2DJ1A

The solution structure of the first thioredoxin domain of mouse protein disulfide-isomerase a4
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
140
structure length
140
Chain Sequence
GSSGSSGDDDLEVKEENGVWVLNDGNFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIASTLKDNDPPIAVAKIDATSASMLASKFDVSGYPTIKILKKGQAVDYDGSRTQEEIVAKVREVSQPDWTPPPEVTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Protein disulfide-isomerase A4
publication title The solution structure of the first thioredoxin domain of mouse Protein disulfide-isomerase A4
rcsb
source organism Mus musculus
total genus 24
structure length 140
sequence length 140
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2006-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2dj1A00
4J57E 4I97A 1BEDA 2C3TA 3LXZA 3GX0A 2GSQA 4N0ZA 3W8SA 4IHUA 2ZNMA 4ACSA 2H1AA 3D4MA 1ERWA 3H79A 2C0DA 3KJYA 20GSA 4MZCA 1VF4A 3OR5A 2IL3A 4KB3A 5B6MA 3MAKA 1QUWA 1NW2A 2JZTA 1G6YA 1SYRA 2RUEA 2TIRA 1QQ2A 1ZYQB 4PNFA 4K6XA 2GT5A 3GURA 4YAVA 4DSSB 1NM3A 4FO5A 1S3CA 3CSIA 3CTFA 3J7Yb 3ZVJD 3HKRA 2LRTA 4NMUA 4TR0A 1XWAA 4KCEA 5G2ZA 2GQKA 5IMCA 2LV3A 2ALBA 1PGTA 1FHEA 3TKQA 5HFKA 3GFKA 1K0OA 5A4WA 3VWXA 1F3BA 3UBKA 1O73A 4PX1A 2OBKA 3M0FA 5D9TA 4F9ZA 2CZ2A 3GKXA 4KSMA 3TJKA 4NV2A 2O87A 3DKSA 18GSA 2LJAA 5IQYA 3LWAA 1PRXA 5EPFA 1W89A 2YWIA 1TJDA 1PL1A 1U87A 2FUG2 4XTSA 2B3SA 4IKHA 2PGTA 5ENUA 1GTUA 1G7EA 3W6GA 1VF2A 1GTBA 3M9JA 4Q5RA 1GSSA 1TXXA 2C4JA 2CAIA 4RQRA 4X1UA 1A24A 4KH7A 2FGXA 2C3NA 2DJ3A 1YY7A 3LFLA 3PH9A 4K9ZA 3ZFLA 5L71A 4AGSA 3HJMA 2OKAA 4FH8A 1YKCA 2E2GA 1XWCA 4YQVA 1EEJA 4O32A 1PMTA 1XXUA 1MDIA 1ML6A 1ST9A 3UAPA 3I69A 4POLA 2K18A 1SK1A 2V6KA 3M3MA 3NIVA 2AUVA 2B7JA 2H1DA 1M2BA 1GSQA 5F07A 2R37A 4BVXA 4HZ2A 3FRCA 4AF2A 2L5LA 5D8IA 3TKRA 3EVIA 3UMAA 2WFCA 3HVXA 3CSHA 5D93A 1XCCA 2DSAA 4YQMA 2CQ9A 2P31A 3EINA 2GVPA 3C73A 3VURA 1RQMA 2YJ7A 1K3YA 3UOMA 2YPMA 6GSWA 2XC2A 3L9SA 2LQQA 2H8LA 1TK0B 1GNWA 2HZEB 4JZQA 1HD2A 4OCFA 3EC3A 3FZ4A 4AJ6A 2FWEA 4IS0A 1TI3A 1AC1A 2V1MA 4I5QA 1OKTA 2JACA 2I81A 4WF5A 2WGRA 2X8CA 3M9KA 4GTUA 1TI1A 1GTIA 3WGDA 1ILOA 2J9HA 1M2AA 3F9UA 1MDJA 4KW6A 3HVVA 2LRNA 4TVEA 2VCWA 1B4QA 4KDXA 5DCGA 3UIWA 2HLSA 2H74A 2C3QA 1UVZA 3QD9A 2Z9SA 3LYPA 2H6XA 1ACVA 4POBA 1AXDA 1O7UA 4X43A 1DUGA 4EE0A 5G1KA 3ERFA 1JZDA 2PPTA 5CO3A 1THOA 3M8NA 2CT6A 3RDWA 4XRDA 5G5FA 1LU4A 4GRFA 4IQAA 3MWHA 3QOUA 9GSSA 1H75A 2HXKA 3ZITA 4O92A 4XS4A 2H0HA 1JFUA 1F6MC 1FVKA 5CRWA 3DMLA 5HR2A 5C04A 3CRUA 1GUMA 3F0IA 2DMLA 1HNBA 1EOHA 2FWGA 4TR4A 2L6DA 5ECHB 4DSQA 3UJ1A 1SD8A 2YV9A 3P8WA 2O85A 3LORA 2VL9A 3RAZA 2IMKA 4CDOA 5A5KA 2KP2A 5AN1A 3GYKA 1R4WA 2VCQA 4F0CA 3QFBC 3BD2A 3BCIA 2FA4A 4WR5A 1U6TA 3ZYWA 2MMAA 3VI5A 4K0NA 1F2EA 5E59A 3IDVA 2GQMA 4MJEA 4EVMA 4XIHA 1GUKA 2EIQA 16GSA 3HJPA 5J41A 2DJ1A 2DJKA 1WMJA 4IP6A 1F3AA 1XPVA 2D2ZA 2RUFA 3DGQA 1K0NA 2HZFA 1V2AA 1XWGA 4G2EA 4HU7A 3UVTA 4TRXA 2KHPA 2FHEA 4IJIA 5EL8A 5ELAA 4E8HA 5F8BA 2KP1A 22GSA 4ZIJA 2OE0A 3VPTA 4MPFA 1QFNA 1V98A 1M2DA 1I9DA 5D96A 3NOFA 4Z7XA 5CAXA 4OO4A 5F0GA 5DBQA 1YF1A 4I2UA 4H86A 4LMVA 2PBJA 2VUPA 3US3A 2B6MA 2C8UA 5J5NA 4AJ7A 2X64A 3C71A 1K0MA 2TRXA 2REMA 5F06A 1QGVA 5C00A 4EL1A 3RHBA 3KCMA 5IO0A 2VL2A 2PVQA 2L4CA 4JBBA 2C0EA 2C0GA 3IHQA 2GS3A 3U6VA 2MMNA 3DD3A 1XWKA 1TRWA 2OBIA 4F82A 2FCHA 3F6DA 3HHVA 4YAPA 3HCZA 4BVYA 2B7KA 1FG4A 1S3DA 4NAXA 4G19A 4RQXA 3VFIA 3PR8A 4N30A 4K7OA 5DDLA 4J56E 4PNGA 2GSRA 4XRAA 3Q19A 1UN2A 4KCAA 3MSZA 4K2DA 4N0VA 2AHEA 1EZKA 4EKZA 3WGXA 2WULA 1SJ6A 5HR0A 1G7OA 1S3AA 5ECNB 1GSYA 2IMIA 19GSA 4ID0A 4GXZA 1A8YA 5IM9A 1MD4A 2ES7A 1ON4A 2YZHA 2VCTA 2H1GA 2HT9A 2MBTA 2PUKC 1N2AA 1BX9A 1U88A 4L0WA 1M99A 1PL2A 4MF7A 3KTBA 4IQ1A 5KN2A 1VGLA 5F05A 1OC9B 3E3EA 3TGZA 5A4UA 3GRXA 2B5XA 2LJRA 3DVWA 2YNXA 3GSSA 2CAQA 1TK8B 1SKSB 4ECBA 2HYXA 5AISA 1TW9A 2JZSA 2DJ2A 3LYKA 3KEBA 2EIOA 3SWLA 5FWGA 3TJJA 2LQOA 4PUAA 4TXVA 1PKZA 4HJMA 5CYYA 2L6CA 1JZOA 2XBQA 3FR3A 2MBSA 3IRAA 2VCXA 4ECIA 3I9V2 4MA9A 1K0DA 2CA8A 5H5RA 3QR6A 3TJGA 5ECLB 3VWVA 4EUYA 1M9AA 2VLUA 3DVXA 2WZ9A 3I43A 1WPIA 4OMVA 2H01A 1RK4A 2V2GA 2OACA 2VO4A 2HE3A 2HFDA 5EY6A 3G7JA 2IPAA 4ZB9A 2C0FA 4ZXGA 1XWBA 1A2LA 2BJXA 3IR4A 1Z7RA 2E0QA 11GSA 2H0IA 1B8XA 2LNTA 4IBPA 3ME7A 4TR3A 5IO2A 2H30A 3D0ZA 4I8BA 2YP6A 5B6NA 3KTLA 2M72A 4E8EA 4OO5A 4V1Ag 3RHCA 3QFAC 3MNGA 3KIJA 2VL3A 3EE2A 2F8AA 3ZRDA 2HRFA 1TRVA 1HYUA 3KZQA 3GX8A 3HD5A 2EIRA 4KUNA 3J7Yk 4OFNA 1M0UA 5G31A 4POKA 5FT3A 5DVBA 2A2SA 4DSSA 5GSTA 4NV5A 5INYA 1EV4A 2J23A 5D9XA 4TXOB 1GP1A 5DAKB 4O5RA 2VLVA 2QSIA 2V32A 1Z3EA 4FIWA 4ILFA 1HNAA 2OA7A 5ECRB 3IPZA 3TJFA 4ECCA 1TTZA 2HNLA 5J9CA 4IGJA 2OE3A 3ED3A 5GSSA 3L9UA 2LNSA 2K8VA 1XVWA 1ERUA 3ZFBA 3GL3A 3TOTA 2PVOC 4MP4A 3A2VA 4LL4B 5FHIA 3QCPA 5IIZA 2H0GA 5CREA 2V6OA 1B9YC 3ZLPA 1SL2B 1OYJA 3L9VA 4KNDA 1EGOA 3V1WA 3GKMA 1AAZA 3UBLA 2R5GA 4MMMA 2H72A 3FR6A 4F03A 1T00A 1XZOA 4OD7A 3KMNA 3BBYA 4IN0A 1ZGNA 4QL9A 5KN3A 1THXA 4HQSA 2EC4A 5ECSA 2I9HA 1SL0B 1Z7PA 3A2XA 3A2WA 6GSTA 1O8XA 2MMOA 1JZRA 4FYBA 5LNKe 2QC7A 2L5OA 3AY8A 3HY2A 4DEJA 5JCWA 2O89A 2H76A 4EDZA 4MJAA 5IOXA 2FWFA 5G1LA 1ERVA 4IW9A 4F2IA 1K0BA 4JEDA 3L78A 5ECOB 4KX4A 2R2JA 3JCML 2AB6A 1GL8A 5DJLA 2YWNA 2M80A 4KGIA 1HNCA 4LLRA 2WJUA 5IOWA 2ZUPA 5H5SA 4PXOA 1EP7A 3TRQA 2DLXA 4N10A 5GZZB 4EXJA 4XS1A 2HZEA 3TDGA 2N5BA 2XPEA 2YN1A 1USBA 4PQIA 3IA1A 4WXTA 5DQSA 5CNWA 3HDCA 1MDKA 2HSYA 1MEKA 3P7XA 5DQYA 1TRSA 3H1NA 2F51A 1TKDB 3BCKA 1T8EB 2PMTA 4Q5FA 4WETA 3WD6A 1SK2A 5COHA 2HSHA 5IPGA 4V2MA 1CQGA 4N11A 5IMVA 2H1BA 4I6XA 4ZBDA 5HFGA 3RPNA 2IIYA 4YH2A 2OADA 5JCUA 1YJ6A 1R26A 3C1RA 4TN8A 1PN9A 2JZRA 3BOAA 1K0CA 4HS1A 2F9SA 1OAZA 1KEBA 1X9MB 3KH9A 2GLRA 2KOKA 3FYGA 5DJMA 2YJHA 1U3IA 3K8NA 5H5QA 2XHFA 3CRTA 3EMXA 1SU9A 5ECMB 7GSSA 3EWLA 3TRPA 5ID2B 6GSUA 5ECQB 1GULA 2YOIA 5KEJA 1ZL9A 2NVLA 1E6BA 4HQZA 4MH2A 5CP1A 3APQA 1EGRA 4MZBA 3D4TA 4ML6A 5HFIA 3GN3A 1UC7A 2O8VB 3GSTA 4G10A 2GZZA 2B1KA 3EU4A 1SD9A 3TKSE 1A23A 1QMVA 2YCDA 4LA1A 2N5AA 5AIXA 1IYHA 2GTUA 2XPDA 1GRXA 2TRCP 1ZZYA 5IMAA 1EEMA 2G2QA 3FKFA 4MZWA 5GAND 4MJBA 5JWRB 4BPYA 1K3LA 1X0RA 3A3TA 2X8HA 3APSA 2I4AA 4NHZA 1JHBA 3P2AA 1DSBA 1FW1A 2VM1A 3W8JA 4MPGA 1OE8A 2CX4A 1DE2A 1X9WB 2GGTA 2OJLA 5ECIB 1B4PA 3CXGA 1YF0A 4WR4A 3HZ4A 3F8UA 3KMOA 4QQ7A 2H73A 4MDCA 1OVNA 3TCOA 1BAYA 1TK5B 2RM5A 1C72A 4L5OA 4WBJA 3UARA 3IK9A 4K8MA 3IAM2 3F4TA 2H75A 1WE0A 5ECKB 2GZYA 1OC3A 2RM6A 4CHSA 2R3XA 4NHWA 2IFQB 2YWOA 1KBNA 4JR6A 4KAEA 3ZMKA 2PERA 3PGTA 1X9SB 4HDEA 1MTCA 5G30A 3CTGA 2CVDA 4G9HA 1O6JA 3S9FA 3LXTA 4TW5A 2LRCA 2B1LA 1DE1A 3HYPA 2NTOA 5IMZA 3KH7A 1FOVA 1AQXA 4HU9A 5IPHA 3FHKA 4TOPA 3HZ8A 3LG6A 4ZBAA 3VPQA 4HZ4A 3G7YA 2VM2A 2GT6A 2R6KA 3H8QA 2IFQA 3ME8A 3KP8A 4DSRA 2OE1A 5B7CA 2CVKA 3FR9A 4JRRA 3GHAA 3DXBA 2DBCA 4JU5A 4X0XA 1GNEA 3D5JA 3KXOA 3GTUB 4GWRA 3EMPA 3VI7A 4ECJA 5CRHA 1XOBA 2B5YA 1G6WA 3EYTA 3WT2A 1T1VA 3VK9A 1G0TA 5A4VA 3GH6A 2GQLA 3ISOA 2CV4A 1KNGA 4MH3A 3F63A 3DWVA 4GSNA 4PQHA 1GSFA 3FY7A 2R4VA 2FA8A 1BG5A 2L4QA 1OC9A 1FB0A 3ERGA 3G7IA 4TR1B 2LTKA 1AUCA 2XBIA 1H4OA 1ABAA 3DRNA 5AIVA 1FAAA 3NZNA 4ZL8A 2ZCTA 5CRGA 4GSTA 3EU3A 1GUHA 3FW2A 4BL7A 4QL7A 2VD0A 4KDYA 3TKSC 5ABRA 3O76A 3L4NA 1YQ1A 4K7NA 1ZYEA 4KA0A 1QK8A 5JWQB 3TJBA 4IP1A 3UVHA 1AW9A 1AQVA 2V41A 3GKNA 1V58A 4K7IA 1PSQA 1X5DA 4TR1A 3CMIA 2IJYA 4POMA 3GV1A 3ZIVA 5D73A 4EO3A 4ULXA 3TKPA 2GSTA 1GTAA 1I5GA 1PX7A 4FYCA 4ZL9A 1WOUA 3ZZXA 4V2LA 2YWMA 1DBYA 3KGKA 2LEGA 3N5OA 2KUCA 1TU8A 1K0AA 5GAPD 1X5EA 1YDKA 3GA4A 4RI7A 4XCSA 2DIZA 3TRXA 1Y6EA 3LGCA 4L5LA 2G0FA 3FZAA 4GF0A 5J3RA 1BQ7A 2LKUA 1J9BA 3U5RE 2IN3A 2KLXA 4FYUA 1XW9A 4RUVA 3Q6OA 2A2RA 1VF3A 2C1YA 1F37A 3O3TA 1EV9A 3ZREA 1OE7A 2AAWA 2DC5A 2VLTA 4MF5A 1PQNA 1Z9HA 4CW9A 3IOSA 4GCIA 3D21A 3A5WA 4JR4A 2I1UA 2AJQB 6GSYA 3FZ9A 1T7PB 1V9WA 2FLSA 1Y25A 2LJKA 3GMFA 3LEFA 2RIIA 10GSA 1WRYA 4GQCA 4EF0A 4TXOA 5DAKA 1ZCPA 1PD21 1GSEA 2GZPA 4OFTA 1WIKA 3TUEA 3E9JB 3O6TA 4PUFC 2A4VA 3GKKA 12GSA 4LMWA 1R5PA 3QPMA 1J08A 1J0FA 1Z6MA 1GLQA 1XBSA 2JSZA 2LSTA 5J4UA 1NHOA 2P5QA 4YQUA 5G5EA 2VAFA 2CZ3A 4WKWA 2H6ZA 1FO5A 2CVBA 4EC0A 2P0GA 3IV4A 1A0RP 1O8WA 6GSVA 2N5FA 4HUAA 3GUSA 2X99A 1T4ZA 1TOFA 2IMEA 3F4RA 3CSJA 2VD1A 2B5EA 5E4WA 5KN0A 3TOUA 4ZL7A 3DEXA 1WP0A 3C1SA 3F4SA 3EURA 4KE3A 1LBKA 4MJCA 4WBRD 5CRDA 1FB6A 4MLYA 1UA5A 1VRSD 4MK3A 1R5AA 3HJOA 1B48A 4V1Ap 4L0UA 3D6IA 5HR1A 1E2YA 4TKYA 1EP8A 2WS2A 2NPBA 3WGEA 2E7PA 4IELA 1RW1A 3GNJA 4J2FA 3M1GA 1XW5A 3L0HA 3H4KA 5AGYA 1V40A 1Z6NA 3IK7A 1A2JA 1URMA 5D9VA 1XVQA 5DALB 3HA9A 1GH2A 4GQFA 2JU5A 3TB2A 1WJKA 4PQ1A 2IMDA 1OKDA 3IBHA 2E2MA 2QKEA 5JWOB 3QDNA 2VOCA 1O81A 1IYIA 4XHMA 2AYTA 2H19A 3ZMLA 17GSA 2HRNA 2FNOA 2WCIA 1SENA 2DJJA 2NDOA 3KP9A 4OCEA 4PGTA 1N8JA 4XS4B 2FWHA 4BWQA 2DMMA 1XOAA 4GLTA 2LS5A 3ERWA 5ELGA 5DALA 2H71A 4ISDA 1SJIA 2GSSA 4DVCA 2YV7A 1AIUA 4O7HA 1T4YA 1YEPA 2L57A 4I2TA 3HXSA 4Q5QA 3SBCA 3DYRA 3ZTLA 2ON7A 1A2MA 8GSSA 3IC4A 2GDRA 5LD0A 1W4VA 1TDIA 1TRUA 4L8EA 2HI7A 3F6FA 4HJ2A 1XFLA 4JE1A 3RPPA 4MCUA 2PWJA 3UL3A 1YEXA 4IVFA 2P5RA 3QAGA 2L59A 2LUSA 2VCVA 2K8SA 4KDUA 6GSXA 2F8FA 3KD0A 3MDKA 3N9JA 1KTEA 2CX3A 1YKAA 2F3MA 2WB9A 2I3YA 3BJ5A 2YZUA 2H66A 3F3RA 4Q5NA 2MMZA 2C80A 2M46A 4MABA 2PN8A 4BA7A 3HVSA 3QMXA 6GSSA 1LJRA 3IAS2 5DCHA 3P90A 4GSSA 3GH9A 2IMFA 1M9BA 5B8BA 5J9BA 2JSYA 1SL1B 3C7MA 3QAWA 1FVJA 4ML1A 1Z5YE 1ZMAA 3D22A 1XW6A 1VF1A 4V2NA 4EDYA 2VCZA 5ID2A 4IJ3A 1XIYA 1BJXA 1HQOA 2AV4A 1JLVA 3VWUA 5ECPB 1Q4JA 5LCZA 4OWYA 1OC8A 3IE3A 1GSUA 1U3AA 3GIXA 2MYGA 2NBSA 1QXHA 4PURA 2DIYA 3VWWA 1SK0A 3Q74A 1V57A 3RBTA 1EOGA 2FD3A 5HR3A 5IMFA 13GSA 3ZIJA 4NPBA 3G9BA 4AJ8A 4XS6A 1JLWA 1O85A 3WT1A 2FY6A 3I6AA 5HQPA 1Q98A 3GL5A 3CBUA 2JL4A 1WWJA 2BMXA 2K6VA 4OFMA 4WEYA 1GSDA 3APOA 2K9FA 14GSA 4RI6A 2H70A 1ZOFA 3TKSA 3ZVJA 4ZBBA 3CYNA 2X8GA 3FEUA 3QAVA 3FZ5A 1SYXA 1F9MA 1EWXA 1A8LA 3H93A 2O7KA 4KSOA 1JZWA 3LSZA 3Q18A 2VIMA 1GWCA 2JADA 3FK8A 1NHYA 1PX6A 4ZILA 3R2QA 3LJRA 1CQHA 4ZB6A 1X5CA 4K0GA 5JCGA 4ZB8A 4NWYA 2ON5A 1SKRB 4HOJA 1NSWA 4NXIA 4HEA2 4D73B 1B9XC 1SJZA 2H6YA 3F3QA 2RLIA 2BTOT 2WRTA 3VLNA 1K3OA 3LQ7A 5EVOA 1GLPA 2WDUA 4WF4A 1SKWB 1PA3A 1BYEA 1YZXA 1R7HA 5B8AA 1T3BA 2DJ0A 4F0BA 3IXRA 3GTUA 2YANA 4LL1B 2MZCA 2PU9C 5KN1A 1PKWA 4D73A 3C8EA 2VL2C 1M7TA 1A0FA 2QGVA 4MF6A 1AQWA 1TP9A 3KM6A 3DIEA 3WYWA 4P3YB 1MD3A 1TU7A 2IWTA 4K1FA 5D9WA 1ERTA 5IMDA 3ZL5A 4BWSA 3UEMA 3E0UA 4HI7A 3PINA
