A;  3WYW A;  2A4V A;  1CQH A;  1OC3 A;  3HVV A;  3JCM L;  1F2E A;  4LL1 B;  2X49 A;  1NSW A;  1SJZ A;  4IP1 A;  1IYI A;  5E4W A;  1JLW A;  4K6X A;  1KNG A;  4TKY A;  3HJO A;  4OWY A;  2VLU A;  2B3S A;  2H01 A;  2OE3 A;  3TCO A;  5CRW A;  1ZL9 A;  2WS2 A;  4POM A;  2DJK A;  2VD1 A;  4CHS A;  2D2Z A;  4GRF A;  3IPZ A;  2DML A;  3HYP A;  1X9S B;  3IRA A;  1Z3E A;  5IPH A;  3TDG A;  1RQM A;  1AQV A;  3I43 A;  3FR6 A;  5J9B A;  2F8F A;  6GSY A;  1TU7 A;  1PFO A;  2LEG A;  4KDY A;  1DBY A;  3GHA A;  1QFN A;  2ON7 A;  4GF0 A;  2M46 A;  1Z7R A;  3DVX A;  1FG4 A;  1XBS A;  2HT9 A;  2BMX A;  2YNX A;  4OD7 A;  3KH7 A;  4PTS A;  6GSV A;  4MF6 A;  3FK8 A;  1K0C A;  5LNK e;  3APO A;  1FAA A;  2PVO C;  3HVX A;  1GUM A;  4WEY A;  1B4Q A;  2RM5 A;  1M3J A;  2O89 A;  2CAI A;  2GQK A;  3HJP A;  3L9V A;  1QXH A;  2O85 A;  3GRX A;  4PUR A;  2XPE A;  2FA4 A;  3AY8 A;  3D0Z A;  2H19 A;  4ICY A;  4N30 A;  3IC8 A;  3UL3 A;  4HU9 A;  3TJG A;  1O85 A;  3VFI A;  1V57 A;  4IN0 A;  1PRX A;  2HI7 A;  3H8Q A;  3L0H A;  5IMC A;  2GGT A;  2ZUP A;  3GUS A;  4Z7X A;  5ECP B;  4GTU A;  2R0C A;  3MNG A;  3M9K A;  2OE1 A;  4RQR A;  4DSS A;  1GLQ A;  4LLR A;  1M2D A;  5ELA A;  4K5S A;  4EE0 A;  3KJY A;  2IMF A;  3LGC A;  2YZH A;  3DKS A;  4HQZ A;  1EV9 A;  5HR3 A;  2VCV A;  3IBH A;  3ZVJ A;  3HJM A;  4BWQ A;  1VF2 A;  4X4J A;  3LW9 A;  5DBQ A;  3VK9 A;  5LD0 A;  4KA0 A;  3QFB C;  1F3A A;  3S9F A;  3M8N A;  4USS A;  2L4C A;  4G0I A;  3PH9 A;  3IHG A;  3M0F A;  1WWJ A;  4X1U A;  3BD2 A;  1JZO A;  5CP1 A;  3VUR A;  5IOX A;  1A2M A;  2H70 A;  1F3B A;  5IO0 A;  2OA7 A;  2WUL A;  5IM9 A;  3ERW A;  3KM6 A;  10GS A;  4PNF A;  2HSM A;  1XFL A;  4GQF A;  4PUF C;  2A2R A;  4ZB9 A;  2MBS A;  3KTL A;  1YKC A;  5AIX A;  3SBC A;  1ERV A;  4PQH A;  2P31 A;  5H5R A;  1GSY A;  1LBK A;  5DAK B;  1XPV A;  2IMK A;  1THX A;  1M2B A;  4GCI A;  4X0X A;  2R6K A;  1YEP A;  4OMV A;  4WF4 A;  5HR1 A;  1KTE A;  2GS3 A;  4HEA 2;  2OAD A;  4WXT A;  4F82 A;  3L9S A;  3VWW A;  4WBR D;  3KP8 A;  3ZML A;  2HLS A;  3GH6 A;  2IJY A;  2GLR A;  4JBB A;  3HXS A;  1B9Y C;  1HYU A;  3LYP A;  3DEX A;  2C8U A;  1V9W A;  2MZC A;  3FY7 A;  4YQM A;  2QKE A;  5C04 A;  11GS A;  4HOJ A;  1BYE A;  3MSZ A;  3ZMK A;  3GNJ A;  3C7M A;  5CRD A;  1XWC A;  2R2J A;  4WR4 A;  5C00 A;  1A24 A;  22GS A;  3R2Q A;  3IHQ A;  5AIS A;  5G31 A;  4KAE A;  1JZW A;  2DIZ A;  4HJ2 A;  1JZD A;  5FWG A;  3D21 A;  3ME8 A;  4XS1 A;  1R5A A;  2WCI A;  1Q4J A;  2LRT A;  4V1A p;  3EMP A;  3L4N A;  4HSC X;  3MYD A;  4DVC A;  3J7Y k;  1PSQ A;  1I9D A;  5HQP A;  1K0O A;  2VCW A;  1SJ6 A;  5G5F A;  3GL5 A;  4K7I A;  4N0V A;  3KTB A;  4NHZ A;  2F3M A;  1X5D A;  4TRX A;  3EU4 A;  1A0F A;  2XHF A;  7GSS A;  