2M80A

Solution structure of yeast dithiol glutaredoxin grx8
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
109
structure length
109
Chain Sequence
MSAFVTKAEEMIKSHPYFQLSASWCPDCVYANSIWNKLNVQDKVFVFDIGSLPRNEQEKWRIAFQKVVGSRNLPTIVVNGKFWGTESQLHRFEAKGTLEEELTKIGLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glutaredoxin-8
publication title Structure-guided activity enhancement and catalytic mechanism of yeast grx8
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 24
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2m80A00
1WPIA 1QGVA 2LJAA 3CSIA 2L6DA 3LGCA 1AQVA 1TJDA 2OE1A 1VRSD 3CRTA 5GSSA 1EV4A 3ED3A 2B7JA 5KN0A 4RQXA 2PPTA 2RM6A 1T3BA 1X9SB 3VPTA 1V98A 2H8LA 3O6TA 2H71A 3GX0A 2EIOA 4ZB6A 2H0IA 5ECSA 2OE0A 4PUFC 2ALBA 2WRTA 1M0UA 2ZUPA 3QCPA 1X9WB 4OCFA 1VGLA 2H19A 2YCDA 2DIYA 5ID2B 2IMIA 5HQPA 2ON7A 4AGSA 1JFUA 4FIWA 5F0GA 5E59A 4K9ZA 1K0NA 4V2NA 8GSSA 2LRCA 1ZCPA 1SENA 2HZEA 4JR4A 3FHKA 1S3CA 4AJ7A 1GLQA 3DVWA 2I1UA 5CRDA 1G6WA 3IPZA 3LYKA 1GSEA 5IQYA 3EC3A 4OFMA 1AC1A 3UIWA 5J4UA 3TJFA 4TVEA 3CXGA 3GSTA 4XCSA 5G31A 4KCAA 3D0ZA 1N2AA 3L78A 3WT1A 1PQNA 4N0VA 1GSFA 1XXUA 3GKXA 3DKSA 1M9BA 4NV2A 3LG6A 3ZFLA 3FZ4A 1SYXA 2GSTA 1U3IA 3BCKA 3EWLA 7GSSA 1MDJA 1GSDA 1NHOA 2FUG2 1FOVA 3ZRDA 4HOJA 2F51A 4ZIJA 2WDUA 3BCIA 5F8BA 3QD9A 4CHSA 1ABAA 2ZNMA 4KCEA 1A24A 4EF0A 3FZ5A 4MLYA 3QOUA 20GSA 2B1LA 1HNAA 5G5FA 5B6MA 3ZLPA 2KOKA 2VCVA 3HJPA 4AJ8A 2IFQB 4TR1A 3I9V2 1A23A 3LWAA 2DLXA 3TKSA 3ME7A 4KAEA 4IVFA 4DEJA 3GUSA 1YEPA 3HVSA 3EMXA 5CP1A 1EGRA 2ES7A 2QKEA 1C72A 3CRUA 2XPEA 2VM1A 1XVQA 2RLIA 3GL5A 1EP8A 3P2AA 3US3A 1M2AA 2A4VA 3KH9A 2OE3A 2VCTA 3Q18A 2AB6A 4I8BA 1XWCA 19GSA 1TRUA 2PBJA 2VAFA 1FO5A 1NSWA 5IMZA 1F2EA 2F8FA 2C3QA 1A0FA 5C04A 3UBKA 3TRPA 2FD3A 5G2ZA 2P5QA 2VCWA 1K3OA 3TKPA 3CBUA 1G7EA 3MDKA 2GGTA 2CVDA 2DJ3A 1B9YC 2MMNA 1PRXA 2X8CA 3FZ9A 4OD7A 1MD3A 4GSSA 1O81A 1PL1A 3KMNA 2C0EA 3APSA 3P7XA 4RI7A 2V32A 1HD2A 3SBCA 1B8XA 3GL3A 3IE3A 3DVXA 1TRSA 3TRXA 3ZVJD 4K7OA 4IP1A 1KTEA 3A2WA 4PXOA 4IBPA 5EPFA 4AJ6A 2DJ1A 1WJKA 4ZL7A 4MJAA 2VL9A 2K6VA 3O76A 5A4VA 1UC7A 1AAZA 2DSAA 3C73A 4BPYA 4TR3A 1YKCA 2HFDA 3GV1A 2VL2A 4V1Ap 1A2MA 3TCOA 3ZFBA 3TDGA 2IMDA 4DSSA 2AAWA 4RI6A 3E0UA 1DE1A 1EOGA 2N5AA 2L5LA 4TXOB 1PX7A 2JZRA 2L6CA 3A3TA 3WT2A 5AIXA 4O5RA 4AF2A 3RPNA 1GSQA 4OWYA 3UL3A 1WMJA 2LTKA 1QQ2A 5ENUA 2OACA 4TRXA 2FLSA 3F6FA 1Q4JA 2A2RA 4XS4A 1HNBA 4IP6A 2OKAA 3G9BA 2J9HA 2HNLA 6GSYA 2LQOA 3FKFA 2YV9A 1UVZA 2B5XA 1Z9HA 3TOUA 5KEJA 4ISDA 5AISA 2WCIA 2O7KA 2MMOA 5CNWA 1SL1B 4ML1A 2FNOA 2YP6A 1FB6A 1ZGNA 4O32A 3H4KA 1WOUA 1OC3A 3KTBA 4GWRA 3KIJA 3HHVA 1YJ6A 1O6JA 5F06A 2BTOT 16GSA 1T4YA 5ELGA 1GNEA 3RBTA 1GTUA 3KH7A 3QAVA 2TIRA 3UVHA 2VLTA 4KW6A 1GRXA 1Z6NA 1NM3A 1SJ6A 4I6XA 4G10A 2Z9SA 4WR5A 1RQMA 3PGTA 3H8QA 1XW6A 4H86A 4HQSA 1XW9A 1S3DA 3CSHA 2R3XA 3TJGA 4N0ZA 3A5WA 2YN1A 1R5AA 3HVXA 1SKRB 2RUFA 3FR9A 2C3TA 1GH2A 1M9AA 2N5BA 2F9SA 2GZPA 1GP1A 2TRCP 3GKNA 4YQVA 1DBYA 1S3AA 2H6YA 1PL2A 2DBCA 3TJKA 1BJXA 1V58A 2V1MA 3GTUB 3HJMA 1XFLA 5GSTA 2E0QA 1BG5A 4KH7A 1MEKA 3HYPA 3BOAA 5CO3A 3IDVA 1GUKA 4O7HA 1BX9A 2HT9A 3CMIA 4WKWA 3FYGA 4WXTA 1F3AA 5G1KA 2IIYA 2CV4A 5ABRA 2YOIA 3NOFA 2DJKA 2R4VA 4EL1A 1T8EB 1PA3A 1PX6A 1KBNA 3KZQA 2RIIA 4IHUA 3HJOA 4WEYA 1EV9A 2H66A 3IAM2 4V2LA 2OBKA 1WWJA 2XBQA 1PMTA 4NXIA 5C00A 3F4RA 1QFNA 1UN2A 4DSRA 5DVBA 3HDCA 3LXTA 5GZZB 4ULXA 4IQAA 2V2GA 3ZREA 2L59A 2HI7A 2XHFA 2JZTA 1AIUA 1TKDB 1OC9B 3RPPA 3MWHA 1O7UA 5ECMB 1PD21 1SK2A 2DIZA 3TJJA 4MJCA 3DD3A 4YQMA 2H73A 2PVQA 5GAPD 5JWQB 5A5KA 2GSRA 1F3BA 3FK8A 2TRXA 2H1DA 2YNXA 4MP4A 4K7IA 3SWLA 1ZZYA 4D73A 1B9XC 2X99A 1GSSA 4HUAA 4N10A 3HVVA 4KUNA 2QGVA 4GSTA 2IJYA 4LA1A 2R37A 1X5EA 2FY6A 3EU4A 2LJRA 1SJZA 2VD0A 3EINA 4HJMA 2LV3A 4WBRD 4G19A 4MZBA 1KEBA 1ACVA 3VWWA 1ZYQB 6GSVA 1V2AA 1F6MC 3ZIJA 3N5OA 4X0XA 2GZYA 4EDYA 2B1KA 2O8VB 3QFAC 4JU5A 5DALB 1A0RP 4K7NA 4PNFA 1Y6EA 1YKAA 1Z7RA 4PX1A 2X8GA 22GSA 2V41A 4TKYA 4PNGA 1Q98A 2WGRA 2H1AA 3GSSA 3FRCA 2PN8A 3WGDA 2CX3A 4WBJA 4JE1A 1I5GA 4KE3A 3F4SA 3LYPA 5H5RA 3JCML 2YJ7A 1U88A 3RHCA 1DSBA 1DE2A 3GNJA 4I2UA 3KJYA 4V2MA 1TRVA 2EIRA 4L0WA 3Q74A 3GN3A 1UA5A 5INYA 1ZL9A 1XWBA 4HZ2A 3FEUA 2I81A 5D9XA 5ECRB 1EP7A 3GRXA 4TW5A 3H1NA 3E3EA 1K0AA 2AUVA 3IK7A 1G0TA 5IPHA 2H01A 2PMTA 2QC7A 5KN3A 5D9TA 4HS1A 2C80A 3ZIVA 1B4QA 1ILOA 1YF1A 1Z3EA 1FAAA 2G2QA 1SJIA 1EWXA 3BD2A 1JLWA 4YAVA 1WE0A 2JACA 2H0HA 4WF4A 5AGYA 4POBA 3HZ8A 4TOPA 1F37A 4EC0A 3O3TA 3L4NA 1ZOFA 5CYYA 1BEDA 1K0DA 1MD4A 5IOWA 2LKUA 1A2JA 3UOMA 4MF5A 2O89A 3L9UA 3IAS2 4L5OA 2YV7A 4NWYA 3I43A 5EVOA 2HZEB 4F0BA 3F6DA 4K6XA 3C1RA 2XPDA 3CYNA 4WF5A 3RHBA 2XC2A 3EMPA 1O8WA 1I9DA 4CDOA 4WETA 1OKTA 2NTOA 1XWKA 5J5NA 1A8YA 3ME8A 2EC4A 2O85A 3DGQA 2GLRA 4RQRA 1XVWA 3QPMA 2C1YA 2KHPA 5LD0A 2PU9C 3F3QA 2JU5A 3F3RA 3Q19A 2WJUA 4ECJA 2IWTA 2LSTA 5ECQB 5COHA 4GSNA 1GUMA 5HFIA 4ZXGA 4KA0A 4TN8A 2GTUA 1J08A 1K0OA 1QMVA 2LQQA 4WR4A 1PKWA 5J9CA 2CT6A 4MJEA 1X0RA 3LEFA 1WRYA 3I6AA 2GSSA 2GS3A 3L0HA 4FYBA 3LQ7A 4OFTA 2FWGA 4LL4B 5DCGA 1K3YA 3TKQA 1THOA 2HE3A 2FA4A 1ZYEA 5D96A 4EE0A 13GSA 1TW9A 5FHIA 3D4MA 1TU7A 4DSQA 4GQCA 4ZB9A 5DJMA 1THXA 3TOTA 3APQA 2LEGA 1BYEA 2EIQA 2P5RA 4ZBDA 1SU9A 1XW5A 4LMWA 1GTAA 2N5FA 4MF6A 4MPFA 1T7PB 1XBSA 2C0DA 1JZRA 18GSA 1ZMAA 1E2YA 4I5QA 5JWOB 4TR1B 4OMVA 5ELAA 5IO0A 4NAXA 6GSWA 1W89A 3H93A 2AYTA 2GQLA 2WULA 1VF2A 5LCZA 2E7PA 2PWJA 3MNGA 2KP2A 4NPBA 4PUAA 2VOCA 3EURA 3HY2A 2H70A 4YH2A 3KP9A 1XOBA 2LRNA 1XWAA 2IMFA 3F9UA 1PSQA 1IYHA 3WGEA 5IMFA 5IMDA 1JLVA 3HD5A 1R26A 2B6MA 4N30A 1SK0A 1R5PA 3U5RE 1ERUA 1XCCA 1Y25A 2IMKA 3VFIA 2WZ9A 4PURA 2YWNA 2LNTA 2CVBA 3ERWA 4KDYA 2L4QA 1OKDA 4MA9A 4GQFA 2AV4A 3DXBA 2FHEA 2HSYA 5F07A 2GQKA 3QAWA 3NZNA 2PGTA 1VF4A 3PINA 2CX4A 2M46A 3L9VA 4MJBA 3UJ1A 3ERFA 2I3YA 2JZSA 5CREA 5A4WA 1DUGA 4HJ2A 2B7KA 3VI7A 1G7OA 5KN2A 2YWMA 2NVLA 2JSYA 1YDKA 2OADA 5A4UA 4ML6A 1O8XA 2DJ2A 2R5GA 3IV4A 3C1SA 4ZILA 1TK8B 1JZWA 4MPGA 4P3YB 5G5EA 1GTBA 1SKWB 3V1WA 1X9MB 2CA8A 1TI3A 4CW9A 1X5CA 4QL9A 1W4VA 1AQWA 4EXJA 4NHZA 1MDIA 4NHWA 1YEXA 2OJLA 1EGOA 2WFCA 3KCMA 1FVKA 2I9HA 2H76A 1XOAA 2VCQA 3RDWA 4MABA 4DSSB 2RM5A 3GH6A 2VUPA 3D4TA 4XIHA 4NMUA 3VPQA 3FR6A 3GFKA 1EEMA 5J41A 3M9KA 5DDLA 4KX4A 2K8VA 2J23A 2FGXA 4XS1A 5IMAA 4LMVA 2YANA 3F4TA 4XS4B 3FW2A 4Z7XA 4KDUA 1M2DA 3NIVA 3UVTA 5ECLB 3BBYA 1YF0A 2H72A 4POLA 3TRQA 1E6BA 2P31A 1XIYA 1OE7A 2FWHA 4LLRA 5ECHB 3Q6OA 11GSA 1SYRA 2HLSA 2C4JA 1PKZA 1A2LA 3UEMA 1G6YA 3AY8A 3W8JA 2H74A 3GA4A 1EEJA 3IA1A 4MH2A 1YZXA 4BVYA 2ON5A 6GSTA 4EKZA 5DJLA 1U6TA 3DMLA 5IM9A 4KSMA 3M1GA 2C3NA 2XBIA 3KM6A 3TGZA 1JZDA 1WIKA 5DBQA 3GHAA 1OVNA 1O85A 4PQIA 4L0UA 2IN3A 3APOA 2VLUA 2P0GA 3KD0A 5AN1A 5DCHA 2WB9A 2C0FA 1XPVA 1PN9A 1OAZA 2A2SA 2VCXA 1OE8A 4ZL8A 1GWCA 2DJ0A 2K9FA 3ZVJA 5ECIB 4HU7A 4MCUA 1CQGA 5FWGA 5IMVA 4ECBA 4PGTA 1K0BA 5G30A 2H0GA 5ID2A 3D22A 3W8SA 1AQXA 2FCHA 2E2MA 4K0GA 4HI7A 4HQZA 4TR4A 3A2VA 2R2JA 1TP9A 1R4WA 5B7CA 3IBHA 2YZUA 3VWXA 4EVMA 2BMXA 3VWUA 5HFGA 1Z6MA 2VL3A 3QAGA 4XS6A 2IL3A 1GNWA 4MDCA 4GCIA 1GSYA 17GSA 5B8BA 1ST9A 2BJXA 3LORA 2L57A 2NPBA 2B5YA 3HZ4A 4KGIA 4IGJA 1GUHA 2H6XA 4O92A 2GZZA 2H1GA 2MBSA 1R7HA 2L4CA 4MH3A 2K18A 4ECIA 1N8JA 1Z7PA 3M8NA 2LUSA 2MYGA 2FWFA 1FVJA 2H1BA 3QDNA 4XTSA 4EO3A 2PUKC 2MBTA 2HRFA 1TU8A 3KEBA 4YAPA 3TB2A 4F9ZA 3LFLA 5D8IA 1EZKA 3QFBC 4KNDA 1AW9A 4K0NA 5JCWA 4GLTA 1QXHA 3GMFA 2K8SA 2MMZA 1NHYA 4OFNA 4JBBA 1BQ7A 4GXZA 2V6OA 4K8MA 4ZL9A 2B3SA 3A2XA 4KDXA 5FT3A 3M3MA 5DAKA 1J9BA 4IKHA 1K0MA 2YWOA 3W6GA 3TKRA 3MSZA 3F63A 3IK9A 3GKMA 2VD1A 2PVOC 4KSOA 2LRTA 1ERTA 2CVKA 5IMCA 3ZMKA 2ZCTA 6GSSA 2JSZA 5DQSA 3IXRA 2G0FA 1BAYA 1RW1A 2IFQA 4D73B 1M99A 3IRAA 3KXOA 1LU4A 2GDRA 1IYIA 5KN1A 2OA7A 9GSSA 1GTIA 1F9MA 1TRWA 3U6VA 1HQOA 2L5OA 3J7Yk 3H79A 1OYJA 4J56E 4PQ1A 2CAIA 4IS0A 2M80A 3K8NA 3EU3A 3UMAA 4ZBBA 1XWGA 5E4WA 2CQ9A 4GRFA 3VURA 3DRNA 4L8EA 3F0IA 4IN0A 2O87A 4ID0A 3G7YA 4ZBAA 10GSA 3ISOA 4ILFA 2HYXA 5ECOB 1LJRA 3D21A 5EY6A 5IOXA 3LJRA 3FR3A 4BVXA 3IR4A 3ZL5A 2GVPA 1NW2A 1TK5B 3C8EA 1LBKA 3QMXA 3G7IA 4JRRA 1QUWA 2YZHA 3EE2A 3KMOA 2CAQA 4ZB8A 5DAKB 12GSA 1USBA 2YJHA 3HA9A 3OR5A 2B5EA 5CAXA 3KGKA 1SK1A 3CTGA 4HU9A 5D93A 3TJBA 1HNCA 1ML6A 4BWSA 4GF0A 4V1Ag 2GQMA 1TDIA 4FYCA 3GH9A 4I2TA 1YY7A 3G7JA 3BJ5A 5HR1A 3N9JA 3C7MA 2FA8A 2E2GA 4XRAA 3WGXA 4FH8A 5JCUA 5LNKe 5JWRB 3F8UA 1T4ZA 3UARA 3GYKA 5ECKB 1H4OA 5D73A 1K3LA 5G1LA 5CRHA 1SD9A 4QQ7A 1RK4A 4K1FA 1FB0A 2R6KA 5J3RA 4Q5FA 1SL2B 1B4PA 4IW9A 5ECPB 1SKSB 4F82A 4TXOA 5HR3A 1T00A 1AXDA 4OO4A 2LJKA 2KUCA 6GSXA 3E9JB 3VWVA 4GTUA 4MF7A 5AIVA 5HR0A 5ECNB 4NV5A 4HZ4A 3S9FA 3HCZA 5B6NA 4YQUA 1FHEA 1JHBA 1ON4A 2NDOA 3RAZA 1U87A 2IMEA 5CRWA 1O73A 1V57A 3MAKA 4J57E 4BL7A 3ERGA 1M7TA 4X43A 4IJIA 3CSJA 3M0FA 2LNSA 2JL4A 1GULA 5L71A 3DYRA 5JCGA 2OBIA 4PQHA 4XRDA 4HEA2 5GAND 2DMLA 4F2IA 1TTZA 5HFKA 3EYTA 4I97A 1H75A 2IPAA 3GIXA 4OO5A 4OCEA 5EL8A 3VK9A 3WYWA 1AUCA 4XHMA 1EOHA 1XZOA 1JZOA 2HRNA 4G9HA 4Q5RA 1FG4A 3L9SA 2GT6A 2HZFA 5J9BA 2H30A 4K2DA 1V40A 2REMA 3IHQA 4E8HA 1PGTA 2H6ZA 3DWVA 3D5JA 4MK3A 3KP8A 2H75A 4POMA 3J7Yb 2GT5A 3PR8A 3KTLA 4G2EA 3WD6A 1TOFA 2JADA 4LL1B 3GTUA 5IPGA 2AHEA 3UAPA 2F3MA 1OC8A 3HXSA 4IJ3A 4KB3A 2VM2A 1MDKA 1YQ1A 1GL8A 1ERWA 2MMAA 2M72A 5HR2A 2D2ZA 3ZTLA 5IO2A 2NBSA 3D6IA 4IQ1A 4BWQA 5H5QA 4MMMA 2CZ3A 2CZ2A 2F8AA 3TKSC 1ERVA 2YWIA 5IIZA 4DVCA 2V6KA 1HYUA 1M2BA 1KNGA 2VLVA 1TXXA 3ZMLA 1V9WA 4POKA 3FZAA 2DMMA 4ACSA 14GSA 4HDEA 3C71A 4MZCA 1CQHA 4BA7A 2I4AA 1GLPA 2X8HA 4N11A 2RUEA 4QL7A 2KLXA 5F05A 1WP0A 1VF1A 3CTFA 4IELA 1SD8A 1B48A 1Z5YE 1TI1A 1OC9A 3VLNA 3GURA 2AJQB 4FYUA 1X5DA 3IOSA 5B8AA 1URMA 4TR0A 2WS2A 1U3AA 4E8EA 1QK8A 1FW1A 2QSIA 2HXKA 2VO4A 5H5SA 1T1VA 2HSHA 3DIEA 2C0GA 1TK0B 3HKRA 3P90A 3UBLA 2C8UA 4F0CA 4RUVA 3IC4A 3EVIA 5DQYA 1K0CA 4F03A 3I69A 1A8LA 4Q5QA 4X1UA 3ZZXA 3GX8A 3ZITA 1J0FA 1MTCA 1VF3A 4EUYA 2VL2C 3GKKA 3LSZA 5CRGA 4JEDA 2FWEA 2YPMA 3DEXA 3P8WA 5DALA 4FO5A 4JR6A 4EDZA 5D9WA 3LXZA 4J2FA 1SL0B 4JZQA 2VIMA 4Q5NA 1GSUA 4L5LA 3PH9A 4ECCA 2X64A 2DC5A 3ZYWA 2KP1A 3FY7A 2VCZA 6GSUA 2DJJA 2GSQA 3R2QA 3TKSE 3VI5A 4MZWA 2LS5A 5D9VA 2MZCA 3M9JA 4TXVA 3QR6A 3TUEA 2PERA
