2M80A

Solution structure of yeast dithiol glutaredoxin grx8
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
109
structure length
109
Chain Sequence
MSAFVTKAEEMIKSHPYFQLSASWCPDCVYANSIWNKLNVQDKVFVFDIGSLPRNEQEKWRIAFQKVVGSRNLPTIVVNGKFWGTESQLHRFEAKGTLEEELTKIGLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaredoxin-8
publication title Structure-guided activity enhancement and catalytic mechanism of yeast grx8
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 24
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2m80A00
1OC9A 2X8HA 3GMFA 3KIJA 4MZCA 1YKAA 5L71A 3GYKA 4ZL8A 1OVNA 2H76A 2O7KA 4EC0A 1T00A 1BX9A 5CRWA 1AIUA 6GSSA 1KNGA 4MH2A 1Z7PA 3W8SA 2PGTA 4YQVA 1K3YA 2FCHA 1YY7A 4N30A 1SKRB 2F8FA 2VCZA 3DGQA 1ILOA 4TR4A 4HQSA 1TI1A 1UVZA 3UAPA 5HR2A 2GZZA 1FO5A 2GQLA 1J9BA 3HA9A 5IMFA 3F4SA 3KCMA 1X9WB 4J57E 3GV1A 1VF3A 3EU3A 3LYPA 3IAM2 3DEXA 5CO3A 5ECLB 3V1WA 4WF5A 4LA1A 5ELAA 2XC2A 2ZCTA 1A23A 1QGVA 1GLPA 2C3QA 3U6VA 4L0UA 4XS6A 3ZVJD 1GULA 1U88A 1MDJA 4LMWA 2I4AA 3F4TA 4H86A 4OO4A 3HVXA 3UVTA 2ON7A 3EINA 3GTUB 4IGJA 1WMJA 4KSOA 2WGRA 1GWCA 1U3IA 4K6XA 3VK9A 4DSRA 1B9XC 8GSSA 4IKHA 2C0EA 3KM6A 4PNGA 2YOIA 3HCZA 2YCDA 2CX4A 5AIVA 3QFAC 3WGDA 2GSSA 2AHEA 4TR1A 4TW5A 3GKNA 4BPYA 5D8IA 3PH9A 2M46A 2V6OA 4KDXA 3UJ1A 1G0TA 2VCQA 5DDLA 4EDYA 3A2XA 2K8VA 4I2TA 3ZMKA 1U87A 2REMA 3RHCA 1WPIA 1VF1A 7GSSA 4HEA2 3ME7A 3IC4A 2B5EA 1HYUA 4XCSA 3OR5A 3I43A 4WF4A 1AQVA 4MF5A 2RUEA 2VCWA 1T8EB 4CW9A 4TRXA 4WKWA 1E6BA 4BL7A 5KN2A 3QFBC 2KHPA 3O3TA 4OD7A 3RHBA 3RDWA 1R5AA 1A2LA 2CZ2A 1K3LA 4IQ1A 2BTOT 1K0AA 1PD21 2GQMA 5HR1A 2VCVA 2MMOA 1ZMAA 2MBSA 4OFMA 2LTKA 5D73A 3QDNA 2G2QA 3C1SA 3D21A 1WE0A 4MJCA 4EE0A 5LD0A 2A2SA 2X99A 2CV4A 1ACVA 3TKSE 3N5OA 2EIOA 5FT3A 1XW5A 9GSSA 2D2ZA 4WEYA 3L4NA 2DLXA 2LNSA 1I5GA 1HNAA 2J9HA 2H01A 4GQFA 2HSHA 3GUSA 1JHBA 3FR6A 1XPVA 4MLYA 1SJIA 2H6YA 3L9VA 1TRSA 2X8GA 2XHFA 4YH2A 2LJAA 3W8JA 2H6ZA 5E4WA 4EDZA 5IO2A 4RI7A 2CA8A 2L5LA 5A4UA 4BVXA 3H8QA 2DMLA 1XZOA 3U5RE 1PKWA 4HUAA 4ZILA 3PINA 4PUFC 4PNFA 1MDKA 1QMVA 2CVDA 3TRPA 3RAZA 4MPFA 1S3CA 2C8UA 4NPBA 5D9VA 1HNCA 3VPQA 2HSYA 4YQUA 1YZXA 2GQKA 3BCKA 6GSXA 1ZCPA 1TXXA 2JSYA 1U6TA 4FYCA 4FO5A 4MPGA 3FYGA 1FB0A 20GSA 2FUG2 1GSSA 4D73A 2MMAA 2VL3A 4ZBBA 5B6MA 3GN3A 19GSA 4RI6A 4XTSA 3ZZXA 1AC1A 2E7PA 5DQYA 1SYXA 2H8LA 4F2IA 2F9SA 3ZYWA 2C0GA 5ABRA 2YPMA 4MABA 3A2VA 5IMZA 1ERWA 2OE1A 2V2GA 3EURA 3ZREA 2YJHA 3P2AA 4MP4A 3G7JA 3VI5A 3FRCA 1TI3A 4L8EA 5CAXA 1Q4JA 2FWGA 1PMTA 2YN1A 3A3TA 3QPMA 4IW9A 1E2YA 1UC7A 2A2RA 5FWGA 3IA1A 2OE3A 4F03A 4J56E 1ON4A 5GSSA 4N0VA 4WR5A 4Q5RA 3QD9A 1YF0A 5F0GA 4I2UA 3US3A 3DYRA 4KNDA 1T3BA 2H1AA 2H1BA 4HZ2A 4EL1A 5E59A 2AV4A 1ZZYA 4ZL7A 2CQ9A 1SL1B 4EUYA 5ECOB 3APSA 2B5YA 4I97A 2PVQA 3HY2A 5EVOA 3C8EA 5IIZA 3HD5A 5HFIA 2H74A 5J4UA 2VAFA 4DVCA 3APOA 4IQAA 3VI7A 4OFNA 2NVLA 5DQSA 2PUKC 3E3EA 1TK8B 3UBLA 4GLTA 3GSTA 4PURA 4F82A 4KCAA 5LCZA 3J7Yk 1TRUA 2IJYA 2JACA 4QL9A 1I9DA 3UL3A 4JR4A 5F05A 3FZ5A 6GSWA 1XWBA 2ZNMA 2CT6A 5G5EA 1SENA 2A4VA 3C7MA 1HNBA 3UVHA 3LEFA 3WT1A 4AGSA 3WD6A 2GT6A 1OE8A 1YEXA 2PVOC 4D73B 4X0XA 5HFGA 1Z6NA 2P0GA 3A5WA 3M0FA 1VF4A 3MDKA 1O73A 3ZIVA 1JZOA 5IMCA 2YP6A 4IP1A 3ZMLA 2HRFA 1KTEA 2VLTA 3GTUA 1X5EA 3LORA 4POLA 4MA9A 3TKSA 4RQRA 2CX3A 2NTOA 2KOKA 1K0DA 1URMA 2VL2A 4AF2A 4ZBDA 2FGXA 5C04A 2FWHA 3QMXA 1GP1A 1XWCA 4F0BA 2H19A 4YAPA 2YWNA 1TP9A 4KH7A 2KP2A 2YZHA 2LRTA 4KSMA 4MF6A 2YZUA 1EGOA 1V2AA 5D9XA 2WJUA 1QK8A 2YV9A 2IMKA 4ZL9A 3DIEA 4XS1A 2ALBA 2M80A 2VM1A 5ECHB 2CZ3A 4EVMA 2JL4A 1GTBA 2PERA 4WBRD 4ECJA 1XVWA 4GF0A 2DJ1A 1AQWA 1SK0A 3VURA 4FIWA 1AW9A 4DSQA 2E2MA 1GSUA 3D5JA 2M72A 4AJ7A 4ISDA 2QKEA 1PA3A 4V1Ag 4X1UA 1DBYA 4MCUA 2WCIA 5G31A 1M99A 2DBCA 2DMMA 4EF0A 3GH9A 1XWKA 4WBJA 3QR6A 1SK1A 2GT5A 3Q19A 4FYBA 4LL1B 3TJGA 4POKA 4J2FA 1X5DA 1V40A 3GHAA 3CBUA 5CRDA 5DJLA 1QFNA 3I69A 2FA4A 3Q6OA 1GNWA 3QAWA 1T1VA 1EP8A 3FK8A 1O7UA 4Q5QA 4KDYA 3VPTA 4O32A 2WS2A 3TRQA 3F3QA 2HNLA 4OO5A 1FVJA 1SKWB 4HS1A 3CRTA 1UN2A 4OMVA 1CQGA 4NHWA 3EMXA 4MZWA 2I9HA 1AUCA 3O76A 2YANA 4V1Ap 3NZNA 3DD3A 4TKYA 1FHEA 3HJOA 3M8NA 1WP0A 1O8WA 2VCTA 1O81A 2XBIA 2H73A 5LNKe 1EP7A 1X0RA 2E2GA 1JZRA 2HZEB 2MMNA 1TJDA 4ECIA 2LQOA 3N9JA 3KH9A 1PRXA 3G7YA 2WDUA 6GSVA 2YWIA 3PGTA 3F8UA 3GKKA 17GSA 5D9TA 5DBQA 3MNGA 1H75A 4O5RA 5KN0A 2RUFA 1Y6EA 1WWJA 2OKAA 1S3DA 4PXOA 2WFCA 1XOBA 3F0IA 4MZBA 5ECPB 3UARA 3GNJA 1XIYA 3F63A 5D9WA 5J41A 3IK9A 5GAPD 3UMAA 1ERUA 2FWEA 2H1DA 1XW6A 1NHOA 2PWJA 3GH6A 4P3YB 5ECQB 1PGTA 2IMIA 1MTCA 3VWUA 2GTUA 1G6WA 3HVVA 5EPFA 4K1FA 2LV3A 1XFLA 2B6MA 1WRYA 1GTUA 2B7KA 3HKRA 3PR8A 4LLRA 2LQQA 1QQ2A 2NPBA 4K2DA 4HDEA 2YV7A 3G9BA 3KD0A 4IP6A 1THOA 3TOUA 1YEPA 3M9KA 2CVBA 2WRTA 2OBIA 5DAKB 1SD8A 1H4OA 4K7NA 4RQXA 4NHZA 3LFLA 4GTUA 1DSBA 1F37A 1THXA 3DMLA 2B1LA 3LYKA 4MJEA 3EC3A 4GCIA 5FHIA 1VF2A 1B4PA 4Q5FA 3E0UA 1X5CA 4NWYA 3FHKA 1C72A 4NV2A 2PPTA 1GUKA 5CREA 1GUHA 2H1GA 3GRXA 2F3MA 3IPZA 3GKXA 4Z7XA 4QL7A 2MBTA 1OC8A 3DVXA 2C1YA 2P5RA 4ACSA 1Z9HA 5H5QA 1LBKA 4L5OA 2QGVA 4TXVA 2DC5A 22GSA 3P8WA 2J23A 1OKTA 11GSA 5CP1A 3TDGA 2KP1A 2DJJA 3GSSA 3APQA 1K0CA 2LUSA 1ZL9A 5B8AA 3GA4A 3GX0A 4PUAA 2GGTA 2JADA 1NHYA 1TOFA 3EYTA 4IVFA 2GLRA 4MH3A 1XWAA 2IPAA 1B8XA 2FNOA 2H72A 4TXOB 3P90A 3W6GA 3L0HA 2LRNA 5JWRB 1GNEA 2VIMA 1IYHA 3D4TA 3SBCA 5GZZB 1BJXA 4ZB6A 4DSSB 3QCPA 3TJKA 3TJBA 2C3TA 14GSA 2VD0A 4G2EA 2V32A 3VWWA 5JCWA 2H0GA 1R5PA 4XS4B 2R2JA 5KEJA 4G9HA 4MMMA 5IOWA 4TOPA 2IL3A 1EGRA 2AB6A 3FEUA 3KH7A 1K3OA 1YJ6A 2YNXA 3LSZA 2H6XA 3HVSA 3KEBA 2O85A 3CRUA 3ZTLA 1FG4A 2FA8A 4K0NA 1FW1A 5ENUA 1A0RP 3GFKA 6GSUA 4OCFA 4KUNA 2OADA 3IBHA 5A4WA 2MMZA 3SWLA 4PQ1A 2DJ2A 4K0GA 1BG5A 4WXTA 4BWSA 3F6DA 3GL3A 2GSRA 1JFUA 1GTAA 2IFQB 1F3BA 4GQCA 1ERVA 3TB2A 1A2MA 3J7Yb 4GRFA 1J0FA 3TGZA 2IN3A 2LJKA 1N2AA 1EV9A 3IV4A 1A0FA 4JE1A 4I5QA 3AY8A 2GSQA 4CDOA 4XRDA 5ECIB 3L78A 4HZ4A 3O6TA 4IS0A 1GSEA 2VM2A 4IN0A 3HHVA 1TRWA 6GSYA 2GVPA 1YQ1A 4AJ6A 5C00A 3KXOA 3IDVA 2L5OA 3F3RA 2JSZA 5HR3A 2R6KA 2VLVA 2HZFA 2R37A 1B4QA 2MZCA 2L6DA 1X9MB 3M9JA 4TR3A 2H66A 3VLNA 2L6CA 4YQMA 2TIRA 1PSQA 1DE1A 5DJMA 4POMA 4BA7A 1AAZA 1KBNA 5EY6A 2RM6A 3A2WA 4ECBA 4GSTA 5CNWA 1TDIA 1QXHA 3QOUA 4POBA 3DVWA 1M2AA 5ECSA 4KW6A 2JZSA 18GSA 3LWAA 2LKUA 4PQIA 2OA7A 3D6IA 5IMAA 2I1UA 1ABAA 4NXIA 3WGXA 3FZ9A 4HU7A 5DVBA 1GRXA 4WR4A 2LEGA 1PX6A 2O87A 1TU8A 3ZRDA 2EC4A 5CRGA 5AIXA 2TRCP 2DJ0A 5AGYA 1Z6MA 3CSJA 3G7IA 4I6XA 4AJ8A 1XCCA 3ZLPA 5COHA 3LJRA 3KZQA 1F9MA 2OACA 1FAAA 4QQ7A 4N11A 3BBYA 2HZEA 3C1RA 2FY6A 1GLQA 2PN8A 5J5NA 2BMXA 3H79A 2E0QA 5J3RA 3D0ZA 3GURA 4O92A 4PX1A 2VD1A 4ID0A 5H5SA 3FY7A 5D93A 3QAGA 1R4WA 2PU9C 1K0OA 3KTBA 4OWYA 1SL2B 1EOHA 5CRHA 3HXSA 4JZQA 2F51A 2DJ3A 3M3MA 5IMVA 1WIKA 1V98A 4TR0A 1B9YC 3IE3A 2HXKA 2X8CA 4KAEA 5IPGA 2LSTA 1GSYA 3M1GA 2AAWA 4MK3A 4L0WA 3UOMA 1EOGA 3UEMA 2GDRA 1XWGA 13GSA 4ULXA 1F3AA 4OCEA 3NOFA 2P5QA 3KTLA 2C3NA 5A5KA 4N10A 2VLUA 1ZYQB 1YDKA 3VWXA 1JZWA 1BEDA 3TJJA 1EEJA 4PGTA 5DAKA 4FH8A 3H93A 4V2LA 3C73A 1A8LA 4N0ZA 3ZITA 2GS3A 4IJ3A 2GZYA 1JLVA 2R5GA 1SJZA 2VCXA 5ID2B 3TJFA 1HD2A 1Z7RA 5ECRB 5G1LA 1RQMA 5DALB 3ED3A 1XBSA 2YWOA 3FR3A 4PQHA 1A8YA 1FB6A 1ML6A 1EWXA 5B6NA 2RIIA 1ZOFA 3LG6A 3EU4A 3TOTA 4G19A 1G6YA 1Z5YE 3FZAA 4X43A 1R26A 1TK5B 2L59A 2IWTA 5AISA 1M2DA 5A4VA 4JU5A 4ZB8A 2WZ9A 5G2ZA 6GSTA 2G0FA 2H30A 1USBA 2C80A 4LL4B 3ZFLA 4GSSA 1DUGA 3VWVA 5JWOB 2P31A 2ES7A 3F6FA 5IMDA 5G5FA 1B48A 1PKZA 1GSQA 2PBJA 3CTGA 3HYPA 3F9UA 3UIWA 1EZKA 1JZDA 1TW9A 2N5BA 3WYWA 3DXBA 1G7OA 1GTIA 1V58A 4NAXA 4KGIA 2HFDA 2AYTA 1MD3A 4TXOA 4O7HA 2O89A 3MSZA 4I8BA 2RLIA 1LJRA 3E9JB 3ZVJA 4GXZA 5IPHA 2VOCA 4KB3A 2OBKA 1GH2A 5JWQB 4DSSA 5GAND 2FHEA 3D22A 4XS4A 4FYUA 1JLWA 5GSTA 3IR4A 3GIXA 1W89A 3KMOA 3R2QA 4HOJA 2OE0A 1U3AA 2KLXA 3I6AA 1PL1A 2O8VB 1GL8A 2YJ7A 3RBTA 3I9V2 3Q74A 3K8NA 2NDOA 4EO3A 4IBPA 1GUMA 1OYJA 3HZ4A 2L4QA 2HT9A 2B1KA 5ELGA 2IIYA 1T7PB 2ZUPA 2CAQA 4MJBA 1F2EA 1OC9B 4ECCA 4EXJA 2JZRA 5F06A 3FKFA 2HI7A 2NBSA 4K9ZA 1RW1A 4HU9A 4IHUA 1F6MC 1EEMA 3IK7A 5AN1A 1OC3A 2IFQA 2BJXA 4HJ2A 3UBKA 1K0MA 3EVIA 1TU7A 5KN1A 1FVKA 1TRVA 4V2NA 5H5RA 4E8HA 3KP9A 2RM5A 3L9SA 5JCGA 1XW9A 2JZTA 2N5AA 1X9SB 5IOXA 1M0UA 5IQYA 5F07A 3LGCA 1AQXA 12GSA 4XHMA 3BCIA 3IRAA 4WETA 2H70A 1NSWA 2AUVA 1O8XA 5EL8A 3ERGA 4GWRA 2MYGA 3HJMA 3Q18A 1SYRA 2KUCA 4HI7A 1XOAA 1AXDA 1XXUA 1Q98A 5IM9A 3LXZA 2XPEA 1M9BA 4F0CA 1KEBA 4KDUA 2K9FA 2AJQB 4NMUA 1UA5A 4JRRA 4DEJA 4BWQA 2LNTA 3BOAA 2I81A 4ZXGA 1OKDA 4BVYA 2H75A 5J9CA 3IXRA 1SJ6A 3FW2A 1M7TA 2GSTA 5KN3A 1PQNA 3CTFA 3P7XA 3KJYA 2VUPA 5F8BA 1K0BA 3HDCA 4JBBA 4KA0A 3H4KA 1QUWA 5CYYA 3TUEA 3D4MA 1IYIA 2HE3A 3EE2A 4TR1B 2YWMA 3CYNA 4ML6A 3KP8A 3S9FA 10GSA 2FWFA 1R7HA 4ZB9A 2V1MA 4L5LA 1DE2A 1BQ7A 5JCUA 2GZPA 3NIVA 1BAYA 3KMNA 2EIQA 4HJMA 3ERWA 1T4ZA 1GSDA 5J9BA 3WGEA 3VFIA 2CVKA 2K8SA 4TN8A 3CSHA 2IMEA 3DKSA 2X64A 1OE7A 5DCGA 5D96A 3CSIA 4LMVA 2HLSA 3RPNA 1LU4A 4ILFA 3MAKA 3IHQA 1W4VA 3CXGA 1XVQA 4IJIA 2XPDA 2C0FA 2B5XA 3TKQA 1OAZA 3KGKA 1Y25A 4MDCA 2VO4A 1WOUA 3LQ7A 2L4CA 3H1NA 4ZBAA 4KX4A 4XRAA 1ST9A 1G7EA 2WULA 3RPPA 2V41A 3QAVA 4K8MA 3HZ8A 5G1KA 1A24A 3C71A 1J08A 1HQOA 4KCEA 3F4RA 2B3SA 3BJ5A 2DIZA 1YKCA 3ME8A 3IAS2 3EMPA 1TKDB 1NW2A 2VL9A 4ZIJA 4RUVA 1SK2A 2LJRA 3IOSA 5ECMB 3TCOA 2L57A 3WT2A 2HRNA 5HR0A 2LS5A 2DSAA 3GL5A 1M2BA 5ID2A 1MEKA 5HFKA 2HYXA 5DALA 2IMDA 2OJLA 1ZGNA 4YAVA 5IO0A 2DIYA 5ECNB 4CHSA 3ZIJA 3GX8A 2PMTA 1TTZA 5G30A 5HQPA 1TK0B 1PX7A 2QSIA 2WB9A 3JCML 4XIHA 1MDIA 1V57A 3ISOA 4HQZA 1N8JA 3LXTA 3TRXA 2R3XA 4EKZA 2H71A 4NV5A 1NM3A 1V9WA 1WJKA 4K7IA 2B7JA 4IELA 1FOVA 1BYEA 4JR6A 3GKMA 16GSA 2I3YA 4TVEA 1ERTA 5DCHA 2H0IA 4V2MA 2ON5A 1SD9A 1T4YA 4OFTA 2F8AA 5B7CA 3ERFA 1A2JA 3ZFBA 2Z9SA 3TKSC 3ZL5A 2VL2C 4JEDA 1MD4A 1K0NA 1S3AA 2LRCA 1PL2A 4MJAA 2K18A 2R4VA 3HJPA 1PN9A 1M9AA 2C0DA 2CAIA 4K7OA 2TRXA 2FLSA 5INYA 3FR9A 3EWLA 1SU9A 1SKSB 1VRSD 5ECKB 2QC7A 3DWVA 4GSNA 1CQHA 4ML1A 1RK4A 1ZYEA 3L9UA 4Q5NA 2C4JA 1EV4A 1VGLA 4KE3A 3MWHA 2JU5A 2EIRA 4MF7A 3BD2A 3TKPA 1YF1A 3DRNA 1O6JA 1O85A 2K6VA 2V6KA 1GSFA 4E8EA 3CMIA 4G10A 5B8BA 1Z3EA 2XBQA 3TKRA 2DJKA 2H0HA 3FZ4A 2IMFA 2N5FA 2FD3A 1SL0B 4F9ZA