2FCH A;  2GSR A;  4FO5 A;  2TRC P;  4Z2R A;  4TR0 A;  3RBT A;  1MD3 A;  3KH9 A;  3FZA A;  3QCP A;  1ON4 A;  3ZRD A;  3GA4 A;  3IE3 A;  3D4M A;  3R3E A;  3CRT A;  3PIN A;  4ECB A;  5DCG A;  1Y25 A;  2UZ8 A;  4F9Z A;  4TXV A;  3VPT A;  4JE1 A;  3HVN A;  3Q6O A;  4G0L A;  4TXO A;  3DD3 A;  1PN0 A;  5B8A A;  2ZNM A;  3FZ5 A;  4AJ6 A;  4EF0 A;  2DC5 A;  1ZCP A;  1ZYN A;  2OJL A;  2G2Q A;  2VL3 A;  5D9T A;  1V98 A;  2L57 A;  2X99 A;  4GQC A;  5A4U A;  8GSS A;  2OE0 A;  2XBQ A;  3Q19 A;  5JCU A;  3APS A;  3ZFL A;  1N2A A;  5ABR A;  1O7U A;  2H30 A;  2LTK A;  3GL3 A;  1X5E A;  1S3D A;  1EEJ A;  1NHO A;  2DIY A;  5B7C A;  5JWR B;  2KLX A;  2GDR A;  2LST A;  1K0D A;  2CT6 A;  4BIK A;  1GSF A;  4K9Z A;  4BVY B;  3F0I A;  1GTA A;  1XW6 A;  4ECC A;  2NTO A;  2GQM A;  5JWO B;  3QMX A;  4ZL9 A;  1GTI A;  2ES7 A;  4ILF A;  2GT6 A;  4E8H A;  4J56 E;  4FH8 A;  5HR0 A;  3P8W A;  2YWN A;  3FKF A;  1TKD B;  1ZYQ B;  1U6T A;  1OYJ A;  3GST A;  3LWA A;  4BVX B;  4I8B A;  3H1N A;  3SWL A;  4Z2T A;  1I5G A;  1ERU A;  4ID0 A;  2JAC A;  4I6X A;  3KZQ A;  4CY6 A;  1WIK A;  1MEK A;  3NIV A;  5GSS A;  5GZZ B;  1PL2 A;  9GSS A;  5J3R A;  3HVS A;  1DE1 A;  4E8E A;  3DXB A;  4PQI A;  1TI3 A;  5H5S A;  3C73 A;  1XOA A;  2R37 A;  3LOR A;  4NV2 A;  3H4K A;  2EIO A;  5F06 A;  3U6V A;  5INY A;  5IOW A;  4BVY A;  1ACV A;  4KSO A;  5LCZ A;  2GSS A;  1O8X A;  3KEB A;  2XBI A;  4HDE A;  1Q98 A;  1G6W A;  2MMO A;  4MZB A;  5DAL A;  3F3Q A;  4NPB A;  2MBT A;  3EIN A;  3GTU A;  3IR4 A;  3FR9 A;  1DE2 A;  2XC2 A;  4MJE A;  2IL3 A;  3BBY A;  4ML1 A;  4WKW A;  5D9X A;  1QMV A;  5HR2 A;  1UC7 A;  2IME A;  4YH2 A;  2I4A A;  5IMV A;  1TK5 B;  5AGY A;  2VL2 C;  1E6B A;  3KXO A;  4IP6 A;  2N5F A;  3G9B A;  5ECH B;  1PX7 A;  1T4Y A;  1PGT A;  5D93 A;  1NHY A;  2CQ9 A;  2QA2 A;  1T4Z A;  1W89 A;  2GZP A;  1V58 A;  2DJ1 A;  2FA8 A;  3KCM A;  4QL7 A;  2E2G A;  3P90 A;  4KSM A;  1ST9 A;  1AQX A;  5G5E A;  4YQU A;  3UAP A;  4ECI A;  3QPM A;  3A5W A;  3V1W A;  3TB2 A;  5CO3 A;  1SKW B;  3IAS 2;  1IYH A;  2AJQ B;  2B7K A;  1HNA A;  4N11 A;  2V1M A;  1FVJ A;  1Z6M A;  4JED A;  5ECS A;  3LQ7 A;  3N5O A;  4JRR A;  2V6O A;  1K3Y A;  3HD5 A;  1PA3 A;  3G7I A;  2C0E A;  1ERT A;  4FYU A;  4AF2 A;  3ZIV A;  1K0A A;  3VI5 A;  4I2U A;  2OKA A;  4IEL A;  4MCU A;  1RK4 A;  2PU9 C;  2YOI A;  4MF7 A;  1YJ6 A;  4HU7 A;  3UVT A;  3GV1 A;  5B8B A;  1X0R A;  4BL7 A;  4G2E A;  3ERG A;  2WZ9 A;  4XS6 A;  2CZ3 A;  1AIU A;  2HRF A;  1T7P B;  2PGT A;  3EPT A;  3RHB A;  2A2S A;  1TP9 A;  2H1B A;  4DSS B;  5ECQ B;  2CV4 A;  1EV4 A;  2YV9 A;  3GKX A;  4HZ4 A;  2LJA A;  1DSB A;  3TKS A;  4ZL7 A;  2N5A A;  2WRT A;  1E2Y A;  2B5E A;  4ECJ A;  4DSQ A;  4OFT A;  5GAN D;  2R0P