4H86A

Crystal structure of ahp1 from saccharomyces cerevisiae in reduced form
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
187
structure length
187
Chain Sequence
GLVPRGSHMASMSDLVNKKFPAGDYKFQYIAISQSDADSESCKMPQTVEWSKLISENKKVIITGAPAAFSPTCTVSHIPGYINYLDELVKEKEVDQVIVVTVDNPFANQAWAKSLGVKDTTHIKFASDPGCAFTKSIGFELAVGDGVYWSGRWAMVVENGIVTYAAKETNPGTDVTVSSVESVLAHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Peroxiredoxin type-2
publication title Crystal structure of Ahp1 from Saccharomyces cerevisiae in reduced form
rcsb
source organism Saccharomyces cerevisiae
total genus 57
structure length 187
sequence length 187
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2012-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4h86A00
2TRCP 4ZIJA 2YJ7A 4XS4A 2GZZA 3FR6A 2FWEA 3LSZA 3QDNA 3F6DA 1WJKA 4YH2A 1OAZA 3HJPA 2K9FA 4K8MA 2M72A 4GRFA 2AYTA 2OACA 2AUVA 3F3QA 3RHCA 2PN8A 5ECMB 1OYJA 1V2AA 4PXOA 2LQOA 2H70A 1LU4A 4WXTA 4PQIA 4XRAA 3ME8A 2VCZA 4MMMA 1U3IA 2GZYA 1JLWA 1AAZA 22GSA 14GSA 4KA0A 3TJJA 3CSHA 5IO0A 3D6IA 2XPDA 2HT9A 1AIUA 2QSIA 4K0GA 4BPYA 1GTAA 1EP8A 3CTGA 3RAZA 2H0HA 4HU9A 2JL4A 2H0IA 5C04A 3CXGA 1TKDB 4ZBBA 1K0NA 3IV4A 5LD0A 4IJIA 3TJGA 1B4QA 3QD9A 1NM3A 4MJEA 4MCUA 3BD2A 1PSQA 1A2JA 2IMKA 5DCHA 1H75A 3F4RA 1TRVA 3D5JA 5G31A 3TKSE 4EXJA 2V6KA 2IMEA 3KIJA 3QFAC 1ILOA 1TRSA 3GYKA 1EEJA 2VM1A 3LYKA 4HJ2A 2ON5A 1UC7A 1XXUA 4WR5A 1A0FA 1BYEA 5B6NA 3M3MA 2G2QA 2YWMA 1GH2A 1GSDA 2B5XA 3E0UA 2VO4A 1K3YA 4GQFA 2VCTA 2XPEA 5KN1A 9GSSA 4JU5A 2IL3A 2OADA 2N5FA 2CZ2A 4GXZA 1WRYA 4NXIA 4I5QA 1YDKA 3EC3A 2LS5A 3LFLA 1AW9A 5ECPB 2C3QA 2H73A 4FIWA 2HSYA 4F9ZA 3EU4A 1RQMA 1T7PB 4V1Ag 3D4MA 2C3NA 1ZOFA 3UL3A 5J5NA 2FWFA 3D4TA 1B48A 3I9V2 5DQYA 2AJQB 4IQAA 1EEMA 1OE8A 1T1VA 4X0XA 2V6OA 2B5EA 1ACVA 3W6GA 4XIHA 2C0EA 4DSQA 1ZCPA 2H1AA 3TKSA 5J41A 3MAKA 5H5SA 2CZ3A 4POLA 3TRQA 1A2LA 1FO5A 2B7JA 4K0NA 2NVLA 3BOAA 5IMDA 3FR3A 3QR6A 5HFIA 4ZBDA 4KSOA 2I4AA 1MDIA 4V2LA 3ERWA 3SBCA 2C3TA 3TCOA 1KTEA 2PVOC 3FY7A 4LL1B 3TJFA 5D93A 2DJJA 1YEXA 5DAKA 4XTSA 1TOFA 3GURA 5ELGA 2B1KA 4F03A 4WF5A 4QL7A 3EYTA 1KBNA 3QMXA 4I2UA 2WDUA 3DWVA 2GSRA 1URMA 3WD6A 3GH6A 1SK0A 1SJZA 4ECIA 1K0OA 3FZ4A 1QQ2A 2HI7A 2B1LA 3VPQA 5JWQB 3C1SA 4BA7A 5ECRB 2FGXA 3TJKA 3DYRA 5EY6A 1PMTA 4ZXGA 2A4VA 1C72A 3GA4A 3ZREA 3KMNA 1F6MC 1V40A 1OVNA 5CRGA 5HQPA 2F51A 4WETA 3OR5A 5FHIA 2DMMA 2HZEA 8GSSA 1FB0A 5ENUA 4WBJA 3ZTLA 5DDLA 5IOXA 1Q98A 2G0FA 3N9JA 3H8QA 4JR4A 1U3AA 2LJAA 4IGJA 1GSEA 4L0WA 3DGQA 2YV7A 4N11A 16GSA 1PGTA 4ULXA 1SENA 10GSA 1ML6A 2C4JA 1EOGA 4ZB6A 3IA1A 4HEA2 1F3AA 4KCAA 3ZVJD 4BL7A 2PGTA 2LV3A 2YN1A 2M80A 1G0TA 5CNWA 5GAPD 1R26A 5IMFA 1O8WA 1XVQA 1AQVA 2H19A 1SD9A 1VGLA 4MF5A 4ZB8A 4QL9A 5AISA 4IS0A 2XC2A 1AUCA 2WB9A 4MF6A 4IKHA 4N0VA 3W8SA 5KN0A 4XCSA 2H30A 5KN3A 2E7PA 2OE0A 4N30A 3FK8A 2C80A 2Z9SA 3HY2A 2E2MA 4PUFC 5ECSA 4CDOA 1X5EA 2GZPA 1SL1B 1LJRA 3ZYWA 3F6FA 2L4QA 4Q5NA 4DSSB 1UA5A 1FAAA 1M2DA 4V1Ap 3O76A 2FWHA 1XWKA 3NIVA 3VLNA 2K8VA 4PNFA 1XWCA 1VRSD 1DBYA 3CSJA 4I6XA 4MH3A 2IN3A 1EOHA 4GLTA 1S3AA 1WWJA 5JCWA 5HR1A 6GSSA 3L9SA 1TRWA 4MJBA 2E0QA 1YQ1A 1X5CA 2FLSA 1A24A 1T8EB 2YZUA 2L5OA 3ERFA 3LQ7A 2HRFA 4PUAA 1HNCA 3EE2A 2WJUA 3UBLA 1PQNA 1QMVA 2WS2A 3GH9A 1QGVA 5IMCA 2CAIA 3FRCA 3O6TA 1MDJA 4TXVA 2DIYA 2IIYA 2DBCA 1SU9A 3ME7A 3HJMA 1PD21 2HSHA 1W89A 3LGCA 4TRXA 1OC9A 3EMPA 2GSTA 3UVTA 1ZZYA 5ELAA 2L6DA 3DVXA 2LTKA 4HQZA 3Q6OA 5G5FA 2C1YA 2KHPA 4TN8A 4EC0A 3GX0A 5D9VA 1RW1A 11GSA 2NDOA 3A5WA 5IOWA 2YP6A 2MMAA 4K7OA 1Z3EA 2K18A 3FR9A 3H93A 2L5LA 2PU9C 2DJ3A 2P5RA 4LMWA 1F9MA 3W8JA 2X99A 2H01A 5IM9A 1PX7A 1M7TA 2CX3A 2YV9A 3CBUA 4KCEA 1X9WB 4TOPA 1KNGA 2PWJA 5IMAA 2YPMA 4I97A 3HVSA 4AJ6A 2GT5A 1GUMA 2MMNA 4NHWA 3TRPA 2BJXA 1EV4A 2YWIA 5G1LA 2OBKA 4PNGA 2LJKA 3VPTA 4KAEA 5G1KA 1T00A 1PKZA 2GGTA 2TIRA 1Q4JA 4TR1B 1K0CA 1MTCA 4GSSA 4JBBA 5JCUA 2CAQA 2I3YA 1O85A 2PPTA 1XPVA 2RIIA 4K6XA 2VCQA 2V41A 3A3TA 4TKYA 6GSTA 1MD3A 5IIZA 3BJ5A 4N10A 5DALB 3H4KA 18GSA 4YAPA 2MBSA 4OWYA 2HYXA 2WCIA 4NV2A 5D8IA 3FEUA 1ZYQB 5ECLB 2HZFA 1EZKA 1TK8B 1GWCA 1B4PA 1GLQA 7GSSA 1I5GA 4JEDA 5HR3A 3G7JA 2CQ9A 2GT6A 3DRNA 3GIXA 3KZQA 5D9WA 5ECIB 1X5DA 1BQ7A 4ECJA 4MLYA 3GL5A 4TR3A 4MJAA 1K0DA 2VCWA 1N8JA 1ERTA 3KH7A 1VF4A 1YJ6A 5A4VA 2WFCA 4KDYA 4L8EA 2JZSA 4TXOB 4GWRA 2QGVA 1R5PA 1TK5B 5IQYA 3WT2A 4XS1A 1DE2A 1YKAA 4D73B 3L4NA 1ERUA 2IWTA 2GSSA 3BCKA 1O6JA 2VUPA 4GQCA 5COHA 3IK9A 2X64A 3ZMKA 3G9BA 3GFKA 2CT6A 1V9WA 4L0UA 1PL1A 3KM6A 4KE3A 2H66A 3VI5A 1BX9A 2LJRA 3L0HA 3PGTA 1X0RA 4XHMA 4BWSA 2L6CA 2H76A 1DSBA 5ECHB 1NW2A 2CVKA 4I8BA 4ZL9A 4GSTA 4KH7A 2KOKA 2LRNA 5C00A 3RBTA 4PX1A 1F37A 5A4WA 5IMZA 3ZMLA 1SKRB 1IYHA 1HQOA 2EIOA 1SKSB 2KP2A 3Q18A 3HZ8A 3TKSC 4CW9A 4ML6A 2JZRA 3GKNA 1GSYA 2PBJA 3D22A 2H75A 2H1BA 2C8UA 2GSQA 3M0FA 2L59A 2N5BA 1NHYA 4NAXA 2VL3A 6GSUA 3HJOA 1MEKA 2OA7A 3IAM2 4K9ZA 4J57E 3DVWA 2I9HA 4ACSA 2VL9A 3P8WA 2ZNMA 1JZOA 3F8UA 5G2ZA 5AN1A 2RUEA 3UAPA 2DC5A 5DVBA 1OE7A 4E8HA 1K3OA 5HFKA 4TR0A 1THXA 5CP1A 5F06A 3P2AA 3DKSA 3IRAA 3KXOA 2GDRA 1PRXA 3GX8A 2LQQA 2RUFA 3UIWA 2VLVA 2AB6A 1VF3A 4K1FA 6GSWA 2X8HA 4WF4A 2ALBA 1WOUA 2BMXA 3EWLA 1I9DA 2MYGA 1XW6A 3BCIA 1BG5A 2IMDA 4FYCA 3CRUA 3ZITA 2GTUA 3EMXA 3K8NA 3H79A 1PX6A 3QCPA 3QFBC 2FA4A 5B6MA 1Z7RA 4POMA 5HR2A 3F63A 1OC3A 5KEJA 4ML1A 3CRTA 4RQRA 1O8XA 1EGOA 5GZZB 1Z5YE 3TB2A 4K7NA 1FG4A 1A23A 2WULA 3VWUA 4DSSA 2DJ2A 1J9BA 4PGTA 3LXZA 4KX4A 1GSQA 3ZZXA 2HLSA 4MDCA 4G2EA 1HD2A 2YZHA 1ERWA 5JWOB 3MSZA 4MK3A 5J3RA 1TDIA 1T4ZA 2I81A 2R37A 4MF7A 1GL8A 1JFUA 2FHEA 4NPBA 5DBQA 1XW9A 1AQXA 3DD3A 2B6MA 4RUVA 3VWVA 2MBTA 2CV4A 2E2GA 2ON7A 2LRCA 3VFIA 3Q74A 3VK9A 4ZBAA 2EC4A 2YWNA 3TKQA 5B8AA 4IVFA 3IXRA 4HI7A 1OC8A 1SL0B 5CRHA 3IOSA 5F0GA 2DIZA 1WIKA 3M9KA 1T4YA 3VURA 3GTUB 1Z6MA 4IELA 3KGKA 4ILFA 1CQGA 1M9BA 2GLRA 5CRWA 2HE3A 3WYWA 4ZL7A 2HXKA 3HDCA 5B7CA 1M2BA 2LNTA 2J23A 4EDYA 2OE1A 2ZUPA 1U87A 1FOVA 3PINA 1NSWA 5H5RA 3I6AA 3Q19A 4X43A 2HNLA 2JADA 1WE0A 4NHZA 1JZDA 1XWGA 3IR4A 1THOA 4JZQA 5CYYA 1EP7A 3WGDA 5E4WA 1R7HA 1GUHA 1G7EA 3GHAA 1GNWA 3CYNA 1QUWA 4ZL8A 4DSRA 1HNAA 4IW9A 2LSTA 5D96A 2O89A 2VLTA 2YCDA 2JSYA 3F9UA 1FHEA 3HVXA 4NV5A 1A8LA 3IHQA 5CREA 2O87A 3TGZA 4LL4B 1YY7A 4EE0A 4KSMA 4L5LA 4J56E 2VD0A 5CAXA 3L9VA 3RDWA 4TR1A 4YAVA 5G30A 3L78A 1E6BA 2LUSA 5EVOA 1SYRA 3UOMA 2DJ1A 2CA8A 3LYPA 3FZ9A 2OBIA 4LA1A 1HNBA 1ST9A 2YNXA 5HFGA 3RHBA 3HA9A 3M1GA 4OO5A 5EPFA 1A8YA 2YOIA 2LNSA 3DEXA 5CO3A 3WGXA 3UJ1A 3QAGA 2B3SA 5DALA 2CVDA 4KNDA 4KB3A 1JZRA 2H74A 1EV9A 2MZCA 2IJYA 1F2EA 5IPGA 1ZYEA 3DXBA 3EINA 2VL2C 1XFLA 5ECKB 1NHOA 3GL3A 1H4OA 2FWGA 4GTUA 3LG6A 2V1MA 4O32A 1DUGA 3RPPA 4BVXA 1A0RP 3TKPA 1K0MA 1YF0A 3A2WA 2XHFA 1CQHA 1S3DA 1XZOA 4Q5RA 5LNKe 2F9SA 2DMLA 3ZIVA 13GSA 1MD4A 3VI7A 2FY6A 1JZWA 2H1DA 1TW9A 4K7IA 2ZCTA 4TW5A 2VIMA 5KN2A 3M8NA 4EUYA 3UEMA 3GNJA 4TXOA 1TRUA 4KGIA 19GSA 2O7KA 3ZRDA 5ECOB 4WBRD 1SJ6A 1GTUA 1SJIA 3KJYA 3P7XA 3ZIJA 2H6XA 4D73A 2IFQB 4TVEA 2O8VB 3DMLA 1YEPA 1JLVA 2P0GA 1ABAA 2WZ9A 1B9YC 1FVJA 5F8BA 2JU5A 2VOCA 3KD0A 2DJKA 5ID2B 4G19A 1XOBA 3IBHA 3APOA 1ZGNA 3LXTA 3DIEA 3FZ5A 4EVMA 4XS6A 1EWXA 3N5OA 4ECCA 1GULA 1G7OA 5AIXA 4Z7XA 2NBSA 3PR8A 5FWGA 4FO5A 4TR4A 5A5KA 2R4VA 3E3EA 2X8CA 4PQ1A 3MDKA 4O7HA 1TU7A 1M0UA 2DSAA 3C8EA 4H86A 3GV1A 1PA3A 3KTLA 3FKFA 1DE1A 6GSXA 5E59A 1V98A 4G9HA 2R2JA 4IP1A 1RK4A 4OFMA 5DJLA 1AXDA 1W4VA 3ZL5A 3TUEA 4DVCA 3U5RE 4RI6A 4HS1A 3CSIA 2HFDA 3JCML 2VD1A 4GF0A 4F2IA 4K2DA 2AHEA 3IAS2 4POKA 3LEFA 4HZ2A 1BEDA 1SK2A 2FUG2 2H8LA 4F0CA 5G5EA 2M46A 4POBA 4F82A 4JR6A 5J9CA 3FYGA 4J2FA 5JCGA 2D2ZA 4XRDA 3EURA 2H72A 4FH8A 1PL2A 4WKWA 2A2RA 2REMA 2YANA 2LRTA 5D9TA 2PMTA 3WT1A 2LKUA 3APQA 4MPGA 4G10A 20GSA 2YJHA 1O81A 1G6YA 2LEGA 3GMFA 2N5AA 1TTZA 3TKRA 2XBQA 4FYUA 1Y25A 2JSZA 4EL1A 3G7YA 3C71A 4IBPA 4ECBA 2PUKC 3I43A 5DQSA 2V32A 4I2TA 4PURA 1XBSA 1SD8A 3A2XA 2GQKA 3EVIA 3ZFLA 4ZB9A 1TJDA 2K8SA 2EIRA 3GRXA 4HU7A 4NWYA 3MNGA 4FYBA 3UARA 3LJRA 4EDZA 2QKEA 1V58A 1S3CA 2P31A 1U6TA 1J0FA 2O85A 4EKZA 2C0GA 1J08A 1BAYA 5AGYA 2HRNA 1GLPA 2B7KA 3HYPA 4OCFA 1XCCA 4XS4B 3QAWA 5J9BA 4WEYA 2VAFA 4ZILA 2F8FA 4MJCA 1FW1A 4N0ZA 3IE3A 3MWHA 1Z7PA 2RLIA 1UN2A 2JZTA 2IMIA 3FZAA 4MP4A 1SKWB 1Y6EA 3GTUA 2ES7A 4AF2A 1VF1A 5D73A 1B8XA 3ZLPA 2GVPA 5DCGA 1AQWA 3F4TA 3HVVA 2K6VA 4F0BA 5EL8A 1O73A 1ON4A 1FVKA 1JHBA 4CHSA 5D9XA 5H5QA 3E9JB 1HYUA 3APSA 5INYA 3H1NA 3ISOA 1O7UA 4OFTA 1GSUA 3O3TA 2CX4A 3GKXA 2RM5A 3IDVA 2IPAA 1R4WA 2DJ0A 3F0IA 2AV4A 1VF2A 4KUNA 3CTFA 1XVWA 2JACA 4KW6A 3HHVA 4OO4A 3C7MA 1QK8A 4YQVA 6GSYA 1ERVA 2WRTA 5ECQB 1TP9A 3KH9A 3BBYA 2RM6A 3SWLA 1PN9A 3F3RA 4HJMA 2R6KA 5IMVA 1GRXA 2VLUA 1PKWA 4IHUA 3R2QA 3PH9A 1V57A 1K3LA 1OKTA 3KP8A 3V1WA 1GP1A 2TRXA 3GN3A 4X1UA 4L5OA 2B5YA 5B8BA 2V2GA 2OKAA 3G7IA 3QPMA 1SK1A 3GKKA 4MZWA 2AAWA 2VM2A 1K0BA 3US3A 5F05A 3VWWA 3KMOA 3HCZA 2L4CA 4JRRA 5AIVA 2I1UA 4AJ8A 4BVYA 3FW2A 3GUSA 2MMZA 4ID0A 2FD3A 4IP6A 5A4UA 4BWQA 3TOUA 2BTOT 1M2AA 3NOFA 1GSFA 1XWAA 5GAND 4PQHA 1ZMAA 3TDGA 4KDXA 4MZBA 2X8GA 1XWBA 1UVZA 2H6YA 3M9JA 12GSA 4OFNA 1GNEA 5GSSA 3A2VA 5JWRB 3U6VA 2FA8A 4NMUA 3UBKA 2MMOA 5FT3A 3J7Yk 4MH2A 4O92A 2J9HA 6GSVA 1USBA 4Q5QA 3UMAA 1Z6NA 1G6WA 5IPHA 4EO3A 1X9MB 3C1RA 3TOTA 2R5GA 4MZCA 4MABA 4GCIA 3QOUA 5L71A 1Z9HA 2FCHA 1U88A 2IFQA 5DAKB 1LBKA 2H1GA 4KDUA 2GQMA 2DLXA 4QQ7A 5ID2A 5J4UA 5ABRA 2PERA 1M9AA 4RI7A 2GQLA 1R5AA 3KCMA 1WPIA 4HZ4A 4GSNA 4HDEA 2C0DA 3RPNA 2GS3A 3L9UA 2HZEB 4HQSA 3KTBA 2F8AA 3HZ4A 4E8EA 5CRDA 1X9SB 1KEBA 4O5RA 1GUKA 3D21A 1QXHA 1F3BA 4HUAA 2NPBA 1TU8A 4OD7A 3ZVJA 1TK0B 5F07A 1YZXA 3FHKA 3I69A 4LLRA 1YKCA 1N2AA 2A2SA 2KLXA 1ZL9A 2NTOA 3ED3A 3AY8A 3HXSA 3IPZA 1WMJA 1BJXA 4JE1A 1SYXA 4MA9A 2H71A 1GSSA 1A2MA 1TXXA 4YQUA 2F3MA 2KP1A 3HKRA 1MDKA 4IN0A 4IQ1A 1AC1A 3TJBA 1B9XC 2OJLA 3GKMA 3S9FA 17GSA 3CMIA 3NZNA 3TRXA 1E2YA 3WGEA 1TI3A 2H0GA 5ECNB 1IYIA 2EIQA 2CVBA 1FB6A 5GSTA 3P90A 1WP0A 1XOAA 3HD5A 3LORA 4V2NA 1YF1A 2C0FA 1GTBA 2XBIA 1SL2B 1T3BA 2H6ZA 4AGSA 4DEJA 3C73A 1EGRA 4MPFA 3GSTA 2PVQA 2L57A 5LCZA 2VCXA 1K0AA 3UVHA 4LMVA 4V2MA 3IK7A 2FNOA 1XW5A 4OMVA 3ERGA 4IJ3A 4Q5FA 3GSSA 5DJMA 2P5QA 1GTIA 4RQXA 2VL2A 1QFNA 3KEBA 3LWAA 2R3XA 5IO2A 2KUCA 2QC7A 3D0ZA 2VCVA 2IMFA 3ZFBA 4P3YB 4YQMA 3F4SA 1XIYA 2OE3A 3IC4A 4HOJA 3J7Yb 5HR0A 2YWOA 3VWXA 4AJ7A 1TI1A 4ISDA 1OKDA 1M99A 4EF0A 4OCEA 3EU3A 2WGRA 3QAVA 3KP9A 1OC9B 4WR4A