chains in the Genus database with same CATH superfamily
1OC9A 2X8HA 3GMFA 3KIJA 4MZCA 1YKAA 5L71A 3GYKA 4ZL8A 1OVNA 2H76A 2O7KA 4EC0A 1T00A 1BX9A 5CRWA 1AIUA 6GSSA 1KNGA 4MH2A 1Z7PA 3W8SA 2PGTA 4YQVA 1K3YA 2FCHA 1YY7A 4N30A 1SKRB 2F8FA 2VCZA 3DGQA 1ILOA 4TR4A 4HQSA 1TI1A 1UVZA 3UAPA 5HR2A 2X49A 2GZZA 1FO5A 2GQLA 1J9BA 3HA9A 5IMFA 3F4SA 3KCMA 1X9WB 4J57E 3GV1A 1VF3A 3EU3A 3LYPA 3IAM2 3DEXA 5CO3A 5ECLB 3V1WA 4WF5A 4LA1A 5ELAA 2XC2A 2ZCTA 1A23A 5BMUA 1QGVA 1GLPA 4HSCX 2C3QA 3U6VA 4BIKA 4L0UA 4XS6A 3ZVJD 1GULA 1U88A 1MDJA 3HVNA 4LMWA 2I4AA 3F4TA 4H86A 4OO4A 3HVXA 3UVTA 2ON7A 4Z2TA 3EINA 3GTUB 4IGJA 1WMJA 4KSOA 2WGRA 1GWCA 1U3IA 4K6XA 3VK9A 4DSRA 1FOHA 1B9XC 8GSSA 4IKHA 2C0EA 3KM6A 4PNGA 4Z2UA 2YOIA 3HCZA 2YCDA 2CX4A 5AIVA 3QFAC 3WGDA 2GSSA 2AHEA 4TR1A 4TW5A 3GKNA 2R0CA 4BPYA 5D8IA 3PH9A 2M46A 2V6OA 4KDXA 3UJ1A 1G0TA 2VCQA 5DDLA 4EDYA 3A2XA 2K8VA 4I2TA 3ZMKA 1U87A 2REMA 4KF9A 3RHCA 1WPIA 1VF1A 7GSSA 4HEA2 3ME7A 1M3IA 3IC4A 2B5EA 1HYUA 4XCSA 3OR5A 3I43A 4WF4A 1AQVA 4MF5A 2RUEA 2VCWA 1T8EB 4CW9A 4TRXA 4WKWA 1E6BA 4BL7A 5KN2A 3QFBC 2KHPA 3O3TA 4OD7A 3RHBA 3RDWA 1R5AA 1A2LA 2CZ2A 1K3LA 4IQ1A 2BTOT 1K0AA 1PD21 2GQMA 5HR1A 2VCVA 2MMOA 1ZMAA 2MBSA 4OFMA 2LTKA 5D73A 3QDNA 2G2QA 3C1SA 3D21A 1WE0A 4MJCA 4EE0A 5LD0A 2A2SA 2X99A 2CV4A 1ACVA 3TKSE 3N5OA 2EIOA 5FT3A 1XW5A 9GSSA 2D2ZA 4WEYA 3L4NA 2DLXA 2LNSA 1I5GA 1HNAA 2J9HA 2H01A 4GQFA 2HSHA 3GUSA 1JHBA 3FR6A 1XPVA 4MLYA 1SJIA 2H6YA 3L9VA 1TRSA 2X8GA 2XHFA 4YH2A 2LJAA 3W8JA 2H6ZA 5E4WA 3CQFA 4EDZA 5IO2A 4RI7A 2CA8A 2L5LA 5A4UA 4BVXA 3H8QA 2DMLA 1XZOA 3U5RE 1PKWA 4HUAA 4ZILA 3PINA 4PUFC 4PNFA 1MDKA 1QMVA 2CVDA 3TRPA 3RAZA 4MPFA 1S3CA 2C8UA 4NPBA 5D9VA 1HNCA 3VPQA 2HSYA 4YQUA 1YZXA 2GQKA 3BCKA 6GSXA 1ZCPA 1TXXA 2JSYA 1U6TA 4FYCA 4FO5A 4MPGA 3FYGA 1FB0A 20GSA 2FUG2 1GSSA 1S3RA 4D73A 2MMAA 2VL3A 4ZBBA 5B6MA 3GN3A 19GSA 3MIXA 4YKFA 4RI6A 4XTSA 4CY6A 3ZZXA 1AC1A 2E7PA 5DQYA 1SYXA 2H8LA 4F2IA 2F9SA 3ZYWA 2C0GA 5ABRA 2R0PA 2YPMA 4MABA 3A2VA 5IMZA 1ERWA 2OE1A 2V2GA 3EURA 3ZREA 2YJHA 3P2AA 4MP4A 2HRKA 3G7JA 3VI5A 3FRCA 1TI3A 4L8EA 3A5IA 5CAXA 1Q4JA 2FWGA 1PMTA 2YN1A 3A3TA 3QPMA 4IW9A 1E2YA 1UC7A 2A2RA 5FWGA 3IA1A 2OE3A 2QA1A 4F03A 4J56E 1ON4A 5GSSA 2UZ8A 4N0VA 4WR5A 4Q5RA 3QD9A 1YF0A 5F0GA 4I2UA 3US3A 3DYRA 4KNDA 1T3BA 2H1AA 2H1BA 4HZ2A 4EL1A 5E59A 2AV4A 1ZZYA 4ZL7A 2CQ9A 1SL1B 4EUYA 5ECOB 3APSA 2B5YA 4I97A 2PVQA 3HY2A 5EVOA 1ZYNA 3LW9A 3C8EA 5IIZA 3HD5A 5HFIA 2H74A 5J4UA 2VAFA 4DVCA 3APOA 4IQAA 3VI7A 4OFNA 1M3JA 2NVLA 5DQSA 2PUKC 3E3EA 1TK8B 3UBLA 4GLTA 3GSTA 4PURA 4F82A 4KCAA 5LCZA 3J7Yk 1TRUA 2IJYA 2JACA 4QL9A 1I9DA 3UL3A 4JR4A 5F05A 3FZ5A 6GSWA 1XWBA 2ZNMA 2CT6A 5G5EA 1SENA 2A4VA 3C7MA 1HNBA 3UVHA 3LEFA 3WT1A 4AGSA 3WD6A 2GT6A 1OE8A 1YEXA 2PVOC 4D73B 4X0XA 5HFGA 1Z6NA 2P0GA 3A5WA 3M0FA 1VF4A 3MDKA 1O73A 3ZIVA 1JZOA 5IMCA 2YP6A 4IP1A 3ZMLA 2HRFA 4K5RA 1KTEA 2VLTA 3GTUA 1X5EA 3LORA 4POLA 4MA9A 3TKSA 4RQRA 2CX3A 2NTOA 2KOKA 1K0DA 1URMA 2VL2A 4AF2A 4ZBDA 2FGXA 5C04A 2FWHA 3QMXA 1GP1A 1XWCA 4F0BA 2H19A 4YAPA 2YWNA 1TP9A 4KH7A 2KP2A 2YZHA 2LRTA 2DKIA 4KSMA 5KOWA 4MF6A 2YZUA 1EGOA 1V2AA 5D9XA 2WJUA 1QK8A 2YV9A 2IMKA 4ZL9A 3DIEA 4XS1A 2ALBA 2M80A 2VM1A 5ECHB 2CZ3A 4EVMA 2JL4A 1GTBA 2PERA 4WBRD 2R0GA 4ECJA 1XVWA 4GF0A 2DJ1A 1AQWA 1SK0A 3VURA 5BRTA 4FIWA 1AW9A 4DSQA 2E2MA 1GSUA 3R3EA 3D5JA 2M72A 4AJ7A 4ISDA 2QKEA 1PA3A 4V1Ag 4X1UA 1DBYA 4MCUA 2WCIA 5G31A 1M99A 2DBCA 2DMMA 4EF0A 3GH9A 1XWKA 4WBJA 3QR6A 1SK1A 2GT5A 3Q19A 4FYBA 4LL1B 3TJGA 4POKA 4J2FA 1X5DA 1V40A 3GHAA 3CBUA 5CRDA 5DJLA 1QFNA 3I69A 2FA4A 3Q6OA 1GNWA 3QAWA 1T1VA 1EP8A 3FK8A 1O7UA 4Q5QA 4KDYA 3VPTA 4O32A 2WS2A 3TRQA 3F3QA 2HNLA 4OO5A 4G0IA 1FVJA 1SKWB 4HS1A 3CRTA 1UN2A 4OMVA 1CQGA 4NHWA 3EMXA 4MZWA 2I9HA 1AUCA 3O76A 2YANA 4V1Ap 3NZNA 3DD3A 4TKYA 1FHEA 3IHGA 3HJOA 3M8NA 1WP0A 1O8WA 2VCTA 1O81A 2XBIA 2H73A 5LNKe 1EP7A 1X0RA 2E2GA 1JZRA 2HZEB 2MMNA 4YKGA 1TJDA 4ECIA 2LQOA 3N9JA 3KH9A 1PRXA 3G7YA 2WDUA 6GSVA 2YWIA 3PGTA 3F8UA 3GKKA 17GSA 5D9TA 5DBQA 3MNGA 1H75A 4O5RA 5KN0A 2RUFA 4MNNA 1Y6EA 1WWJA 2OKAA 1S3DA 4G0LA 4PXOA 2WFCA 1XOBA 3F0IA 4MZBA 2QA2A 5ECPB 3UARA 3GNJA 1XIYA 3F63A 5D9WA 5J41A 3IK9A 5GAPD 3UMAA 1ERUA 4A5PA 2FWEA 2H1DA 1XW6A 1NHOA 2PWJA 3GH6A 4P3YB 4O5QA 5ECQB 1PGTA 2IMIA 1MTCA 3VWUA 2GTUA 1G6WA 3HVVA 4K2XA 5EPFA 4K1FA 2LV3A 1XFLA 2B6MA 3FMWA 1WRYA 1GTUA 1PFOA 2B7KA 3HKRA 3PR8A 4LLRA 2LQQA 1QQ2A 2NPBA 4K2DA 4HDEA 2YV7A 3G9BA 3KD0A 4IP6A 1THOA 3TOUA 1YEPA 3M9KA 2CVBA 2WRTA 2OBIA 5DAKB 1SD8A 1H4OA 4K7NA 4RQXA 4NHZA 3LFLA 4GTUA 1DSBA 1F37A 1THXA 3DMLA 2B1LA 3LYKA 4MJEA 3EC3A 4GCIA 5FHIA 1PN0A 1VF2A 1B4PA 4Q5FA 3E0UA 1X5CA 4NWYA 3FHKA 4NV2A 1C72A 2PPTA 1GUKA 5CREA 1GUHA 2H1GA 3GRXA 2F3MA 3IPZA 3GKXA 4Z7XA 4QL7A 2MBTA 1OC8A 3DVXA 2C1YA 2P5RA 4ACSA 1Z9HA 5H5QA 1LBKA 3MYDA 4L5OA 2QGVA 4TXVA 2DC5A 22GSA 3P8WA 2J23A 1OKTA 11GSA 5CP1A 3TDGA 2KP1A 2DJJA 3GSSA 3APQA 1K0CA 2LUSA 4FQUA 1ZL9A 5B8AA 3GA4A 3GX0A 4PUAA 2GGTA 2JADA 1NHYA 1TOFA 3EYTA 4IVFA 2GLRA 4MH3A 1XWAA 2IPAA 1B8XA 2FNOA 2H72A 4TXOB 3P90A 2HRAA 3W6GA 3L0HA 2LRNA 5JWRB 4X4JA 1GNEA 2VIMA 1IYHA 3D4TA 3SBCA 5GZZB 1BJXA 4ZB6A 4DSSB 3QCPA 3TJKA 3TJBA 2C3TA 14GSA 2VD0A 4G2EA 2V32A 3VWWA 5JCWA 2H0GA 1R5PA 4XS4B 2R2JA 5KEJA 4G9HA 4MMMA 5IOWA 4TOPA 2IL3A 1EGRA 2AB6A 3FEUA 3KH7A 1K3OA 1YJ6A 2YNXA 3LSZA 2H6XA 3HVSA 3KEBA 2O85A 3CRUA 3ZTLA 1FG4A 2FA8A 4K0NA 1FW1A 5ENUA 1A0RP 3GFKA 6GSUA 4OCFA 4KUNA 2OADA 3IBHA 5A4WA 2MMZA 3SWLA 4PQ1A 2DJ2A 4K0GA 1BG5A 4WXTA 4BWSA 3F6DA 3GL3A 2GSRA 1JFUA 1GTAA 2IFQB 1F3BA 4GQCA 1ERVA 3TB2A 1A2MA 3J7Yb 4GRFA 1J0FA 1XG8A 3TGZA 2IN3A 2LJKA 1N2AA 1EV9A 3IV4A 1A0FA 4JE1A 4I5QA 3AY8A 2GSQA 4CDOA 4XRDA 5ECIB 3L78A 4HZ4A 3O6TA 4IS0A 1GSEA 2VM2A 4IN0A 3HHVA 1TRWA 6GSYA 2GVPA 1YQ1A 4AJ6A 5C00A 3KXOA 3IDVA 2L5OA 3F3RA 2JSZA 5HR3A 2R6KA 2VLVA 2HZFA 4ICYA 2R37A 1B4QA 2MZCA 2L6DA 1X9MB 3M9JA 4TR3A 2H66A 3VLNA 2L6CA 4YQMA 2TIRA 1PSQA 1DE1A 5DJMA 4POMA 4BA7A 1AAZA 1KBNA 5EY6A 2RM6A 4G0KA 3A2WA 4ECBA 4GSTA 5CNWA 1TDIA 1QXHA 4BVYB 3QOUA 4POBA 3DVWA 1M2AA 5ECSA 4KW6A 2JZSA 18GSA 3LWAA 2LKUA 4PQIA 2OA7A 3D6IA 5IMAA 2I1UA 1ABAA 4NXIA 3WGXA 3FZ9A 4HU7A 5DVBA 1GRXA 4WR4A 2LEGA 1PX6A 2O87A 1TU8A 3ZRDA 2EC4A 5CRGA 5AIXA 2TRCP 2DJ0A 5AGYA 1Z6MA 3CSJA 3G7IA 4I6XA 4AJ8A 1XCCA 3ZLPA 5COHA 3LJRA 3KZQA 1F9MA 2OACA 1FAAA 4QQ7A 4N11A 3BBYA 2HZEA 3C1RA 2FY6A 1GLQA 2PN8A 5J5NA 2BMXA 3H79A 2E0QA 5J3RA 3D0ZA 3GURA 4O92A 4PX1A 2VD1A 4ID0A 5H5SA 3FY7A 5D93A 3QAGA 1R4WA 2PU9C 1K0OA 3KTBA 4OWYA 1SL2B 1EOHA 5CRHA 3HXSA 4JZQA 2F51A 2DJ3A 3M3MA 5IMVA 1WIKA 1V98A 4TR0A 1B9YC 3IE3A 2HXKA 2X8CA 4KAEA 5IPGA 2LSTA 1GSYA 3M1GA 2AAWA 4MK3A 4L0WA 3UOMA 1EOGA 3UEMA 2GDRA 1XWGA 13GSA 4ULXA 1F3AA 4OCEA 3NOFA 2P5QA 3EPTA 3KTLA 2C3NA 5A5KA 4N10A 2VLUA 1ZYQB 1YDKA 3VWXA 1JZWA 1BEDA 3TJJA 1EEJA 4PGTA 5DAKA 4FH8A 3H93A 4V2LA 3C73A 1A8LA 4N0ZA 3ZITA 2GS3A 4IJ3A 2GZYA 1JLVA 2R5GA 1SJZA 2VCXA 5ID2B 3TJFA 1HD2A 1Z7RA 5ECRB 5G1LA 1RQMA 5DALB 3ED3A 2DKHA 1XBSA 2YWOA 3FR3A 4PQHA 1A8YA 1FB6A 1ML6A 1EWXA 5B6NA 2RIIA 1ZOFA 3LG6A 3EU4A 3TOTA 4G19A 1G6YA 1Z5YE 3FZAA 4X43A 1R26A 1TK5B 2L59A 2IWTA 5AISA 1M2DA 5A4VA 4JU5A 4ZB8A 2WZ9A 5G2ZA 6GSTA 2G0FA 2H30A 1USBA 2C80A 4LL4B 3ZFLA 4GSSA 1DUGA 3VWVA 5JWOB 2P31A 2ES7A 3F6FA 5IMDA 5G5FA 1B48A 4Z2RA 1PKZA 1GSQA 2PBJA 3CTGA 3HYPA 3F9UA 3UIWA 1EZKA 1JZDA 1TW9A 2N5BA 3WYWA 3DXBA 1G7OA 1GTIA 1V58A 4NAXA 4KGIA 2HFDA 2AYTA 1MD3A 4TXOA 4O7HA 2O89A 3MSZA 4I8BA 2RLIA 1LJRA 3IC8A 3E9JB 3ZVJA 4GXZA 5IPHA 2VOCA 4KB3A 2OBKA 1GH2A 5JWQB 4DSSA 5GAND 2FHEA 3D22A 4XS4A 4FYUA 1JLWA 5GSTA 3IR4A 3GIXA 1W89A 3KMOA 3R2QA 4HOJA 2OE0A 1U3AA 2KLXA 3I6AA 1PL1A 2O8VB 1GL8A 2YJ7A 3RBTA 3I9V2 2A4HA 3Q74A 4EIQA 3K8NA 2NDOA 4EO3A 4IBPA 2A2PA 1GUMA 1OYJA 3HZ4A 2L4QA 2HT9A 2B1KA 5ELGA 2IIYA 1T7PB 2ZUPA 4O5UA 2CAQA 4MJBA 1F2EA 1OC9B 4ECCA 4EXJA 2JZRA 5F06A 3FKFA 2HI7A 2NBSA 4K9ZA 1RW1A 4HU9A 4IHUA 1F6MC 1EEMA 3IK7A 5AN1A 1OC3A 2IFQA 2BJXA 4HJ2A 3UBKA 1K0MA 3EVIA 1TU7A 5KN1A 1FVKA 1TRVA 4V2NA 5H5RA 4E8HA 3KP9A 2RM5A 2X4AA 3L9SA 5JCGA 1XW9A 2JZTA 2N5AA 1X9SB 3PPUA 5IOXA 1M0UA 5IQYA 5F07A 3LGCA 1AQXA 12GSA 4XHMA 3BCIA 3IRAA 4WETA 2H70A 1NSWA 2AUVA 1O8XA 5EL8A 3ERGA 4GWRA 2MYGA 3HJMA 3Q18A 1SYRA 2KUCA 4HI7A 1XOAA 1AXDA 1XXUA 1Q98A 5IM9A 3LXZA 2XPEA 1M9BA 4F0CA 1KEBA 4KDUA 2K9FA 2AJQB 4NMUA 1UA5A 4JRRA 4DEJA 4BWQA 2LNTA 3BOAA 2I81A 4ZXGA 1OKDA 4BVYA 2H75A 5J9CA 3IXRA 1SJ6A 3FW2A 1M7TA 2GSTA 5KN3A 1PQNA 3CTFA 3P7XA 3KJYA 2VUPA 5F8BA 1K0BA 3HDCA 4JBBA 4KA0A 3H4KA 1QUWA 5CYYA 3TUEA 3D4MA 1IYIA 2HE3A 3EE2A 4TR1B 2YWMA 3CYNA 4ML6A 3KP8A 3S9FA 