A;  1OAZ A;  4NXI A;  3F9U A;  4KUN A;  4ML6 A;  5KOW A;  3GFK A;  1GSU A;  2B7J A;  13GS A;  1B9X C;  2X4A A;  3IK7 A;  1LU4 A;  2JAD A;  1O8W A;  3UIW A;  1FB0 A;  3EUR A;  1XWG A;  3BCI A;  2EC4 A;  4L5L A;  1ZZY A;  4JU5 A;  4CY8 A;  1K0N A;  2E0Q A;  3TOT A;  2PN8 A;  3IA1 A;  4K8M A;  4XIH A;  3L78 A;  1MDJ A;  4NHW A;  5IQY A;  3IK9 A;  2WFC A;  3VPQ A;  2GST A;  1XXU A;  1OC8 A;  4MDC A;  2YPM A;  4POL A;  2VM1 A;  2DJ3 A;  3DYR A;  5F05 A;  2FHE A;  1S3R A;  2OBI A;  2ON5 A;  3VWX A;  4MAB A;  5H5Q A;  1FO5 A;  1GWC A;  5AIV A;  3ZVJ D;  3FRC A;  2M72 A;  1TDI A;  3APQ A;  4FYC A;  2EIQ A;  3HY2 A;  4ZBB A;  3DVW A;  4F2I A;  1FHE A;  2CAQ A;  1EP7 A;  2DSA A;  3TOU A;  2VM2 A;  1PN9 A;  2V32 A;  3I69 A;  2R3X A;  4FQU A;  4EXJ A;  5J5N A;  2O87 A;  4XRA A;  3U5R E;  1QQ2 A;  3A2V A;  3K8N A;  5CNW A;  3VI7 A;  3CQF A;  4MH2 A;  2HE3 A;  2TRX A;  1YF1 A;  3TJB A;  3O3T A;  4G0K A;  2H6X A;  5CRE A;  2V2G A;  1GSS A;  2FY6 A;  2IMD A;  3IC4 A;  1C72 A;  4HUA A;  5ECL B;  2H1A A;  2IFQ A;  5D9W A;  2RLI A;  5BRT A;  4IJ3 A;  5ECM B;  5KN3 A;  4WR5 A;  2LRN A;  4OO4 A;  2PBJ A;  1OE8 A;  5DDL A;  1N8J A;  5HFG A;  5HFI A;  2B6M A;  4MH3 A;  5FHI A;  14GS A;  1SK1 A;  2JSY A;  3I6A A;  3TKR A;  2FWG A;  4ZIL A;  4DSR A;  4JZQ A;  3ZL5 A;  2PER A;  3KP9 A;  1G6Y A;  2MMN A;  3OR5 A;  3TGZ A;  2VLT A;  1U87 A;  2P5R A;  1GSE A;  4K5R A;  3MAK A;  4ZXG A;  3ISO A;  2TIR A;  2RUE A;  1HNC A;  3F4T A;  4EVM A;  2JZT A;  4K1F A;  5D9V A;  5F8B A;  5HFK A;  2HNL A;  3F63 A;  3VWU A;  4I2T A;  2LKU A;  2DJ0 A;  1XW9 A;  3D6I A;  3O6T A;  2ZCT A; 
#chains in the Genus database with same CATH homology
 4EKZ A;  1TU8 A;  1GUL A;  1Z6N A;  5EY6 A;  2G0F A;  4KF9 A;  1EGO A;  2DLX A;  1PD2 1;  5EVO A;  2KP1 A;  3E3E A;  4WBJ A;  2KOK A;  1PKZ A;  3TJJ A;  4I5Q A;  2ALB A;  2L59 A;  1USB A;  2HRA A;  2HXK A;  1GLP A;  3RPP A;  5IO2 A;  2OAC A;  3Q18 A;  4EDZ A;  17GS A;  2HYX A;  4TXO B;  2IWT A;  6GSX A;  1PL1 A;  4EL1 A;  2Z9S A;  3ZZX A;  3QOU A;  4G9H A;  4JR4 A;  1HNB A;  1THO A;  3D4T A;  2FNO A;  2VUP A;  3WGX A;  1K3L A;  4V1A g;  2N5B A;  3GUR A;  19GS A;  1MDI A;  3WGD A;  3FZ9 A;  3QR6 A;  3QFA C;  3H93 A;  2C3T A;  1SU9 A;  2VLV A;  3DRN A;  5CRG A;  5IMZ A;  1VF4 A;  2K8V A;  2PUK C;  3FHK A;  3PGT A;  4MLY A;  3W8S A;  2YV7 A;  1MDK A;  3WT2 A;  3F6F A;  4BPY A;  2H1D A;  1SYR A;  1YY7 A;  3CTF A;  1XOB A;  4KE3 A;  1FOH A;  2HZE A;  1B8X A;  1WPI A;  4Q5R A;  1YF0 A;  5ID2 A;  1BJX A;  4IBP A;  1U88 A;  2C0G A;  3IAM 2;  4AJ8 A;  2AHE A;  3P7X A;  1ZMA A;  3C1S A;  1TRS A;  2C3N A;  4MA9 A;  1V40 A;  4F0B A;  4I97 A;  3CMI A;  1OKT A;  3G7J A;  3RHC A;  1WOU A;  3A2X A;  1DUG A;  