2HRNA

Solution structure of cu(i) p174l-hsco1
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
173
structure length
173
Chain Sequence
SFTGKPLLGGPFSLTTHTGERKTDKDYLGQWLLIYFGFTHCPDVCLEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPYRKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords SCO1 protein homolog, mitochondrial
publication title Human Sco1 functional studies and pathological implications of the P174L mutant.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2006-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02630 SCO1-SenC SCO1/SenC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2hrnA00
3J7Yk 2LJRA 3F4SA 3IE3A 2WB9A 1THXA 4IQ1A 1NW2A 3DKSA 5ECNB 5IMAA 4IS0A 1T8EB 3APOA 3WT2A 1E6BA 3BCKA 4KSOA 4PQHA 1YDKA 5B6MA 4HS1A 3TJGA 1WP0A 3LGCA 3TKSA 5ID2A 3RDWA 3GTUA 3HCZA 2DJJA 1R26A 1SL1B 2KP1A 3UARA 3GN3A 3S9FA 2G2QA 4HEA2 2LV3A 2R6KA 4XS4B 2LTKA 4XS6A 2K18A 1SD9A 4L0UA 2H01A 14GSA 3EMPA 4KDUA 4DEJA 4LMVA 4NV5A 5F07A 2FHEA 3F3RA 1TRSA 1FOVA 5A4VA 3TKRA 4N0ZA 3WT1A 3BCIA 4XIHA 3L0HA 2YZUA 2KUCA 1VF2A 3KEBA 1ABAA 3HA9A 5IPGA 3TOUA 4KGIA 3GYKA 2WCIA 2C8UA 2PVQA 1DE1A 2OKAA 4ZB9A 1DE2A 2V32A 1EGOA 2NBSA 4KDYA 4POLA 3J7Yb 2NPBA 3GFKA 3IDVA 5LD0A 1BX9A 1B9XC 1OKDA 1KTEA 1TU7A 4GQCA 2JU5A 2KP2A 3I6AA 2MBTA 1FHEA 1RW1A 5AIVA 2VCQA 3NZNA 2GT6A 4V2NA 1XW9A 4PUFC 5HR0A 1QXHA 1SK1A 1VF3A 4AF2A 4OMVA 1CQGA 3VWUA 3L9SA 3A2XA 1T4ZA 4BA7A 5B8BA 3EURA 1AIUA 3P90A 1ZL9A 4MH2A 3ERWA 5A4UA 5AIXA 3DYRA 1AC1A 2NTOA 5G5FA 4TR1A 1IYIA 1R7HA 3F6FA 4GXZA 4D73A 2RUFA 4ZL7A 1UA5A 2ON7A 5CREA 4K6XA 2GSQA 4MZCA 1F3AA 3VPQA 1W89A 3ED3A 3U6VA 3TOTA 1SENA 6GSWA 4IJ3A 3UVTA 1A8LA 4CW9A 2XBIA 2O7KA 4WEYA 4MPGA 5DCHA 3LG6A 2Z9SA 5B7CA 1H4OA 4IQAA 5JWOB 5J3RA 4F82A 4MA9A 3MNGA 2HYXA 3CXGA 1YZXA 1SJ6A 4I5QA 2GQLA 5EPFA 1O8XA 3KZQA 5EL8A 1I5GA 4GSNA 4MMMA 5ENUA 2DBCA 1YQ1A 2YCDA 4MZBA 3F3QA 1OE8A 2B1LA 2VCXA 3N5OA 2RM5A 5IO0A 2HXKA 2I3YA 1XWBA 2HZEA 1PN9A 5ECLB 5H5RA 1TU8A 2VCVA 2KOKA 4JRRA 3CMIA 4ZL8A 1GLQA 4FH8A 3WD6A 3V1WA 5KN0A 3VLNA 5IMDA 3EC3A 3O6TA 5CRHA 1G6YA 4MJBA 12GSA 4FYCA 4ZILA 2RM6A 3DEXA 4ACSA 4K0GA 4GSTA 1ON4A 4POKA 2WDUA 4K9ZA 3CSJA 1SKSB 3ZVJD 1OKTA 4F03A 2RLIA 3H1NA 1U3AA 5ECQB 2FWEA 1SD8A 4WETA 3KP9A 1V9WA 3IK9A 1FB0A 4N0VA 3DIEA 3IAM2 4J57E 1ZMAA 3TGZA 3DMLA 5IMFA 3IPZA 1A24A 2R2JA 1LJRA 3RHCA 1PX6A 1AW9A 1SL0B 3GL5A 2PVOC 3CYNA 1BEDA 2VO4A 2CVDA 4AJ7A 4TXOA 3EU4A 2AB6A 2QKEA 2DMLA 2LKUA 1M2AA 1WOUA 3K8NA 1YJ6A 1O73A 2CX3A 1GH2A 4I8BA 4MK3A 3IRAA 3GSSA 1YF1A 3P2AA 2ZNMA 3QDNA 5J4UA 1M9AA 5D9WA 3EVIA 3CTGA 2GS3A 3IBHA 1PQNA 1PL1A 2CVKA 3D6IA 5EY6A 2MYGA 3APQA 2H76A 3RPNA 2VIMA 3E0UA 4PGTA 1SYXA 2IMFA 2IMIA 3ZFBA 2N5FA 4NHWA 2M46A 4POMA 2ES7A 4KB3A 2B3SA 3BJ5A 3KH9A 5IPHA 2IJYA 4OFNA 4F0BA 2VLTA 4JEDA 3O76A 4HQZA 2MBSA 4ISDA 2YN1A 2H66A 5IO2A 1EP7A 2C3TA 2L6CA 3VWXA 3EINA 2X8CA 3M9KA 2VOCA 1T1VA 2KLXA 2PERA 4I2TA 2WS2A 4Q5QA 4EL1A 2VD1A 4IW9A 2JACA 3ZMKA 1Z6NA 3FR9A 4IN0A 4YAVA 5HR3A 3PGTA 1M9BA 3HVXA 2K8SA 1G7EA 2YNXA 1U6TA 2HE3A 4PQIA 2H0GA 4X43A 1AUCA 2TIRA 3C8EA 5ECOB 3HJPA 4YQVA 3F8UA 4HU7A 4NAXA 3UVHA 3GNJA 2EC4A 3GKKA 4LMWA 2DMMA 1WWJA 2M72A 2L4QA 5DAKB 1O8WA 2LJKA 4IELA 3ZIVA 4XHMA 2OE1A 3I43A 5FWGA 2OJLA 3TB2A 1GWCA 1G0TA 2IMEA 1TTZA 3FW2A 5ECSA 1WIKA 4HUAA 1JZWA 19GSA 5G2ZA 3TRQA 2DJ1A 2OADA 3PH9A 4QQ7A 2H1GA 5JWRB 1EGRA 6GSUA 1PRXA 1HNCA 3ISOA 4KH7A 3TDGA 3D4TA 5EVOA 5CNWA 4V1Ag 3G7YA 4AJ8A 3IAS2 4ZIJA 4PURA 1LU4A 2AUVA 3F4RA 1RK4A 2AAWA 3DXBA 2P5QA 4P3YB 2PU9C 2B5EA 4GSSA 3HJMA 5IMCA 