chains in the Genus database with same CATH superfamily
1WPIA 1QGVA 2LJAA 3CSIA 2L6DA 3LGCA 1AQVA 1TJDA 3FMWA 2OE1A 1VRSD 3CRTA 5GSSA 1EV4A 3ED3A 2B7JA 5KN0A 4RQXA 2PPTA 2RM6A 1T3BA 1X9SB 3VPTA 1V98A 2H8LA 3O6TA 2H71A 3GX0A 2EIOA 4ZB6A 2H0IA 5ECSA 2OE0A 4PUFC 2ALBA 2WRTA 1M0UA 2ZUPA 3QCPA 1X9WB 3MYDA 4OCFA 1VGLA 2H19A 2YCDA 2DIYA 5ID2B 2IMIA 5HQPA 2ON7A 4AGSA 1JFUA 4FIWA 5F0GA 5E59A 4K9ZA 1K0NA 4V2NA 8GSSA 2LRCA 1ZCPA 1SENA 2HZEA 4JR4A 3FHKA 1S3CA 4AJ7A 1GLQA 3DVWA 2I1UA 5CRDA 1G6WA 3IPZA 3LYKA 1GSEA 5IQYA 4G0IA 3EC3A 4OFMA 1AC1A 3UIWA 5J4UA 3TJFA 4TVEA 3CXGA 3GSTA 4XCSA 5G31A 4KCAA 3D0ZA 1N2AA 3L78A 3WT1A 1PQNA 4N0VA 1GSFA 1XXUA 3GKXA 3DKSA 1M9BA 4NV2A 3LG6A 3ZFLA 3FZ4A 1SYXA 2GSTA 1U3IA 4EIPA 3BCKA 3EWLA 3IHGA 7GSSA 1MDJA 1GSDA 1NHOA 2FUG2 1FOVA 3ZRDA 4HOJA 2F51A 4ZIJA 2WDUA 3BCIA 5F8BA 3QD9A 4CHSA 1ABAA 2ZNMA 4KCEA 1A24A 4EF0A 3FZ5A 4MLYA 3QOUA 20GSA 2B1LA 1HNAA 5G5FA 5B6MA 3ZLPA 2KOKA 2VCVA 3HJPA 4AJ8A 2IFQB 4TR1A 3I9V2 1A23A 3LWAA 2DLXA 3TKSA 3ME7A 4KAEA 4IVFA 2X49A 4DEJA 3GUSA 1YEPA 3HVSA 3EMXA 5CP1A 1EGRA 2ES7A 2QKEA 1C72A 3CRUA 2XPEA 2VM1A 1XVQA 2RLIA 3GL5A 1EP8A 3P2AA 3US3A 1M2AA 2A4VA 3KH9A 2OE3A 2VCTA 3Q18A 2AB6A 1PN0A 4I8BA 1XWCA 19GSA 1TRUA 2PBJA 2VAFA 1FO5A 1NSWA 5IMZA 1F2EA 2F8FA 2C3QA 1A0FA 5C04A 4BVXB 3UBKA 3TRPA 2FD3A 5G2ZA 2P5QA 2VCWA 1K3OA 3TKPA 3CBUA 1G7EA 3MDKA 4PTSA 2GGTA 2CVDA 2DJ3A 1B9YC 2MMNA 1PRXA 2X8CA 3FZ9A 4OD7A 1MD3A 4GSSA 1O81A 1PL1A 3KMNA 2C0EA 2UZ8A 3APSA 3P7XA 4RI7A 2V32A 1HD2A 3SBCA 1B8XA 3GL3A 3IE3A 3DVXA 1TRSA 3TRXA 3ZVJD 4K7OA 4IP1A 1KTEA 3A2WA 4PXOA 4IBPA 5EPFA 4AJ6A 2DJ1A 1WJKA 4ZL7A 4MJAA 2VL9A 2K6VA 3O76A 5A4VA 1UC7A 1AAZA 2DSAA 3R3EA 3C73A 4BPYA 4TR3A 1YKCA 2HFDA 3GV1A 2VL2A 4V1Ap 1A2MA 3TCOA 3ZFBA 3TDGA 2IMDA 4DSSA 2AAWA 4RI6A 3E0UA 1DE1A 1EOGA 2N5AA 2L5LA 4TXOB 1PX7A 2JZRA 2L6CA 3A3TA 3WT2A 5AIXA 4O5RA 4AF2A 3RPNA 1GSQA 4OWYA 3UL3A 2DKIA 1WMJA 2LTKA 1QQ2A 5ENUA 2R0GA 2OACA 4TRXA 2FLSA 3F6FA 1Q4JA 2A2RA 4XS4A 1HNBA 4IP6A 2OKAA 3G9BA 2J9HA 2HNLA 6GSYA 2LQOA 3FKFA 2YV9A 1UVZA 2B5XA 1Z9HA 3TOUA 5KEJA 4ISDA 5AISA 2WCIA 2O7KA 2MMOA 5CNWA 1SL1B 4ML1A 2FNOA 2YP6A 1FB6A 4BL7B 1ZGNA 4O32A 3H4KA 1WOUA 1OC3A 4K5SA 3KTBA 4GWRA 3KIJA 3HHVA 1YJ6A 1O6JA 5F06A 2BTOT 16GSA 1T4YA 5ELGA 1GNEA 3RBTA 1GTUA 3KH7A 3QAVA 2TIRA 3UVHA 2VLTA 4KW6A 1GRXA 1Z6NA 1NM3A 1SJ6A 4I6XA 4G10A 2Z9SA 4WR5A 1RQMA 3PGTA 3H8QA 1XW6A 1ZYPA 4H86A 4HQSA 1XW9A 1S3DA 3CSHA 2R3XA 4O5UA 3TJGA 4N0ZA 3A5WA 2YN1A 1R5AA 3HVXA 1SKRB 2RUFA 3FR9A 2C3TA 1GH2A 1M9AA 2N5BA 2F9SA 2GZPA 1GP1A 2TRCP 3GKNA 4YQVA 1DBYA 1S3AA 2H6YA 1PL2A 2DBCA 3TJKA 1BJXA 4YKGA 1V58A 2V1MA 3GTUB 3HJMA 1XFLA 5GSTA 2E0QA 1BG5A 4KH7A 4FQUA 1MEKA 3HYPA 3BOAA 5CO3A 3IDVA 1GUKA 4O7HA 1BX9A 2HT9A 3CMIA 4WKWA 3FYGA 4WXTA 1F3AA 5G1KA 2IIYA 2CV4A 5ABRA 2YOIA 3NOFA 3EPTA 2DJKA 2R4VA 4EL1A 1T8EB 1PA3A 1PX6A 1KBNA 3KZQA 5BRTA 2R0CA 2RIIA 4IHUA 3HJOA 4WEYA 1EV9A 2H66A 3IAM2 4V2LA 2OBKA 1WWJA 2XBQA 1PMTA 4NXIA 2DKHA 5C00A 3F4RA 1QFNA 1UN2A 4DSRA 5DVBA 3HDCA 3LXTA 5GZZB 4ULXA 4IQAA 2V2GA 3ZREA 2L59A 2HI7A 2XHFA 2JZTA 1AIUA 1TKDB 1OC9B 3RPPA 3MWHA 1O7UA 5ECMB 1PD21 1SK2A 2DIZA 3TJJA 4MJCA 3DD3A 4YQMA 2H73A 2PVQA 5GAPD 5JWQB 5A5KA 2GSRA 1F3BA 3FK8A 2TRXA 2H1DA 2YNXA 4MP4A 4K7IA 3SWLA 1ZZYA 4D73A 1B9XC 2X99A 1GSSA 4HUAA 4N10A 3HVVA 4KUNA 2QGVA 4GSTA 2IJYA 4LA1A 2R37A 1X5EA 2FY6A 3EU4A 2LJRA 1SJZA 2VD0A 3EINA 4HJMA 2LV3A 4WBRD 4G19A 4MZBA 1KEBA 1ACVA 2A2PA 3VWWA 1ZYQB 6GSVA 1V2AA 1F6MC 3ZIJA 3N5OA 4X0XA 2GZYA 4EDYA 2B1KA 2O8VB 4ICYA 3QFAC 4JU5A 5DALB 1A0RP 4K7NA 4PNFA 1Y6EA 1YKAA 1Z7RA 4PX1A 2X8GA 22GSA 2V41A 4TKYA 4PNGA 1Q98A 2WGRA 2H1AA 3GSSA 3FRCA 2PN8A 3WGDA 2CX3A 4WBJA 4JE1A 1I5GA 4KE3A 3F4SA 3LYPA 5H5RA 3JCML 2YJ7A 1U88A 3RHCA 1DSBA 1DE2A 2HSMA 3GNJA 4I2UA 3KJYA 4V2MA 1TRVA 2EIRA 4L0WA 3Q74A 3GN3A 1UA5A 5INYA 1ZL9A 1XWBA 4HZ2A 3FEUA 2I81A 5D9XA 5ECRB 1EP7A 3GRXA 4TW5A 3H1NA 3E3EA 1K0AA 5KOXA 2AUVA 3IK7A 1G0TA 5IPHA 2H01A 2PMTA 2QC7A 5KN3A 5D9TA 4HS1A 2C80A 3ZIVA 1B4QA 1ILOA 1YF1A 1Z3EA 1FAAA 2G2QA 1SJIA 1EWXA 3BD2A 1JLWA 4YAVA 1WE0A 2JACA 2H0HA 4WF4A 5AGYA 4POBA 3HZ8A 4TOPA 1F37A 4EC0A 3O3TA 3L4NA 1ZOFA 5CYYA 1BEDA 1K0DA 1MD4A 5IOWA 2LKUA 1A2JA 4MNNA 4MF5A 3UOMA 2O89A 3L9UA 3A5IA 3MIXA 3IAS2 4EIQA 4L5OA 2YV7A 4NWYA 3I43A 5EVOA 2HZEB 4F0BA 3F6DA 4K6XA 3C1RA 2XPDA 3CYNA 4WF5A 3RHBA 2XC2A 3EMPA 1O8WA 1I9DA 4CDOA 4WETA 1OKTA 2NTOA 1XWKA 5J5NA 1A8YA 3ME8A 2EC4A 2O85A 3DGQA 2GLRA 4RQRA 1XVWA 3QPMA 2C1YA 2KHPA 5LD0A 2PU9C 3F3QA 2JU5A 3F3RA 3Q19A 2WJUA 4ECJA 2IWTA 2LSTA 5ECQB 5COHA 4GSNA 1GUMA 5KOWA 5HFIA 4ZXGA 4KA0A 4TN8A 2GTUA 1J08A 1K0OA 1QMVA 2LQQA 4WR4A 1PKWA 5J9CA 2CT6A 4MJEA 1X0RA 3LEFA 1WRYA 3I6AA 2GSSA 2GS3A 3L0HA 4FYBA 3LQ7A 4OFTA 2FWGA 4LL4B 5DCGA 1K3YA 3TKQA 1THOA 2HE3A 2FA4A 1ZYEA 5D96A 4EE0A 13GSA 4K2XA 1TW9A 5FHIA 3D4MA 1TU7A 4DSQA 4GQCA 4ZB9A 5DJMA 1THXA 3TOTA 3APQA 2LEGA 1BYEA 2EIQA 2P5RA 4ZBDA 1SU9A 1XW5A 4LMWA 1GTAA 2N5FA 4MF6A 4MPFA 1T7PB 1XBSA 2C0DA 1JZRA 4YKFA 18GSA 1ZMAA 1E2YA 4I5QA 5JWOB 4TR1B 4OMVA 5ELAA 5IO0A 4NAXA 6GSWA 1W89A 3H93A 2AYTA 2GQLA 2WULA 1VF2A 5LCZA 2E7PA 2PWJA 3MNGA 2KP2A 4NPBA 4PUAA 2VOCA 3EURA 3HY2A 2H70A 4YH2A 4K5RA 3KP9A 1XOBA 2LRNA 1XWAA 2IMFA 3F9UA 1PSQA 1IYHA 3WGEA 5IMFA 2QA1A 5IMDA 1JLVA 3HD5A 1R26A 2B6MA 4N30A 1SK0A 1R5PA 3U5RE 1ERUA 1XCCA 1Y25A 2IMKA 3VFIA 1ZYNA 2WZ9A 4PURA 2YWNA 2LNTA 2CVBA 3ERWA 4KDYA 2L4QA 1OKDA 4MA9A 4GQFA 2AV4A 3DXBA 2FHEA 2HSYA 5F07A 2GQKA 3QAWA 3NZNA 2PGTA 1VF4A 3PINA 2CX4A 2M46A 3L9VA 4MJBA 3UJ1A 3ERFA 2I3YA 2JZSA 5CREA 5A4WA 1DUGA 4HJ2A 2B7KA 3VI7A 1G7OA 5KN2A 2YWMA 1XG8A 2NVLA 2JSYA 1YDKA 2OADA 5A4UA 4ML6A 1O8XA 2DJ2A 2R5GA 3IV4A 3C1SA 4ZILA 1TK8B 1JZWA 4MPGA 4P3YB 5G5EA 1GTBA 1SKWB 3V1WA 1X9MB 2CA8A 1TI3A 4CW9A 1X5CA 4QL9A 1W4VA 1AQWA 4EXJA 4NHZA 1MDIA 4NHWA 1YEXA 2OJLA 1EGOA 2WFCA 3KCMA 1FVKA 2I9HA 2H76A 1XOAA 2VCQA 3RDWA 4MABA 4DSSB 4A5PA 2RM5A 3GH6A 2VUPA 3D4TA 4XIHA 4NMUA 3VPQA 3FR6A 3GFKA 1EEMA 5J41A 3M9KA 5DDLA 4KX4A 2K8VA 2J23A 2FGXA 4XS1A 5IMAA 4LMVA 2YANA 3F4TA 4XS4B 3FW2A 4Z7XA 4KDUA 1M2DA 3NIVA 3UVTA 5ECLB 3BBYA 1YF0A 2H72A 4POLA 3TRQA 1E6BA 2P31A 1XIYA 1OE7A 2FWHA 4LLRA 5ECHB 3Q6OA 2HRKA 11GSA 1SYRA 2HLSA 2C4JA 1PKZA 1A2LA 3UEMA 1G6YA 3AY8A 3W8JA 2H74A 3GA4A 1EEJA 3IA1A 4MH2A 1YZXA 4BVYA 2ON5A 6GSTA 4EKZA 5DJLA 1U6TA 3DMLA 5IM9A 4KSMA 3M1GA 2C3NA 2XBIA 3KM6A 3TGZA 1JZDA 1WIKA 5DBQA 3GHAA 1OVNA 1O85A 4PQIA 4L0UA 2IN3A 3APOA 2VLUA 2P0GA 3KD0A 5AN1A 5DCHA 2WB9A 2C0FA 1XPVA 1PN9A 1OAZA 2A2SA 2VCXA 1OE8A 4ZL8A 1GWCA 2DJ0A 2K9FA 3ZVJA 5ECIB 4HU7A 4MCUA 1CQGA 5FWGA 5IMVA 4ECBA 4PGTA 1K0BA 5G30A 2H0GA 5ID2A 3D22A 3W8SA 4CY6A 1AQXA 2FCHA 2E2MA 4K0GA 4HI7A 4HQZA 4Z2UA 4TR4A 2QA2A 3A2VA 2R2JA 1TP9A 1R4WA 5B7CA 3IBHA 2YZUA 3VWXA 4EVMA 2BMXA 3VWUA 5HFGA 1Z6MA 2VL3A 3QAGA 4XS6A 2IL3A 1GNWA 4MDCA 4GCIA 1GSYA 17GSA 5B8BA 1ST9A 2BJXA 3LORA 2L57A 2NPBA 2B5YA 3HZ4A 4KGIA 4IGJA 1GUHA 2H6XA 4O92A 2GZZA 2H1GA 2MBSA 1R7HA 2L4CA 4MH3A 2K18A 4ECIA 1N8JA 1Z7PA 3M8NA 2LUSA 2MYGA 2FWFA 1FVJA 2H1BA 3QDNA 4XTSA 4EO3A 2PUKC 2MBTA 4O5QA 2HRFA 1TU8A 3KEBA 4YAPA 3TB2A 4F9ZA 3LFLA 5D8IA 1EZKA 3QFBC 4KNDA 1AW9A 4K0NA 5JCWA 4GLTA 1QXHA 3GMFA 2K8SA 2MMZA 1NHYA 4Z2RA 4OFNA 4JBBA 1BQ7A 4GXZA 2V6OA 4K8MA 4ZL9A 2B3SA 3A2XA 4KDXA 5FT3A 3M3MA 5DAKA 1J9BA 4IKHA 1K0MA 2YWOA 3W6GA 3TKRA 3MSZA 3F63A 3IK9A 3GKMA 2VD1A 2PVOC 4KSOA 2LRTA 1ERTA 4X4JA 2CVKA 5IMCA 3ZMKA 2ZCTA 6GSSA 2JSZA 5DQSA 3IXRA 2G0FA 1BAYA 1RW1A 2IFQA 4D73B 1M99A 3IRAA 3KXOA 1LU4A 2GDRA 1IYIA 5KN1A 3IC8A 2OA7A 9GSSA 1GTIA 1F9MA 1TRWA 3U6VA 1HQOA 3PPUA 2A4HA 2L5OA 3H79A 1OYJA 3J7Yk 4J56E 4PQ1A 4KF9A 2CAIA 4IS0A 2M80A 3K8NA 3EU3A 3UMAA 4ZBBA 1XWGA 5E4WA 2CQ9A 4GRFA 3VURA 3DRNA 4L8EA 3F0IA 4IN0A 2O87A 4ID0A 3G7YA 4ZBAA 10GSA 3ISOA 4ILFA 2HYXA 4G0LA 5ECOB 1LJRA 3D21A 5EY6A 4CY8A 5IOXA 3LJRA 3FR3A 4BVXA 3IR4A 3ZL5A 2GVPA 1NW2A 1TK5B 3C8EA 1LBKA 3QMXA 3G7IA 4JRRA 1QUWA 2YZHA 3EE2A 3KMOA 2CAQA 4ZB8A 5DAKB 12GSA 1USBA 2YJHA 3HA9A 3OR5A 2B5EA 5CAXA 3KGKA 4Z2TA 1SK1A 3CTGA 4HU9A 5D93A 3TJBA 1HNCA 1ML6A 4BWSA 4GF0A 4V1Ag 2GQMA 1TDIA 4FYCA 3GH9A 4I2TA 1YY7A 3G7JA 3BJ5A 4USSA 5HR1A 3N9JA 3C7MA 2FA8A 2E2GA 4XRAA 3WGXA 4FH8A 5BMUA 5JCUA 5LNKe 5JWRB 3F8UA 1T4ZA 3UARA 3GYKA 5ECKB 1H4OA 5D73A 1K3LA 5G1LA 5CRHA 1SD9A 4HSCX 4QQ7A 1RK4A 4K1FA 1FB0A 2R6KA 5J3RA 4Q5FA 1SL2B 4BIKA 1B4PA 4IW9A 5ECPB 1SKSB 4F82A 4TXOA 2R0PA 5HR3A 1T00A 2HRAA 3LW9A 1AXDA 4OO4A 2LJKA 2KUCA 3HVNA 6GSXA 3E9JB 3VWVA 4GTUA 4MF7A 5AIVA 5HR0A 5ECNB 4NV5A 4HZ4A 3S9FA 3HCZA 5B6NA 4YQUA 1FHEA 1JHBA 1ON4A 2NDOA 3RAZA 1U87A 2IMEA 5CRWA 