chains in the Genus database with same CATH superfamily
4J57E 3PPUA 4I97A 1BEDA 2C3TA 3LXZA 3GX0A 2GSQA 4N0ZA 3W8SA 4IHUA 2ZNMA 4ACSA 2H1AA 3D4MA 1ERWA 3H79A 2C0DA 3KJYA 20GSA 4MZCA 1VF4A 3OR5A 2IL3A 4KB3A 5B6MA 3MAKA 1QUWA 1NW2A 2JZTA 1G6YA 1SYRA 2RUEA 2TIRA 1QQ2A 1ZYQB 4PNFA 4K6XA 2GT5A 3GURA 4YAVA 4DSSB 1NM3A 4FO5A 1S3CA 3CSIA 3CTFA 3J7Yb 3ZVJD 3HKRA 2LRTA 4NMUA 4TR0A 1XWAA 4KCEA 5G2ZA 2GQKA 5IMCA 2LV3A 2ALBA 1PGTA 1FHEA 3TKQA 5HFKA 3GFKA 1K0OA 5A4WA 3VWXA 1F3BA 3UBKA 1O73A 4PX1A 2OBKA 3M0FA 5D9TA 4F9ZA 2CZ2A 3GKXA 4KSMA 3TJKA 4NV2A 2O87A 3DKSA 18GSA 2LJAA 5IQYA 3LWAA 1PRXA 5EPFA 1W89A 2YWIA 1TJDA 1PL1A 1U87A 2FUG2 4XTSA 2B3SA 4IKHA 2PGTA 5ENUA 1GTUA 1G7EA 3W6GA 1VF2A 1GTBA 3M9JA 4Q5RA 1GSSA 1TXXA 2C4JA 2CAIA 4RQRA 4X1UA 1A24A 4KH7A 4EIQA 2FGXA 2C3NA 2DJ3A 1YY7A 3LFLA 3PH9A 4K9ZA 3IC8A 3ZFLA 5L71A 4AGSA 3HJMA 2OKAA 4FH8A 1YKCA 2E2GA 1XWCA 4YQVA 1EEJA 4O32A 1PMTA 1XXUA 2R0GA 1MDIA 1ML6A 1ST9A 3UAPA 1S3RA 3I69A 4POLA 2K18A 1SK1A 2R0CA 2V6KA 3M3MA 3NIVA 2AUVA 2B7JA 2H1DA 1M2BA 1GSQA 5F07A 2R37A 4BVXA 4HZ2A 3FRCA 4AF2A 2L5LA 5D8IA 3TKRA 3EVIA 3UMAA 2WFCA 3HVXA 3CSHA 5D93A 1XCCA 2DSAA 4YQMA 2CQ9A 2P31A 3EINA 2GVPA 3C73A 3VURA 1RQMA 2YJ7A 1K3YA 3UOMA 2YPMA 6GSWA 2XC2A 3L9SA 2LQQA 2H8LA 2DKHA 1TK0B 1GNWA 2HZEB 4JZQA 1HD2A 4OCFA 3EC3A 3FZ4A 4AJ6A 2FWEA 4IS0A 1TI3A 1AC1A 2V1MA 4I5QA 1OKTA 2JACA 2I81A 4WF5A 2WGRA 2X8CA 3M9KA 4GTUA 1TI1A 2X49A 1GTIA 3WGDA 1ILOA 2J9HA 1M2AA 3F9UA 1MDJA 4KW6A 3HVVA 2LRNA 4TVEA 2VCWA 1B4QA 4KDXA 4G0IA 5DCGA 3UIWA 2HLSA 2H74A 2C3QA 1UVZA 3QD9A 2Z9SA 3LYPA 2H6XA 1ACVA 4POBA 1AXDA 1O7UA 4X43A 1DUGA 4EE0A 5G1KA 3ERFA 1JZDA 2PPTA 5CO3A 1THOA 3M8NA 2CT6A 3RDWA 4XRDA 5G5FA 1LU4A 2A2PA 4GRFA 3HVNA 4IQAA 3MWHA 3QOUA 9GSSA 1H75A 2HXKA 3ZITA 4O92A 4XS4A 2H0HA 1JFUA 1F6MC 1FVKA 5CRWA 3DMLA 5HR2A 5C04A 3CRUA 1GUMA 3F0IA 2DMLA 1HNBA 4X4JA 1EOHA 2FWGA 4TR4A 2L6DA 5ECHB 4DSQA 3UJ1A 1SD8A 2YV9A 3P8WA 2O85A 3LORA 2VL9A 3RAZA 2IMKA 4CDOA 5A5KA 2KP2A 4O5UA 5AN1A 3GYKA 1R4WA 2VCQA 4F0CA 3QFBC 3BD2A 3BCIA 2FA4A 4WR5A 1U6TA 3ZYWA 2MMAA 3VI5A 4K0NA 1F2EA 5E59A 3IDVA 2GQMA 4MJEA 4EVMA 4XIHA 1GUKA 2EIQA 16GSA 3HJPA 5J41A 2DJ1A 2DJKA 1WMJA 4IP6A 1F3AA 1XPVA 2D2ZA 2RUFA 4ICYA 3DGQA 1K0NA 2HZFA 1V2AA 1XWGA 4G2EA 4HU7A 3FMWA 3UVTA 4TRXA 2KHPA 2FHEA 4IJIA 5EL8A 5ELAA 4E8HA 5F8BA 5KOWA 2KP1A 22GSA 4ZIJA 2OE0A 3VPTA 4MPFA 1QFNA 1V98A 1M2DA 1I9DA 5D96A 3NOFA 4Z7XA 5CAXA 4OO4A 5F0GA 5DBQA 1YF1A 4I2UA 4H86A 4LMVA 2PBJA 2VUPA 3US3A 2B6MA 2C8UA 5J5NA 4AJ7A 2X64A 3C71A 1K0MA 2TRXA 2REMA 5F06A 1QGVA 5C00A 4EL1A 3RHBA 3KCMA 5IO0A 2VL2A 2PVQA 2L4CA 4JBBA 2C0EA 2C0GA 3IHQA 2GS3A 3U6VA 2MMNA 3DD3A 1XWKA 1TRWA 2OBIA 4F82A 2FCHA 3F6DA 3HHVA 4YAPA 3HCZA 4BVYA 2B7KA 1FG4A 1S3DA 4NAXA 4G19A 4RQXA 3VFIA 3PR8A 4N30A 4K7OA 5DDLA 4J56E 4PNGA 2GSRA 4XRAA 3Q19A 1UN2A 4KCAA 3MSZA 4K2DA 4N0VA 2AHEA 1EZKA 4EKZA 3CQFA 2HRAA 3WGXA 2WULA 1SJ6A 5HR0A 1G7OA 1S3AA 3A5IA 5ECNB 1GSYA 2IMIA 19GSA 4ID0A 4GXZA 1A8YA 4HSCX 5IM9A 1MD4A 2ES7A 1ON4A 2YZHA 2VCTA 2H1GA 2HT9A 2MBTA 2PUKC 1N2AA 1BX9A 1U88A 4L0WA 4G0KA 1M99A 1PL2A 4MF7A 3KTBA 4IQ1A 5KN2A 1VGLA 5F05A 1OC9B 3E3EA 3TGZA 5A4UA 3GRXA 2B5XA 2LJRA 3DVWA 2YNXA 2QA2A 1FOHA 3GSSA 2CAQA 5BRTA 1TK8B 1SKSB 4ECBA 2HYXA 5AISA 1ZYPA 1TW9A 2JZSA 2DJ2A 3LYKA 3KEBA 2EIOA 3SWLA 5FWGA 3TJJA 2LQOA 4PUAA 4TXVA 1PKZA 4HJMA 5CYYA 2L6CA 1JZOA 2XBQA 3FR3A 2MBSA 3IRAA 2VCXA 4ECIA 3I9V2 1XG8A 3IHGA 4MA9A 1K0DA 2CA8A 5H5RA 3QR6A 3TJGA 5ECLB 3VWVA 4EUYA 1M9AA 2VLUA 3DVXA 2WZ9A 3I43A 1WPIA 4OMVA 2H01A 1RK4A 2V2GA 2OACA 2VO4A 2HE3A 2HFDA 5EY6A 3G7JA 2IPAA 4ZB9A 2C0FA 4ZXGA 1XWBA 1A2LA 2BJXA 3IR4A 1Z7RA 2E0QA 11GSA 2H0IA 1B8XA 2LNTA 4IBPA 3ME7A 4TR3A 5IO2A 2H30A 3D0ZA 4I8BA 2YP6A 5B6NA 3KTLA 2M72A 4E8EA 4OO5A 4V1Ag 3RHCA 3QFAC 3MNGA 3KIJA 2VL3A 3EE2A 2F8AA 3ZRDA 2HRFA 1TRVA 1HYUA 3KZQA 3GX8A 3HD5A 2EIRA 4KUNA 3J7Yk 4OFNA 1M0UA 5G31A 4POKA 5FT3A 5DVBA 2A2SA 4DSSA 5GSTA 4NV5A 5INYA 1EV4A 2J23A 5D9XA 4TXOB 1GP1A 5DAKB 4O5RA 2VLVA 2QSIA 2V32A 1Z3EA 4FIWA 4ILFA 1HNAA 2OA7A 5ECRB 3IPZA 3TJFA 4ECCA 1TTZA 2HNLA 5J9CA 4IGJA 2OE3A 3ED3A 5GSSA 3L9UA 2LNSA 2K8VA 1XVWA 1ERUA 3ZFBA 3GL3A 3TOTA 2PVOC 4MP4A 3A2VA 4LL4B 2HSMA 5FHIA 3QCPA 5IIZA 2H0GA 5CREA 2V6OA 1B9YC 3ZLPA 1SL2B 1OYJA 3L9VA 4KNDA 1EGOA 3V1WA 3GKMA 1AAZA 3UBLA 2R5GA 4MMMA 2H72A 3FR6A 4F03A 1T00A 1XZOA 4OD7A 3KMNA 3BBYA 4IN0A 1ZGNA 4QL9A 5KN3A 1THXA 4HQSA 2EC4A 5ECSA 2I9HA 1SL0B 1Z7PA 3A2XA 3A2WA 4A5PA 6GSTA 1O8XA 2MMOA 1JZRA 4FYBA 5LNKe 2QC7A 4MNNA 2L5OA 3AY8A 3HY2A 4DEJA 5JCWA 2O89A 2H76A 4EDZA 4MJAA 5IOXA 2FWFA 5G1LA 1ERVA 4IW9A 4F2IA 1K0BA 4JEDA 3L78A 5ECOB 4KX4A 2R2JA 3JCML 2AB6A 4Z2TA 1GL8A 1ZYNA 5DJLA 2YWNA 2M80A 4KGIA 1HNCA 4LLRA 2WJUA 5IOWA 2ZUPA 5H5SA 4PXOA 2UZ8A 1EP7A 4FQUA 3TRQA 2DLXA 4N10A 5GZZB 4EXJA 4XS1A 2HZEA 3TDGA 2N5BA 2XPEA 2YN1A 1USBA 4PQIA 3IA1A 4WXTA 5DQSA 5CNWA 3HDCA 1MDKA 2HSYA 1MEKA 3P7XA 5DQYA 1TRSA 3H1NA 2F51A 1TKDB 3BCKA 1T8EB 2PMTA 4Q5FA 4WETA 3WD6A 1SK2A 5COHA 2HSHA 3R3EA 5IPGA 4V2MA 1CQGA 4N11A 5IMVA 2H1BA 4I6XA 4ZBDA 5HFGA 3RPNA 2IIYA 4YH2A 2OADA 5JCUA 1YJ6A 1R26A 3C1RA 4TN8A 1PN9A 2JZRA 3BOAA 1K0CA 4HS1A 2F9SA 1OAZA 1KEBA 1X9MB 3KH9A 2GLRA 2KOKA 3FYGA 5DJMA 2YJHA 1U3IA 3K8NA 5H5QA 2XHFA 3CRTA 3EMXA 1SU9A 5ECMB 7GSSA 3EWLA 3TRPA 5ID2B 6GSUA 5ECQB 1GULA 2YOIA 4EIPA 5KEJA 1ZL9A 2NVLA 1E6BA 4HQZA 4MH2A 5CP1A 3APQA 1EGRA 4MZBA 3D4TA 4ML6A 5HFIA 3GN3A 1UC7A 2O8VB 3GSTA 4G10A 2GZZA 2B1KA 3EU4A 1SD9A 3TKSE 1A23A 1QMVA 2YCDA 4LA1A 2N5AA 5AIXA 1IYHA 2GTUA 2XPDA 1GRXA 4CY8A 2TRCP 1ZZYA 5IMAA 1EEMA 2G2QA 3FKFA 4MZWA 5GAND 4MJBA 5JWRB 4BPYA 1K3LA 1X0RA 3A3TA 2X8HA 3APSA 2I4AA 4NHZA 1JHBA 3P2AA 1DSBA 1FW1A 2VM1A 3W8JA 4MPGA 1OE8A 2CX4A 1DE2A 1X9WB 2GGTA 2OJLA 5ECIB 1B4PA 3CXGA 1YF0A 4WR4A 3HZ4A 3F8UA 3KMOA 4QQ7A 2H73A 4MDCA 1OVNA 3TCOA 1BAYA 1TK5B 2RM5A 1C72A 4L5OA 4WBJA 3UARA 3IK9A 4K8MA 3IAM2 3F4TA 2H75A 1WE0A 5ECKB 2GZYA 1OC3A 2RM6A 4CHSA 2R3XA 4NHWA 2IFQB 2YWOA 1KBNA 4JR6A 4KAEA 3ZMKA 2PERA 4KF9A 3PGTA 1X9SB 4HDEA 1MTCA 5G30A 3CTGA 4O5QA 2CVDA 4G9HA 1O6JA 3S9FA 3LXTA 4TW5A 2LRCA 2B1LA 1DE1A 3HYPA 2NTOA 5IMZA 3KH7A 1FOVA 1AQXA 4HU9A 5IPHA 3FHKA 4TOPA 3HZ8A 3LG6A 4ZBAA 3VPQA 4HZ4A 3G7YA 2VM2A 2GT6A 2R6KA 3H8QA 2IFQA 3ME8A 3KP8A 4DSRA 2OE1A 5B7CA 2CVKA 3FR9A 4JRRA 3GHAA 3DXBA 2DBCA 4JU5A 4X0XA 1GNEA 3D5JA 3KXOA 3GTUB 4GWRA 3EMPA 3VI7A 4ECJA 5CRHA 1XOBA 2B5YA 1G6WA 3EYTA 3WT2A 1T1VA 3VK9A 1G0TA 5A4VA 3GH6A 2GQLA 3ISOA 2CV4A 1KNGA 4MH3A 4BL7B 3F63A 3DWVA 4GSNA 4PQHA 1GSFA 3FY7A 2R4VA 2FA8A 1BG5A 2L4QA 1OC9A 1FB0A 3ERGA 3G7IA 4TR1B 2LTKA 1AUCA 2XBIA 1H4OA 1ABAA 3DRNA 5AIVA 1FAAA 2X4AA 3NZNA 4ZL8A 2ZCTA 5CRGA 4GSTA 3EU3A 1GUHA 3FW2A 4BL7A 4QL7A 2VD0A 4KDYA 3TKSC 5ABRA 3O76A 3L4NA 1YQ1A 4K7NA 1ZYEA 4KA0A 1QK8A 5JWQB 3TJBA 4IP1A 3UVHA 1AW9A 1AQVA 2V41A 4CY6A 3GKNA 1V58A 4K7IA 1PSQA 1X5DA 4TR1A 3CMIA 2IJYA 4POMA 3GV1A 3ZIVA 5D73A 1M3JA 4EO3A 4ULXA 3TKPA 2GSTA 1GTAA 1I5GA 1PX7A 4FYCA 4ZL9A 1WOUA 3ZZXA 4V2LA 2YWMA 1DBYA 3KGKA 2HRKA 2LEGA 4Z2UA 3N5OA 2KUCA 1TU8A 1K0AA 5GAPD 1X5EA 3EPTA 1YDKA 3GA4A 4RI7A 4XCSA 2DIZA 3TRXA 1Y6EA 3LGCA 4L5LA 2G0FA 3FZAA 4GF0A 5J3RA 1BQ7A 2LKUA 1J9BA 3U5RE 2IN3A 2KLXA 4FYUA 1XW9A 4RUVA 3Q6OA 2A2RA 1VF3A 2C1YA 1F37A 3O3TA 1EV9A 3ZREA 1OE7A 2AAWA 2DC5A 2VLTA 4MF5A 1PQNA 1Z9HA 4CW9A 3IOSA 4GCIA 3D21A 3A5WA 4JR4A 2I1UA 2AJQB 6GSYA 3FZ9A 1T7PB 1V9WA 4Z2RA 2FLSA 1Y25A 2LJKA 3GMFA 3LEFA 2RIIA 10GSA 1WRYA 4GQCA 4EF0A 4TXOA 5DAKA 1ZCPA 1PD21 1GSEA 2GZPA 4BVXB 4OFTA 1WIKA 3TUEA 3E9JB 3O6TA 4PUFC 2A4VA 3GKKA 12GSA 4LMWA 1R5PA 3QPMA 1J08A 1J0FA 5BMUA 2DKIA 1Z6MA 1GLQA 1XBSA 2JSZA 2LSTA 5J4UA 1NHOA 2P5QA 4YQUA 5G5EA 2VAFA 2CZ3A 4WKWA 2H6ZA 1FO5A 2CVBA 4EC0A 2P0GA 3IV4A 1A0RP 1O8WA 6GSVA 2N5FA 4HUAA 3GUSA 2X99A 1T4ZA 1TOFA 2IMEA 3F4RA 3CSJA 2VD1A 2B5EA 5E4WA 5KN0A 3TOUA 4ZL7A 3DEXA 1WP0A 3C1SA 3F4SA 3EURA 4KE3A 3LW9A 1LBKA 4MJCA 5CRDA 4WBRD 1FB6A 4MLYA 1UA5A 1VRSD 4MK3A 1R5AA 3HJOA 1B48A 4V1Ap 4L0UA 3D6IA 5HR1A 1E2YA 4TKYA 1EP8A 2WS2A 2NPBA 3WGEA 2E7PA 4IELA 1RW1A 3GNJA 4J2FA 3M1GA 1XW5A 3L0HA 3H4KA 5AGYA 1V40A 1Z6NA 3IK7A 1A2JA 1URMA 5D9VA 1XVQA 5DALB 3HA9A 1GH2A 4GQFA 2JU5A 3TB2A 1WJKA 4PQ1A 2IMDA 1OKDA 3IBHA 2E2MA 2QKEA 5JWOB 3QDNA 2VOCA 1O81A 1IYIA 4XHMA 2AYTA 2H19A 3ZMLA 17GSA 2HRNA 2FNOA 2WCIA 1SENA 2DJJA 2NDOA 3KP9A 4OCEA 4PGTA 1N8JA 4XS4B 1PN0A 2FWHA 4BWQA 2DMMA 1XOAA 4GLTA 2LS5A 3ERWA 5ELGA 5DALA 2H71A 4ISDA 