4LLRA 1MTCA 5DALB 3OR5A 3FZ9A 4I97A 3Q19A 5HFIA 5G5EA 2LQQA 1G6WA 2F51A 3FZ5A 17GSA 3H93A 4NPBA 1JZOA 2JZTA 5DDLA 1S3AA 2V2GA 5ECMB 2IFQA 2E0QA 5F0GA 4N30A 1R4WA 3LXTA 4YH2A 3F0IA 2HFDA 3FY7A 2JL4A 4GTUA 1IYHA 5CRGA 4HJMA 2H8LA 2LSTA 1VF1A 2O85A 1TK8B 1GTAA 2H6YA 2DLXA 3ME7A 1VRSD 10GSA 4OCFA 4WF4A 1GTBA 1JHBA 2GTUA 5ECIB 4YQUA 3GKXA 4JR6A 4EVMA 5G1LA 2CZ3A 2FWFA 4NXIA 2AYTA 2PPTA 3D22A 1XIYA 3PINA 2CQ9A 2C3QA 3WYWA 4L8EA 2GDRA 3MAKA 6GSTA 5J9BA 2QGVA 2H70A 2DJ0A 3C73A 1U3IA 3UBKA 3P8WA 4PX1A 3KTBA 3UMAA 1PA3A 3TKPA 16GSA 1B9YC 2FA8A 4KA0A 1YKCA 1BYEA 1K0AA 3HDCA 5E4WA 5G30A 3VK9A 1GTIA 1GUMA 3QR6A 3D5JA 3CRUA 1ERTA 1AAZA 2IWTA 3UAPA 1HD2A 1K0DA 4EE0A 4F0CA 3VURA 3M1GA 1USBA 4XTSA 2HSYA 2RUEA 2R3XA 4ILFA 3KGKA 4HQSA 4HI7A 1GULA 1Y25A 5D8IA 3LYPA 2H74A 4H86A 4XRDA 1TKDB 2GZZA 2L5OA 3KCMA 7GSSA 1F37A 1TDIA 2H75A 3MSZA 5A4WA 2IIYA 2VUPA 4Q5NA 4ECJA 5CP1A 1QMVA 4PQ1A 1QQ2A 4K7IA 1M2BA 5D9TA 4V2MA 2PGTA 4EDZA 5J41A 2XPDA 2OBKA 3VI7A 4ML1A 1FO5A 3C1SA 3ZVJA 3N9JA 3PR8A 3GH9A 2L59A 5G1KA 4EUYA 3W8SA 4GLTA 1URMA 3EMXA 4MF5A 3DVXA 2YPMA 5LNKe 1DBYA 2CVBA 1GP1A 2GZYA 2B5XA 1E2YA 2C0DA 3L9UA 1PX7A 5INYA 5DQSA 2CAIA 3GH6A 2FGXA 3LXZA 3KMNA 1OC9A 3QAGA 3C7MA 5F05A 1GSYA 3ZLPA 2DC5A 3LFLA 2I1UA 4WKWA 2CAQA 4X0XA 5CAXA 2NVLA 3G7JA 4AGSA 2FD3A 4G19A 1HNAA 2LRNA 1Z6MA 4GWRA 3ZITA 5GAND 1PKZA 2YV9A 4QL7A 1V40A 3FK8A 9GSSA 1NM3A 2PWJA 2XHFA 5CO3A 2YP6A 5ECPB 2EIQA 5KN1A 1T00A 4DSSB 4YAPA 3KH7A 2VM2A 1TP9A 2RIIA 3GKNA 5F06A 1Z3EA 1JZDA 1GUKA 3TUEA 1JLVA 2VD0A 3RPPA 3HZ8A 1U88A 1J9BA 1TJDA 6GSSA 4OWYA 2J23A 4NV2A 5HR1A 3GV1A 4KCEA 1Z7PA 2YOIA 4CDOA 3P7XA 2YJ7A 1XW6A 1VF4A 2C1YA 2FLSA 5F8BA 1F9MA 3EWLA 1A0FA 4TOPA 1M99A 4ZB6A 1S3DA 1J08A 1EEJA 3VWVA 1JFUA 3F9UA 1TW9A 1EOGA 3M0FA 4V1Ap 2YWNA 2IMDA 4XS4A 4WR5A 1SL2B 2R4VA 5AGYA 4RI7A 1K0NA 1I9DA 2DJ2A 3ZRDA 1ERUA 3DVWA 3MDKA 5AN1A 3SWLA 4MLYA 1SU9A 5HQPA 5IIZA 2K8VA 5C04A 1A2JA 5FT3A 2C3NA 2JZSA 1XCCA 2H73A 4V2LA 4JZQA 1MDKA 3RBTA 2VAFA 1TRUA 2WZ9A 2X99A 4K7NA 3FRCA 4QL9A 2HRFA 1ZZYA 3BBYA 3A3TA 2X8GA 5KEJA 5H5QA 4BWQA 4AJ6A 1PKWA 2P5RA 2FNOA 2L5LA 5IOWA 4O92A 2OBIA 1AXDA 2I81A 2XPEA 4YQMA 2NDOA 1O85A 4TN8A 4MH3A 5J9CA 3L4NA 5IMVA 2LQOA 2B7KA 2B6MA 1ST9A 1K3OA 5ECHB 5DJMA 2GSSA 1F2EA 1A23A 2GSRA 4RQXA 4OCEA 1MD3A 1UN2A 1J0FA 1KEBA 2V6OA 4DSQA 4G10A 4FIWA 3I69A 1QUWA 5GZZB 2H6XA 1O6JA 1SKWB 1OC8A 2IL3A 4LA1A 1BG5A 1B8XA 1EV4A 2IN3A 1OE7A 5GSSA 2PBJA 1EZKA 3IR4A 4F2IA 4NMUA 1K0BA 3GA4A 3CRTA 1YEPA 4DSSA 3I9V2 1T7PB 3QAWA 2LEGA 2YWIA 1XWGA 3GX0A 1PL2A 4MPFA 1SJZA 5LCZA 5ID2B 3GTUB 1A2LA 2D2ZA 1EWXA 1A2MA 5JCUA 2GVPA 3KMOA 3ZYWA 1X5DA 3ME8A 2VM1A 4KCAA 5IMZA 3A5WA 2YZHA 4RI6A 3WGXA 4GCIA 2WRTA 3HVSA 3UEMA 3JCML 2F3MA 2YJHA 3TKSE 4PXOA 3CTFA 1T4YA 4EDYA 2MMNA 1AQVA 2F9SA 5HR2A 2M80A 3Q6OA 3DD3A 3VFIA 2H0HA 2QC7A 4HDEA 2H1AA 1X9WB 4KNDA 1N2AA 1XVWA 2GQMA 1X9SB 4EXJA 4PUAA 5FHIA 4MDCA 3W8JA 1QK8A 4ZBDA 1BJXA 4L0WA 4G2EA 1U87A 2LRCA 3TCOA 3ZL5A 3KTLA 1GSUA 4ECCA 3W6GA 4TXVA 5JCWA 1CQHA 3BOAA 5CRDA 2L57A 2X64A 4O5RA 4G9HA 5KN2A 3TKQA 2P0GA 3R2QA 4K7OA 1AQXA 1XXUA 3BD2A 1KNGA 4K2DA 3E9JB 4KX4A 1GLPA 3LORA 1O81A 5HFGA 4TR1B 1QGVA 4D73B 3LJRA 2JZRA 4MJAA 2IMKA 2VCTA 3MWHA 1Q98A 2JADA 1GTUA 4EO3A 3H79A 3QAVA 3LWAA 4J2FA 2HSHA 2VLVA 1QFNA 1MEKA 4I6XA 2KHPA 5D73A 2H0IA 3E3EA 2G0FA 4XS1A 4ECIA 3QOUA 2V6KA 1SYRA 1JLWA 4MF6A 3KD0A 4NHZA 5DQYA 4MCUA 4OFMA 3RAZA 1XOAA 2L4CA 2AHEA 1R5PA 1TXXA 3ZFLA 1XFLA 5GSTA 3Q74A 1UVZA 1X5CA 2AJQB 4IBPA 2R37A 1MDIA 4TR4A 6GSVA 4BVYA 2OACA 3RHBA 1V57A 3FR6A 2F8AA 3FKFA 