10GSA 4PTSA 2FWFA 1R7HA 4ZB9A 2V1MA 4L5LA 1DE2A 1BQ7A 5JCUA 2GZPA 3NIVA 1BAYA 3KMNA 2EIQA 4HJMA 3ERWA 1T4ZA 1GSDA 5J9BA 3WGEA 4CY8A 3VFIA 2CVKA 2K8SA 4TN8A 3CSHA 2IMEA 3DKSA 4EIPA 2X64A 1OE7A 5DCGA 4BL7B 5D96A 3CSIA 4LMVA 2HLSA 3RPNA 1LU4A 4ILFA 3MAKA 3IHQA 1W4VA 3CXGA 1XVQA 4IJIA 2XPDA 2C0FA 2B5XA 3TKQA 1OAZA 3KGKA 1Y25A 4MDCA 2VO4A 1WOUA 3LQ7A 2L4CA 3H1NA 4ZBAA 4KX4A 4XRAA 1ST9A 1G7EA 2WULA 3RPPA 2V41A 3QAVA 4K8MA 3HZ8A 5G1KA 1A24A 3C71A 1J08A 1HQOA 4KCEA 3F4RA 2B3SA 3BJ5A 2DIZA 1YKCA 3ME8A 3IAS2 3EMPA 1TKDB 1NW2A 2VL9A 4ZIJA 4RUVA 2HSMA 1SK2A 2LJRA 3IOSA 5ECMB 3TCOA 2L57A 3WT2A 2HRNA 5HR0A 2LS5A 2DSAA 3GL5A 1M2BA 5ID2A 1MEKA 5HFKA 2HYXA 5DALA 2IMDA 2OJLA 1ZGNA 4YAVA 5IO0A 2DIYA 5ECNB 4CHSA 4BVXB 3ZIJA 4USSA 3GX8A 2PMTA 1TTZA 5G30A 5HQPA 1TK0B 1PX7A 2QSIA 2WB9A 3JCML 4XIHA 1MDIA 1V57A 3ISOA 4HQZA 1N8JA 3LXTA 3TRXA 2R3XA 4EKZA 2H71A 4NV5A 1NM3A 1V9WA 1WJKA 4K7IA 2B7JA 4IELA 1FOVA 1BYEA 4JR6A 3GKMA 16GSA 2I3YA 4TVEA 1ERTA 4V2MA 2H0IA 5DCHA 2ON5A 1SD9A 1T4YA 4OFTA 2F8AA 5B7CA 3ERFA 1A2JA 3ZFBA 2Z9SA 3TKSC 3ZL5A 2VL2C 4JEDA 1MD4A 1K0NA 1S3AA 2LRCA 5KOXA 1PL2A 4MJAA 2K18A 2R4VA 3HJPA 1PN9A 1M9AA 2C0DA 2CAIA 4K7OA 2TRXA 2FLSA 5INYA 3FR9A 3EWLA 1SU9A 1SKSB 1VRSD 5ECKB 2QC7A 3DWVA 4GSNA 1CQHA 4ML1A 1RK4A 1ZYEA 3L9UA 4Q5NA 2C4JA 1EV4A 4K5SA 1VGLA 4KE3A 3MWHA 2JU5A 2EIRA 4MF7A 3BD2A 3TKPA 1YF1A 3DRNA 1O6JA 1O85A 2K6VA 2V6KA 1GSFA 4E8EA 3CMIA 4G10A 5B8BA 1Z3EA 2XBQA 3TKRA 2DJKA 2H0HA 3FZ4A 2IMFA 2N5FA 2FD3A 1ZYPA 1SL0B 4F9ZA
chains in the Genus database with same CATH topology
1OC9A 2X8HA 3GMFA 3KIJA 4MZCA 1YKAA 5L71A 3GYKA 4ZL8A 1OVNA 2H76A 2O7KA 4EC0A 1T00A 1BX9A 5CRWA 1AIUA 6GSSA 1KNGA 4MH2A 1Z7PA 3W8SA 2PGTA 4YQVA 1K3YA 2FCHA 1YY7A 4N30A 1SKRB 2F8FA 2VCZA 3DGQA 1ILOA 4TR4A 4HQSA 1TI1A 1UVZA 3UAPA 5HR2A 2X49A 2GZZA 1FO5A 2GQLA 1J9BA 3HA9A 5IMFA 3F4SA 3KCMA 1X9WB 4J57E 3GV1A 1VF3A 3EU3A 3LYPA 3IAM2 3DEXA 5CO3A 5ECLB 3V1WA 4WF5A 4LA1A 5ELAA 2XC2A 2ZCTA 1A23A 5BMUA 1QGVA 1GLPA 2C3QA 3U6VA 4L0UA 4XS6A 3ZVJD 1GULA 1U88A 1MDJA 4LMWA 2I4AA 3F4TA 4H86A 4OO4A 3HVXA 3UVTA 2ON7A 4Z2TA 3EINA 3GTUB 4IGJA 1WMJA 4KSOA 2WGRA 1GWCA 1U3IA 4K6XA 3VK9A 4DSRA 1FOHA 1B9XC 8GSSA 4IKHA 2C0EA 3KM6A 4PNGA 4Z2UA 2YOIA 3HCZA 2YCDA 2CX4A 5AIVA 3QFAC 3WGDA 2GSSA 2AHEA 4TR1A 4TW5A 3GKNA 2R0CA 4BPYA 5D8IA 3PH9A 2M46A 2V6OA 4KDXA 3UJ1A 1G0TA 2VCQA 5DDLA 4EDYA 3A2XA 2K8VA 4I2TA 3ZMKA 1U87A 2REMA 4KF9A 3RHCA 1WPIA 1VF1A 7GSSA 4HEA2 3ME7A 3IC4A 2B5EA 1HYUA 4XCSA 3OR5A 3I43A 4WF4A 1AQVA 4MF5A 2RUEA 2VCWA 1T8EB 4CW9A 4TRXA 4WKWA 1E6BA 4BL7A 5KN2A 3QFBC 2KHPA 3O3TA 4OD7A 3RHBA 3RDWA 1R5AA 1A2LA 2CZ2A 1K3LA 4IQ1A 2BTOT 1K0AA 1PD21 2GQMA 5HR1A 2VCVA 2MMOA 1ZMAA 2MBSA 4OFMA 2LTKA 5D73A 3QDNA 2G2QA 3C1SA 3D21A 1WE0A 4MJCA 4EE0A 5LD0A 2A2SA 2X99A 2CV4A 1ACVA 3TKSE 3N5OA 2EIOA 5FT3A 1XW5A 9GSSA 2D2ZA 4WEYA 3L4NA 2DLXA 2LNSA 1I5GA 1HNAA 2J9HA 2H01A 4GQFA 2HSHA 3GUSA 1JHBA 3FR6A 1XPVA 4MLYA 1SJIA 2H6YA 3L9VA 1TRSA 2X8GA 2XHFA 4YH2A 2LJAA 3W8JA 2H6ZA 5E4WA 4EDZA 5IO2A 4RI7A 2CA8A 2L5LA 5A4UA 4BVXA 3H8QA 2DMLA 1XZOA 3U5RE 1PKWA 4HUAA 4ZILA 3PINA 4PUFC 4PNFA 1MDKA 1QMVA 2CVDA 3TRPA 3RAZA 4MPFA 1S3CA 2C8UA 4NPBA 5D9VA 1HNCA 3VPQA 2HSYA 4YQUA 1YZXA 2GQKA 3BCKA 6GSXA 1ZCPA 1TXXA 2JSYA 1U6TA 4FYCA 4FO5A 4MPGA 3FYGA 1FB0A 20GSA 2FUG2 1GSSA 4D73A 2MMAA 2VL3A 4ZBBA 5B6MA 3GN3A 19GSA 3MIXA 4YKFA 4RI6A 4XTSA 4CY6A 3ZZXA 1AC1A 2E7PA 5DQYA 1SYXA 2H8LA 4F2IA 2F9SA 3ZYWA 2C0GA 5ABRA 2R0PA 2YPMA 4MABA 3A2VA 5IMZA 1ERWA 2OE1A 2V2GA 3EURA 3ZREA 2YJHA 3P2AA 4MP4A 2HRKA 3G7JA 3VI5A 3FRCA 1TI3A 4L8EA 3A5IA 5CAXA 1Q4JA 2FWGA 1PMTA 2YN1A 3A3TA 3QPMA 4IW9A 1E2YA 1UC7A 2A2RA 5FWGA 3IA1A 2OE3A 2QA1A 4F03A 4J56E 1ON4A 5GSSA 2UZ8A 4N0VA 4WR5A 4Q5RA 3QD9A 1YF0A 5F0GA 4I2UA 3US3A 3DYRA 4KNDA 1T3BA 2H1AA 2H1BA 4HZ2A 4EL1A 5E59A 2AV4A 1ZZYA 4ZL7A 2CQ9A 1SL1B 4EUYA 5ECOB 3APSA 2B5YA 4I97A 2PVQA 3HY2A 5EVOA 1ZYNA 3LW9A 3C8EA 5IIZA 3HD5A 5HFIA 2H74A 5J4UA 2VAFA 4DVCA 3APOA 4IQAA 3VI7A 4OFNA 2NVLA 5DQSA 2PUKC 3E3EA 1TK8B 3UBLA 4GLTA 3GSTA 4PURA 4F82A 4KCAA 5LCZA 3J7Yk 1TRUA 2IJYA 2JACA 4QL9A 1I9DA 3UL3A 4JR4A 5F05A 3FZ5A 6GSWA 1XWBA 2ZNMA 2CT6A 5G5EA 1SENA 2A4VA 3C7MA 1HNBA 3UVHA 3LEFA 3WT1A 4AGSA 3WD6A 2GT6A 1OE8A 1YEXA 2PVOC 4D73B 4X0XA 5HFGA 1Z6NA 2P0GA 3A5WA 3M0FA 1VF4A 3MDKA 1O73A 3ZIVA 1JZOA 5IMCA 2YP6A 4IP1A 3ZMLA 2HRFA 4K5RA 1KTEA 2VLTA 3GTUA 1X5EA 3LORA 4POLA 4MA9A 3TKSA 4RQRA 2CX3A 2NTOA 2KOKA 1K0DA 1URMA 2VL2A 4AF2A 4ZBDA 2FGXA 5C04A 2FWHA 3QMXA 1GP1A 1XWCA 4F0BA 2H19A 4YAPA 2YWNA 1TP9A 4KH7A 2KP2A 2YZHA 2LRTA 2DKIA 4KSMA 5KOWA 4MF6A 2YZUA 1EGOA 1V2AA 5D9XA 2WJUA 1QK8A 2YV9A 2IMKA 4ZL9A 3DIEA 4XS1A 2ALBA 2M80A 2VM1A 5ECHB 2CZ3A 4EVMA 2JL4A 1GTBA 2PERA 4WBRD 2R0GA 4ECJA 1XVWA 4GF0A 2DJ1A 1AQWA 1SK0A 3VURA 5BRTA 4FIWA 1AW9A 4DSQA 2E2MA 1GSUA 3R3EA 3D5JA 2M72A 4AJ7A 4ISDA 2QKEA 1PA3A 4V1Ag 4X1UA 1DBYA 4MCUA 2WCIA 5G31A 1M99A 2DBCA 2DMMA 4EF0A 3GH9A 1XWKA 4WBJA 3QR6A 1SK1A 2GT5A 3Q19A 4FYBA 4LL1B 3TJGA 4POKA 4J2FA 1X5DA 1V40A 3GHAA 3CBUA 5CRDA 5DJLA 1QFNA 3I69A 2FA4A 3Q6OA 1GNWA 3QAWA 1T1VA 1EP8A 3FK8A 1O7UA 4Q5QA 4KDYA 3VPTA 4O32A 2WS2A 3TRQA 3F3QA 2HNLA 4OO5A 4G0IA 1FVJA 1SKWB 4HS1A 3CRTA 1UN2A 4OMVA 1CQGA 4NHWA 3EMXA 4MZWA 2I9HA 1AUCA 3O76A 2YANA 4V1Ap 3NZNA 3DD3A 4TKYA 1FHEA 3IHGA 3HJOA 3M8NA 1WP0A 1O8WA 2VCTA 1O81A 2XBIA 2H73A 5LNKe 1EP7A 1X0RA 2E2GA 1JZRA 2HZEB 2MMNA 4YKGA 1TJDA 4ECIA 2LQOA 3N9JA 3KH9A 1PRXA 3G7YA 2WDUA 6GSVA 2YWIA 3PGTA 3F8UA 3GKKA 17GSA 5D9TA 5DBQA 3MNGA 1H75A 4O5RA 5KN0A 2RUFA 4MNNA 1Y6EA 1WWJA 2OKAA 1S3DA 4G0LA 4PXOA 2WFCA 1XOBA 3F0IA 4MZBA 2QA2A 5ECPB 3UARA 3GNJA 1XIYA 3F63A 5D9WA 5J41A 3IK9A 5GAPD 3UMAA 1ERUA 4A5PA 2FWEA 2H1DA 1XW6A 1NHOA 2PWJA 3GH6A 4P3YB 4O5QA 5ECQB 1PGTA 2IMIA 1MTCA 3VWUA 2GTUA 1G6WA 3HVVA 4K2XA 5EPFA 4K1FA 2LV3A 1XFLA 2B6MA 3FMWA 1WRYA 1GTUA 2B7KA 3HKRA 3PR8A 4LLRA 2LQQA 1QQ2A 2NPBA 4K2DA 4HDEA 2YV7A 3G9BA 3KD0A 4IP6A 1THOA 3TOUA 1YEPA 3M9KA 2CVBA 2WRTA 2OBIA 5DAKB 1SD8A 1H4OA 4K7NA 4RQXA 4NHZA 3LFLA 4GTUA 1DSBA 1F37A 1THXA 3DMLA 2B1LA 3LYKA 4MJEA 3EC3A 4GCIA 5FHIA 1PN0A 1VF2A 1B4PA 4Q5FA 3E0UA 1X5CA 4NWYA 3FHKA 4NV2A 1C72A 2PPTA 1GUKA 5CREA 1GUHA 2H1GA 3GRXA 2F3MA 3IPZA 3GKXA 4Z7XA 4QL7A 2MBTA 1OC8A 3DVXA 2C1YA 2P5RA 4ACSA 1Z9HA 5H5QA 1LBKA 3MYDA 4L5OA 2QGVA 4TXVA 2DC5A 22GSA 3P8WA 2J23A 1OKTA 11GSA 5CP1A 3TDGA 2KP1A 2DJJA 3GSSA 3APQA 1K0CA 2LUSA 4FQUA 1ZL9A 5B8AA 3GA4A 3GX0A 4PUAA 2GGTA 2JADA 1NHYA 1TOFA 3EYTA 4IVFA 2GLRA 4MH3A 1XWAA 2IPAA 1B8XA 2FNOA 2H72A 4TXOB 3P90A 2HRAA 3W6GA 3L0HA 2LRNA 5JWRB 4X4JA 1GNEA 2VIMA 1IYHA 3D4TA 3SBCA 5GZZB 1BJXA 4ZB6A 4DSSB 3QCPA 3TJKA 3TJBA 2C3TA 14GSA 2VD0A 4G2EA 2V32A 3VWWA 5JCWA 2H0GA 1R5PA 4XS4B 2R2JA 5KEJA 4G9HA 4MMMA 5IOWA 4TOPA 2IL3A 1EGRA 2AB6A 3FEUA 3KH7A 1K3OA 1YJ6A 2YNXA 3LSZA 2H6XA 3HVSA 3KEBA 2O85A 3CRUA 3ZTLA 1FG4A 2FA8A 4K0NA 1FW1A 5ENUA 1A0RP 3GFKA 6GSUA 4OCFA 4KUNA 2OADA 3IBHA 5A4WA 2MMZA 3SWLA 4PQ1A 2DJ2A 4K0GA 1BG5A 4WXTA 4BWSA 3F6DA 3GL3A 2GSRA 1JFUA 1GTAA 2IFQB 1F3BA 4GQCA 1ERVA 3TB2A 1A2MA 3J7Yb 4GRFA 1J0FA 3TGZA 2IN3A 2LJKA 1N2AA 1EV9A 3IV4A 1A0FA 4JE1A 4I5QA 3AY8A 2GSQA 4CDOA 4XRDA 5ECIB 3L78A 4HZ4A 3O6TA 4IS0A 1GSEA 2VM2A 4IN0A 3HHVA 1TRWA 6GSYA 2GVPA 1YQ1A 4AJ6A 5C00A 3KXOA 3IDVA 2L5OA 3F3RA 2JSZA 5HR3A 2R6KA 2VLVA 2HZFA 4ICYA 2R37A 1B4QA 2MZCA 2L6DA 1X9MB 3M9JA 4TR3A 2H66A 3VLNA 2L6CA 4YQMA 2TIRA 1PSQA 1DE1A 5DJMA 4POMA 4BA7A 1AAZA 1KBNA 5EY6A 2RM6A 4G0KA 3A2WA 4ECBA 4GSTA 5CNWA 1TDIA 1QXHA 4BVYB 3QOUA 4POBA 3DVWA 1M2AA 5ECSA 4KW6A 2JZSA 18GSA 3LWAA 2LKUA 4PQIA 2OA7A 3D6IA 5IMAA 2I1UA 1ABAA 4NXIA 3WGXA 3FZ9A 4HU7A 5DVBA 1GRXA 4WR4A 2LEGA 1PX6A 2O87A 1TU8A 3ZRDA 2EC4A 5CRGA 5AIXA 2TRCP 2DJ0A 5AGYA 1Z6MA 3CSJA 3G7IA 4I6XA 4AJ8A 1XCCA 3ZLPA 5COHA 3LJRA 3KZQA 1F9MA 2OACA 1FAAA 4QQ7A 4N11A 3BBYA 2HZEA 3C1RA 2FY6A 1GLQA 2PN8A 5J5NA 2BMXA 3H79A 2E0QA 5J3RA 3D0ZA 3GURA 4O92A 4PX1A 2VD1A 4ID0A 5H5SA 3FY7A 5D93A 3QAGA 1R4WA 2PU9C 1K0OA 3KTBA 4OWYA 1SL2B 1EOHA 5CRHA 3HXSA 4JZQA 2F51A 2DJ3A 3M3MA 5IMVA 1WIKA 1V98A 4TR0A 1B9YC 3IE3A 2HXKA 2X8CA 4KAEA 5IPGA 2LSTA 1GSYA 3M1GA 2AAWA 4MK3A 4L0WA 3UOMA 1EOGA 3UEMA 2GDRA 1XWGA 13GSA 4ULXA 1F3AA 4OCEA 3NOFA 2P5QA 3EPTA 3KTLA 2C3NA 5A5KA 4N10A 2VLUA 1ZYQB 1YDKA 3VWXA 1JZWA 1BEDA 3TJJA 1EEJA 4PGTA 5DAKA 4FH8A 3H93A 4V2LA 3C73A 1A8LA 4N0ZA 3ZITA 2GS3A 4IJ3A 2GZYA 1JLVA 2R5GA 1SJZA 2VCXA 5ID2B 3TJFA 1HD2A 1Z7RA 5ECRB 5G1LA 1RQMA 5DALB 3ED3A 2DKHA 1XBSA 2YWOA 3FR3A 4PQHA 1A8YA 1FB6A 1ML6A 1EWXA 5B6NA 2RIIA 1ZOFA 3LG6A 3EU4A 3TOTA 4G19A 1G6YA 1Z5YE 3FZAA 4X43A 1R26A 1TK5B 2L59A 2IWTA 5AISA 1M2DA 5A4VA 4JU5A 4ZB8A 2WZ9A 5G2ZA 6GSTA 2G0FA 2H30A 1USBA 2C80A 4LL4B 3ZFLA 4GSSA 1DUGA 3VWVA 5JWOB 2P31A 2ES7A 3F6FA 5IMDA 5G5FA 1B48A 4Z2RA 1PKZA 1GSQA 2PBJA 3CTGA 3HYPA 3F9UA 3UIWA 1EZKA 1JZDA 1TW9A 2N5BA 3WYWA 3DXBA 1G7OA 1GTIA 1V58A 4NAXA 4KGIA 2HFDA 2AYTA 1MD3A 4TXOA 4O7HA 2O89A 3MSZA 4I8BA 2RLIA 1LJRA 3IC8A 3E9JB 3ZVJA 4GXZA 5IPHA 2VOCA 4KB3A 2OBKA 1GH2A 5JWQB 4DSSA 5GAND 2FHEA 3D22A 4XS4A 4FYUA 1JLWA 5GSTA 3IR4A 3GIXA 1W89A 3KMOA 3R2QA 4HOJA 2OE0A 1U3AA 2KLXA 3I6AA 1PL1A 2O8VB 1GL8A 2YJ7A 3RBTA 3I9V2 2A4HA 3Q74A 4EIQA 3K8NA 2NDOA 4EO3A 4IBPA 2A2PA 1GUMA 1OYJA 3HZ4A 2L4QA 2HT9A 2B1KA 5ELGA 2IIYA 1T7PB 2ZUPA 4O5UA 2CAQA 4MJBA 1F2EA 1OC9B 4ECCA 4EXJA 2JZRA 5F06A 3FKFA 2HI7A 2NBSA 4K9ZA 1RW1A 4HU9A 4IHUA 1F6MC 1EEMA 3IK7A 