1O73A 1V57A 3MAKA 4J57E 4BL7A 3ERGA 4G0KA 1M7TA 4X43A 4IJIA 3CSJA 3M0FA 2LNSA 2JL4A 1GULA 5L71A 3DYRA 5JCGA 2OBIA 4PQHA 4XRDA 4HEA2 5GAND 2DMLA 1M3JA 4F2IA 1TTZA 5HFKA 3EYTA 4I97A 1H75A 2IPAA 3GIXA 4OO5A 4OCEA 5EL8A 3VK9A 3WYWA 1FOHA 1AUCA 4XHMA 1EOHA 1XZOA 1PFOA 1JZOA 2HRNA 4G9HA 4Q5RA 1FG4A 3L9SA 1S3RA 2GT6A 2HZFA 5J9BA 2H30A 4K2DA 1V40A 2REMA 3IHQA 4E8HA 1PGTA 2H6ZA 3DWVA 3D5JA 4MK3A 3KP8A 2H75A 4POMA 3J7Yb 2GT5A 3PR8A 3KTLA 4G2EA 3WD6A 1TOFA 2JADA 4LL1B 3GTUA 5IPGA 2AHEA 3UAPA 2F3MA 1OC8A 3HXSA 4IJ3A 4KB3A 2VM2A 1MDKA 1YQ1A 1GL8A 1ERWA 2MMAA 2M72A 5HR2A 2D2ZA 3ZTLA 5IO2A 2NBSA 3D6IA 4IQ1A 4BWQA 5H5QA 4MMMA 2CZ3A 2CZ2A 2F8AA 3TKSC 1ERVA 2YWIA 5IIZA 4DVCA 2V6KA 1HYUA 1M2BA 1KNGA 2VLVA 1TXXA 1M3IA 3ZMLA 1V9WA 4POKA 3FZAA 2DMMA 4ACSA 14GSA 4HDEA 3C71A 4MZCA 1CQHA 4BA7A 2I4AA 1GLPA 2X8HA 4N11A 2RUEA 4QL7A 2KLXA 5F05A 1WP0A 1VF1A 3CTFA 4IELA 1SD8A 1B48A 1Z5YE 1TI1A 1OC9A 3VLNA 3GURA 2AJQB 4FYUA 1X5DA 3IOSA 5B8AA 1URMA 4TR0A 2WS2A 1U3AA 4E8EA 1QK8A 1FW1A 2QSIA 2HXKA 2VO4A 5H5SA 1T1VA 2HSHA 3DIEA 2C0GA 1TK0B 3HKRA 3P90A 3UBLA 2C8UA 4F0CA 4RUVA 3IC4A 3EVIA 5DQYA 1K0CA 4F03A 3I69A 1A8LA 4Q5QA 4X1UA 3ZZXA 3GX8A 3ZITA 1J0FA 1MTCA 1VF3A 4EUYA 2VL2C 3GKKA 3LSZA 5CRGA 4JEDA 2FWEA 3CQFA 2YPMA 3DEXA 3P8WA 4FO5A 5DALA 4JR6A 4EDZA 5D9WA 3LXZA 4J2FA 1SL0B 4JZQA 2VIMA 4Q5NA 2X4AA 1GSUA 4L5LA 3PH9A 4ECCA 2X64A 2DC5A 3ZYWA 2KP1A 3FY7A 2VCZA 6GSUA 2DJJA 2GSQA 3R2QA 3TKSE 3VI5A 4MZWA 2LS5A 5D9VA 2MZCA 3M9JA 4TXVA 3QR6A 3TUEA 2PERA 4BVYB
chains in the Genus database with same CATH topology
1WPIA 1QGVA 2LJAA 3CSIA 2L6DA 3LGCA 1AQVA 1TJDA 3FMWA 2OE1A 1VRSD 3CRTA 5GSSA 1EV4A 3ED3A 2B7JA 5KN0A 4RQXA 2PPTA 2RM6A 1T3BA 1X9SB 3VPTA 1V98A 2H8LA 3O6TA 2H71A 3GX0A 2EIOA 4ZB6A 2H0IA 5ECSA 2OE0A 4PUFC 2ALBA 2WRTA 1M0UA 2ZUPA 3QCPA 1X9WB 3MYDA 4OCFA 1VGLA 2H19A 2YCDA 2DIYA 5ID2B 2IMIA 5HQPA 2ON7A 4AGSA 1JFUA 4FIWA 5F0GA 5E59A 4K9ZA 1K0NA 4V2NA 8GSSA 2LRCA 1ZCPA 1SENA 2HZEA 4JR4A 3FHKA 1S3CA 4AJ7A 1GLQA 3DVWA 2I1UA 5CRDA 1G6WA 3IPZA 3LYKA 1GSEA 5IQYA 4G0IA 3EC3A 4OFMA 1AC1A 3UIWA 5J4UA 3TJFA 4TVEA 3CXGA 3GSTA 4XCSA 5G31A 4KCAA 3D0ZA 1N2AA 3L78A 3WT1A 1PQNA 4N0VA 1GSFA 1XXUA 3GKXA 3DKSA 1M9BA 4NV2A 3LG6A 3ZFLA 3FZ4A 1SYXA 2GSTA 1U3IA 4EIPA 3BCKA 3EWLA 3IHGA 7GSSA 1MDJA 1GSDA 1NHOA 2FUG2 1FOVA 3ZRDA 4HOJA 2F51A 4ZIJA 2WDUA 3BCIA 5F8BA 3QD9A 4CHSA 1ABAA 2ZNMA 4KCEA 1A24A 4EF0A 3FZ5A 4MLYA 3QOUA 20GSA 2B1LA 1HNAA 5G5FA 5B6MA 3ZLPA 2KOKA 2VCVA 3HJPA 4AJ8A 2IFQB 4TR1A 3I9V2 1A23A 3LWAA 2DLXA 3TKSA 3ME7A 4KAEA 4IVFA 2X49A 4DEJA 3GUSA 1YEPA 3HVSA 3EMXA 5CP1A 1EGRA 2ES7A 2QKEA 1C72A 3CRUA 2XPEA 2VM1A 1XVQA 2RLIA 3GL5A 1EP8A 3P2AA 3US3A 1M2AA 2A4VA 3KH9A 2OE3A 2VCTA 3Q18A 2AB6A 1PN0A 4I8BA 1XWCA 19GSA 1TRUA 2PBJA 2VAFA 1FO5A 1NSWA 5IMZA 1F2EA 2F8FA 2C3QA 1A0FA 5C04A 4BVXB 3UBKA 3TRPA 2FD3A 5G2ZA 2P5QA 2VCWA 1K3OA 3TKPA 3CBUA 1G7EA 3MDKA 4PTSA 2GGTA 2CVDA 2DJ3A 1B9YC 2MMNA 1PRXA 2X8CA 3FZ9A 4OD7A 1MD3A 4GSSA 1O81A 1PL1A 3KMNA 2C0EA 2UZ8A 3APSA 3P7XA 4RI7A 2V32A 1HD2A 3SBCA 1B8XA 3GL3A 3IE3A 3DVXA 1TRSA 3TRXA 3ZVJD 4K7OA 4IP1A 1KTEA 3A2WA 4PXOA 4IBPA 5EPFA 4AJ6A 2DJ1A 1WJKA 4ZL7A 4MJAA 2VL9A 2K6VA 3O76A 5A4VA 1UC7A 1AAZA 2DSAA 3R3EA 3C73A 4BPYA 4TR3A 1YKCA 2HFDA 3GV1A 2VL2A 4V1Ap 1A2MA 3TCOA 3ZFBA 3TDGA 2IMDA 4DSSA 2AAWA 4RI6A 3E0UA 1DE1A 1EOGA 2N5AA 2L5LA 4TXOB 1PX7A 2JZRA 2L6CA 3A3TA 3WT2A 5AIXA 4O5RA 4AF2A 3RPNA 1GSQA 4OWYA 3UL3A 2DKIA 1WMJA 2LTKA 1QQ2A 5ENUA 2R0GA 2OACA 4TRXA 2FLSA 3F6FA 1Q4JA 2A2RA 4XS4A 1HNBA 4IP6A 2OKAA 3G9BA 2J9HA 2HNLA 6GSYA 2LQOA 3FKFA 2YV9A 1UVZA 2B5XA 1Z9HA 3TOUA 5KEJA 4ISDA 5AISA 2WCIA 2O7KA 2MMOA 5CNWA 1SL1B 4ML1A 2FNOA 2YP6A 1FB6A 4BL7B 1ZGNA 4O32A 3H4KA 1WOUA 1OC3A 4K5SA 3KTBA 4GWRA 3KIJA 3HHVA 1YJ6A 1O6JA 5F06A 2BTOT 16GSA 1T4YA 5ELGA 1GNEA 3RBTA 1GTUA 3KH7A 3QAVA 2TIRA 3UVHA 2VLTA 4KW6A 1GRXA 1Z6NA 1NM3A 1SJ6A 4I6XA 4G10A 2Z9SA 4WR5A 1RQMA 3PGTA 3H8QA 1XW6A 1ZYPA 4H86A 4HQSA 1XW9A 1S3DA 3CSHA 2R3XA 4O5UA 3TJGA 4N0ZA 3A5WA 2YN1A 1R5AA 3HVXA 1SKRB 2RUFA 3FR9A 2C3TA 1GH2A 1M9AA 2N5BA 2F9SA 2GZPA 1GP1A 2TRCP 3GKNA 4YQVA 1DBYA 1S3AA 2H6YA 1PL2A 2DBCA 3TJKA 1BJXA 4YKGA 1V58A 2V1MA 3GTUB 3HJMA 1XFLA 5GSTA 2E0QA 1BG5A 4KH7A 4FQUA 1MEKA 3HYPA 3BOAA 5CO3A 3IDVA 1GUKA 4O7HA 1BX9A 2HT9A 3CMIA 4WKWA 3FYGA 4WXTA 1F3AA 5G1KA 2IIYA 2CV4A 5ABRA 2YOIA 3NOFA 3EPTA 2DJKA 2R4VA 4EL1A 1T8EB 1PA3A 1PX6A 1KBNA 3KZQA 5BRTA 2R0CA 2RIIA 4IHUA 3HJOA 4WEYA 1EV9A 2H66A 3IAM2 4V2LA 2OBKA 1WWJA 2XBQA 1PMTA 4NXIA 2DKHA 5C00A 3F4RA 1QFNA 1UN2A 4DSRA 5DVBA 3HDCA 3LXTA 5GZZB 4ULXA 4IQAA 2V2GA 3ZREA 2L59A 2HI7A 2XHFA 2JZTA 1AIUA 1TKDB 1OC9B 3RPPA 3MWHA 1O7UA 5ECMB 1PD21 1SK2A 2DIZA 3TJJA 4MJCA 3DD3A 4YQMA 2H73A 2PVQA 5GAPD 5JWQB 5A5KA 2GSRA 1F3BA 3FK8A 2TRXA 2H1DA 2YNXA 4MP4A 4K7IA 3SWLA 1ZZYA 4D73A 1B9XC 2X99A 1GSSA 4HUAA 4N10A 3HVVA 4KUNA 2QGVA 4GSTA 2IJYA 4LA1A 2R37A 1X5EA 2FY6A 3EU4A 2LJRA 1SJZA 2VD0A 3EINA 4HJMA 2LV3A 4WBRD 4G19A 4MZBA 1KEBA 1ACVA 2A2PA 3VWWA 1ZYQB 6GSVA 1V2AA 1F6MC 3ZIJA 3N5OA 4X0XA 2GZYA 4EDYA 2B1KA 2O8VB 4ICYA 3QFAC 4JU5A 5DALB 1A0RP 4K7NA 4PNFA 1Y6EA 1YKAA 1Z7RA 4PX1A 2X8GA 22GSA 2V41A 4TKYA 4PNGA 1Q98A 2WGRA 2H1AA 3GSSA 3FRCA 2PN8A 3WGDA 2CX3A 4WBJA 4JE1A 1I5GA 4KE3A 3F4SA 3LYPA 5H5RA 3JCML 2YJ7A 1U88A 3RHCA 1DSBA 1DE2A 2HSMA 3GNJA 4I2UA 3KJYA 4V2MA 1TRVA 2EIRA 4L0WA 3Q74A 3GN3A 1UA5A 5INYA 1ZL9A 1XWBA 4HZ2A 3FEUA 2I81A 5D9XA 5ECRB 1EP7A 3GRXA 4TW5A 3H1NA 3E3EA 1K0AA 5KOXA 2AUVA 3IK7A 1G0TA 5IPHA 2H01A 2PMTA 2QC7A 5KN3A 5D9TA 4HS1A 2C80A 3ZIVA 1B4QA 1ILOA 1YF1A 1Z3EA 1FAAA 2G2QA 1SJIA 1EWXA 3BD2A 1JLWA 4YAVA 1WE0A 2JACA 2H0HA 4WF4A 5AGYA 4POBA 3HZ8A 4TOPA 1F37A 4EC0A 3O3TA 3L4NA 1ZOFA 5CYYA 1BEDA 1K0DA 1MD4A 5IOWA 2LKUA 1A2JA 4MNNA 4MF5A 3UOMA 2O89A 3L9UA 3A5IA 3MIXA 3IAS2 4EIQA 4L5OA 2YV7A 4NWYA 3I43A 5EVOA 2HZEB 4F0BA 3F6DA 4K6XA 3C1RA 2XPDA 3CYNA 4WF5A 3RHBA 2XC2A 3EMPA 1O8WA 1I9DA 4CDOA 4WETA 1OKTA 2NTOA 1XWKA 5J5NA 1A8YA 3ME8A 2EC4A 2O85A 3DGQA 2GLRA 4RQRA 1XVWA 3QPMA 2C1YA 2KHPA 5LD0A 2PU9C 3F3QA 2JU5A 3F3RA 3Q19A 2WJUA 4ECJA 2IWTA 2LSTA 5ECQB 5COHA 4GSNA 1GUMA 5KOWA 5HFIA 4ZXGA 4KA0A 4TN8A 2GTUA 1J08A 1K0OA 1QMVA 2LQQA 4WR4A 1PKWA 5J9CA 2CT6A 4MJEA 1X0RA 3LEFA 1WRYA 3I6AA 2GSSA 2GS3A 3L0HA 4FYBA 3LQ7A 4OFTA 2FWGA 4LL4B 5DCGA 1K3YA 3TKQA 1THOA 2HE3A 2FA4A 1ZYEA 5D96A 4EE0A 13GSA 4K2XA 1TW9A 5FHIA 3D4MA 1TU7A 4DSQA 4GQCA 4ZB9A 5DJMA 1THXA 3TOTA 3APQA 2LEGA 1BYEA 2EIQA 2P5RA 4ZBDA 1SU9A 1XW5A 4LMWA 1GTAA 2N5FA 4MF6A 4MPFA 1T7PB 1XBSA 2C0DA 1JZRA 4YKFA 18GSA 1ZMAA 1E2YA 4I5QA 5JWOB 4TR1B 4OMVA 5ELAA 5IO0A 4NAXA 6GSWA 1W89A 3H93A 2AYTA 2GQLA 2WULA 1VF2A 5LCZA 2E7PA 2PWJA 3MNGA 2KP2A 4NPBA 4PUAA 2VOCA 3EURA 3HY2A 2H70A 4YH2A 4K5RA 3KP9A 1XOBA 2LRNA 1XWAA 2IMFA 3F9UA 1PSQA 1IYHA 3WGEA 5IMFA 2QA1A 5IMDA 1JLVA 3HD5A 1R26A 2B6MA 4N30A 1SK0A 1R5PA 3U5RE 1ERUA 1XCCA 1Y25A 2IMKA 3VFIA 1ZYNA 2WZ9A 4PURA 2YWNA 2LNTA 2CVBA 3ERWA 4KDYA 2L4QA 1OKDA 4MA9A 4GQFA 2AV4A 3DXBA 2FHEA 2HSYA 5F07A 2GQKA 3QAWA 3NZNA 2PGTA 1VF4A 3PINA 2CX4A 2M46A 3L9VA 4MJBA 3UJ1A 3ERFA 2I3YA 2JZSA 5CREA 5A4WA 1DUGA 4HJ2A 2B7KA 3VI7A 1G7OA 5KN2A 2YWMA 2NVLA 2JSYA 1YDKA 2OADA 5A4UA 4ML6A 1O8XA 2DJ2A 2R5GA 3IV4A 3C1SA 4ZILA 1TK8B 1JZWA 4MPGA 4P3YB 5G5EA 1GTBA 1SKWB 3V1WA 1X9MB 2CA8A 1TI3A 4CW9A 1X5CA 4QL9A 1W4VA 1AQWA 4EXJA 4NHZA 1MDIA 4NHWA 1YEXA 2OJLA 1EGOA 2WFCA 3KCMA 1FVKA 2I9HA 2H76A 1XOAA 2VCQA 3RDWA 4MABA 4DSSB 4A5PA 2RM5A 3GH6A 2VUPA 3D4TA 4XIHA 4NMUA 3VPQA 3FR6A 3GFKA 1EEMA 5J41A 3M9KA 5DDLA 4KX4A 2K8VA 2J23A 2FGXA 4XS1A 5IMAA 4LMVA 2YANA 3F4TA 4XS4B 3FW2A 4Z7XA 4KDUA 1M2DA 3NIVA 3UVTA 5ECLB 3BBYA 1YF0A 2H72A 4POLA 3TRQA 1E6BA 2P31A 1XIYA 1OE7A 2FWHA 4LLRA 5ECHB 3Q6OA 2HRKA 11GSA 1SYRA 2HLSA 2C4JA 1PKZA 1A2LA 3UEMA 1G6YA 3AY8A 3W8JA 2H74A 3GA4A 1EEJA 3IA1A 4MH2A 1YZXA 4BVYA 2ON5A 6GSTA 4EKZA 5DJLA 1U6TA 3DMLA 5IM9A 4KSMA 3M1GA 2C3NA 2XBIA 3KM6A 3TGZA 1JZDA 1WIKA 5DBQA 3GHAA 1OVNA 1O85A 4PQIA 4L0UA 2IN3A 3APOA 2VLUA 2P0GA 3KD0A 5AN1A 5DCHA 2WB9A 2C0FA 1XPVA 1PN9A 1OAZA 2A2SA 2VCXA 1OE8A 4ZL8A 1GWCA 2DJ0A 2K9FA 3ZVJA 5ECIB 4HU7A 4MCUA 1CQGA 5FWGA 5IMVA 4ECBA 4PGTA 1K0BA 5G30A 2H0GA 5ID2A 3D22A 3W8SA 4CY6A 1AQXA 2FCHA 2E2MA 4K0GA 4HI7A 4HQZA 4Z2UA 4TR4A 2QA2A 3A2VA 2R2JA 1TP9A 1R4WA 5B7CA 3IBHA 2YZUA 3VWXA 4EVMA 2BMXA 3VWUA 5HFGA 1Z6MA 2VL3A 3QAGA 4XS6A 2IL3A 1GNWA 4MDCA 4GCIA 1GSYA 17GSA 5B8BA 1ST9A 2BJXA 3LORA 2L57A 2NPBA 2B5YA 3HZ4A 4KGIA 4IGJA 1GUHA 2H6XA 4O92A 2GZZA 2H1GA 2MBSA 1R7HA 2L4CA 4MH3A 2K18A 4ECIA 1N8JA 1Z7PA 3M8NA 2LUSA 2MYGA 2FWFA 1FVJA 2H1BA 3QDNA 4XTSA 4EO3A 2PUKC 2MBTA 4O5QA 2HRFA 1TU8A 3KEBA 4YAPA 3TB2A 4F9ZA 3LFLA 5D8IA 1EZKA 3QFBC 4KNDA 1AW9A 4K0NA 5JCWA 4GLTA 1QXHA 3GMFA 2K8SA 2MMZA 1NHYA 4Z2RA 4OFNA 4JBBA 1BQ7A 4GXZA 2V6OA 4K8MA 4ZL9A 2B3SA 3A2XA 4KDXA 5FT3A 3M3MA 5DAKA 1J9BA 4IKHA 1K0MA 2YWOA 3W6GA 3TKRA 3MSZA 3F63A 3IK9A 3GKMA 2VD1A 2PVOC 4KSOA 2LRTA 1ERTA 4X4JA 2CVKA 5IMCA 3ZMKA 2ZCTA 6GSSA 2JSZA 5DQSA 3IXRA 2G0FA 1BAYA 1RW1A 2IFQA 4D73B 1M99A 3IRAA 3KXOA 1LU4A 2GDRA 1IYIA 5KN1A 3IC8A 2OA7A 9GSSA 1GTIA 1F9MA 1TRWA 3U6VA 1HQOA 3PPUA 2A4HA 2L5OA 3H79A 1OYJA 3J7Yk 4J56E 4PQ1A 4KF9A 2CAIA 4IS0A 2M80A 3K8NA 3EU3A 3UMAA 4ZBBA 1XWGA 5E4WA 2CQ9A 4GRFA 3VURA 3DRNA 4L8EA 3F0IA 4IN0A 2O87A 4ID0A 3G7YA 4ZBAA 10GSA 3ISOA 4ILFA 2HYXA 4G0LA 5ECOB 1LJRA 3D21A 5EY6A 4CY8A 5IOXA 3LJRA 3FR3A 4BVXA 3IR4A 3ZL5A 