chains in the Genus database with same CATH superfamily
2TRCP 4ZIJA 2YJ7A 4XS4A 2GZZA 3FR6A 2FWEA 3LSZA 3QDNA 3F6DA 1WJKA 4YH2A 1OAZA 3HJPA 2K9FA 1M3IA 4K8MA 2M72A 4GRFA 2AYTA 2OACA 2AUVA 3F3QA 3RHCA 2PN8A 5ECMB 1OYJA 1V2AA 4PXOA 2LQOA 2H70A 1LU4A 4WXTA 4PQIA 4XRAA 3ME8A 2VCZA 4MMMA 1U3IA 2GZYA 1JLWA 1AAZA 22GSA 14GSA 4KA0A 3TJJA 3CSHA 5IO0A 3D6IA 2XPDA 3IHGA 2HT9A 1AIUA 2QSIA 4K0GA 4BPYA 1GTAA 1EP8A 3CTGA 3RAZA 2H0HA 4HU9A 2JL4A 2H0IA 5C04A 3CXGA 1TKDB 4ZBBA 1K0NA 3IV4A 5LD0A 4IJIA 3TJGA 1B4QA 3QD9A 1NM3A 4MJEA 4MCUA 3BD2A 1PSQA 1A2JA 2IMKA 5DCHA 1H75A 3F4RA 1TRVA 1PFOA 3D5JA 5G31A 3TKSE 4EXJA 2V6KA 2IMEA 3KIJA 3QFAC 1ILOA 1TRSA 3GYKA 1EEJA 2VM1A 3LYKA 4HJ2A 2ON5A 1UC7A 1XXUA 4WR5A 1A0FA 1BYEA 5B6NA 3M3MA 2G2QA 2YWMA 1FOHA 1GH2A 1GSDA 2B5XA 3E0UA 2VO4A 1K3YA 4GQFA 2VCTA 4HSCX 2XPEA 5KN1A 9GSSA 4JU5A 2IL3A 2OADA 2N5FA 2CZ2A 4GXZA 1WRYA 4NXIA 4I5QA 1YDKA 3EC3A 2LS5A 3LFLA 2HSMA 1AW9A 5ECPB 2C3QA 2H73A 4FIWA 2HSYA 4F9ZA 3EU4A 1RQMA 1T7PB 4V1Ag 3D4MA 2C3NA 1ZOFA 3UL3A 5J5NA 2FWFA 3D4TA 1B48A 3I9V2 5DQYA 2AJQB 4IQAA 1EEMA 1OE8A 1T1VA 4X0XA 2V6OA 2B5EA 1ACVA 3W6GA 4XIHA 2C0EA 4DSQA 1ZCPA 2H1AA 3TKSA 5J41A 3MAKA 5H5SA 2CZ3A 4POLA 3TRQA 1A2LA 1FO5A 2B7JA 4K0NA 2NVLA 3BOAA 5IMDA 3FR3A 3QR6A 5HFIA 4ZBDA 4KSOA 2I4AA 1MDIA 4V2LA 3ERWA 3SBCA 2C3TA 3TCOA 1KTEA 2PVOC 3FY7A 4LL1B 3TJFA 5D93A 2DJJA 1YEXA 5DAKA 4XTSA 1TOFA 3GURA 5ELGA 2B1KA 4F03A 4WF5A 4QL7A 3EYTA 1KBNA 3QMXA 4I2UA 2WDUA 3DWVA 2GSRA 1URMA 3WD6A 3GH6A 1SK0A 1SJZA 4ECIA 1K0OA 3FZ4A 1QQ2A 2HI7A 2B1LA 3VPQA 5JWQB 3C1SA 4BA7A 5ECRB 2FGXA 3TJKA 3DYRA 5EY6A 1PMTA 4ZXGA 2A4VA 1C72A 3GA4A 3ZREA 3KMNA 1F6MC 1V40A 1OVNA 5CRGA 5HQPA 2F51A 4WETA 3OR5A 5FHIA 2DMMA 2HZEA 8GSSA 1FB0A 5ENUA 4WBJA 3ZTLA 5DDLA 5IOXA 1Q98A 2G0FA 3N9JA 3H8QA 4JR4A 1U3AA 2LJAA 4IGJA 1GSEA 4L0WA 3DGQA 2YV7A 4N11A 16GSA 1PGTA 4ULXA 1SENA 10GSA 1ML6A 2C4JA 1EOGA 4ZB6A 4Z2UA 3IA1A 4HEA2 1F3AA 4KCAA 3ZVJD 4BL7A 2PGTA 2LV3A 2YN1A 3LW9A 2M80A 1G0TA 5CNWA 5GAPD 1R26A 5IMFA 1O8WA 1XVQA 1AQVA 2H19A 1SD9A 1VGLA 4MF5A 4ZB8A 4QL9A 5AISA 4IS0A 2XC2A 1AUCA 2WB9A 4MF6A 4IKHA 4N0VA 3W8SA 5KN0A 4XCSA 2H30A 5KN3A 2E7PA 2OE0A 4N30A 3FK8A 2C80A 2Z9SA 3HY2A 2E2MA 4PUFC 5ECSA 4CY8A 4CDOA 1X5EA 2GZPA 1SL1B 1LJRA 3ZYWA 3F6FA 2L4QA 4Q5NA 4DSSB 1UA5A 1FAAA 1M2DA 4V1Ap 3O76A 2FWHA 1XWKA 3NIVA 3VLNA 2K8VA 4PNFA 1XWCA 1VRSD 1DBYA 4EIPA 3CSJA 4I6XA 4MH3A 2IN3A 1EOHA 4GLTA 1S3AA 1WWJA 5JCWA 5HR1A 1XG8A 2A2PA 6GSSA 3L9SA 1TRWA 4MJBA 2E0QA 1YQ1A 1X5CA 2FLSA 1A24A 1T8EB 2YZUA 2L5OA 3ERFA 3LQ7A 2HRFA 4PUAA 1HNCA 3EE2A 2WJUA 3UBLA 1PQNA 1QMVA 2WS2A 3GH9A 1QGVA 5IMCA 2CAIA 3FRCA 3O6TA 1MDJA 4TXVA 2DIYA 2IIYA 2DBCA 1SU9A 3ME7A 3HJMA 1PD21 2HSHA 1W89A 3LGCA 4TRXA 1OC9A 3EMPA 2GSTA 3UVTA 1ZZYA 5ELAA 3FMWA 2L6DA 3DVXA 2LTKA 4HQZA 3Q6OA 5G5FA 2C1YA 2KHPA 4TN8A 4EC0A 3GX0A 5D9VA 1RW1A 11GSA 2NDOA 3A5WA 5IOWA 2YP6A 2MMAA 4K7OA 1Z3EA 2K18A 3FR9A 3H93A 2L5LA 2PU9C 2DJ3A 2P5RA 4LMWA 1F9MA 3W8JA 2X99A 2H01A 5IM9A 1PX7A 1M7TA 2CX3A 2YV9A 3CBUA 4KCEA 1X9WB 4TOPA 1KNGA 2PWJA 5IMAA 2YPMA 4I97A 2R0GA 3HVSA 4AJ6A 2GT5A 1GUMA 2MMNA 4NHWA 3TRPA 2BJXA 1EV4A 2YWIA 5G1LA 2OBKA 4PNGA 2LJKA 3VPTA 4KAEA 5G1KA 1T00A 3CQFA 1PKZA 2GGTA 2TIRA 1Q4JA 4TR1B 1K0CA 1MTCA 4GSSA 4JBBA 5JCUA 2CAQA 2I3YA 1O85A 2PPTA 1XPVA 2RIIA 4K6XA 2VCQA 2V41A 3A3TA 4TKYA 6GSTA 1MD3A 5IIZA 3BJ5A 4N10A 5DALB 3H4KA 18GSA 4YAPA 2MBSA 4OWYA 2HYXA 2WCIA 4NV2A 5D8IA 3FEUA 1ZYQB 5ECLB 1PN0A 2DKHA 2HZFA 1EZKA 1TK8B 1GWCA 1B4PA 1GLQA 7GSSA 1I5GA 4JEDA 4BVXB 5HR3A 3G7JA 2CQ9A 2GT6A 3DRNA 3GIXA 3KZQA 5D9WA 5ECIB 1X5DA 1BQ7A 4ECJA 4MLYA 3GL5A 4USSA 4TR3A 4MJAA 1K0DA 2VCWA 1N8JA 1ERTA 3KH7A 1VF4A 1YJ6A 5A4VA 2WFCA 4KDYA 4L8EA 2JZSA 4TXOB 4GWRA 2QGVA 1R5PA 1TK5B 5IQYA 3WT2A 4XS1A 1DE2A 1YKAA 4D73B 3L4NA 1ERUA 2IWTA 2GSSA 3BCKA 1O6JA 2VUPA 4GQCA 5COHA 3IK9A 2X64A 3ZMKA 3G9BA 3GFKA 2CT6A 1V9WA 4BIKA 4L0UA 1PL1A 3KM6A 4KE3A 2H66A 3VI5A 1BX9A 2LJRA 3L0HA 3PGTA 1X0RA 4XHMA 4BWSA 2L6CA 2H76A 1DSBA 5ECHB 1NW2A 2CVKA 4I8BA 4ZL9A 4GSTA 4KH7A 2KOKA 2LRNA 5C00A 3RBTA 4PX1A 3MYDA 1F37A 3IC8A 5A4WA 5IMZA 3ZMLA 1SKRB 1IYHA 1HQOA 2EIOA 1SKSB 2KP2A 3Q18A 3HZ8A 3TKSC 4CW9A 4ML6A 2JZRA 3GKNA 2QA2A 1GSYA 2PBJA 3D22A 2H75A 2H1BA 2C8UA 2GSQA 3M0FA 2L59A 2N5BA 1NHYA 4NAXA 2VL3A 6GSUA 3HJOA 1MEKA 2OA7A 3IAM2 4K9ZA 4J57E 3DVWA 2I9HA 4ACSA 2VL9A 3P8WA 2ZNMA 1JZOA 3F8UA 5G2ZA 5AN1A 2RUEA 3UAPA 2DC5A 5DVBA 1OE7A 4E8HA 1K3OA 5HFKA 2HRAA 1THXA 4TR0A 5CP1A 5F06A 3P2AA 3DKSA 3IRAA 3KXOA 2GDRA 1PRXA 3GX8A 2LQQA 2RUFA 3UIWA 2VLVA 2AB6A 1VF3A 4K1FA 6GSWA 2X8HA 4WF4A 2ALBA 1WOUA 2BMXA 3EWLA 1I9DA 2MYGA 1XW6A 3BCIA 1BG5A 2IMDA 4FYCA 3CRUA 3ZITA 2GTUA 3EMXA 3K8NA 3H79A 1PX6A 3QCPA 5BRTA 3QFBC 2FA4A 5B6MA 1Z7RA 4POMA 5HR2A 3F63A 1OC3A 5KEJA 4ML1A 3CRTA 4RQRA 1O8XA 1EGOA 5GZZB 1Z5YE 1S3RA 3TB2A 4K7NA 1FG4A 1A23A 2WULA 3VWUA 4DSSA 2DJ2A 1J9BA 4PGTA 3LXZA 4KX4A 1GSQA 3ZZXA 2HLSA 4MDCA 4G2EA 1HD2A 2YZHA 1ERWA 5JWOB 3MSZA 4MK3A 5J3RA 1TDIA 1T4ZA 2I81A 2R37A 4MF7A 1GL8A 1JFUA 2FHEA 4NPBA 5DBQA 1XW9A 1AQXA 2R0PA 3DD3A 2B6MA 4RUVA 3VWVA 2MBTA 2CV4A 2E2GA 2ON7A 2LRCA 3VFIA 3Q74A 3VK9A 4ZBAA 2EC4A 3EPTA 2YWNA 3TKQA 5B8AA 4IVFA 3IXRA 4HI7A 1OC8A 1SL0B 5CRHA 3IOSA 5F0GA 2DIZA 1WIKA 4K5RA 3M9KA 1T4YA 3VURA 3GTUB 1Z6MA 4IELA 4ICYA 3KGKA 4ILFA 1CQGA 1M9BA 2GLRA 5CRWA 2HE3A 3WYWA 4ZL7A 2HXKA 3HDCA 5B7CA 1M2BA 2LNTA 2J23A 4EDYA 2OE1A 2ZUPA 1U87A 1FOVA 3PINA 1NSWA 5H5RA 3I6AA 3Q19A 4X43A 2HNLA 2JADA 1WE0A 4NHZA 1JZDA 1XWGA 3IR4A 1THOA 4JZQA 5CYYA 1EP7A 3WGDA 5E4WA 1R7HA 1GUHA 1G7EA 3GHAA 1GNWA 3CYNA 1QUWA 4ZL8A 4DSRA 1HNAA 4IW9A 2LSTA 5D96A 2O89A 2VLTA 2YCDA 2JSYA 3F9UA 1FHEA 3HVXA 4NV5A 1A8LA 3IHQA 5CREA 5KOWA 2O87A 3TGZA 4LL4B 1YY7A 4EE0A 4KSMA 4L5LA 4J56E 2VD0A 5CAXA 3L9VA 3RDWA 4TR1A 4YAVA 5G30A 3L78A 1E6BA 2LUSA 5EVOA 1SYRA 3UOMA 2DJ1A 2CA8A 3LYPA 3FZ9A 2OBIA 4LA1A 1HNBA 1ST9A 2YNXA 5HFGA 3RHBA 3HA9A 3M1GA 4OO5A 5EPFA 1A8YA 2YOIA 2LNSA 3DEXA 5CO3A 3WGXA 3UJ1A 3QAGA 2B3SA 3PPUA 5DALA 4BVYB 2CVDA 4KNDA 4KB3A 1JZRA 2H74A 1EV9A 2MZCA 4Z2RA 2IJYA 1F2EA 5IPGA 4O5UA 1ZYEA 3DXBA 3EINA 2VL2C 1XFLA 5ECKB 2X4AA 1NHOA 3GL3A 1H4OA 2FWGA 4GTUA 3LG6A 2V1MA 4O32A 1DUGA 3RPPA 4BVXA 1A0RP 3TKPA 1K0MA 1YF0A 3A2WA 2XHFA 1CQHA 5BMUA 1S3DA 1XZOA 4Q5RA 5LNKe 2F9SA 2DMLA 3ZIVA 13GSA 1MD4A 3VI7A 2FY6A 1JZWA 2H1DA 1TW9A 4K7IA 2ZCTA 4TW5A 2VIMA 5KN2A 3M8NA 4EIQA 4EUYA 3UEMA 3GNJA 4TXOA 1TRUA 4KGIA 19GSA 2O7KA 3ZRDA 5ECOB 4WBRD 1SJ6A 1GTUA 1SJIA 3KJYA 4G0KA 3P7XA 3ZIJA 2H6XA 4D73A 2IFQB 4TVEA 2O8VB 3DMLA 1YEPA 1JLVA 2P0GA 1ABAA 2WZ9A 1B9YC 1FVJA 5F8BA 2JU5A 2VOCA 3KD0A 2DJKA 5ID2B 4G19A 1XOBA 3IBHA 3APOA 1ZGNA 3LXTA 3DIEA 3FZ5A 4EVMA 4XS6A 1EWXA 3N5OA 4ECCA 1GULA 1G7OA 5AIXA 4Z7XA 2NBSA 3PR8A 5FWGA 4FO5A 4TR4A 5A5KA 4YKFA 2R4VA 3E3EA 2X8CA 4PQ1A 3MDKA 4O7HA 1TU7A 1M0UA 2DSAA 3C8EA 4H86A 3GV1A 1PA3A 3KTLA 3FKFA 1DE1A 6GSXA 5E59A 4PTSA 1V98A 4G9HA 2R2JA 4IP1A 1RK4A 4OFMA 5DJLA 1AXDA 1W4VA 3ZL5A 3TUEA 4FQUA 4DVCA 3U5RE 4RI6A 4HS1A 3CSIA 2HFDA 3JCML 2VD1A 4GF0A 4F2IA 4K2DA 2AHEA 3IAS2 4POKA 2QA1A 3LEFA 4HZ2A 1BEDA 1SK2A 2FUG2 2H8LA 4F0CA 5G5EA 2M46A 4POBA 4F82A 4JR6A 5J9CA 3FYGA 4J2FA 5JCGA 2D2ZA 4XRDA 3EURA 2H72A 4FH8A 1PL2A 4WKWA 2A2RA 2REMA 2YANA 2R0CA 2LRTA 5D9TA 2PMTA 3WT1A 2LKUA 3APQA 4MPGA 3R3EA 4G10A 20GSA 2YJHA 1O81A 1G6YA 2LEGA 3GMFA 2N5AA 1TTZA 3TKRA 2XBQA 4FYUA 4X4JA 1Y25A 2JSZA 4EL1A 3G7YA 3C71A 4IBPA 4ECBA 2PUKC 3I43A 5DQSA 2V32A 4I2TA 4PURA 4K5SA 1XBSA 1SD8A 3A2XA 2GQKA 4O5QA 3EVIA 3ZFLA 4ZB9A 1TJDA 2K8SA 2EIRA 3GRXA 4HU7A 4NWYA 3MNGA 4FYBA 3UARA 3LJRA 4EDZA 2QKEA 1V58A 1S3CA 2P31A 1U6TA 1J0FA 2O85A 4EKZA 2C0GA 1J08A 1BAYA 5AGYA 2HRNA 1GLPA 2DKIA 2B7KA 3HYPA 4OCFA 1XCCA 4XS4B 3QAWA 5J9BA 4WEYA 4G0LA 2VAFA 4ZILA 2F8FA 4MJCA 1FW1A 4N0ZA 3IE3A 3MWHA 1Z7PA 2RLIA 1UN2A 2JZTA 2IMIA 3FZAA 4MP4A 1SKWB 1Y6EA 3GTUA 2ES7A 4AF2A 1VF1A 5D73A 2HRKA 1B8XA 3ZLPA 2GVPA 5DCGA 1AQWA 3F4TA 3HVVA 2K6VA 4F0BA 5EL8A 1O73A 1ON4A 1FVKA 1JHBA 4CHSA 5D9XA 5H5QA 3E9JB 1HYUA 3APSA 5INYA 3H1NA 3ISOA 1O7UA 4OFTA 1GSUA 3O3TA 2CX4A 3GKXA 2RM5A 3IDVA 2IPAA 2X49A 1R4WA 2DJ0A 3F0IA 2AV4A 1VF2A 4KUNA 3CTFA 1XVWA 2JACA 4KW6A 3HHVA 4OO4A 3C7MA 1QK8A 4YQVA 6GSYA 1ERVA 2WRTA 5ECQB 1TP9A 3KH9A 3BBYA 2RM6A 3SWLA 1PN9A 3F3RA 4HJMA 2R6KA 5IMVA 1GRXA 2VLUA 1PKWA 4IHUA 3R2QA 3PH9A 1V57A 1K3LA 1OKTA 3KP8A 3V1WA 1GP1A 4KF9A 2TRXA 3GN3A 3A5IA 4X1UA 4L5OA 2B5YA 5B8BA 2V2GA 2OKAA 3G7IA 