1SJIA 2GSSA 4DVCA 2YV7A 1AIUA 4O7HA 1T4YA 1YEPA 2L57A 4I2TA 3HXSA 4Q5QA 3SBCA 3DYRA 3ZTLA 2ON7A 1A2MA 8GSSA 3IC4A 2GDRA 5LD0A 1W4VA 1TDIA 1TRUA 4L8EA 2HI7A 3F6FA 4HJ2A 4K2XA 1XFLA 4JE1A 3RPPA 4MCUA 2PWJA 3UL3A 1YEXA 4IVFA 2P5RA 3QAGA 2L59A 2LUSA 2VCVA 2K8SA 4KDUA 6GSXA 2F8FA 3KD0A 3MDKA 3N9JA 1KTEA 2CX3A 1YKAA 2F3MA 2WB9A 3MIXA 2I3YA 4BIKA 3BJ5A 2YZUA 2H66A 3F3RA 4YKFA 4Q5NA 2MMZA 2C80A 2M46A 4MABA 2PN8A 4BA7A 3HVSA 3QMXA 6GSSA 1LJRA 3IAS2 5DCHA 4YKGA 3P90A 4GSSA 3GH9A 2IMFA 1M9BA 5B8BA 5J9BA 2JSYA 1SL1B 3C7MA 3QAWA 1FVJA 4ML1A 1Z5YE 1ZMAA 3D22A 1XW6A 1VF1A 4V2NA 4EDYA 2VCZA 5ID2A 4IJ3A 1XIYA 1BJXA 1HQOA 2AV4A 1JLVA 3VWUA 5ECPB 1Q4JA 5LCZA 4OWYA 1OC8A 3IE3A 1GSUA 1U3AA 3GIXA 2A4HA 2MYGA 2NBSA 1QXHA 4PURA 2DIYA 3VWWA 1SK0A 3Q74A 1V57A 3RBTA 1EOGA 2FD3A 5HR3A 5IMFA 13GSA 3ZIJA 4NPBA 4BVYB 3G9BA 4AJ8A 4XS6A 1JLWA 1O85A 3WT1A 2FY6A 3I6AA 5HQPA 1Q98A 3GL5A 3CBUA 2JL4A 1WWJA 2BMXA 2K6VA 4OFMA 4WEYA 1GSDA 3APOA 5KOXA 2K9FA 1M3IA 14GSA 4RI6A 2H70A 1ZOFA 3TKSA 3ZVJA 4ZBBA 3CYNA 2X8GA 3FEUA 4K5RA 3QAVA 3FZ5A 1SYXA 1F9MA 1EWXA 1A8LA 3H93A 2O7KA 4KSOA 1JZWA 3LSZA 3Q18A 2VIMA 1GWCA 2JADA 3FK8A 1NHYA 1PX6A 4ZILA 3R2QA 3LJRA 1CQHA 4ZB6A 1X5CA 4K0GA 5JCGA 4ZB8A 4K5SA 4NWYA 2ON5A 1SKRB 4HOJA 1NSWA 2QA1A 4NXIA 4HEA2 4D73B 1B9XC 1SJZA 2H6YA 3F3QA 2RLIA 2BTOT 2WRTA 3VLNA 1K3OA 4PTSA 3LQ7A 5EVOA 1GLPA 2WDUA 4WF4A 1SKWB 1PA3A 1BYEA 1YZXA 1PFOA 1R7HA 5B8AA 1T3BA 2DJ0A 4G0LA 4F0BA 3IXRA 3GTUA 2R0PA 2YANA 4LL1B 2MZCA 2PU9C 5KN1A 1PKWA 4D73A 3MYDA 3C8EA 2VL2C 1M7TA 1A0FA 2QGVA 4MF6A 1AQWA 1TP9A 3KM6A 3DIEA 3WYWA 4P3YB 1MD3A 1TU7A 2IWTA 4K1FA 5D9WA 1ERTA 5IMDA 3ZL5A 4USSA 4BWSA 3UEMA 3E0UA 4HI7A 3PINA
chains in the Genus database with same CATH topology
4J57E 3PPUA 4I97A 1BEDA 2C3TA 3LXZA 3GX0A 2GSQA 4N0ZA 3W8SA 4IHUA 2ZNMA 4ACSA 2H1AA 3D4MA 1ERWA 3H79A 2C0DA 3KJYA 20GSA 4MZCA 1VF4A 3OR5A 2IL3A 4KB3A 5B6MA 3MAKA 1QUWA 1NW2A 2JZTA 1G6YA 1SYRA 2RUEA 2TIRA 1QQ2A 1ZYQB 4PNFA 4K6XA 2GT5A 3GURA 4YAVA 4DSSB 1NM3A 4FO5A 1S3CA 3CSIA 3CTFA 3J7Yb 3ZVJD 3HKRA 2LRTA 4NMUA 4TR0A 1XWAA 4KCEA 5G2ZA 2GQKA 5IMCA 2LV3A 2ALBA 1PGTA 1FHEA 3TKQA 5HFKA 3GFKA 1K0OA 5A4WA 3VWXA 1F3BA 3UBKA 1O73A 4PX1A 2OBKA 3M0FA 5D9TA 4F9ZA 2CZ2A 3GKXA 4KSMA 3TJKA 4NV2A 2O87A 3DKSA 18GSA 2LJAA 5IQYA 3LWAA 1PRXA 5EPFA 1W89A 2YWIA 1TJDA 1PL1A 1U87A 2FUG2 4XTSA 2B3SA 4IKHA 2PGTA 5ENUA 1GTUA 1G7EA 3W6GA 1VF2A 1GTBA 3M9JA 4Q5RA 1GSSA 1TXXA 2C4JA 2CAIA 4RQRA 4X1UA 1A24A 4KH7A 4EIQA 2FGXA 2C3NA 2DJ3A 1YY7A 3LFLA 3PH9A 4K9ZA 3IC8A 3ZFLA 5L71A 4AGSA 3HJMA 2OKAA 4FH8A 1YKCA 2E2GA 1XWCA 4YQVA 1EEJA 4O32A 1PMTA 1XXUA 2R0GA 1MDIA 1ML6A 1ST9A 3UAPA 3I69A 4POLA 2K18A 1SK1A 2R0CA 2V6KA 3M3MA 3NIVA 2AUVA 2B7JA 2H1DA 1M2BA 1GSQA 5F07A 2R37A 4BVXA 4HZ2A 3FRCA 4AF2A 2L5LA 5D8IA 3TKRA 3EVIA 3UMAA 2WFCA 3HVXA 3CSHA 5D93A 1XCCA 2DSAA 4YQMA 2CQ9A 2P31A 3EINA 2GVPA 3C73A 3VURA 1RQMA 2YJ7A 1K3YA 3UOMA 2YPMA 6GSWA 2XC2A 3L9SA 2LQQA 2H8LA 2DKHA 1TK0B 1GNWA 2HZEB 4JZQA 1HD2A 4OCFA 3EC3A 3FZ4A 4AJ6A 2FWEA 4IS0A 1TI3A 1AC1A 2V1MA 4I5QA 1OKTA 2JACA 2I81A 4WF5A 2WGRA 2X8CA 3M9KA 4GTUA 1TI1A 2X49A 1GTIA 3WGDA 1ILOA 2J9HA 1M2AA 3F9UA 1MDJA 4KW6A 3HVVA 2LRNA 4TVEA 2VCWA 1B4QA 4KDXA 4G0IA 5DCGA 3UIWA 2HLSA 2H74A 2C3QA 1UVZA 3QD9A 2Z9SA 3LYPA 2H6XA 1ACVA 4POBA 1AXDA 1O7UA 4X43A 1DUGA 4EE0A 5G1KA 3ERFA 1JZDA 2PPTA 5CO3A 1THOA 3M8NA 2CT6A 3RDWA 4XRDA 5G5FA 1LU4A 2A2PA 4GRFA 4IQAA 3MWHA 3QOUA 9GSSA 1H75A 2HXKA 3ZITA 4O92A 4XS4A 2H0HA 1JFUA 1F6MC 1FVKA 5CRWA 3DMLA 5HR2A 5C04A 3CRUA 1GUMA 3F0IA 2DMLA 1HNBA 4X4JA 1EOHA 2FWGA 4TR4A 2L6DA 5ECHB 4DSQA 3UJ1A 1SD8A 2YV9A 3P8WA 2O85A 3LORA 2VL9A 3RAZA 2IMKA 4CDOA 5A5KA 2KP2A 4O5UA 5AN1A 3GYKA 1R4WA 2VCQA 4F0CA 3QFBC 3BD2A 3BCIA 2FA4A 4WR5A 1U6TA 3ZYWA 2MMAA 3VI5A 4K0NA 1F2EA 5E59A 3IDVA 2GQMA 4MJEA 4EVMA 4XIHA 1GUKA 2EIQA 16GSA 3HJPA 5J41A 2DJ1A 2DJKA 1WMJA 4IP6A 1F3AA 1XPVA 2D2ZA 2RUFA 4ICYA 3DGQA 1K0NA 2HZFA 1V2AA 1XWGA 4G2EA 4HU7A 3FMWA 3UVTA 4TRXA 2KHPA 2FHEA 4IJIA 5EL8A 5ELAA 4E8HA 5F8BA 5KOWA 2KP1A 22GSA 4ZIJA 2OE0A 3VPTA 4MPFA 1QFNA 1V98A 1M2DA 1I9DA 5D96A 3NOFA 4Z7XA 5CAXA 4OO4A 5F0GA 5DBQA 1YF1A 4I2UA 4H86A 4LMVA 2PBJA 2VUPA 3US3A 2B6MA 2C8UA 5J5NA 4AJ7A 2X64A 3C71A 1K0MA 2TRXA 2REMA 5F06A 1QGVA 5C00A 4EL1A 3RHBA 3KCMA 5IO0A 2VL2A 2PVQA 2L4CA 4JBBA 2C0EA 2C0GA 3IHQA 2GS3A 3U6VA 2MMNA 3DD3A 1XWKA 1TRWA 2OBIA 4F82A 2FCHA 3F6DA 3HHVA 4YAPA 3HCZA 4BVYA 2B7KA 1FG4A 1S3DA 4NAXA 4G19A 4RQXA 3VFIA 3PR8A 4N30A 4K7OA 5DDLA 4J56E 4PNGA 2GSRA 4XRAA 3Q19A 1UN2A 4KCAA 3MSZA 4K2DA 4N0VA 2AHEA 1EZKA 4EKZA 2HRAA 3WGXA 2WULA 1SJ6A 5HR0A 1G7OA 1S3AA 3A5IA 5ECNB 1GSYA 2IMIA 19GSA 4ID0A 4GXZA 1A8YA 5IM9A 1MD4A 2ES7A 1ON4A 2YZHA 2VCTA 2H1GA 2HT9A 2MBTA 2PUKC 1N2AA 1BX9A 1U88A 4L0WA 4G0KA 1M99A 1PL2A 4MF7A 3KTBA 4IQ1A 5KN2A 1VGLA 5F05A 1OC9B 3E3EA 3TGZA 5A4UA 3GRXA 2B5XA 2LJRA 3DVWA 2YNXA 2QA2A 1FOHA 3GSSA 2CAQA 5BRTA 1TK8B 1SKSB 4ECBA 2HYXA 5AISA 1ZYPA 1TW9A 2JZSA 2DJ2A 3LYKA 3KEBA 2EIOA 3SWLA 5FWGA 3TJJA 2LQOA 4PUAA 4TXVA 1PKZA 4HJMA 5CYYA 2L6CA 1JZOA 2XBQA 3FR3A 2MBSA 3IRAA 2VCXA 4ECIA 3I9V2 3IHGA 4MA9A 1K0DA 2CA8A 5H5RA 3QR6A 3TJGA 5ECLB 3VWVA 4EUYA 1M9AA 2VLUA 3DVXA 2WZ9A 3I43A 1WPIA 4OMVA 2H01A 1RK4A 2V2GA 2OACA 2VO4A 2HE3A 2HFDA 5EY6A 3G7JA 2IPAA 4ZB9A 2C0FA 4ZXGA 1XWBA 1A2LA 2BJXA 3IR4A 1Z7RA 2E0QA 11GSA 2H0IA 1B8XA 2LNTA 4IBPA 3ME7A 4TR3A 5IO2A 2H30A 3D0ZA 4I8BA 2YP6A 5B6NA 3KTLA 2M72A 4E8EA 4OO5A 4V1Ag 3RHCA 3QFAC 3MNGA 3KIJA 2VL3A 3EE2A 2F8AA 3ZRDA 2HRFA 1TRVA 1HYUA 3KZQA 3GX8A 3HD5A 2EIRA 4KUNA 3J7Yk 4OFNA 1M0UA 5G31A 4POKA 5FT3A 5DVBA 2A2SA 4DSSA 5GSTA 4NV5A 5INYA 1EV4A 2J23A 5D9XA 4TXOB 1GP1A 5DAKB 4O5RA 2VLVA 2QSIA 2V32A 1Z3EA 4FIWA 4ILFA 1HNAA 2OA7A 5ECRB 3IPZA 3TJFA 4ECCA 1TTZA 2HNLA 5J9CA 4IGJA 2OE3A 3ED3A 5GSSA 3L9UA 2LNSA 2K8VA 1XVWA 1ERUA 3ZFBA 3GL3A 3TOTA 2PVOC 4MP4A 3A2VA 4LL4B 2HSMA 5FHIA 3QCPA 5IIZA 2H0GA 5CREA 2V6OA 1B9YC 3ZLPA 1SL2B 1OYJA 3L9VA 4KNDA 1EGOA 3V1WA 3GKMA 1AAZA 3UBLA 2R5GA 4MMMA 2H72A 3FR6A 4F03A 1T00A 1XZOA 4OD7A 3KMNA 3BBYA 4IN0A 1ZGNA 4QL9A 5KN3A 1THXA 4HQSA 2EC4A 5ECSA 2I9HA 1SL0B 1Z7PA 3A2XA 3A2WA 4A5PA 6GSTA 1O8XA 2MMOA 1JZRA 4FYBA 5LNKe 2QC7A 4MNNA 2L5OA 3AY8A 3HY2A 4DEJA 5JCWA 2O89A 2H76A 4EDZA 4MJAA 5IOXA 2FWFA 5G1LA 1ERVA 4IW9A 4F2IA 1K0BA 4JEDA 3L78A 5ECOB 4KX4A 2R2JA 3JCML 2AB6A 4Z2TA 1GL8A 1ZYNA 5DJLA 2YWNA 2M80A 4KGIA 1HNCA 4LLRA 2WJUA 5IOWA 2ZUPA 5H5SA 4PXOA 2UZ8A 1EP7A 4FQUA 3TRQA 2DLXA 4N10A 5GZZB 4EXJA 4XS1A 2HZEA 3TDGA 2N5BA 2XPEA 2YN1A 1USBA 4PQIA 3IA1A 4WXTA 5DQSA 5CNWA 3HDCA 1MDKA 2HSYA 1MEKA 3P7XA 5DQYA 1TRSA 3H1NA 2F51A 1TKDB 3BCKA 1T8EB 2PMTA 4Q5FA 4WETA 3WD6A 1SK2A 5COHA 2HSHA 3R3EA 5IPGA 4V2MA 1CQGA 4N11A 5IMVA 2H1BA 4I6XA 4ZBDA 5HFGA 3RPNA 2IIYA 4YH2A 2OADA 5JCUA 1YJ6A 1R26A 3C1RA 4TN8A 1PN9A 2JZRA 3BOAA 1K0CA 4HS1A 2F9SA 1OAZA 1KEBA 1X9MB 3KH9A 2GLRA 2KOKA 3FYGA 5DJMA 2YJHA 1U3IA 3K8NA 5H5QA 2XHFA 3CRTA 3EMXA 1SU9A 5ECMB 7GSSA 3EWLA 3TRPA 5ID2B 6GSUA 5ECQB 1GULA 2YOIA 4EIPA 5KEJA 1ZL9A 2NVLA 1E6BA 4HQZA 4MH2A 5CP1A 3APQA 1EGRA 4MZBA 3D4TA 4ML6A 5HFIA 3GN3A 1UC7A 2O8VB 3GSTA 4G10A 2GZZA 2B1KA 3EU4A 1SD9A 3TKSE 1A23A 1QMVA 2YCDA 4LA1A 2N5AA 5AIXA 1IYHA 2GTUA 2XPDA 1GRXA 4CY8A 2TRCP 1ZZYA 5IMAA 1EEMA 2G2QA 3FKFA 4MZWA 5GAND 4MJBA 5JWRB 4BPYA 1K3LA 1X0RA 3A3TA 2X8HA 3APSA 2I4AA 4NHZA 1JHBA 3P2AA 1DSBA 1FW1A 2VM1A 3W8JA 4MPGA 1OE8A 2CX4A 1DE2A 1X9WB 2GGTA 2OJLA 5ECIB 1B4PA 3CXGA 1YF0A 4WR4A 3HZ4A 3F8UA 3KMOA 4QQ7A 2H73A 4MDCA 1OVNA 3TCOA 1BAYA 1TK5B 2RM5A 1C72A 4L5OA 4WBJA 3UARA 3IK9A 4K8MA 3IAM2 3F4TA 2H75A 1WE0A 5ECKB 2GZYA 1OC3A 2RM6A 4CHSA 2R3XA 4NHWA 2IFQB 2YWOA 1KBNA 4JR6A 4KAEA 3ZMKA 2PERA 4KF9A 3PGTA 1X9SB 4HDEA 1MTCA 5G30A 3CTGA 4O5QA 2CVDA 4G9HA 1O6JA 3S9FA 3LXTA 4TW5A 2LRCA 2B1LA 1DE1A 3HYPA 2NTOA 5IMZA 3KH7A 1FOVA 1AQXA 4HU9A 5IPHA 3FHKA 4TOPA 3HZ8A 3LG6A 4ZBAA 3VPQA 4HZ4A 3G7YA 2VM2A 2GT6A 2R6KA 3H8QA 2IFQA 3ME8A 3KP8A 4DSRA 2OE1A 5B7CA 2CVKA 3FR9A 4JRRA 3GHAA 3DXBA 2DBCA 4JU5A 4X0XA 1GNEA 3D5JA 3KXOA 3GTUB 4GWRA 3EMPA 3VI7A 4ECJA 5CRHA 1XOBA 2B5YA 1G6WA 3EYTA 3WT2A 1T1VA 3VK9A 1G0TA 5A4VA 3GH6A 2GQLA 3ISOA 2CV4A 1KNGA 4MH3A 4BL7B 3F63A 3DWVA 4GSNA 4PQHA 1GSFA 3FY7A 2R4VA 2FA8A 1BG5A 2L4QA 1OC9A 1FB0A 3ERGA 3G7IA 4TR1B 2LTKA 1AUCA 2XBIA 1H4OA 1ABAA 3DRNA 5AIVA 1FAAA 2X4AA 3NZNA 4ZL8A 2ZCTA 5CRGA 4GSTA 3EU3A 1GUHA 3FW2A 4BL7A 4QL7A 2VD0A 4KDYA 3TKSC 5ABRA 3O76A 3L4NA 1YQ1A 4K7NA 1ZYEA 4KA0A 1QK8A 5JWQB 3TJBA 4IP1A 3UVHA 1AW9A 1AQVA 2V41A 4CY6A 3GKNA 1V58A 4K7IA 1PSQA 1X5DA 4TR1A 3CMIA 2IJYA 4POMA 3GV1A 3ZIVA 5D73A 4EO3A 4ULXA 3TKPA 2GSTA 1GTAA 1I5GA 1PX7A 4FYCA 4ZL9A 1WOUA 3ZZXA 4V2LA 2YWMA 1DBYA 3KGKA 2HRKA 2LEGA 4Z2UA 3N5OA 2KUCA 1TU8A 1K0AA 5GAPD 1X5EA 3EPTA 1YDKA 3GA4A 4RI7A 4XCSA 2DIZA 3TRXA 1Y6EA 3LGCA 4L5LA 2G0FA 3FZAA 4GF0A 5J3RA 1BQ7A 2LKUA 1J9BA 3U5RE 2IN3A 2KLXA 4FYUA 1XW9A 4RUVA 3Q6OA 2A2RA 1VF3A 2C1YA 1F37A 3O3TA 1EV9A 3ZREA 1OE7A 2AAWA 2DC5A 2VLTA 4MF5A 1PQNA 1Z9HA 4CW9A 3IOSA 4GCIA 3D21A 3A5WA 4JR4A 2I1UA 2AJQB 6GSYA 3FZ9A 1T7PB 1V9WA 4Z2RA 2FLSA 1Y25A 2LJKA 3GMFA 3LEFA 2RIIA 10GSA 1WRYA 4GQCA 4EF0A 4TXOA 5DAKA 1ZCPA 1PD21 1GSEA 2GZPA 4BVXB 4OFTA 1WIKA 3TUEA 3E9JB 3O6TA 4PUFC 2A4VA 3GKKA 12GSA 4LMWA 1R5PA 3QPMA 1J08A 1J0FA 5BMUA 2DKIA 1Z6MA 1GLQA 1XBSA 2JSZA 2LSTA 5J4UA 1NHOA 2P5QA 4YQUA 5G5EA 2VAFA 2CZ3A 4WKWA 2H6ZA 1FO5A 2CVBA 4EC0A 2P0GA 3IV4A 1A0RP 1O8WA 6GSVA 2N5FA 4HUAA 3GUSA 