2GVPA 1NW2A 1TK5B 3C8EA 1LBKA 3QMXA 3G7IA 4JRRA 1QUWA 2YZHA 3EE2A 3KMOA 2CAQA 4ZB8A 5DAKB 12GSA 1USBA 2YJHA 3HA9A 3OR5A 2B5EA 5CAXA 3KGKA 4Z2TA 1SK1A 3CTGA 4HU9A 5D93A 3TJBA 1HNCA 1ML6A 4BWSA 4GF0A 4V1Ag 2GQMA 1TDIA 4FYCA 3GH9A 4I2TA 1YY7A 3G7JA 3BJ5A 4USSA 5HR1A 3N9JA 3C7MA 2FA8A 2E2GA 4XRAA 3WGXA 4FH8A 5BMUA 5JCUA 5LNKe 5JWRB 3F8UA 1T4ZA 3UARA 3GYKA 5ECKB 1H4OA 5D73A 1K3LA 5G1LA 5CRHA 1SD9A 4QQ7A 1RK4A 4K1FA 1FB0A 2R6KA 5J3RA 4Q5FA 1SL2B 1B4PA 4IW9A 5ECPB 1SKSB 4F82A 4TXOA 2R0PA 5HR3A 1T00A 2HRAA 3LW9A 1AXDA 4OO4A 2LJKA 2KUCA 6GSXA 3E9JB 3VWVA 4GTUA 4MF7A 5AIVA 5HR0A 5ECNB 4NV5A 4HZ4A 3S9FA 3HCZA 5B6NA 4YQUA 1FHEA 1JHBA 1ON4A 2NDOA 3RAZA 1U87A 2IMEA 5CRWA 1O73A 1V57A 3MAKA 4J57E 4BL7A 3ERGA 4G0KA 1M7TA 4X43A 4IJIA 3CSJA 3M0FA 2LNSA 2JL4A 1GULA 5L71A 3DYRA 5JCGA 2OBIA 4PQHA 4XRDA 4HEA2 5GAND 2DMLA 4F2IA 1TTZA 5HFKA 3EYTA 4I97A 1H75A 2IPAA 3GIXA 4OO5A 4OCEA 5EL8A 3VK9A 3WYWA 1FOHA 1AUCA 4XHMA 1EOHA 1XZOA 1JZOA 2HRNA 4G9HA 4Q5RA 1FG4A 3L9SA 2GT6A 2HZFA 5J9BA 2H30A 4K2DA 1V40A 2REMA 3IHQA 4E8HA 1PGTA 2H6ZA 3DWVA 3D5JA 4MK3A 3KP8A 2H75A 4POMA 3J7Yb 2GT5A 3PR8A 3KTLA 4G2EA 3WD6A 1TOFA 2JADA 4LL1B 3GTUA 5IPGA 2AHEA 3UAPA 2F3MA 1OC8A 3HXSA 4IJ3A 4KB3A 2VM2A 1MDKA 1YQ1A 1GL8A 1ERWA 2MMAA 2M72A 5HR2A 2D2ZA 3ZTLA 5IO2A 2NBSA 3D6IA 4IQ1A 4BWQA 5H5QA 4MMMA 2CZ3A 2CZ2A 2F8AA 3TKSC 1ERVA 2YWIA 5IIZA 4DVCA 2V6KA 1HYUA 1M2BA 1KNGA 2VLVA 1TXXA 3ZMLA 1V9WA 4POKA 3FZAA 2DMMA 4ACSA 14GSA 4HDEA 3C71A 4MZCA 1CQHA 4BA7A 2I4AA 1GLPA 2X8HA 4N11A 2RUEA 4QL7A 2KLXA 5F05A 1WP0A 1VF1A 3CTFA 4IELA 1SD8A 1B48A 1Z5YE 1TI1A 1OC9A 3VLNA 3GURA 2AJQB 4FYUA 1X5DA 3IOSA 5B8AA 1URMA 4TR0A 2WS2A 1U3AA 4E8EA 1QK8A 1FW1A 2QSIA 2HXKA 2VO4A 5H5SA 1T1VA 2HSHA 3DIEA 2C0GA 1TK0B 3HKRA 3P90A 3UBLA 2C8UA 4F0CA 4RUVA 3IC4A 3EVIA 5DQYA 1K0CA 4F03A 3I69A 1A8LA 4Q5QA 4X1UA 3ZZXA 3GX8A 3ZITA 1J0FA 1MTCA 1VF3A 4EUYA 2VL2C 3GKKA 3LSZA 5CRGA 4JEDA 2FWEA 2YPMA 3DEXA 3P8WA 4FO5A 5DALA 4JR6A 4EDZA 5D9WA 3LXZA 4J2FA 1SL0B 4JZQA 2VIMA 4Q5NA 2X4AA 1GSUA 4L5LA 3PH9A 4ECCA 2X64A 2DC5A 3ZYWA 2KP1A 3FY7A 2VCZA 6GSUA 2DJJA 2GSQA 3R2QA 3TKSE 3VI5A 4MZWA 2LS5A 5D9VA 2MZCA 3M9JA 4TXVA 3QR6A 3TUEA 2PERA 4BVYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WPI A;  1QGV A;  2LJA A;  3CSI A;  2L6D A;  3LGC A;  1AQV A;  1TJD A;  2OE1 A;  1VRS D;  3CRT A;  5GSS A;  1EV4 A;  3ED3 A;  2B7J A;  5KN0 A;  4RQX A;  2PPT A;  2RM6 A;  1T3B A;  1X9S B;  3VPT A;  1V98 A;  2H8L A;  3O6T A;  2H71 A;  3GX0 A;  2EIO A;  4ZB6 A;  2H0I A;  5ECS A;  2OE0 A;  4PUF C;  2ALB A;  2WRT A;  1M0U A;  2ZUP A;  3QCP A;  1X9W B;  4OCF A;  1VGL A;  2H19 A;  2YCD A;  2DIY A;  5ID2 B;  2IMI A;  5HQP A;  2ON7 A;  4AGS A;  1JFU A;  4FIW A;  5F0G A;  5E59 A;  4K9Z A;  1K0N A;  4V2N A;  8GSS A;  2LRC A;  1ZCP A;  1SEN A;  2HZE A;  4JR4 A;  3FHK A;  1S3C A;  4AJ7 A;  1GLQ A;  3DVW A;  2I1U A;  5CRD A;  1G6W A;  3IPZ A;  3LYK A;  1GSE A;  5IQY A;  3EC3 A;  4OFM A;  1AC1 A;  3UIW A;  5J4U A;  3TJF A;  4TVE A;  3CXG A;  3GST A;  4XCS A;  5G31 A;  4KCA A;  3D0Z A;  1N2A A;  3L78 A;  3WT1 A;  1PQN A;  4N0V A;  1GSF A;  1XXU A;  3GKX A;  3DKS A;  1M9B A;  4NV2 A;  3LG6 A;  3ZFL A;  3FZ4 A;  1SYX A;  2GST A;  1U3I A;  3BCK A;  3EWL A;  7GSS A;  1MDJ A;  1GSD A;  1NHO A;  2FUG 2;  1FOV A;  3ZRD A;  4HOJ A;  2F51 A;  4ZIJ A;  2WDU A;  3BCI A;  5F8B A;  3QD9 A;  4CHS A;  1ABA A;  2ZNM A;  4KCE A;  1A24 A;  4EF0 A;  3FZ5 A;  4MLY A;  3QOU A;  20GS A;  2B1L A;  1HNA A;  5G5F A;  5B6M A;  3ZLP A;  2KOK A;  2VCV A;  3HJP A;  4AJ8 A;  2IFQ B;  4TR1 A;  3I9V 2;  1A23 A;  3LWA A;  2DLX A;  3TKS A;  3ME7 A;  4KAE A;  4IVF A;  4DEJ A;  3GUS A;  1YEP A;  3HVS A;  3EMX A;  5CP1 A;  1EGR A;  2ES7 A;  2QKE A;  1C72 A;  3CRU A;  2XPE A;  2VM1 A;  1XVQ A;  2RLI A;  3GL5 A;  1EP8 A;  3P2A A;  3US3 A;  1M2A A;  2A4V A;  3KH9 A;  2OE3 A;  2VCT A;  3Q18 A;  2AB6 A;  4I8B A;  1XWC A;  19GS A;  1TRU A;  2PBJ A;  2VAF A;  1FO5 A;  1NSW A;  5IMZ A;  1F2E A;  2F8F A;  2C3Q A;  1A0F A;  5C04 A;  3UBK A;  3TRP A;  2FD3 A;  5G2Z A;  2P5Q A;  2VCW A;  1K3O A;  3TKP A;  3CBU A;  1G7E A;  3MDK A;  2GGT A;  2CVD A;  2DJ3 A;  1B9Y C;  2MMN A;  1PRX A;  2X8C A;  3FZ9 A;  4OD7 A;  1MD3 A;  4GSS A;  1O81 A;  1PL1 A;  3KMN A;  2C0E A;  3APS A;  3P7X A;  4RI7 A;  2V32 A;  1HD2 A;  3SBC A;  1B8X A;  3GL3 A;  3IE3 A;  3DVX A;  1TRS A;  3TRX A;  3ZVJ D;  4K7O A;  4IP1 A;  1KTE A;  3A2W A;  4PXO A;  4IBP A;  5EPF A;  4AJ6 A;  2DJ1 A;  1WJK A;  4ZL7 A;  4MJA A;  2VL9 A;  2K6V A;  3O76 A;  5A4V A;  1UC7 A;  1AAZ A;  2DSA A;  3C73 A;  4BPY A;  4TR3 A;  1YKC A;  2HFD A;  3GV1 A;  2VL2 A;  4V1A p;  1A2M A;  3TCO A;  3ZFB A;  3TDG A;  2IMD A;  4DSS A;  2AAW A;  4RI6 A;  3E0U A;  1DE1 A;  1EOG A;  2N5A A;  2L5L A;  4TXO B;  1PX7 A;  2JZR A;  2L6C A;  3A3T A;  3WT2 A;  5AIX A;  4O5R A;  4AF2 A;  3RPN A;  1GSQ A;  4OWY A;  3UL3 A;  1WMJ A;  2LTK A;  1QQ2 A;  5ENU A;  2OAC A;  4TRX A;  2FLS A;  3F6F A;  1Q4J A;  2A2R A;  4XS4 A;  1HNB A;  4IP6 A;  2OKA A;  3G9B A;  2J9H A;  2HNL A;  6GSY A;  2LQO A;  3FKF A;  2YV9 A;  1UVZ A;  2B5X A;  1Z9H A;  3TOU A;  5KEJ A;  4ISD A;  5AIS A;  2WCI A;  2O7K A;  2MMO A;  5CNW A;  1SL1 B;  4ML1 A;  2FNO A;  2YP6 A;  1FB6 A;  1ZGN A;  4O32 A;  3H4K A;  1WOU A;  1OC3 A;  3KTB A;  4GWR A;  3KIJ A;  3HHV A;  1YJ6 A;  1O6J A;  5F06 A;  2BTO T;  16GS A;  1T4Y A;  5ELG A;  1GNE A;  3RBT A;  1GTU A;  3KH7 A;  3QAV A;  2TIR A;  3UVH A;  2VLT A;  4KW6 A;  1GRX A;  1Z6N A;  1NM3 A;  1SJ6 A;  4I6X A;  4G10 A;  2Z9S A;  4WR5 A;  1RQM A;  3PGT A;  3H8Q A;  1XW6 A;  4H86 A;  4HQS A;  1XW9 A;  1S3D A;  3CSH A;  2R3X A;  3TJG A;  4N0Z A;  3A5W A;  2YN1 A;  1R5A A;  3HVX A;  1SKR B;  2RUF A;  3FR9 A;  2C3T A;  1GH2 A;  1M9A A;  2N5B A;  2F9S A;  2GZP A;  1GP1 A;  2TRC P;  3GKN A;  4YQV A;  1DBY A;  1S3A A;  2H6Y A;  1PL2 A;  2DBC A;  3TJK A;  1BJX A;  1V58 A;  2V1M A;  3GTU B;  3HJM A;  1XFL A;  5GST A;  2E0Q A;  1BG5 A;  4KH7 A;  1MEK A;  3HYP A;  3BOA A;  5CO3 A;  3IDV A;  1GUK A;  4O7H A;  1BX9 A;  2HT9 A;  3CMI A;  4WKW A;  3FYG A;  4WXT A;  1F3A A;  5G1K A;  2IIY A;  2CV4 A;  5ABR A;  2YOI A;  3NOF A;  2DJK A;  2R4V A;  4EL1 A;  1T8E B;  1PA3 A;  1PX6 A;  1KBN A;  3KZQ A;  2RII A;  4IHU A;  3HJO A;  4WEY A;  1EV9 A;  2H66 A;  3IAM 2;  4V2L A;  2OBK A;  1WWJ A;  2XBQ A;  1PMT A;  4NXI A;  5C00 A;  3F4R A;  1QFN A;  1UN2 A;  4DSR A;  5DVB A;  3HDC A;  3LXT A;  5GZZ B;  4ULX A;  4IQA A;  2V2G A;  3ZRE A;  2L59 A;  2HI7 A;  2XHF A;  2JZT A;  1AIU A;  1TKD B;  1OC9 B;  3RPP A;  3MWH A;  1O7U A;  5ECM B;  1PD2 1;  1SK2 A;  2DIZ A;  3TJJ A;  4MJC A;  3DD3 A;  4YQM A;  2H73 A;  2PVQ A;  5GAP D;  5JWQ B;  5A5K A;  2GSR A;  1F3B A;  3FK8 A;  2TRX A;  2H1D A;  2YNX A;  4MP4 A;  4K7I A;  3SWL A;  1ZZY A;  4D73 A;  1B9X C;  2X99 A;  1GSS A;  4HUA A;  4N10 A;  3HVV A;  4KUN A;  2QGV A;  4GST A;  2IJY A;  4LA1 A;  2R37 A;  1X5E A;  2FY6 A;  3EU4 A;  2LJR A;  1SJZ A;  2VD0 A;  3EIN A;  4HJM A;  2LV3 A;  4WBR D;  4G19 A;  4MZB A;  1KEB A;  1ACV A;  3VWW A;  1ZYQ B;  6GSV A;  1V2A A;  1F6M C;  3ZIJ A;  3N5O A;  4X0X A;  2GZY A;  4EDY A;  2B1K A;  2O8V B;  3QFA C;  4JU5 A;  5DAL B;  1A0R P;  4K7N A;  4PNF A;  1Y6E A;  1YKA A;  1Z7R A;  4PX1 A;  2X8G A;  22GS A;  2V41 A;  4TKY A;  4PNG A;  1Q98 A;  2WGR A;  2H1A A;  3GSS A;  3FRC A;  2PN8 A;  3WGD A;  2CX3 A;  4WBJ A;  4JE1 A;  1I5G A;  4KE3 A;  3F4S A;  3LYP A;  5H5R A;  3JCM L;  2YJ7 A;  1U88 A;  3RHC A;  1DSB A;  1DE2 A;  3GNJ A;  4I2U A;  3KJY A;  4V2M A;  1TRV A;  2EIR A;  4L0W A;  3Q74 A;  3GN3 A;  1UA5 A;  5INY A;  1ZL9 A;  1XWB A;  4HZ2 A;  3FEU A;  2I81 A;  5D9X A;  5ECR B;  1EP7 A;  3GRX A;  4TW5 A;  3H1N A;  3E3E A;  1K0A A;  2AUV A;  3IK7 A;  1G0T A;  5IPH A;  2H01 A;  2PMT A;  2QC7 A;  5KN3 A;  5D9T A;  4HS1 A;  2C80 A;  3ZIV A;  1B4Q A;  1ILO A;  1YF1 A;  1Z3E A;  1FAA A;  2G2Q A;  1SJI A;  1EWX A;  3BD2 A;  1JLW A;  4YAV A;  1WE0 A;  2JAC A;  2H0H A;  4WF4 A;  5AGY A;  4POB A;  3HZ8 A;  4TOP A;  1F37 A;  4EC0 A;  3O3T A;  3L4N A;  1ZOF A;  5CYY A;  1BED A;  1K0D A;  1MD4 A;  5IOW A;  2LKU A;  1A2J A;  3UOM A;  4MF5 A;  2O89 A;  3L9U A;  3IAS 2;  4L5O A;  2YV7 A;  4NWY A;  3I43 A;  5EVO A;  2HZE B;  4F0B A;  3F6D A;  4K6X A;  3C1R A;  2XPD A;  3CYN A;  4WF5 A;  3RHB A;  2XC2 A;  3EMP A;  1O8W A;  1I9D A;  4CDO A;  4WET A;  1OKT A;  2NTO A;  1XWK A;  5J5N A;  1A8Y A;  3ME8 A;  2EC4 A;  2O85 A;  3DGQ A;  2GLR A;  4RQR A;  1XVW A;  3QPM A;  2C1Y A;  2KHP A;  5LD0 A;  2PU9 C;  3F3Q A;  2JU5 A;  3F3R A;  3Q19 A;  2WJU A;  4ECJ A;  2IWT A;  2LST A;  5ECQ B;  5COH A;  4GSN A;  1GUM A;  5HFI A;  4ZXG A;  4KA0 A;  4TN8 A;  2GTU A;  1J08 A;  1K0O A;  1QMV A;  2LQQ A;  4WR4 A;  1PKW A;  5J9C A;  2CT6 A;  4MJE A;  1X0R A;  3LEF A;  1WRY A;  3I6A A;  2GSS A;  2GS3 A;  3L0H A;  4FYB A;  3LQ7 A;  4OFT A;  2FWG A;  4LL4 B;  5DCG A;  1K3Y A;  3TKQ A;  1THO A;  2HE3 A;  2FA4 A;  1ZYE A;  5D96 A;  4EE0 A;  13GS A;  1TW9 A;  5FHI A;  3D4M A;  1TU7 A;  4DSQ A;  4GQC A;  4ZB9 A;  5DJM A;  1THX A;  3TOT A;  3APQ A;  2LEG A;  1BYE A;  2EIQ A;  2P5R A;  4ZBD A;  1SU9 A;  1XW5 A;  4LMW A;  1GTA A;  2N5F A;  4MF6 A;  4MPF A;  1T7P B;  1XBS A;  2C0D A;  1JZR A;  18GS A;  1ZMA A;  1E2Y A;  4I5Q A;  