5AN1A 1OC3A 2IFQA 2BJXA 4HJ2A 3UBKA 1K0MA 3EVIA 1TU7A 5KN1A 1FVKA 1TRVA 4V2NA 5H5RA 4E8HA 3KP9A 2RM5A 2X4AA 3L9SA 5JCGA 1XW9A 2JZTA 2N5AA 1X9SB 3PPUA 5IOXA 1M0UA 5IQYA 5F07A 3LGCA 1AQXA 12GSA 4XHMA 3BCIA 3IRAA 4WETA 2H70A 1NSWA 2AUVA 1O8XA 5EL8A 3ERGA 4GWRA 2MYGA 3HJMA 3Q18A 1SYRA 2KUCA 4HI7A 1XOAA 1AXDA 1XXUA 1Q98A 5IM9A 3LXZA 2XPEA 1M9BA 4F0CA 1KEBA 4KDUA 2K9FA 2AJQB 4NMUA 1UA5A 4JRRA 4DEJA 4BWQA 2LNTA 3BOAA 2I81A 4ZXGA 1OKDA 4BVYA 2H75A 5J9CA 3IXRA 1SJ6A 3FW2A 1M7TA 2GSTA 5KN3A 1PQNA 3CTFA 3P7XA 3KJYA 2VUPA 5F8BA 1K0BA 3HDCA 4JBBA 4KA0A 3H4KA 1QUWA 5CYYA 3TUEA 3D4MA 1IYIA 2HE3A 3EE2A 4TR1B 2YWMA 3CYNA 4ML6A 3KP8A 3S9FA 10GSA 4PTSA 2FWFA 1R7HA 4ZB9A 2V1MA 4L5LA 1DE2A 1BQ7A 5JCUA 2GZPA 3NIVA 1BAYA 3KMNA 2EIQA 4HJMA 3ERWA 1T4ZA 1GSDA 5J9BA 3WGEA 4CY8A 3VFIA 2CVKA 2K8SA 4TN8A 3CSHA 2IMEA 3DKSA 4EIPA 2X64A 1OE7A 5DCGA 4BL7B 5D96A 3CSIA 4LMVA 2HLSA 3RPNA 1LU4A 4ILFA 3MAKA 3IHQA 1W4VA 3CXGA 1XVQA 4IJIA 2XPDA 2C0FA 2B5XA 3TKQA 1OAZA 3KGKA 1Y25A 4MDCA 2VO4A 1WOUA 3LQ7A 2L4CA 3H1NA 4ZBAA 4KX4A 4XRAA 1ST9A 1G7EA 2WULA 3RPPA 2V41A 3QAVA 4K8MA 3HZ8A 5G1KA 1A24A 3C71A 1J08A 1HQOA 4KCEA 3F4RA 2B3SA 3BJ5A 2DIZA 1YKCA 3ME8A 3IAS2 3EMPA 1TKDB 1NW2A 2VL9A 4ZIJA 4RUVA 2HSMA 1SK2A 2LJRA 3IOSA 5ECMB 3TCOA 2L57A 3WT2A 2HRNA 5HR0A 2LS5A 2DSAA 3GL5A 1M2BA 5ID2A 1MEKA 5HFKA 2HYXA 5DALA 2IMDA 2OJLA 1ZGNA 4YAVA 5IO0A 2DIYA 5ECNB 4CHSA 4BVXB 3ZIJA 4USSA 3GX8A 2PMTA 1TTZA 5G30A 5HQPA 1TK0B 1PX7A 2QSIA 2WB9A 3JCML 4XIHA 1MDIA 1V57A 3ISOA 4HQZA 1N8JA 3LXTA 3TRXA 2R3XA 4EKZA 2H71A 4NV5A 1NM3A 1V9WA 1WJKA 4K7IA 2B7JA 4IELA 1FOVA 1BYEA 4JR6A 3GKMA 16GSA 2I3YA 4TVEA 1ERTA 4V2MA 2H0IA 5DCHA 2ON5A 1SD9A 1T4YA 4OFTA 2F8AA 5B7CA 3ERFA 1A2JA 3ZFBA 2Z9SA 3TKSC 3ZL5A 2VL2C 4JEDA 1MD4A 1K0NA 1S3AA 2LRCA 5KOXA 1PL2A 4MJAA 2K18A 2R4VA 3HJPA 1PN9A 1M9AA 2C0DA 2CAIA 4K7OA 2TRXA 2FLSA 5INYA 3FR9A 3EWLA 1SU9A 1SKSB 1VRSD 5ECKB 2QC7A 3DWVA 4GSNA 1CQHA 4ML1A 1RK4A 1ZYEA 3L9UA 4Q5NA 2C4JA 1EV4A 4K5SA 1VGLA 4KE3A 3MWHA 2JU5A 2EIRA 4MF7A 3BD2A 3TKPA 1YF1A 3DRNA 1O6JA 1O85A 2K6VA 2V6KA 1GSFA 4E8EA 3CMIA 4G10A 5B8BA 1Z3EA 2XBQA 3TKRA 2DJKA 2H0HA 3FZ4A 2IMFA 2N5FA 2FD3A 1ZYPA 1SL0B 4F9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OC9 A;  2X8H A;  3GMF A;  3KIJ A;  4MZC A;  1YKA A;  5L71 A;  3GYK A;  4ZL8 A;  1OVN A;  2H76 A;  2O7K A;  4EC0 A;  1T00 A;  1BX9 A;  5CRW A;  1AIU A;  6GSS A;  1KNG A;  4MH2 A;  1Z7P A;  3W8S A;  2PGT A;  4YQV A;  1K3Y A;  2FCH A;  1YY7 A;  4N30 A;  1SKR B;  2F8F A;  2VCZ A;  3DGQ A;  1ILO A;  4TR4 A;  4HQS A;  1TI1 A;  1UVZ A;  3UAP A;  5HR2 A;  2GZZ A;  1FO5 A;  2GQL A;  1J9B A;  3HA9 A;  5IMF A;  3F4S A;  3KCM A;  1X9W B;  4J57 E;  3GV1 A;  1VF3 A;  3EU3 A;  3LYP A;  3IAM 2;  3DEX A;  5CO3 A;  5ECL B;  3V1W A;  4WF5 A;  4LA1 A;  5ELA A;  2XC2 A;  2ZCT A;  1A23 A;  1QGV A;  1GLP A;  2C3Q A;  3U6V A;  4L0U A;  4XS6 A;  3ZVJ D;  1GUL A;  1U88 A;  1MDJ A;  4LMW A;  2I4A A;  3F4T A;  4H86 A;  4OO4 A;  3HVX A;  3UVT A;  2ON7 A;  3EIN A;  3GTU B;  4IGJ A;  1WMJ A;  4KSO A;  2WGR A;  1GWC A;  1U3I A;  4K6X A;  3VK9 A;  4DSR A;  1B9X C;  8GSS A;  4IKH A;  2C0E A;  3KM6 A;  4PNG A;  2YOI A;  3HCZ A;  2YCD A;  2CX4 A;  5AIV A;  3QFA C;  3WGD A;  2GSS A;  2AHE A;  4TR1 A;  4TW5 A;  3GKN A;  4BPY A;  5D8I A;  3PH9 A;  2M46 A;  2V6O A;  4KDX A;  3UJ1 A;  1G0T A;  2VCQ A;  5DDL A;  4EDY A;  3A2X A;  2K8V A;  4I2T A;  3ZMK A;  1U87 A;  2REM A;  3RHC A;  1WPI A;  1VF1 A;  7GSS A;  4HEA 2;  3ME7 A;  3IC4 A;  2B5E A;  1HYU A;  4XCS A;  3OR5 A;  3I43 A;  4WF4 A;  1AQV A;  4MF5 A;  2RUE A;  2VCW A;  1T8E B;  4CW9 A;  4TRX A;  4WKW A;  1E6B A;  4BL7 A;  5KN2 A;  3QFB C;  2KHP A;  3O3T A;  4OD7 A;  3RHB A;  3RDW A;  1R5A A;  1A2L A;  2CZ2 A;  1K3L A;  4IQ1 A;  2BTO T;  1K0A A;  1PD2 1;  2GQM A;  5HR1 A;  2VCV A;  2MMO A;  1ZMA A;  2MBS A;  4OFM A;  2LTK A;  5D73 A;  3QDN A;  2G2Q A;  3C1S A;  3D21 A;  1WE0 A;  4MJC A;  4EE0 A;  5LD0 A;  2A2S A;  2X99 A;  2CV4 A;  1ACV A;  3TKS E;  3N5O A;  2EIO A;  5FT3 A;  1XW5 A;  9GSS A;  2D2Z A;  4WEY A;  3L4N A;  2DLX A;  2LNS A;  1I5G A;  1HNA A;  2J9H A;  2H01 A;  4GQF A;  2HSH A;  3GUS A;  1JHB A;  3FR6 A;  1XPV A;  4MLY A;  1SJI A;  2H6Y A;  3L9V A;  1TRS A;  2X8G A;  2XHF A;  4YH2 A;  2LJA A;  3W8J A;  2H6Z A;  5E4W A;  4EDZ A;  5IO2 A;  4RI7 A;  2CA8 A;  2L5L A;  5A4U A;  4BVX A;  3H8Q A;  2DML A;  1XZO A;  3U5R E;  1PKW A;  4HUA A;  4ZIL A;  3PIN A;  4PUF C;  4PNF A;  1MDK A;  1QMV A;  2CVD A;  3TRP A;  3RAZ A;  4MPF A;  1S3C A;  2C8U A;  4NPB A;  5D9V A;  1HNC A;  3VPQ A;  2HSY A;  4YQU A;  1YZX A;  2GQK A;  3BCK A;  6GSX A;  1ZCP A;  1TXX A;  2JSY A;  1U6T A;  4FYC A;  4FO5 A;  4MPG A;  3FYG A;  1FB0 A;  20GS A;  2FUG 2;  1GSS A;  4D73 A;  2MMA A;  2VL3 A;  4ZBB A;  5B6M A;  3GN3 A;  19GS A;  4RI6 A;  4XTS A;  3ZZX A;  1AC1 A;  2E7P A;  5DQY A;  1SYX A;  2H8L A;  4F2I A;  2F9S A;  3ZYW A;  2C0G A;  5ABR A;  2YPM A;  4MAB A;  3A2V A;  5IMZ A;  1ERW A;  2OE1 A;  2V2G A;  3EUR A;  3ZRE A;  2YJH A;  3P2A A;  4MP4 A;  3G7J A;  3VI5 A;  3FRC A;  1TI3 A;  4L8E A;  5CAX A;  1Q4J A;  2FWG A;  1PMT A;  2YN1 A;  3A3T A;  3QPM A;  4IW9 A;  1E2Y A;  1UC7 A;  2A2R A;  5FWG A;  3IA1 A;  2OE3 A;  4F03 A;  4J56 E;  1ON4 A;  5GSS A;  4N0V A;  4WR5 A;  4Q5R A;  3QD9 A;  1YF0 A;  5F0G A;  4I2U A;  3US3 A;  3DYR A;  4KND A;  1T3B A;  2H1A A;  2H1B A;  4HZ2 A;  4EL1 A;  5E59 A;  2AV4 A;  1ZZY A;  4ZL7 A;  2CQ9 A;  1SL1 B;  4EUY A;  5ECO B;  3APS A;  2B5Y A;  4I97 A;  2PVQ A;  3HY2 A;  5EVO A;  3C8E A;  5IIZ A;  3HD5 A;  5HFI A;  2H74 A;  5J4U A;  2VAF A;  4DVC A;  3APO A;  4IQA A;  3VI7 A;  4OFN A;  2NVL A;  5DQS A;  2PUK C;  3E3E A;  1TK8 B;  3UBL A;  4GLT A;  3GST A;  4PUR A;  4F82 A;  4KCA A;  5LCZ A;  3J7Y k;  1TRU A;  2IJY A;  2JAC A;  4QL9 A;  1I9D A;  3UL3 A;  4JR4 A;  5F05 A;  3FZ5 A;  6GSW A;  1XWB A;  2ZNM A;  2CT6 A;  5G5E A;  1SEN A;  2A4V A;  3C7M A;  1HNB A;  3UVH A;  3LEF A;  3WT1 A;  4AGS A;  3WD6 A;  2GT6 A;  1OE8 A;  1YEX A;  2PVO C;  4D73 B;  4X0X A;  5HFG A;  1Z6N A;  2P0G A;  3A5W A;  3M0F A;  1VF4 A;  3MDK A;  1O73 A;  3ZIV A;  1JZO A;  5IMC A;  2YP6 A;  4IP1 A;  3ZML A;  2HRF A;  1KTE A;  2VLT A;  3GTU A;  1X5E A;  3LOR A;  4POL A;  4MA9 A;  3TKS A;  4RQR A;  2CX3 A;  2NTO A;  2KOK A;  1K0D A;  1URM A;  2VL2 A;  4AF2 A;  4ZBD A;  2FGX A;  5C04 A;  2FWH A;  3QMX A;  1GP1 A;  1XWC A;  4F0B A;  2H19 A;  4YAP A;  2YWN A;  1TP9 A;  4KH7 A;  2KP2 A;  2YZH A;  2LRT A;  4KSM A;  4MF6 A;  2YZU A;  1EGO A;  1V2A A;  5D9X A;  2WJU A;  1QK8 A;  2YV9 A;  2IMK A;  4ZL9 A;  3DIE A;  4XS1 A;  2ALB A;  2M80 A;  2VM1 A;  5ECH B;  2CZ3 A;  4EVM A;  2JL4 A;  1GTB A;  2PER A;  4WBR D;  4ECJ A;  1XVW A;  4GF0 A;  2DJ1 A;  1AQW A;  1SK0 A;  3VUR A;  4FIW A;  1AW9 A;  4DSQ A;  2E2M A;  1GSU A;  3D5J A;  2M72 A;  4AJ7 A;  4ISD A;  2QKE A;  1PA3 A;  4V1A g;  4X1U A;  1DBY A;  4MCU A;  2WCI A;  5G31 A;  1M99 A;  2DBC A;  2DMM A;  4EF0 A;  3GH9 A;  1XWK A;  4WBJ A;  3QR6 A;  1SK1 A;  2GT5 A;  3Q19 A;  4FYB A;  4LL1 B;  3TJG A;  4POK A;  4J2F A;  1X5D A;  1V40 A;  3GHA A;  3CBU A;  5CRD A;  5DJL A;  1QFN A;  3I69 A;  2FA4 A;  3Q6O A;  1GNW A;  3QAW A;  1T1V A;  1EP8 A;  3FK8 A;  1O7U A;  4Q5Q A;  4KDY A;  3VPT A;  4O32 A;  2WS2 A;  3TRQ A;  3F3Q A;  2HNL A;  4OO5 A;  1FVJ A;  1SKW B;  4HS1 A;  3CRT A;  1UN2 A;  4OMV A;  1CQG A;  4NHW A;  3EMX A;  4MZW A;  2I9H A;  1AUC A;  3O76 A;  2YAN A;  4V1A p;  3NZN A;  3DD3 A;  4TKY A;  1FHE A;  3HJO A;  3M8N A;  1WP0 A;  1O8W A;  2VCT A;  1O81 A;  2XBI A;  2H73 A;  5LNK e;  1EP7 A;  1X0R A;  2E2G A;  1JZR A;  2HZE B;  2MMN A;  1TJD A;  4ECI A;  2LQO A;  3N9J A;  3KH9 A;  1PRX A;  3G7Y A;  2WDU A;  6GSV A;  2YWI A;  3PGT A;  3F8U A;  3GKK A;  17GS A;  5D9T A;  5DBQ A;  3MNG A;  1H75 A;  4O5R A;  5KN0 A;  2RUF A;  1Y6E A;  1WWJ A;  2OKA A;  1S3D A;  4PXO A;  2WFC A;  1XOB A;  3F0I A;  4MZB A;  5ECP B;  3UAR A;  3GNJ A;  1XIY A;  3F63 A;  5D9W A;  5J41 A;  3IK9 A;  5GAP D;  3UMA A;  1ERU A;  2FWE A;  2H1D A;  1XW6 A;  1NHO A;  2PWJ A;  3GH6 A;  4P3Y B;  5ECQ B;  1PGT A;  2IMI A;  1MTC A;  3VWU A;  2GTU A;  1G6W A;  3HVV A;  5EPF A;  4K1F A;  2LV3 A;  1XFL A;  2B6M A;  1WRY A;  1GTU A;  2B7K A;  3HKR A;  3PR8 A;  4LLR A;  2LQQ A;  1QQ2 A;  2NPB A;  4K2D A;  4HDE A;  2YV7 A;  3G9B A;  3KD0 A;  4IP6 A;  1THO A;  3TOU A;  1YEP A;  3M9K A;  2CVB A;  2WRT A;  2OBI A;  5DAK B;  1SD8 A;  1H4O A;  4K7N A;  4RQX A;  4NHZ A;  3LFL A;  4GTU A;  1DSB A;  1F37 A;  1THX A;  3DML A;  2B1L A;  3LYK A;  4MJE A;  3EC3 A;  4GCI A;  5FHI A;  1VF2 A;  1B4P A;  4Q5F A;  3E0U A;  1X5C A;  4NWY A;  3FHK A;  1C72 A;  4NV2 A;  2PPT A;  1GUK A;  5CRE A;  1GUH A;  2H1G A;  3GRX A;  2F3M A;  3IPZ A;  3GKX A;  4Z7X A;  4QL7 A;  2MBT A;  1OC8 A;  3DVX A;  2C1Y A;  2P5R A;  4ACS A;  1Z9H A;  5H5Q A;  1LBK A;  4L5O A;  2QGV A;  4TXV A;  2DC5 A;  22GS A;  3P8W A;  2J23 A;  1OKT A;  11GS A;  5CP1 A;  3TDG A;  2KP1 A;  2DJJ A;  3GSS A;  3APQ A;  1K0C A;  2LUS A;  1ZL9 A;  5B8A A;  3GA4 A;  3GX0 A;  4PUA A;  2GGT A;  2JAD A;  1NHY A;  1TOF A;  3EYT A;  4IVF A;  2GLR A;  4MH3 A;  1XWA A;  2IPA A;  1B8X A;  2FNO A;  2H72 A;  4TXO B;  3P90 A;  3W6G A;  3L0H A;  2LRN A;  5JWR B;  1GNE A;  2VIM A;  1IYH A;  3D4T A;  3SBC A;  5GZZ B;  1BJX A;  4ZB6 A;  4DSS B;  3QCP A;  3TJK A;  3TJB A;  2C3T A;  14GS A;  2VD0 A;  4G2E A;  2V32 A;  3VWW A;  5JCW A;  2H0G A;  1R5P A;  4XS4 B;  2R2J A;  5KEJ A;  4G9H A;  4MMM A;  5IOW A;  4TOP A;  2IL3 A;  1EGR A;  2AB6 A;  3FEU A;  3KH7 A;  1K3O A;  1YJ6 A;  2YNX A;  3LSZ A;  2H6X A;  3HVS A;  3KEB A;  2O85 A;  3CRU A;  3ZTL A;  1FG4 A;  2FA8 A;  4K0N A;  1FW1 A;  5ENU A;  1A0R P;  3GFK A;  6GSU A;  4OCF A;  4KUN A;  2OAD A;  3IBH A;  5A4W A;  2MMZ A;  3SWL A;  4PQ1 A;  2DJ2 A;  4K0G A;  1BG5 A;  4WXT A;  4BWS A;  3F6D A;  3GL3 A;  2GSR A;  1JFU A;  1GTA A;  2IFQ B;  1F3B A;  4GQC A;  1ERV A;  3TB2 A;  1A2M A;  3J7Y b;  4GRF A;  1J0F A;  3TGZ A;  2IN3 A;  2LJK A;  1N2A A;  1EV9 A;  3IV4 A;  1A0F A;  4JE1 A;  4I5Q A;  3AY8 A;  2GSQ A;  4CDO A;  4XRD A;  5ECI B;  3L78 A;  4HZ4 A;  3O6T A;  4IS0 A;  1GSE A;  2VM2 A;  4IN0 A;  3HHV A;  1TRW A;  6GSY A;  2GVP A;  1YQ1 A;  4AJ6 A;  5C00 A;  3KXO A;  3IDV A;  2L5O A;  3F3R A;  2JSZ A;  5HR3 A;  2R6K A;  2VLV A;  2HZF A;  2R37 A;  1B4Q A;  2MZC A;  2L6D A;  1X9M B;  3M9J A;  4TR3 A;  2H66 A;  3VLN A;  2L6C A;  4YQM A;  2TIR A;  1PSQ A;  1DE1 A;  5DJM A;  4POM A;  4BA7 A;  1AAZ A;  1KBN A;  5EY6 A;  2RM6 A;  3A2W A;  4ECB A;  4GST A;  5CNW A;  1TDI A;  1QXH A;  3QOU A;  4POB A;  3DVW A;  1M2A A;  5ECS A;  4KW6 A;  2JZS A;  18GS A;  3LWA A;  2LKU A;  4PQI A;  2OA7 A;  3D6I A;  5IMA A;  2I1U A;  1ABA A;  4NXI A;  3WGX A;  3FZ9 A;  4HU7 A;  5DVB A;  1GRX A;  4WR4 A;  2LEG A;  1PX6 A;  2O87 A;  1TU8 A;  3ZRD A;  2EC4 A;  5CRG A;  5AIX A;  2TRC P;  2DJ0 A;  5AGY A;  1Z6M A;  3CSJ A;  3G7I A;  4I6X A;  4AJ8 A;  1XCC A;  3ZLP A;  5COH A;  3LJR A;  3KZQ A;  1F9M A;  2OAC A;  1FAA A;  4QQ7 A;  4N11 A;  3BBY A;  2HZE A;  3C1R A;  2FY6 A;  1GLQ A;  2PN8 A;  5J5N A;  2BMX A;  3H79 A;  2E0Q A;  5J3R A;  3D0Z A;  3GUR A;  4O92 A;  4PX1 A;  2VD1 A;  4ID0 A;  5H5S A;  3FY7 A;  5D93 A;  3QAG A;  1R4W A;  2PU9 C;  1K0O A;  3KTB A;  4OWY A;  1SL2 B;  1EOH A;  5CRH A;  3HXS A;  4JZQ A;  2F51 A;  2DJ3 A;  3M3M A;  5IMV A;  1WIK A;  1V98 A;  4TR0 A;  1B9Y C;  3IE3 A;  2HXK A;  2X8C A;  4KAE A;  5IPG A;  2LST A;  1GSY A;  3M1G A;  2AAW A;  4MK3 A;  4L0W A;  3UOM A;  1EOG A;  3UEM A;  2GDR A;  1XWG A;  13GS A;  4ULX A;  1F3A A;  4OCE A;  3NOF A;  2P5Q A;  3KTL A;  2C3N A;  5A5K A;  4N10 A;  2VLU A;  1ZYQ B;  1YDK A;  3VWX A;  1JZW A;  1BED A;  3TJJ A;  1EEJ A;  4PGT A;  5DAK A;  4FH8 A;  3H93 A;  4V2L A;  3C73 A;  1A8L A;  4N0Z A;  3ZIT A;  2GS3 A;  4IJ3 A;  2GZY A;  1JLV A;  2R5G A;  1SJZ A;  2VCX A;  5ID2 B;  3TJF A;  1HD2 A;  1Z7R A;  5ECR B;  5G1L A;  1RQM A;  5DAL B;  3ED3 A;  1XBS A;  2YWO A;  3FR3 A;  4PQH A;  1A8Y A;  1FB6 A;  1ML6 A;  1EWX A;  5B6N A;  2RII A;  1ZOF A;  3LG6 A;  3EU4 A;  3TOT A;  4G19 A;  1G6Y A;  1Z5Y E;  3FZA A;  4X43 A;  1R26 A;  1TK5 B;  2L59 A;  2IWT A;  5AIS A;  1M2D A;  5A4V A;  4JU5 A;  4ZB8 A;  2WZ9 A;  5G2Z A;  6GST A;  2G0F A;  2H30 A;  1USB A;  2C80 A;  4LL4 B;  3ZFL A;  4GSS A;  1DUG A;  3VWV A;  5JWO B;  2P31 A;  2ES7 A;  3F6F A;  5IMD A;  5G5F A;  1B48 A;  1PKZ A;  1GSQ A;  2PBJ A;  3CTG A;  3HYP A;  3F9U A;  3UIW A;  1EZK A;  1JZD A;  1TW9 A;  2N5B A;  3WYW A;  3DXB A;  1G7O A;  1GTI A;  1V58 A;  4NAX A;  4KGI A;  2HFD A;  2AYT A;  1MD3 A;  4TXO A;  4O7H A;  2O89 A;  3MSZ A;  4I8B A;  2RLI A;  1LJR A;  3E9J B;  3ZVJ A;  4GXZ A;  5IPH A;  2VOC A;  4KB3 A;  2OBK A;  1GH2 A;  5JWQ B;  4DSS A;  5GAN D;  2FHE A;  3D22 A;  4XS4 A;  4FYU A;  1JLW A;  5GST A;  3IR4 A;  3GIX A;  1W89 A;  3KMO A;  3R2Q A;  4HOJ A;  2OE0 A;  1U3A A;  2KLX A;  3I6A A;  1PL1 A;  2O8V B;  1GL8 A;  2YJ7 A;  3RBT A;  3I9V 2;  3Q74 A;  3K8N A;  2NDO A;  4EO3 A;  4IBP A;  1GUM A;  1OYJ A;  3HZ4 A;  2L4Q A;  2HT9 A;  2B1K A;  5ELG A;  2IIY A;  1T7P B;  2ZUP A;  2CAQ A;  4MJB A;  1F2E A;  1OC9 B;  4ECC A;  4EXJ A;  2JZR A;  5F06 A;  3FKF A;  2HI7 A;  2NBS A;  4K9Z A;  1RW1 A;  4HU9 A;  4IHU A;  1F6M C;  1EEM A;  3IK7 A;  5AN1 A;  1OC3 A;  2IFQ A;  2BJX A;  4HJ2 A;  3UBK A;  1K0M A;  3EVI A;  1TU7 A;  5KN1 A;  1FVK A;  1TRV A;  4V2N A;  5H5R A;  4E8H A;  3KP9 A;  2RM5 A;  3L9S A;  5JCG A;  1XW9 A;  2JZT A;  2N5A A;  1X9S B;  5IOX A;  1M0U A;  5IQY A;  5F07 A;  3LGC A;  1AQX A;  12GS A;  4XHM A;  3BCI A;  3IRA A;  4WET A;  2H70 A;  1NSW A;  2AUV A;  1O8X A;  5EL8 A;  3ERG A;  4GWR A;  2MYG A;  3HJM A;  3Q18 A;  1SYR A;  2KUC A;  4HI7 A;  1XOA A;  1AXD A;  1XXU A;  1Q98 A;  5IM9 A;  3LXZ A;  2XPE A;  1M9B A;  4F0C A;  1KEB A;  4KDU A;  2K9F A;  2AJQ B;  4NMU A;  1UA5 A;  4JRR A;  4DEJ A;  4BWQ A;  2LNT A;  3BOA A;  2I81 A;  4ZXG A;  1OKD A;  4BVY A;  2H75 A;  5J9C A;  3IXR A;  1SJ6 A;  3FW2 A;  1M7T A;  2GST A;  5KN3 A;  1PQN A;  3CTF A;  3P7X A;  3KJY A;  2VUP A;  5F8B A;  1K0B A;  3HDC A;  4JBB A;  4KA0 A;  3H4K A;  1QUW A;  5CYY A;  3TUE A;  3D4M A;  1IYI A;  2HE3 A;  3EE2 A;  4TR1 B;  2YWM A;  3CYN A;  4ML6 A;  3KP8 A;  3S9F A;  10GS A;  2FWF A;  1R7H A;  4ZB9 A;  2V1M A;  4L5L A;  1DE2 A;  1BQ7 A;  5JCU A;  2GZP A;  3NIV A;  1BAY A;  3KMN A;  2EIQ A;  4HJM A;  3ERW A;  1T4Z A;  1GSD A;  5J9B A;  3WGE A;  3VFI A;  2CVK A;  2K8S A;  4TN8 A;  3CSH A;  2IME A;  3DKS A;  2X64 A;  1OE7 A;  5DCG A;  5D96 A;  3CSI A;  4LMV A;  2HLS A;  3RPN A;  1LU4 A;  4ILF A;  3MAK A;  3IHQ A;  1W4V A;  3CXG A;  1XVQ A;  4IJI A;  2XPD A;  2C0F A;  2B5X A;  3TKQ A;  1OAZ A;  3KGK A;  1Y25 A;  4MDC A;  2VO4 A;  1WOU A;  3LQ7 A;  2L4C A;  3H1N A;  4ZBA A;  4KX4 A;  4XRA A;  1ST9 A;  1G7E A;  2WUL A;  3RPP A;  2V41 A;  3QAV A;  4K8M A;  3HZ8 A;  5G1K A;  1A24 A;  3C71 A;  1J08 A;  1HQO A;  4KCE A;  3F4R A;  2B3S A;  3BJ5 A;  2DIZ A;  1YKC A;  3ME8 A;  3IAS 2;  3EMP A;  1TKD B;  1NW2 A;  2VL9 A;  4ZIJ A;  4RUV A;  1SK2 A;  2LJR A;  3IOS A;  5ECM B;  3TCO A;  2L57 A;  3WT2 A;  2HRN A;  5HR0 A;  2LS5 A;  2DSA A;  3GL5 A;  1M2B A;  5ID2 A;  1MEK A;  5HFK A;  2HYX A;  5DAL A;  2IMD A;  2OJL A;  1ZGN A;  4YAV A;  5IO0 A;  2DIY A;  5ECN B;  4CHS A;  3ZIJ A;  3GX8 A;  2PMT A;  1TTZ A;  5G30 A;  5HQP A;  1TK0 B;  1PX7 A;  2QSI A;  2WB9 A;  3JCM L;  4XIH A;  1MDI A;  1V57 A;  3ISO A;  4HQZ A;  1N8J A;  3LXT A;  3TRX A;  2R3X A;  4EKZ A;  2H71 A;  4NV5 A;  1NM3 A;  1V9W A;  1WJK A;  4K7I A;  2B7J A;  4IEL A;  1FOV A;  1BYE A;  4JR6 A;  3GKM A;  16GS A;  2I3Y A;  4TVE A;  1ERT A;  5DCH A;  2H0I A;  4V2M A;  2ON5 A;  1SD9 A;  1T4Y A;  4OFT A;  2F8A A;  5B7C A;  3ERF A;  1A2J A;  3ZFB A;  2Z9S A;  3TKS C;  3ZL5 A;  2VL2 C;  4JED A;  1MD4 A;  1K0N A;  1S3A A;  2LRC A;  1PL2 A;  4MJA A;  2K18 A;  2R4V A;  3HJP A;  1PN9 A;  1M9A A;  2C0D A;  2CAI A;  4K7O A;  2TRX A;  2FLS A;  5INY A;  3FR9 A;  3EWL A;  1SU9 A;  1SKS B;  1VRS D;  5ECK B;  2QC7 A;  3DWV A;  4GSN A;  1CQH A;  4ML1 A;  1RK4 A;  1ZYE A;  3L9U A;  4Q5N A;  2C4J A;  1EV4 A;  1VGL A;  4KE3 A;  3MWH A;  2JU5 A;  2EIR A;  4MF7 A;  3BD2 A;  3TKP A;  1YF1 A;  3DRN A;  1O6J A;  1O85 A;  2K6V A;  2V6K A;  1GSF A;  4E8E A;  3CMI A;  4G10 A;  5B8B A;  1Z3E A;  2XBQ A;  3TKR A;  2DJK A;  2H0H A;  3FZ4 A;  2IMF A;  2N5F A;  2FD3 A;  1SL0 B;  4F9Z A; 
#chains in the Genus database with same CATH topology
 1OC9 A;  2X8H A;  3GMF A;  3KIJ A;  4MZC A;  1YKA A;  5L71 A;  3GYK A;  4ZL8 A;  1OVN A;  2H76 A;  2O7K A;  4EC0 A;  1T00 A;  1BX9 A;  5CRW A;  1AIU A;  6GSS A;  1KNG A;  4MH2 A;  1Z7P A;  3W8S A;  2PGT A;  4YQV A;  1K3Y A;  2FCH A;  1YY7 A;  4N30 A;  1SKR B;  2F8F A;  2VCZ A;  3DGQ A;  1ILO A;  4TR4 A;  4HQS A;  1TI1 A;  1UVZ A;  3UAP A;  5HR2 A;  2X49 A;  2GZZ A;  1FO5 A;  2GQL A;  1J9B A;  3HA9 A;  5IMF A;  3F4S A;  3KCM A;  1X9W B;  4J57 E;  3GV1 A;  1VF3 A;  3EU3 A;  3LYP A;  3IAM 2;  3DEX A;  5CO3 A;  5ECL B;  3V1W A;  4WF5 A;  4LA1 A;  5ELA A;  2XC2 A;  2ZCT A;  1A23 A;  5BMU A;  1QGV A;  1GLP A;  4HSC X;  2C3Q A;  3U6V A;  4BIK A;  4L0U A;  4XS6 A;  3ZVJ D;  1GUL A;  1U88 A;  1MDJ A;  3HVN A;  4LMW A;  2I4A A;  3F4T A;  4H86 A;  4OO4 A;  3HVX A;  3UVT A;  2ON7 A;  4Z2T A;  3EIN A;  3GTU B;  4IGJ A;  1WMJ A;  4KSO A;  2WGR A;  1GWC A;  1U3I A;  4K6X A;  3VK9 A;  4DSR A;  1FOH A;  1B9X C;  8GSS A;  4IKH A;  2C0E A;  3KM6 A;  4PNG A;  4Z2U A;  2YOI A;  3HCZ A;  2YCD A;  2CX4 A;  5AIV A;  3QFA C;  3WGD A;  2GSS A;  2AHE A;  4TR1 A;  4TW5 A;  3GKN A;  2R0C A;  4BPY A;  5D8I A;  3PH9 A;  2M46 A;  2V6O A;  4KDX A;  3UJ1 A;  1G0T A;  2VCQ A;  5DDL A;  4EDY A;  3A2X A;  2K8V A;  4I2T A;  3ZMK A;  1U87 A;  2REM A;  4KF9 A;  3RHC A;  1WPI A;  1VF1 A;  7GSS A;  4HEA 2;  3ME7 A;  1M3I A;  3IC4 A;  2B5E A;  1HYU A;  4XCS A;  3OR5 A;  3I43 A;  4WF4 A;  1AQV A;  4MF5 A;  2RUE A;  2VCW A;  1T8E B;  4CW9 A;  4TRX A;  4WKW A;  1E6B A;  4BL7 A;  5KN2 A;  3QFB C;  2KHP A;  3O3T A;  4OD7 A;  3RHB A;  3RDW A;  1R5A A;  1A2L A;  2CZ2 A;  1K3L A;  4IQ1 A;  2BTO T;  1K0A A;  1PD2 1;  2GQM A;  5HR1 A;  2VCV A;  2MMO A;  1ZMA A;  2MBS A;  4OFM A;  2LTK A;  5D73 A;  3QDN A;  2G2Q A;  3C1S A;  3D21 A;  1WE0 A;  4MJC A;  4EE0 A;  5LD0 A;  2A2S A;  2X99 A;  2CV4 A;  1ACV A;  3TKS E;  3N5O A;  2EIO A;  5FT3 A;  1XW5 A;  9GSS A;  2D2Z A;  4WEY A;  3L4N A;  2DLX A;  2LNS A;  1I5G A;  1HNA A;  2J9H A;  2H01 A;  4GQF