2HZEB 1LBKA 2CV4A 1GSFA 2LUSA 4OFTA 1TRWA 1M0UA 2PUKC 1SKRB 3G9BA 2B1KA 2GLRA 2HRNA 2YWOA 2CZ2A 1BAYA 3IC4A 1SK2A 1M7TA 1WRYA 2B7JA 2P31A 4OD7A 3HYPA 4X1UA 2O87A 3KM6A 2A2SA 3KP8A 4L5OA 3TJBA 1GSSA 4IGJA 2DIZA 11GSA 4MF7A 3M3MA 1JZRA 2K9FA 3GURA 3IA1A 1GSDA 1EOHA 1GNWA 2LRTA 5DAKA 1C72A 5IM9A 3EYTA 3TJJA 4TKYA 5GAPD 5H5SA 5E59A 4PNGA 2R5GA 4Q5FA 1WJKA 2EIRA 2MMAA 1X0RA 2BTOT 3C1RA 1OVNA 3ERGA 1BQ7A 3KXOA 1TK0B 4L5LA 4POBA 2OE0A 5G31A 1W4VA 2GQKA 3UBLA 1PGTA 3ZTLA 4XCSA 1FVKA 4TXOB 2YANA 3GMFA 1K0MA 1XPVA 1Z5YE 5L71A 1FB6A 1YEXA 5DALA 2GT5A 3A2VA 3M8NA 2WGRA 3GSTA 4OO4A 1KBNA 4ZB8A 3WGEA 2N5AA 2MZCA 1V2AA 5COHA 1FAAA 5CYYA 1WPIA 1NHYA 3GL3A 4DVCA 4IKHA 2OA7A 2QSIA 2VCZA 2FY6A 1Y6EA 4N11A 4JE1A 5A5KA 2LS5A 1B48A 5ELGA 3CSHA 4ZL9A 3HXSA 3FZ4A 4ZBAA 1SK0A 2MMZA 4ULXA 1TK5B 2H30A 4HZ4A 3GRXA 1FG4A 3DWVA 1B4QA 3IHQA 1Q4JA 2PN8A 1WMJA 4MJEA 2FWGA 2GGTA 3D21A 5B6NA 4RUVA 1RQMA 5B8AA 1XWAA 3TRXA 4TVEA 1K0OA 6GSYA 2DSAA 1MDJA 2LJAA 1NHOA 2C0FA 2C0GA 1ZOFA 5DVBA 1GUHA 4JU5A 5J5NA 4RQRA 4NWYA 3HD5A 1Z9HA 20GSA 3LSZA 2BJXA 3SBCA 2JSZA 4GF0A 18GSA 3UJ1A 22GSA 2I9HA 4EC0A 3KIJA 4ML6A 4WF5A 4HOJA 4WBJA 5ELAA 2L6DA 1XVQA 3WGDA 1OYJA 3L9VA 3GIXA 1SJIA 4Q5RA 4KAEA 3HVVA 4PNFA 2YWMA 3FZAA 3GHAA 5DBQA 2C0EA 8GSSA 2CA8A 5C00A 3FEUA 2J9HA 2K6VA 3ERFA 3VI5A 4KW6A 2C4JA 3NIVA 2GZPA 4ZXGA 4KE3A 2VL2C 2XC2A 3ZIJA 1XWKA 2C80A 2VCWA 4TR3A 3H8QA 2PMTA 2E2MA 3HKRA 3A2WA 1HQOA 1FVJA 2HT9A 2A2RA 4IVFA 5KN3A 1AQWA 1TOFA 5HFKA 3UIWA 1GL8A 1O7UA 1GNEA 2H1DA 1ZYEA 4LL1B 1V98A 3F4TA 2O8VB 4F9ZA 1B4PA 3LEFA 1HNBA 5IOXA 3IXRA 2FUG2 4MABA 4E8EA 3NOFA 1FW1A 1T3BA 2IFQB 4MP4A 2VL3A 4IJIA 3D0ZA 1VGLA 1YKAA 3ZZXA 2HI7A 4BWSA 13GSA 2HNLA 1PMTA 2CT6A 3D4MA 2VLUA 1ZGNA 5D9XA 4FYUA 2E7PA 5CRWA 2V1MA 2N5BA 1XZOA 5AISA 4GQFA 3Q18A 1K3LA 1XWCA 1F6MC 4DSRA 2EIOA 3U5RE 3QD9A 5JWQB 1Z7RA 2TRXA 4OO5A 4O32A 1TI1A 2JSYA 6GSXA 1V58A 2ON5A 3F63A 2MMOA 1GSEA 2WULA 1PD21 1ZCPA 2FCHA 4ZBBA 2OE3A 3CSIA 4HU9A 3AY8A 3TKSC 3LYKA 1HYUA 1ERWA 2LNTA 3QMXA 1DSBA 1R5AA 4IHUA 1ACVA 3HHVA 1K3YA 1UC7A 4K8MA 2H71A 1PSQA 3L78A 1EEMA 3TJFA 3IK7A 1EV9A 1MD4A 1NSWA 2H6ZA 1XW5A 3FR3A 4CHSA 1ZYQB 1F3BA 2E2GA 4Z7XA 1THOA 1ML6A 1K0CA 1TI3A 3TRPA 4E8HA 1X5EA 2DJKA 3H4KA 3GKMA 3EE2A 2F8FA 4K1FA 2H72A 3G7IA 3QPMA 1M2DA 4KDXA 3QFBC 4KSMA 2B5YA 1OC3A 2XBQA 2IPAA 1XOBA 1N8JA 4I2UA 4BVXA 5DCGA 3IOSA 3KJYA 3GX8A 4TR0A 4O7HA 4HZ2A 3FYGA 1A8YA 2ZCTA 2ZUPA 2DIYA 1YF0A 5ABRA 3DGQA 2LNSA 5DJLA 4TRXA 4IP6A 3VWWA 5JCGA 2VL9A 1WE0A 3QCPA 4WBRD 2GSTA 5IQYA 1OAZA 3APSA 3C71A 3TJKA 4WR4A 4ECBA 5D93A 4MJCA 4WXTA 4JBBA 2BMXA 3F6DA 2H19A 3UOMA 4XRAA 5ECKB 3GUSA 1A0RP 4J56E 1S3CA 3UL3A 2VL2A 1G7OA 2HLSA 1OC9B 4JR4A 5D96A 2REMA 4MZWA 1YY7A 2FWHA 4EKZA 2DJ3A 3O3TA 1XBSA 2HZFA 1X9MB 2TRCP 2X8HA 4K0NA 1TRVA 1GRXA 4BPYA 3LQ7A 1EP8A 4LL4B 3ZMLA 2WFCA 3US3A 2V41A 2H1BA 1H75A 2CX4A 4EF0A 5ECRB 1ERVA 4GRFA 4HJ2A 2YV7A 3FHKA 3EU3A 1GSQA 4TW5A 2O89A 3CBUA 4BL7A 3IV4A 2FA4A 1ILOA 3HZ4A 4ID0A 4IP1A 2AV4A 4FO5A 3ZREA 3M9JA 4N10A 3HY2A 3VPTA 2I4AA 3QFAC 2ALBA 2A4VA 1DUGA 3DRNA 4KUNA 4FYBA 3HJOA 5D9VA 2WJUA
chains in the Genus database with same CATH superfamily