2X99A 1T4ZA 1TOFA 2IMEA 3F4RA 3CSJA 2VD1A 2B5EA 5E4WA 5KN0A 3TOUA 4ZL7A 3DEXA 1WP0A 3C1SA 3F4SA 3EURA 4KE3A 3LW9A 1LBKA 4MJCA 5CRDA 4WBRD 1FB6A 4MLYA 1UA5A 1VRSD 4MK3A 1R5AA 3HJOA 1B48A 4V1Ap 4L0UA 3D6IA 5HR1A 1E2YA 4TKYA 1EP8A 2WS2A 2NPBA 3WGEA 2E7PA 4IELA 1RW1A 3GNJA 4J2FA 3M1GA 1XW5A 3L0HA 3H4KA 5AGYA 1V40A 1Z6NA 3IK7A 1A2JA 1URMA 5D9VA 1XVQA 5DALB 3HA9A 1GH2A 4GQFA 2JU5A 3TB2A 1WJKA 4PQ1A 2IMDA 1OKDA 3IBHA 2E2MA 2QKEA 5JWOB 3QDNA 2VOCA 1O81A 1IYIA 4XHMA 2AYTA 2H19A 3ZMLA 17GSA 2HRNA 2FNOA 2WCIA 1SENA 2DJJA 2NDOA 3KP9A 4OCEA 4PGTA 1N8JA 4XS4B 1PN0A 2FWHA 4BWQA 2DMMA 1XOAA 4GLTA 2LS5A 3ERWA 5ELGA 5DALA 2H71A 4ISDA 1SJIA 2GSSA 4DVCA 2YV7A 1AIUA 4O7HA 1T4YA 1YEPA 2L57A 4I2TA 3HXSA 4Q5QA 3SBCA 3DYRA 3ZTLA 2ON7A 1A2MA 8GSSA 3IC4A 2GDRA 5LD0A 1W4VA 1TDIA 1TRUA 4L8EA 2HI7A 3F6FA 4HJ2A 4K2XA 1XFLA 4JE1A 3RPPA 4MCUA 2PWJA 3UL3A 1YEXA 4IVFA 2P5RA 3QAGA 2L59A 2LUSA 2VCVA 2K8SA 4KDUA 6GSXA 2F8FA 3KD0A 3MDKA 3N9JA 1KTEA 2CX3A 1YKAA 2F3MA 2WB9A 3MIXA 2I3YA 3BJ5A 2YZUA 2H66A 3F3RA 4YKFA 4Q5NA 2MMZA 2C80A 2M46A 4MABA 2PN8A 4BA7A 3HVSA 3QMXA 6GSSA 1LJRA 3IAS2 5DCHA 4YKGA 3P90A 4GSSA 3GH9A 2IMFA 1M9BA 5B8BA 5J9BA 2JSYA 1SL1B 3C7MA 3QAWA 1FVJA 4ML1A 1Z5YE 1ZMAA 3D22A 1XW6A 1VF1A 4V2NA 4EDYA 2VCZA 5ID2A 4IJ3A 1XIYA 1BJXA 1HQOA 2AV4A 1JLVA 3VWUA 5ECPB 1Q4JA 5LCZA 4OWYA 1OC8A 3IE3A 1GSUA 1U3AA 3GIXA 2A4HA 2MYGA 2NBSA 1QXHA 4PURA 2DIYA 3VWWA 1SK0A 3Q74A 1V57A 3RBTA 1EOGA 2FD3A 5HR3A 5IMFA 13GSA 3ZIJA 4NPBA 4BVYB 3G9BA 4AJ8A 4XS6A 1JLWA 1O85A 3WT1A 2FY6A 3I6AA 5HQPA 1Q98A 3GL5A 3CBUA 2JL4A 1WWJA 2BMXA 2K6VA 4OFMA 4WEYA 1GSDA 3APOA 5KOXA 2K9FA 14GSA 4RI6A 2H70A 1ZOFA 3TKSA 3ZVJA 4ZBBA 3CYNA 2X8GA 3FEUA 4K5RA 3QAVA 3FZ5A 1SYXA 1F9MA 1EWXA 1A8LA 3H93A 2O7KA 4KSOA 1JZWA 3LSZA 3Q18A 2VIMA 1GWCA 2JADA 3FK8A 1NHYA 1PX6A 4ZILA 3R2QA 3LJRA 1CQHA 4ZB6A 1X5CA 4K0GA 5JCGA 4ZB8A 4K5SA 4NWYA 2ON5A 1SKRB 4HOJA 1NSWA 2QA1A 4NXIA 4HEA2 4D73B 1B9XC 1SJZA 2H6YA 3F3QA 2RLIA 2BTOT 2WRTA 3VLNA 1K3OA 4PTSA 3LQ7A 5EVOA 1GLPA 2WDUA 4WF4A 1SKWB 1PA3A 1BYEA 1YZXA 1R7HA 5B8AA 1T3BA 2DJ0A 4G0LA 4F0BA 3IXRA 3GTUA 2R0PA 2YANA 4LL1B 2MZCA 2PU9C 5KN1A 1PKWA 4D73A 3MYDA 3C8EA 2VL2C 1M7TA 1A0FA 2QGVA 4MF6A 1AQWA 1TP9A 3KM6A 3DIEA 3WYWA 4P3YB 1MD3A 1TU7A 2IWTA 4K1FA 5D9WA 1ERTA 5IMDA 3ZL5A 4USSA 4BWSA 3UEMA 3E0UA 4HI7A 3PINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J57 E;  4I97 A;  1BED A;  2C3T A;  3LXZ A;  3GX0 A;  2GSQ A;  4N0Z A;  3W8S A;  4IHU A;  2ZNM A;  4ACS A;  2H1A A;  3D4M A;  1ERW A;  3H79 A;  2C0D A;  3KJY A;  20GS A;  4MZC A;  1VF4 A;  3OR5 A;  2IL3 A;  4KB3 A;  5B6M A;  3MAK A;  1QUW A;  1NW2 A;  2JZT A;  1G6Y A;  1SYR A;  2RUE A;  2TIR A;  1QQ2 A;  1ZYQ B;  4PNF A;  4K6X A;  2GT5 A;  3GUR A;  4YAV A;  4DSS B;  1NM3 A;  4FO5 A;  1S3C A;  3CSI A;  3CTF A;  3J7Y b;  3ZVJ D;  3HKR A;  2LRT A;  4NMU A;  4TR0 A;  1XWA A;  4KCE A;  5G2Z A;  2GQK A;  5IMC A;  2LV3 A;  2ALB A;  1PGT A;  1FHE A;  3TKQ A;  5HFK A;  3GFK A;  1K0O A;  5A4W A;  3VWX A;  1F3B A;  3UBK A;  1O73 A;  4PX1 A;  2OBK A;  3M0F A;  5D9T A;  4F9Z A;  2CZ2 A;  3GKX A;  4KSM A;  3TJK A;  4NV2 A;  2O87 A;  3DKS A;  18GS A;  2LJA A;  5IQY A;  3LWA A;  1PRX A;  5EPF A;  1W89 A;  2YWI A;  1TJD A;  1PL1 A;  1U87 A;  2FUG 2;  4XTS A;  2B3S A;  4IKH A;  2PGT A;  5ENU A;  1GTU A;  1G7E A;  3W6G A;  1VF2 A;  1GTB A;  3M9J A;  4Q5R A;  1GSS A;  1TXX A;  2C4J A;  2CAI A;  4RQR A;  4X1U A;  1A24 A;  4KH7 A;  2FGX A;  2C3N A;  2DJ3 A;  1YY7 A;  3LFL A;  3PH9 A;  4K9Z A;  3ZFL A;  5L71 A;  4AGS A;  3HJM A;  2OKA A;  4FH8 A;  1YKC A;  2E2G A;  1XWC A;  4YQV A;  1EEJ A;  4O32 A;  1PMT A;  1XXU A;  1MDI A;  1ML6 A;  1ST9 A;  3UAP A;  3I69 A;  4POL A;  2K18 A;  1SK1 A;  2V6K A;  3M3M A;  3NIV A;  2AUV A;  2B7J A;  2H1D A;  1M2B A;  1GSQ A;  5F07 A;  2R37 A;  4BVX A;  4HZ2 A;  3FRC A;  4AF2 A;  2L5L A;  5D8I A;  3TKR A;  3EVI A;  3UMA A;  2WFC A;  3HVX A;  3CSH A;  5D93 A;  1XCC A;  2DSA A;  4YQM A;  2CQ9 A;  2P31 A;  3EIN A;  2GVP A;  3C73 A;  3VUR A;  1RQM A;  2YJ7 A;  1K3Y A;  3UOM A;  2YPM A;  6GSW A;  2XC2 A;  3L9S A;  2LQQ A;  2H8L A;  1TK0 B;  1GNW A;  2HZE B;  4JZQ A;  1HD2 A;  4OCF A;  3EC3 A;  3FZ4 A;  4AJ6 A;  2FWE A;  4IS0 A;  1TI3 A;  1AC1 A;  2V1M A;  4I5Q A;  1OKT A;  2JAC A;  2I81 A;  4WF5 A;  2WGR A;  2X8C A;  3M9K A;  4GTU A;  1TI1 A;  1GTI A;  3WGD A;  1ILO A;  2J9H A;  1M2A A;  3F9U A;  1MDJ A;  4KW6 A;  3HVV A;  2LRN A;  4TVE A;  2VCW A;  1B4Q A;  4KDX A;  5DCG A;  3UIW A;  2HLS A;  2H74 A;  2C3Q A;  1UVZ A;  3QD9 A;  2Z9S A;  3LYP A;  2H6X A;  1ACV A;  4POB A;  1AXD A;  1O7U A;  4X43 A;  1DUG A;  4EE0 A;  5G1K A;  3ERF A;  1JZD A;  2PPT A;  5CO3 A;  1THO A;  3M8N A;  2CT6 A;  3RDW A;  4XRD A;  5G5F A;  1LU4 A;  4GRF A;  4IQA A;  3MWH A;  3QOU A;  9GSS A;  1H75 A;  2HXK A;  3ZIT A;  4O92 A;  4XS4 A;  2H0H A;  1JFU A;  1F6M C;  1FVK A;  5CRW A;  3DML A;  5HR2 A;  5C04 A;  3CRU A;  1GUM A;  3F0I A;  2DML A;  1HNB A;  1EOH A;  2FWG A;  4TR4 A;  2L6D A;  5ECH B;  4DSQ A;  3UJ1 A;  1SD8 A;  2YV9 A;  3P8W A;  2O85 A;  3LOR A;  2VL9 A;  3RAZ A;  2IMK A;  4CDO A;  5A5K A;  2KP2 A;  5AN1 A;  3GYK A;  1R4W A;  2VCQ A;  4F0C A;  3QFB C;  3BD2 A;  3BCI A;  2FA4 A;  4WR5 A;  1U6T A;  3ZYW A;  2MMA A;  3VI5 A;  4K0N A;  1F2E A;  5E59 A;  3IDV A;  2GQM A;  4MJE A;  4EVM A;  4XIH A;  1GUK A;  2EIQ A;  16GS A;  3HJP A;  5J41 A;  2DJ1 A;  2DJK A;  1WMJ A;  4IP6 A;  1F3A A;  1XPV A;  2D2Z A;  2RUF A;  3DGQ A;  1K0N A;  2HZF A;  1V2A A;  1XWG A;  4G2E A;  4HU7 A;  3UVT A;  4TRX A;  2KHP A;  2FHE A;  4IJI A;  5EL8 A;  5ELA A;  4E8H A;  5F8B A;  2KP1 A;  22GS A;  4ZIJ A;  2OE0 A;  3VPT A;  4MPF A;  1QFN A;  1V98 A;  1M2D A;  1I9D A;  5D96 A;  3NOF A;  4Z7X A;  5CAX A;  4OO4 A;  5F0G A;  5DBQ A;  1YF1 A;  4I2U A;  4H86 A;  4LMV A;  2PBJ A;  2VUP A;  3US3 A;  2B6M A;  2C8U A;  5J5N A;  4AJ7 A;  2X64 A;  3C71 A;  1K0M A;  2TRX A;  2REM A;  5F06 A;  1QGV A;  5C00 A;  4EL1 A;  3RHB A;  3KCM A;  5IO0 A;  2VL2 A;  2PVQ A;  2L4C A;  4JBB A;  2C0E A;  2C0G A;  3IHQ A;  2GS3 A;  3U6V A;  2MMN A;  3DD3 A;  1XWK A;  1TRW A;  2OBI A;  4F82 A;  2FCH A;  3F6D A;  3HHV A;  4YAP A;  3HCZ A;  4BVY A;  2B7K A;  1FG4 A;  1S3D A;  4NAX A;  4G19 A;  4RQX A;  3VFI A;  3PR8 A;  4N30 A;  4K7O A;  5DDL A;  4J56 E;  4PNG A;  2GSR A;  4XRA A;  3Q19 A;  1UN2 A;  4KCA A;  3MSZ A;  4K2D A;  4N0V A;  2AHE A;  1EZK A;  4EKZ A;  3WGX A;  2WUL A;  1SJ6 A;  5HR0 A;  1G7O A;  1S3A A;  5ECN B;  1GSY A;  2IMI A;  19GS A;  4ID0 A;  4GXZ A;  1A8Y A;  5IM9 A;  1MD4 A;  2ES7 A;  1ON4 A;  2YZH A;  2VCT A;  2H1G A;  2HT9 A;  2MBT A;  2PUK C;  1N2A A;  1BX9 A;  1U88 A;  4L0W A;  1M99 A;  1PL2 A;  4MF7 A;  3KTB A;  4IQ1 A;  5KN2 A;  1VGL A;  5F05 A;  1OC9 B;  3E3E A;  3TGZ A;  5A4U A;  3GRX A;  2B5X A;  2LJR A;  3DVW A;  2YNX A;  3GSS A;  2CAQ A;  1TK8 B;  1SKS B;  4ECB A;  2HYX A;  5AIS A;  1TW9 A;  2JZS A;  2DJ2 A;  3LYK A;  3KEB A;  2EIO A;  3SWL A;  5FWG A;  3TJJ A;  2LQO A;  4PUA A;  4TXV A;  1PKZ A;  4HJM A;  5CYY A;  2L6C A;  1JZO A;  2XBQ A;  3FR3 A;  2MBS A;  3IRA A;  2VCX A;  4ECI A;  3I9V 2;  4MA9 A;  1K0D A;  2CA8 A;  5H5R A;  3QR6 A;  3TJG A;  5ECL B;  3VWV A;  4EUY A;  1M9A A;  2VLU A;  3DVX A;  2WZ9 A;  3I43 A;  1WPI A;  4OMV A;  2H01 A;  1RK4 A;  2V2G A;  2OAC A;  2VO4 A;  2HE3 A;  2HFD A;  5EY6 A;  3G7J A;  2IPA A;  4ZB9 A;  2C0F A;  4ZXG A;  1XWB A;  1A2L A;  2BJX A;  3IR4 A;  1Z7R A;  2E0Q A;  11GS A;  2H0I A;  1B8X A;  2LNT A;  4IBP A;  3ME7 A;  4TR3 A;  5IO2 A;  2H30 A;  3D0Z A;  4I8B A;  2YP6 A;  5B6N A;  3KTL A;  2M72 A;  4E8E A;  4OO5 A;  4V1A g;  3RHC A;  3QFA C;  3MNG A;  3KIJ A;  2VL3 A;  3EE2 A;  2F8A A;  3ZRD A;  2HRF A;  1TRV A;  1HYU A;  3KZQ A;  3GX8 A;  3HD5 A;  2EIR A;  4KUN A;  3J7Y k;  4OFN A;  1M0U A;  5G31 A;  4POK A;  5FT3 A;  5DVB A;  2A2S A;  4DSS A;  5GST A;  4NV5 A;  5INY A;  1EV4 A;  2J23 A;  5D9X A;  4TXO B;  1GP1 A;  5DAK B;  4O5R A;  2VLV A;  2QSI A;  2V32 A;  1Z3E A;  4FIW A;  4ILF A;  1HNA A;  2OA7 A;  5ECR B;  3IPZ A;  3TJF A;  4ECC A;  1TTZ A;  2HNL A;  5J9C A;  4IGJ A;  2OE3 A;  3ED3 A;  5GSS A;  3L9U A;  2LNS A;  2K8V A;  1XVW A;  1ERU A;  3ZFB A;  3GL3 A;  3TOT A;  2PVO C;  4MP4 A;  3A2V A;  4LL4 B;  5FHI A;  3QCP A;  5IIZ A;  2H0G A;  5CRE A;  2V6O A;  1B9Y C;  3ZLP A;  1SL2 B;  1OYJ A;  3L9V A;  4KND A;  1EGO A;  3V1W A;  3GKM A;  1AAZ A;  3UBL A;  2R5G A;  4MMM A;  2H72 A;  3FR6 A;  4F03 A;  1T00 A;  1XZO A;  4OD7 A;  3KMN A;  3BBY A;  4IN0 A;  1ZGN A;  4QL9 A;  5KN3 A;  1THX A;  4HQS A;  2EC4 A;  5ECS A;  2I9H A;  1SL0 B;  1Z7P A;  3A2X A;  3A2W A;  6GST A;  1O8X A;  2MMO A;  1JZR A;  4FYB A;  5LNK e;  2QC7 A;  2L5O A;  3AY8 A;  3HY2 A;  4DEJ A;  5JCW A;  2O89 A;  2H76 A;  4EDZ A;  4MJA A;  5IOX A;  2FWF A;  5G1L A;  1ERV A;  4IW9 A;  4F2I A;  1K0B A;  4JED A;  3L78 A;  5ECO B;  4KX4 A;  2R2J A;  3JCM L;  2AB6 A;  1GL8 A;  5DJL A;  2YWN A;  2M80 A;  4KGI A;  1HNC A;  4LLR A;  2WJU A;  5IOW A;  2ZUP A;  5H5S A;  4PXO A;  1EP7 A;  3TRQ A;  2DLX A;  4N10 A;  5GZZ B;  4EXJ A;  4XS1 A;  2HZE A;  3TDG A;  2N5B A;  2XPE A;  2YN1 A;  1USB A;  4PQI A;  3IA1 A;  4WXT A;  5DQS A;  5CNW A;  3HDC A;  1MDK A;  2HSY A;  1MEK A;  3P7X A;  5DQY A;  1TRS A;  3H1N A;  2F51 A;  1TKD B;  3BCK