3QPMA 1SK1A 3GKKA 4MZWA 2AAWA 2VM2A 1K0BA 3US3A 5F05A 3VWWA 3KMOA 3HCZA 2L4CA 1ZYPA 4YKGA 4JRRA 5AIVA 2I1UA 4AJ8A 4BVYA 3FW2A 3GUSA 2MMZA 4ID0A 2FD3A 4IP6A 5A4UA 4BWQA 3TOUA 2BTOT 1M2AA 3NOFA 1GSFA 1XWAA 5GAND 4PQHA 1ZMAA 3TDGA 4KDXA 4MZBA 2X8GA 1XWBA 1UVZA 2H6YA 3M9JA 12GSA 4OFNA 1GNEA 5GSSA 3A2VA 5JWRB 3U6VA 2FA8A 4NMUA 3UBKA 2MMOA 5FT3A 3J7Yk 4MH2A 4O92A 2A4HA 2J9HA 6GSVA 1USBA 4Q5QA 3UMAA 1Z6NA 1G6WA 5IPHA 5KOXA 4EO3A 1X9MB 4Z2TA 3C1RA 3TOTA 2R5GA 4MZCA 4MABA 4GCIA 3HVNA 3QOUA 5L71A 1Z9HA 2FCHA 1U88A 1ZYNA 2IFQA 5DAKB 4A5PA 1LBKA 2H1GA 4KDUA 2GQMA 2DLXA 4QQ7A 5ID2A 5J4UA 5ABRA 2PERA 1M9AA 4RI7A 2GQLA 1R5AA 3KCMA 1WPIA 4HZ4A 4GSNA 4HDEA 2C0DA 3RPNA 2GS3A 3L9UA 2HZEB 4HQSA 3KTBA 2F8AA 3HZ4A 4E8EA 5CRDA 1X9SB 1KEBA 4O5RA 1GUKA 3D21A 1QXHA 1F3BA 4HUAA 2NPBA 1TU8A 4OD7A 3ZVJA 1TK0B 5F07A 1YZXA 3FHKA 3I69A 4LLRA 1YKCA 1N2AA 4K2XA 2A2SA 2KLXA 4BL7B 1ZL9A 2NTOA 3ED3A 3AY8A 3HXSA 3IPZA 1WMJA 1BJXA 4JE1A 1SYXA 4MA9A 2H71A 1GSSA 1A2MA 1TXXA 4YQUA 2F3MA 2KP1A 3HKRA 1MDKA 4IN0A 4IQ1A 1AC1A 3TJBA 1B9XC 2OJLA 3GKMA 3S9FA 17GSA 4MNNA 3CMIA 3NZNA 4G0IA 3TRXA 1E2YA 3WGEA 1TI3A 2H0GA 5ECNB 1IYIA 2EIQA 2CVBA 1FB6A 5GSTA 3P90A 4CY6A 1WP0A 1XOAA 3HD5A 3LORA 4V2NA 1YF1A 2C0FA 1GTBA 2XBIA 1SL2B 1T3BA 2H6ZA 4AGSA 4DEJA 3C73A 1EGRA 4MPFA 3GSTA 2PVQA 2L57A 5LCZA 2VCXA 1K0AA 3UVHA 4LMVA 4V2MA 3IK7A 2FNOA 1XW5A 4OMVA 3ERGA 4IJ3A 4Q5FA 3GSSA 5DJMA 2P5QA 1GTIA 4RQXA 2VL2A 1QFNA 1M3JA 3KEBA 3LWAA 2R3XA 5IO2A 2KUCA 2QC7A 3D0ZA 2VCVA 2IMFA 3ZFBA 4P3YB 4YQMA 3F4SA 1XIYA 2OE3A 3IC4A 4HOJA 3J7Yb 5HR0A 2YWOA 3VWXA 4AJ7A 2UZ8A 1TI1A 4ISDA 1OKDA 1M99A 4EF0A 4OCEA 3EU3A 2WGRA 3QAVA 3KP9A 1OC9B 3MIXA 4WR4A
chains in the Genus database with same CATH topology
2TRCP 4ZIJA 2YJ7A 4XS4A 2GZZA 3FR6A 2FWEA 3LSZA 3QDNA 3F6DA 1WJKA 4YH2A 1OAZA 3HJPA 2K9FA 4K8MA 2M72A 4GRFA 2AYTA 2OACA 2AUVA 3F3QA 3RHCA 2PN8A 5ECMB 1OYJA 1V2AA 4PXOA 2LQOA 2H70A 1LU4A 4WXTA 4PQIA 4XRAA 3ME8A 2VCZA 4MMMA 1U3IA 2GZYA 1JLWA 1AAZA 22GSA 14GSA 4KA0A 3TJJA 3CSHA 5IO0A 3D6IA 2XPDA 3IHGA 2HT9A 1AIUA 2QSIA 4K0GA 4BPYA 1GTAA 1EP8A 3CTGA 3RAZA 2H0HA 4HU9A 2JL4A 2H0IA 5C04A 3CXGA 1TKDB 4ZBBA 1K0NA 3IV4A 5LD0A 4IJIA 3TJGA 1B4QA 3QD9A 1NM3A 4MJEA 4MCUA 3BD2A 1PSQA 1A2JA 2IMKA 5DCHA 1H75A 3F4RA 1TRVA 3D5JA 5G31A 3TKSE 4EXJA 2V6KA 2IMEA 3KIJA 3QFAC 1ILOA 1TRSA 3GYKA 1EEJA 2VM1A 3LYKA 4HJ2A 2ON5A 1UC7A 1XXUA 4WR5A 1A0FA 1BYEA 5B6NA 3M3MA 2G2QA 2YWMA 1FOHA 1GH2A 1GSDA 2B5XA 3E0UA 2VO4A 1K3YA 4GQFA 2VCTA 2XPEA 5KN1A 9GSSA 4JU5A 2IL3A 2OADA 2N5FA 2CZ2A 4GXZA 1WRYA 4NXIA 4I5QA 1YDKA 3EC3A 2LS5A 3LFLA 2HSMA 1AW9A 5ECPB 2C3QA 2H73A 4FIWA 2HSYA 4F9ZA 3EU4A 1RQMA 1T7PB 4V1Ag 3D4MA 2C3NA 1ZOFA 3UL3A 5J5NA 2FWFA 3D4TA 1B48A 3I9V2 5DQYA 2AJQB 4IQAA 1EEMA 1OE8A 1T1VA 4X0XA 2V6OA 2B5EA 1ACVA 3W6GA 4XIHA 2C0EA 4DSQA 1ZCPA 2H1AA 3TKSA 5J41A 3MAKA 5H5SA 2CZ3A 4POLA 3TRQA 1A2LA 1FO5A 2B7JA 4K0NA 2NVLA 3BOAA 5IMDA 3FR3A 3QR6A 5HFIA 4ZBDA 4KSOA 2I4AA 1MDIA 4V2LA 3ERWA 3SBCA 2C3TA 3TCOA 1KTEA 2PVOC 3FY7A 4LL1B 3TJFA 5D93A 2DJJA 1YEXA 5DAKA 4XTSA 1TOFA 3GURA 5ELGA 2B1KA 4F03A 4WF5A 4QL7A 3EYTA 1KBNA 3QMXA 4I2UA 2WDUA 3DWVA 2GSRA 1URMA 3WD6A 3GH6A 1SK0A 1SJZA 4ECIA 1K0OA 3FZ4A 1QQ2A 2HI7A 2B1LA 3VPQA 5JWQB 3C1SA 4BA7A 5ECRB 2FGXA 3TJKA 3DYRA 5EY6A 1PMTA 4ZXGA 2A4VA 1C72A 3GA4A 3ZREA 3KMNA 1F6MC 1V40A 1OVNA 5CRGA 5HQPA 2F51A 4WETA 3OR5A 5FHIA 2DMMA 2HZEA 8GSSA 1FB0A 5ENUA 4WBJA 3ZTLA 5DDLA 5IOXA 1Q98A 2G0FA 3N9JA 3H8QA 4JR4A 1U3AA 2LJAA 4IGJA 1GSEA 4L0WA 3DGQA 2YV7A 4N11A 16GSA 1PGTA 4ULXA 1SENA 10GSA 1ML6A 2C4JA 1EOGA 4ZB6A 4Z2UA 3IA1A 4HEA2 1F3AA 4KCAA 3ZVJD 4BL7A 2PGTA 2LV3A 2YN1A 3LW9A 2M80A 1G0TA 5CNWA 5GAPD 1R26A 5IMFA 1O8WA 1XVQA 1AQVA 2H19A 1SD9A 1VGLA 4MF5A 4ZB8A 4QL9A 5AISA 4IS0A 2XC2A 1AUCA 2WB9A 4MF6A 4IKHA 4N0VA 3W8SA 5KN0A 4XCSA 2H30A 5KN3A 2E7PA 2OE0A 4N30A 3FK8A 2C80A 2Z9SA 3HY2A 2E2MA 4PUFC 5ECSA 4CY8A 4CDOA 1X5EA 2GZPA 1SL1B 1LJRA 3ZYWA 3F6FA 2L4QA 4Q5NA 4DSSB 1UA5A 1FAAA 1M2DA 4V1Ap 3O76A 2FWHA 1XWKA 3NIVA 3VLNA 2K8VA 4PNFA 1XWCA 1VRSD 1DBYA 4EIPA 3CSJA 4I6XA 4MH3A 2IN3A 1EOHA 4GLTA 1S3AA 1WWJA 5JCWA 5HR1A 2A2PA 6GSSA 3L9SA 1TRWA 4MJBA 2E0QA 1YQ1A 1X5CA 2FLSA 1A24A 1T8EB 2YZUA 2L5OA 3ERFA 3LQ7A 2HRFA 4PUAA 1HNCA 3EE2A 2WJUA 3UBLA 1PQNA 1QMVA 2WS2A 3GH9A 1QGVA 5IMCA 2CAIA 3FRCA 3O6TA 1MDJA 4TXVA 2DIYA 2IIYA 2DBCA 1SU9A 3ME7A 3HJMA 1PD21 2HSHA 1W89A 3LGCA 4TRXA 1OC9A 3EMPA 2GSTA 3UVTA 1ZZYA 5ELAA 3FMWA 2L6DA 3DVXA 2LTKA 4HQZA 3Q6OA 5G5FA 2C1YA 2KHPA 4TN8A 4EC0A 3GX0A 5D9VA 1RW1A 11GSA 2NDOA 3A5WA 5IOWA 2YP6A 2MMAA 4K7OA 1Z3EA 2K18A 3FR9A 3H93A 2L5LA 2PU9C 2DJ3A 2P5RA 4LMWA 1F9MA 3W8JA 2X99A 2H01A 5IM9A 1PX7A 1M7TA 2CX3A 2YV9A 3CBUA 4KCEA 1X9WB 4TOPA 1KNGA 2PWJA 5IMAA 2YPMA 4I97A 2R0GA 3HVSA 4AJ6A 2GT5A 1GUMA 2MMNA 4NHWA 3TRPA 2BJXA 1EV4A 2YWIA 5G1LA 2OBKA 4PNGA 2LJKA 3VPTA 4KAEA 5G1KA 1T00A 1PKZA 2GGTA 2TIRA 1Q4JA 4TR1B 1K0CA 1MTCA 4GSSA 4JBBA 5JCUA 2CAQA 2I3YA 1O85A 2PPTA 1XPVA 2RIIA 4K6XA 2VCQA 2V41A 3A3TA 4TKYA 6GSTA 1MD3A 5IIZA 3BJ5A 4N10A 5DALB 3H4KA 18GSA 4YAPA 2MBSA 4OWYA 2HYXA 2WCIA 4NV2A 5D8IA 3FEUA 1ZYQB 5ECLB 1PN0A 2DKHA 2HZFA 1EZKA 1TK8B 1GWCA 1B4PA 1GLQA 7GSSA 1I5GA 4JEDA 4BVXB 5HR3A 3G7JA 2CQ9A 2GT6A 3DRNA 3GIXA 3KZQA 5D9WA 5ECIB 1X5DA 1BQ7A 4ECJA 4MLYA 3GL5A 4USSA 4TR3A 4MJAA 1K0DA 2VCWA 1N8JA 1ERTA 3KH7A 1VF4A 1YJ6A 5A4VA 2WFCA 4KDYA 4L8EA 2JZSA 4TXOB 4GWRA 2QGVA 1R5PA 1TK5B 5IQYA 3WT2A 4XS1A 1DE2A 1YKAA 4D73B 3L4NA 1ERUA 2IWTA 2GSSA 3BCKA 1O6JA 2VUPA 4GQCA 5COHA 3IK9A 2X64A 3ZMKA 3G9BA 3GFKA 2CT6A 1V9WA 4L0UA 1PL1A 3KM6A 4KE3A 2H66A 3VI5A 1BX9A 2LJRA 3L0HA 3PGTA 1X0RA 4XHMA 4BWSA 2L6CA 2H76A 1DSBA 5ECHB 1NW2A 2CVKA 4I8BA 4ZL9A 4GSTA 4KH7A 2KOKA 2LRNA 5C00A 3RBTA 4PX1A 3MYDA 1F37A 3IC8A 5A4WA 5IMZA 3ZMLA 1SKRB 1IYHA 1HQOA 2EIOA 1SKSB 2KP2A 3Q18A 3HZ8A 3TKSC 4CW9A 4ML6A 2JZRA 3GKNA 2QA2A 1GSYA 2PBJA 3D22A 2H75A 2H1BA 2C8UA 2GSQA 3M0FA 2L59A 2N5BA 1NHYA 4NAXA 2VL3A 6GSUA 3HJOA 1MEKA 2OA7A 3IAM2 4K9ZA 4J57E 3DVWA 2I9HA 4ACSA 2VL9A 3P8WA 2ZNMA 1JZOA 3F8UA 5G2ZA 5AN1A 2RUEA 3UAPA 2DC5A 5DVBA 1OE7A 4E8HA 1K3OA 5HFKA 2HRAA 1THXA 4TR0A 5CP1A 5F06A 3P2AA 3DKSA 3IRAA 3KXOA 2GDRA 1PRXA 3GX8A 2LQQA 2RUFA 3UIWA 2VLVA 2AB6A 1VF3A 4K1FA 6GSWA 2X8HA 4WF4A 2ALBA 1WOUA 2BMXA 3EWLA 1I9DA 2MYGA 1XW6A 3BCIA 1BG5A 2IMDA 4FYCA 3CRUA 3ZITA 2GTUA 3EMXA 3K8NA 3H79A 1PX6A 3QCPA 5BRTA 3QFBC 2FA4A 5B6MA 1Z7RA 4POMA 5HR2A 3F63A 1OC3A 5KEJA 4ML1A 3CRTA 4RQRA 1O8XA 1EGOA 5GZZB 1Z5YE 3TB2A 4K7NA 1FG4A 1A23A 2WULA 3VWUA 4DSSA 2DJ2A 1J9BA 4PGTA 3LXZA 4KX4A 1GSQA 3ZZXA 2HLSA 4MDCA 4G2EA 1HD2A 2YZHA 1ERWA 5JWOB 3MSZA 4MK3A 5J3RA 1TDIA 1T4ZA 2I81A 2R37A 4MF7A 1GL8A 1JFUA 2FHEA 4NPBA 5DBQA 1XW9A 1AQXA 2R0PA 3DD3A 2B6MA 4RUVA 3VWVA 2MBTA 2CV4A 2E2GA 2ON7A 2LRCA 3VFIA 3Q74A 3VK9A 4ZBAA 2EC4A 3EPTA 2YWNA 3TKQA 5B8AA 4IVFA 3IXRA 4HI7A 1OC8A 1SL0B 5CRHA 3IOSA 5F0GA 2DIZA 1WIKA 4K5RA 3M9KA 1T4YA 3VURA 3GTUB 1Z6MA 4IELA 4ICYA 3KGKA 4ILFA 1CQGA 1M9BA 2GLRA 5CRWA 2HE3A 3WYWA 4ZL7A 2HXKA 3HDCA 5B7CA 1M2BA 2LNTA 2J23A 4EDYA 2OE1A 2ZUPA 1U87A 1FOVA 3PINA 1NSWA 5H5RA 3I6AA 3Q19A 4X43A 2HNLA 2JADA 1WE0A 4NHZA 1JZDA 1XWGA 3IR4A 1THOA 4JZQA 5CYYA 1EP7A 3WGDA 5E4WA 1R7HA 1GUHA 1G7EA 3GHAA 1GNWA 3CYNA 1QUWA 4ZL8A 4DSRA 1HNAA 4IW9A 2LSTA 5D96A 2O89A 2VLTA 2YCDA 2JSYA 3F9UA 1FHEA 3HVXA 4NV5A 1A8LA 3IHQA 5CREA 5KOWA 2O87A 3TGZA 4LL4B 1YY7A 4EE0A 4KSMA 4L5LA 4J56E 2VD0A 5CAXA 3L9VA 3RDWA 4TR1A 4YAVA 5G30A 3L78A 1E6BA 2LUSA 5EVOA 1SYRA 3UOMA 2DJ1A 2CA8A 3LYPA 3FZ9A 2OBIA 4LA1A 1HNBA 1ST9A 2YNXA 5HFGA 3RHBA 3HA9A 3M1GA 4OO5A 5EPFA 1A8YA 2YOIA 2LNSA 3DEXA 5CO3A 3WGXA 3UJ1A 3QAGA 2B3SA 3PPUA 5DALA 4BVYB 2CVDA 4KNDA 4KB3A 1JZRA 2H74A 1EV9A 2MZCA 4Z2RA 2IJYA 1F2EA 5IPGA 4O5UA 1ZYEA 3DXBA 3EINA 2VL2C 1XFLA 5ECKB 2X4AA 1NHOA 3GL3A 1H4OA 2FWGA 4GTUA 3LG6A 2V1MA 4O32A 1DUGA 3RPPA 4BVXA 1A0RP 3TKPA 1K0MA 1YF0A 3A2WA 2XHFA 1CQHA 5BMUA 1S3DA 1XZOA 4Q5RA 5LNKe 2F9SA 2DMLA 3ZIVA 13GSA 1MD4A 3VI7A 2FY6A 1JZWA 2H1DA 1TW9A 4K7IA 2ZCTA 4TW5A 2VIMA 5KN2A 3M8NA 4EIQA 4EUYA 3UEMA 3GNJA 4TXOA 1TRUA 4KGIA 19GSA 2O7KA 3ZRDA 5ECOB 4WBRD 1SJ6A 1GTUA 1SJIA 3KJYA 4G0KA 3P7XA 3ZIJA 2H6XA 4D73A 2IFQB 4TVEA 2O8VB 3DMLA 1YEPA 1JLVA 2P0GA 1ABAA 2WZ9A 1B9YC 1FVJA 5F8BA 2JU5A 2VOCA 3KD0A 2DJKA 5ID2B 4G19A 1XOBA 3IBHA 3APOA 1ZGNA 3LXTA 3DIEA 3FZ5A 4EVMA 4XS6A 1EWXA 3N5OA 4ECCA 1GULA 1G7OA 5AIXA 4Z7XA 2NBSA 3PR8A 5FWGA 4FO5A 4TR4A 5A5KA 4YKFA 2R4VA 3E3EA 2X8CA 4PQ1A 3MDKA 4O7HA 1TU7A 1M0UA 2DSAA 3C8EA 4H86A 3GV1A 1PA3A 3KTLA 3FKFA 1DE1A 6GSXA 5E59A 4PTSA 1V98A 4G9HA 2R2JA 4IP1A 1RK4A 4OFMA 5DJLA 1AXDA 1W4VA 3ZL5A 3TUEA 4FQUA 4DVCA 3U5RE 4RI6A 4HS1A 3CSIA 2HFDA 3JCML 2VD1A 4GF0A 4F2IA 4K2DA 2AHEA 3IAS2 4POKA 2QA1A 3LEFA 4HZ2A 1BEDA 1SK2A 2FUG2 2H8LA 4F0CA 5G5EA 2M46A 4POBA 4F82A 4JR6A 5J9CA 3FYGA 4J2FA 5JCGA 2D2ZA 4XRDA 3EURA 2H72A 4FH8A 1PL2A 4WKWA 2A2RA 2REMA 2YANA 2R0CA 2LRTA 5D9TA 2PMTA 3WT1A 2LKUA 3APQA 4MPGA 3R3EA 4G10A 20GSA 2YJHA 1O81A 1G6YA 2LEGA 3GMFA 2N5AA 1TTZA 3TKRA 2XBQA 4FYUA 4X4JA 1Y25A 2JSZA 4EL1A 3G7YA 3C71A 4IBPA 4ECBA 2PUKC 3I43A 5DQSA 2V32A 4I2TA 4PURA 4K5SA 1XBSA 1SD8A 3A2XA 2GQKA 4O5QA 3EVIA 3ZFLA 4ZB9A 1TJDA 2K8SA 2EIRA 3GRXA 4HU7A 4NWYA 3MNGA 4FYBA 3UARA 3LJRA 4EDZA 2QKEA 1V58A 1S3CA 2P31A 1U6TA 1J0FA 2O85A 4EKZA 2C0GA 1J08A 1BAYA 5AGYA 2HRNA 1GLPA 2DKIA 2B7KA 3HYPA 4OCFA 1XCCA 4XS4B 3QAWA 5J9BA 4WEYA 4G0LA 2VAFA 4ZILA 2F8FA 4MJCA 1FW1A 