A;  2HSH A;  3GUS A;  1JHB A;  3FR6 A;  1XPV A;  4MLY A;  1SJI A;  2H6Y A;  3L9V A;  1TRS A;  2X8G A;  2XHF A;  4YH2 A;  2LJA A;  3W8J A;  2H6Z A;  5E4W A;  3CQF A;  4EDZ A;  5IO2 A;  4RI7 A;  2CA8 A;  2L5L A;  5A4U A;  4BVX A;  3H8Q A;  2DML A;  1XZO A;  3U5R E;  1PKW A;  4HUA A;  4ZIL A;  3PIN A;  4PUF C;  4PNF A;  1MDK A;  1QMV A;  2CVD A;  3TRP A;  3RAZ A;  4MPF A;  1S3C A;  2C8U A;  4NPB A;  5D9V A;  1HNC A;  3VPQ A;  2HSY A;  4YQU A;  1YZX A;  2GQK A;  3BCK A;  6GSX A;  1ZCP A;  1TXX A;  2JSY A;  1U6T A;  4FYC A;  4FO5 A;  4MPG A;  3FYG A;  1FB0 A;  20GS A;  2FUG 2;  1GSS A;  1S3R A;  4D73 A;  2MMA A;  2VL3 A;  4ZBB A;  5B6M A;  3GN3 A;  19GS A;  3MIX A;  4YKF A;  4RI6 A;  4XTS A;  4CY6 A;  3ZZX A;  1AC1 A;  2E7P A;  5DQY A;  1SYX A;  2H8L A;  4F2I A;  2F9S A;  3ZYW A;  2C0G A;  5ABR A;  2R0P A;  2YPM A;  4MAB A;  3A2V A;  5IMZ A;  1ERW A;  2OE1 A;  2V2G A;  3EUR A;  3ZRE A;  2YJH A;  3P2A A;  4MP4 A;  2HRK A;  3G7J A;  3VI5 A;  3FRC A;  1TI3 A;  4L8E A;  3A5I A;  5CAX A;  1Q4J A;  2FWG A;  1PMT A;  2YN1 A;  3A3T A;  3QPM A;  4IW9 A;  1E2Y A;  1UC7 A;  2A2R A;  5FWG A;  3IA1 A;  2OE3 A;  2QA1 A;  4F03 A;  4J56 E;  1ON4 A;  5GSS A;  2UZ8 A;  4N0V A;  4WR5 A;  4Q5R A;  3QD9 A;  1YF0 A;  5F0G A;  4I2U A;  3US3 A;  3DYR A;  4KND A;  1T3B A;  2H1A A;  2H1B A;  4HZ2 A;  4EL1 A;  5E59 A;  2AV4 A;  1ZZY A;  4ZL7 A;  2CQ9 A;  1SL1 B;  4EUY A;  5ECO B;  3APS A;  2B5Y A;  4I97 A;  2PVQ A;  3HY2 A;  5EVO A;  1ZYN A;  3LW9 A;  3C8E A;  5IIZ A;  3HD5 A;  5HFI A;  2H74 A;  5J4U A;  2VAF A;  4DVC A;  3APO A;  4IQA A;  3VI7 A;  4OFN A;  1M3J A;  2NVL A;  5DQS A;  2PUK C;  3E3E A;  1TK8 B;  3UBL A;  4GLT A;  3GST A;  4PUR A;  4F82 A;  4KCA A;  5LCZ A;  3J7Y k;  1TRU A;  2IJY A;  2JAC A;  4QL9 A;  1I9D A;  3UL3 A;  4JR4 A;  5F05 A;  3FZ5 A;  6GSW A;  1XWB A;  2ZNM A;  2CT6 A;  5G5E A;  1SEN A;  2A4V A;  3C7M A;  1HNB A;  3UVH A;  3LEF A;  3WT1 A;  4AGS A;  3WD6 A;  2GT6 A;  1OE8 A;  1YEX A;  2PVO C;  4D73 B;  4X0X A;  5HFG A;  1Z6N A;  2P0G A;  3A5W A;  3M0F A;  1VF4 A;  3MDK A;  1O73 A;  3ZIV A;  1JZO A;  5IMC A;  2YP6 A;  4IP1 A;  3ZML A;  2HRF A;  4K5R A;  1KTE A;  2VLT A;  3GTU A;  1X5E A;  3LOR A;  4POL A;  4MA9 A;  3TKS A;  4RQR A;  2CX3 A;  2NTO A;  2KOK A;  1K0D A;  1URM A;  2VL2 A;  4AF2 A;  4ZBD A;  2FGX A;  5C04 A;  2FWH A;  3QMX A;  1GP1 A;  1XWC A;  4F0B A;  2H19 A;  4YAP A;  2YWN A;  1TP9 A;  4KH7 A;  2KP2 A;  2YZH A;  2LRT A;  2DKI A;  4KSM A;  5KOW A;  4MF6 A;  2YZU A;  1EGO A;  1V2A A;  5D9X A;  2WJU A;  1QK8 A;  2YV9 A;  2IMK A;  4ZL9 A;  3DIE A;  4XS1 A;  2ALB A;  2M80 A;  2VM1 A;  5ECH B;  2CZ3 A;  4EVM A;  2JL4 A;  1GTB A;  2PER A;  4WBR D;  2R0G A;  4ECJ A;  1XVW A;  4GF0 A;  2DJ1 A;  1AQW A;  1SK0 A;  3VUR A;  5BRT A;  4FIW A;  1AW9 A;  4DSQ A;  2E2M A;  1GSU A;  3R3E A;  3D5J A;  2M72 A;  4AJ7 A;  4ISD A;  2QKE A;  1PA3 A;  4V1A g;  4X1U A;  1DBY A;  4MCU A;  2WCI A;  5G31 A;  1M99 A;  2DBC A;  2DMM A;  4EF0 A;  3GH9 A;  1XWK A;  4WBJ A;  3QR6 A;  1SK1 A;  2GT5 A;  3Q19 A;  4FYB A;  4LL1 B;  3TJG A;  4POK A;  4J2F A;  1X5D A;  1V40 A;  3GHA A;  3CBU A;  5CRD A;  5DJL A;  1QFN A;  3I69 A;  2FA4 A;  3Q6O A;  1GNW A;  3QAW A;  1T1V A;  1EP8 A;  3FK8 A;  1O7U A;  4Q5Q A;  4KDY A;  3VPT A;  4O32 A;  2WS2 A;  3TRQ A;  3F3Q A;  2HNL A;  4OO5 A;  4G0I A;  1FVJ A;  1SKW B;  4HS1 A;  3CRT A;  1UN2 A;  4OMV A;  1CQG A;  4NHW A;  3EMX A;  4MZW A;  2I9H A;  1AUC A;  3O76 A;  2YAN A;  4V1A p;  3NZN A;  3DD3 A;  4TKY A;  1FHE A;  3IHG A;  3HJO A;  3M8N A;  1WP0 A;  1O8W A;  2VCT A;  1O81 A;  2XBI A;  2H73 A;  5LNK e;  1EP7 A;  1X0R A;  2E2G A;  1JZR A;  2HZE B;  2MMN A;  4YKG A;  1TJD A;  4ECI A;  2LQO A;  3N9J A;  3KH9 A;  1PRX A;  3G7Y A;  2WDU A;  6GSV A;  2YWI A;  3PGT A;  3F8U A;  3GKK A;  17GS A;  5D9T A;  5DBQ A;  3MNG A;  1H75 A;  4O5R A;  5KN0 A;  2RUF A;  4MNN A;  1Y6E A;  1WWJ A;  2OKA A;  1S3D A;  4G0L A;  4PXO A;  2WFC A;  1XOB A;  3F0I A;  4MZB A;  2QA2 A;  5ECP B;  3UAR A;  3GNJ A;  1XIY A;  3F63 A;  5D9W A;  5J41 A;  3IK9 A;  5GAP D;  3UMA A;  1ERU A;  4A5P A;  2FWE A;  2H1D A;  1XW6 A;  1NHO A;  2PWJ A;  3GH6 A;  4P3Y B;  4O5Q A;  5ECQ B;  1PGT A;  2IMI A;  1MTC A;  3VWU A;  2GTU A;  1G6W A;  3HVV A;  4K2X A;  5EPF A;  4K1F A;  2LV3 A;  1XFL A;  2B6M A;  3FMW A;  1WRY A;  1GTU A;  1PFO A;  2B7K A;  3HKR A;  3PR8 A;  4LLR A;  2LQQ A;  1QQ2 A;  2NPB A;  4K2D A;  4HDE A;  2YV7 A;  3G9B A;  3KD0 A;  4IP6 A;  1THO A;  3TOU A;  1YEP A;  3M9K A;  2CVB A;  2WRT A;  2OBI A;  5DAK B;  1SD8 A;  1H4O A;  4K7N A;  4RQX A;  4NHZ A;  3LFL A;  4GTU A;  1DSB A;  1F37 A;  1THX A;  3DML A;  2B1L A;  3LYK A;  4MJE A;  3EC3 A;  4GCI A;  5FHI A;  1PN0 A;  1VF2 A;  1B4P A;  4Q5F A;  3E0U A;  1X5C A;  4NWY A;  3FHK A;  4NV2 A;  1C72 A;  2PPT A;  1GUK A;  5CRE A;  1GUH A;  2H1G A;  3GRX A;  2F3M A;  3IPZ A;  3GKX A;  4Z7X A;  4QL7 A;  2MBT A;  1OC8 A;  3DVX A;  2C1Y A;  2P5R A;  4ACS A;  1Z9H A;  5H5Q A;  1LBK A;  3MYD A;  4L5O A;  2QGV A;  4TXV A;  2DC5 A;  22GS A;  3P8W A;  2J23 A;  1OKT A;  11GS A;  5CP1 A;  3TDG A;  2KP1 A;  2DJJ A;  3GSS A;  3APQ A;  1K0C A;  2LUS A;  4FQU A;  1ZL9 A;  5B8A A;  3GA4 A;  3GX0 A;  4PUA A;  2GGT A;  2JAD A;  1NHY A;  1TOF A;  3EYT A;  4IVF A;  2GLR A;  4MH3 A;  1XWA A;  2IPA A;  1B8X A;  2FNO A;  2H72 A;  4TXO B;  3P90 A;  2HRA A;  3W6G A;  3L0H A;  2LRN A;  5JWR B;  4X4J A;  1GNE A;  2VIM A;  1IYH A;  3D4T A;  3SBC A;  5GZZ B;  1BJX A;  4ZB6 A;  4DSS B;  3QCP A;  3TJK A;  3TJB A;  2C3T A;  14GS A;  2VD0 A;  4G2E A;  2V32 A;  3VWW A;  5JCW A;  2H0G A;  1R5P A;  4XS4 B;  2R2J A;  5KEJ A;  4G9H A;  4MMM A;  5IOW A;  4TOP A;  2IL3 A;  1EGR A;  2AB6 A;  3FEU A;  3KH7 A;  1K3O A;  1YJ6 A;  2YNX A;  3LSZ A;  2H6X A;  3HVS A;  3KEB A;  2O85 A;  3CRU A;  3ZTL A;  1FG4 A;  2FA8 A;  4K0N A;  1FW1 A;  5ENU A;  1A0R P;  3GFK A;  6GSU A;  4OCF A;  4KUN A;  2OAD A;  3IBH A;  5A4W A;  2MMZ A;  3SWL A;  4PQ1 A;  2DJ2 A;  4K0G A;  1BG5 A;  4WXT A;  4BWS A;  3F6D A;  3GL3 A;  2GSR A;  1JFU A;  1GTA A;  2IFQ B;  1F3B A;  4GQC A;  1ERV A;  3TB2 A;  1A2M A;  3J7Y b;  4GRF A;  1J0F A;  1XG8 A;  3TGZ A;  2IN3 A;  2LJK A;  1N2A A;  1EV9 A;  3IV4 A;  1A0F A;  4JE1 A;  4I5Q A;  3AY8 A;  2GSQ A;  4CDO A;  4XRD A;  5ECI B;  3L78 A;  4HZ4 A;  3O6T A;  4IS0 A;  1GSE A;  2VM2 A;  4IN0 A;  3HHV A;  1TRW A;  6GSY A;  2GVP A;  1YQ1 A;  4AJ6 A;  5C00 A;  3KXO A;  3IDV A;  2L5O A;  3F3R A;  2JSZ A;  5HR3 A;  2R6K A;  2VLV A;  2HZF A;  4ICY A;  2R37 A;  1B4Q A;  2MZC A;  2L6D A;  1X9M B;  3M9J A;  4TR3 A;  2H66 A;  3VLN A;  2L6C A;  4YQM A;  2TIR A;  1PSQ A;  1DE1 A;  5DJM A;  4POM A;  4BA7 A;  1AAZ A;  1KBN A;  5EY6 A;  2RM6 A;  4G0K A;  3A2W A;  4ECB A;  4GST A;  5CNW A;  1TDI A;  1QXH A;  4BVY B;  3QOU A;  4POB A;  3DVW A;  1M2A A;  5ECS A;  4KW6 A;  2JZS A;  18GS A;  3LWA A;  2LKU A;  4PQI A;  2OA7 A;  3D6I A;  5IMA A;  2I1U A;  1ABA A;  4NXI A;  3WGX A;  3FZ9 A;  4HU7 A;  5DVB A;  1GRX A;  4WR4 A;  2LEG A;  1PX6 A;  2O87 A;  1TU8 A;  3ZRD A;  2EC4 A;  5CRG A;  5AIX A;  2TRC P;  2DJ0 A;  5AGY A;  1Z6M A;  3CSJ A;  3G7I A;  4I6X A;  4AJ8 A;  1XCC A;  3ZLP A;  5COH A;  3LJR A;  3KZQ A;  1F9M A;  2OAC A;  1FAA A;  4QQ7 A;  4N11 A;  3BBY A;  2HZE A;  3C1R A;  2FY6 A;  1GLQ A;  2PN8 A;  5J5N A;  2BMX A;  3H79 A;  2E0Q A;  5J3R A;  3D0Z A;  3GUR A;  4O92 A;  4PX1 A;  2VD1 A;  4ID0 A;  5H5S A;  3FY7 A;  5D93 A;  3QAG A;  1R4W A;  2PU9 C;  1K0O A;  3KTB A;  4OWY A;  1SL2 B;  1EOH A;  5CRH A;  3HXS A;  4JZQ A;  2F51 A;  2DJ3 A;  3M3M A;  5IMV A;  1WIK A;  1V98 A;  4TR0 A;  1B9Y C;  3IE3 A;  2HXK A;  2X8C A;  4KAE A;  5IPG A;  2LST A;  1GSY A;  3M1G A;  2AAW A;  4MK3 A;  4L0W A;  3UOM A;  1EOG A;  3UEM A;  2GDR A;  1XWG A;  13GS A;  4ULX A;  1F3A A;  4OCE A;  3NOF A;  2P5Q A;  3EPT A;  3KTL A;  2C3N A;  5A5K A;  4N10 A;  2VLU A;  1ZYQ B;  1YDK A;  3VWX A;  1JZW A;  1BED A;  3TJJ A;  1EEJ A;  4PGT A;  5DAK A;  4FH8 A;  3H93 A;  4V2L A;  3C73 A;  1A8L A;  4N0Z A;  3ZIT A;  2GS3 A;  4IJ3 A;  2GZY A;  1JLV A;  2R5G A;  1SJZ A;  2VCX A;  5ID2 B;  3TJF A;  1HD2 A;  1Z7R A;  5ECR B;  5G1L A;  1RQM A;  5DAL B;  3ED3 A;  2DKH A;  1XBS A;  2YWO A;  3FR3 A;  4PQH A;  1A8Y A;  1FB6 A;  1ML6 A;  1EWX A;  5B6N A;  2RII A;  1ZOF A;  3LG6 A;  3EU4 A;  3TOT A;  4G19 A;  1G6Y A;  1Z5Y E;  3FZA A;  4X43 A;  1R26 A;  1TK5 B;  2L59 A;  2IWT A;  5AIS A;  1M2D A;  5A4V A;  4JU5 A;  4ZB8 A;  2WZ9 A;  5G2Z A;  6GST A;  2G0F A;  2H30 A;  1USB A;  2C80 A;  4LL4 B;  3ZFL A;  4GSS A;  1DUG A;  3VWV A;  5JWO B;  2P31 A;  2ES7 A;  3F6F A;  5IMD A;  5G5F A;  1B48 A;  4Z2R A;  1PKZ A;  1GSQ A;  2PBJ A;  3CTG A;  3HYP A;  3F9U A;  3UIW A;  1EZK A;  1JZD A;  1TW9 A;  2N5B A;  3WYW A;  3DXB A;  1G7O A;  1GTI A;  1V58 A;  4NAX A;  4KGI A;  2HFD A;  2AYT A;  1MD3 A;  4TXO A;  4O7H A;  2O89 A;  3MSZ A;  4I8B A;  2RLI A;  1LJR A;  3IC8 A;  3E9J B;  3ZVJ A;  4GXZ A;  5IPH A;  2VOC A;  4KB3 A;  2OBK A;  1GH2 A;  5JWQ B;  4DSS A;  5GAN D;  2FHE A;  3D22 A;  4XS4 A;  4FYU A;  1JLW A;  5GST A;  3IR4 A;  3GIX A;  1W89 A;  3KMO A;  3R2Q A;  4HOJ A;  2OE0 A;  1U3A A;  2KLX A;  3I6A A;  1PL1 A;  2O8V B;  1GL8 A;  2YJ7 A;  3RBT A;  3I9V 