A;  1T8E B;  2PMT A;  4Q5F A;  4WET A;  3WD6 A;  1SK2 A;  5COH A;  2HSH A;  5IPG A;  4V2M A;  1CQG A;  4N11 A;  5IMV A;  2H1B A;  4I6X A;  4ZBD A;  5HFG A;  3RPN A;  2IIY A;  4YH2 A;  2OAD A;  5JCU A;  1YJ6 A;  1R26 A;  3C1R A;  4TN8 A;  1PN9 A;  2JZR A;  3BOA A;  1K0C A;  4HS1 A;  2F9S A;  1OAZ A;  1KEB A;  1X9M B;  3KH9 A;  2GLR A;  2KOK A;  3FYG A;  5DJM A;  2YJH A;  1U3I A;  3K8N A;  5H5Q A;  2XHF A;  3CRT A;  3EMX A;  1SU9 A;  5ECM B;  7GSS A;  3EWL A;  3TRP A;  5ID2 B;  6GSU A;  5ECQ B;  1GUL A;  2YOI A;  5KEJ A;  1ZL9 A;  2NVL A;  1E6B A;  4HQZ A;  4MH2 A;  5CP1 A;  3APQ A;  1EGR A;  4MZB A;  3D4T A;  4ML6 A;  5HFI A;  3GN3 A;  1UC7 A;  2O8V B;  3GST A;  4G10 A;  2GZZ A;  2B1K A;  3EU4 A;  1SD9 A;  3TKS E;  1A23 A;  1QMV A;  2YCD A;  4LA1 A;  2N5A A;  5AIX A;  1IYH A;  2GTU A;  2XPD A;  1GRX A;  2TRC P;  1ZZY A;  5IMA A;  1EEM A;  2G2Q A;  3FKF A;  4MZW A;  5GAN D;  4MJB A;  5JWR B;  4BPY A;  1K3L A;  1X0R A;  3A3T A;  2X8H A;  3APS A;  2I4A A;  4NHZ A;  1JHB A;  3P2A A;  1DSB A;  1FW1 A;  2VM1 A;  3W8J A;  4MPG A;  1OE8 A;  2CX4 A;  1DE2 A;  1X9W B;  2GGT A;  2OJL A;  5ECI B;  1B4P A;  3CXG A;  1YF0 A;  4WR4 A;  3HZ4 A;  3F8U A;  3KMO A;  4QQ7 A;  2H73 A;  4MDC A;  1OVN A;  3TCO A;  1BAY A;  1TK5 B;  2RM5 A;  1C72 A;  4L5O A;  4WBJ A;  3UAR A;  3IK9 A;  4K8M A;  3IAM 2;  3F4T A;  2H75 A;  1WE0 A;  5ECK B;  2GZY A;  1OC3 A;  2RM6 A;  4CHS A;  2R3X A;  4NHW A;  2IFQ B;  2YWO A;  1KBN A;  4JR6 A;  4KAE A;  3ZMK A;  2PER A;  3PGT A;  1X9S B;  4HDE A;  1MTC A;  5G30 A;  3CTG A;  2CVD A;  4G9H A;  1O6J A;  3S9F A;  3LXT A;  4TW5 A;  2LRC A;  2B1L A;  1DE1 A;  3HYP A;  2NTO A;  5IMZ A;  3KH7 A;  1FOV A;  1AQX A;  4HU9 A;  5IPH A;  3FHK A;  4TOP A;  3HZ8 A;  3LG6 A;  4ZBA A;  3VPQ A;  4HZ4 A;  3G7Y A;  2VM2 A;  2GT6 A;  2R6K A;  3H8Q A;  2IFQ A;  3ME8 A;  3KP8 A;  4DSR A;  2OE1 A;  5B7C A;  2CVK A;  3FR9 A;  4JRR A;  3GHA A;  3DXB A;  2DBC A;  4JU5 A;  4X0X A;  1GNE A;  3D5J A;  3KXO A;  3GTU B;  4GWR A;  3EMP A;  3VI7 A;  4ECJ A;  5CRH A;  1XOB A;  2B5Y A;  1G6W A;  3EYT A;  3WT2 A;  1T1V A;  3VK9 A;  1G0T A;  5A4V A;  3GH6 A;  2GQL A;  3ISO A;  2CV4 A;  1KNG A;  4MH3 A;  3F63 A;  3DWV A;  4GSN A;  4PQH A;  1GSF A;  3FY7 A;  2R4V A;  2FA8 A;  1BG5 A;  2L4Q A;  1OC9 A;  1FB0 A;  3ERG A;  3G7I A;  4TR1 B;  2LTK A;  1AUC A;  2XBI A;  1H4O A;  1ABA A;  3DRN A;  5AIV A;  1FAA A;  3NZN A;  4ZL8 A;  2ZCT A;  5CRG A;  4GST A;  3EU3 A;  1GUH A;  3FW2 A;  4BL7 A;  4QL7 A;  2VD0 A;  4KDY A;  3TKS C;  5ABR A;  3O76 A;  3L4N A;  1YQ1 A;  4K7N A;  1ZYE A;  4KA0 A;  1QK8 A;  5JWQ B;  3TJB A;  4IP1 A;  3UVH A;  1AW9 A;  1AQV A;  2V41 A;  3GKN A;  1V58 A;  4K7I A;  1PSQ A;  1X5D A;  4TR1 A;  3CMI A;  2IJY A;  4POM A;  3GV1 A;  3ZIV A;  5D73 A;  4EO3 A;  4ULX A;  3TKP A;  2GST A;  1GTA A;  1I5G A;  1PX7 A;  4FYC A;  4ZL9 A;  1WOU A;  3ZZX A;  4V2L A;  2YWM A;  1DBY A;  3KGK A;  2LEG A;  3N5O A;  2KUC A;  1TU8 A;  1K0A A;  5GAP D;  1X5E A;  1YDK A;  3GA4 A;  4RI7 A;  4XCS A;  2DIZ A;  3TRX A;  1Y6E A;  3LGC A;  4L5L A;  2G0F A;  3FZA A;  4GF0 A;  5J3R A;  1BQ7 A;  2LKU A;  1J9B A;  3U5R E;  2IN3 A;  2KLX A;  4FYU A;  1XW9 A;  4RUV A;  3Q6O A;  2A2R A;  1VF3 A;  2C1Y A;  1F37 A;  3O3T A;  1EV9 A;  3ZRE A;  1OE7 A;  2AAW A;  2DC5 A;  2VLT A;  4MF5 A;  1PQN A;  1Z9H A;  4CW9 A;  3IOS A;  4GCI A;  3D21 A;  3A5W A;  4JR4 A;  2I1U A;  2AJQ B;  6GSY A;  3FZ9 A;  1T7P B;  1V9W A;  2FLS A;  1Y25 A;  2LJK A;  3GMF A;  3LEF A;  2RII A;  10GS A;  1WRY A;  4GQC A;  4EF0 A;  4TXO A;  5DAK A;  1ZCP A;  1PD2 1;  1GSE A;  2GZP A;  4OFT A;  1WIK A;  3TUE A;  3E9J B;  3O6T A;  4PUF C;  2A4V A;  3GKK A;  12GS A;  4LMW A;  1R5P A;  3QPM A;  1J08 A;  1J0F A;  1Z6M A;  1GLQ A;  1XBS A;  2JSZ A;  2LST A;  5J4U A;  1NHO A;  2P5Q A;  4YQU A;  5G5E A;  2VAF A;  2CZ3 A;  4WKW A;  2H6Z A;  1FO5 A;  2CVB A;  4EC0 A;  2P0G A;  3IV4 A;  1A0R P;  1O8W A;  6GSV A;  2N5F A;  4HUA A;  3GUS A;  2X99 A;  1T4Z A;  1TOF A;  2IME A;  3F4R A;  3CSJ A;  2VD1 A;  2B5E A;  5E4W A;  5KN0 A;  3TOU A;  4ZL7 A;  3DEX A;  1WP0 A;  3C1S A;  3F4S A;  3EUR A;  4KE3 A;  1LBK A;  4MJC A;  4WBR D;  5CRD A;  1FB6 A;  4MLY A;  1UA5 A;  1VRS D;  4MK3 A;  1R5A A;  3HJO A;  1B48 A;  4V1A p;  4L0U A;  3D6I A;  5HR1 A;  1E2Y A;  4TKY A;  1EP8 A;  2WS2 A;  2NPB A;  3WGE A;  2E7P A;  4IEL A;  1RW1 A;  3GNJ A;  4J2F A;  3M1G A;  1XW5 A;  3L0H A;  3H4K A;  5AGY A;  1V40 A;  1Z6N A;  3IK7 A;  1A2J A;  1URM A;  5D9V A;  1XVQ A;  5DAL B;  3HA9 A;  1GH2 A;  4GQF A;  2JU5 A;  3TB2 A;  1WJK A;  4PQ1 A;  2IMD A;  1OKD A;  3IBH A;  2E2M A;  2QKE A;  5JWO B;  3QDN A;  2VOC A;  1O81 A;  1IYI A;  4XHM A;  2AYT A;  2H19 A;  3ZML A;  17GS A;  2HRN A;  2FNO A;  2WCI A;  1SEN A;  2DJJ A;  2NDO A;  3KP9 A;  4OCE A;  4PGT A;  1N8J A;  4XS4 B;  2FWH A;  4BWQ A;  2DMM A;  1XOA A;  4GLT A;  2LS5 A;  3ERW A;  5ELG A;  5DAL A;  2H71 A;  4ISD A;  1SJI A;  2GSS A;  4DVC A;  2YV7 A;  1AIU A;  4O7H A;  1T4Y A;  1YEP A;  2L57 A;  4I2T A;  3HXS A;  4Q5Q A;  3SBC A;  3DYR A;  3ZTL A;  2ON7 A;  1A2M A;  8GSS A;  3IC4 A;  2GDR A;  5LD0 A;  1W4V A;  1TDI A;  1TRU A;  4L8E A;  2HI7 A;  3F6F A;  4HJ2 A;  1XFL A;  4JE1 A;  3RPP A;  4MCU A;  2PWJ A;  3UL3 A;  1YEX A;  4IVF A;  2P5R A;  3QAG A;  2L59 A;  2LUS A;  2VCV A;  2K8S A;  4KDU A;  6GSX A;  2F8F A;  3KD0 A;  3MDK A;  3N9J A;  1KTE A;  2CX3 A;  1YKA A;  2F3M A;  2WB9 A;  2I3Y A;  3BJ5 A;  2YZU A;  2H66 A;  3F3R A;  4Q5N A;  2MMZ A;  2C80 A;  2M46 A;  4MAB A;  2PN8 A;  4BA7 A;  3HVS A;  3QMX A;  6GSS A;  1LJR A;  3IAS 2;  5DCH A;  3P90 A;  4GSS A;  3GH9 A;  2IMF A;  1M9B A;  5B8B A;  5J9B A;  2JSY A;  1SL1 B;  3C7M A;  3QAW A;  1FVJ A;  4ML1 A;  1Z5Y E;  1ZMA A;  3D22 A;  1XW6 A;  1VF1 A;  4V2N A;  4EDY A;  2VCZ A;  5ID2 A;  4IJ3 A;  1XIY A;  1BJX A;  1HQO A;  2AV4 A;  1JLV A;  3VWU A;  5ECP B;  1Q4J A;  5LCZ A;  4OWY A;  1OC8 A;  3IE3 A;  1GSU A;  1U3A A;  3GIX A;  2MYG A;  2NBS A;  1QXH A;  4PUR A;  2DIY A;  3VWW A;  1SK0 A;  3Q74 A;  1V57 A;  3RBT A;  1EOG A;  2FD3 A;  5HR3 A;  5IMF A;  13GS A;  3ZIJ A;  4NPB A;  3G9B A;  4AJ8 A;  4XS6 A;  1JLW A;  1O85 A;  3WT1 A;  2FY6 A;  3I6A A;  5HQP A;  1Q98 A;  3GL5 A;  3CBU A;  2JL4 A;  1WWJ A;  2BMX A;  2K6V A;  4OFM A;  4WEY A;  1GSD A;  3APO A;  2K9F A;  14GS A;  4RI6 A;  2H70 A;  1ZOF A;  3TKS A;  3ZVJ A;  4ZBB A;  3CYN A;  2X8G A;  3FEU A;  3QAV A;  3FZ5 A;  1SYX A;  1F9M A;  1EWX A;  1A8L A;  3H93 A;  2O7K A;  4KSO A;  1JZW A;  3LSZ A;  3Q18 A;  2VIM A;  1GWC A;  2JAD A;  3FK8 A;  1NHY A;  1PX6 A;  4ZIL A;  3R2Q A;  3LJR A;  1CQH A;  4ZB6 A;  1X5C A;  4K0G A;  5JCG A;  4ZB8 A;  4NWY A;  2ON5 A;  1SKR B;  4HOJ A;  1NSW A;  4NXI A;  4HEA 2;  4D73 B;  1B9X C;  1SJZ A;  2H6Y A;  3F3Q A;  2RLI A;  2BTO T;  2WRT A;  3VLN A;  1K3O A;  3LQ7 A;  5EVO A;  1GLP A;  2WDU A;  4WF4 A;  1SKW B;  1PA3 A;  1BYE A;  1YZX A;  1R7H A;  5B8A A;  1T3B A;  2DJ0 A;  4F0B A;  3IXR A;  3GTU A;  2YAN A;  4LL1 B;  2MZC A;  2PU9 C;  5KN1 A;  1PKW A;  4D73 A;  3C8E A;  2VL2 C;  1M7T A;  1A0F A;  2QGV A;  4MF6 A;  1AQW A;  1TP9 A;  3KM6 A;  3DIE A;  3WYW A;  4P3Y B;  1MD3 A;  1TU7 A;  2IWT A;  4K1F A;  5D9W A;  1ERT A;  5IMD A;  3ZL5 A;  4BWS A;  3UEM A;  3E0U A;  4HI7 A;  3PIN A; 
#chains in the Genus database with same CATH topology
 4J57 E;  3PPU A;  4I97 A;  1BED A;  2C3T A;  3LXZ A;  3GX0 A;  2GSQ A;  4N0Z A;  3W8S A;  4IHU A;  2ZNM A;  4ACS A;  2H1A A;  3D4M A;  1ERW A;  3H79 A;  2C0D A;  3KJY A;  20GS A;  4MZC A;  1VF4 A;  3OR5 A;  2IL3 A;  4KB3 A;  5B6M A;  3MAK A;  1QUW A;  1NW2 A;  2JZT A;  1G6Y A;  1SYR A;  2RUE A;  2TIR A;  1QQ2 A;  1ZYQ B;  4PNF A;  4K6X A;  2GT5 A;  3GUR A;  4YAV A;  4DSS B;  1NM3 A;  4FO5 A;  1S3C A;  3CSI A;  3CTF A;  3J7Y b;  3ZVJ D;  3HKR A;  2LRT A;  4NMU A;  4TR0 A;  1XWA A;  4KCE A;  5G2Z A;  2GQK A;  5IMC A;  2LV3 A;  2ALB A;  1PGT A;  1FHE A;  3TKQ A;  5HFK A;  3GFK A;  1K0O A;  5A4W A;  3VWX A;  1F3B A;  3UBK A;  1O73 A;  4PX1 A;  2OBK A;  3M0F A;  5D9T A;  4F9Z A;  2CZ2 A;  3GKX A;  4KSM A;  3TJK A;  4NV2 A;  2O87 A;  3DKS A;  18GS A;  2LJA A;  5IQY A;  3LWA A;  1PRX A;  5EPF A;  1W89 A;  2YWI A;  1TJD A;  1PL1 A;  1U87 A;  2FUG 2;  4XTS A;  2B3S A;  4IKH A;  2PGT A;  5ENU A;  1GTU A;  1G7E A;  3W6G A;  1VF2 A;  1GTB A;  3M9J A;  4Q5R A;  1GSS A;  1TXX A;  2C4J A;  2CAI A;  4RQR A;  4X1U A;  1A24 A;  4KH7 A;  4EIQ A;  2FGX A;  2C3N A;  2DJ3 A;  1YY7 A;  3LFL A;  3PH9 A;  4K9Z A;  3IC8 A;  3ZFL A;  5L71 A;  4AGS A;  3HJM A;  2OKA A;  4FH8 A;  1YKC A;  2E2G A;  1XWC A;  4YQV A;  1EEJ A;  4O32 A;  1PMT A;  1XXU A;  2R0G A;  1MDI A;  1ML6 A;  1ST9 A;  3UAP A;  1S3R A;  3I69 A;  4POL A;  2K18 A;  1SK1 A;  2R0C A;  2V6K A;  3M3M A;  3NIV A;  2AUV A;  2B7J A;  2H1D A;  1M2B A;  1GSQ A;  5F07 A;  2R37 A;  4BVX A;  4HZ2 A;  3FRC A;  4AF2 A;  2L5L A;  5D8I A;  3TKR A;  3EVI A;  3UMA A;  2WFC A;  3HVX A;  3CSH A;  5D93 A;  1XCC A;  2DSA A;  4YQM A;  2CQ9 A;  2P31 A;  3EIN A;  2GVP A;  3C73 A;  3VUR A;  1RQM A;  2YJ7 A;  1K3Y A;  3UOM A;  2YPM A;  6GSW A;  2XC2 A;  3L9S A;  2LQQ A;  2H8L A;  2DKH A;  1TK0 B;  1GNW A;  2HZE B;  4JZQ A;  1HD2 A;  4OCF A;  3EC3 A;  3FZ4 A;  4AJ6 A;  2FWE A;  4IS0 A;  1TI3 A;  1AC1 