5JWO B;  4TR1 B;  4OMV A;  5ELA A;  5IO0 A;  4NAX A;  6GSW A;  1W89 A;  3H93 A;  2AYT A;  2GQL A;  2WUL A;  1VF2 A;  5LCZ A;  2E7P A;  2PWJ A;  3MNG A;  2KP2 A;  4NPB A;  4PUA A;  2VOC A;  3EUR A;  3HY2 A;  2H70 A;  4YH2 A;  3KP9 A;  1XOB A;  2LRN A;  1XWA A;  2IMF A;  3F9U A;  1PSQ A;  1IYH A;  3WGE A;  5IMF A;  5IMD A;  1JLV A;  3HD5 A;  1R26 A;  2B6M A;  4N30 A;  1SK0 A;  1R5P A;  3U5R E;  1ERU A;  1XCC A;  1Y25 A;  2IMK A;  3VFI A;  2WZ9 A;  4PUR A;  2YWN A;  2LNT A;  2CVB A;  3ERW A;  4KDY A;  2L4Q A;  1OKD A;  4MA9 A;  4GQF A;  2AV4 A;  3DXB A;  2FHE A;  2HSY A;  5F07 A;  2GQK A;  3QAW A;  3NZN A;  2PGT A;  1VF4 A;  3PIN A;  2CX4 A;  2M46 A;  3L9V A;  4MJB A;  3UJ1 A;  3ERF A;  2I3Y A;  2JZS A;  5CRE A;  5A4W A;  1DUG A;  4HJ2 A;  2B7K A;  3VI7 A;  1G7O A;  5KN2 A;  2YWM A;  2NVL A;  2JSY A;  1YDK A;  2OAD A;  5A4U A;  4ML6 A;  1O8X A;  2DJ2 A;  2R5G A;  3IV4 A;  3C1S A;  4ZIL A;  1TK8 B;  1JZW A;  4MPG A;  4P3Y B;  5G5E A;  1GTB A;  1SKW B;  3V1W A;  1X9M B;  2CA8 A;  1TI3 A;  4CW9 A;  1X5C A;  4QL9 A;  1W4V A;  1AQW A;  4EXJ A;  4NHZ A;  1MDI A;  4NHW A;  1YEX A;  2OJL A;  1EGO A;  2WFC A;  3KCM A;  1FVK A;  2I9H A;  2H76 A;  1XOA A;  2VCQ A;  3RDW A;  4MAB A;  4DSS B;  2RM5 A;  3GH6 A;  2VUP A;  3D4T A;  4XIH A;  4NMU A;  3VPQ A;  3FR6 A;  3GFK A;  1EEM A;  5J41 A;  3M9K A;  5DDL A;  4KX4 A;  2K8V A;  2J23 A;  2FGX A;  4XS1 A;  5IMA A;  4LMV A;  2YAN A;  3F4T A;  4XS4 B;  3FW2 A;  4Z7X A;  4KDU A;  1M2D A;  3NIV A;  3UVT A;  5ECL B;  3BBY A;  1YF0 A;  2H72 A;  4POL A;  3TRQ A;  1E6B A;  2P31 A;  1XIY A;  1OE7 A;  2FWH A;  4LLR A;  5ECH B;  3Q6O A;  11GS A;  1SYR A;  2HLS A;  2C4J A;  1PKZ A;  1A2L A;  3UEM A;  1G6Y A;  3AY8 A;  3W8J A;  2H74 A;  3GA4 A;  1EEJ A;  3IA1 A;  4MH2 A;  1YZX A;  4BVY A;  2ON5 A;  6GST A;  4EKZ A;  5DJL A;  1U6T A;  3DML A;  5IM9 A;  4KSM A;  3M1G A;  2C3N A;  2XBI A;  3KM6 A;  3TGZ A;  1JZD A;  1WIK A;  5DBQ A;  3GHA A;  1OVN A;  1O85 A;  4PQI A;  4L0U A;  2IN3 A;  3APO A;  2VLU A;  2P0G A;  3KD0 A;  5AN1 A;  5DCH A;  2WB9 A;  2C0F A;  1XPV A;  1PN9 A;  1OAZ A;  2A2S A;  2VCX A;  1OE8 A;  4ZL8 A;  1GWC A;  2DJ0 A;  2K9F A;  3ZVJ A;  5ECI B;  4HU7 A;  4MCU A;  1CQG A;  5FWG A;  5IMV A;  4ECB A;  4PGT A;  1K0B A;  5G30 A;  2H0G A;  5ID2 A;  3D22 A;  3W8S A;  1AQX A;  2FCH A;  2E2M A;  4K0G A;  4HI7 A;  4HQZ A;  4TR4 A;  3A2V A;  2R2J A;  1TP9 A;  1R4W A;  5B7C A;  3IBH A;  2YZU A;  3VWX A;  4EVM A;  2BMX A;  3VWU A;  5HFG A;  1Z6M A;  2VL3 A;  3QAG A;  4XS6 A;  2IL3 A;  1GNW A;  4MDC A;  4GCI A;  1GSY A;  17GS A;  5B8B A;  1ST9 A;  2BJX A;  3LOR A;  2L57 A;  2NPB A;  2B5Y A;  3HZ4 A;  4KGI A;  4IGJ A;  1GUH A;  2H6X A;  4O92 A;  2GZZ A;  2H1G A;  2MBS A;  1R7H A;  2L4C A;  4MH3 A;  2K18 A;  4ECI A;  1N8J A;  1Z7P A;  3M8N A;  2LUS A;  2MYG A;  2FWF A;  1FVJ A;  2H1B A;  3QDN A;  4XTS A;  4EO3 A;  2PUK C;  2MBT A;  2HRF A;  1TU8 A;  3KEB A;  4YAP A;  3TB2 A;  4F9Z A;  3LFL A;  5D8I A;  1EZK A;  3QFB C;  4KND A;  1AW9 A;  4K0N A;  5JCW A;  4GLT A;  1QXH A;  3GMF A;  2K8S A;  2MMZ A;  1NHY A;  4OFN A;  4JBB A;  1BQ7 A;  4GXZ A;  2V6O A;  4K8M A;  4ZL9 A;  2B3S A;  3A2X A;  4KDX A;  5FT3 A;  3M3M A;  5DAK A;  1J9B A;  4IKH A;  1K0M A;  2YWO A;  3W6G A;  3TKR A;  3MSZ A;  3F63 A;  3IK9 A;  3GKM A;  2VD1 A;  2PVO C;  4KSO A;  2LRT A;  1ERT A;  2CVK A;  5IMC A;  3ZMK A;  2ZCT A;  6GSS A;  2JSZ A;  5DQS A;  3IXR A;  2G0F A;  1BAY A;  1RW1 A;  2IFQ A;  4D73 B;  1M99 A;  3IRA A;  3KXO A;  1LU4 A;  2GDR A;  1IYI A;  5KN1 A;  2OA7 A;  9GSS A;  1GTI A;  1F9M A;  1TRW A;  3U6V A;  1HQO A;  2L5O A;  3J7Y k;  3H79 A;  1OYJ A;  4J56 E;  4PQ1 A;  2CAI A;  4IS0 A;  2M80 A;  3K8N A;  3EU3 A;  3UMA A;  4ZBB A;  1XWG A;  5E4W A;  2CQ9 A;  4GRF A;  3VUR A;  3DRN A;  4L8E A;  3F0I A;  4IN0 A;  2O87 A;  4ID0 A;  3G7Y A;  4ZBA A;  10GS A;  3ISO A;  4ILF A;  2HYX A;  5ECO B;  1LJR A;  3D21 A;  5EY6 A;  5IOX A;  3LJR A;  3FR3 A;  4BVX A;  3IR4 A;  3ZL5 A;  2GVP A;  1NW2 A;  1TK5 B;  3C8E A;  1LBK A;  3QMX A;  3G7I A;  4JRR A;  1QUW A;  2YZH A;  3EE2 A;  3KMO A;  2CAQ A;  4ZB8 A;  5DAK B;  12GS A;  1USB A;  2YJH A;  3HA9 A;  3OR5 A;  2B5E A;  5CAX A;  3KGK A;  1SK1 A;  3CTG A;  4HU9 A;  5D93 A;  3TJB A;  1HNC A;  1ML6 A;  4BWS A;  4GF0 A;  4V1A g;  2GQM A;  1TDI A;  4FYC A;  3GH9 A;  4I2T A;  1YY7 A;  3G7J A;  3BJ5 A;  5HR1 A;  3N9J A;  3C7M A;  2FA8 A;  2E2G A;  4XRA A;  3WGX A;  4FH8 A;  5JCU A;  5LNK e;  5JWR B;  3F8U A;  1T4Z A;  3UAR A;  3GYK A;  5ECK B;  1H4O A;  5D73 A;  1K3L A;  5G1L A;  5CRH A;  1SD9 A;  4QQ7 A;  1RK4 A;  4K1F A;  1FB0 A;  2R6K A;  5J3R A;  4Q5F A;  1SL2 B;  1B4P A;  4IW9 A;  5ECP B;  1SKS B;  4F82 A;  4TXO A;  5HR3 A;  1T00 A;  1AXD A;  4OO4 A;  2LJK A;  2KUC A;  6GSX A;  3E9J B;  3VWV A;  4GTU A;  4MF7 A;  5AIV A;  5HR0 A;  5ECN B;  4NV5 A;  4HZ4 A;  3S9F A;  3HCZ A;  5B6N A;  4YQU A;  1FHE A;  1JHB A;  1ON4 A;  2NDO A;  3RAZ A;  1U87 A;  2IME A;  5CRW A;  1O73 A;  1V57 A;  3MAK A;  4J57 E;  4BL7 A;  3ERG A;  1M7T A;  4X43 A;  4IJI A;  3CSJ A;  3M0F A;  2LNS A;  2JL4 A;  1GUL A;  5L71 A;  3DYR A;  5JCG A;  2OBI A;  4PQH A;  4XRD A;  4HEA 2;  5GAN D;  2DML A;  4F2I A;  1TTZ A;  5HFK A;  3EYT A;  4I97 A;  1H75 A;  2IPA A;  3GIX A;  4OO5 A;  4OCE A;  5EL8 A;  3VK9 A;  3WYW A;  1AUC A;  4XHM A;  1EOH A;  1XZO A;  1JZO A;  2HRN A;  4G9H A;  4Q5R A;  1FG4 A;  3L9S A;  2GT6 A;  2HZF A;  5J9B A;  2H30 A;  4K2D A;  1V40 A;  2REM A;  3IHQ A;  4E8H A;  1PGT A;  2H6Z A;  3DWV A;  3D5J A;  4MK3 A;  3KP8 A;  2H75 A;  4POM A;  3J7Y b;  2GT5 A;  3PR8 A;  3KTL A;  4G2E A;  3WD6 A;  1TOF A;  2JAD A;  4LL1 B;  3GTU A;  5IPG A;  2AHE A;  3UAP A;  2F3M A;  1OC8 A;  3HXS A;  4IJ3 A;  4KB3 A;  2VM2 A;  1MDK A;  1YQ1 A;  1GL8 A;  1ERW A;  2MMA A;  2M72 A;  5HR2 A;  2D2Z A;  3ZTL A;  5IO2 A;  2NBS A;  3D6I A;  4IQ1 A;  4BWQ A;  5H5Q A;  4MMM A;  2CZ3 A;  2CZ2 A;  2F8A A;  3TKS C;  1ERV A;  2YWI A;  5IIZ A;  4DVC A;  2V6K A;  1HYU A;  1M2B A;  1KNG A;  2VLV A;  1TXX A;  3ZML A;  1V9W A;  4POK A;  3FZA A;  2DMM A;  4ACS A;  14GS A;  4HDE A;  3C71 A;  4MZC A;  1CQH A;  4BA7 A;  2I4A A;  1GLP A;  2X8H A;  4N11 A;  2RUE A;  4QL7 A;  2KLX A;  5F05 A;  1WP0 A;  1VF1 A;  3CTF A;  4IEL A;  1SD8 A;  1B48 A;  1Z5Y E;  1TI1 A;  1OC9 A;  3VLN A;  3GUR A;  2AJQ B;  4FYU A;  1X5D A;  3IOS A;  5B8A A;  1URM A;  4TR0 A;  2WS2 A;  1U3A A;  4E8E A;  1QK8 A;  1FW1 A;  2QSI A;  2HXK A;  2VO4 A;  5H5S A;  1T1V A;  2HSH A;  3DIE A;  2C0G A;  1TK0 B;  3HKR A;  3P90 A;  3UBL A;  2C8U A;  4F0C A;  4RUV A;  3IC4 A;  3EVI A;  5DQY A;  1K0C A;  4F03 A;  3I69 A;  1A8L A;  4Q5Q A;  4X1U A;  3ZZX A;  3GX8 A;  3ZIT A;  1J0F A;  1MTC A;  1VF3 A;  4EUY A;  2VL2 C;  3GKK A;  3LSZ A;  5CRG A;  4JED A;  2FWE A;  2YPM A;  3DEX A;  3P8W A;  5DAL A;  4FO5 A;  4JR6 A;  4EDZ A;  5D9W A;  3LXZ A;  4J2F A;  1SL0 B;  4JZQ A;  2VIM A;  4Q5N A;  1GSU A;  4L5L A;  3PH9 A;  4ECC A;  2X64 A;  2DC5 A;  3ZYW A;  2KP1 A;  3FY7 A;  2VCZ A;  6GSU A;  2DJJ A;  2GSQ A;  3R2Q A;  3TKS E;  3VI5 A;  4MZW A;  2LS5 A;  5D9V A;  2MZC A;  3M9J A;  4TXV A;  3QR6 A;  3TUE A;  2PER A; 
#chains in the Genus database with same CATH topology
 1WPI A;  1QGV A;  2LJA A;  3CSI A;  2L6D A;  3LGC A;  1AQV A;  1TJD A;  3FMW A;  2OE1 A;  1VRS D;  3CRT A;  5GSS A;  1EV4 A;  3ED3 A;  2B7J A;  5KN0 A;  4RQX A;  2PPT A;  2RM6 A;  1T3B A;  1X9S B;  3VPT A;  1V98 A;  2H8L A;  3O6T A;  2H71 A;  3GX0 A;  2EIO A;  4ZB6 A;  2H0I A;  5ECS A;  2OE0 A;  4PUF C;  2ALB A;  2WRT A;  1M0U A;  2ZUP A;  3QCP A;  1X9W B;  3MYD A;  4OCF A;  1VGL A;  2H19 A;  2YCD A;  2DIY A;  5ID2 B;  2IMI A;  5HQP A;  2ON7 A;  4AGS A;  1JFU A;  4FIW A;  5F0G A;  5E59 A;  4K9Z A;  1K0N A;  4V2N A;  8GSS A;  2LRC A;  1ZCP A;  1SEN A;  2HZE A;  4JR4 A;  3FHK A;  1S3C A;  4AJ7 A;  1GLQ A;  3DVW A;  2I1U A;  5CRD A;  1G6W A;  3IPZ A;  3LYK A;  1GSE A;  5IQY A;  4G0I A;  3EC3 A;  4OFM A;  1AC1 A;  3UIW A;  5J4U A;  3TJF A;  4TVE A;  3CXG A;  3GST A;  4XCS A;  5G31 A;  4KCA A;  3D0Z A;  1N2A A;  3L78 A;  3WT1 A;  1PQN A;  4N0V A;  1GSF A;  1XXU A;  3GKX A;  3DKS A;  1M9B A;  4NV2 A;  3LG6 A;  3ZFL A;  3FZ4 A;  1SYX A;  2GST A;  1U3I A;  4EIP A;  3BCK A;  3EWL A;  3IHG A;  7GSS A;  1MDJ A;  1GSD A;  1NHO A;  2FUG 2;  1FOV A;  3ZRD A;  4HOJ A;  2F51 A;  4ZIJ A;  2WDU A;  3BCI A;  5F8B A;  3QD9 A;  4CHS A;  1ABA A;  2ZNM A;  4KCE A;  1A24 A;  4EF0 A;  3FZ5 A;  4MLY A;  3QOU A;  20GS A;  2B1L A;  1HNA A;  5G5F A;  5B6M A;  3ZLP A;  2KOK A;  2VCV A;  3HJP A;  4AJ8 A;  2IFQ B;  4TR1 A;  3I9V 2;  1A23 A;  3LWA A;  2DLX A;  3TKS A;  3ME7 A;  4KAE A;  4IVF A;  2X49 A;  4DEJ A;  3GUS A;  1YEP A;  3HVS A;  3EMX A;  5CP1 A;  1EGR A;  2ES7 A;  2QKE A;  1C72 A;  3CRU A;  2XPE A;  2VM1 A;  1XVQ A;  2RLI A;  3GL5 A;  1EP8 A;  3P2A A;  3US3 A;  1M2A A;  2A4V A;  3KH9 A;  2OE3 A;  2VCT A;  3Q18 A;  2AB6 A;  1PN0 A;  4I8B A;  1XWC A;  19GS A;  1TRU A;  2PBJ A;  2VAF A;  1FO5 A;  1NSW A;  5IMZ A;  1F2E A;  2F8F A;  2C3Q A;  1A0F A;  5C04 A;  4BVX B;  3UBK A;  3TRP A;  2FD3 A;  5G2Z A;  2P5Q A;  2VCW A;  1K3O A;  3TKP A;  3CBU A;  1G7E A;  3MDK A;  4PTS A;  2GGT A;  2CVD A;  2DJ3 A;  1B9Y C;  2MMN