4N0ZA 3IE3A 3MWHA 1Z7PA 2RLIA 1UN2A 2JZTA 2IMIA 3FZAA 4MP4A 1SKWB 1Y6EA 3GTUA 2ES7A 4AF2A 1VF1A 5D73A 2HRKA 1B8XA 3ZLPA 2GVPA 5DCGA 1AQWA 3F4TA 3HVVA 2K6VA 4F0BA 5EL8A 1O73A 1ON4A 1FVKA 1JHBA 4CHSA 5D9XA 5H5QA 3E9JB 1HYUA 3APSA 5INYA 3H1NA 3ISOA 1O7UA 4OFTA 1GSUA 3O3TA 2CX4A 3GKXA 2RM5A 3IDVA 2IPAA 2X49A 1R4WA 2DJ0A 3F0IA 2AV4A 1VF2A 4KUNA 3CTFA 1XVWA 2JACA 4KW6A 3HHVA 4OO4A 3C7MA 1QK8A 4YQVA 6GSYA 1ERVA 2WRTA 5ECQB 1TP9A 3KH9A 3BBYA 2RM6A 3SWLA 1PN9A 3F3RA 4HJMA 2R6KA 5IMVA 1GRXA 2VLUA 1PKWA 4IHUA 3R2QA 3PH9A 1V57A 1K3LA 1OKTA 3KP8A 3V1WA 1GP1A 4KF9A 2TRXA 3GN3A 3A5IA 4X1UA 4L5OA 2B5YA 5B8BA 2V2GA 2OKAA 3G7IA 3QPMA 1SK1A 3GKKA 4MZWA 2AAWA 2VM2A 1K0BA 3US3A 5F05A 3VWWA 3KMOA 3HCZA 2L4CA 1ZYPA 4YKGA 4JRRA 5AIVA 2I1UA 4AJ8A 4BVYA 3FW2A 3GUSA 2MMZA 4ID0A 2FD3A 4IP6A 5A4UA 4BWQA 3TOUA 2BTOT 1M2AA 3NOFA 1GSFA 1XWAA 5GAND 4PQHA 1ZMAA 3TDGA 4KDXA 4MZBA 2X8GA 1XWBA 1UVZA 2H6YA 3M9JA 12GSA 4OFNA 1GNEA 5GSSA 3A2VA 5JWRB 3U6VA 2FA8A 4NMUA 3UBKA 2MMOA 5FT3A 3J7Yk 4MH2A 4O92A 2A4HA 2J9HA 6GSVA 1USBA 4Q5QA 3UMAA 1Z6NA 1G6WA 5IPHA 5KOXA 4EO3A 1X9MB 4Z2TA 3C1RA 3TOTA 2R5GA 4MZCA 4MABA 4GCIA 3QOUA 5L71A 1Z9HA 2FCHA 1U88A 1ZYNA 2IFQA 5DAKB 4A5PA 1LBKA 2H1GA 4KDUA 2GQMA 2DLXA 4QQ7A 5ID2A 5J4UA 5ABRA 2PERA 1M9AA 4RI7A 2GQLA 1R5AA 3KCMA 1WPIA 4HZ4A 4GSNA 4HDEA 2C0DA 3RPNA 2GS3A 3L9UA 2HZEB 4HQSA 3KTBA 2F8AA 3HZ4A 4E8EA 5CRDA 1X9SB 1KEBA 4O5RA 1GUKA 3D21A 1QXHA 1F3BA 4HUAA 2NPBA 1TU8A 4OD7A 3ZVJA 1TK0B 5F07A 1YZXA 3FHKA 3I69A 4LLRA 1YKCA 1N2AA 4K2XA 2A2SA 2KLXA 4BL7B 1ZL9A 2NTOA 3ED3A 3AY8A 3HXSA 3IPZA 1WMJA 1BJXA 4JE1A 1SYXA 4MA9A 2H71A 1GSSA 1A2MA 1TXXA 4YQUA 2F3MA 2KP1A 3HKRA 1MDKA 4IN0A 4IQ1A 1AC1A 3TJBA 1B9XC 2OJLA 3GKMA 3S9FA 17GSA 4MNNA 3CMIA 3NZNA 4G0IA 3TRXA 1E2YA 3WGEA 1TI3A 2H0GA 5ECNB 1IYIA 2EIQA 2CVBA 1FB6A 5GSTA 3P90A 4CY6A 1WP0A 1XOAA 3HD5A 3LORA 4V2NA 1YF1A 2C0FA 1GTBA 2XBIA 1SL2B 1T3BA 2H6ZA 4AGSA 4DEJA 3C73A 1EGRA 4MPFA 3GSTA 2PVQA 2L57A 5LCZA 2VCXA 1K0AA 3UVHA 4LMVA 4V2MA 3IK7A 2FNOA 1XW5A 4OMVA 3ERGA 4IJ3A 4Q5FA 3GSSA 5DJMA 2P5QA 1GTIA 4RQXA 2VL2A 1QFNA 3KEBA 3LWAA 2R3XA 5IO2A 2KUCA 2QC7A 3D0ZA 2VCVA 2IMFA 3ZFBA 4P3YB 4YQMA 3F4SA 1XIYA 2OE3A 3IC4A 4HOJA 3J7Yb 5HR0A 2YWOA 3VWXA 4AJ7A 2UZ8A 1TI1A 4ISDA 1OKDA 1M99A 4EF0A 4OCEA 3EU3A 2WGRA 3QAVA 3KP9A 1OC9B 3MIXA 4WR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2TRC P;  4ZIJ A;  2YJ7 A;  4XS4 A;  2GZZ A;  3FR6 A;  2FWE A;  3LSZ A;  3QDN A;  3F6D A;  1WJK A;  4YH2 A;  1OAZ A;  3HJP A;  2K9F A;  4K8M A;  2M72 A;  4GRF A;  2AYT A;  2OAC A;  2AUV A;  3F3Q A;  3RHC A;  2PN8 A;  5ECM B;  1OYJ A;  1V2A A;  4PXO A;  2LQO A;  2H70 A;  1LU4 A;  4WXT A;  4PQI A;  4XRA A;  3ME8 A;  2VCZ A;  4MMM A;  1U3I A;  2GZY A;  1JLW A;  1AAZ A;  22GS A;  14GS A;  4KA0 A;  3TJJ A;  3CSH A;  5IO0 A;  3D6I A;  2XPD A;  2HT9 A;  1AIU A;  2QSI A;  4K0G A;  4BPY A;  1GTA A;  1EP8 A;  3CTG A;  3RAZ A;  2H0H A;  4HU9 A;  2JL4 A;  2H0I A;  5C04 A;  3CXG A;  1TKD B;  4ZBB A;  1K0N A;  3IV4 A;  5LD0 A;  4IJI A;  3TJG A;  1B4Q A;  3QD9 A;  1NM3 A;  4MJE A;  4MCU A;  3BD2 A;  1PSQ A;  1A2J A;  2IMK A;  5DCH A;  1H75 A;  3F4R A;  1TRV A;  3D5J A;  5G31 A;  3TKS E;  4EXJ A;  2V6K A;  2IME A;  3KIJ A;  3QFA C;  1ILO A;  1TRS A;  3GYK A;  1EEJ A;  2VM1 A;  3LYK A;  4HJ2 A;  2ON5 A;  1UC7 A;  1XXU A;  4WR5 A;  1A0F A;  1BYE A;  5B6N A;  3M3M A;  2G2Q A;  2YWM A;  1GH2 A;  1GSD A;  2B5X A;  3E0U A;  2VO4 A;  1K3Y A;  4GQF A;  2VCT A;  2XPE A;  5KN1 A;  9GSS A;  4JU5 A;  2IL3 A;  2OAD A;  2N5F A;  2CZ2 A;  4GXZ A;  1WRY A;  4NXI A;  4I5Q A;  1YDK A;  3EC3 A;  2LS5 A;  3LFL A;  1AW9 A;  5ECP B;  2C3Q A;  2H73 A;  4FIW A;  2HSY A;  4F9Z A;  3EU4 A;  1RQM A;  1T7P B;  4V1A g;  3D4M A;  2C3N A;  1ZOF A;  3UL3 A;  5J5N A;  2FWF A;  3D4T A;  1B48 A;  3I9V 2;  5DQY A;  2AJQ B;  4IQA A;  1EEM A;  1OE8 A;  1T1V A;  4X0X A;  2V6O A;  2B5E A;  1ACV A;  3W6G A;  4XIH A;  2C0E A;  4DSQ A;  1ZCP A;  2H1A A;  3TKS A;  5J41 A;  3MAK A;  5H5S A;  2CZ3 A;  4POL A;  3TRQ A;  1A2L A;  1FO5 A;  2B7J A;  4K0N A;  2NVL A;  3BOA A;  5IMD A;  3FR3 A;  3QR6 A;  5HFI A;  4ZBD A;  4KSO A;  2I4A A;  1MDI A;  4V2L A;  3ERW A;  3SBC A;  2C3T A;  3TCO A;  1KTE A;  2PVO C;  3FY7 A;  4LL1 B;  3TJF A;  5D93 A;  2DJJ A;  1YEX A;  5DAK A;  4XTS A;  1TOF A;  3GUR A;  5ELG A;  2B1K A;  4F03 A;  4WF5 A;  4QL7 A;  3EYT A;  1KBN A;  3QMX A;  4I2U A;  2WDU A;  3DWV A;  2GSR A;  1URM A;  3WD6 A;  3GH6 A;  1SK0 A;  1SJZ A;  4ECI A;  1K0O A;  3FZ4 A;  1QQ2 A;  2HI7 A;  2B1L A;  3VPQ A;  5JWQ B;  3C1S A;  4BA7 A;  5ECR B;  2FGX A;  3TJK A;  3DYR A;  5EY6 A;  1PMT A;  4ZXG A;  2A4V A;  1C72 A;  3GA4 A;  3ZRE A;  3KMN A;  1F6M C;  1V40 A;  1OVN A;  5CRG A;  5HQP A;  2F51 A;  4WET A;  3OR5 A;  5FHI A;  2DMM A;  2HZE A;  8GSS A;  1FB0 A;  5ENU A;  4WBJ A;  3ZTL A;  5DDL A;  5IOX A;  1Q98 A;  2G0F A;  3N9J A;  3H8Q A;  4JR4 A;  1U3A A;  2LJA A;  4IGJ A;  1GSE A;  4L0W A;  3DGQ A;  2YV7 A;  4N11 A;  16GS A;  1PGT A;  4ULX A;  1SEN A;  10GS A;  1ML6 A;  2C4J A;  1EOG A;  4ZB6 A;  3IA1 A;  4HEA 2;  1F3A A;  4KCA A;  3ZVJ D;  4BL7 A;  2PGT A;  2LV3 A;  2YN1 A;  2M80 A;  1G0T A;  5CNW A;  5GAP D;  1R26 A;  5IMF A;  1O8W A;  1XVQ A;  1AQV A;  2H19 A;  1SD9 A;  1VGL A;  4MF5 A;  4ZB8 A;  4QL9 A;  5AIS A;  4IS0 A;  2XC2 A;  1AUC A;  2WB9 A;  4MF6 A;  4IKH A;  4N0V A;  3W8S A;  5KN0 A;  4XCS A;  2H30 A;  5KN3 A;  2E7P A;  2OE0 A;  4N30 A;  3FK8 A;  2C80 A;  2Z9S A;  3HY2 A;  2E2M A;  4PUF C;  5ECS A;  4CDO A;  1X5E A;  2GZP A;  1SL1 B;  1LJR A;  3ZYW A;  3F6F A;  2L4Q A;  4Q5N A;  4DSS B;  1UA5 A;  1FAA A;  1M2D A;  4V1A p;  3O76 A;  2FWH A;  1XWK A;  3NIV A;  3VLN A;  2K8V A;  4PNF A;  1XWC A;  1VRS D;  1DBY A;  3CSJ A;  4I6X A;  4MH3 A;  2IN3 A;  1EOH A;  4GLT A;  1S3A A;  1WWJ A;  5JCW A;  5HR1 A;  6GSS A;  3L9S A;  1TRW A;  4MJB A;  2E0Q A;  1YQ1 A;  1X5C A;  2FLS A;  1A24 A;  1T8E B;  2YZU A;  2L5O A;  3ERF A;  3LQ7 A;  2HRF A;  4PUA A;  1HNC A;  3EE2 A;  2WJU A;  3UBL A;  1PQN A;  1QMV A;  2WS2 A;  3GH9 A;  1QGV A;  5IMC A;  2CAI A;  3FRC A;  3O6T A;  1MDJ A;  4TXV A;  2DIY A;  2IIY A;  2DBC A;  1SU9 A;  3ME7 A;  3HJM A;  1PD2 1;  2HSH A;  1W89 A;  3LGC A;  4TRX A;  1OC9 A;  3EMP A;  2GST A;  3UVT A;  1ZZY A;  5ELA A;  2L6D A;  3DVX A;  2LTK A;  4HQZ A;  3Q6O A;  5G5F A;  2C1Y A;  2KHP A;  4TN8 A;  4EC0 A;  3GX0 A;  5D9V A;  1RW1 A;  11GS A;  2NDO A;  3A5W A;  5IOW A;  2YP6 A;  2MMA A;  4K7O A;  1Z3E A;  2K18 A;  3FR9 A;  3H93 A;  2L5L A;  2PU9 C;  2DJ3 A;  2P5R A;  4LMW A;  1F9M A;  3W8J A;  2X99 A;  2H01 A;  5IM9 A;  1PX7 A;  1M7T A;  2CX3 A;  2YV9 A;  3CBU A;  4KCE A;  1X9W B;  4TOP A;  1KNG A;  2PWJ A;  5IMA A;  2YPM A;  4I97 A;  3HVS A;  4AJ6 A;  2GT5 A;  1GUM A;  2MMN A;  4NHW A;  3TRP A;  2BJX A;  1EV4 A;  2YWI A;  5G1L A;  2OBK A;  4PNG A;  2LJK A;  3VPT A;  4KAE A;  5G1K A;  1T00 A;  1PKZ A;  2GGT A;  2TIR A;  1Q4J A;  4TR1 B;  1K0C A;  1MTC A;  4GSS A;  4JBB A;  5JCU A;  2CAQ A;  2I3Y A;  1O85 A;  2PPT A;  1XPV A;  2RII A;  4K6X A;  2VCQ A;  2V41 A;  3A3T A;  4TKY A;  6GST A;  1MD3 A;  5IIZ A;  3BJ5 A;  4N10 A;  5DAL B;  3H4K A;  18GS A;  4YAP A;  2MBS A;  4OWY A;  2HYX A;  2WCI A;  4NV2 A;  5D8I A;  3FEU A;  1ZYQ B;  5ECL B;  2HZF A;  1EZK A;  1TK8 B;  1GWC A;  1B4P A;  1GLQ A;  7GSS A;  1I5G A;  4JED A;  5HR3 A;  3G7J A;  2CQ9 A;  2GT6 A;  3DRN A;  3GIX A;  3KZQ A;  5D9W A;  5ECI B;  1X5D A;  1BQ7 A;  4ECJ A;  4MLY A;  3GL5 A;  4TR3 A;  4MJA A;  1K0D A;  2VCW A;  1N8J A;  1ERT A;  3KH7 A;  1VF4 A;  1YJ6 A;  5A4V A;  2WFC A;  4KDY A;  4L8E A;  2JZS A;  4TXO B;  4GWR A;  2QGV A;  1R5P A;  1TK5 B;  5IQY A;  3WT2 A;  4XS1 A;  1DE2 A;  1YKA A;  4D73 B;  3L4N A;  1ERU A;  2IWT A;  2GSS A;  3BCK A;  1O6J A;  2VUP A;  4GQC A;  5COH A;  3IK9 A;  2X64 A;  3ZMK A;  3G9B A;  3GFK A;  2CT6 A;  1V9W A;  4L0U A;  1PL1 A;  3KM6 A;  4KE3 A;  2H66 A;  3VI5 A;  1BX9 A;  2LJR A;  3L0H A;  3PGT A;  1X0R A;  4XHM A;  4BWS A;  2L6C A;  2H76 A;  1DSB A;  5ECH B;  1NW2 A;  2CVK A;  4I8B A;  4ZL9 A;  4GST A;  4KH7 A;  2KOK A;  2LRN A;  5C00 A;  3RBT A;  4PX1 A;  1F37 A;  5A4W A;  5IMZ A;  3ZML A;  1SKR B;  1IYH A;  1HQO A;  2EIO A;  1SKS B;  2KP2 A;  3Q18 A;  3HZ8 A;  3TKS C;  4CW9 A;  4ML6 A;  2JZR A;  3GKN A;  1GSY A;  2PBJ A;  3D22 A;  2H75 A;  2H1B A;  2C8U A;  2GSQ A;  3M0F A;  2L59 A;  2N5B A;  1NHY A;  4NAX A;  2VL3 A;  6GSU A;  3HJO A;  1MEK A;  2OA7 A;  3IAM 2;  4K9Z A;  4J57 E;  3DVW A;  2I9H A;  4ACS A;  2VL9 A;  3P8W A;  2ZNM A;  1JZO A;  3F8U A;  5G2Z A;  5AN1 A;  2RUE A;  3UAP A;  2DC5 A;  5DVB A;  1OE7 A;  4E8H A;  1K3O A;  5HFK A;  4TR0 A;  1THX A;  5CP1 A;  5F06 A;  3P2A A;  3DKS A;  3IRA A;  3KXO A;  2GDR A;  1PRX A;  3GX8 A;  2LQQ A;  2RUF A;  3UIW A;  2VLV A;  2AB6 A;  1VF3 A;  4K1F A;  6GSW A;  2X8H A;  4WF4 A;  2ALB A;  1WOU A;  2BMX A;  3EWL A;  1I9D A;  2MYG A;  1XW6 A;  3BCI A;  1BG5 A;  2IMD A;  4FYC A;  3CRU A;  3ZIT A;  2GTU A;  3EMX A;  3K8N A;  3H79 A;  1PX6 A;  3QCP A;  3QFB C;  2FA4 A;  5B6M A;  1Z7R A;  4POM A;  5HR2 A;  3F63 A;  1OC3 A;  5KEJ A;  4ML1 A;  3CRT A;  4RQR A;  1O8X A;  1EGO A;  5GZZ B;  1Z5Y E;  3TB2 A;  4K7N A;  1FG4 A;  1A23 A;  2WUL A;  3VWU A;  4DSS A;  2DJ2 A;  1J9B A;  4PGT A;  3LXZ A;  4KX4 A;  1GSQ A;  3ZZX A;  2HLS A;  4MDC A;  4G2E A;  1HD2 A;  2YZH A;  1ERW A;  5JWO B;  3MSZ A;  4MK3 A;  5J3R A;  1TDI A;  1T4Z A;  2I81 A;  2R37 A;  4MF7 A;  1GL8 A;  1JFU A;  2FHE A;  4NPB A;  5DBQ A;  1XW9 A;  1AQX A;  3DD3 A;  2B6M A;  4RUV A;  3VWV A;  2MBT A;  2CV4 A;  2E2G A;  2ON7 A;  2LRC A;  3VFI A;  3Q74 A;  3VK9 A;  4ZBA A;  2EC4 A;  2YWN A;  3TKQ A;  5B8A A;  4IVF A;  3IXR A;  4HI7 A;  1OC8 A;  1SL0 B;  5CRH A;  3IOS A;  5F0G A;  2DIZ A;  1WIK A;  3M9K A;  1T4Y A;  3VUR A;  3GTU B;  1Z6M A;  4IEL A;  3KGK A;  4ILF A;  1CQG A;  1M9B A;  2GLR A;  5CRW A;  2HE3 A;  3WYW A;  4ZL7 A;  2HXK A;  3HDC A;  5B7C A;  1M2B A;  2LNT A;  2J23 A;  4EDY A;  2OE1 A;  2ZUP A;  1U87 A;  1FOV A;  3PIN A;  1NSW A;  5H5R A;  3I6A A;  3Q19 A;  4X43 A;  2HNL A;  2JAD A;  1WE0 A;  4NHZ A;  1JZD A;  1XWG A;  3IR4 A;  1THO A;  4JZQ A;  5CYY A;  1EP7 A;  3WGD A;  5E4W A;  1R7H A;  1GUH A;  1G7E A;  3GHA A;  1GNW A;  3CYN A;  1QUW A;  4ZL8 A;  4DSR A;  1HNA A;  4IW9 A;  2LST A;  5D96 A;  2O89 A;  2VLT A;  2YCD A;  2JSY A;  3F9U A;  1FHE A;  3HVX A;  4NV5 A;  1A8L A;  3IHQ A;  5CRE A;  2O87 A;  3TGZ A;  4LL4 B;  1YY7 A;  4EE0 A;  4KSM A;  4L5L A;  4J56 E;  2VD0 A;  5CAX A;  3L9V A;  3RDW A;  4TR1 A;  4YAV A;  5G30 A;  3L78 A;  1E6B A;  2LUS A;  5EVO A;  1SYR A;  3UOM A;  2DJ1 A;  2CA8 A;  3LYP A;  3FZ9 A;  2OBI A;  4LA1 A;  1HNB A;  1ST9 A;  2YNX A;  5HFG A;  3RHB A;  3HA9 A;  3M1G A;  4OO5 A;  5EPF A;  1A8Y A;  2YOI A;  2LNS A;  3DEX A;  5CO3 A;  3WGX A;  3UJ1 A;  3QAG A;  2B3S A;  5DAL A;  2CVD A;  4KND A;  4KB3 A;  1JZR A;  2H74 A;  1EV9 A;  2MZC A;  2IJY A;  1F2E A;  5IPG A;  1ZYE A;  3DXB A;  3EIN A;  2VL2 C;  1XFL A;  5ECK B;  1NHO A;  3GL3 A;  1H4O A;  2FWG A;  4GTU A;  3LG6 A;  2V1M A;  4O32 A;  1DUG A;  3RPP A;  4BVX A;  1A0R P;  3TKP A;  1K0M A;  1YF0 A;  3A2W A;  2XHF A;  1CQH A;  1S3D A;  1XZO A;  4Q5R A;  5LNK e;  2F9S A;  2DML A;  3ZIV A;  13GS A;  1MD4 A;  3VI7 A;  2FY6 A;  1JZW A;  2H1D A;  1TW9 A;  4K7I A;  2ZCT A;  4TW5 A;  2VIM A;  5KN2 A;  3M8N A;  4EUY A;  3UEM A;  3GNJ A;  4TXO A;  1TRU A;  4KGI A;  19GS A;  2O7K A;  3ZRD A;  5ECO B;  4WBR D;  1SJ6 A;  1GTU A;  1SJI A;  3KJY A;  3P7X A;  3ZIJ A;  2H6X A;  4D73 A;  2IFQ B;  4TVE A;  2O8V B;  3DML A;  1YEP A;  1JLV A;  2P0G A;  1ABA A;  2WZ9 A;  1B9Y C;  1FVJ A;  5F8B A;  2JU5 A;  2VOC A;  3KD0 A;  2DJK A;  5ID2 B;  4G19 A;  1XOB A;  3IBH A;  3APO A;  1ZGN A;  3LXT A;  3DIE A;  3FZ5 A;  4EVM A;  4XS6 A;  1EWX A;  3N5O A;  4ECC A;  1GUL A;  1G7O A;  5AIX A;  4Z7X A;  2NBS A;  3PR8 A;  5FWG A;  4FO5 A;  4TR4 A;  5A5K A;  2R4V A;  3E3E A;  2X8C A;  4PQ1 A;  3MDK A;  4O7H A;  1TU7 A;  1M0U A;  2DSA A;  3C8E A;  4H86 A;  3GV1 A;  1PA3 A;  3KTL A;  3FKF A;  1DE1 A;  6GSX A;  5E59 A;  1V98 A;  4G9H A;  2R2J A;  4IP1 A;  1RK4 A;  4OFM A;  5DJL A;  1AXD A;  1W4V A;  3ZL5 A;  3TUE A;  4DVC A;  3U5R E;  4RI6 A;  4HS1 A;  3CSI A;  2HFD A;  3JCM L;  2VD1 A;  4GF0 A;  4F2I A;  4K2D A;  2AHE A;  3IAS 2;  4POK A;  3LEF A;  4HZ2 A;  1BED A;  1SK2 A;  2FUG 2;  2H8L A;  4F0C A;  5G5E A;  2M46 A;  4POB A;  4F82 A;  4JR6 A;  5J9C A;  3FYG A;  4J2F A;  5JCG A;  2D2Z A;  4XRD A;  3EUR A;  2H72 A;  4FH8 A;  1PL2 A;  4WKW A;  2A2R A;  2REM A;  2YAN A;  2LRT A;  5D9T A;  2PMT A;  3WT1 A;  2LKU A;  3APQ A;  4MPG A;  4G10 A;  20GS A;  2YJH A;  1O81 A;  1G6Y A;  2LEG A;  3GMF A;  2N5A A;  1TTZ A;  3TKR A;  2XBQ A;  4FYU A;  1Y25 A;  2JSZ A;  4EL1 A;  3G7Y A;  3C71 A;  4IBP A;  4ECB A;  2PUK C;  3I43 A;  5DQS A;  2V32 A;  4I2T A;  4PUR A;  1XBS A;  1SD8 A;  3A2X A;  2GQK A;  3EVI A;  3ZFL A;  4ZB9 A;  1TJD A;  2K8S A;  2EIR A;  3GRX A;  4HU7 A;  4NWY A;  3MNG A;  4FYB A;  3UAR A;  3LJR A;  4EDZ A;  2QKE A;  1V58 A;  1S3C A;  2P31 A;  1U6T A;  1J0F A;  2O85 A;  4EKZ A;  2C0G A;  1J08 A;  1BAY A;  5AGY A;  2HRN A;  1GLP A;  2B7K A;  3HYP A;  4OCF A;  1XCC A;  4XS4 B;  3QAW A;  5J9B A;  4WEY A;  2VAF A;  4ZIL A;  2F8F A;  4MJC A;  1FW1 A;  4N0Z A;  3IE3 A;  3MWH A;  1Z7P A;  2RLI A;  1UN2 A;  2JZT A;  2IMI A;  3FZA A;  4MP4 A;  1SKW B;  1Y6E A;  3GTU A;  2ES7 A;  4AF2 A;  1VF1 A;  5D73 A;  1B8X A;  3ZLP A;  2GVP A;  5DCG A;  1AQW A;  3F4T A;  3HVV A;  2K6V A;  4F0B A;  5EL8 A;  1O73 A;  1ON4 A;  1FVK A;  1JHB A;  4CHS A;  5D9X A;  5H5Q A;  3E9J B;  1HYU A;  3APS A;  5INY A;  3H1N A;  3ISO A;  1O7U A;  4OFT A;  1GSU A;  3O3T A;  2CX4 A;  3GKX A;  2RM5 A;  3IDV A;  2IPA A;  1R4W A;  2DJ0 A;  3F0I A;  2AV4 A;  1VF2 A;  4KUN A;  3CTF A;  1XVW A;  2JAC A;  4KW6 A;  3HHV A;  4OO4 A;  3C7M A;  1QK8 A;  4YQV A;  6GSY A;  1ERV A;  2WRT A;  5ECQ B;  1TP9 A;  3KH9 A;  3BBY A;  2RM6 A;  3SWL A;  1PN9 A;  3F3R A;  4HJM A;  2R6K A;  5IMV A;  1GRX A;  2VLU A;  1PKW A;  4IHU A;  3R2Q A;  3PH9 A;  1V57 A;  1K3L A;  1OKT A;  3KP8 A;  3V1W A;  1GP1 A;  2TRX A;  3GN3 A;  4X1U A;  4L5O A;  2B5Y A;  5B8B A;  2V2G A;  2OKA A;  3G7I A;  3QPM A;  1SK1 A;  3GKK A;  4MZW A;  2AAW A;  2VM2 A;  1K0B A;  3US3 A;  5F05 A;  3VWW A;  3KMO A;  3HCZ A;  2L4C A;  4JRR A;  5AIV A;  2I1U A;  4AJ8 A;  4BVY A;  3FW2 A;  3GUS A;  2MMZ A;  4ID0 A;  2FD3 A;  4IP6 A;  5A4U A;  4BWQ A;  3TOU A;  2BTO T;  1M2A A;  3NOF A;  1GSF A;  1XWA A;  5GAN D;  4PQH A;  1ZMA A;  3TDG A;  4KDX A;  4MZB A;  2X8G A;  1XWB A;  1UVZ A;  2H6Y A;  3M9J A;  12GS A;  4OFN A;  1GNE A;  5GSS A;  3A2V A;  5JWR B;  3U6V A;  2FA8 A;  4NMU A;  3UBK A;  2MMO A;  5FT3 A;  3J7Y k;  4MH2 A;  4O92 A;  2J9H A;  6GSV A;  1USB A;  4Q5Q A;  3UMA A;  1Z6N A;  1G6W A;  5IPH A;  4EO3 A;  1X9M B;  3C1R A;  3TOT A;  2R5G A;  4MZC A;  4MAB A;  4GCI A;  3QOU A;  5L71 A;  1Z9H A;  2FCH A;  1U88 A;  2IFQ A;  5DAK B;  1LBK A;  2H1G A;  4KDU A;  2GQM A;  2DLX A;  4QQ7 A;  5ID2 A;  5J4U A;  5ABR A;  2PER A;  1M9A A;  4RI7 A;  2GQL A;  1R5A A;  3KCM A;  1WPI A;  4HZ4 A;  4GSN A;  4HDE A;  2C0D A;  3RPN A;  2GS3 A;  3L9U A;  2HZE B;  4HQS A;  3KTB A;  2F8A A;  3HZ4 A;  4E8E A;  5CRD A;  1X9S B;  1KEB A;  4O5R A;  1GUK A;  3D21 A;  1QXH A;  1F3B A;  4HUA A;  2NPB A;  1TU8 A;  4OD7 A;  3ZVJ A;  1TK0 B;  5F07 A;  1YZX A;  3FHK A;  3I69 A;  4LLR A;  1YKC A;  1N2A A;  2A2S A;  2KLX A;  1ZL9 A;  2NTO A;  3ED3 A;  3AY8 A;  3HXS A;  3IPZ A;  1WMJ A;  1BJX A;  4JE1 A;  1SYX A;  4MA9 A;  2H71 A;  1GSS A;  1A2M A;  1TXX A;  4YQU A;  2F3M A;  2KP1 A;  3HKR A;  1MDK A;  4IN0 A;  4IQ1 A;  1AC1 A;  3TJB A;  1B9X C;  2OJL A;  3GKM A;  3S9F A;  17GS A;  3CMI A;  3NZN A;  3TRX A;  1E2Y A;  3WGE A;  1TI3 A;  2H0G A;  5ECN B;  1IYI A;  2EIQ A;  2CVB A;  1FB6 A;  5GST A;  3P90 A;  1WP0 A;  1XOA A;  3HD5 A;  3LOR A;  4V2N A;  1YF1 A;  2C0F A;  1GTB A;  2XBI A;  1SL2 B;  1T3B A;  2H6Z A;  4AGS A;  4DEJ A;  3C73 A;  1EGR A;  4MPF A;  3GST A;  2PVQ A;  2L57 A;  5LCZ A;  2VCX A;  1K0A A;  3UVH A;  4LMV A;  4V2M A;  3IK7 A;  2FNO A;  1XW5 A;  4OMV A;  3ERG A;  4IJ3 A;  4Q5F A;  3GSS A;  5DJM A;  2P5Q A;  1GTI A;  4RQX A;  2VL2 A;  1QFN A;  3KEB A;  3LWA A;  2R3X A;  5IO2 A;  2KUC A;  2QC7 A;  3D0Z A;  2VCV A;  2IMF A;  3ZFB A;  4P3Y B;  4YQM A;  3F4S A;  1XIY A;  2OE3 A;  3IC4 A;  4HOJ A;  3J7Y b;  5HR0 A;  2YWO A;  3VWX A;  4AJ7 A;  1TI1 A;  4ISD A;  1OKD A;  1M99 A;  4EF0 A;  4OCE A;  3EU3 A;  2WGR A;  3QAV A;  3KP9 A;  1OC9 B;  4WR4 A; 
#chains in the Genus database with same CATH topology
 2TRC P;  4ZIJ A;  2YJ7 A;  4XS4 A;  2GZZ A;  3FR6 A;  2FWE A;  3LSZ A;  3QDN A;  3F6D A;  1WJK A;  4YH2 A;  1OAZ A;  3HJP A;  2K9F A;  1M3I A;  4K8M A;  2M72 A;  4GRF A;  2AYT A;  2OAC A;  2AUV A;  3F3Q A;  3RHC A;  2PN8 A;  5ECM B;  1OYJ A;  1V2A A;  4PXO A;  2LQO A;  2H70 A;  1LU4 A;  4WXT A;  4PQI A;  4XRA A;  3ME8 A;  2VCZ A;  4MMM A;  1U3I A;  2GZY A;  1JLW A;  1AAZ A;  22GS A;  14GS A;  4KA0 A;  3TJJ A;  3CSH A;  5IO0 A;  3D6I A;  2XPD A;  3IHG A;  2HT9 A;  1AIU A;  2QSI A;  4K0G A;  4BPY A;  1GTA A;  1EP8 A;  3CTG A;  3RAZ A;  2H0H A;  4HU9 A;  2JL4 A;  2H0I A;  5C04 A;  3CXG A;  1TKD B;  4ZBB A;  1K0N A;  3IV4 A;  5LD0 A;  4IJI A;  3TJG A;  1B4Q A;  3QD9 A;  1NM3 A;  4MJE A;  4MCU A;  3BD2 A;  1PSQ A;  1A2J A;  2IMK A;  5DCH A;  1H75 A;  3F4R A;  1TRV A;  1PFO A;  3D5J A;  5G31 A;  3TKS E;  4EXJ A;  2V6K A;  2IME A;  3KIJ A;  3QFA C;  1ILO A;  1TRS A;  3GYK A;  1EEJ A;  2VM1 A;  3LYK A;  4HJ2 A;  2ON5 A;  1UC7 A;  1XXU A;  4WR5 A;  1A0F A;  1BYE A;  5B6N A;  3M3M A;  2G2Q A;  2YWM A;  1FOH A;  1GH2 A;  1GSD A;  2B5X A;  3E0U A;  2VO4 A;  1K3Y A;  4GQF A;  2VCT A;  4HSC X;  2XPE A;  5KN1 A;  9GSS A;  4JU5 A;  2IL3 A;  2OAD A;  2N5F A;  2CZ2 A;  4GXZ A;  1WRY A;  4NXI A;  4I5Q A;  1YDK A;  3EC3 A;  2LS5 A;  3LFL A;  2HSM A;  1AW9 A;  5ECP B;  2C3Q A;  2H73 A;  4FIW A;  2HSY A;  4F9Z A;  3EU4 A;  1RQM A;  1T7P B;  4V1A g;  3D4M A;  2C3N A;  1ZOF A;  3UL3 A;  5J5N A;  2FWF A;  3D4T A;  1B48 A;  3I9V 2;  5DQY A;  2AJQ B;  4IQA A;  1EEM A;  1OE8 A;  1T1V A;  4X0X A;  2V6O A;  2B5E A;  1ACV A;  3W6G A;  4XIH A;  2C0E A;  4DSQ A;  1ZCP A;  2H1A A;  3TKS A;  5J41 A;  3MAK A;  5H5S A;  2CZ3 A;  4POL A;  3TRQ A;  1A2L A;  1FO5 A;  2B7J A;  4K0N A;  2NVL A;  3BOA A;  5IMD A;  3FR3 A;  3QR6 A;  5HFI A;  4ZBD A;  4KSO A;  2I4A A;  1MDI A;  4V2L A;  3ERW A;  3SBC A;  2C3T A;  3TCO A;  1KTE A;  2PVO C;  3FY7 A;  4LL1 B;  