2WDU A;  3LXZ A;  5IIZ A;  1QK8 A;  4TOP A;  1OVN A;  3ED3 A;  1B4P A;  1YDK A;  4YAP A;  3QDN A;  5J9C A;  3LFL A;  3UMA A;  4K0G A;  1PMT A;  5D73 A;  4PNG A;  2EIR A;  3PPU A;  2R5G A;  2LRC A;  4KW6 A;  5KN1 A;  1J9B A;  2LQO A;  3J7Y b;  1XWK A;  4YKG A;  1EWX A;  1TW9 A;  3GH9 A;  1OKD A;  1BQ7 A;  2JU5 A;  2NBS A;  5F0G A;  1X9M B;  2HRN A;  4FYB A;  5DAL B;  2F8A A;  3GTU B;  2FWH A;  1GSD A;  4PX1 A;  5IPG A;  1FB6 A;  3WD6 A;  1ZYE A;  2L6C A;  1VF1 A;  1G7E A;  4CDO A;  4XTS A;  6GSU A;  5AN1 A;  1U3A A;  1T1V A;  2XPD A;  1OC9 B;  4BWS A;  1J08 A;  4LA1 A;  2AB6 A;  2FUG 2;  2FLS A;  2K8S A;  1SD9 A;  2H66 A;  5D8I A;  2NDO A;  3ZIJ A;  3FYG A;  3VWV A;  2P5Q A;  3A3T A;  1SL2 B;  3BJ5 A;  3G7Y A;  4K7N A;  3TJF A;  1GTB A;  1R26 A;  2A4H A;  4ACS A;  2YWI A;  1JLV A;  2QSI A;  2IPA A;  3UAR A;  2I9H A;  4EUY A;  4XHM A;  5ECK B;  1YZX A;  1XWB A;  1LJR A;  4PGT A;  1SD8 A;  2BJX A;  2HSY A;  2MYG A;  3HZ4 A;  1R7H A;  2I81 A;  1B48 A;  2C80 A;  2AYT A;  2VCX A;  2VOC A;  4TR1 A;  1EEM A;  5G1K A;  1XVQ A;  5L71 A;  2LNS A;  3QD9 A;  2VO4 A;  3CYN A;  1TK0 B;  4F03 A;  1XW5 A;  4DEJ A;  4EO3 A;  2HRK A;  4OCE A;  5ECO B;  2WGR A;  4BL7 B;  1OC9 A;  1A0R P;  2REM A;  4PQ1 A;  5DQS A;  4TR3 A;  4IGJ A;  5DJM A;  3TRP A;  3UBL A;  3BCK A;  2H74 A;  1ILO A;  4WET A;  3US3 A;  1TRV A;  2IIY A;  5DCH A;  4H86 A;  5ECI B;  3TUE A;  3ZTL A;  3FEU A;  1M99 A;  2HZF A;  5EPF A;  4KDU A;  2YWM A;  2MMA A;  2R0G A;  1WE0 A;  4WF5 A;  4MPF A;  1Z7P A;  1HD2 A;  1QUW A;  4O92 A;  4RQX A;  3ZIT A;  2CX3 A;  2VD0 A;  3GX0 A;  1NW2 A;  1AAZ A;  12GS A;  3FR3 A;  1R5P A;  1FVK A;  4GWR A;  4GXZ A;  3KMN A;  3TRQ A;  3PR8 A;  5CRH A;  4K2D A;  2GQL A;  3MDK A;  4L8E A;  4BA7 A;  2MMZ A;  4Q5F A;  5EL8 A;  5ECN B;  2FD3 A;  2X8G A;  4A5P A;  4RI6 A;  4L5O A;  4FIW A;  1RW1 A;  3E9J B;  4ZL8 A;  3ZLP A;  1M9A A;  2JZS A;  4OFN A;  5F07 A;  1AXD A;  1M7T A;  1TRU A;  3CTG A;  2L5O A;  5JCG A;  5J4U A;  3CSI A;  4OO5 A;  2VL9 A;  3UVH A;  5D96 A;  2B1L A;  3CBU A;  1T8E B;  2CX4 A;  4MMM A;  1W4V A;  3TKS E;  3F4S A;  3F3R A;  1SYX A;  2L4Q A;  3HHV A;  5B6M A;  1SK2 A;  2DMM A;  3KD0 A;  4EC0 A;  2OBK A;  2LUS A;  2GT5 A;  2K6V A;  2YWO A;  5IMF A;  3L9U A;  3LYK A;  2A2P A;  1MD4 A;  2QA1 A;  3O76 A;  1H75 A;  5G1L A;  2H0G A;  4P3Y B;  3E0U A;  4O5Q A;  3C8E A;  1URM A;  4IS0 A;  2H76 A;  3H79 A;  3RAZ A;  3KGK A;  4HZ2 A;  4PXO A;  5FT3 A;  2I1U A;  4KB3 A;  2VCT A;  3ME7 A;  4ZBA A;  1EGR A;  3DWV A;  3MWH A;  2P0G A;  2PWJ A;  2GSQ A;  1S3C A;  2KUC A;  4HQS A;  1O6J A;  3LJR A;  5CAX A;  3LG6 A;  3GKK A;  2IFQ B;  2H6Y A;  6GSS A;  4D73 B;  4EDY A;  1F9M A;  2DKH A;  1UVZ A;  4NAX A;  1TOF