3J7Yk 2LJRA 3F4SA 3IE3A 2WB9A 1THXA 4IQ1A 1NW2A 3DKSA 5ECNB 5IMAA 4IS0A 1T8EB 3APOA 3WT2A 1E6BA 3BCKA 4KSOA 4PQHA 1YDKA 5B6MA 4HS1A 3TJGA 1WP0A 3LGCA 3TKSA 5ID2A 3RDWA 3GTUA 3HCZA 2DJJA 1R26A 1SL1B 2KP1A 3UARA 3GN3A 3S9FA 2G2QA 2DKHA 4HEA2 2LV3A 2R6KA 4XS4B 2LTKA 4XS6A 2K18A 1SD9A 4L0UA 2H01A 14GSA 3EMPA 4KDUA 4DEJA 4LMVA 4NV5A 5F07A 2FHEA 3F3RA 1TRSA 1FOVA 5A4VA 3TKRA 4N0ZA 3WT1A 3BCIA 4XIHA 3L0HA 2YZUA 2KUCA 1VF2A 3KEBA 1ABAA 3HA9A 5IPGA 3TOUA 4KGIA 3GYKA 2WCIA 2C8UA 2PVQA 1DE1A 2OKAA 4ZB9A 1DE2A 2V32A 1EGOA 2NBSA 4KDYA 4POLA 3J7Yb 2NPBA 3GFKA 3IDVA 5LD0A 1BX9A 1B9XC 1OKDA 1KTEA 1TU7A 4GQCA 2JU5A 2KP2A 3I6AA 2MBTA 1FHEA 1RW1A 5AIVA 2VCQA 3NZNA 2GT6A 4V2NA 1XW9A 4PUFC 5HR0A 1QXHA 1SK1A 1VF3A 4AF2A 4OMVA 1CQGA 3VWUA 4CY6A 3L9SA 3A2XA 1T4ZA 4BA7A 5B8BA 4Z2RA 3EURA 5KOXA 1AIUA 3P90A 1ZL9A 4MH2A 3ERWA 5A4UA 5AIXA 3DYRA 1AC1A 2NTOA 5G5FA 4TR1A 1IYIA 1R7HA 3F6FA 4GXZA 4D73A 2RUFA 4ZL7A 1UA5A 2ON7A 5CREA 4K6XA 2GSQA 4MZCA 1F3AA 3VPQA 1W89A 3ED3A 3U6VA 3TOTA 1SENA 6GSWA 4IJ3A 3UVTA 3R3EA 1A8LA 4CW9A 2XBIA 2O7KA 4WEYA 4MPGA 5DCHA 3LG6A 2Z9SA 5B7CA 1H4OA 4IQAA 5JWOB 5J3RA 4F82A 4MA9A 3MNGA 2HYXA 3CXGA 1YZXA 1SJ6A 4A5PA 4I5QA 2GQLA 5EPFA 1O8XA 3KZQA 5EL8A 1I5GA 4GSNA 4MMMA 5ENUA 2DBCA 1YQ1A 2YCDA 4MZBA 3F3QA 1OE8A 2B1LA 2VCXA 3N5OA 2A4HA 2RM5A 5IO0A 2HXKA 2I3YA 1XWBA 2HZEA 1PN9A 5ECLB 5H5RA 1TU8A 2VCVA 2KOKA 4JRRA 3CMIA 4ZL8A 1GLQA 4FH8A 3WD6A 3V1WA 5KN0A 3VLNA 5IMDA 3EC3A 3O6TA 1PFOA 5CRHA 1G6YA 4MJBA 12GSA 4FYCA 4ZILA 2RM6A 3DEXA 4ACSA 4K0GA 4GSTA 1ON4A 4POKA 2WDUA 4K9ZA 3CSJA 1SKSB 3ZVJD 1OKTA 4F03A 2RLIA 3H1NA 1U3AA 5ECQB 2FWEA 1SD8A 4WETA 3KP9A 1V9WA 3IK9A 1FB0A 4N0VA 3DIEA 3IAM2 4J57E 1ZMAA 3LW9A 3TGZA 3DMLA 5IMFA 3IPZA 1A24A 2R2JA 1LJRA 3RHCA 1PX6A 1AW9A 1SL0B 5BRTA 3GL5A 2PVOC 3CYNA 1BEDA 2VO4A 2X4AA 4O5UA 2CVDA 4AJ7A 4TXOA 3EU4A 2AB6A 2QKEA 2DMLA 2LKUA 1M2AA 1WOUA 3K8NA 1YJ6A 1O73A 2CX3A 1GH2A 4I8BA 4MK3A 3IRAA 3GSSA 1YF1A 3P2AA 2ZNMA 3QDNA 5J4UA 1M9AA 5D9WA 3EVIA 3CTGA 2GS3A 3IBHA 1PQNA 1PL1A 2CVKA 3D6IA 5EY6A 4G0LA 2MYGA 3APQA 2H76A 3RPNA 2VIMA 3E0UA 4PGTA 1SYXA 2IMFA 2IMIA 3ZFBA 2N5FA 4NHWA 2M46A 4POMA 2ES7A 4KB3A 2B3SA 3BJ5A 3KH9A 5IPHA 5KOWA 2IJYA 4OFNA 4F0BA 4BVYB 2VLTA 4JEDA 3O76A 4HQZA 2MBSA 4ISDA 2YN1A 2H66A 4EIPA 5IO2A 1EP7A 2C3TA 2L6CA 3VWXA 3EINA 2X8CA 3M9KA 2VOCA 1T1VA 4KF9A 2KLXA 2PERA 4I2TA 2WS2A 3IC8A 4Q5QA 4EL1A 2VD1A 4IW9A 2JACA 2HRAA 4HSCX 3ZMKA 1Z6NA 3FR9A 4IN0A 4YAVA 5HR3A 3PGTA 1M9BA 3HVXA 2K8SA 1G7EA 2YNXA 1U6TA 2HE3A 4PQIA 2H0GA 4X43A 1AUCA 2TIRA 3C8EA 5ECOB 3HJPA 4YQVA 3F8UA 4HU7A 4NAXA 3UVHA 3GNJA 2EC4A 3GKKA 4LMWA 2DMMA 1WWJA 2M72A 2L4QA 1O8WA 5DAKB 2LJKA 4IELA 3ZIVA 4XHMA 2OE1A 3I43A 5FWGA 2OJLA 3TB2A 1GWCA 1G0TA 2IMEA 1TTZA 3FW2A 5ECSA 1WIKA 4HUAA 1JZWA 19GSA 5G2ZA 3TRQA 1FOHA 2DJ1A 2OADA 3PH9A 4QQ7A 2H1GA 5JWRB 1EGRA 6GSUA 1PRXA 1HNCA 3ISOA 4KH7A 3TDGA 3D4TA 5EVOA 5CNWA 4V1Ag 3G7YA 4AJ8A 3IAS2 4ZIJA 4PURA 1LU4A 2AUVA 3F4RA 1RK4A 2AAWA 3DXBA 2P5QA 4P3YB 2PU9C 2B5EA 4GSSA 3HJMA 5IMCA 4LLRA 1MTCA 5DALB 3OR5A 3FZ9A 4I97A 3Q19A 5HFIA 5G5EA 2LQQA 1G6WA 2F51A 3FZ5A 17GSA 2X49A 3H93A 4NPBA 1JZOA 2JZTA 5DDLA 1S3AA 2V2GA 5ECMB 4K2XA 3A5IA 2IFQA 2E0QA 5F0GA 4N30A 1R4WA 3LXTA 4YH2A 3F0IA 2HFDA 3FY7A 2JL4A 4GTUA 1IYHA 5CRGA 4HJMA 2H8LA 2LSTA 1VF1A 2O85A 1TK8B 1GTAA 2H6YA 2DLXA 3ME7A 1VRSD 10GSA 4OCFA 4WF4A 1GTBA 1JHBA 2GTUA 5ECIB 4YQUA 3GKXA 4JR6A 4EVMA 5G1LA 2CZ3A 2FWFA 4NXIA 2AYTA 2PPTA 3D22A 1XIYA 3PINA 2CQ9A 2C3QA 3WYWA 4L8EA 2GDRA 3MAKA 6GSTA 5J9BA 2QGVA 2H70A 2DJ0A 3C73A 1U3IA 3UBKA 3P8WA 4PX1A 3KTBA 3UMAA 1PA3A 3TKPA 16GSA 4FQUA 1B9YC 2FA8A 4KA0A 1YKCA 1BYEA 1K0AA 3HDCA 5E4WA 5G30A 3VK9A 1GTIA 1GUMA 3QR6A 3D5JA 3CRUA 1ERTA 1AAZA 2IWTA 3UAPA 1HD2A 1K0DA 4EE0A 4F0CA 3VURA 3M1GA 1USBA 4XTSA 2HSYA 2RUEA 2R3XA 4ILFA 3KGKA 4HQSA 4HI7A 1GULA 1Y25A 5D8IA 3LYPA 2H74A 4H86A 4XRDA 1TKDB 2GZZA 2L5OA 3KCMA 7GSSA 1F37A 4G0IA 1TDIA 2H75A 3MSZA 5A4WA 2IIYA 2VUPA 4Q5NA 4YKFA 