A;  1PRX A;  2X8C A;  3FZ9 A;  4OD7 A;  1MD3 A;  4GSS A;  1O81 A;  1PL1 A;  3KMN A;  2C0E A;  2UZ8 A;  3APS A;  3P7X A;  4RI7 A;  2V32 A;  1HD2 A;  3SBC A;  1B8X A;  3GL3 A;  3IE3 A;  3DVX A;  1TRS A;  3TRX A;  3ZVJ D;  4K7O A;  4IP1 A;  1KTE A;  3A2W A;  4PXO A;  4IBP A;  5EPF A;  4AJ6 A;  2DJ1 A;  1WJK A;  4ZL7 A;  4MJA A;  2VL9 A;  2K6V A;  3O76 A;  5A4V A;  1UC7 A;  1AAZ A;  2DSA A;  3R3E A;  3C73 A;  4BPY A;  4TR3 A;  1YKC A;  2HFD A;  3GV1 A;  2VL2 A;  4V1A p;  1A2M A;  3TCO A;  3ZFB A;  3TDG A;  2IMD A;  4DSS A;  2AAW A;  4RI6 A;  3E0U A;  1DE1 A;  1EOG A;  2N5A A;  2L5L A;  4TXO B;  1PX7 A;  2JZR A;  2L6C A;  3A3T A;  3WT2 A;  5AIX A;  4O5R A;  4AF2 A;  3RPN A;  1GSQ A;  4OWY A;  3UL3 A;  2DKI A;  1WMJ A;  2LTK A;  1QQ2 A;  5ENU A;  2R0G A;  2OAC A;  4TRX A;  2FLS A;  3F6F A;  1Q4J A;  2A2R A;  4XS4 A;  1HNB A;  4IP6 A;  2OKA A;  3G9B A;  2J9H A;  2HNL A;  6GSY A;  2LQO A;  3FKF A;  2YV9 A;  1UVZ A;  2B5X A;  1Z9H A;  3TOU A;  5KEJ A;  4ISD A;  5AIS A;  2WCI A;  2O7K A;  2MMO A;  5CNW A;  1SL1 B;  4ML1 A;  2FNO A;  2YP6 A;  1FB6 A;  4BL7 B;  1ZGN A;  4O32 A;  3H4K A;  1WOU A;  1OC3 A;  4K5S A;  3KTB A;  4GWR A;  3KIJ A;  3HHV A;  1YJ6 A;  1O6J A;  5F06 A;  2BTO T;  16GS A;  1T4Y A;  5ELG A;  1GNE A;  3RBT A;  1GTU A;  3KH7 A;  3QAV A;  2TIR A;  3UVH A;  2VLT A;  4KW6 A;  1GRX A;  1Z6N A;  1NM3 A;  1SJ6 A;  4I6X A;  4G10 A;  2Z9S A;  4WR5 A;  1RQM A;  3PGT A;  3H8Q A;  1XW6 A;  1ZYP A;  4H86 A;  4HQS A;  1XW9 A;  1S3D A;  3CSH A;  2R3X A;  4O5U A;  3TJG A;  4N0Z A;  3A5W A;  2YN1 A;  1R5A A;  3HVX A;  1SKR B;  2RUF A;  3FR9 A;  2C3T A;  1GH2 A;  1M9A A;  2N5B A;  2F9S A;  2GZP A;  1GP1 A;  2TRC P;  3GKN A;  4YQV A;  1DBY A;  1S3A A;  2H6Y A;  1PL2 A;  2DBC A;  3TJK A;  1BJX A;  4YKG A;  1V58 A;  2V1M A;  3GTU B;  3HJM A;  1XFL A;  5GST A;  2E0Q A;  1BG5 A;  4KH7 A;  4FQU A;  1MEK A;  3HYP A;  3BOA A;  5CO3 A;  3IDV A;  1GUK A;  4O7H A;  1BX9 A;  2HT9 A;  3CMI A;  4WKW A;  3FYG A;  4WXT A;  1F3A A;  5G1K A;  2IIY A;  2CV4 A;  5ABR A;  2YOI A;  3NOF A;  3EPT A;  2DJK A;  2R4V A;  4EL1 A;  1T8E B;  1PA3 A;  1PX6 A;  1KBN A;  3KZQ A;  5BRT A;  2R0C A;  2RII A;  4IHU A;  3HJO A;  4WEY A;  1EV9 A;  2H66 A;  3IAM 2;  4V2L A;  2OBK A;  1WWJ A;  2XBQ A;  1PMT A;  4NXI A;  2DKH A;  5C00 A;  3F4R A;  1QFN A;  1UN2 A;  4DSR A;  5DVB A;  3HDC A;  3LXT A;  5GZZ B;  4ULX A;  4IQA A;  2V2G A;  3ZRE A;  2L59 A;  2HI7 A;  2XHF A;  2JZT A;  1AIU A;  1TKD B;  1OC9 B;  3RPP A;  3MWH A;  1O7U A;  5ECM B;  1PD2 1;  1SK2 A;  2DIZ A;  3TJJ A;  4MJC A;  3DD3 A;  4YQM A;  2H73 A;  2PVQ A;  5GAP D;  5JWQ B;  5A5K A;  2GSR A;  1F3B A;  3FK8 A;  2TRX A;  2H1D A;  2YNX A;  4MP4 A;  4K7I A;  3SWL A;  1ZZY A;  4D73 A;  1B9X C;  2X99 A;  1GSS A;  4HUA A;  4N10 A;  3HVV A;  4KUN A;  2QGV A;  4GST A;  2IJY A;  4LA1 A;  2R37 A;  1X5E A;  2FY6 A;  3EU4 A;  2LJR A;  1SJZ A;  2VD0 A;  3EIN A;  4HJM A;  2LV3 A;  4WBR D;  4G19 A;  4MZB A;  1KEB A;  1ACV A;  2A2P A;  3VWW A;  1ZYQ B;  6GSV A;  1V2A A;  1F6M C;  3ZIJ A;  3N5O A;  4X0X A;  2GZY A;  4EDY A;  2B1K A;  2O8V B;  4ICY A;  3QFA C;  4JU5 A;  5DAL B;  1A0R P;  4K7N A;  4PNF A;  1Y6E A;  1YKA A;  1Z7R A;  4PX1 A;  2X8G A;  22GS A;  2V41 A;  4TKY A;  4PNG A;  1Q98 A;  2WGR A;  2H1A A;  3GSS A;  3FRC A;  2PN8 A;  3WGD A;  2CX3 A;  4WBJ A;  4JE1 A;  1I5G A;  4KE3 A;  3F4S A;  3LYP A;  5H5R A;  3JCM L;  2YJ7 A;  1U88 A;  3RHC A;  1DSB A;  1DE2 A;  2HSM A;  3GNJ A;  4I2U A;  3KJY A;  4V2M A;  1TRV A;  2EIR A;  4L0W A;  3Q74 A;  3GN3 A;  1UA5 A;  5INY A;  1ZL9 A;  1XWB A;  4HZ2 A;  3FEU A;  2I81 A;  5D9X A;  5ECR B;  1EP7 A;  3GRX A;  4TW5 A;  3H1N A;  3E3E A;  1K0A A;  5KOX A;  2AUV A;  3IK7 A;  1G0T A;  5IPH A;  2H01 A;  2PMT A;  2QC7 A;  5KN3 A;  5D9T A;  4HS1 A;  2C80 A;  3ZIV A;  1B4Q A;  1ILO A;  1YF1 A;  1Z3E A;  1FAA A;  2G2Q A;  1SJI A;  1EWX A;  3BD2 A;  1JLW A;  4YAV A;  1WE0 A;  2JAC A;  2H0H A;  4WF4 A;  5AGY A;  4POB A;  3HZ8 A;  4TOP A;  1F37 A;  4EC0 A;  3O3T A;  3L4N A;  1ZOF A;  5CYY A;  1BED A;  1K0D A;  1MD4 A;  5IOW A;  2LKU A;  1A2J A;  4MNN A;  4MF5 A;  3UOM A;  2O89 A;  3L9U A;  3A5I A;  3MIX A;  3IAS 2;  4EIQ A;  4L5O A;  2YV7 A;  4NWY A;  3I43 A;  5EVO A;  2HZE B;  4F0B A;  3F6D A;  4K6X A;  3C1R A;  2XPD A;  3CYN A;  4WF5 A;  3RHB A;  2XC2 A;  3EMP A;  1O8W A;  1I9D A;  4CDO A;  4WET A;  1OKT A;  2NTO A;  1XWK A;  5J5N A;  1A8Y A;  3ME8 A;  2EC4 A;  2O85 A;  3DGQ A;  2GLR A;  4RQR A;  1XVW A;  3QPM A;  2C1Y A;  2KHP A;  5LD0 A;  2PU9 C;  3F3Q A;  2JU5 A;  3F3R A;  3Q19 A;  2WJU A;  4ECJ A;  2IWT A;  2LST A;  5ECQ B;  5COH A;  4GSN A;  1GUM A;  5KOW A;  5HFI A;  4ZXG A;  4KA0 A;  4TN8 A;  2GTU A;  1J08 A;  1K0O A;  1QMV A;  2LQQ A;  4WR4 A;  1PKW A;  5J9C A;  2CT6 A;  4MJE A;  1X0R A;  3LEF A;  1WRY A;  3I6A A;  2GSS A;  2GS3 A;  3L0H A;  4FYB A;  3LQ7 A;  4OFT A;  2FWG A;  4LL4 B;  5DCG A;  1K3Y A;  3TKQ A;  1THO A;  2HE3 A;  2FA4 A;  1ZYE A;  5D96 A;  4EE0 A;  13GS A;  4K2X A;  1TW9 A;  5FHI A;  3D4M A;  1TU7 A;  4DSQ A;  4GQC A;  4ZB9 A;  5DJM A;  1THX A;  3TOT A;  3APQ A;  2LEG A;  1BYE A;  2EIQ A;  2P5R A;  4ZBD A;  1SU9 A;  1XW5 A;  4LMW A;  1GTA A;  2N5F A;  4MF6 A;  4MPF A;  1T7P B;  1XBS A;  2C0D A;  1JZR A;  4YKF A;  18GS A;  1ZMA A;  1E2Y A;  4I5Q A;  5JWO B;  4TR1 B;  4OMV A;  5ELA A;  5IO0 A;  4NAX A;  6GSW A;  1W89 A;  3H93 A;  2AYT A;  2GQL A;  2WUL A;  1VF2 A;  5LCZ A;  2E7P A;  2PWJ A;  3MNG A;  2KP2 A;  4NPB A;  4PUA A;  2VOC A;  3EUR A;  3HY2 A;  2H70 A;  4YH2 A;  4K5R A;  3KP9 A;  1XOB A;  2LRN A;  1XWA A;  2IMF A;  3F9U A;  1PSQ A;  1IYH A;  3WGE A;  5IMF A;  2QA1 A;  5IMD A;  1JLV A;  3HD5 A;  1R26 A;  2B6M A;  4N30 A;  1SK0 A;  1R5P A;  3U5R E;  1ERU A;  1XCC A;  1Y25 A;  2IMK A;  3VFI A;  1ZYN A;  2WZ9 A;  4PUR A;  2YWN A;  2LNT A;  2CVB A;  3ERW A;  4KDY A;  2L4Q A;  1OKD A;  4MA9 A;  4GQF A;  2AV4 A;  3DXB A;  2FHE A;  2HSY A;  5F07 A;  2GQK A;  3QAW A;  3NZN A;  2PGT A;  1VF4 A;  3PIN A;  2CX4 A;  2M46 A;  3L9V A;  4MJB A;  3UJ1 A;  3ERF A;  2I3Y A;  2JZS A;  5CRE A;  5A4W A;  1DUG A;  4HJ2 A;  2B7K A;  3VI7 A;  1G7O A;  5KN2 A;  2YWM A;  1XG8 A;  2NVL A;  2JSY A;  1YDK A;  2OAD A;  5A4U A;  4ML6 A;  1O8X A;  2DJ2 A;  2R5G A;  3IV4 A;  3C1S A;  4ZIL A;  1TK8 B;  1JZW A;  4MPG A;  4P3Y B;  5G5E A;  1GTB A;  1SKW B;  3V1W A;  1X9M B;  2CA8 A;  1TI3 A;  4CW9 A;  1X5C A;  4QL9 A;  1W4V A;  1AQW A;  4EXJ A;  4NHZ A;  1MDI A;  4NHW A;  1YEX A;  2OJL A;  1EGO A;  2WFC A;  3KCM A;  1FVK A;  2I9H A;  2H76 A;  1XOA A;  2VCQ A;  3RDW A;  4MAB A;  4DSS B;  4A5P A;  2RM5 A;  3GH6 A;  2VUP A;  3D4T A;  4XIH A;  4NMU A;  3VPQ A;  3FR6 A;  3GFK A;  1EEM A;  5J41 A;  3M9K A;  5DDL A;  4KX4 A;  2K8V A;  2J23 A;  2FGX A;  4XS1 A;  5IMA A;  4LMV A;  2YAN A;  3F4T A;  4XS4 B;  3FW2 A;  4Z7X A;  4KDU A;  1M2D A;  3NIV A;  3UVT A;  5ECL B;  3BBY A;  1YF0 A;  2H72 A;  4POL A;  3TRQ A;  1E6B A;  2P31 A;  1XIY A;  1OE7 A;  2FWH A;  4LLR A;  5ECH B;  3Q6O A;  2HRK A;  11GS A;  1SYR A;  2HLS A;  2C4J A;  1PKZ A;  1A2L A;  3UEM A;  1G6Y A;  3AY8 A;  3W8J A;  2H74 A;  3GA4 A;  1EEJ A;  3IA1 A;  4MH2 A;  1YZX A;  4BVY A;  2ON5 A;  6GST A;  4EKZ A;  5DJL A;  1U6T A;  3DML A;  5IM9 A;  4KSM A;  3M1G A;  2C3N A;  2XBI A;  3KM6 A;  3TGZ A;  1JZD A;  1WIK A;  5DBQ A;  3GHA A;  1OVN A;  1O85 A;  4PQI A;  4L0U A;  2IN3 A;  3APO A;  2VLU A;  2P0G A;  3KD0 A;  5AN1 A;  5DCH A;  2WB9 A;  2C0F A;  1XPV A;  1PN9 A;  1OAZ A;  2A2S A;  2VCX A;  1OE8 A;  4ZL8 A;  1GWC A;  2DJ0 A;  2K9F A;  3ZVJ A;  5ECI B;  4HU7 A;  4MCU A;  1CQG A;  5FWG A;  5IMV A;  4ECB A;  4PGT A;  1K0B A;  5G30 A;  2H0G A;  5ID2 A;  3D22 A;  3W8S A;  4CY6 A;  1AQX A;  2FCH A;  2E2M A;  4K0G A;  4HI7 A;  4HQZ A;  4Z2U A;  4TR4 A;  2QA2 A;  3A2V A;  2R2J A;  1TP9 A;  1R4W A;  5B7C A;  3IBH A;  2YZU A;  3VWX A;  4EVM A;  2BMX A;  3VWU A;  5HFG A;  1Z6M A;  2VL3 A;  3QAG A;  4XS6 A;  2IL3 A;  1GNW A;  4MDC A;  4GCI A;  1GSY A;  17GS A;  5B8B A;  1ST9 A;  2BJX A;  3LOR A;  2L57 A;  2NPB A;  2B5Y A;  3HZ4 A;  4KGI A;  4IGJ A;  1GUH A;  2H6X A;  4O92 A;  2GZZ A;  2H1G A;  2MBS A;  1R7H A;  2L4C A;  4MH3 A;  2K18 A;  4ECI A;  1N8J A;  1Z7P A;  3M8N A;  2LUS A;  2MYG A;  2FWF A;  1FVJ A;  2H1B A;  3QDN A;  4XTS A;  4EO3 A;  2PUK C;  2MBT A;  4O5Q A;  2HRF A;  1TU8 A;  3KEB A;  4YAP A;  3TB2 A;  4F9Z A;  3LFL A;  5D8I A;  1EZK A;  3QFB C;  4KND A;  1AW9 A;  4K0N A;  5JCW A;  4GLT A;  1QXH A;  3GMF A;  2K8S A;  2MMZ A;  1NHY A;  4Z2R A;  4OFN A;  4JBB A;  1BQ7 A;  4GXZ A;  2V6O A;  4K8M A;  4ZL9 A;  2B3S A;  3A2X A;  4KDX A;  5FT3 A;  3M3M A;  5DAK A;  1J9B A;  4IKH A;  1K0M A;  2YWO A;  3W6G A;  3TKR A;  3MSZ A;  3F63 A;  3IK9 A;  3GKM A;  2VD1 A;  2PVO C;  4KSO A;  2LRT A;  1ERT A;  4X4J A;  2CVK A;  5IMC A;  3ZMK A;  2ZCT A;  6GSS A;  2JSZ A;  5DQS A;  3IXR A;  2G0F A;  1BAY A;  1RW1 A;  2IFQ A;  4D73 B;  1M99 A;  3IRA A;  3KXO A;  1LU4 A;  2GDR A;  1IYI A;  5KN1 A;  3IC8 A;  2OA7 A;  9GSS A;  1GTI A;  1F9M A;  1TRW A;  3U6V A;  1HQO A;  3PPU A;  2A4H A;  2L5O A;  3H79 A;  1OYJ A;  3J7Y k;  4J56 E;  4PQ1 A;  4KF9 A;  2CAI A;  4IS0 A;  2M80 A;  3K8N A;  3EU3 A;  3UMA A;  4ZBB A;  