2;  2A4H A;  3Q74 A;  4EIQ A;  3K8N A;  2NDO A;  4EO3 A;  4IBP A;  2A2P A;  1GUM A;  1OYJ A;  3HZ4 A;  2L4Q A;  2HT9 A;  2B1K A;  5ELG A;  2IIY A;  1T7P B;  2ZUP A;  4O5U A;  2CAQ A;  4MJB A;  1F2E A;  1OC9 B;  4ECC A;  4EXJ A;  2JZR A;  5F06 A;  3FKF A;  2HI7 A;  2NBS A;  4K9Z A;  1RW1 A;  4HU9 A;  4IHU A;  1F6M C;  1EEM A;  3IK7 A;  5AN1 A;  1OC3 A;  2IFQ A;  2BJX A;  4HJ2 A;  3UBK A;  1K0M A;  3EVI A;  1TU7 A;  5KN1 A;  1FVK A;  1TRV A;  4V2N A;  5H5R A;  4E8H A;  3KP9 A;  2RM5 A;  2X4A A;  3L9S A;  5JCG A;  1XW9 A;  2JZT A;  2N5A A;  1X9S B;  3PPU A;  5IOX A;  1M0U A;  5IQY A;  5F07 A;  3LGC A;  1AQX A;  12GS A;  4XHM A;  3BCI A;  3IRA A;  4WET A;  2H70 A;  1NSW A;  2AUV A;  1O8X A;  5EL8 A;  3ERG A;  4GWR A;  2MYG A;  3HJM A;  3Q18 A;  1SYR A;  2KUC A;  4HI7 A;  1XOA A;  1AXD A;  1XXU A;  1Q98 A;  5IM9 A;  3LXZ A;  2XPE A;  1M9B A;  4F0C A;  1KEB A;  4KDU A;  2K9F A;  2AJQ B;  4NMU A;  1UA5 A;  4JRR A;  4DEJ A;  4BWQ A;  2LNT A;  3BOA A;  2I81 A;  4ZXG A;  1OKD A;  4BVY A;  2H75 A;  5J9C A;  3IXR A;  1SJ6 A;  3FW2 A;  1M7T A;  2GST A;  5KN3 A;  1PQN A;  3CTF A;  3P7X A;  3KJY A;  2VUP A;  5F8B A;  1K0B A;  3HDC A;  4JBB A;  4KA0 A;  3H4K A;  1QUW A;  5CYY A;  3TUE A;  3D4M A;  1IYI A;  2HE3 A;  3EE2 A;  4TR1 B;  2YWM A;  3CYN A;  4ML6 A;  3KP8 A;  3S9F A;  10GS A;  4PTS A;  2FWF A;  1R7H A;  4ZB9 A;  2V1M A;  4L5L A;  1DE2 A;  1BQ7 A;  5JCU A;  2GZP A;  3NIV A;  1BAY A;  3KMN A;  2EIQ A;  4HJM A;  3ERW A;  1T4Z A;  1GSD A;  5J9B A;  3WGE A;  4CY8 A;  3VFI A;  2CVK A;  2K8S A;  4TN8 A;  3CSH A;  2IME A;  3DKS A;  4EIP A;  2X64 A;  1OE7 A;  5DCG A;  4BL7 B;  5D96 A;  3CSI A;  4LMV A;  2HLS A;  3RPN A;  1LU4 A;  4ILF A;  3MAK A;  3IHQ A;  1W4V A;  3CXG A;  1XVQ A;  4IJI A;  2XPD A;  2C0F A;  2B5X A;  3TKQ A;  1OAZ A;  3KGK A;  1Y25 A;  4MDC A;  2VO4 A;  1WOU A;  3LQ7 A;  2L4C A;  3H1N A;  4ZBA A;  4KX4 A;  4XRA A;  1ST9 A;  1G7E A;  2WUL A;  3RPP A;  2V41 A;  3QAV A;  4K8M A;  3HZ8 A;  5G1K A;  1A24 A;  3C71 A;  1J08 A;  1HQO A;  4KCE A;  3F4R A;  2B3S A;  3BJ5 A;  2DIZ A;  1YKC A;  3ME8 A;  3IAS 2;  3EMP A;  1TKD B;  1NW2 A;  2VL9 A;  4ZIJ A;  4RUV A;  2HSM A;  1SK2 A;  2LJR A;  3IOS A;  5ECM B;  3TCO A;  2L57 A;  3WT2 A;  2HRN A;  5HR0 A;  2LS5 A;  2DSA A;  3GL5 A;  1M2B A;  5ID2 A;  1MEK A;  5HFK A;  2HYX A;  5DAL A;  2IMD A;  2OJL A;  1ZGN A;  4YAV A;  5IO0 A;  2DIY A;  5ECN B;  4CHS A;  4BVX B;  3ZIJ A;  4USS A;  3GX8 A;  2PMT A;  1TTZ A;  5G30 A;  5HQP A;  1TK0 B;  1PX7 A;  2QSI A;  2WB9 A;  3JCM L;  4XIH A;  1MDI A;  1V57 A;  3ISO A;  4HQZ A;  1N8J A;  3LXT A;  3TRX A;  2R3X A;  4EKZ A;  2H71 A;  4NV5 A;  1NM3 A;  1V9W A;  1WJK A;  4K7I A;  2B7J A;  4IEL A;  1FOV A;  1BYE A;  4JR6 A;  3GKM A;  16GS A;  2I3Y A;  4TVE A;  1ERT A;  4V2M A;  2H0I A;  5DCH A;  2ON5 A;  1SD9 A;  1T4Y A;  4OFT A;  2F8A A;  5B7C A;  3ERF A;  1A2J A;  3ZFB A;  2Z9S A;  3TKS C;  3ZL5 A;  2VL2 C;  4JED A;  1MD4 A;  1K0N A;  1S3A A;  2LRC A;  5KOX A;  1PL2 A;  4MJA A;  2K18 A;  2R4V A;  3HJP A;  1PN9 A;  1M9A A;  2C0D A;  2CAI A;  4K7O A;  2TRX A;  2FLS A;  5INY A;  3FR9 A;  3EWL A;  1SU9 A;  1SKS B;  1VRS D;  5ECK B;  2QC7 A;  3DWV A;  4GSN A;  1CQH A;  4ML1 A;  1RK4 A;  1ZYE A;  3L9U A;  4Q5N A;  2C4J A;  1EV4 A;  4K5S A;  1VGL A;  4KE3 A;  3MWH A;  2JU5 A;  2EIR A;  4MF7 A;  3BD2 A;  3TKP A;  1YF1 A;  3DRN A;  1O6J A;  1O85 A;  2K6V A;  2V6K A;  1GSF A;  4E8E A;  3CMI A;  4G10 A;  5B8B A;  1Z3E A;  2XBQ A;  3TKR A;  2DJK A;  2H0H A;  3FZ4 A;  2IMF A;  2N5F A;  2FD3 A;  1ZYP A;  1SL0 B;  4F9Z A; 
#chains in the Genus database with same CATH homology
 1OC9 A;  2X8H A;  3GMF A;  3KIJ A;  4MZC A;  1YKA A;  5L71 A;  3GYK A;  4ZL8 A;  1OVN A;  2H76 A;  2O7K A;  4EC0 A;  1T00 A;  1BX9 A;  5CRW A;  1AIU A;  6GSS A;  1KNG A;  4MH2 A;  1Z7P A;  3W8S A;  2PGT A;  4YQV A;  1K3Y A;  2FCH A;  1YY7 A;  4N30 A;  1SKR B;  2F8F A;  2VCZ A;  3DGQ A;  1ILO A;  4TR4 A;  4HQS A;  1TI1 A;  1UVZ A;  3UAP A;  5HR2 A;  2X49 A;  2GZZ A;  1FO5 A;  2GQL A;  1J9B A;  3HA9 A;  5IMF A;  3F4S A;  3KCM A;  1X9W B;  4J57 E;  3GV1 A;  1VF3 A;  3EU3 A;  3LYP A;  3IAM 2;  3DEX A;  5CO3 A;  5ECL B;  3V1W A;  4WF5 A;  4LA1 A;  5ELA A;  2XC2 A;  2ZCT A;  1A23 A;  5BMU A;  1QGV A;  1GLP A;  2C3Q A;  3U6V A;  4L0U A;  4XS6 A;  3ZVJ D;  1GUL A;  1U88 A;  1MDJ A;  4LMW A;  2I4A A;  3F4T A;  4H86 A;  4OO4 A;  3HVX A;  3UVT A;  2ON7 A;  4Z2T A;  3EIN A;  3GTU B;  4IGJ A;  1WMJ A;  4KSO A;  2WGR A;  1GWC A;  1U3I A;  4K6X A;  3VK9 A;  4DSR A;  1FOH A;  1B9X C;  8GSS A;  4IKH A;  2C0E A;  3KM6 A;  4PNG A;  4Z2U A;  2YOI A;  3HCZ A;  2YCD A;  2CX4 A;  5AIV A;  3QFA C;  3WGD A;  2GSS A;  2AHE A;  4TR1 A;  4TW5 A;  3GKN A;  2R0C A;  4BPY A;  5D8I A;  3PH9 A;  2M46 A;  2V6O A;  4KDX A;  3UJ1 A;  1G0T A;  2VCQ A;  5DDL A;  4EDY A;  3A2X A;  2K8V A;  4I2T A;  3ZMK A;  1U87 A;  2REM A;  4KF9 A;  3RHC A;  1WPI A;  1VF1 A;  7GSS A;  4HEA 2;  3ME7 A;  3IC4 A;  2B5E A;  1HYU A;  4XCS A;  3OR5 A;  3I43 A;  4WF4 A;  1AQV A;  4MF5 A;  2RUE A;  2VCW A;  1T8E B;  4CW9 A;  4TRX A;  4WKW A;  1E6B A;  4BL7 A;  5KN2 A;  3QFB C;  2KHP A;  3O3T A;  4OD7 A;  3RHB A;  3RDW A;  1R5A A;  1A2L A;  2CZ2 A;  1K3L A;  4IQ1 A;  2BTO T;  1K0A A;  1PD2 1;  2GQM A;  5HR1 A;  2VCV A;  2MMO A;  1ZMA A;  2MBS A;  4OFM A;  2LTK A;  5D73 A;  3QDN A;  2G2Q A;  3C1S A;  3D21 A;  1WE0 A;  4MJC A;  4EE0 A;  5LD0 A;  2A2S A;  2X99 A;  2CV4 A;  1ACV A;  3TKS E;  3N5O A;  2EIO A;  5FT3 A;  1XW5 A;  9GSS A;  2D2Z A;  4WEY A;  3L4N A;  2DLX A;  2LNS A;  1I5G A;  1HNA A;  2J9H A;  2H01 A;  4GQF A;  2HSH A;  3GUS A;  1JHB A;  3FR6 A;  1XPV A;  4MLY A;  1SJI A;  2H6Y A;  3L9V A;  1TRS A;  2X8G A;  2XHF A;  4YH2 A;  2LJA A;  3W8J A;  2H6Z A;  5E4W A;  4EDZ A;  5IO2 A;  4RI7 A;  2CA8 A;  2L5L A;  5A4U A;  4BVX A;  3H8Q A;  2DML A;  1XZO A;  3U5R E;  1PKW A;  4HUA A;  4ZIL A;  3PIN A;  4PUF C;  4PNF A;  1MDK A;  1QMV A;  2CVD A;  3TRP A;  3RAZ A;  4MPF A;  1S3C A;  2C8U A;  4NPB A;  5D9V A;  1HNC A;  3VPQ A;  2HSY A;  4YQU A;  1YZX A;  2GQK A;  3BCK A;  6GSX A;  1ZCP A;  1TXX A;  2JSY A;  1U6T A;  4FYC A;  4FO5 A;  4MPG A;  3FYG A;  1FB0 A;  20GS A;  2FUG 2;  1GSS A;  4D73 A;  2MMA A;  2VL3 A;  4ZBB A;  5B6M A;  3GN3 A;  19GS A;  3MIX A;  4YKF A;  4RI6 A;  4XTS A;  4CY6 A;  3ZZX A;  1AC1 A;  2E7P A;  5DQY A;  1SYX A;  2H8L A;  4F2I A;  2F9S A;  3ZYW A;  2C0G A;  5ABR A;  2R0P A;  2YPM A;  4MAB A;  3A2V A;  5IMZ A;  1ERW A;  2OE1 A;  2V2G A;  3EUR A;  3ZRE A;  2YJH A;  3P2A A;  4MP4 A;  2HRK A;  3G7J A;  3VI5 A;  3FRC A;  1TI3 A;  4L8E A;  3A5I A;  5CAX A;  1Q4J A;  2FWG A;  1PMT A;  2YN1 A;  3A3T A;  3QPM A;  4IW9 A;  1E2Y A;  1UC7 A;  2A2R A;  5FWG A;  3IA1 A;  2OE3 A;  2QA1 A;  4F03 A;  4J56 E;  1ON4 A;  5GSS A;  2UZ8 A;  4N0V A;  4WR5 A;  4Q5R A;  3QD9 A;  1YF0 A;  5F0G A;  4I2U A;  3US3 A;  3DYR A;  4KND A;  1T3B A;  2H1A A;  2H1B A;  4HZ2 A;  4EL1 A;  5E59 A;  2AV4 A;  1ZZY A;  4ZL7 A;  2CQ9 A;  1SL1 B;  4EUY A;  5ECO B;  3APS A;  2B5Y A;  4I97 A;  2PVQ A;  3HY2 A;  5EVO A;  1ZYN A;  3LW9 A;  3C8E A;  5IIZ A;  3HD5 A;  5HFI A;  2H74 A;  5J4U A;  2VAF A;  4DVC A;  3APO A;  4IQA A;  3VI7 A;  4OFN A;  2NVL A;  5DQS A;  2PUK C;  3E3E A;  1TK8 B;  3UBL A;  4GLT A;  3GST A;  4PUR A;  4F82 A;  4KCA A;  5LCZ A;  3J7Y k;  1TRU A;  2IJY A;  2JAC A;  4QL9 A;  1I9D A;  3UL3 A;  4JR4 A;  5F05 A;  3FZ5 A;  6GSW A;  1XWB A;  2ZNM A;  2CT6 A;  5G5E A;  1SEN A;  2A4V A;  3C7M A;  1HNB A;  3UVH A;  3LEF A;  3WT1 A;  4AGS A;  3WD6 A;  2GT6 A;  1OE8 A;  1YEX A;  2PVO C;  4D73 B;  4X0X A;  5HFG A;  1Z6N A;  2P0G A;  3A5W A;  3M0F A;  1VF4 A;  3MDK A;  1O73 A;  3ZIV A;  1JZO A;  5IMC A;  2YP6 A;  4IP1 A;  3ZML A;  2HRF A;  4K5R A;  1KTE A;  2VLT A;  3GTU A;  1X5E A;  3LOR A;  4POL A;  4MA9 A;  3TKS A;  4RQR A;  2CX3 A;  2NTO A;  2KOK A;  1K0D A;  1URM A;  2VL2 A;  4AF2 A;  4ZBD A;  2FGX A;  5C04 A;  2FWH A;  3QMX A;  1GP1 A;  1XWC A;  4F0B A;  2H19 A;  4YAP A;  2YWN A;  1TP9 A;  4KH7 A;  2KP2 A;  2YZH A;  2LRT A;  2DKI A;  4KSM A;  5KOW A;  4MF6 A;  2YZU A;  1EGO A;  1V2A A;  5D9X A;  2WJU A;  1QK8 A;  2YV9 A;  2IMK A;  4ZL9 A;  3DIE A;  4XS1 A;  2ALB A;  2M80 A;  2VM1 A;  5ECH B;  2CZ3 A;  4EVM A;  2JL4 A;  1GTB A;  2PER A;  4WBR D;  2R0G A;  4ECJ A;  1XVW A;  4GF0 A;  2DJ1 A;  1AQW A;  1SK0 A;  3VUR A;  5BRT A;  4FIW A;  1AW9 A;  4DSQ A;  2E2M A;  1GSU A;  3R3E A;  3D5J A;  2M72 A;  4AJ7 A;  4ISD A;  2QKE A;  1PA3 A;  4V1A g;  4X1U A;  1DBY A;  4MCU A;  2WCI A;  5G31 A;  1M99 A;  2DBC A;  2DMM A;  4EF0 A;  3GH9 A;  1XWK A;  4WBJ A;  3QR6 A;  1SK1 A;  2GT5 A;  3Q19 A;  4FYB A;  4LL1 B;  3TJG A;  4POK A;  4J2F A;  1X5D A;  1V40 A;  3GHA A;  3CBU A;  5CRD A;  5DJL A;  1QFN A;  3I69 A;  2FA4 A;  3Q6O A;  1GNW A;  3QAW A;  1T1V A;  1EP8 A;  3FK8 A;  1O7U A;  4Q5Q A;  4KDY A;  3VPT A;  4O32 A;  2WS2 A;  3TRQ A;  3F3Q A;  2HNL A;  4OO5 A;  4G0I A;  1FVJ A;  1SKW B;  4HS1 A;  3CRT A;  1UN2 A;  4OMV A;  1CQG A;  4NHW A;  3EMX A;  4MZW A;  2I9H A;  1AUC A;  3O76 A;  2YAN A;  4V1A p;  3NZN A;  3DD3 A;  4TKY A;  1FHE A;  3IHG A;  3HJO A;  3M8N A;  1WP0 A;  1O8W A;  2VCT A;  1O81 A;  2XBI A;  2H73 A;  5LNK e;  