4ECJA 5CP1A 1QMVA 4PQ1A 1QQ2A 4K7IA 1M2BA 5D9TA 4V2MA 2PGTA 4EDZA 5J41A 2XPDA 2OBKA 3VI7A 4ML1A 1FO5A 3C1SA 3ZVJA 3N9JA 3PR8A 3HVNA 3GH9A 2L59A 5G1KA 4EUYA 3W8SA 4GLTA 1URMA 3EMXA 4MF5A 3DVXA 2YPMA 5LNKe 1DBYA 2CVBA 1GP1A 2GZYA 2B5XA 1E2YA 2C0DA 3L9UA 1PX7A 5INYA 5DQSA 2CAIA 3GH6A 2FGXA 3LXZA 3KMNA 1OC9A 3QAGA 5BMUA 3C7MA 5F05A 1GSYA 3ZLPA 2DC5A 3LFLA 2I1UA 4WKWA 2CAQA 4X0XA 5CAXA 1ZYNA 2NVLA 3G7JA 4AGSA 2FD3A 4G19A 1HNAA 2LRNA 1Z6MA 4GWRA 3ZITA 5GAND 1PKZA 2YV9A 4QL7A 1V40A 3FK8A 9GSSA 1NM3A 2PWJA 2XHFA 5CO3A 2YP6A 5ECPB 2EIQA 5KN1A 1T00A 4DSSB 4YAPA 3KH7A 2VM2A 1TP9A 2RIIA 3GKNA 5F06A 1Z3EA 1JZDA 1GUKA 3TUEA 1JLVA 2VD0A 3RPPA 3HZ8A 1U88A 1J9BA 1TJDA 6GSSA 4OWYA 2J23A 4NV2A 5HR1A 3GV1A 4KCEA 1Z7PA 2YOIA 4CDOA 3P7XA 2YJ7A 1XW6A 1VF4A 2C1YA 2FLSA 5F8BA 1F9MA 4BVXB 3EWLA 4TOPA 1A0FA 1M99A 4ZB6A 1S3DA 3MYDA 1J08A 1EEJA 3VWVA 1JFUA 3F9UA 1TW9A 1EOGA 3M0FA 4V1Ap 2YWNA 2IMDA 1ZYPA 4XS4A 4WR5A 1S3RA 1SL2B 2R4VA 5AGYA 4RI7A 1K0NA 1I9DA 2DJ2A 3ZRDA 1ERUA 3DVWA 3MDKA 5AN1A 3SWLA 4MLYA 1SU9A 5HQPA 5IIZA 4MNNA 4BIKA 2K8VA 5C04A 1A2JA 5FT3A 2C3NA 2JZSA 2DKIA 1XCCA 2H73A 4V2LA 4JZQA 1MDKA 3RBTA 2VAFA 1TRUA 2WZ9A 2X99A 4K7NA 3FRCA 4QL9A 2HRFA 1ZZYA 3BBYA 3A3TA 2X8GA 5KEJA 5H5QA 4BWQA 4AJ6A 1PKWA 2P5RA 2FNOA 2L5LA 5IOWA 4O92A 2OBIA 1AXDA 2I81A 2XPEA 4YQMA 2NDOA 1O85A 4TN8A 4MH3A 5J9CA 3L4NA 5IMVA 2LQOA 2B7KA 2B6MA 4BL7B 1ST9A 1K3OA 5ECHB 5DJMA 2GSSA 1F2EA 1A23A 2GSRA 4RQXA 4OCEA 1MD3A 1UN2A 1J0FA 1KEBA 2V6OA 4DSQA 4G10A 4FIWA 3I69A 1QUWA 5GZZB 2H6XA 1O6JA 1SKWB 1OC8A 2IL3A 4LA1A 1BG5A 4EIQA 1B8XA 1EV4A 2IN3A 1OE7A 5GSSA 2HRKA 2PBJA 1EZKA 3IR4A 4F2IA 4NMUA 1K0BA 3GA4A 3CRTA 1YEPA 4DSSA 3I9V2 1T7PB 3QAWA 2LEGA 2YWIA 1XWGA 3GX0A 1PL2A 4MPFA 1SJZA 5LCZA 5ID2B 3GTUB 1A2LA 2D2ZA 1EWXA 1A2MA 5JCUA 2A2PA 2GVPA 3KMOA 3ZYWA 1X5DA 3ME8A 2VM1A 4KCAA 5IMZA 3A5WA 2YZHA 4RI6A 3WGXA 4GCIA 2WRTA 3HVSA 3UEMA 3JCML 2F3MA 2YJHA 3TKSE 4PXOA 3CTFA 1T4YA 4EDYA 4ICYA 2MMNA 1AQVA 2F9SA 5HR2A 2M80A 3Q6OA 3DD3A 3VFIA 2H0HA 2QC7A 4HDEA 2H1AA 1X9WB 4KNDA 1N2AA 1XVWA 2GQMA 1X9SB 1XG8A 4EXJA 4PUAA 5FHIA 4MDCA 3W8JA 1QK8A 4ZBDA 1BJXA 4L0WA 4G2EA 1U87A 2LRCA 3TCOA 3ZL5A 3KTLA 1GSUA 4ECCA 3W6GA 4TXVA 5JCWA 1CQHA 3BOAA 3MIXA 5CRDA 2L57A 2X64A 4O5RA 4G9HA 5KN2A 3TKQA 2P0GA 3R2QA 4K7OA 1AQXA 1XXUA 3BD2A 1KNGA 4K2DA 3E9JB 4KX4A 1GLPA 3LORA 1O81A 5HFGA 4TR1B 1QGVA 4D73B 3LJRA 2JZRA 4MJAA 2IMKA 2VCTA 3MWHA 1Q98A 2JADA 1GTUA 4EO3A 3H79A 3QAVA 3LWAA 4J2FA 2HSHA 2VLVA 1QFNA 1MEKA 4I6XA 2KHPA 5D73A 2H0IA 3E3EA 2G0FA 4XS1A 4ECIA 3QOUA 2V6KA 1SYRA 1JLWA 4MF6A 3KD0A 4NHZA 4X4JA 5DQYA 4MCUA 4OFMA 3RAZA 1XOAA 2L4CA 2AHEA 1R5PA 1TXXA 3ZFLA 1XFLA 4K5RA 5GSTA 3Q74A 1UVZA 1X5CA 2AJQB 4IBPA 2R37A 1MDIA 4TR4A 6GSVA 4BVYA 2OACA 3RHBA 1V57A 3FR6A 2F8AA 3FKFA 2HZEB 1LBKA 2CV4A 1GSFA 2LUSA 4OFTA 1TRWA 1M0UA 2PUKC 1SKRB 3G9BA 2B1KA 2GLRA 2HRNA 2YWOA 2CZ2A 1BAYA 3IC4A 1SK2A 1M7TA 1WRYA 2B7JA 2P31A 4OD7A 3HYPA 4X1UA 2O87A 3KM6A 2A2SA 3KP8A 4L5OA 3TJBA 1GSSA 4IGJA 2DIZA 11GSA 4MF7A 3M3MA 1JZRA 2K9FA 3GURA 3IA1A 1M3IA 1GSDA 1EOHA 1GNWA 2LRTA 5DAKA 1C72A 5IM9A 3EYTA 3TJJA 4TKYA 5GAPD 5H5SA 5E59A 4PNGA 2R5GA 4G0KA 4Q5FA 1WJKA 2EIRA 2MMAA 1X0RA 2BTOT 3C1RA 1OVNA 3ERGA 1BQ7A 3KXOA 1TK0B 4L5LA 4POBA 2OE0A 5G31A 1W4VA 2GQKA 3UBLA 1PGTA 3ZTLA 4XCSA 1FVKA 4TXOB 2R0GA 3PPUA 2YANA 3GMFA 1K0MA 1XPVA 1Z5YE 5L71A 1FB6A 1YEXA 5DALA 2GT5A 3A2VA 3M8NA 2WGRA 3GSTA 4OO4A 1KBNA 4ZB8A 3WGEA 2N5AA 2MZCA 1V2AA 5COHA 1FAAA 5CYYA 1WPIA 1NHYA 3GL3A 4DVCA 4IKHA 2OA7A 2QSIA 2VCZA 2FY6A 1Y6EA 4N11A 4JE1A 5A5KA 2LS5A 