A;  1FOV A;  1A23 A;  5J41 A;  4PUA A;  5CYY A;  1XVW A;  4XRD A;  2NVL A;  4POK A;  4POB A;  3DIE A;  3TKQ A;  4L0W A;  2CVK A;  4LMV A;  3UJ1 A;  1O81 A;  5G2Z A;  3N9J A;  1T00 A;  1TTZ A;  2K9F A;  3W8J A;  1GTU A;  3VLN A;  4IJI A;  1GH2 A;  4L0U A;  5IMA A;  4YQV A;  4NV5 A;  3QAW A;  3GKM A;  2LJR A;  16GS A;  2C0F A;  3D5J A;  2E2M A;  2L5L A;  3DML A;  2H75 A;  1WJK A;  4KDX A;  1KEB A;  4KCA A;  4XS4 B;  4RUV A;  4LMW A;  3FMW A;  4G19 A;  2AAW A;  3D22 A;  4ISD A;  18GS A;  3I9V 2;  1SEN A;  1JHB A;  1XWA A;  1GNE A;  3GKN A;  3TKS C;  4OFM A;  2V6K A;  4Z2U A;  2BTO T;  1JFU A;  6GST A;  2H71 A;  4D73 A;  5BMU A;  1BX9 A;  3GSS A;  3WT1 A;  3DGQ A;  5KEJ A;  2PVQ A;  1EOG A;  4V2M A;  5KOX A;  1ERW A;  1GSQ A;  3RDW A;  3M9J A;  3GYK A;  1UN2 A;  4HI7 A;  3HKR A;  1WMJ A;  3TJK A;  1BED A;  4O32 A;  5DJL A;  2VAF A;  3EC3 A;  1F37 A;  5ENU A;  4MF5 A;  1ML6 A;  3CSH A;  2IMI A;  4ZBD A;  1SKS B;  4XS4 A;  1GUH A;  4QL9 A;  5A4V A;  2DJJ A;  4MJA A;  1M0U A;  4Q5Q A;  3TRX A;  2C0D A;  3FW2 A;  1YKA A;  2B5X A;  2J23 A;  3F6D A;  1A8Y A;  3CSJ A;  1YQ1 A;  1G7O A;  1UA5 A;  1QGV A;  4O7H A;  4TVE A;  1NM3 A;  2E7P A;  1AQW A;  1OE7 A;  2JSZ A;  4OCF A;  3F4R A;  2WJU A;  3HA9 A;  4QQ7 A;  1JZR A;  4KND A;  4TW5 A;  1FW1 A;  5IMD A;  2H73 A;  2HZE B;  1KBN A;  3HZ8 A;  4MNN A;  1ZGN A;  2CVB A;  1VGL A;  5ID2 B;  3IXR A;  1HQO A;  2K18 A;  1ZYP A;  1U3I A;  4MJB A;  4YKF A;  5DAK A;  3FZ4 A;  3C71 A;  2NPB A;  3P2A A;  3CXG A;  1M9B A;  1Y6E A;  4MZC A;  2WB9 A;  1GNW A;  2YP6 A;  3ZFB A;  1TRW A;  4HJM A;  4ZB6 A;  20GS A;  1WP0 A;  4J2F A;  4IVF A;  1GL8 A;  2YJH A;  1GRX A;  1VF3 A;  1M2A A;  4K2X A;  3CRU A;  3KIJ A;  2DKI A;  1A8L A;  3IDV A;  2I3Y A;  5COH A;  4O5R A;  2GZZ A;  3EE2 A;  4GSN A;  3C1R A;  2YAN A;  2FGX A;  2JL4 A;  1X9W B;  4GLT A;  4KX4 A;  2J9H A;  2GTU A;  1Z5Y E;  5A4W A;  3ZRE A;  4Q5N A;  2F9S A;  4TR4 A;  4ZIJ A;  1PQN A;  3QAG A;  2X64 A;  3M3M A;  1EZK A;  2QGV A;  4X43 A;  2H0H A;  1X5C A;  1S3A A;  3HDC A;  2HSH A;  5ELG A;  4IKH A;  3ERF A;  5DVB A;  2LV3 A;  2YZU A;  2DJ2 A;  4RI7 A;  1A2J A;  1PKW A;  3EYT A;  2O7K A;  3W6G A;  4EIP A;  1GUK A;  3ZYW A;  1ZOF A;  2RM6 A;  3Q74 A;  1AUC A;  4KCE A;  2LS5 A;  1SK0 A;  5A5K A;  6GSW A;  4J57 E;  1J0F A;  3GX8 A;  4NWY A;  4K7O A;  4ZB8 A;  4JR6 A;  5G30 A;  2F51 A;  2JZR A;  2CVD A;  1TI1 A;  4IW9 A;  2AUV A;  4MPG A;  2CZ2 A;  4IQ1 A;  2AV4 A;  1EP8 A;  4AJ7 A;  2PMT A;  1XZO A;  3GIX A;  5B6N A;  3A2W A;  2QC7 A;  2R4V A;  2GVP A;  3NOF A;  4F0C A;  3IOS A;  2FWE A;  4IHU A;  2GZY A;  3A5I A;  2VL2 A;  1TK8 B;  2H72 A;  1H4O A;  1R4W A;  3M1G A;  4TR1 B;  4KH7 A;  2L6D A;  2B1K A;  3KMO A;  