1EP7 A;  1X0R A;  2E2G A;  1JZR A;  2HZE B;  2MMN A;  4YKG A;  1TJD A;  4ECI A;  2LQO A;  3N9J A;  3KH9 A;  1PRX A;  3G7Y A;  2WDU A;  6GSV A;  2YWI A;  3PGT A;  3F8U A;  3GKK A;  17GS A;  5D9T A;  5DBQ A;  3MNG A;  1H75 A;  4O5R A;  5KN0 A;  2RUF A;  4MNN A;  1Y6E A;  1WWJ A;  2OKA A;  1S3D A;  4G0L A;  4PXO A;  2WFC A;  1XOB A;  3F0I A;  4MZB A;  2QA2 A;  5ECP B;  3UAR A;  3GNJ A;  1XIY A;  3F63 A;  5D9W A;  5J41 A;  3IK9 A;  5GAP D;  3UMA A;  1ERU A;  4A5P A;  2FWE A;  2H1D A;  1XW6 A;  1NHO A;  2PWJ A;  3GH6 A;  4P3Y B;  4O5Q A;  5ECQ B;  1PGT A;  2IMI A;  1MTC A;  3VWU A;  2GTU A;  1G6W A;  3HVV A;  4K2X A;  5EPF A;  4K1F A;  2LV3 A;  1XFL A;  2B6M A;  3FMW A;  1WRY A;  1GTU A;  2B7K A;  3HKR A;  3PR8 A;  4LLR A;  2LQQ A;  1QQ2 A;  2NPB A;  4K2D A;  4HDE A;  2YV7 A;  3G9B A;  3KD0 A;  4IP6 A;  1THO A;  3TOU A;  1YEP A;  3M9K A;  2CVB A;  2WRT A;  2OBI A;  5DAK B;  1SD8 A;  1H4O A;  4K7N A;  4RQX A;  4NHZ A;  3LFL A;  4GTU A;  1DSB A;  1F37 A;  1THX A;  3DML A;  2B1L A;  3LYK A;  4MJE A;  3EC3 A;  4GCI A;  5FHI A;  1PN0 A;  1VF2 A;  1B4P A;  4Q5F A;  3E0U A;  1X5C A;  4NWY A;  3FHK A;  4NV2 A;  1C72 A;  2PPT A;  1GUK A;  5CRE A;  1GUH A;  2H1G A;  3GRX A;  2F3M A;  3IPZ A;  3GKX A;  4Z7X A;  4QL7 A;  2MBT A;  1OC8 A;  3DVX A;  2C1Y A;  2P5R A;  4ACS A;  1Z9H A;  5H5Q A;  1LBK A;  3MYD A;  4L5O A;  2QGV A;  4TXV A;  2DC5 A;  22GS A;  3P8W A;  2J23 A;  1OKT A;  11GS A;  5CP1 A;  3TDG A;  2KP1 A;  2DJJ A;  3GSS A;  3APQ A;  1K0C A;  2LUS A;  4FQU A;  1ZL9 A;  5B8A A;  3GA4 A;  3GX0 A;  4PUA A;  2GGT A;  2JAD A;  1NHY A;  1TOF A;  3EYT A;  4IVF A;  2GLR A;  4MH3 A;  1XWA A;  2IPA A;  1B8X A;  2FNO A;  2H72 A;  4TXO B;  3P90 A;  2HRA A;  3W6G A;  3L0H A;  2LRN A;  5JWR B;  4X4J A;  1GNE A;  2VIM A;  1IYH A;  3D4T A;  3SBC A;  5GZZ B;  1BJX A;  4ZB6 A;  4DSS B;  3QCP A;  3TJK A;  3TJB A;  2C3T A;  14GS A;  2VD0 A;  4G2E A;  2V32 A;  3VWW A;  5JCW A;  2H0G A;  1R5P A;  4XS4 B;  2R2J A;  5KEJ A;  4G9H A;  4MMM A;  5IOW A;  4TOP A;  2IL3 A;  1EGR A;  2AB6 A;  3FEU A;  3KH7 A;  1K3O A;  1YJ6 A;  2YNX A;  3LSZ A;  2H6X A;  3HVS A;  3KEB A;  2O85 A;  3CRU A;  3ZTL A;  1FG4 A;  2FA8 A;  4K0N A;  1FW1 A;  5ENU A;  1A0R P;  3GFK A;  6GSU A;  4OCF A;  4KUN A;  2OAD A;  3IBH A;  5A4W A;  2MMZ A;  3SWL A;  4PQ1 A;  2DJ2 A;  4K0G A;  1BG5 A;  4WXT A;  4BWS A;  3F6D A;  3GL3 A;  2GSR A;  1JFU A;  1GTA A;  2IFQ B;  1F3B A;  4GQC A;  1ERV A;  3TB2 A;  1A2M A;  3J7Y b;  4GRF A;  1J0F A;  3TGZ A;  2IN3 A;  2LJK A;  1N2A A;  1EV9 A;  3IV4 A;  1A0F A;  4JE1 A;  4I5Q A;  3AY8 A;  2GSQ A;  4CDO A;  4XRD A;  5ECI B;  3L78 A;  4HZ4 A;  3O6T A;  4IS0 A;  1GSE A;  2VM2 A;  4IN0 A;  3HHV A;  1TRW A;  6GSY A;  2GVP A;  1YQ1 A;  4AJ6 A;  5C00 A;  3KXO A;  3IDV A;  2L5O A;  3F3R A;  2JSZ A;  5HR3 A;  2R6K A;  2VLV A;  2HZF A;  4ICY A;  2R37 A;  1B4Q A;  2MZC A;  2L6D A;  1X9M B;  3M9J A;  4TR3 A;  2H66 A;  3VLN A;  2L6C A;  4YQM A;  2TIR A;  1PSQ A;  1DE1 A;  5DJM A;  4POM A;  4BA7 A;  1AAZ A;  1KBN A;  5EY6 A;  2RM6 A;  4G0K A;  3A2W A;  4ECB A;  4GST A;  5CNW A;  1TDI A;  1QXH A;  4BVY B;  3QOU A;  4POB A;  3DVW A;  1M2A A;  5ECS A;  4KW6 A;  2JZS A;  18GS A;  3LWA A;  2LKU A;  4PQI A;  2OA7 A;  3D6I A;  5IMA A;  2I1U A;  1ABA A;  4NXI A;  3WGX A;  3FZ9 A;  4HU7 A;  5DVB A;  1GRX A;  4WR4 A;  2LEG A;  1PX6 A;  2O87 A;  1TU8 A;  3ZRD A;  2EC4 A;  5CRG A;  5AIX A;  2TRC P;  2DJ0 A;  5AGY A;  1Z6M A;  3CSJ A;  3G7I A;  4I6X A;  4AJ8 A;  1XCC A;  3ZLP A;  5COH A;  3LJR A;  3KZQ A;  1F9M A;  2OAC A;  1FAA A;  4QQ7 A;  4N11 A;  3BBY A;  2HZE A;  3C1R A;  2FY6 A;  1GLQ A;  2PN8 A;  5J5N A;  2BMX A;  3H79 A;  2E0Q A;  5J3R A;  3D0Z A;  3GUR A;  4O92 A;  4PX1 A;  2VD1 A;  4ID0 A;  5H5S A;  3FY7 A;  5D93 A;  3QAG A;  1R4W A;  2PU9 C;  1K0O A;  3KTB A;  4OWY A;  1SL2 B;  1EOH A;  5CRH A;  3HXS A;  4JZQ A;  2F51 A;  2DJ3 A;  3M3M A;  5IMV A;  1WIK A;  1V98 A;  4TR0 A;  1B9Y C;  3IE3 A;  2HXK A;  2X8C A;  4KAE A;  5IPG A;  2LST A;  1GSY A;  3M1G A;  2AAW A;  4MK3 A;  4L0W A;  3UOM A;  1EOG A;  3UEM A;  2GDR A;  1XWG A;  13GS A;  4ULX A;  1F3A A;  4OCE A;  3NOF A;  2P5Q A;  3EPT A;  3KTL A;  2C3N A;  5A5K A;  4N10 A;  2VLU A;  1ZYQ B;  1YDK A;  3VWX A;  1JZW A;  1BED A;  3TJJ A;  1EEJ A;  4PGT A;  5DAK A;  4FH8 A;  3H93 A;  4V2L A;  3C73 A;  1A8L A;  4N0Z A;  3ZIT A;  2GS3 A;  4IJ3 A;  2GZY A;  1JLV A;  2R5G A;  1SJZ A;  2VCX A;  5ID2 B;  3TJF A;  1HD2 A;  1Z7R A;  5ECR B;  5G1L A;  1RQM A;  5DAL B;  3ED3 A;  2DKH A;  1XBS A;  2YWO A;  3FR3 A;  4PQH A;  1A8Y A;  1FB6 A;  1ML6 A;  1EWX A;  5B6N A;  2RII A;  1ZOF A;  3LG6 A;  3EU4 A;  3TOT A;  4G19 A;  1G6Y A;  1Z5Y E;  3FZA A;  4X43 A;  1R26 A;  1TK5 B;  2L59 A;  2IWT A;  5AIS A;  1M2D A;  5A4V A;  4JU5 A;  4ZB8 A;  2WZ9 A;  5G2Z A;  6GST A;  2G0F A;  2H30 A;  1USB A;  2C80 A;  4LL4 B;  3ZFL A;  4GSS A;  1DUG A;  3VWV A;  5JWO B;  2P31 A;  2ES7 A;  3F6F A;  5IMD A;  5G5F A;  1B48 A;  4Z2R A;  1PKZ A;  1GSQ A;  2PBJ A;  3CTG A;  3HYP A;  3F9U A;  3UIW A;  1EZK A;  1JZD A;  1TW9 A;  2N5B A;  3WYW A;  3DXB A;  1G7O A;  1GTI A;  1V58 A;  4NAX A;  4KGI A;  2HFD A;  2AYT A;  1MD3 A;  4TXO A;  4O7H A;  2O89 A;  3MSZ A;  4I8B A;  2RLI A;  1LJR A;  3IC8 A;  3E9J B;  3ZVJ A;  4GXZ A;  5IPH A;  2VOC A;  4KB3 A;  2OBK A;  1GH2 A;  5JWQ B;  4DSS A;  5GAN D;  2FHE A;  3D22 A;  4XS4 A;  4FYU A;  1JLW A;  5GST A;  3IR4 A;  3GIX A;  1W89 A;  3KMO A;  3R2Q A;  4HOJ A;  2OE0 A;  1U3A A;  2KLX A;  3I6A A;  1PL1 A;  2O8V B;  1GL8 A;  2YJ7 A;  3RBT A;  3I9V 2;  2A4H A;  3Q74 A;  4EIQ A;  3K8N A;  2NDO A;  4EO3 A;  4IBP A;  2A2P A;  1GUM A;  1OYJ A;  3HZ4 A;  2L4Q A;  2HT9 A;  2B1K A;  5ELG A;  2IIY A;  1T7P B;  2ZUP A;  4O5U A;  2CAQ A;  4MJB A;  1F2E A;  1OC9 B;  4ECC A;  4EXJ A;  2JZR A;  5F06 A;  3FKF A;  2HI7 A;  2NBS A;  4K9Z A;  1RW1 A;  4HU9 A;  4IHU A;  1F6M C;  1EEM A;  3IK7 A;  5AN1 A;  1OC3 A;  2IFQ A;  2BJX A;  4HJ2 A;  3UBK A;  1K0M A;  3EVI A;  1TU7 A;  5KN1 A;  1FVK A;  1TRV A;  4V2N A;  5H5R A;  4E8H A;  3KP9 A;  2RM5 A;  2X4A A;  3L9S A;  5JCG A;  1XW9 A;  2JZT A;  2N5A A;  1X9S B;  3PPU A;  5IOX A;  1M0U A;  5IQY A;  5F07 A;  3LGC A;  1AQX A;  12GS A;  4XHM A;  3BCI A;  3IRA A;  4WET A;  2H70 A;  1NSW A;  2AUV A;  1O8X A;  5EL8 A;  3ERG A;  4GWR A;  2MYG A;  3HJM A;  3Q18 A;  1SYR A;  2KUC A;  4HI7 A;  1XOA A;  1AXD A;  1XXU A;  1Q98 A;  5IM9 A;  3LXZ A;  2XPE A;  1M9B A;  4F0C A;  1KEB A;  4KDU A;  2K9F A;  2AJQ B;  4NMU A;  1UA5 A;  4JRR A;  4DEJ A;  4BWQ A;  2LNT A;  3BOA A;  2I81 A;  4ZXG A;  1OKD A;  4BVY A;  2H75 A;  5J9C A;  3IXR A;  1SJ6 A;  3FW2 A;  1M7T A;  2GST A;  5KN3 A;  1PQN A;  3CTF A;  3P7X A;  3KJY A;  2VUP A;  5F8B A;  1K0B A;  3HDC A;  4JBB A;  4KA0 A;  3H4K A;  1QUW A;  5CYY A;  3TUE A;  3D4M A;  1IYI A;  2HE3 A;  3EE2 A;  4TR1 B;  2YWM A;  3CYN A;  4ML6 A;  3KP8 A;  3S9F A;  10GS A;  4PTS A;  2FWF A;  1R7H A;  4ZB9 A;  2V1M A;  4L5L A;  1DE2 A;  1BQ7 A;  5JCU A;  2GZP A;  3NIV A;  1BAY A;  3KMN A;  2EIQ A;  4HJM A;  3ERW A;  1T4Z A;  1GSD A;  5J9B A;  3WGE A;  4CY8 A;  3VFI A;  2CVK A;  2K8S A;  4TN8 A;  3CSH A;  2IME A;  3DKS A;  4EIP A;  2X64 A;  1OE7 A;  5DCG A;  4BL7 B;  5D96 A;  3CSI A;  4LMV A;  2HLS A;  3RPN A;  1LU4 A;  4ILF A;  3MAK A;  3IHQ A;  1W4V A;  3CXG A;  1XVQ A;  4IJI A;  2XPD A;  2C0F A;  2B5X A;  3TKQ A;  1OAZ A;  3KGK A;  1Y25 A;  4MDC A;  2VO4 A;  1WOU A;  3LQ7 A;  2L4C A;  3H1N A;  4ZBA A;  4KX4 A;  4XRA A;  1ST9 A;  1G7E A;  2WUL A;  3RPP A;  2V41 A;  3QAV A;  4K8M A;  3HZ8 A;  5G1K A;  1A24 A;  3C71 A;  1J08 A;  1HQO A;  4KCE A;  3F4R A;  2B3S A;  3BJ5 A;  2DIZ A;  1YKC A;  3ME8 A;  3IAS 2;  3EMP A;  1TKD B;  1NW2 A;  2VL9 A;  4ZIJ A;  4RUV A;  2HSM A;  1SK2 A;  2LJR A;  3IOS A;  5ECM B;  3TCO A;  2L57 A;  3WT2 A;  2HRN A;  5HR0 A;  2LS5 A;  2DSA A;  3GL5 A;  1M2B A;  5ID2 A;  1MEK A;  5HFK A;  2HYX A;  5DAL A;  2IMD A;  2OJL A;  1ZGN A;  4YAV A;  5IO0 A;  2DIY A;  5ECN B;  4CHS A;  4BVX B;  3ZIJ A;  4USS A;  3GX8 A;  2PMT A;  1TTZ A;  5G30 A;  5HQP A;  1TK0 B;  1PX7 A;  2QSI A;  2WB9 A;  3JCM L;  4XIH A;  1MDI A;  1V57 A;  3ISO A;  4HQZ A;  1N8J A;  3LXT A;  3TRX A;  2R3X A;  4EKZ A;  2H71 A;  4NV5 A;  1NM3 A;  1V9W A;  1WJK A;  4K7I A;  2B7J A;  4IEL A;  1FOV A;  1BYE A;  4JR6 A;  3GKM A;  16GS A;  2I3Y A;  4TVE A;  1ERT A;  4V2M A;  2H0I A;  5DCH A;  2ON5 A;  1SD9 A;  1T4Y A;  4OFT A;  2F8A A;  5B7C A;  3ERF A;  1A2J A;  3ZFB A;  2Z9S A;  3TKS C;  3ZL5 A;  2VL2 C;  4JED A;  1MD4 A;  1K0N A;  1S3A A;  2LRC A;  5KOX A;  1PL2 A;  4MJA A;  2K18 A;  2R4V A;  3HJP A;  1PN9 A;  1M9A A;  2C0D A;  2CAI A;  4K7O A;  2TRX A;  2FLS A;  5INY A;  3FR9 A;  3EWL A;  1SU9 A;  1SKS B;  1VRS D;  5ECK B;  2QC7 A;  3DWV A;  4GSN A;  1CQH A;  4ML1 A;  1RK4 A;  1ZYE A;  3L9U A;  4Q5N A;  2C4J A;  1EV4 A;  4K5S A;  1VGL A;  4KE3 A;  3MWH A;  2JU5 A;  2EIR A;  4MF7 A;  3BD2 A;  3TKP A;  1YF1 A;  3DRN A;  1O6J A;  1O85 A;  2K6V A;  2V6K A;  1GSF A;  4E8E A;  3CMI A;  4G10 A;  5B8B A;  1Z3E A;  2XBQ A;  3TKR A;  2DJK A;  2H0H A;  3FZ4 A;  2IMF A;  2N5F A;  2FD3 A;  1ZYP A;  1SL0 B;  4F9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...