1B48A 5ELGA 3CSHA 4ZL9A 3HXSA 3FZ4A 4ZBAA 1SK0A 2MMZA 4ULXA 1TK5B 2H30A 4HZ4A 3GRXA 1FG4A 3DWVA 1B4QA 3IHQA 1Q4JA 2PN8A 1WMJA 4MJEA 2FWGA 2GGTA 3D21A 5B6NA 4RUVA 1RQMA 5B8AA 1XWAA 3TRXA 4TVEA 1K0OA 6GSYA 2DSAA 1MDJA 2LJAA 1NHOA 2C0FA 2C0GA 1ZOFA 5DVBA 1GUHA 4JU5A 5J5NA 4RQRA 4NWYA 3HD5A 1Z9HA 20GSA 3LSZA 2BJXA 3SBCA 2JSZA 4GF0A 18GSA 3UJ1A 22GSA 2I9HA 4EC0A 4CY8A 3KIJA 4ML6A 4WF5A 4HOJA 3IHGA 4WBJA 5ELAA 2L6DA 1XVQA 3WGDA 1OYJA 3L9VA 3GIXA 1SJIA 4Q5RA 4KAEA 3HVVA 4PNFA 2YWMA 3FZAA 3GHAA 5DBQA 2C0EA 8GSSA 2CA8A 5C00A 3FEUA 2J9HA 2K6VA 2R0CA 3ERFA 3VI5A 4KW6A 2C4JA 3NIVA 2GZPA 4ZXGA 4KE3A 2VL2C 2XC2A 3ZIJA 1XWKA 2C80A 2VCWA 4TR3A 3H8QA 2PMTA 2E2MA 3HKRA 4O5QA 3A2WA 1HQOA 4YKGA 1FVJA 2HT9A 2A2RA 4IVFA 5KN3A 1AQWA 1TOFA 5HFKA 3UIWA 1GL8A 1O7UA 1GNEA 2H1DA 1ZYEA 4LL1B 1V98A 3F4TA 2O8VB 4F9ZA 1B4PA 3LEFA 1HNBA 5IOXA 3IXRA 2FUG2 4MABA 4E8EA 3NOFA 1FW1A 1T3BA 2IFQB 4MP4A 2VL3A 4IJIA 3D0ZA 1VGLA 1YKAA 3ZZXA 2HI7A 4BWSA 13GSA 2HNLA 1PMTA 2CT6A 3D4MA 2VLUA 3EPTA 1ZGNA 5D9XA 4FYUA 2E7PA 5CRWA 2V1MA 2N5BA 1XZOA 5AISA 4GQFA 3Q18A 1K3LA 1XWCA 1F6MC 4DSRA 2EIOA 3U5RE 3QD9A 5JWQB 1Z7RA 2TRXA 4OO5A 4O32A 1TI1A 2JSYA 6GSXA 1V58A 2ON5A 3F63A 3FMWA 2QA1A 2MMOA 1GSEA 2WULA 1PD21 1ZCPA 2FCHA 4ZBBA 2OE3A 3CSIA 4HU9A 3AY8A 3TKSC 3LYKA 1HYUA 1ERWA 2LNTA 3QMXA 1DSBA 1R5AA 4IHUA 1ACVA 3HHVA 1K3YA 1UC7A 4K8MA 2H71A 1PSQA 3L78A 1EEMA 3TJFA 3IK7A 1EV9A 1MD4A 1NSWA 2H6ZA 1XW5A 3FR3A 4CHSA 1ZYQB 1F3BA 2E2GA 4Z7XA 1THOA 1ML6A 1K0CA 1TI3A 3TRPA 4E8HA 1X5EA 2DJKA 3H4KA 2UZ8A 3GKMA 4K5SA 3EE2A 2F8FA 4K1FA 2H72A 3G7IA 3QPMA 1M2DA 4KDXA 3QFBC 4KSMA 2B5YA 1M3JA 1OC3A 2XBQA 2IPAA 2QA2A 1XOBA 1N8JA 4I2UA 4BVXA 5DCGA 3IOSA 3KJYA 3GX8A 4TR0A 4O7HA 4HZ2A 3FYGA 1A8YA 2ZCTA 2ZUPA 2DIYA 1YF0A 5ABRA 2R0PA 3DGQA 2LNSA 5DJLA 4TRXA 4IP6A 3VWWA 5JCGA 2VL9A 1WE0A 3QCPA 4WBRD 2GSTA 5IQYA 1OAZA 3APSA 3C71A 3TJKA 4WR4A 4ECBA 5D93A 4MJCA 4WXTA 4JBBA 2BMXA 3F6DA 2H19A 3UOMA 4XRAA 5ECKB 3GUSA 1A0RP 4J56E 1S3CA 3UL3A 2VL2A 1G7OA 2HLSA 1OC9B 4JR4A 5D96A 2REMA 4MZWA 1YY7A 2FWHA 4EKZA 2DJ3A 3O3TA 1XBSA 2HZFA 4Z2UA 1X9MB 2TRCP 2X8HA 4K0NA 1TRVA 1GRXA 4BPYA 3LQ7A 1EP8A 4LL4B 3ZMLA 2WFCA 3US3A 2V41A 2H1BA 1H75A 2CX4A 4EF0A 5ECRB 1ERVA 4Z2TA 3CQFA 4GRFA 4HJ2A 2YV7A 3FHKA 3EU3A 1GSQA 1PN0A 4TW5A 2O89A 3CBUA 4USSA 4BL7A 3IV4A 2FA4A 4PTSA 1ILOA 3HZ4A 4ID0A 4IP1A 2AV4A 4FO5A 3ZREA 3M9JA 4N10A 3HY2A 2HSMA 3VPTA 2I4AA 3QFAC 2ALBA 2A4VA 1DUGA 3DRNA 4KUNA 4FYBA 3HJOA 5D9VA 2WJUA
chains in the Genus database with same CATH topology
3J7Yk 2LJRA 3F4SA 3IE3A 2WB9A 1THXA 4IQ1A 1NW2A 3DKSA 5ECNB 5IMAA 4IS0A 1T8EB 3APOA 3WT2A 1E6BA 3BCKA 4KSOA 4PQHA 1YDKA 5B6MA 4HS1A 3TJGA 1WP0A 3LGCA 3TKSA 5ID2A 3RDWA 3GTUA 3HCZA 2DJJA 1R26A 1SL1B 2KP1A 3UARA 3GN3A 3S9FA 2G2QA 2DKHA 4HEA2 2LV3A 2R6KA 4XS4B 2LTKA 4XS6A 2K18A 1SD9A 4L0UA 2H01A 14GSA 3EMPA 4KDUA 4DEJA 4LMVA 4NV5A 5F07A 2FHEA 3F3RA 1TRSA 1FOVA 5A4VA 3TKRA 4N0ZA 3WT1A 3BCIA 4XIHA 3L0HA 2YZUA 2KUCA 1VF2A 3KEBA 1ABAA 3HA9A 5IPGA 3TOUA 4KGIA 3GYKA 2WCIA 2C8UA 2PVQA 1DE1A 2OKAA 4ZB9A 1DE2A 2V32A 1EGOA 2NBSA 4KDYA 4POLA 3J7Yb 2NPBA 3GFKA 3IDVA 5LD0A 1BX9A 1B9XC 1OKDA 1KTEA 1TU7A 4GQCA 2JU5A 2KP2A 3I6AA 2MBTA 1FHEA 1RW1A 5AIVA 2VCQA 3NZNA 2GT6A 4V2NA 1XW9A 4PUFC 5HR0A 1QXHA 1SK1A 1VF3A 4AF2A 4OMVA 1CQGA 3VWUA 4CY6A 3L9SA 3A2XA 1T4ZA 4BA7A 5B8BA 4Z2RA 3EURA 5KOXA 1AIUA 3P90A 1ZL9A 4MH2A 3ERWA 5A4UA 5AIXA 3DYRA 1AC1A 2NTOA 5G5FA 4TR1A 1IYIA 1R7HA 3F6FA 4GXZA 4D73A 2RUFA 4ZL7A 1UA5A 2ON7A 5CREA 4K6XA 2GSQA 4MZCA 1F3AA 3VPQA 1W89A 3ED3A 3U6VA 3TOTA 1SENA 