3EVI A;  4K0N A;  1GP1 A;  2CA8 A;  2VIM A;  2LQQ A;  3UBK A;  1BAY A;  1T3B A;  1SL0 B;  1EOH A;  4IQA A;  2VCZ A;  1AC1 A;  3F8U A;  1SJI A;  4G10 A;  4AGS A;  2LJK A;  4YAV A;  5GST A;  4CW9 A;  2KP2 A;  4V2L A;  2M80 A;  3MIX A;  4GST A;  4MK3 A;  4NMU A;  3LEF A;  2H1G A;  1PX6 A;  5JCW A;  3LXT A;  4MP4 A;  3RPN A;  4V2N A;  3EMX A;  1F6M C;  1VRS D;  4GSS A;  4N10 A;  4N0Z A;  3GMF A;  1WRY A;  1TJD A;  5GAP D;  2YJ7 A;  2C1Y A;  2H6Z A;  2O8V B;  2IN3 A;  3UEM A;  1BG5 A;  2X8H A;  3BOA A;  1XCC A;  3GN3 A;  3HCZ A;  1V2A A;  2VCQ A;  1TXX A;  1Z9H A;  4XCS A;  1K3O A;  1K0B A;  4ULX A;  1K0M A;  2YCD A;  3WGE A;  1G0T A;  4BVX A;  4HS1 A;  2RUF A;  3UOM A;  2LNT A;  5KN0 A;  1SKR B;  1ABA A;  3QAV A;  1AW9 A;  2H8L A;  2V41 A;  5E59 A;  3EU3 A;  1MTC A;  4EIQ A;  2B5Y A;  3TKP A;  2RII A;  5KN2 A;  2PPT A;  4O5U A;  2C4J A;  3LSZ A;  2FWF A;  1YEX A;  2H0I A;  2HFD A;  2KHP A;  4MJC A;  5ECR B;  3EWL A;  2YN1 A;  3NZN A;  3IV4 A;  5JWQ B;  2C3Q A;  2X8C A;  4MZW A;  4LL4 B;  1SL1 B;  1O73 A;  1CQG A;  4TN8 A;  1A2L A;  2DBC A;  5DQY A;  1XIY A;  4KGI A;  3WYW A;  2A4V A;  1CQH A;  1OC3 A;  3HVV A;  3JCM L;  1F2E A;  4LL1 B;  2X49 A;  1NSW A;  1SJZ A;  4IP1 A;  1IYI A;  5E4W A;  1JLW A;  4K6X A;  1KNG A;  4TKY A;  3HJO A;  4OWY A;  2VLU A;  2B3S A;  2H01 A;  2OE3 A;  3TCO A;  5CRW A;  1ZL9 A;  2WS2 A;  4POM A;  2DJK A;  2VD1 A;  4CHS A;  2D2Z A;  4GRF A;  3IPZ A;  2DML A;  3HYP A;  1X9S B;  3IRA A;  1Z3E A;  5IPH A;  3TDG A;  1RQM A;  1AQV A;  3I43 A;  3FR6 A;  5J9B A;  2F8F A;  6GSY A;  1TU7 A;  2LEG A;  4KDY A;  1DBY A;  3GHA A;  1QFN A;  2ON7 A;  4GF0 A;  2M46 A;  1Z7R A;  3DVX A;  1FG4 A;  1XBS A;  2HT9 A;  2BMX A;  2YNX A;  4OD7 A;  3KH7 A;  4PTS A;  6GSV A;  4MF6 A;  3FK8 A;  1K0C A;  5LNK e;  3APO A;  1FAA A;  2PVO C;  3HVX A;  1GUM A;  4WEY A;  1B4Q A;  2RM5 A;  2O89 A;  2CAI A;  2GQK A;  3HJP A;  3L9V A;  1QXH A;  2O85 A;  3GRX A;  4PUR A;  2XPE A;  2FA4 A;  3AY8 A;  3D0Z A;  2H19 A;  4ICY A;  4N30 A;  3IC8 A;  3UL3 A;  4HU9 A;  3TJG A;  1O85 A;  3VFI A;  1V57 A;  4IN0 A;  1PRX A;  2HI7 A;  3H8Q A;  3L0H A;  5IMC A;  2GGT A;  2ZUP A;  3GUS A;  4Z7X A;  5ECP B;  4GTU A;  2R0C A;  3MNG A;  3M9K A;  2OE1 A;  4RQR A;  4DSS A;  1GLQ A;  4LLR A;  1M2D A;  5ELA A;  4K5S A;  4EE0 A;  3KJY A;  2IMF A;  3LGC A;  2YZH A;  3DKS A;  4HQZ A;  1EV9 A;  5HR3 A;  2VCV A;  3IBH A;  3ZVJ A;  3HJM A;  4BWQ A;  1VF2 A;  4X4J A;  3LW9 A;  5DBQ A;  3VK9 A;  5LD0 A;  4KA0 A;  3QFB C;  1F3A A;  3S9F A;  3M8N A;  4USS A;  2L4C A;  4G0I A;  3PH9 A;  3IHG A;  3M0F A;  1WWJ A;  4X1U A;  3BD2 A;  1JZO A;  5CP1 A;  3VUR A;  5IOX A;  1A2M A;  2H70 A;  1F3B A;  5IO0 A;  2OA7 A;  2WUL A;  5IM9 A;  3ERW