3TJF A;  5D93 A;  2DJJ A;  1YEX A;  5DAK A;  4XTS A;  1TOF A;  3GUR A;  5ELG A;  2B1K A;  4F03 A;  4WF5 A;  4QL7 A;  3EYT A;  1KBN A;  3QMX A;  4I2U A;  2WDU A;  3DWV A;  2GSR A;  1URM A;  3WD6 A;  3GH6 A;  1SK0 A;  1SJZ A;  4ECI A;  1K0O A;  3FZ4 A;  1QQ2 A;  2HI7 A;  2B1L A;  3VPQ A;  5JWQ B;  3C1S A;  4BA7 A;  5ECR B;  2FGX A;  3TJK A;  3DYR A;  5EY6 A;  1PMT A;  4ZXG A;  2A4V A;  1C72 A;  3GA4 A;  3ZRE A;  3KMN A;  1F6M C;  1V40 A;  1OVN A;  5CRG A;  5HQP A;  2F51 A;  4WET A;  3OR5 A;  5FHI A;  2DMM A;  2HZE A;  8GSS A;  1FB0 A;  5ENU A;  4WBJ A;  3ZTL A;  5DDL A;  5IOX A;  1Q98 A;  2G0F A;  3N9J A;  3H8Q A;  4JR4 A;  1U3A A;  2LJA A;  4IGJ A;  1GSE A;  4L0W A;  3DGQ A;  2YV7 A;  4N11 A;  16GS A;  1PGT A;  4ULX A;  1SEN A;  10GS A;  1ML6 A;  2C4J A;  1EOG A;  4ZB6 A;  4Z2U A;  3IA1 A;  4HEA 2;  1F3A A;  4KCA A;  3ZVJ D;  4BL7 A;  2PGT A;  2LV3 A;  2YN1 A;  3LW9 A;  2M80 A;  1G0T A;  5CNW A;  5GAP D;  1R26 A;  5IMF A;  1O8W A;  1XVQ A;  1AQV A;  2H19 A;  1SD9 A;  1VGL A;  4MF5 A;  4ZB8 A;  4QL9 A;  5AIS A;  4IS0 A;  2XC2 A;  1AUC A;  2WB9 A;  4MF6 A;  4IKH A;  4N0V A;  3W8S A;  5KN0 A;  4XCS A;  2H30 A;  5KN3 A;  2E7P A;  2OE0 A;  4N30 A;  3FK8 A;  2C80 A;  2Z9S A;  3HY2 A;  2E2M A;  4PUF C;  5ECS A;  4CY8 A;  4CDO A;  1X5E A;  2GZP A;  1SL1 B;  1LJR A;  3ZYW A;  3F6F A;  2L4Q A;  4Q5N A;  4DSS B;  1UA5 A;  1FAA A;  1M2D A;  4V1A p;  3O76 A;  2FWH A;  1XWK A;  3NIV A;  3VLN A;  2K8V A;  4PNF A;  1XWC A;  1VRS D;  1DBY A;  4EIP A;  3CSJ A;  4I6X A;  4MH3 A;  2IN3 A;  1EOH A;  4GLT A;  1S3A A;  1WWJ A;  5JCW A;  5HR1 A;  1XG8 A;  2A2P A;  6GSS A;  3L9S A;  1TRW A;  4MJB A;  2E0Q A;  1YQ1 A;  1X5C A;  2FLS A;  1A24 A;  1T8E B;  2YZU A;  2L5O A;  3ERF A;  3LQ7 A;  2HRF A;  4PUA A;  1HNC A;  3EE2 A;  2WJU A;  3UBL A;  1PQN A;  1QMV A;  2WS2 A;  3GH9 A;  1QGV A;  5IMC A;  2CAI A;  3FRC A;  3O6T A;  1MDJ A;  4TXV A;  2DIY A;  2IIY A;  2DBC A;  1SU9 A;  3ME7 A;  3HJM A;  1PD2 1;  2HSH A;  1W89 A;  3LGC A;  4TRX A;  1OC9 A;  3EMP A;  2GST A;  3UVT A;  1ZZY A;  5ELA A;  3FMW A;  2L6D A;  3DVX A;  2LTK A;  4HQZ A;  3Q6O A;  5G5F A;  2C1Y A;  2KHP A;  4TN8 A;  4EC0 A;  3GX0 A;  5D9V A;  1RW1 A;  11GS A;  2NDO A;  3A5W A;  5IOW A;  2YP6 A;  2MMA A;  4K7O A;  1Z3E A;  2K18 A;  3FR9 A;  3H93 A;  2L5L A;  2PU9 C;  2DJ3 A;  2P5R A;  4LMW A;  1F9M A;  3W8J A;  2X99 A;  2H01 A;  5IM9 A;  1PX7 A;  1M7T A;  2CX3 A;  2YV9 A;  3CBU A;  4KCE A;  1X9W B;  4TOP A;  1KNG A;  2PWJ A;  5IMA A;  2YPM A;  4I97 A;  2R0G A;  3HVS A;  4AJ6 A;  2GT5 A;  1GUM A;  2MMN A;  4NHW A;  3TRP A;  2BJX A;  1EV4 A;  2YWI A;  5G1L A;  2OBK A;  4PNG A;  2LJK A;  3VPT A;  4KAE A;  5G1K A;  1T00 A;  3CQF A;  1PKZ A;  2GGT A;  2TIR A;  1Q4J A;  4TR1 B;  1K0C A;  1MTC A;  4GSS A;  4JBB A;  5JCU A;  2CAQ A;  2I3Y A;  1O85 A;  2PPT A;  1XPV A;  2RII A;  4K6X A;  2VCQ A;  2V41 A;  3A3T A;  4TKY A;  6GST A;  1MD3 A;  5IIZ A;  3BJ5 A;  4N10 A;  5DAL B;  3H4K A;  18GS A;  4YAP A;  2MBS A;  4OWY A;  2HYX A;  2WCI A;  4NV2 A;  5D8I A;  3FEU A;  1ZYQ B;  5ECL B;  1PN0 A;  2DKH A;  2HZF A;  1EZK A;  1TK8 B;  1GWC A;  1B4P A;  1GLQ A;  7GSS A;  1I5G A;  4JED A;  4BVX B;  5HR3 A;  3G7J A;  2CQ9 A;  2GT6 A;  3DRN A;  3GIX A;  3KZQ A;  5D9W A;  5ECI B;  1X5D A;  1BQ7 A;  4ECJ A;  4MLY A;  3GL5 A;  4USS A;  4TR3 A;  4MJA A;  1K0D A;  2VCW A;  1N8J A;  1ERT A;  3KH7 A;  1VF4 A;  1YJ6 A;  5A4V A;  2WFC A;  4KDY A;  4L8E A;  2JZS A;  4TXO B;  4GWR A;  2QGV A;  1R5P A;  1TK5 B;  5IQY A;  3WT2 A;  4XS1 A;  1DE2 A;  1YKA A;  4D73 B;  3L4N A;  1ERU A;  2IWT A;  2GSS A;  3BCK A;  1O6J A;  2VUP A;  4GQC A;  5COH A;  3IK9 A;  2X64 A;  3ZMK A;  3G9B A;  3GFK A;  2CT6 A;  1V9W A;  4BIK A;  4L0U A;  1PL1 A;  3KM6 A;  4KE3 A;  2H66 A;  3VI5 A;  1BX9 A;  2LJR A;  3L0H A;  3PGT A;  1X0R A;  4XHM A;  4BWS A;  2L6C A;  2H76 A;  1DSB A;  5ECH B;  1NW2 A;  2CVK A;  4I8B A;  4ZL9 A;  4GST A;  4KH7 A;  2KOK A;  2LRN A;  5C00 A;  3RBT A;  4PX1 A;  3MYD A;  1F37 A;  3IC8 A;  5A4W A;  5IMZ A;  3ZML A;  1SKR B;  1IYH A;  1HQO A;  2EIO A;  1SKS B;  2KP2 A;  3Q18 A;  3HZ8 A;  3TKS C;  4CW9 A;  4ML6 A;  2JZR A;  3GKN A;  2QA2 A;  1GSY A;  2PBJ A;  3D22 A;  2H75 A;  2H1B A;  2C8U A;  2GSQ A;  3M0F A;  2L59 A;  2N5B A;  1NHY A;  4NAX A;  2VL3 A;  6GSU A;  3HJO A;  1MEK A;  2OA7 A;  3IAM 2;  4K9Z A;  4J57 E;  3DVW A;  2I9H A;  4ACS A;  2VL9 A;  3P8W A;  2ZNM A;  1JZO A;  3F8U A;  5G2Z A;  5AN1 A;  2RUE A;  3UAP A;  2DC5 A;  5DVB A;  1OE7 A;  4E8H A;  1K3O A;  5HFK A;  2HRA A;  1THX A;  4TR0 A;  5CP1 A;  5F06 A;  3P2A A;  3DKS A;  3IRA A;  3KXO A;  2GDR A;  1PRX A;  3GX8 A;  2LQQ A;  2RUF A;  3UIW A;  2VLV A;  2AB6 A;  1VF3 A;  4K1F A;  6GSW A;  2X8H A;  4WF4 A;  2ALB A;  1WOU A;  2BMX A;  3EWL A;  1I9D A;  2MYG A;  1XW6 A;  3BCI A;  1BG5 A;  2IMD A;  4FYC A;  3CRU A;  3ZIT A;  2GTU A;  3EMX A;  3K8N A;  3H79 A;  1PX6 A;  3QCP A;  5BRT A;  3QFB C;  2FA4 A;  5B6M A;  1Z7R A;  4POM A;  5HR2 A;  3F63 A;  1OC3 A;  5KEJ A;  4ML1 A;  3CRT A;  4RQR A;  1O8X A;  1EGO A;  5GZZ B;  1Z5Y E;  1S3R A;  3TB2 A;  4K7N A;  1FG4 A;  1A23 A;  2WUL A;  3VWU A;  4DSS A;  2DJ2 A;  1J9B A;  4PGT A;  3LXZ A;  4KX4 A;  1GSQ A;  3ZZX A;  2HLS A;  4MDC A;  4G2E A;  1HD2 A;  2YZH A;  1ERW A;  5JWO B;  3MSZ A;  4MK3 A;  5J3R A;  1TDI A;  1T4Z A;  2I81 A;  2R37 A;  4MF7 A;  1GL8 A;  1JFU A;  2FHE A;  4NPB A;  5DBQ A;  1XW9 A;  1AQX A;  2R0P A;  3DD3 A;  2B6M A;  4RUV A;  3VWV A;  2MBT A;  2CV4 A;  2E2G A;  2ON7 A;  2LRC A;  3VFI A;  3Q74 A;  3VK9 A;  4ZBA A;  2EC4 A;  3EPT A;  2YWN A;  3TKQ A;  5B8A A;  4IVF A;  3IXR A;  4HI7 A;  1OC8 A;  1SL0 B;  5CRH A;  3IOS A;  5F0G A;  2DIZ A;  1WIK A;  4K5R A;  3M9K A;  1T4Y A;  3VUR A;  3GTU B;  1Z6M A;  4IEL A;  4ICY A;  3KGK A;  4ILF A;  1CQG A;  1M9B A;  2GLR A;  5CRW A;  2HE3 A;  3WYW A;  4ZL7 A;  2HXK A;  3HDC A;  5B7C A;  1M2B A;  2LNT A;  2J23 A;  4EDY A;  2OE1 A;  2ZUP A;  1U87 A;  1FOV A;  3PIN A;  1NSW A;  5H5R A;  3I6A A;  3Q19 A;  4X43 A;  2HNL A;  2JAD A;  1WE0 A;  4NHZ A;  1JZD A;  1XWG A;  3IR4 A;  1THO A;  4JZQ A;  5CYY A;  1EP7 A;  3WGD A;  5E4W A;  1R7H A;  1GUH A;  1G7E A;  3GHA A;  1GNW A;  3CYN A;  1QUW A;  4ZL8 A;  4DSR A;  1HNA A;  4IW9 A;  2LST A;  5D96 A;  2O89 A;  2VLT A;  2YCD A;  2JSY A;  3F9U A;  1FHE A;  3HVX A;  4NV5 A;  1A8L A;  3IHQ A;  5CRE A;  5KOW A;  2O87 A;  3TGZ A;  4LL4 B;  1YY7 A;  4EE0 A;  4KSM A;  4L5L A;  4J56 E;  2VD0 A;  5CAX A;  3L9V A;  3RDW A;  4TR1 A;  4YAV A;  5G30 A;  3L78 A;  1E6B A;  2LUS A;  5EVO A;  1SYR A;  3UOM A;  2DJ1 A;  2CA8 A;  3LYP A;  3FZ9 A;  2OBI A;  4LA1 A;  1HNB A;  1ST9 A;  2YNX A;  5HFG A;  3RHB A;  3HA9 A;  3M1G A;  4OO5 A;  5EPF A;  1A8Y A;  2YOI A;  2LNS A;  3DEX A;  5CO3 A;  3WGX A;  3UJ1 A;  3QAG A;  2B3S A;  3PPU A;  5DAL A;  4BVY B;  2CVD A;  4KND A;  4KB3 A;  1JZR A;  2H74 A;  1EV9 A;  2MZC A;  4Z2R A;  2IJY A;  1F2E A;  5IPG A;  4O5U A;  1ZYE A;  3DXB A;  3EIN A;  2VL2 C;  1XFL A;  5ECK B;  2X4A A;  1NHO A;  3GL3 A;  1H4O A;  2FWG A;  4GTU A;  3LG6 A;  2V1M A;  4O32 A;  1DUG A;  3RPP A;  4BVX A;  1A0R P;  3TKP A;  1K0M A;  1YF0 A;  3A2W A;  2XHF A;  1CQH A;  5BMU A;  1S3D A;  1XZO A;  4Q5R A;  5LNK e;  2F9S A;  2DML A;  3ZIV A;  13GS A;  1MD4 A;  3VI7 A;  2FY6 A;  1JZW A;  2H1D A;  1TW9 A;  4K7I A;  2ZCT A;  4TW5 A;  2VIM A;  5KN2 A;  3M8N A;  4EIQ A;  4EUY A;  3UEM A;  3GNJ A;  4TXO A;  1TRU A;  4KGI A;  19GS A;  2O7K A;  3ZRD A;  5ECO B;  4WBR D;  1SJ6 A;  1GTU A;  1SJI A;  3KJY A;  4G0K A;  3P7X A;  3ZIJ A;  2H6X A;  4D73 A;  2IFQ B;  4TVE A;  2O8V B;  3DML A;  1YEP A;  1JLV A;  2P0G A;  1ABA A;  2WZ9 A;  1B9Y C;  1FVJ A;  5F8B A;  2JU5 A;  2VOC A;  3KD0 A;  2DJK A;  5ID2 B;  4G19 A;  1XOB A;  3IBH A;  3APO A;  1ZGN A;  3LXT A;  3DIE A;  3FZ5 A;  4EVM A;  4XS6 A;  1EWX A;  3N5O A;  4ECC A;  1GUL A;  1G7O A;  5AIX A;  4Z7X A;  2NBS A;  3PR8 A;  5FWG A;  4FO5 A;  4TR4 A;  5A5K A;  4YKF A;  2R4V A;  3E3E A;  2X8C A;  4PQ1 A;  3MDK A;  4O7H A;  1TU7 A;  1M0U A;  2DSA A;  3C8E A;  4H86 A;  3GV1 A;  1PA3 A;  3KTL A;  3FKF A;  1DE1 A;  6GSX A;  5E59 A;  4PTS A;  1V98 A;  4G9H A;  2R2J A;  4IP1 A;  1RK4 A;  4OFM A;  5DJL A;  1AXD A;  1W4V A;  3ZL5 A;  3TUE A;  4FQU A;  4DVC A;  3U5R E;  4RI6 A;  4HS1 A;  3CSI A;  2HFD A;  3JCM L;  2VD1 A;  4GF0 A;  4F2I A;  4K2D A;  2AHE A;  3IAS 2;  4POK A;  2QA1 A;  3LEF A;  4HZ2 A;  1BED A;  1SK2 A;  2FUG 2;  2H8L A;  4F0C A;  5G5E A;  2M46 A;  4POB A;  4F82 A;  4JR6 A;  5J9C A;  3FYG A;  4J2F A;  5JCG A;  2D2Z A;  4XRD A;  3EUR A;  2H72 A;  4FH8 A;  1PL2 A;  4WKW A;  2A2R A;  2REM A;  2YAN A;  2R0C A;  2LRT A;  5D9T A;  2PMT A;  3WT1 A;  2LKU A;  3APQ A;  4MPG A;  3R3E A;  4G10 A;  20GS A;  2YJH A;  1O81 A;  1G6Y A;  2LEG A;  3GMF A;  2N5A A;  1TTZ A;  3TKR A;  2XBQ A;  4FYU A;  4X4J A;  1Y25 A;  2JSZ A;  4EL1 A;  3G7Y A;  3C71 A;  4IBP A;  4ECB A;  2PUK C;  3I43 A;  5DQS A;  2V32 A;  4I2T A;  4PUR A;  4K5S A;  1XBS A;  1SD8 A;  3A2X A;  2GQK A;  4O5Q A;  3EVI A;  3ZFL A;  4ZB9 A;  1TJD A;  2K8S A;  2EIR A;  3GRX A;  4HU7 A;  4NWY A;  3MNG A;  4FYB A;  3UAR A;  3LJR A;  4EDZ A;  2QKE A;  1V58 A;  1S3C A;  2P31 A;  1U6T A;  1J0F A;  2O85 A;  4EKZ A;  2C0G A;  1J08 