A;  2V1M A;  4I5Q A;  1OKT A;  2JAC A;  2I81 A;  4WF5 A;  2WGR A;  2X8C A;  3M9K A;  4GTU A;  1TI1 A;  2X49 A;  1GTI A;  3WGD A;  1ILO A;  2J9H A;  1M2A A;  3F9U A;  1MDJ A;  4KW6 A;  3HVV A;  2LRN A;  4TVE A;  2VCW A;  1B4Q A;  4KDX A;  4G0I A;  5DCG A;  3UIW A;  2HLS A;  2H74 A;  2C3Q A;  1UVZ A;  3QD9 A;  2Z9S A;  3LYP A;  2H6X A;  1ACV A;  4POB A;  1AXD A;  1O7U A;  4X43 A;  1DUG A;  4EE0 A;  5G1K A;  3ERF A;  1JZD A;  2PPT A;  5CO3 A;  1THO A;  3M8N A;  2CT6 A;  3RDW A;  4XRD A;  5G5F A;  1LU4 A;  2A2P A;  4GRF A;  3HVN A;  4IQA A;  3MWH A;  3QOU A;  9GSS A;  1H75 A;  2HXK A;  3ZIT A;  4O92 A;  4XS4 A;  2H0H A;  1JFU A;  1F6M C;  1FVK A;  5CRW A;  3DML A;  5HR2 A;  5C04 A;  3CRU A;  1GUM A;  3F0I A;  2DML A;  1HNB A;  4X4J A;  1EOH A;  2FWG A;  4TR4 A;  2L6D A;  5ECH B;  4DSQ A;  3UJ1 A;  1SD8 A;  2YV9 A;  3P8W A;  2O85 A;  3LOR A;  2VL9 A;  3RAZ A;  2IMK A;  4CDO A;  5A5K A;  2KP2 A;  4O5U A;  5AN1 A;  3GYK A;  1R4W A;  2VCQ A;  4F0C A;  3QFB C;  3BD2 A;  3BCI A;  2FA4 A;  4WR5 A;  1U6T A;  3ZYW A;  2MMA A;  3VI5 A;  4K0N A;  1F2E A;  5E59 A;  3IDV A;  2GQM A;  4MJE A;  4EVM A;  4XIH A;  1GUK A;  2EIQ A;  16GS A;  3HJP A;  5J41 A;  2DJ1 A;  2DJK A;  1WMJ A;  4IP6 A;  1F3A A;  1XPV A;  2D2Z A;  2RUF A;  4ICY A;  3DGQ A;  1K0N A;  2HZF A;  1V2A A;  1XWG A;  4G2E A;  4HU7 A;  3FMW A;  3UVT A;  4TRX A;  2KHP A;  2FHE A;  4IJI A;  5EL8 A;  5ELA A;  4E8H A;  5F8B A;  5KOW A;  2KP1 A;  22GS A;  4ZIJ A;  2OE0 A;  3VPT A;  4MPF A;  1QFN A;  1V98 A;  1M2D A;  1I9D A;  5D96 A;  3NOF A;  4Z7X A;  5CAX A;  4OO4 A;  5F0G A;  5DBQ A;  1YF1 A;  4I2U A;  4H86 A;  4LMV A;  2PBJ A;  2VUP A;  3US3 A;  2B6M A;  2C8U A;  5J5N A;  4AJ7 A;  2X64 A;  3C71 A;  1K0M A;  2TRX A;  2REM A;  5F06 A;  1QGV A;  5C00 A;  4EL1 A;  3RHB A;  3KCM A;  5IO0 A;  2VL2 A;  2PVQ A;  2L4C A;  4JBB A;  2C0E A;  2C0G A;  3IHQ A;  2GS3 A;  3U6V A;  2MMN A;  3DD3 A;  1XWK A;  1TRW A;  2OBI A;  4F82 A;  2FCH A;  3F6D A;  3HHV A;  4YAP A;  3HCZ A;  4BVY A;  2B7K A;  1FG4 A;  1S3D A;  4NAX A;  4G19 A;  4RQX A;  3VFI A;  3PR8 A;  4N30 A;  4K7O A;  5DDL A;  4J56 E;  4PNG A;  2GSR A;  4XRA A;  3Q19 A;  1UN2 A;  4KCA A;  3MSZ A;  4K2D A;  4N0V A;  2AHE A;  1EZK A;  4EKZ A;  3CQF A;  2HRA A;  3WGX A;  2WUL A;  1SJ6 A;  5HR0 A;  1G7O A;  1S3A A;  3A5I A;  5ECN B;  1GSY A;  2IMI A;  19GS A;  4ID0 A;  4GXZ A;  1A8Y A;  4HSC X;  5IM9 A;  1MD4 A;  2ES7 A;  1ON4 A;  2YZH A;  2VCT A;  2H1G A;  2HT9 A;  2MBT A;  2PUK C;  1N2A A;  1BX9 A;  1U88 A;  4L0W A;  4G0K A;  1M99 A;  1PL2 A;  4MF7 A;  3KTB A;  4IQ1 A;  5KN2 A;  1VGL A;  5F05 A;  1OC9 B;  3E3E A;  3TGZ A;  5A4U A;  3GRX A;  2B5X A;  2LJR A;  3DVW A;  2YNX A;  2QA2 A;  1FOH A;  3GSS A;  2CAQ A;  5BRT A;  1TK8 B;  1SKS B;  4ECB A;  2HYX A;  5AIS A;  1ZYP A;  1TW9 A;  2JZS A;  2DJ2 A;  3LYK A;  3KEB A;  2EIO A;  3SWL A;  5FWG A;  3TJJ A;  2LQO A;  4PUA A;  4TXV A;  1PKZ A;  4HJM A;  5CYY A;  2L6C A;  1JZO A;  2XBQ A;  3FR3 A;  2MBS A;  3IRA A;  2VCX A;  4ECI A;  3I9V 2;  1XG8 A;  3IHG A;  4MA9 A;  1K0D A;  2CA8 A;  5H5R A;  3QR6 A;  3TJG A;  5ECL B;  3VWV A;  4EUY A;  1M9A A;  2VLU A;  3DVX A;  2WZ9 A;  3I43 A;  1WPI A;  4OMV A;  2H01 A;  1RK4 A;  2V2G A;  2OAC A;  2VO4 A;  2HE3 A;  2HFD A;  5EY6 A;  3G7J A;  2IPA A;  4ZB9 A;  2C0F A;  4ZXG A;  1XWB A;  1A2L A;  2BJX A;  3IR4 A;  1Z7R A;  2E0Q A;  11GS A;  2H0I A;  1B8X A;  2LNT A;  4IBP A;  3ME7 A;  4TR3 A;  5IO2 A;  2H30 A;  3D0Z A;  4I8B A;  2YP6 A;  5B6N A;  3KTL A;  2M72 A;  4E8E A;  4OO5 A;  4V1A g;  3RHC A;  3QFA C;  3MNG A;  3KIJ A;  2VL3 A;  3EE2 A;  2F8A A;  3ZRD A;  2HRF A;  1TRV A;  1HYU A;  3KZQ A;  3GX8 A;  3HD5 A;  2EIR A;  4KUN A;  3J7Y k;  4OFN A;  1M0U A;  5G31 A;  4POK A;  5FT3 A;  5DVB A;  2A2S A;  4DSS A;  5GST A;  4NV5 A;  5INY A;  1EV4 A;  2J23 A;  5D9X A;  4TXO B;  1GP1 A;  5DAK B;  4O5R A;  2VLV A;  2QSI A;  2V32 A;  1Z3E A;  4FIW A;  4ILF A;  1HNA A;  2OA7 A;  5ECR B;  3IPZ A;  3TJF A;  4ECC A;  1TTZ A;  2HNL A;  5J9C A;  4IGJ A;  2OE3 A;  3ED3 A;  5GSS A;  3L9U A;  2LNS A;  2K8V A;  1XVW A;  1ERU A;  3ZFB A;  3GL3 A;  3TOT A;  2PVO C;  4MP4 A;  3A2V A;  4LL4 B;  2HSM A;  5FHI A;  3QCP A;  5IIZ A;  2H0G A;  5CRE A;  2V6O A;  1B9Y C;  3ZLP A;  1SL2 B;  1OYJ A;  3L9V A;  4KND A;  1EGO A;  3V1W A;  3GKM A;  1AAZ A;  3UBL A;  2R5G A;  4MMM A;  2H72 A;  3FR6 A;  4F03 A;  1T00 A;  1XZO A;  4OD7 A;  3KMN A;  3BBY A;  4IN0 A;  1ZGN A;  4QL9 A;  5KN3 A;  1THX A;  4HQS A;  2EC4 A;  5ECS A;  2I9H A;  1SL0 B;  1Z7P A;  3A2X A;  3A2W A;  4A5P A;  6GST A;  1O8X A;  2MMO A;  1JZR A;  4FYB A;  5LNK e;  2QC7 A;  4MNN A;  2L5O A;  3AY8 A;  3HY2 A;  4DEJ A;  5JCW A;  2O89 A;  2H76 A;  4EDZ A;  4MJA A;  5IOX A;  2FWF A;  5G1L A;  1ERV A;  4IW9 A;  4F2I A;  1K0B A;  4JED A;  3L78 A;  5ECO B;  4KX4 A;  2R2J A;  3JCM L;  2AB6 A;  4Z2T A;  1GL8 A;  1ZYN A;  5DJL A;  2YWN A;  2M80 A;  4KGI A;  1HNC A;  4LLR A;  2WJU A;  5IOW A;  2ZUP A;  5H5S A;  4PXO A;  2UZ8 A;  1EP7 A;  4FQU A;  3TRQ A;  2DLX A;  4N10 A;  5GZZ B;  4EXJ A;  4XS1 A;  2HZE A;  3TDG A;  2N5B A;  2XPE A;  2YN1 A;  1USB A;  4PQI A;  3IA1 A;  4WXT A;  5DQS A;  5CNW A;  3HDC A;  1MDK A;  2HSY A;  1MEK A;  3P7X A;  5DQY A;  1TRS A;  3H1N A;  2F51 A;  1TKD B;  3BCK A;  1T8E B;  2PMT A;  4Q5F A;  4WET A;  3WD6 A;  1SK2 A;  5COH A;  2HSH A;  3R3E A;  5IPG A;  4V2M A;  1CQG A;  4N11 A;  5IMV A;  2H1B A;  4I6X A;  4ZBD A;  5HFG A;  3RPN A;  2IIY A;  4YH2 A;  2OAD A;  5JCU A;  1YJ6 A;  1R26 A;  3C1R A;  4TN8 A;  1PN9 A;  2JZR A;  3BOA A;  1K0C A;  4HS1 A;  2F9S A;  1OAZ A;  1KEB A;  1X9M B;  3KH9 A;  2GLR A;  2KOK A;  3FYG A;  5DJM A;  2YJH A;  1U3I A;  3K8N A;  5H5Q A;  2XHF A;  3CRT A;  3EMX A;  1SU9 A;  5ECM B;  7GSS A;  3EWL A;  3TRP A;  5ID2 B;  6GSU A;  5ECQ B;  1GUL A;  2YOI A;  4EIP A;  5KEJ A;  1ZL9 A;  2NVL A;  1E6B A;  4HQZ A;  4MH2 A;  5CP1 A;  3APQ A;  1EGR A;  4MZB A;  3D4T A;  4ML6 A;  5HFI A;  3GN3 A;  1UC7 A;  2O8V B;  3GST A;  4G10 A;  2GZZ A;  2B1K A;  3EU4 A;  1SD9 A;  3TKS E;  1A23 A;  1QMV A;  2YCD A;  4LA1 A;  2N5A A;  5AIX A;  1IYH A;  2GTU A;  2XPD A;  1GRX A;  4CY8 A;  2TRC P;  1ZZY A;  5IMA A;  1EEM A;  2G2Q A;  3FKF A;  4MZW A;  5GAN D;  4MJB A;  5JWR B;  4BPY A;  1K3L A;  1X0R A;  3A3T A;  2X8H A;  3APS A;  2I4A A;  4NHZ A;  1JHB A;  3P2A A;  1DSB A;  1FW1 A;  2VM1 A;  3W8J A;  4MPG A;  1OE8 A;  2CX4 A;  1DE2 A;  1X9W B;  2GGT A;  2OJL A;  5ECI B;  1B4P A;  3CXG A;  1YF0 A;  4WR4 A;  3HZ4 A;  3F8U A;  3KMO A;  4QQ7 A;  2H73 A;  4MDC A;  1OVN A;  3TCO A;  1BAY A;  1TK5 B;  2RM5 A;  1C72 A;  4L5O A;  4WBJ A;  3UAR A;  3IK9 A;  4K8M A;  3IAM 2;  3F4T A;  2H75 A;  1WE0 A;  5ECK B;  2GZY A;  1OC3 A;  2RM6 A;  4CHS A;  2R3X A;  4NHW A;  2IFQ B;  2YWO A;  1KBN A;  4JR6 A;  4KAE A;  3ZMK A;  2PER A;  4KF9 A;  3PGT A;  1X9S B;  4HDE A;  1MTC A;  5G30 A;  3CTG A;  4O5Q A;  2CVD A;  4G9H A;  1O6J A;  3S9F A;  3LXT A;  4TW5 A;  2LRC A;  2B1L A;  1DE1 A;  3HYP A;  2NTO A;  5IMZ A;  3KH7 A;  1FOV A;  1AQX A;  4HU9 A;  5IPH A;  3FHK A;  4TOP A;  3HZ8 A;  3LG6 A;  4ZBA A;  3VPQ A;  4HZ4 A;  3G7Y A;  2VM2 A;  2GT6 A;  2R6K A;  3H8Q A;  2IFQ A;  3ME8 A;  3KP8 A;  4DSR A;  2OE1 A;  5B7C A;  2CVK A;  3FR9 A;  4JRR A;  3GHA A;  3DXB A;  2DBC A;  4JU5 A;  4X0X A;  1GNE A;  3D5J A;  3KXO A;  3GTU B;  4GWR A;  3EMP A;  3VI7 A;  4ECJ A;  5CRH A;  1XOB A;  2B5Y A;  1G6W A;  3EYT A;  3WT2 A;  1T1V A;  3VK9 A;  1G0T A;  5A4V A;  3GH6 A;  2GQL A;  3ISO A;  2CV4 A;  1KNG A;  4MH3 A;  4BL7 B;  3F63 A;  3DWV A;  4GSN A;  4PQH A;  1GSF A;  3FY7 A;  2R4V A;  2FA8 A;  1BG5 A;  2L4Q A;  1OC9 A;  1FB0 A;  3ERG A;  3G7I A;  4TR1 B;  2LTK A;  1AUC A;  2XBI A;  1H4O A;  1ABA A;  3DRN A;  5AIV A;  1FAA A;  2X4A A;  3NZN A;  4ZL8 A;  2ZCT A;  5CRG A;  4GST A;  3EU3 A;  1GUH A;  3FW2 A;  4BL7 A;  4QL7 A;  2VD0 A;  4KDY A;  3TKS C;  5ABR A;  3O76 A;  3L4N A;  1YQ1 A;  4K7N A;  1ZYE A;  4KA0 A;  1QK8 A;  5JWQ B;  3TJB A;  4IP1 A;  3UVH A;  1AW9 A;  1AQV A;  2V41 A;  4CY6 A;  3GKN A;  1V58 A;  4K7I A;  1PSQ A;  1X5D A;  4TR1 A;  3CMI A;  2IJY A;  4POM A;  3GV1 A;  3ZIV A;  5D73 A;  1M3J A;  4EO3 A;  4ULX A;  3TKP A;  2GST A;  1GTA A;  1I5G A;  1PX7 A;  4FYC A;  4ZL9 A;  1WOU A;  3ZZX A;  4V2L A;  2YWM A;  1DBY A;  3KGK A;  2HRK A;  2LEG A;  4Z2U A;  3N5O A;  2KUC A;  1TU8 A;  1K0A A;  5GAP D;  1X5E A;  3EPT A;  1YDK A;  3GA4 A;  4RI7 A;  4XCS A;  2DIZ A;  3TRX A;  1Y6E A;  3LGC A;  4L5L A;  2G0F A;  3FZA A;  4GF0 A;  5J3R A;  1BQ7 A;  2LKU A;  1J9B A;  3U5R E;  2IN3 A;  2KLX A;  4FYU A;  1XW9 A;  4RUV A;  3Q6O A;  2A2R A;  1VF3 A;  2C1Y A;  1F37 A;  3O3T A;  1EV9 A;  3ZRE A;  1OE7 A;  2AAW A;  2DC5 A;  2VLT A;  4MF5 A;  1PQN A;  1Z9H A;  4CW9 A;  3IOS A;  4GCI A;  3D21 A;  3A5W A;  4JR4 A;  2I1U A;  2AJQ B;  6GSY A;  3FZ9 A;  1T7P B;  1V9W A;  4Z2R A;  2FLS A;  1Y25 A;  2LJK A;  3GMF A;  3LEF A;  2RII A;  10GS A;  1WRY A;  4GQC A;  4EF0 A;  4TXO A;  5DAK A;  1ZCP A;  1PD2 1;  1GSE A;  2GZP A;  4BVX B;  4OFT A;  1WIK A;  3TUE A;  3E9J B;  3O6T A;  4PUF C;  2A4V A;  3GKK A;  12GS A;  4LMW A;  1R5P A;  3QPM A;  1J08 A;  1J0F A;  5BMU A;  2DKI A;  1Z6M A;  1GLQ A;  1XBS A;  2JSZ A;  2LST A;  5J4U A;  1NHO A;  