A;  3KM6 A;  10GS A;  4PNF A;  2HSM A;  1XFL A;  4GQF A;  4PUF C;  2A2R A;  4ZB9 A;  2MBS A;  3KTL A;  1YKC A;  5AIX A;  3SBC A;  1ERV A;  4PQH A;  2P31 A;  5H5R A;  1GSY A;  1LBK A;  5DAK B;  1XPV A;  2IMK A;  1THX A;  1M2B A;  4GCI A;  4X0X A;  2R6K A;  1YEP A;  4OMV A;  4WF4 A;  5HR1 A;  1KTE A;  2GS3 A;  4HEA 2;  2OAD A;  4WXT A;  4F82 A;  3L9S A;  3VWW A;  4WBR D;  3KP8 A;  3ZML A;  2HLS A;  3GH6 A;  2IJY A;  2GLR A;  4JBB A;  3HXS A;  1B9Y C;  1HYU A;  3LYP A;  3DEX A;  2C8U A;  1V9W A;  2MZC A;  3FY7 A;  4YQM A;  2QKE A;  5C04 A;  11GS A;  4HOJ A;  1BYE A;  3MSZ A;  3ZMK A;  3GNJ A;  3C7M A;  5CRD A;  1XWC A;  2R2J A;  4WR4 A;  5C00 A;  1A24 A;  22GS A;  3R2Q A;  3IHQ A;  5AIS A;  5G31 A;  4KAE A;  1JZW A;  2DIZ A;  4HJ2 A;  1JZD A;  5FWG A;  3D21 A;  3ME8 A;  4XS1 A;  1R5A A;  2WCI A;  1Q4J A;  2LRT A;  4V1A p;  3EMP A;  3L4N A;  3MYD A;  4DVC A;  3J7Y k;  1PSQ A;  1I9D A;  5HQP A;  1K0O A;  2VCW A;  1SJ6 A;  5G5F A;  3GL5 A;  4K7I A;  4N0V A;  3KTB A;  4NHZ A;  2F3M A;  1X5D A;  4TRX A;  3EU4 A;  1A0F A;  2XHF A;  7GSS A;  2FCH A;  2GSR A;  4FO5 A;  2TRC P;  4Z2R A;  4TR0 A;  3RBT A;  1MD3 A;  3KH9 A;  3FZA A;  3QCP A;  1ON4 A;  3ZRD A;  3GA4 A;  3IE3 A;  3D4M A;  3R3E A;  3CRT A;  3PIN A;  4ECB A;  5DCG A;  1Y25 A;  2UZ8 A;  4F9Z A;  4TXV A;  3VPT A;  4JE1 A;  3Q6O A;  4G0L A;  4TXO A;  3DD3 A;  1PN0 A;  5B8A A;  2ZNM A;  3FZ5 A;  4AJ6 A;  4EF0 A;  2DC5 A;  1ZCP A;  1ZYN A;  2OJL A;  2G2Q A;  2VL3 A;  5D9T A;  1V98 A;  2L57 A;  2X99 A;  4GQC A;  5A4U A;  8GSS A;  2OE0 A;  2XBQ A;  3Q19 A;  5JCU A;  3APS A;  3ZFL A;  1N2A A;  5ABR A;  1O7U A;  2H30 A;  2LTK A;  3GL3 A;  1X5E A;  1S3D A;  1EEJ A;  1NHO A;  2DIY A;  5B7C A;  5JWR B;  2KLX A;  2GDR A;  2LST A;  1K0D A;  2CT6 A;  1GSF A;  4K9Z A;  4BVY B;  3F0I A;  1GTA A;  1XW6 A;  4ECC A;  2NTO A;  2GQM A;  5JWO B;  3QMX A;  4ZL9 A;  1GTI A;  2ES7 A;  4ILF A;  2GT6 A;  4E8H A;  4J56 E;  4FH8 A;  5HR0 A;  3P8W A;  2YWN A;  3FKF A;  1TKD B;  1ZYQ B;  1U6T A;  1OYJ A;  3GST A;  3LWA A;  4BVX B;  4I8B A;  3H1N A;  3SWL A;  4Z2T A;  1I5G A;  1ERU A;  4ID0 A;  2JAC A;  4I6X A;  3KZQ A;  4CY6 A;  1WIK A;  1MEK A;  3NIV A;  5GSS A;  5GZZ B;  1PL2 A;  9GSS A;  5J3R A;  3HVS A;  1DE1 A;  4E8E A;  3DXB A;  4PQI A;  1TI3 A;  5H5S A;  3C73 A;  1XOA A;  2R37 A;  3LOR A;  4NV2 A;  3H4K A;  2EIO A;  5F06 A;  3U6V A;  5INY A;  5IOW A;  4BVY A;  1ACV A;  4KSO A;  5LCZ A;  2GSS A;  1O8X A;  3KEB A;  2XBI A;  4HDE A;  1Q98 A;  1G6W A;  2MMO A;  4MZB A;  5DAL A;  3F3Q A;  4NPB A;  2MBT A;  3EIN A;  3GTU A;  3IR4 A;  3FR9 A;  1DE2 A;  2XC2 A;  4MJE A;  2IL3 A;  3BBY A;  4ML1 A;  4WKW A;  5D9X A;  1QMV A;  5HR2 A;  1UC7 A;  2IME A;  4YH2 A;  2I4A A;  