A;  1BAY A;  5AGY A;  2HRN A;  1GLP A;  2DKI A;  2B7K A;  3HYP A;  4OCF A;  1XCC A;  4XS4 B;  3QAW A;  5J9B A;  4WEY A;  4G0L A;  2VAF A;  4ZIL A;  2F8F A;  4MJC A;  1FW1 A;  4N0Z A;  3IE3 A;  3MWH A;  1Z7P A;  2RLI A;  1UN2 A;  2JZT A;  2IMI A;  3FZA A;  4MP4 A;  1SKW B;  1Y6E A;  3GTU A;  2ES7 A;  4AF2 A;  1VF1 A;  5D73 A;  2HRK A;  1B8X A;  3ZLP A;  2GVP A;  5DCG A;  1AQW A;  3F4T A;  3HVV A;  2K6V A;  4F0B A;  5EL8 A;  1O73 A;  1ON4 A;  1FVK A;  1JHB A;  4CHS A;  5D9X A;  5H5Q A;  3E9J B;  1HYU A;  3APS A;  5INY A;  3H1N A;  3ISO A;  1O7U A;  4OFT A;  1GSU A;  3O3T A;  2CX4 A;  3GKX A;  2RM5 A;  3IDV A;  2IPA A;  2X49 A;  1R4W A;  2DJ0 A;  3F0I A;  2AV4 A;  1VF2 A;  4KUN A;  3CTF A;  1XVW A;  2JAC A;  4KW6 A;  3HHV A;  4OO4 A;  3C7M A;  1QK8 A;  4YQV A;  6GSY A;  1ERV A;  2WRT A;  5ECQ B;  1TP9 A;  3KH9 A;  3BBY A;  2RM6 A;  3SWL A;  1PN9 A;  3F3R A;  4HJM A;  2R6K A;  5IMV A;  1GRX A;  2VLU A;  1PKW A;  4IHU A;  3R2Q A;  3PH9 A;  1V57 A;  1K3L A;  1OKT A;  3KP8 A;  3V1W A;  1GP1 A;  4KF9 A;  2TRX A;  3GN3 A;  3A5I A;  4X1U A;  4L5O A;  2B5Y A;  5B8B A;  2V2G A;  2OKA A;  3G7I A;  3QPM A;  1SK1 A;  3GKK A;  4MZW A;  2AAW A;  2VM2 A;  1K0B A;  3US3 A;  5F05 A;  3VWW A;  3KMO A;  3HCZ A;  2L4C A;  1ZYP A;  4YKG A;  4JRR A;  5AIV A;  2I1U A;  4AJ8 A;  4BVY A;  3FW2 A;  3GUS A;  2MMZ A;  4ID0 A;  2FD3 A;  4IP6 A;  5A4U A;  4BWQ A;  3TOU A;  2BTO T;  1M2A A;  3NOF A;  1GSF A;  1XWA A;  5GAN D;  4PQH A;  1ZMA A;  3TDG A;  4KDX A;  4MZB A;  2X8G A;  1XWB A;  1UVZ A;  2H6Y A;  3M9J A;  12GS A;  4OFN A;  1GNE A;  5GSS A;  3A2V A;  5JWR B;  3U6V A;  2FA8 A;  4NMU A;  3UBK A;  2MMO A;  5FT3 A;  3J7Y k;  4MH2 A;  4O92 A;  2A4H A;  2J9H A;  6GSV A;  1USB A;  4Q5Q A;  3UMA A;  1Z6N A;  1G6W A;  5IPH A;  5KOX A;  4EO3 A;  1X9M B;  4Z2T A;  3C1R A;  3TOT A;  2R5G A;  4MZC A;  4MAB A;  4GCI A;  3HVN A;  3QOU A;  5L71 A;  1Z9H A;  2FCH A;  1U88 A;  1ZYN A;  2IFQ A;  5DAK B;  4A5P A;  1LBK A;  2H1G A;  4KDU A;  2GQM A;  2DLX A;  4QQ7 A;  5ID2 A;  5J4U A;  5ABR A;  2PER A;  1M9A A;  4RI7 A;  2GQL A;  1R5A A;  3KCM A;  1WPI A;  4HZ4 A;  4GSN A;  4HDE A;  2C0D A;  3RPN A;  2GS3 A;  3L9U A;  2HZE B;  4HQS A;  3KTB A;  2F8A A;  3HZ4 A;  4E8E A;  5CRD A;  1X9S B;  1KEB A;  4O5R A;  1GUK A;  3D21 A;  1QXH A;  1F3B A;  4HUA A;  2NPB A;  1TU8 A;  4OD7 A;  3ZVJ A;  1TK0 B;  5F07 A;  1YZX A;  3FHK A;  3I69 A;  4LLR A;  1YKC A;  1N2A A;  4K2X A;  2A2S A;  2KLX A;  4BL7 B;  1ZL9 A;  2NTO A;  3ED3 A;  3AY8 A;  3HXS A;  3IPZ A;  1WMJ A;  1BJX A;  4JE1 A;  1SYX A;  4MA9 A;  2H71 A;  1GSS A;  1A2M A;  1TXX A;  4YQU A;  2F3M A;  2KP1 A;  3HKR A;  1MDK A;  4IN0 A;  4IQ1 A;  1AC1 A;  3TJB A;  1B9X C;  2OJL A;  3GKM A;  3S9F A;  17GS A;  4MNN A;  3CMI A;  3NZN A;  4G0I A;  3TRX A;  1E2Y A;  3WGE A;  1TI3 A;  2H0G A;  5ECN B;  1IYI A;  2EIQ A;  2CVB A;  1FB6 A;  5GST A;  3P90 A;  4CY6 A;  1WP0 A;  1XOA A;  3HD5 A;  3LOR A;  4V2N A;  1YF1 A;  2C0F A;  1GTB A;  2XBI A;  1SL2 B;  1T3B A;  2H6Z A;  4AGS A;  4DEJ A;  3C73 A;  1EGR A;  4MPF A;  3GST A;  2PVQ A;  2L57 A;  5LCZ A;  2VCX A;  1K0A A;  3UVH A;  4LMV A;  4V2M A;  3IK7 A;  2FNO A;  1XW5 A;  4OMV A;  3ERG A;  4IJ3 A;  4Q5F A;  3GSS A;  5DJM A;  2P5Q A;  1GTI A;  4RQX A;  2VL2 A;  1QFN A;  1M3J A;  3KEB A;  3LWA A;  2R3X A;  5IO2 A;  2KUC A;  2QC7 A;  3D0Z A;  2VCV A;  2IMF A;  3ZFB A;  4P3Y B;  4YQM A;  3F4S A;  1XIY A;  2OE3 A;  3IC4 A;  4HOJ A;  3J7Y b;  5HR0 A;  2YWO A;  3VWX A;  4AJ7 A;  2UZ8 A;  1TI1 A;  4ISD A;  1OKD A;  1M99 A;  4EF0 A;  4OCE A;  3EU3 A;  2WGR A;  3QAV A;  3KP9 A;  1OC9 B;  3MIX A;  4WR4 A; 
#chains in the Genus database with same CATH homology
 2TRC P;  4ZIJ A;  2YJ7 A;  4XS4 A;  2GZZ A;  3FR6 A;  2FWE A;  3LSZ A;  3QDN A;  3F6D A;  1WJK A;  4YH2 A;  1OAZ A;  3HJP A;  2K9F A;  4K8M A;  2M72 A;  4GRF A;  2AYT A;  2OAC A;  2AUV A;  3F3Q A;  3RHC A;  2PN8 A;  5ECM B;  1OYJ A;  1V2A A;  4PXO A;  2LQO A;  2H70 A;  1LU4 A;  4WXT A;  4PQI A;  4XRA A;  3ME8 A;  2VCZ A;  4MMM A;  1U3I A;  2GZY A;  1JLW A;  1AAZ A;  22GS A;  14GS A;  4KA0 A;  3TJJ A;  3CSH A;  5IO0 A;  3D6I A;  2XPD A;  3IHG A;  2HT9 A;  1AIU A;  2QSI A;  4K0G A;  4BPY A;  1GTA A;  1EP8 A;  3CTG A;  3RAZ A;  2H0H A;  4HU9 A;  2JL4 A;  2H0I A;  5C04 A;  3CXG A;  1TKD B;  4ZBB A;  1K0N A;  3IV4 A;  5LD0 A;  4IJI A;  3TJG A;  1B4Q A;  3QD9 A;  1NM3 A;  4MJE A;  4MCU A;  3BD2 A;  1PSQ A;  1A2J A;  2IMK A;  5DCH A;  1H75 A;  3F4R A;  1TRV A;  3D5J A;  5G31 A;  3TKS E;  4EXJ A;  2V6K A;  2IME A;  3KIJ A;  3QFA C;  1ILO A;  1TRS A;  3GYK A;  1EEJ A;  2VM1 A;  3LYK A;  4HJ2 A;  2ON5 A;  1UC7 A;  1XXU A;  4WR5 A;  1A0F A;  1BYE A;  5B6N A;  3M3M A;  2G2Q A;  2YWM A;  1FOH A;  1GH2 A;  1GSD A;  2B5X A;  3E0U A;  2VO4 A;  1K3Y A;  4GQF A;  2VCT A;  2XPE A;  5KN1 A;  9GSS A;  4JU5 A;  2IL3 A;  2OAD A;  2N5F A;  2CZ2 A;  4GXZ A;  1WRY A;  4NXI A;  4I5Q A;  1YDK A;  3EC3 A;  2LS5 A;  3LFL A;  2HSM A;  1AW9 A;  5ECP B;  2C3Q A;  2H73 A;  4FIW A;  2HSY A;  4F9Z A;  3EU4 A;  1RQM A;  1T7P B;  4V1A g;  3D4M A;  2C3N A;  1ZOF A;  3UL3 A;  5J5N A;  2FWF A;  3D4T A;  1B48 A;  3I9V 2;  5DQY A;  2AJQ B;  4IQA A;  1EEM A;  1OE8 A;  1T1V A;  4X0X A;  2V6O A;  2B5E A;  1ACV A;  3W6G A;  4XIH A;  2C0E A;  4DSQ A;  1ZCP A;  2H1A A;  3TKS A;  5J41 A;  3MAK A;  5H5S A;  2CZ3 A;  4POL A;  3TRQ A;  1A2L A;  1FO5 A;  2B7J A;  4K0N A;  2NVL A;  3BOA A;  5IMD A;  3FR3 A;  3QR6 A;  5HFI A;  4ZBD A;  4KSO A;  2I4A A;  1MDI A;  4V2L A;  3ERW A;  3SBC A;  2C3T A;  3TCO A;  1KTE A;  2PVO C;  3FY7 A;  4LL1 B;  3TJF A;  5D93 A;  2DJJ A;  1YEX A;  5DAK A;  4XTS A;  1TOF A;  3GUR A;  5ELG A;  2B1K A;  4F03 A;  4WF5 A;  4QL7 A;  3EYT A;  1KBN A;  3QMX A;  4I2U A;  2WDU A;  3DWV A;  2GSR A;  1URM A;  3WD6 A;  3GH6 A;  1SK0 A;  1SJZ A;  4ECI A;  1K0O A;  3FZ4 A;  1QQ2 A;  2HI7 A;  2B1L A;  3VPQ A;  5JWQ B;  3C1S A;  4BA7 A;  5ECR B;  2FGX A;  3TJK A;  3DYR A;  5EY6 A;  1PMT A;  4ZXG A;  2A4V A;  1C72 A;  3GA4 A;  3ZRE A;  3KMN A;  1F6M C;  1V40 A;  1OVN A;  5CRG A;  5HQP A;  2F51 A;  4WET A;  3OR5 A;  5FHI A;  2DMM A;  2HZE A;  8GSS A;  1FB0 A;  5ENU A;  4WBJ A;  3ZTL A;  5DDL A;  5IOX A;  1Q98 A;  2G0F A;  3N9J A;  3H8Q A;  4JR4 A;  1U3A A;  2LJA A;  4IGJ A;  1GSE A;  4L0W A;  3DGQ A;  2YV7 A;  4N11 A;  16GS A;  1PGT A;  4ULX A;  1SEN A;  10GS A;  1ML6 A;  2C4J A;  1EOG A;  4ZB6 A;  4Z2U A;  3IA1 A;  4HEA 2;  1F3A A;  4KCA A;  3ZVJ D;  4BL7 A;  2PGT A;  2LV3 A;  2YN1 A;  3LW9 A;  2M80 A;  1G0T A;  5CNW A;  5GAP D;  1R26 A;  5IMF A;  1O8W A;  1XVQ A;  1AQV A;  2H19 A;  1SD9 A;  1VGL A;  4MF5 A;  4ZB8 A;  4QL9 A;  5AIS A;  4IS0 A;  2XC2 A;  1AUC A;  2WB9 A;  4MF6 A;  4IKH A;  4N0V A;  3W8S A;  5KN0 A;  4XCS A;  2H30 A;  5KN3 A;  2E7P A;  2OE0 A;  4N30 A;  3FK8 A;  2C80 A;  2Z9S A;  3HY2 A;  2E2M A;  4PUF C;  5ECS A;  4CY8 A;  4CDO A;  1X5E A;  2GZP A;  1SL1 B;  1LJR A;  3ZYW A;  3F6F A;  2L4Q A;  4Q5N A;  4DSS B;  1UA5 A;  1FAA A;  1M2D A;  4V1A p;  3O76 A;  2FWH A;  1XWK A;  3NIV A;  3VLN A;  2K8V A;  4PNF A;  1XWC A;  1VRS D;  1DBY A;  4EIP A;  3CSJ A;  4I6X A;  4MH3 A;  2IN3 A;  1EOH A;  4GLT A;  1S3A A;  1WWJ A;  5JCW A;  5HR1 A;  2A2P A;  6GSS A;  3L9S A;  1TRW A;  4MJB A;  2E0Q A;  1YQ1 A;  1X5C A;  2FLS A;  1A24 A;  1T8E B;  2YZU A;  2L5O A;  3ERF A;  3LQ7 A;  2HRF A;  4PUA A;  1HNC A;  3EE2 A;  2WJU A;  3UBL A;  1PQN A;  1QMV A;  2WS2 A;  3GH9 A;  1QGV A;  5IMC A;  2CAI A;  3FRC A;  3O6T A;  1MDJ A;  4TXV A;  2DIY A;  2IIY A;  2DBC A;  1SU9 A;  3ME7 A;  3HJM A;  1PD2 1;  2HSH A;  1W89 A;  3LGC A;  4TRX A;  1OC9 A;  3EMP A;  2GST A;  3UVT A;  1ZZY A;  5ELA A;  3FMW A;  2L6D A;  3DVX A;  2LTK A;  4HQZ A;  3Q6O A;  5G5F A;  2C1Y A;  2KHP A;  4TN8 A;  4EC0 A;  3GX0 A;  5D9V A;  1RW1 A;  11GS A;  2NDO A;  3A5W A;  5IOW A;  2YP6 A;  2MMA A;  4K7O A;  1Z3E A;  2K18 A;  3FR9 A;  3H93 A;  2L5L A;  2PU9 C;  2DJ3 A;  2P5R A;  4LMW A;  1F9M A;  3W8J A;  2X99 A;  2H01 A;  5IM9 A;  1PX7 A;  1M7T A;  2CX3 A;  2YV9 A;  3CBU A;  4KCE A;  1X9W B;  4TOP A;  1KNG A;  2PWJ A;  5IMA A;  2YPM A;  4I97 A;  2R0G A;  3HVS A;  4AJ6 A;  2GT5 A;  1GUM A;  2MMN A;  4NHW A;  3TRP A;  2BJX A;  1EV4 A;  2YWI A;  5G1L A;  2OBK A;  4PNG A;  2LJK A;  3VPT A;  4KAE A;  5G1K A;  1T00 A;  1PKZ A;  2GGT A;  2TIR A;  1Q4J A;  4TR1 B;  1K0C A;  1MTC A;  4GSS A;  4JBB A;  5JCU A;  2CAQ A;  2I3Y A;  1O85 A;  2PPT A;  1XPV A;  2RII A;  4K6X A;  2VCQ A;  2V41 A;  3A3T A;  4TKY A;  6GST A;  1MD3 A;  5IIZ A;  3BJ5 A;  4N10 A;  5DAL B;  3H4K A;  18GS A;  4YAP A;  2MBS A;  4OWY A;  2HYX A;  2WCI A;  4NV2 A;  5D8I A;  3FEU A;  1ZYQ B;  5ECL B;  1PN0 A;  2DKH A;  2HZF A;  1EZK A;  1TK8 B;  1GWC A;  1B4P A;  1GLQ A;  7GSS A;  1I5G A;  4JED A;  4BVX B;  5HR3 A;  3G7J A;  2CQ9 A;  2GT6 A;  3DRN A;  3GIX A;  3KZQ A;  5D9W A;  5ECI B;  1X5D A;  1BQ7 A;  4ECJ A;  4MLY A;  3GL5 A;  4USS A;  4TR3 A;  4MJA A;  1K0D A;  2VCW A;  1N8J A;  1ERT A;  3KH7 A;  1VF4 A;  1YJ6 A;  5A4V A;  2WFC A;  4KDY A;  4L8E A;  2JZS A;  4TXO B;  4GWR A;  2QGV A;  1R5P A;  1TK5 B;  5IQY A;  3WT2 A;  4XS1 A;  1DE2 A;  1YKA A;  4D73 B;  3L4N A;  1ERU A;  2IWT A;  2GSS A;  3BCK A;  1O6J A;  2VUP A;  4GQC A;  5COH A;  