1XWG A;  5E4W A;  2CQ9 A;  4GRF A;  3VUR A;  3DRN A;  4L8E A;  3F0I A;  4IN0 A;  2O87 A;  4ID0 A;  3G7Y A;  4ZBA A;  10GS A;  3ISO A;  4ILF A;  2HYX A;  4G0L A;  5ECO B;  1LJR A;  3D21 A;  5EY6 A;  4CY8 A;  5IOX A;  3LJR A;  3FR3 A;  4BVX A;  3IR4 A;  3ZL5 A;  2GVP A;  1NW2 A;  1TK5 B;  3C8E A;  1LBK A;  3QMX A;  3G7I A;  4JRR A;  1QUW A;  2YZH A;  3EE2 A;  3KMO A;  2CAQ A;  4ZB8 A;  5DAK B;  12GS A;  1USB A;  2YJH A;  3HA9 A;  3OR5 A;  2B5E A;  5CAX A;  3KGK A;  4Z2T A;  1SK1 A;  3CTG A;  4HU9 A;  5D93 A;  3TJB A;  1HNC A;  1ML6 A;  4BWS A;  4GF0 A;  4V1A g;  2GQM A;  1TDI A;  4FYC A;  3GH9 A;  4I2T A;  1YY7 A;  3G7J A;  3BJ5 A;  4USS A;  5HR1 A;  3N9J A;  3C7M A;  2FA8 A;  2E2G A;  4XRA A;  3WGX A;  4FH8 A;  5BMU A;  5JCU A;  5LNK e;  5JWR B;  3F8U A;  1T4Z A;  3UAR A;  3GYK A;  5ECK B;  1H4O A;  5D73 A;  1K3L A;  5G1L A;  5CRH A;  1SD9 A;  4HSC X;  4QQ7 A;  1RK4 A;  4K1F A;  1FB0 A;  2R6K A;  5J3R A;  4Q5F A;  1SL2 B;  4BIK A;  1B4P A;  4IW9 A;  5ECP B;  1SKS B;  4F82 A;  4TXO A;  2R0P A;  5HR3 A;  1T00 A;  2HRA A;  3LW9 A;  1AXD A;  4OO4 A;  2LJK A;  2KUC A;  3HVN A;  6GSX A;  3E9J B;  3VWV A;  4GTU A;  4MF7 A;  5AIV A;  5HR0 A;  5ECN B;  4NV5 A;  4HZ4 A;  3S9F A;  3HCZ A;  5B6N A;  4YQU A;  1FHE A;  1JHB A;  1ON4 A;  2NDO A;  3RAZ A;  1U87 A;  2IME A;  5CRW A;  1O73 A;  1V57 A;  3MAK A;  4J57 E;  4BL7 A;  3ERG A;  4G0K A;  1M7T A;  4X43 A;  4IJI A;  3CSJ A;  3M0F A;  2LNS A;  2JL4 A;  1GUL A;  5L71 A;  3DYR A;  5JCG A;  2OBI A;  4PQH A;  4XRD A;  4HEA 2;  5GAN D;  2DML A;  1M3J A;  4F2I A;  1TTZ A;  5HFK A;  3EYT A;  4I97 A;  1H75 A;  2IPA A;  3GIX A;  4OO5 A;  4OCE A;  5EL8 A;  3VK9 A;  3WYW A;  1FOH A;  1AUC A;  4XHM A;  1EOH A;  1XZO A;  1PFO A;  1JZO A;  2HRN A;  4G9H A;  4Q5R A;  1FG4 A;  3L9S A;  1S3R A;  2GT6 A;  2HZF A;  5J9B A;  2H30 A;  4K2D A;  1V40 A;  2REM A;  3IHQ A;  4E8H A;  1PGT A;  2H6Z A;  3DWV A;  3D5J A;  4MK3 A;  3KP8 A;  2H75 A;  4POM A;  3J7Y b;  2GT5 A;  3PR8 A;  3KTL A;  4G2E A;  3WD6 A;  1TOF A;  2JAD A;  4LL1 B;  3GTU A;  5IPG A;  2AHE A;  3UAP A;  2F3M A;  1OC8 A;  3HXS A;  4IJ3 A;  4KB3 A;  2VM2 A;  1MDK A;  1YQ1 A;  1GL8 A;  1ERW A;  2MMA A;  2M72 A;  5HR2 A;  2D2Z A;  3ZTL A;  5IO2 A;  2NBS A;  3D6I A;  4IQ1 A;  4BWQ A;  5H5Q A;  4MMM A;  2CZ3 A;  2CZ2 A;  2F8A A;  3TKS C;  1ERV A;  2YWI A;  5IIZ A;  4DVC A;  2V6K A;  1HYU A;  1M2B A;  1KNG A;  2VLV A;  1TXX A;  1M3I A;  3ZML A;  1V9W A;  4POK A;  3FZA A;  2DMM A;  4ACS A;  14GS A;  4HDE A;  3C71 A;  4MZC A;  1CQH A;  4BA7 A;  2I4A A;  1GLP A;  2X8H A;  4N11 A;  2RUE A;  4QL7 A;  2KLX A;  5F05 A;  1WP0 A;  1VF1 A;  3CTF A;  4IEL A;  1SD8 A;  1B48 A;  1Z5Y E;  1TI1 A;  1OC9 A;  3VLN A;  3GUR A;  2AJQ B;  4FYU A;  1X5D A;  3IOS A;  5B8A A;  1URM A;  4TR0 A;  2WS2 A;  1U3A A;  4E8E A;  1QK8 A;  1FW1 A;  2QSI A;  2HXK A;  2VO4 A;  5H5S A;  1T1V A;  2HSH A;  3DIE A;  2C0G A;  1TK0 B;  3HKR A;  3P90 A;  3UBL A;  2C8U A;  4F0C A;  4RUV A;  3IC4 A;  3EVI A;  5DQY A;  1K0C A;  4F03 A;  3I69 A;  1A8L A;  4Q5Q A;  4X1U A;  3ZZX A;  3GX8 A;  3ZIT A;  1J0F A;  1MTC A;  1VF3 A;  4EUY A;  2VL2 C;  3GKK A;  3LSZ A;  5CRG A;  4JED A;  2FWE A;  3CQF A;  2YPM A;  3DEX A;  3P8W A;  4FO5 A;  5DAL A;  4JR6 A;  4EDZ A;  5D9W A;  3LXZ A;  4J2F A;  1SL0 B;  4JZQ A;  2VIM A;  4Q5N A;  2X4A A;  1GSU A;  4L5L A;  3PH9 A;  4ECC A;  2X64 A;  2DC5 A;  3ZYW A;  2KP1 A;  3FY7 A;  2VCZ A;  6GSU A;  2DJJ A;  2GSQ A;  3R2Q A;  3TKS E;  3VI5 A;  4MZW A;  2LS5 A;  5D9V A;  2MZC A;  3M9J A;  4TXV A;  3QR6 A;  3TUE A;  2PER A;  4BVY B; 
#chains in the Genus database with same CATH homology
 1WPI A;  1QGV A;  2LJA A;  3CSI A;  2L6D A;  3LGC A;  1AQV A;  1TJD A;  3FMW A;  2OE1 A;  1VRS D;  3CRT A;  5GSS A;  1EV4 A;  3ED3 A;  2B7J A;  5KN0 A;  4RQX A;  2PPT A;  2RM6 A;  1T3B A;  1X9S B;  3VPT A;  1V98 A;  2H8L A;  3O6T A;  2H71 A;  3GX0 A;  2EIO A;  4ZB6 A;  2H0I A;  5ECS A;  2OE0 A;  4PUF C;  2ALB A;  2WRT A;  1M0U A;  2ZUP A;  3QCP A;  1X9W B;  3MYD A;  4OCF A;  1VGL A;  2H19 A;  2YCD A;  2DIY A;  5ID2 B;  2IMI A;  5HQP A;  2ON7 A;  4AGS A;  1JFU A;  4FIW A;  5F0G A;  5E59 A;  4K9Z A;  1K0N A;  4V2N A;  8GSS A;  2LRC A;  1ZCP A;  1SEN A;  2HZE A;  4JR4 A;  3FHK A;  1S3C A;  4AJ7 A;  1GLQ A;  3DVW A;  2I1U A;  5CRD A;  1G6W A;  3IPZ A;  3LYK A;  1GSE A;  5IQY A;  4G0I A;  3EC3 A;  4OFM A;  1AC1 A;  3UIW A;  5J4U A;  3TJF A;  4TVE A;  3CXG A;  3GST A;  4XCS A;  5G31 A;  4KCA A;  3D0Z A;  1N2A A;  3L78 A;  3WT1 A;  1PQN A;  4N0V A;  1GSF A;  1XXU A;  3GKX A;  3DKS A;  1M9B A;  4NV2 A;  3LG6 A;  3ZFL A;  3FZ4 A;  1SYX A;  2GST A;  1U3I A;  4EIP A;  3BCK A;  3EWL A;  3IHG A;  7GSS A;  1MDJ A;  1GSD A;  1NHO A;  2FUG 2;  1FOV A;  3ZRD A;  4HOJ A;  2F51 A;  4ZIJ A;  2WDU A;  3BCI A;  5F8B A;  3QD9 A;  4CHS A;  1ABA A;  2ZNM A;  4KCE A;  1A24 A;  4EF0 A;  3FZ5 A;  4MLY A;  3QOU A;  20GS A;  2B1L A;  1HNA A;  5G5F A;  5B6M A;  3ZLP A;  2KOK A;  2VCV A;  3HJP A;  4AJ8 A;  2IFQ B;  4TR1 A;  3I9V 2;  1A23 A;  3LWA A;  2DLX A;  3TKS A;  3ME7 A;  4KAE A;  4IVF A;  2X49 A;  4DEJ A;  3GUS A;  1YEP A;  3HVS A;  3EMX A;  5CP1 A;  1EGR A;  2ES7 A;  2QKE A;  1C72 A;  3CRU A;  2XPE A;  2VM1 A;  1XVQ A;  2RLI A;  3GL5 A;  1EP8 A;  3P2A A;  3US3 A;  1M2A A;  2A4V A;  3KH9 A;  2OE3 A;  2VCT A;  3Q18 A;  2AB6 A;  1PN0 A;  4I8B A;  1XWC A;  19GS A;  1TRU A;  2PBJ A;  2VAF A;  1FO5 A;  1NSW A;  5IMZ A;  1F2E A;  2F8F A;  2C3Q A;  1A0F A;  5C04 A;  4BVX B;  3UBK A;  3TRP A;  2FD3 A;  5G2Z A;  2P5Q A;  2VCW A;  1K3O A;  3TKP A;  3CBU A;  1G7E A;  3MDK A;  4PTS A;  2GGT A;  2CVD A;  2DJ3 A;  1B9Y C;  2MMN A;  1PRX A;  2X8C A;  3FZ9 A;  4OD7 A;  1MD3 A;  4GSS A;  1O81 A;  1PL1 A;  3KMN A;  2C0E A;  2UZ8 A;  3APS A;  3P7X A;  4RI7 A;  2V32 A;  1HD2 A;  3SBC A;  1B8X A;  3GL3 A;  3IE3 A;  3DVX A;  1TRS A;  3TRX A;  3ZVJ D;  4K7O A;  4IP1 A;  1KTE A;  3A2W A;  4PXO A;  4IBP A;  5EPF A;  4AJ6 A;  2DJ1 A;  1WJK A;  4ZL7 A;  4MJA A;  2VL9 A;  2K6V A;  3O76 A;  5A4V A;  1UC7 A;  1AAZ A;  2DSA A;  3R3E A;  3C73 A;  4BPY A;  4TR3 A;  1YKC A;  2HFD A;  3GV1 A;  2VL2 A;  4V1A p;  1A2M A;  3TCO A;  3ZFB A;  3TDG A;  2IMD A;  4DSS A;  2AAW A;  4RI6 A;  3E0U A;  1DE1 A;  1EOG A;  2N5A A;  2L5L A;  4TXO B;  1PX7 A;  2JZR A;  2L6C A;  3A3T A;  3WT2 A;  5AIX A;  4O5R A;  4AF2 A;  3RPN A;  1GSQ A;  4OWY A;  3UL3 A;  2DKI A;  1WMJ A;  2LTK A;  1QQ2 A;  5ENU A;  2R0G A;  2OAC A;  4TRX A;  2FLS A;  3F6F A;  1Q4J A;  2A2R A;  4XS4 A;  1HNB A;  4IP6 A;  2OKA A;  3G9B A;  2J9H A;  2HNL A;  6GSY A;  2LQO A;  3FKF A;  2YV9 A;  1UVZ A;  2B5X A;  1Z9H A;  3TOU A;  5KEJ A;  4ISD A;  5AIS A;  2WCI A;  2O7K A;  2MMO A;  5CNW A;  1SL1 B;  4ML1 A;  2FNO A;  2YP6 A;  1FB6 A;  4BL7 B;  1ZGN A;  4O32 A;  3H4K A;  1WOU A;  1OC3 A;  4K5S A;  3KTB A;  4GWR A;  3KIJ A;  3HHV A;  1YJ6 A;  1O6J A;  5F06 A;  2BTO T;  16GS A;  1T4Y A;  5ELG A;  1GNE A;  3RBT A;  1GTU A;  3KH7 A;  3QAV A;  2TIR A;  3UVH A;  2VLT A;  4KW6 A;  1GRX A;  1Z6N A;  1NM3 A;  1SJ6 A;  4I6X A;  4G10 A;  2Z9S A;  4WR5 A;  1RQM A;  3PGT A;  3H8Q A;  1XW6 A;  1ZYP A;  4H86 A;  4HQS A;  1XW9 A;  1S3D A;  3CSH A;  2R3X A;  4O5U A;  3TJG A;  4N0Z A;  3A5W A;  2YN1 A;  1R5A A;  3HVX A;  1SKR B;  2RUF A;  3FR9 A;  2C3T A;  1GH2 A;  1M9A A;  2N5B A;  2F9S A;  2GZP A;  1GP1 A;  2TRC P;  3GKN A;  4YQV A;  1DBY A;  1S3A A;  2H6Y A;  1PL2 A;  2DBC A;  3TJK A;  1BJX A;  4YKG A;  1V58 A;  2V1M A;  3GTU B;  3HJM A;  1XFL A;  5GST A;  2E0Q A;  1BG5 A;  4KH7 A;  4FQU A;  1MEK A;  3HYP A;  3BOA A;  5CO3 A;  3IDV A;  1GUK A;  4O7H A;  1BX9 A;  2HT9 A;  3CMI A;  4WKW A;  3FYG A;  4WXT A;  1F3A A;  5G1K A;  2IIY A;  2CV4 A;  5ABR A;  2YOI A;  3NOF A;  3EPT A;  2DJK A;  2R4V A;  4EL1 A;  1T8E B;  1PA3 A;  1PX6 A;  1KBN A;  3KZQ A;  5BRT A;  2R0C A;  2RII A;  4IHU A;  3HJO A;  4WEY A;  1EV9 A;  2H66 A;  3IAM 2;  4V2L A;  2OBK A;  1WWJ A;  2XBQ A;  1PMT A;  4NXI A;  2DKH A;  5C00 A;  3F4R A;  1QFN A;  1UN2 A;  4DSR A;  5DVB A;  3HDC A;  3LXT A;  5GZZ B;  4ULX A;  4IQA A;  2V2G A;  3ZRE A;  2L59 A;  2HI7 A;  2XHF A;  2JZT A;  1AIU A;  1TKD B;  1OC9 B;  3RPP A;  3MWH A;  1O7U A;  5ECM B;  1PD2 1;  1SK2 A;  2DIZ A;  3TJJ A;  4MJC A;  3DD3 A;  4YQM A;  2H73 A;  2PVQ A;  5GAP D;  5JWQ B;  5A5K A;  2GSR A;  1F3B A;  3FK8 A;  2TRX A;  2H1D A;  2YNX A;  4MP4 A;  4K7I A;  3SWL A;  1ZZY A;  4D73 A;  1B9X C;  2X99 A;  1GSS A;  4HUA A;  4N10 A;  3HVV A;  4KUN A;  2QGV A;  4GST A;  2IJY A;  4LA1 A;  2R37 A;  1X5E A;  2FY6 A;  3EU4 A;  2LJR A;  1SJZ A;  2VD0 A;  3EIN A;  4HJM A;  2LV3 A;  4WBR D;  4G19 A;  4MZB A;  1KEB A;  1ACV A;  2A2P A;  3VWW A;  1ZYQ B;  6GSV A;  1V2A A;  1F6M C;  3ZIJ A;  3N5O A;  4X0X A;  2GZY A;  4EDY A;  2B1K A;  2O8V B;  4ICY A;  3QFA C;  4JU5 A;  5DAL B;  1A0R P;  4K7N A;  4PNF A;  1Y6E A;  1YKA A;  1Z7R A;  4PX1 A;  2X8G A;  22GS A;  2V41 A;  4TKY A;  4PNG A;  1Q98 A;  2WGR A;  2H1A A;  3GSS A;  3FRC A;  2PN8 A;  3WGD A;  2CX3 A;  4WBJ A;  4JE1 A;  1I5G A;  4KE3 A;  3F4S A;  3LYP A;  5H5R A;  3JCM L;  2YJ7 A;  1U88 A;  3RHC A;  1DSB A;  1DE2 A;  2HSM A;  3GNJ A;  4I2U A;  3KJY A;  4V2M A;  1TRV A;  2EIR A;  4L0W A;  3Q74 A;  3GN3 A;  