6GSWA 4IJ3A 3UVTA 3R3EA 1A8LA 4CW9A 2XBIA 2O7KA 4WEYA 4MPGA 5DCHA 3LG6A 2Z9SA 5B7CA 1H4OA 4IQAA 5JWOB 5J3RA 4F82A 4MA9A 3MNGA 2HYXA 3CXGA 1YZXA 1SJ6A 4A5PA 4I5QA 2GQLA 5EPFA 1O8XA 3KZQA 5EL8A 1I5GA 4GSNA 4MMMA 5ENUA 2DBCA 1YQ1A 2YCDA 4MZBA 3F3QA 1OE8A 2B1LA 2VCXA 3N5OA 2A4HA 2RM5A 5IO0A 2HXKA 2I3YA 1XWBA 2HZEA 1PN9A 5ECLB 5H5RA 1TU8A 2VCVA 2KOKA 4JRRA 3CMIA 4ZL8A 1GLQA 4FH8A 3WD6A 3V1WA 5KN0A 3VLNA 5IMDA 3EC3A 3O6TA 5CRHA 1G6YA 4MJBA 12GSA 4FYCA 4ZILA 2RM6A 3DEXA 4ACSA 4K0GA 4GSTA 1ON4A 4POKA 2WDUA 4K9ZA 3CSJA 1SKSB 3ZVJD 1OKTA 4F03A 2RLIA 3H1NA 1U3AA 5ECQB 2FWEA 1SD8A 4WETA 3KP9A 1V9WA 3IK9A 1FB0A 4N0VA 3DIEA 3IAM2 4J57E 1ZMAA 3LW9A 3TGZA 3DMLA 5IMFA 3IPZA 1A24A 2R2JA 1LJRA 3RHCA 1PX6A 1AW9A 1SL0B 5BRTA 3GL5A 2PVOC 3CYNA 1BEDA 2VO4A 2X4AA 4O5UA 2CVDA 4AJ7A 4TXOA 3EU4A 2AB6A 2QKEA 2DMLA 2LKUA 1M2AA 1WOUA 3K8NA 1YJ6A 1O73A 2CX3A 1GH2A 4I8BA 4MK3A 3IRAA 3GSSA 1YF1A 3P2AA 2ZNMA 3QDNA 5J4UA 1M9AA 5D9WA 3EVIA 3CTGA 2GS3A 3IBHA 1PQNA 1PL1A 2CVKA 3D6IA 5EY6A 4G0LA 2MYGA 3APQA 2H76A 3RPNA 2VIMA 3E0UA 4PGTA 1SYXA 2IMFA 2IMIA 3ZFBA 2N5FA 4NHWA 2M46A 4POMA 2ES7A 4KB3A 2B3SA 3BJ5A 3KH9A 5IPHA 5KOWA 2IJYA 4OFNA 4F0BA 4BVYB 2VLTA 4JEDA 3O76A 4HQZA 2MBSA 4ISDA 2YN1A 2H66A 4EIPA 5IO2A 1EP7A 2C3TA 2L6CA 3VWXA 3EINA 2X8CA 3M9KA 2VOCA 1T1VA 4KF9A 2KLXA 2PERA 4I2TA 2WS2A 3IC8A 4Q5QA 4EL1A 2VD1A 4IW9A 2JACA 2HRAA 3ZMKA 1Z6NA 3FR9A 4IN0A 4YAVA 5HR3A 3PGTA 1M9BA 3HVXA 2K8SA 1G7EA 2YNXA 1U6TA 2HE3A 4PQIA 2H0GA 4X43A 1AUCA 2TIRA 3C8EA 5ECOB 3HJPA 4YQVA 3F8UA 4HU7A 4NAXA 3UVHA 3GNJA 2EC4A 3GKKA 4LMWA 2DMMA 1WWJA 2M72A 2L4QA 1O8WA 5DAKB 2LJKA 4IELA 3ZIVA 4XHMA 2OE1A 3I43A 5FWGA 2OJLA 3TB2A 1GWCA 1G0TA 2IMEA 1TTZA 3FW2A 5ECSA 1WIKA 4HUAA 1JZWA 19GSA 5G2ZA 3TRQA 1FOHA 2DJ1A 2OADA 3PH9A 4QQ7A 2H1GA 5JWRB 1EGRA 6GSUA 1PRXA 1HNCA 3ISOA 4KH7A 3TDGA 3D4TA 5EVOA 5CNWA 4V1Ag 3G7YA 4AJ8A 3IAS2 4ZIJA 4PURA 1LU4A 2AUVA 3F4RA 1RK4A 2AAWA 3DXBA 2P5QA 4P3YB 2PU9C 2B5EA 4GSSA 3HJMA 5IMCA 4LLRA 1MTCA 5DALB 3OR5A 3FZ9A 4I97A 3Q19A 5HFIA 5G5EA 2LQQA 1G6WA 2F51A 3FZ5A 17GSA 2X49A 3H93A 4NPBA 1JZOA 2JZTA 5DDLA 1S3AA 2V2GA 5ECMB 4K2XA 3A5IA 2IFQA 2E0QA 5F0GA 4N30A 1R4WA 3LXTA 4YH2A 3F0IA 2HFDA 3FY7A 2JL4A 4GTUA 1IYHA 5CRGA 4HJMA 2H8LA 2LSTA 1VF1A 2O85A 1TK8B 1GTAA 2H6YA 2DLXA 3ME7A 1VRSD 10GSA 4OCFA 4WF4A 1GTBA 1JHBA 2GTUA 5ECIB 4YQUA 3GKXA 4JR6A 4EVMA 5G1LA 2CZ3A 2FWFA 4NXIA 2AYTA 2PPTA 3D22A 1XIYA 3PINA 2CQ9A 2C3QA 3WYWA 4L8EA 2GDRA 3MAKA 6GSTA 5J9BA 2QGVA 2H70A 2DJ0A 3C73A 1U3IA 3UBKA 3P8WA 4PX1A 3KTBA 3UMAA 1PA3A 3TKPA 16GSA 4FQUA 1B9YC 2FA8A 4KA0A 1YKCA 1BYEA 1K0AA 3HDCA 5E4WA 5G30A 3VK9A 1GTIA 1GUMA 3QR6A 3D5JA 3CRUA 1ERTA 1AAZA 2IWTA 3UAPA 1HD2A 1K0DA 4EE0A 4F0CA 3VURA 3M1GA 1USBA 4XTSA 2HSYA 2RUEA 2R3XA 4ILFA 3KGKA 4HQSA 4HI7A 1GULA 1Y25A 5D8IA 3LYPA 2H74A 4H86A 4XRDA 1TKDB 2GZZA 2L5OA 3KCMA 7GSSA 1F37A 4G0IA 1TDIA 2H75A 3MSZA 5A4WA 2IIYA 2VUPA 4Q5NA 4YKFA 4ECJA 5CP1A 1QMVA 4PQ1A 1QQ2A 4K7IA 1M2BA 5D9TA 4V2MA 2PGTA 4EDZA 5J41A 2XPDA 2OBKA 3VI7A 4ML1A 1FO5A 3C1SA 3ZVJA 3N9JA 3PR8A 3GH9A 2L59A 5G1KA 4EUYA 3W8SA 4GLTA 1URMA 3EMXA 4MF5A 3DVXA 2YPMA 5LNKe 1DBYA 2CVBA 1GP1A 2GZYA 2B5XA 1E2YA 2C0DA 3L9UA 1PX7A 5INYA 5DQSA 2CAIA 3GH6A 2FGXA 3LXZA 3KMNA 1OC9A 3QAGA 5BMUA 3C7MA 5F05A 1GSYA 3ZLPA 2DC5A 3LFLA 2I1UA 4WKWA 2CAQA 4X0XA 5CAXA 1ZYNA 2NVLA 3G7JA 4AGSA 2FD3A 4G19A 1HNAA 2LRNA 1Z6MA 4GWRA 3ZITA 5GAND 1PKZA 2YV9A 4QL7A 1V40A 3FK8A 9GSSA 1NM3A 2PWJA 2XHFA 5CO3A 2YP6A 5ECPB 2EIQA 5KN1A 1T00A 4DSSB 4YAPA 3KH7A 2VM2A 1TP9A 2RIIA 3GKNA 5F06A 1Z3EA 1JZDA 1GUKA 