3IK9 A;  2X64 A;  3ZMK A;  3G9B A;  3GFK A;  2CT6 A;  1V9W A;  4L0U A;  1PL1 A;  3KM6 A;  4KE3 A;  2H66 A;  3VI5 A;  1BX9 A;  2LJR A;  3L0H A;  3PGT A;  1X0R A;  4XHM A;  4BWS A;  2L6C A;  2H76 A;  1DSB A;  5ECH B;  1NW2 A;  2CVK A;  4I8B A;  4ZL9 A;  4GST A;  4KH7 A;  2KOK A;  2LRN A;  5C00 A;  3RBT A;  4PX1 A;  3MYD A;  1F37 A;  3IC8 A;  5A4W A;  5IMZ A;  3ZML A;  1SKR B;  1IYH A;  1HQO A;  2EIO A;  1SKS B;  2KP2 A;  3Q18 A;  3HZ8 A;  3TKS C;  4CW9 A;  4ML6 A;  2JZR A;  3GKN A;  2QA2 A;  1GSY A;  2PBJ A;  3D22 A;  2H75 A;  2H1B A;  2C8U A;  2GSQ A;  3M0F A;  2L59 A;  2N5B A;  1NHY A;  4NAX A;  2VL3 A;  6GSU A;  3HJO A;  1MEK A;  2OA7 A;  3IAM 2;  4K9Z A;  4J57 E;  3DVW A;  2I9H A;  4ACS A;  2VL9 A;  3P8W A;  2ZNM A;  1JZO A;  3F8U A;  5G2Z A;  5AN1 A;  2RUE A;  3UAP A;  2DC5 A;  5DVB A;  1OE7 A;  4E8H A;  1K3O A;  5HFK A;  2HRA A;  1THX A;  4TR0 A;  5CP1 A;  5F06 A;  3P2A A;  3DKS A;  3IRA A;  3KXO A;  2GDR A;  1PRX A;  3GX8 A;  2LQQ A;  2RUF A;  3UIW A;  2VLV A;  2AB6 A;  1VF3 A;  4K1F A;  6GSW A;  2X8H A;  4WF4 A;  2ALB A;  1WOU A;  2BMX A;  3EWL A;  1I9D A;  2MYG A;  1XW6 A;  3BCI A;  1BG5 A;  2IMD A;  4FYC A;  3CRU A;  3ZIT A;  2GTU A;  3EMX A;  3K8N A;  3H79 A;  1PX6 A;  3QCP A;  5BRT A;  3QFB C;  2FA4 A;  5B6M A;  1Z7R A;  4POM A;  5HR2 A;  3F63 A;  1OC3 A;  5KEJ A;  4ML1 A;  3CRT A;  4RQR A;  1O8X A;  1EGO A;  5GZZ B;  1Z5Y E;  3TB2 A;  4K7N A;  1FG4 A;  1A23 A;  2WUL A;  3VWU A;  4DSS A;  2DJ2 A;  1J9B A;  4PGT A;  3LXZ A;  4KX4 A;  1GSQ A;  3ZZX A;  2HLS A;  4MDC A;  4G2E A;  1HD2 A;  2YZH A;  1ERW A;  5JWO B;  3MSZ A;  4MK3 A;  5J3R A;  1TDI A;  1T4Z A;  2I81 A;  2R37 A;  4MF7 A;  1GL8 A;  1JFU A;  2FHE A;  4NPB A;  5DBQ A;  1XW9 A;  1AQX A;  2R0P A;  3DD3 A;  2B6M A;  4RUV A;  3VWV A;  2MBT A;  2CV4 A;  2E2G A;  2ON7 A;  2LRC A;  3VFI A;  3Q74 A;  3VK9 A;  4ZBA A;  2EC4 A;  3EPT A;  2YWN A;  3TKQ A;  5B8A A;  4IVF A;  3IXR A;  4HI7 A;  1OC8 A;  1SL0 B;  5CRH A;  3IOS A;  5F0G A;  2DIZ A;  1WIK A;  4K5R A;  3M9K A;  1T4Y A;  3VUR A;  3GTU B;  1Z6M A;  4IEL A;  4ICY A;  3KGK A;  4ILF A;  1CQG A;  1M9B A;  2GLR A;  5CRW A;  2HE3 A;  3WYW A;  4ZL7 A;  2HXK A;  3HDC A;  5B7C A;  1M2B A;  2LNT A;  2J23 A;  4EDY A;  2OE1 A;  2ZUP A;  1U87 A;  1FOV A;  3PIN A;  1NSW A;  5H5R A;  3I6A A;  3Q19 A;  4X43 A;  2HNL A;  2JAD A;  1WE0 A;  4NHZ A;  1JZD A;  1XWG A;  3IR4 A;  1THO A;  4JZQ A;  5CYY A;  1EP7 A;  3WGD A;  5E4W A;  1R7H A;  1GUH A;  1G7E A;  3GHA A;  1GNW A;  3CYN A;  1QUW A;  4ZL8 A;  4DSR A;  1HNA A;  4IW9 A;  2LST A;  5D96 A;  2O89 A;  2VLT A;  2YCD A;  2JSY A;  3F9U A;  1FHE A;  3HVX A;  4NV5 A;  1A8L A;  3IHQ A;  5CRE A;  5KOW A;  2O87 A;  3TGZ A;  4LL4 B;  1YY7 A;  4EE0 A;  4KSM A;  4L5L A;  4J56 E;  2VD0 A;  5CAX A;  3L9V A;  3RDW A;  4TR1 A;  4YAV A;  5G30 A;  3L78 A;  1E6B A;  2LUS A;  5EVO A;  1SYR A;  3UOM A;  2DJ1 A;  2CA8 A;  3LYP A;  3FZ9 A;  2OBI A;  4LA1 A;  1HNB A;  1ST9 A;  2YNX A;  5HFG A;  3RHB A;  3HA9 A;  3M1G A;  4OO5 A;  5EPF A;  1A8Y A;  2YOI A;  2LNS A;  3DEX A;  5CO3 A;  3WGX A;  3UJ1 A;  3QAG A;  2B3S A;  3PPU A;  5DAL A;  4BVY B;  2CVD A;  4KND A;  4KB3 A;  1JZR A;  2H74 A;  1EV9 A;  2MZC A;  4Z2R A;  2IJY A;  1F2E A;  5IPG A;  4O5U A;  1ZYE A;  3DXB A;  3EIN A;  2VL2 C;  1XFL A;  5ECK B;  2X4A A;  1NHO A;  3GL3 A;  1H4O A;  2FWG A;  4GTU A;  3LG6 A;  2V1M A;  4O32 A;  1DUG A;  3RPP A;  4BVX A;  1A0R P;  3TKP A;  1K0M A;  1YF0 A;  3A2W A;  2XHF A;  1CQH A;  5BMU A;  1S3D A;  1XZO A;  4Q5R A;  5LNK e;  2F9S A;  2DML A;  3ZIV A;  13GS A;  1MD4 A;  3VI7 A;  2FY6 A;  1JZW A;  2H1D A;  1TW9 A;  4K7I A;  2ZCT A;  4TW5 A;  2VIM A;  5KN2 A;  3M8N A;  4EIQ A;  4EUY A;  3UEM A;  3GNJ A;  4TXO A;  1TRU A;  4KGI A;  19GS A;  2O7K A;  3ZRD A;  5ECO B;  4WBR D;  1SJ6 A;  1GTU A;  1SJI A;  3KJY A;  4G0K A;  3P7X A;  3ZIJ A;  2H6X A;  4D73 A;  2IFQ B;  4TVE A;  2O8V B;  3DML A;  1YEP A;  1JLV A;  2P0G A;  1ABA A;  2WZ9 A;  1B9Y C;  1FVJ A;  5F8B A;  2JU5 A;  2VOC A;  3KD0 A;  2DJK A;  5ID2 B;  4G19 A;  1XOB A;  3IBH A;  3APO A;  1ZGN A;  3LXT A;  3DIE A;  3FZ5 A;  4EVM A;  4XS6 A;  1EWX A;  3N5O A;  4ECC A;  1GUL A;  1G7O A;  5AIX A;  4Z7X A;  2NBS A;  3PR8 A;  5FWG A;  4FO5 A;  4TR4 A;  5A5K A;  4YKF A;  2R4V A;  3E3E A;  2X8C A;  4PQ1 A;  3MDK A;  4O7H A;  1TU7 A;  1M0U A;  2DSA A;  3C8E A;  4H86 A;  3GV1 A;  1PA3 A;  3KTL A;  3FKF A;  1DE1 A;  6GSX A;  5E59 A;  4PTS A;  1V98 A;  4G9H A;  2R2J A;  4IP1 A;  1RK4 A;  4OFM A;  5DJL A;  1AXD A;  1W4V A;  3ZL5 A;  3TUE A;  4FQU A;  4DVC A;  3U5R E;  4RI6 A;  4HS1 A;  3CSI A;  2HFD A;  3JCM L;  2VD1 A;  4GF0 A;  4F2I A;  4K2D A;  2AHE A;  3IAS 2;  4POK A;  2QA1 A;  3LEF A;  4HZ2 A;  1BED A;  1SK2 A;  2FUG 2;  2H8L A;  4F0C A;  5G5E A;  2M46 A;  4POB A;  4F82 A;  4JR6 A;  5J9C A;  3FYG A;  4J2F A;  5JCG A;  2D2Z A;  4XRD A;  3EUR A;  2H72 A;  4FH8 A;  1PL2 A;  4WKW A;  2A2R A;  2REM A;  2YAN A;  2R0C A;  2LRT A;  5D9T A;  2PMT A;  3WT1 A;  2LKU A;  3APQ A;  4MPG A;  3R3E A;  4G10 A;  20GS A;  2YJH A;  1O81 A;  1G6Y A;  2LEG A;  3GMF A;  2N5A A;  1TTZ A;  3TKR A;  2XBQ A;  4FYU A;  4X4J A;  1Y25 A;  2JSZ A;  4EL1 A;  3G7Y A;  3C71 A;  4IBP A;  4ECB A;  2PUK C;  3I43 A;  5DQS A;  2V32 A;  4I2T A;  4PUR A;  4K5S A;  1XBS A;  1SD8 A;  3A2X A;  2GQK A;  4O5Q A;  3EVI A;  3ZFL A;  4ZB9 A;  1TJD A;  2K8S A;  2EIR A;  3GRX A;  4HU7 A;  4NWY A;  3MNG A;  4FYB A;  3UAR A;  3LJR A;  4EDZ A;  2QKE A;  1V58 A;  1S3C A;  2P31 A;  1U6T A;  1J0F A;  2O85 A;  4EKZ A;  2C0G A;  1J08 A;  1BAY A;  5AGY A;  2HRN A;  1GLP A;  2DKI A;  2B7K A;  3HYP A;  4OCF A;  1XCC A;  4XS4 B;  3QAW A;  5J9B A;  4WEY A;  4G0L A;  2VAF A;  4ZIL A;  2F8F A;  4MJC A;  1FW1 A;  4N0Z A;  3IE3 A;  3MWH A;  1Z7P A;  2RLI A;  1UN2 A;  2JZT A;  2IMI A;  3FZA A;  4MP4 A;  1SKW B;  1Y6E A;  3GTU A;  2ES7 A;  4AF2 A;  1VF1 A;  5D73 A;  2HRK A;  1B8X A;  3ZLP A;  2GVP A;  5DCG A;  1AQW A;  3F4T A;  3HVV A;  2K6V A;  4F0B A;  5EL8 A;  1O73 A;  1ON4 A;  1FVK A;  1JHB A;  4CHS A;  5D9X A;  5H5Q A;  3E9J B;  1HYU A;  3APS A;  5INY A;  3H1N A;  3ISO A;  1O7U A;  4OFT A;  1GSU A;  3O3T A;  2CX4 A;  3GKX A;  2RM5 A;  3IDV A;  2IPA A;  2X49 A;  1R4W A;  2DJ0 A;  3F0I A;  2AV4 A;  1VF2 A;  4KUN A;  3CTF A;  1XVW A;  2JAC A;  4KW6 A;  3HHV A;  4OO4 A;  3C7M A;  1QK8 A;  4YQV A;  6GSY A;  1ERV A;  2WRT A;  5ECQ B;  1TP9 A;  3KH9 A;  3BBY A;  2RM6 A;  3SWL A;  1PN9 A;  3F3R A;  4HJM A;  2R6K A;  5IMV A;  1GRX A;  2VLU A;  1PKW A;  4IHU A;  3R2Q A;  3PH9 A;  1V57 A;  1K3L A;  1OKT A;  3KP8 A;  3V1W A;  1GP1 A;  4KF9 A;  2TRX A;  3GN3 A;  3A5I A;  4X1U A;  4L5O A;  2B5Y A;  5B8B A;  2V2G A;  2OKA A;  3G7I A;  3QPM A;  1SK1 A;  3GKK A;  4MZW A;  2AAW A;  2VM2 A;  1K0B A;  3US3 A;  5F05 A;  3VWW A;  3KMO A;  3HCZ A;  2L4C A;  1ZYP A;  4YKG A;  4JRR A;  5AIV A;  2I1U A;  4AJ8 A;  4BVY A;  3FW2 A;  3GUS A;  2MMZ A;  4ID0 A;  2FD3 A;  4IP6 A;  5A4U A;  4BWQ A;  3TOU A;  2BTO T;  1M2A A;  3NOF A;  1GSF A;  1XWA A;  5GAN D;  4PQH A;  1ZMA A;  3TDG A;  4KDX A;  4MZB A;  2X8G A;  1XWB A;  1UVZ A;  2H6Y A;  3M9J A;  12GS A;  4OFN A;  1GNE A;  5GSS A;  3A2V A;  5JWR B;  3U6V A;  2FA8 A;  4NMU A;  3UBK A;  2MMO A;  5FT3 A;  3J7Y k;  4MH2 A;  4O92 A;  2A4H A;  2J9H A;  6GSV A;  1USB A;  4Q5Q A;  3UMA A;  1Z6N A;  1G6W A;  5IPH A;  5KOX A;  4EO3 A;  1X9M B;  4Z2T A;  3C1R A;  3TOT A;  2R5G A;  4MZC A;  4MAB A;  4GCI A;  3QOU A;  5L71 A;  1Z9H A;  2FCH A;  1U88 A;  1ZYN A;  2IFQ A;  5DAK B;  4A5P A;  1LBK A;  2H1G A;  4KDU A;  2GQM A;  2DLX A;  4QQ7 A;  5ID2 A;  5J4U A;  5ABR A;  2PER A;  1M9A A;  4RI7 A;  2GQL A;  1R5A A;  3KCM A;  1WPI A;  4HZ4 A;  4GSN A;  4HDE A;  2C0D A;  3RPN A;  2GS3 A;  3L9U A;  2HZE B;  4HQS A;  3KTB A;  2F8A A;  3HZ4 A;  4E8E A;  5CRD A;  1X9S B;  1KEB A;  4O5R A;  1GUK A;  3D21 A;  1QXH A;  1F3B A;  4HUA A;  2NPB A;  1TU8 A;  4OD7 A;  3ZVJ A;  1TK0 B;  5F07 A;  1YZX A;  3FHK A;  3I69 A;  4LLR A;  1YKC A;  1N2A A;  4K2X A;  2A2S A;  2KLX A;  4BL7 B;  1ZL9 A;  2NTO A;  3ED3 A;  3AY8 A;  3HXS A;  3IPZ A;  1WMJ A;  1BJX A;  4JE1 A;  1SYX A;  4MA9 A;  2H71 A;  1GSS A;  1A2M A;  1TXX A;  4YQU A;  2F3M A;  2KP1 A;  3HKR A;  1MDK A;  4IN0 A;  4IQ1 A;  1AC1 A;  3TJB A;  1B9X C;  2OJL A;  3GKM A;  3S9F A;  17GS A;  4MNN A;  3CMI A;  3NZN A;  4G0I A;  3TRX A;  1E2Y A;  3WGE A;  1TI3 A;  2H0G A;  5ECN B;  1IYI A;  2EIQ A;  2CVB A;  1FB6 A;  5GST A;  3P90 A;  4CY6 A;  1WP0 A;  1XOA A;  3HD5 A;  3LOR A;  4V2N A;  1YF1 A;  2C0F A;  1GTB A;  2XBI A;  1SL2 B;  1T3B A;  2H6Z A;  4AGS A;  4DEJ A;  3C73 A;  1EGR A;  4MPF A;  3GST A;  2PVQ A;  2L57 A;  5LCZ A;  2VCX A;  1K0A A;  3UVH A;  4LMV A;  4V2M A;  3IK7 A;  2FNO A;  1XW5 A;  4OMV A;  3ERG A;  4IJ3 A;  4Q5F A;  3GSS A;  5DJM A;  2P5Q A;  1GTI A;  4RQX A;  2VL2 A;  1QFN A;  3KEB A;  3LWA A;  2R3X A;  5IO2 A;  2KUC A;  2QC7 A;  3D0Z A;  2VCV A;  2IMF A;  3ZFB A;  4P3Y B;  4YQM A;  3F4S A;  1XIY A;  2OE3 A;  3IC4 A;  4HOJ A;  3J7Y b;  5HR0 A;  2YWO A;  3VWX A;  4AJ7 A;  2UZ8 A;  1TI1 A;  4ISD A;  1OKD A;  1M99 A;  4EF0 A;  4OCE A;  3EU3 A;  2WGR A;  3QAV A;  3KP9 A;  1OC9 B;  3MIX A;  4WR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...