1UA5 A;  5INY A;  1ZL9 A;  1XWB A;  4HZ2 A;  3FEU A;  2I81 A;  5D9X A;  5ECR B;  1EP7 A;  3GRX A;  4TW5 A;  3H1N A;  3E3E A;  1K0A A;  5KOX A;  2AUV A;  3IK7 A;  1G0T A;  5IPH A;  2H01 A;  2PMT A;  2QC7 A;  5KN3 A;  5D9T A;  4HS1 A;  2C80 A;  3ZIV A;  1B4Q A;  1ILO A;  1YF1 A;  1Z3E A;  1FAA A;  2G2Q A;  1SJI A;  1EWX A;  3BD2 A;  1JLW A;  4YAV A;  1WE0 A;  2JAC A;  2H0H A;  4WF4 A;  5AGY A;  4POB A;  3HZ8 A;  4TOP A;  1F37 A;  4EC0 A;  3O3T A;  3L4N A;  1ZOF A;  5CYY A;  1BED A;  1K0D A;  1MD4 A;  5IOW A;  2LKU A;  1A2J A;  4MNN A;  4MF5 A;  3UOM A;  2O89 A;  3L9U A;  3A5I A;  3MIX A;  3IAS 2;  4EIQ A;  4L5O A;  2YV7 A;  4NWY A;  3I43 A;  5EVO A;  2HZE B;  4F0B A;  3F6D A;  4K6X A;  3C1R A;  2XPD A;  3CYN A;  4WF5 A;  3RHB A;  2XC2 A;  3EMP A;  1O8W A;  1I9D A;  4CDO A;  4WET A;  1OKT A;  2NTO A;  1XWK A;  5J5N A;  1A8Y A;  3ME8 A;  2EC4 A;  2O85 A;  3DGQ A;  2GLR A;  4RQR A;  1XVW A;  3QPM A;  2C1Y A;  2KHP A;  5LD0 A;  2PU9 C;  3F3Q A;  2JU5 A;  3F3R A;  3Q19 A;  2WJU A;  4ECJ A;  2IWT A;  2LST A;  5ECQ B;  5COH A;  4GSN A;  1GUM A;  5KOW A;  5HFI A;  4ZXG A;  4KA0 A;  4TN8 A;  2GTU A;  1J08 A;  1K0O A;  1QMV A;  2LQQ A;  4WR4 A;  1PKW A;  5J9C A;  2CT6 A;  4MJE A;  1X0R A;  3LEF A;  1WRY A;  3I6A A;  2GSS A;  2GS3 A;  3L0H A;  4FYB A;  3LQ7 A;  4OFT A;  2FWG A;  4LL4 B;  5DCG A;  1K3Y A;  3TKQ A;  1THO A;  2HE3 A;  2FA4 A;  1ZYE A;  5D96 A;  4EE0 A;  13GS A;  4K2X A;  1TW9 A;  5FHI A;  3D4M A;  1TU7 A;  4DSQ A;  4GQC A;  4ZB9 A;  5DJM A;  1THX A;  3TOT A;  3APQ A;  2LEG A;  1BYE A;  2EIQ A;  2P5R A;  4ZBD A;  1SU9 A;  1XW5 A;  4LMW A;  1GTA A;  2N5F A;  4MF6 A;  4MPF A;  1T7P B;  1XBS A;  2C0D A;  1JZR A;  4YKF A;  18GS A;  1ZMA A;  1E2Y A;  4I5Q A;  5JWO B;  4TR1 B;  4OMV A;  5ELA A;  5IO0 A;  4NAX A;  6GSW A;  1W89 A;  3H93 A;  2AYT A;  2GQL A;  2WUL A;  1VF2 A;  5LCZ A;  2E7P A;  2PWJ A;  3MNG A;  2KP2 A;  4NPB A;  4PUA A;  2VOC A;  3EUR A;  3HY2 A;  2H70 A;  4YH2 A;  4K5R A;  3KP9 A;  1XOB A;  2LRN A;  1XWA A;  2IMF A;  3F9U A;  1PSQ A;  1IYH A;  3WGE A;  5IMF A;  2QA1 A;  5IMD A;  1JLV A;  3HD5 A;  1R26 A;  2B6M A;  4N30 A;  1SK0 A;  1R5P A;  3U5R E;  1ERU A;  1XCC A;  1Y25 A;  2IMK A;  3VFI A;  1ZYN A;  2WZ9 A;  4PUR A;  2YWN A;  2LNT A;  2CVB A;  3ERW A;  4KDY A;  2L4Q A;  1OKD A;  4MA9 A;  4GQF A;  2AV4 A;  3DXB A;  2FHE A;  2HSY A;  5F07 A;  2GQK A;  3QAW A;  3NZN A;  2PGT A;  1VF4 A;  3PIN A;  2CX4 A;  2M46 A;  3L9V A;  4MJB A;  3UJ1 A;  3ERF A;  2I3Y A;  2JZS A;  5CRE A;  5A4W A;  1DUG A;  4HJ2 A;  2B7K A;  3VI7 A;  1G7O A;  5KN2 A;  2YWM A;  2NVL A;  2JSY A;  1YDK A;  2OAD A;  5A4U A;  4ML6 A;  1O8X A;  2DJ2 A;  2R5G A;  3IV4 A;  3C1S A;  4ZIL A;  1TK8 B;  1JZW A;  4MPG A;  4P3Y B;  5G5E A;  1GTB A;  1SKW B;  3V1W A;  1X9M B;  2CA8 A;  1TI3 A;  4CW9 A;  1X5C A;  4QL9 A;  1W4V A;  1AQW A;  4EXJ A;  4NHZ A;  1MDI A;  4NHW A;  1YEX A;  2OJL A;  1EGO A;  2WFC A;  3KCM A;  1FVK A;  2I9H A;  2H76 A;  1XOA A;  2VCQ A;  3RDW A;  4MAB A;  4DSS B;  4A5P A;  2RM5 A;  3GH6 A;  2VUP A;  3D4T A;  4XIH A;  4NMU A;  3VPQ A;  3FR6 A;  3GFK A;  1EEM A;  5J41 A;  3M9K A;  5DDL A;  4KX4 A;  2K8V A;  2J23 A;  2FGX A;  4XS1 A;  5IMA A;  4LMV A;  2YAN A;  3F4T A;  4XS4 B;  3FW2 A;  4Z7X A;  4KDU A;  1M2D A;  3NIV A;  3UVT A;  5ECL B;  3BBY A;  1YF0 A;  2H72 A;  4POL A;  3TRQ A;  1E6B A;  2P31 A;  1XIY A;  1OE7 A;  2FWH A;  4LLR A;  5ECH B;  3Q6O A;  2HRK A;  11GS A;  1SYR A;  2HLS A;  2C4J A;  1PKZ A;  1A2L A;  3UEM A;  1G6Y A;  3AY8 A;  3W8J A;  2H74 A;  3GA4 A;  1EEJ A;  3IA1 A;  4MH2 A;  1YZX A;  4BVY A;  2ON5 A;  6GST A;  4EKZ A;  5DJL A;  1U6T A;  3DML A;  5IM9 A;  4KSM A;  3M1G A;  2C3N A;  2XBI A;  3KM6 A;  3TGZ A;  1JZD A;  1WIK A;  5DBQ A;  3GHA A;  1OVN A;  1O85 A;  4PQI A;  4L0U A;  2IN3 A;  3APO A;  2VLU A;  2P0G A;  3KD0 A;  5AN1 A;  5DCH A;  2WB9 A;  2C0F A;  1XPV A;  1PN9 A;  1OAZ A;  2A2S A;  2VCX A;  1OE8 A;  4ZL8 A;  1GWC A;  2DJ0 A;  2K9F A;  3ZVJ A;  5ECI B;  4HU7 A;  4MCU A;  1CQG A;  5FWG A;  5IMV A;  4ECB A;  4PGT A;  1K0B A;  5G30 A;  2H0G A;  5ID2 A;  3D22 A;  3W8S A;  4CY6 A;  1AQX A;  2FCH A;  2E2M A;  4K0G A;  4HI7 A;  4HQZ A;  4Z2U A;  4TR4 A;  2QA2 A;  3A2V A;  2R2J A;  1TP9 A;  1R4W A;  5B7C A;  3IBH A;  2YZU A;  3VWX A;  4EVM A;  2BMX A;  3VWU A;  5HFG A;  1Z6M A;  2VL3 A;  3QAG A;  4XS6 A;  2IL3 A;  1GNW A;  4MDC A;  4GCI A;  1GSY A;  17GS A;  5B8B A;  1ST9 A;  2BJX A;  3LOR A;  2L57 A;  2NPB A;  2B5Y A;  3HZ4 A;  4KGI A;  4IGJ A;  1GUH A;  2H6X A;  4O92 A;  2GZZ A;  2H1G A;  2MBS A;  1R7H A;  2L4C A;  4MH3 A;  2K18 A;  4ECI A;  1N8J A;  1Z7P A;  3M8N A;  2LUS A;  2MYG A;  2FWF A;  1FVJ A;  2H1B A;  3QDN A;  4XTS A;  4EO3 A;  2PUK C;  2MBT A;  4O5Q A;  2HRF A;  1TU8 A;  3KEB A;  4YAP A;  3TB2 A;  4F9Z A;  3LFL A;  5D8I A;  1EZK A;  3QFB C;  4KND A;  1AW9 A;  4K0N A;  5JCW A;  4GLT A;  1QXH A;  3GMF A;  2K8S A;  2MMZ A;  1NHY A;  4Z2R A;  4OFN A;  4JBB A;  1BQ7 A;  4GXZ A;  2V6O A;  4K8M A;  4ZL9 A;  2B3S A;  3A2X A;  4KDX A;  5FT3 A;  3M3M A;  5DAK A;  1J9B A;  4IKH A;  1K0M A;  2YWO A;  3W6G A;  3TKR A;  3MSZ A;  3F63 A;  3IK9 A;  3GKM A;  2VD1 A;  2PVO C;  4KSO A;  2LRT A;  1ERT A;  4X4J A;  2CVK A;  5IMC A;  3ZMK A;  2ZCT A;  6GSS A;  2JSZ A;  5DQS A;  3IXR A;  2G0F A;  1BAY A;  1RW1 A;  2IFQ A;  4D73 B;  1M99 A;  3IRA A;  3KXO A;  1LU4 A;  2GDR A;  1IYI A;  5KN1 A;  3IC8 A;  2OA7 A;  9GSS A;  1GTI A;  1F9M A;  1TRW A;  3U6V A;  1HQO A;  3PPU A;  2A4H A;  2L5O A;  3H79 A;  1OYJ A;  3J7Y k;  4J56 E;  4PQ1 A;  4KF9 A;  2CAI A;  4IS0 A;  2M80 A;  3K8N A;  3EU3 A;  3UMA A;  4ZBB A;  1XWG A;  5E4W A;  2CQ9 A;  4GRF A;  3VUR A;  3DRN A;  4L8E A;  3F0I A;  4IN0 A;  2O87 A;  4ID0 A;  3G7Y A;  4ZBA A;  10GS A;  3ISO A;  4ILF A;  2HYX A;  4G0L A;  5ECO B;  1LJR A;  3D21 A;  5EY6 A;  4CY8 A;  5IOX A;  3LJR A;  3FR3 A;  4BVX A;  3IR4 A;  3ZL5 A;  2GVP A;  1NW2 A;  1TK5 B;  3C8E A;  1LBK A;  3QMX A;  3G7I A;  4JRR A;  1QUW A;  2YZH A;  3EE2 A;  3KMO A;  2CAQ A;  4ZB8 A;  5DAK B;  12GS A;  1USB A;  2YJH A;  3HA9 A;  3OR5 A;  2B5E A;  5CAX A;  3KGK A;  4Z2T A;  1SK1 A;  3CTG A;  4HU9 A;  5D93 A;  3TJB A;  1HNC A;  1ML6 A;  4BWS A;  4GF0 A;  4V1A g;  2GQM A;  1TDI A;  4FYC A;  3GH9 A;  4I2T A;  1YY7 A;  3G7J A;  3BJ5 A;  4USS A;  5HR1 A;  3N9J A;  3C7M A;  2FA8 A;  2E2G A;  4XRA A;  3WGX A;  4FH8 A;  5BMU A;  5JCU A;  5LNK e;  5JWR B;  3F8U A;  1T4Z A;  3UAR A;  3GYK A;  5ECK B;  1H4O A;  5D73 A;  1K3L A;  5G1L A;  5CRH A;  1SD9 A;  4QQ7 A;  1RK4 A;  4K1F A;  1FB0 A;  2R6K A;  5J3R A;  4Q5F A;  1SL2 B;  1B4P A;  4IW9 A;  5ECP B;  1SKS B;  4F82 A;  4TXO A;  2R0P A;  5HR3 A;  1T00 A;  2HRA A;  3LW9 A;  1AXD A;  4OO4 A;  2LJK A;  2KUC A;  6GSX A;  3E9J B;  3VWV A;  4GTU A;  4MF7 A;  5AIV A;  5HR0 A;  5ECN B;  4NV5 A;  4HZ4 A;  3S9F A;  3HCZ A;  5B6N A;  4YQU A;  1FHE A;  1JHB A;  1ON4 A;  2NDO A;  3RAZ A;  1U87 A;  2IME A;  5CRW A;  1O73 A;  1V57 A;  3MAK A;  4J57 E;  4BL7 A;  3ERG A;  4G0K A;  1M7T A;  4X43 A;  4IJI A;  3CSJ A;  3M0F A;  2LNS A;  2JL4 A;  1GUL A;  5L71 A;  3DYR A;  5JCG A;  2OBI A;  4PQH A;  4XRD A;  4HEA 2;  5GAN D;  2DML A;  4F2I A;  1TTZ A;  5HFK A;  3EYT A;  4I97 A;  1H75 A;  2IPA A;  3GIX A;  4OO5 A;  4OCE A;  5EL8 A;  3VK9 A;  3WYW A;  1FOH A;  1AUC A;  4XHM A;  1EOH A;  1XZO A;  1JZO A;  2HRN A;  4G9H A;  4Q5R A;  1FG4 A;  3L9S A;  2GT6 A;  2HZF A;  5J9B A;  2H30 A;  4K2D A;  1V40 A;  2REM A;  3IHQ A;  4E8H A;  1PGT A;  2H6Z A;  3DWV A;  3D5J A;  4MK3 A;  3KP8 A;  2H75 A;  4POM A;  3J7Y b;  2GT5 A;  3PR8 A;  3KTL A;  4G2E A;  3WD6 A;  1TOF A;  2JAD A;  4LL1 B;  3GTU A;  5IPG A;  2AHE A;  3UAP A;  2F3M A;  1OC8 A;  3HXS A;  4IJ3 A;  4KB3 A;  2VM2 A;  1MDK A;  1YQ1 A;  1GL8 A;  1ERW A;  2MMA A;  2M72 A;  5HR2 A;  2D2Z A;  3ZTL A;  5IO2 A;  2NBS A;  3D6I A;  4IQ1 A;  4BWQ A;  5H5Q A;  4MMM A;  2CZ3 A;  2CZ2 A;  2F8A A;  3TKS C;  1ERV A;  2YWI A;  5IIZ A;  4DVC A;  2V6K A;  1HYU A;  1M2B A;  1KNG A;  2VLV A;  1TXX A;  3ZML A;  1V9W A;  4POK A;  3FZA A;  2DMM A;  4ACS A;  14GS A;  4HDE A;  3C71 A;  4MZC A;  1CQH A;  4BA7 A;  2I4A A;  1GLP A;  2X8H A;  4N11 A;  2RUE A;  4QL7 A;  2KLX A;  5F05 A;  1WP0 A;  1VF1 A;  3CTF A;  4IEL A;  1SD8 A;  1B48 A;  1Z5Y E;  1TI1 A;  1OC9 A;  3VLN A;  3GUR A;  2AJQ B;  4FYU A;  1X5D A;  3IOS A;  5B8A A;  1URM A;  4TR0 A;  2WS2 A;  1U3A A;  4E8E A;  1QK8 A;  1FW1 A;  2QSI A;  2HXK A;  2VO4 A;  5H5S A;  1T1V A;  2HSH A;  3DIE A;  2C0G A;  1TK0 B;  3HKR A;  3P90 A;  3UBL A;  2C8U A;  4F0C A;  4RUV A;  3IC4 A;  3EVI A;  5DQY A;  1K0C A;  4F03 A;  3I69 A;  1A8L A;  4Q5Q A;  4X1U A;  3ZZX A;  3GX8 A;  3ZIT A;  1J0F A;  1MTC A;  1VF3 A;  4EUY A;  2VL2 C;  3GKK A;  3LSZ A;  5CRG A;  4JED A;  2FWE A;  2YPM A;  3DEX A;  3P8W A;  4FO5 A;  5DAL A;  4JR6 A;  4EDZ A;  5D9W A;  3LXZ A;  4J2F A;  1SL0 B;  4JZQ A;  2VIM A;  4Q5N A;  2X4A A;  1GSU A;  4L5L A;  3PH9 A;  4ECC A;  2X64 A;  2DC5 A;  3ZYW A;  2KP1 A;  3FY7 A;  2VCZ A;  6GSU A;  2DJJ A;  2GSQ A;  3R2Q A;  3TKS E;  3VI5 A;  4MZW A;  2LS5 A;  5D9V A;  2MZC A;  3M9J A;  4TXV A;  3QR6 A;  3TUE A;  2PER A;  4BVY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...