2P5Q A;  4YQU A;  5G5E A;  2VAF A;  2CZ3 A;  4WKW A;  2H6Z A;  1FO5 A;  2CVB A;  4EC0 A;  2P0G A;  3IV4 A;  1A0R P;  1O8W A;  6GSV A;  2N5F A;  4HUA A;  3GUS A;  2X99 A;  1T4Z A;  1TOF A;  2IME A;  3F4R A;  3CSJ A;  2VD1 A;  2B5E A;  5E4W A;  5KN0 A;  3TOU A;  4ZL7 A;  3DEX A;  1WP0 A;  3C1S A;  3F4S A;  3EUR A;  4KE3 A;  3LW9 A;  1LBK A;  4MJC A;  5CRD A;  4WBR D;  1FB6 A;  4MLY A;  1UA5 A;  1VRS D;  4MK3 A;  1R5A A;  3HJO A;  1B48 A;  4V1A p;  4L0U A;  3D6I A;  5HR1 A;  1E2Y A;  4TKY A;  1EP8 A;  2WS2 A;  2NPB A;  3WGE A;  2E7P A;  4IEL A;  1RW1 A;  3GNJ A;  4J2F A;  3M1G A;  1XW5 A;  3L0H A;  3H4K A;  5AGY A;  1V40 A;  1Z6N A;  3IK7 A;  1A2J A;  1URM A;  5D9V A;  1XVQ A;  5DAL B;  3HA9 A;  1GH2 A;  4GQF A;  2JU5 A;  3TB2 A;  1WJK A;  4PQ1 A;  2IMD A;  1OKD A;  3IBH A;  2E2M A;  2QKE A;  5JWO B;  3QDN A;  2VOC A;  1O81 A;  1IYI A;  4XHM A;  2AYT A;  2H19 A;  3ZML A;  17GS A;  2HRN A;  2FNO A;  2WCI A;  1SEN A;  2DJJ A;  2NDO A;  3KP9 A;  4OCE A;  4PGT A;  1N8J A;  4XS4 B;  1PN0 A;  2FWH A;  4BWQ A;  2DMM A;  1XOA A;  4GLT A;  2LS5 A;  3ERW A;  5ELG A;  5DAL A;  2H71 A;  4ISD A;  1SJI A;  2GSS A;  4DVC A;  2YV7 A;  1AIU A;  4O7H A;  1T4Y A;  1YEP A;  2L57 A;  4I2T A;  3HXS A;  4Q5Q A;  3SBC A;  3DYR A;  3ZTL A;  2ON7 A;  1A2M A;  8GSS A;  3IC4 A;  2GDR A;  5LD0 A;  1W4V A;  1TDI A;  1TRU A;  4L8E A;  2HI7 A;  3F6F A;  4HJ2 A;  4K2X A;  1XFL A;  4JE1 A;  3RPP A;  4MCU A;  2PWJ A;  3UL3 A;  1YEX A;  4IVF A;  2P5R A;  3QAG A;  2L59 A;  2LUS A;  2VCV A;  2K8S A;  4KDU A;  6GSX A;  2F8F A;  3KD0 A;  3MDK A;  3N9J A;  1KTE A;  2CX3 A;  1YKA A;  2F3M A;  2WB9 A;  3MIX A;  2I3Y A;  4BIK A;  3BJ5 A;  2YZU A;  2H66 A;  3F3R A;  4YKF A;  4Q5N A;  2MMZ A;  2C80 A;  2M46 A;  4MAB A;  2PN8 A;  4BA7 A;  3HVS A;  3QMX A;  6GSS A;  1LJR A;  3IAS 2;  5DCH A;  4YKG A;  3P90 A;  4GSS A;  3GH9 A;  2IMF A;  1M9B A;  5B8B A;  5J9B A;  2JSY A;  1SL1 B;  3C7M A;  3QAW A;  1FVJ A;  4ML1 A;  1Z5Y E;  1ZMA A;  3D22 A;  1XW6 A;  1VF1 A;  4V2N A;  4EDY A;  2VCZ A;  5ID2 A;  4IJ3 A;  1XIY A;  1BJX A;  1HQO A;  2AV4 A;  1JLV A;  3VWU A;  5ECP B;  1Q4J A;  5LCZ A;  4OWY A;  1OC8 A;  3IE3 A;  1GSU A;  1U3A A;  3GIX A;  2A4H A;  2MYG A;  2NBS A;  1QXH A;  4PUR A;  2DIY A;  3VWW A;  1SK0 A;  3Q74 A;  1V57 A;  3RBT A;  1EOG A;  2FD3 A;  5HR3 A;  5IMF A;  13GS A;  3ZIJ A;  4NPB A;  4BVY B;  3G9B A;  4AJ8 A;  4XS6 A;  1JLW A;  1O85 A;  3WT1 A;  2FY6 A;  3I6A A;  5HQP A;  1Q98 A;  3GL5 A;  3CBU A;  2JL4 A;  1WWJ A;  2BMX A;  2K6V A;  4OFM A;  4WEY A;  1GSD A;  3APO A;  5KOX A;  2K9F A;  1M3I A;  14GS A;  4RI6 A;  2H70 A;  1ZOF A;  3TKS A;  3ZVJ A;  4ZBB A;  3CYN A;  2X8G A;  3FEU A;  4K5R A;  3QAV A;  3FZ5 A;  1SYX A;  1F9M A;  1EWX A;  1A8L A;  3H93 A;  2O7K A;  4KSO A;  1JZW A;  3LSZ A;  3Q18 A;  2VIM A;  1GWC A;  2JAD A;  3FK8 A;  1NHY A;  1PX6 A;  4ZIL A;  3R2Q A;  3LJR A;  1CQH A;  4ZB6 A;  1X5C A;  4K0G A;  5JCG A;  4ZB8 A;  4K5S A;  4NWY A;  2ON5 A;  1SKR B;  4HOJ A;  1NSW A;  2QA1 A;  4NXI A;  4HEA 2;  4D73 B;  1B9X C;  1SJZ A;  2H6Y A;  3F3Q A;  2RLI A;  2BTO T;  2WRT A;  3VLN A;  1K3O A;  4PTS A;  3LQ7 A;  5EVO A;  1GLP A;  2WDU A;  4WF4 A;  1SKW B;  1PA3 A;  1BYE A;  1YZX A;  1PFO A;  1R7H A;  5B8A A;  1T3B A;  2DJ0 A;  4G0L A;  4F0B A;  3IXR A;  3GTU A;  2R0P A;  2YAN A;  4LL1 B;  2MZC A;  2PU9 C;  5KN1 A;  1PKW A;  4D73 A;  3MYD A;  3C8E A;  2VL2 C;  1M7T A;  1A0F A;  2QGV A;  4MF6 A;  1AQW A;  1TP9 A;  3KM6 A;  3DIE A;  3WYW A;  4P3Y B;  1MD3 A;  1TU7 A;  2IWT A;  4K1F A;  5D9W A;  1ERT A;  5IMD A;  3ZL5 A;  4USS A;  4BWS A;  3UEM A;  3E0U A;  4HI7 A;  3PIN A; 
#chains in the Genus database with same CATH homology
 4J57 E;  3PPU A;  4I97 A;  1BED A;  2C3T A;  3LXZ A;  3GX0 A;  2GSQ A;  4N0Z A;  3W8S A;  4IHU A;  2ZNM A;  4ACS A;  2H1A A;  3D4M A;  1ERW A;  3H79 A;  2C0D A;  3KJY A;  20GS A;  4MZC A;  1VF4 A;  3OR5 A;  2IL3 A;  4KB3 A;  5B6M A;  3MAK A;  1QUW A;  1NW2 A;  2JZT A;  1G6Y A;  1SYR A;  2RUE A;  2TIR A;  1QQ2 A;  1ZYQ B;  4PNF A;  4K6X A;  2GT5 A;  3GUR A;  4YAV A;  4DSS B;  1NM3 A;  4FO5 A;  1S3C A;  3CSI A;  3CTF A;  3J7Y b;  3ZVJ D;  3HKR A;  2LRT A;  4NMU A;  4TR0 A;  1XWA A;  4KCE A;  5G2Z A;  2GQK A;  5IMC A;  2LV3 A;  2ALB A;  1PGT A;  1FHE A;  3TKQ A;  5HFK A;  3GFK A;  1K0O A;  5A4W A;  3VWX A;  1F3B A;  3UBK A;  1O73 A;  4PX1 A;  2OBK A;  3M0F A;  5D9T A;  4F9Z A;  2CZ2 A;  3GKX A;  4KSM A;  3TJK A;  4NV2 A;  2O87 A;  3DKS A;  18GS A;  2LJA A;  5IQY A;  3LWA A;  1PRX A;  5EPF A;  1W89 A;  2YWI A;  1TJD A;  1PL1 A;  1U87 A;  2FUG 2;  4XTS A;  2B3S A;  4IKH A;  2PGT A;  5ENU A;  1GTU A;  1G7E A;  3W6G A;  1VF2 A;  1GTB A;  3M9J A;  4Q5R A;  1GSS A;  1TXX A;  2C4J A;  2CAI A;  4RQR A;  4X1U A;  1A24 A;  4KH7 A;  4EIQ A;  2FGX A;  2C3N A;  2DJ3 A;  1YY7 A;  3LFL A;  3PH9 A;  4K9Z A;  3IC8 A;  3ZFL A;  5L71 A;  4AGS A;  3HJM A;  2OKA A;  4FH8 A;  1YKC A;  2E2G A;  1XWC A;  4YQV A;  1EEJ A;  4O32 A;  1PMT A;  1XXU A;  2R0G A;  1MDI A;  1ML6 A;  1ST9 A;  3UAP A;  3I69 A;  4POL A;  2K18 A;  1SK1 A;  2R0C A;  2V6K A;  3M3M A;  3NIV A;  2AUV A;  2B7J A;  2H1D A;  1M2B A;  1GSQ A;  5F07 A;  2R37 A;  4BVX A;  4HZ2 A;  3FRC A;  4AF2 A;  2L5L A;  5D8I A;  3TKR A;  3EVI A;  3UMA A;  2WFC A;  3HVX A;  3CSH A;  5D93 A;  1XCC A;  2DSA A;  4YQM A;  2CQ9 A;  2P31 A;  3EIN A;  2GVP A;  3C73 A;  3VUR A;  1RQM A;  2YJ7 A;  1K3Y A;  3UOM A;  2YPM A;  6GSW A;  2XC2 A;  3L9S A;  2LQQ A;  2H8L A;  2DKH A;  1TK0 B;  1GNW A;  2HZE B;  4JZQ A;  1HD2 A;  4OCF A;  3EC3 A;  3FZ4 A;  4AJ6 A;  2FWE A;  4IS0 A;  1TI3 A;  1AC1 A;  2V1M A;  4I5Q A;  1OKT A;  2JAC A;  2I81 A;  4WF5 A;  2WGR A;  2X8C A;  3M9K A;  4GTU A;  1TI1 A;  2X49 A;  1GTI A;  3WGD A;  1ILO A;  2J9H A;  1M2A A;  3F9U A;  1MDJ A;  4KW6 A;  3HVV A;  2LRN A;  4TVE A;  2VCW A;  1B4Q A;  4KDX A;  4G0I A;  5DCG A;  3UIW A;  2HLS A;  2H74 A;  2C3Q A;  1UVZ A;  3QD9 A;  2Z9S A;  3LYP A;  2H6X A;  1ACV A;  4POB A;  1AXD A;  1O7U A;  4X43 A;  1DUG A;  4EE0 A;  5G1K A;  3ERF A;  1JZD A;  2PPT A;  5CO3 A;  1THO A;  3M8N A;  2CT6 A;  3RDW A;  4XRD A;  5G5F A;  1LU4 A;  2A2P A;  4GRF A;  4IQA A;  3MWH A;  3QOU A;  9GSS A;  1H75 A;  2HXK A;  3ZIT A;  4O92 A;  4XS4 A;  2H0H A;  1JFU A;  1F6M C;  1FVK A;  5CRW A;  3DML A;  5HR2 A;  5C04 A;  3CRU A;  1GUM A;  3F0I A;  2DML A;  1HNB A;  4X4J A;  1EOH A;  2FWG A;  4TR4 A;  2L6D A;  5ECH B;  4DSQ A;  3UJ1 A;  1SD8 A;  2YV9 A;  3P8W A;  2O85 A;  3LOR A;  2VL9 A;  3RAZ A;  2IMK A;  4CDO A;  5A5K A;  2KP2 A;  4O5U A;  5AN1 A;  3GYK A;  1R4W A;  2VCQ A;  4F0C A;  3QFB C;  3BD2 A;  3BCI A;  2FA4 A;  4WR5 A;  1U6T A;  3ZYW A;  2MMA A;  3VI5 A;  4K0N A;  1F2E A;  5E59 A;  3IDV A;  2GQM A;  4MJE A;  4EVM A;  4XIH A;  1GUK A;  2EIQ A;  16GS A;  3HJP A;  5J41 A;  2DJ1 A;  2DJK A;  1WMJ A;  4IP6 A;  1F3A A;  1XPV A;  2D2Z A;  2RUF A;  4ICY A;  3DGQ A;  1K0N A;  2HZF A;  1V2A A;  1XWG A;  4G2E A;  4HU7 A;  3FMW A;  3UVT A;  4TRX A;  2KHP A;  2FHE A;  4IJI A;  5EL8 A;  5ELA A;  4E8H A;  5F8B A;  5KOW A;  2KP1 A;  22GS A;  4ZIJ A;  2OE0 A;  3VPT A;  4MPF A;  1QFN A;  1V98 A;  1M2D A;  1I9D A;  5D96 A;  3NOF A;  4Z7X A;  5CAX A;  4OO4 A;  5F0G A;  5DBQ A;  1YF1 A;  4I2U A;  4H86 A;  4LMV A;  2PBJ A;  2VUP A;  3US3 A;  2B6M A;  2C8U A;  5J5N A;  4AJ7 A;  2X64 A;  3C71 A;  1K0M A;  2TRX A;  2REM A;  5F06 A;  1QGV A;  5C00 A;  4EL1 A;  3RHB A;  3KCM A;  5IO0 A;  2VL2 A;  2PVQ A;  2L4C A;  4JBB A;  2C0E A;  2C0G A;  3IHQ A;  2GS3 A;  3U6V A;  2MMN A;  3DD3 A;  1XWK A;  1TRW A;  2OBI A;  4F82 A;  2FCH A;  3F6D A;  3HHV A;  4YAP A;  3HCZ A;  4BVY A;  2B7K A;  1FG4 A;  1S3D A;  4NAX A;  4G19 A;  4RQX A;  3VFI A;  3PR8 A;  4N30 A;  4K7O A;  5DDL A;  4J56 E;  4PNG A;  2GSR A;  4XRA A;  3Q19 A;  1UN2 A;  4KCA A;  3MSZ A;  4K2D A;  4N0V A;  2AHE A;  1EZK A;  4EKZ A;  2HRA A;  3WGX A;  2WUL A;  1SJ6 A;  5HR0 A;  1G7O A;  1S3A A;  3A5I A;  5ECN B;  1GSY A;  2IMI A;  19GS A;  4ID0 A;  4GXZ A;  1A8Y A;  5IM9 A;  1MD4 A;  2ES7 A;  1ON4 A;  2YZH A;  2VCT A;  2H1G A;  2HT9 A;  2MBT A;  2PUK C;  1N2A A;  1BX9 A;  1U88 A;  4L0W A;  4G0K A;  1M99 A;  1PL2 A;  4MF7 A;  3KTB A;  4IQ1 A;  5KN2 A;  1VGL A;  5F05 A;  1OC9 B;  3E3E A;  3TGZ A;  5A4U A;  3GRX A;  2B5X A;  2LJR A;  3DVW A;  2YNX A;  2QA2 A;  1FOH A;  3GSS A;  2CAQ A;  5BRT A;  1TK8 B;  1SKS B;  4ECB A;  2HYX A;  5AIS A;  1ZYP A;  1TW9 A;  2JZS A;  2DJ2 A;  3LYK A;  3KEB A;  2EIO A;  3SWL A;  5FWG A;  3TJJ A;  2LQO A;  4PUA A;  4TXV A;  1PKZ A;  4HJM A;  5CYY A;  2L6C A;  1JZO A;  2XBQ A;  3FR3 A;  2MBS A;  3IRA A;  2VCX A;  4ECI A;  3I9V 2;  3IHG A;  4MA9 A;  1K0D A;  2CA8 A;  5H5R A;  3QR6 A;  3TJG A;  5ECL B;  3VWV A;  4EUY A;  1M9A A;  2VLU A;  3DVX A;  2WZ9 A;  3I43 A;  1WPI A;  4OMV A;  2H01 A;  1RK4 A;  2V2G A;  2OAC A;  2VO4 A;  2HE3 A;  2HFD A;  5EY6 A;  3G7J A;  2IPA A;  4ZB9 A;  2C0F A;  4ZXG A;  1XWB A;  1A2L A;  2BJX A;  3IR4 A;  1Z7R A;  2E0Q A;  11GS A;  2H0I A;  1B8X A;  2LNT A;  4IBP A;  3ME7 A;  4TR3 A;  5IO2 A;  2H30 A;  3D0Z A;  4I8B A;  2YP6 A;  5B6N A;  3KTL A;  2M72 A;  4E8E A;  4OO5 A;  4V1A g;  3RHC A;  3QFA C;  3MNG A;  3KIJ A;  2VL3 A;  3EE2 A;  2F8A A;  3ZRD A;  2HRF A;  1TRV A;  1HYU A;  