5IMV A;  1TK5 B;  5AGY A;  2VL2 C;  1E6B A;  3KXO A;  4IP6 A;  2N5F A;  3G9B A;  5ECH B;  1PX7 A;  1T4Y A;  1PGT A;  5D93 A;  1NHY A;  2CQ9 A;  2QA2 A;  1T4Z A;  1W89 A;  2GZP A;  1V58 A;  2DJ1 A;  2FA8 A;  3KCM A;  4QL7 A;  2E2G A;  3P90 A;  4KSM A;  1ST9 A;  1AQX A;  5G5E A;  4YQU A;  3UAP A;  4ECI A;  3QPM A;  3A5W A;  3V1W A;  3TB2 A;  5CO3 A;  1SKW B;  3IAS 2;  1IYH A;  2AJQ B;  2B7K A;  1HNA A;  4N11 A;  2V1M A;  1FVJ A;  1Z6M A;  4JED A;  5ECS A;  3LQ7 A;  3N5O A;  4JRR A;  2V6O A;  1K3Y A;  3HD5 A;  1PA3 A;  3G7I A;  2C0E A;  1ERT A;  4FYU A;  4AF2 A;  3ZIV A;  1K0A A;  3VI5 A;  4I2U A;  2OKA A;  4IEL A;  4MCU A;  1RK4 A;  2PU9 C;  2YOI A;  4MF7 A;  1YJ6 A;  4HU7 A;  3UVT A;  3GV1 A;  5B8B A;  1X0R A;  4BL7 A;  4G2E A;  3ERG A;  2WZ9 A;  4XS6 A;  2CZ3 A;  1AIU A;  2HRF A;  1T7P B;  2PGT A;  3EPT A;  3RHB A;  2A2S A;  1TP9 A;  2H1B A;  4DSS B;  5ECQ B;  2CV4 A;  1EV4 A;  2YV9 A;  3GKX A;  4HZ4 A;  2LJA A;  1DSB A;  3TKS A;  4ZL7 A;  2N5A A;  2WRT A;  1E2Y A;  2B5E A;  4ECJ A;  4DSQ A;  4OFT A;  5GAN D;  2R0P A;  1OAZ A;  4NXI A;  3F9U A;  4KUN A;  4ML6 A;  5KOW A;  3GFK A;  1GSU A;  2B7J A;  13GS A;  1B9X C;  2X4A A;  3IK7 A;  1LU4 A;  2JAD A;  1O8W A;  3UIW A;  1FB0 A;  3EUR A;  1XWG A;  3BCI A;  2EC4 A;  4L5L A;  1ZZY A;  4JU5 A;  4CY8 A;  1K0N A;  2E0Q A;  3TOT A;  2PN8 A;  3IA1 A;  4K8M A;  4XIH A;  3L78 A;  1MDJ A;  4NHW A;  5IQY A;  3IK9 A;  2WFC A;  3VPQ A;  2GST A;  1XXU A;  1OC8 A;  4MDC A;  2YPM A;  4POL A;  2VM1 A;  2DJ3 A;  3DYR A;  5F05 A;  2FHE A;  2OBI A;  2ON5 A;  3VWX A;  4MAB A;  5H5Q A;  1FO5 A;  1GWC A;  5AIV A;  3ZVJ D;  3FRC A;  2M72 A;  1TDI A;  3APQ A;  4FYC A;  2EIQ A;  3HY2 A;  4ZBB A;  3DVW A;  4F2I A;  1FHE A;  2CAQ A;  1EP7 A;  2DSA A;  3TOU A;  2VM2 A;  1PN9 A;  2V32 A;  3I69 A;  2R3X A;  4FQU A;  4EXJ A;  5J5N A;  2O87 A;  4XRA A;  3U5R E;  1QQ2 A;  3A2V A;  3K8N A;  5CNW A;  3VI7 A;  4MH2 A;  2HE3 A;  2TRX A;  1YF1 A;  3TJB A;  3O3T A;  4G0K A;  2H6X A;  5CRE A;  2V2G A;  1GSS A;  2FY6 A;  2IMD A;  3IC4 A;  1C72 A;  4HUA A;  5ECL B;  2H1A A;  2IFQ A;  5D9W A;  2RLI A;  5BRT A;  4IJ3 A;  5ECM B;  5KN3 A;  4WR5 A;  2LRN A;  4OO4 A;  2PBJ A;  1OE8 A;  5DDL A;  1N8J A;  5HFG A;  5HFI A;  2B6M A;  4MH3 A;  5FHI A;  14GS A;  1SK1 A;  2JSY A;  3I6A A;  3TKR A;  2FWG A;  4ZIL A;  4DSR A;  4JZQ A;  3ZL5 A;  2PER A;  3KP9 A;  1G6Y A;  2MMN A;  3OR5 A;  3TGZ A;  2VLT A;  1U87 A;  2P5R A;  1GSE A;  4K5R A;  3MAK A;  4ZXG A;  3ISO A;  2TIR A;  2RUE A;  1HNC A;  3F4T A;  4EVM A;  2JZT A;  4K1F A;  5D9V A;  5F8B A;  5HFK A;  2HNL A;  3F63 A;  3VWU A;  4I2T A;  2LKU A;  2DJ0 A;  1XW9 A;  3D6I A;  3O6T A;  2ZCT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...