3KZQ A;  3GX8 A;  3HD5 A;  2EIR A;  4KUN A;  3J7Y k;  4OFN A;  1M0U A;  5G31 A;  4POK A;  5FT3 A;  5DVB A;  2A2S A;  4DSS A;  5GST A;  4NV5 A;  5INY A;  1EV4 A;  2J23 A;  5D9X A;  4TXO B;  1GP1 A;  5DAK B;  4O5R A;  2VLV A;  2QSI A;  2V32 A;  1Z3E A;  4FIW A;  4ILF A;  1HNA A;  2OA7 A;  5ECR B;  3IPZ A;  3TJF A;  4ECC A;  1TTZ A;  2HNL A;  5J9C A;  4IGJ A;  2OE3 A;  3ED3 A;  5GSS A;  3L9U A;  2LNS A;  2K8V A;  1XVW A;  1ERU A;  3ZFB A;  3GL3 A;  3TOT A;  2PVO C;  4MP4 A;  3A2V A;  4LL4 B;  2HSM A;  5FHI A;  3QCP A;  5IIZ A;  2H0G A;  5CRE A;  2V6O A;  1B9Y C;  3ZLP A;  1SL2 B;  1OYJ A;  3L9V A;  4KND A;  1EGO A;  3V1W A;  3GKM A;  1AAZ A;  3UBL A;  2R5G A;  4MMM A;  2H72 A;  3FR6 A;  4F03 A;  1T00 A;  1XZO A;  4OD7 A;  3KMN A;  3BBY A;  4IN0 A;  1ZGN A;  4QL9 A;  5KN3 A;  1THX A;  4HQS A;  2EC4 A;  5ECS A;  2I9H A;  1SL0 B;  1Z7P A;  3A2X A;  3A2W A;  4A5P A;  6GST A;  1O8X A;  2MMO A;  1JZR A;  4FYB A;  5LNK e;  2QC7 A;  4MNN A;  2L5O A;  3AY8 A;  3HY2 A;  4DEJ A;  5JCW A;  2O89 A;  2H76 A;  4EDZ A;  4MJA A;  5IOX A;  2FWF A;  5G1L A;  1ERV A;  4IW9 A;  4F2I A;  1K0B A;  4JED A;  3L78 A;  5ECO B;  4KX4 A;  2R2J A;  3JCM L;  2AB6 A;  4Z2T A;  1GL8 A;  1ZYN A;  5DJL A;  2YWN A;  2M80 A;  4KGI A;  1HNC A;  4LLR A;  2WJU A;  5IOW A;  2ZUP A;  5H5S A;  4PXO A;  2UZ8 A;  1EP7 A;  4FQU A;  3TRQ A;  2DLX A;  4N10 A;  5GZZ B;  4EXJ A;  4XS1 A;  2HZE A;  3TDG A;  2N5B A;  2XPE A;  2YN1 A;  1USB A;  4PQI A;  3IA1 A;  4WXT A;  5DQS A;  5CNW A;  3HDC A;  1MDK A;  2HSY A;  1MEK A;  3P7X A;  5DQY A;  1TRS A;  3H1N A;  2F51 A;  1TKD B;  3BCK A;  1T8E B;  2PMT A;  4Q5F A;  4WET A;  3WD6 A;  1SK2 A;  5COH A;  2HSH A;  3R3E A;  5IPG A;  4V2M A;  1CQG A;  4N11 A;  5IMV A;  2H1B A;  4I6X A;  4ZBD A;  5HFG A;  3RPN A;  2IIY A;  4YH2 A;  2OAD A;  5JCU A;  1YJ6 A;  1R26 A;  3C1R A;  4TN8 A;  1PN9 A;  2JZR A;  3BOA A;  1K0C A;  4HS1 A;  2F9S A;  1OAZ A;  1KEB A;  1X9M B;  3KH9 A;  2GLR A;  2KOK A;  3FYG A;  5DJM A;  2YJH A;  1U3I A;  3K8N A;  5H5Q A;  2XHF A;  3CRT A;  3EMX A;  1SU9 A;  5ECM B;  7GSS A;  3EWL A;  3TRP A;  5ID2 B;  6GSU A;  5ECQ B;  1GUL A;  2YOI A;  4EIP A;  5KEJ A;  1ZL9 A;  2NVL A;  1E6B A;  4HQZ A;  4MH2 A;  5CP1 A;  3APQ A;  1EGR A;  4MZB A;  3D4T A;  4ML6 A;  5HFI A;  3GN3 A;  1UC7 A;  2O8V B;  3GST A;  4G10 A;  2GZZ A;  2B1K A;  3EU4 A;  1SD9 A;  3TKS E;  1A23 A;  1QMV A;  2YCD A;  4LA1 A;  2N5A A;  5AIX A;  1IYH A;  2GTU A;  2XPD A;  1GRX A;  4CY8 A;  2TRC P;  1ZZY A;  5IMA A;  1EEM A;  2G2Q A;  3FKF A;  4MZW A;  5GAN D;  4MJB A;  5JWR B;  4BPY A;  1K3L A;  1X0R A;  3A3T A;  2X8H A;  3APS A;  2I4A A;  4NHZ A;  1JHB A;  3P2A A;  1DSB A;  1FW1 A;  2VM1 A;  3W8J A;  4MPG A;  1OE8 A;  2CX4 A;  1DE2 A;  1X9W B;  2GGT A;  2OJL A;  5ECI B;  1B4P A;  3CXG A;  1YF0 A;  4WR4 A;  3HZ4 A;  3F8U A;  3KMO A;  4QQ7 A;  2H73 A;  4MDC A;  1OVN A;  3TCO A;  1BAY A;  1TK5 B;  2RM5 A;  1C72 A;  4L5O A;  4WBJ A;  3UAR A;  3IK9 A;  4K8M A;  3IAM 2;  3F4T A;  2H75 A;  1WE0 A;  5ECK B;  2GZY A;  1OC3 A;  2RM6 A;  4CHS A;  2R3X A;  4NHW A;  2IFQ B;  2YWO A;  1KBN A;  4JR6 A;  4KAE A;  3ZMK A;  2PER A;  4KF9 A;  3PGT A;  1X9S B;  4HDE A;  1MTC A;  5G30 A;  3CTG A;  4O5Q A;  2CVD A;  4G9H A;  1O6J A;  3S9F A;  3LXT A;  4TW5 A;  2LRC A;  2B1L A;  1DE1 A;  3HYP A;  2NTO A;  5IMZ A;  3KH7 A;  1FOV A;  1AQX A;  4HU9 A;  5IPH A;  3FHK A;  4TOP A;  3HZ8 A;  3LG6 A;  4ZBA A;  3VPQ A;  4HZ4 A;  3G7Y A;  2VM2 A;  2GT6 A;  2R6K A;  3H8Q A;  2IFQ A;  3ME8 A;  3KP8 A;  4DSR A;  2OE1 A;  5B7C A;  2CVK A;  3FR9 A;  4JRR A;  3GHA A;  3DXB A;  2DBC A;  4JU5 A;  4X0X A;  1GNE A;  3D5J A;  3KXO A;  3GTU B;  4GWR A;  3EMP A;  3VI7 A;  4ECJ A;  5CRH A;  1XOB A;  2B5Y A;  1G6W A;  3EYT A;  3WT2 A;  1T1V A;  3VK9 A;  1G0T A;  5A4V A;  3GH6 A;  2GQL A;  3ISO A;  2CV4 A;  1KNG A;  4MH3 A;  4BL7 B;  3F63 A;  3DWV A;  4GSN A;  4PQH A;  1GSF A;  3FY7 A;  2R4V A;  2FA8 A;  1BG5 A;  2L4Q A;  1OC9 A;  1FB0 A;  3ERG A;  3G7I A;  4TR1 B;  2LTK A;  1AUC A;  2XBI A;  1H4O A;  1ABA A;  3DRN A;  5AIV A;  1FAA A;  2X4A A;  3NZN A;  4ZL8 A;  2ZCT A;  5CRG A;  4GST A;  3EU3 A;  1GUH A;  3FW2 A;  4BL7 A;  4QL7 A;  2VD0 A;  4KDY A;  3TKS C;  5ABR A;  3O76 A;  3L4N A;  1YQ1 A;  4K7N A;  1ZYE A;  4KA0 A;  1QK8 A;  5JWQ B;  3TJB A;  4IP1 A;  3UVH A;  1AW9 A;  1AQV A;  2V41 A;  4CY6 A;  3GKN A;  1V58 A;  4K7I A;  1PSQ A;  1X5D A;  4TR1 A;  3CMI A;  2IJY A;  4POM A;  3GV1 A;  3ZIV A;  5D73 A;  4EO3 A;  4ULX A;  3TKP A;  2GST A;  1GTA A;  1I5G A;  1PX7 A;  4FYC A;  4ZL9 A;  1WOU A;  3ZZX A;  4V2L A;  2YWM A;  1DBY A;  3KGK A;  2HRK A;  2LEG A;  4Z2U A;  3N5O A;  2KUC A;  1TU8 A;  1K0A A;  5GAP D;  1X5E A;  3EPT A;  1YDK A;  3GA4 A;  4RI7 A;  4XCS A;  2DIZ A;  3TRX A;  1Y6E A;  3LGC A;  4L5L A;  2G0F A;  3FZA A;  4GF0 A;  5J3R A;  1BQ7 A;  2LKU A;  1J9B A;  3U5R E;  2IN3 A;  2KLX A;  4FYU A;  1XW9 A;  4RUV A;  3Q6O A;  2A2R A;  1VF3 A;  2C1Y A;  1F37 A;  3O3T A;  1EV9 A;  3ZRE A;  1OE7 A;  2AAW A;  2DC5 A;  2VLT A;  4MF5 A;  1PQN A;  1Z9H A;  4CW9 A;  3IOS A;  4GCI A;  3D21 A;  3A5W A;  4JR4 A;  2I1U A;  2AJQ B;  6GSY A;  3FZ9 A;  1T7P B;  1V9W A;  4Z2R A;  2FLS A;  1Y25 A;  2LJK A;  3GMF A;  3LEF A;  2RII A;  10GS A;  1WRY A;  4GQC A;  4EF0 A;  4TXO A;  5DAK A;  1ZCP A;  1PD2 1;  1GSE A;  2GZP A;  4BVX B;  4OFT A;  1WIK A;  3TUE A;  3E9J B;  3O6T A;  4PUF C;  2A4V A;  3GKK A;  12GS A;  4LMW A;  1R5P A;  3QPM A;  1J08 A;  1J0F A;  5BMU A;  2DKI A;  1Z6M A;  1GLQ A;  1XBS A;  2JSZ A;  2LST A;  5J4U A;  1NHO A;  2P5Q A;  4YQU A;  5G5E A;  2VAF A;  2CZ3 A;  4WKW A;  2H6Z A;  1FO5 A;  2CVB A;  4EC0 A;  2P0G A;  3IV4 A;  1A0R P;  1O8W A;  6GSV A;  2N5F A;  4HUA A;  3GUS A;  2X99 A;  1T4Z A;  1TOF A;  2IME A;  3F4R A;  3CSJ A;  2VD1 A;  2B5E A;  5E4W A;  5KN0 A;  3TOU A;  4ZL7 A;  3DEX A;  1WP0 A;  3C1S A;  3F4S A;  3EUR A;  4KE3 A;  3LW9 A;  1LBK A;  4MJC A;  5CRD A;  4WBR D;  1FB6 A;  4MLY A;  1UA5 A;  1VRS D;  4MK3 A;  1R5A A;  3HJO A;  1B48 A;  4V1A p;  4L0U A;  3D6I A;  5HR1 A;  1E2Y A;  4TKY A;  1EP8 A;  2WS2 A;  2NPB A;  3WGE A;  2E7P A;  4IEL A;  1RW1 A;  3GNJ A;  4J2F A;  3M1G A;  1XW5 A;  3L0H A;  3H4K A;  5AGY A;  1V40 A;  1Z6N A;  3IK7 A;  1A2J A;  1URM A;  5D9V A;  1XVQ A;  5DAL B;  3HA9 A;  1GH2 A;  4GQF A;  2JU5 A;  3TB2 A;  1WJK A;  4PQ1 A;  2IMD A;  1OKD A;  3IBH A;  2E2M A;  2QKE A;  5JWO B;  3QDN A;  2VOC A;  1O81 A;  1IYI A;  4XHM A;  2AYT A;  2H19 A;  3ZML A;  17GS A;  2HRN A;  2FNO A;  2WCI A;  1SEN A;  2DJJ A;  2NDO A;  3KP9 A;  4OCE A;  4PGT A;  1N8J A;  4XS4 B;  1PN0 A;  2FWH A;  4BWQ A;  2DMM A;  1XOA A;  4GLT A;  2LS5 A;  3ERW A;  5ELG A;  5DAL A;  2H71 A;  4ISD A;  1SJI A;  2GSS A;  4DVC A;  2YV7 A;  1AIU A;  4O7H A;  1T4Y A;  1YEP A;  2L57 A;  4I2T A;  3HXS A;  4Q5Q A;  3SBC A;  3DYR A;  3ZTL A;  2ON7 A;  1A2M A;  8GSS A;  3IC4 A;  2GDR A;  5LD0 A;  1W4V A;  1TDI A;  1TRU A;  4L8E A;  2HI7 A;  3F6F A;  4HJ2 A;  4K2X A;  1XFL A;  4JE1 A;  3RPP A;  4MCU A;  2PWJ A;  3UL3 A;  1YEX A;  4IVF A;  2P5R A;  3QAG A;  2L59 A;  2LUS A;  2VCV A;  2K8S A;  4KDU A;  6GSX A;  2F8F A;  3KD0 A;  3MDK A;  3N9J A;  1KTE A;  2CX3 A;  1YKA A;  2F3M A;  2WB9 A;  3MIX A;  2I3Y A;  3BJ5 A;  2YZU A;  2H66 A;  3F3R A;  4YKF A;  4Q5N A;  2MMZ A;  2C80 A;  2M46 A;  4MAB A;  2PN8 A;  4BA7 A;  3HVS A;  3QMX A;  6GSS A;  1LJR A;  3IAS 2;  5DCH A;  4YKG A;  3P90 A;  4GSS A;  3GH9 A;  2IMF A;  1M9B A;  5B8B A;  5J9B A;  2JSY A;  1SL1 B;  3C7M A;  3QAW A;  1FVJ A;  4ML1 A;  1Z5Y E;  1ZMA A;  3D22 A;  1XW6 A;  1VF1 A;  4V2N A;  4EDY A;  2VCZ A;  5ID2 A;  4IJ3 A;  1XIY A;  1BJX A;  1HQO A;  2AV4 A;  1JLV A;  3VWU A;  5ECP B;  1Q4J A;  5LCZ A;  4OWY A;  1OC8 A;  3IE3 A;  1GSU A;  1U3A A;  3GIX A;  2A4H A;  2MYG A;  2NBS A;  1QXH A;  4PUR A;  2DIY A;  3VWW A;  1SK0 A;  3Q74 A;  1V57 A;  3RBT A;  1EOG A;  2FD3 A;  5HR3 A;  5IMF A;  13GS A;  3ZIJ A;  4NPB A;  4BVY B;  3G9B A;  4AJ8 A;  4XS6 A;  1JLW A;  1O85 A;  3WT1 A;  2FY6 A;  3I6A A;  5HQP A;  1Q98 A;  3GL5 A;  3CBU A;  2JL4 A;  1WWJ A;  2BMX A;  2K6V A;  4OFM A;  4WEY A;  1GSD A;  3APO A;  5KOX A;  2K9F A;  14GS A;  4RI6 A;  2H70 A;  1ZOF A;  3TKS A;  3ZVJ A;  4ZBB A;  3CYN A;  2X8G A;  3FEU A;  4K5R A;  3QAV A;  3FZ5 A;  1SYX A;  1F9M A;  1EWX A;  1A8L A;  3H93 A;  2O7K A;  4KSO A;  1JZW A;  3LSZ A;  3Q18 A;  2VIM A;  1GWC A;  2JAD A;  3FK8 A;  1NHY A;  1PX6 A;  4ZIL A;  3R2Q A;  3LJR A;  1CQH A;  4ZB6 A;  1X5C A;  4K0G A;  5JCG A;  4ZB8 A;  4K5S A;  4NWY A;  2ON5 A;  1SKR B;  4HOJ A;  1NSW A;  2QA1 A;  4NXI A;  4HEA 2;  4D73 B;  1B9X C;  1SJZ A;  2H6Y A;  3F3Q A;  2RLI A;  2BTO T;  2WRT A;  3VLN A;  1K3O A;  4PTS A;  3LQ7 A;  5EVO A;  1GLP A;  2WDU A;  4WF4 A;  1SKW B;  1PA3 A;  1BYE A;  1YZX A;  1R7H A;  5B8A A;  1T3B A;  2DJ0 A;  4G0L A;  4F0B A;  3IXR A;  3GTU A;  2R0P A;  2YAN A;  4LL1 B;  2MZC A;  2PU9 C;  5KN1 A;  1PKW A;  4D73 A;  3MYD A;  3C8E A;  2VL2 C;  1M7T A;  1A0F A;  2QGV A;  4MF6 A;  1AQW A;  1TP9 A;  3KM6 A;  3DIE A;  3WYW A;  4P3Y B;  1MD3 A;  1TU7 A;  2IWT A;  4K1F A;  5D9W A;  1ERT A;  5IMD A;  3ZL5 A;  4USS A;  4BWS A;  3UEM A;  3E0U A;  4HI7 A;  3PIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...