3TUEA 1JLVA 2VD0A 3RPPA 3HZ8A 1U88A 1J9BA 1TJDA 6GSSA 4OWYA 2J23A 4NV2A 5HR1A 3GV1A 4KCEA 1Z7PA 2YOIA 4CDOA 3P7XA 2YJ7A 1XW6A 1VF4A 2C1YA 2FLSA 5F8BA 1F9MA 4BVXB 3EWLA 4TOPA 1A0FA 1M99A 4ZB6A 1S3DA 3MYDA 1J08A 1EEJA 3VWVA 1JFUA 3F9UA 1TW9A 1EOGA 3M0FA 4V1Ap 2YWNA 2IMDA 1ZYPA 4XS4A 4WR5A 1SL2B 2R4VA 5AGYA 4RI7A 1K0NA 1I9DA 2DJ2A 3ZRDA 1ERUA 3DVWA 3MDKA 5AN1A 3SWLA 4MLYA 1SU9A 5HQPA 5IIZA 4MNNA 2K8VA 5C04A 1A2JA 5FT3A 2C3NA 2JZSA 2DKIA 1XCCA 2H73A 4V2LA 4JZQA 1MDKA 3RBTA 2VAFA 1TRUA 2WZ9A 2X99A 4K7NA 3FRCA 4QL9A 2HRFA 1ZZYA 3BBYA 3A3TA 2X8GA 5KEJA 5H5QA 4BWQA 4AJ6A 1PKWA 2P5RA 2FNOA 2L5LA 5IOWA 4O92A 2OBIA 1AXDA 2I81A 2XPEA 4YQMA 2NDOA 1O85A 4TN8A 4MH3A 5J9CA 3L4NA 5IMVA 2LQOA 2B7KA 2B6MA 4BL7B 1ST9A 1K3OA 5ECHB 5DJMA 2GSSA 1F2EA 1A23A 2GSRA 4RQXA 4OCEA 1MD3A 1UN2A 1J0FA 1KEBA 2V6OA 4DSQA 4G10A 4FIWA 3I69A 1QUWA 5GZZB 2H6XA 1O6JA 1SKWB 1OC8A 2IL3A 4LA1A 1BG5A 4EIQA 1B8XA 1EV4A 2IN3A 1OE7A 5GSSA 2HRKA 2PBJA 1EZKA 3IR4A 4F2IA 4NMUA 1K0BA 3GA4A 3CRTA 1YEPA 4DSSA 3I9V2 1T7PB 3QAWA 2LEGA 2YWIA 1XWGA 3GX0A 1PL2A 4MPFA 1SJZA 5LCZA 5ID2B 3GTUB 1A2LA 2D2ZA 1EWXA 1A2MA 5JCUA 2A2PA 2GVPA 3KMOA 3ZYWA 1X5DA 3ME8A 2VM1A 4KCAA 5IMZA 3A5WA 2YZHA 4RI6A 3WGXA 4GCIA 2WRTA 3HVSA 3UEMA 3JCML 2F3MA 2YJHA 3TKSE 4PXOA 3CTFA 1T4YA 4EDYA 4ICYA 2MMNA 1AQVA 2F9SA 5HR2A 2M80A 3Q6OA 3DD3A 3VFIA 2H0HA 2QC7A 4HDEA 2H1AA 1X9WB 4KNDA 1N2AA 1XVWA 2GQMA 1X9SB 4EXJA 4PUAA 5FHIA 4MDCA 3W8JA 1QK8A 4ZBDA 1BJXA 4L0WA 4G2EA 1U87A 2LRCA 3TCOA 3ZL5A 3KTLA 1GSUA 4ECCA 3W6GA 4TXVA 5JCWA 1CQHA 3BOAA 3MIXA 5CRDA 2L57A 2X64A 4O5RA 4G9HA 5KN2A 3TKQA 2P0GA 3R2QA 4K7OA 1AQXA 1XXUA 3BD2A 1KNGA 4K2DA 3E9JB 4KX4A 1GLPA 3LORA 1O81A 5HFGA 4TR1B 1QGVA 4D73B 3LJRA 2JZRA 4MJAA 2IMKA 2VCTA 3MWHA 1Q98A 2JADA 1GTUA 4EO3A 3H79A 3QAVA 3LWAA 4J2FA 2HSHA 2VLVA 1QFNA 1MEKA 4I6XA 2KHPA 5D73A 2H0IA 3E3EA 2G0FA 4XS1A 4ECIA 3QOUA 2V6KA 1SYRA 1JLWA 4MF6A 3KD0A 4NHZA 4X4JA 5DQYA 4MCUA 4OFMA 3RAZA 1XOAA 2L4CA 2AHEA 1R5PA 1TXXA 3ZFLA 1XFLA 4K5RA 5GSTA 3Q74A 1UVZA 1X5CA 2AJQB 4IBPA 2R37A 1MDIA 4TR4A 6GSVA 4BVYA 2OACA 3RHBA 1V57A 3FR6A 2F8AA 3FKFA 2HZEB 1LBKA 2CV4A 1GSFA 2LUSA 4OFTA 1TRWA 1M0UA 2PUKC 1SKRB 3G9BA 2B1KA 2GLRA 2HRNA 2YWOA 2CZ2A 1BAYA 3IC4A 1SK2A 1M7TA 1WRYA 2B7JA 2P31A 4OD7A 3HYPA 4X1UA 2O87A 3KM6A 2A2SA 3KP8A 4L5OA 3TJBA 1GSSA 4IGJA 2DIZA 11GSA 4MF7A 3M3MA 1JZRA 2K9FA 3GURA 3IA1A 1GSDA 1EOHA 1GNWA 2LRTA 5DAKA 1C72A 5IM9A 3EYTA 3TJJA 4TKYA 5GAPD 5H5SA 5E59A 4PNGA 2R5GA 4G0KA 4Q5FA 1WJKA 2EIRA 2MMAA 1X0RA 2BTOT 3C1RA 1OVNA 3ERGA 1BQ7A 3KXOA 1TK0B 4L5LA 4POBA 2OE0A 5G31A 1W4VA 2GQKA 3UBLA 1PGTA 3ZTLA 4XCSA 1FVKA 4TXOB 2R0GA 3PPUA 2YANA 3GMFA 1K0MA 1XPVA 1Z5YE 5L71A 1FB6A 1YEXA 5DALA 2GT5A 3A2VA 3M8NA 2WGRA 3GSTA 4OO4A 1KBNA 4ZB8A 3WGEA 2N5AA 2MZCA 1V2AA 5COHA 1FAAA 5CYYA 1WPIA 1NHYA 3GL3A 4DVCA 4IKHA 2OA7A 2QSIA 2VCZA 2FY6A 1Y6EA 4N11A 4JE1A 5A5KA 2LS5A 1B48A 5ELGA 3CSHA 4ZL9A 3HXSA 3FZ4A 4ZBAA 1SK0A 2MMZA 4ULXA 1TK5B 2H30A 4HZ4A 3GRXA 1FG4A 3DWVA 1B4QA 3IHQA 1Q4JA 2PN8A 1WMJA 4MJEA 2FWGA 2GGTA 3D21A 5B6NA 4RUVA 1RQMA 5B8AA 1XWAA 3TRXA 4TVEA 1K0OA 6GSYA 2DSAA 1MDJA 2LJAA 1NHOA 2C0FA 2C0GA 1ZOFA 5DVBA 1GUHA 4JU5A 5J5NA 4RQRA 4NWYA 3HD5A 1Z9HA 20GSA 3LSZA 2BJXA 3SBCA 2JSZA 4GF0A 18GSA 3UJ1A 22GSA 2I9HA 4EC0A 4CY8A 3KIJA 4ML6A 4WF5A 4HOJA 3IHGA 4WBJA 5ELAA 2L6DA 1XVQA 3WGDA 1OYJA 3L9VA 3GIXA 1SJIA 4Q5RA 4KAEA 3HVVA 4PNFA 2YWMA 3FZAA 3GHAA 5DBQA 2C0EA 8GSSA 2CA8A 5C00A 3FEUA 2J9HA 2K6VA 2R0CA 3ERFA 3VI5A 4KW6A 2C4JA 3NIVA 2GZPA 4ZXGA 4KE3A 2VL2C 2XC2A 3ZIJA 1XWKA 2C80A 2VCWA 4TR3A 3H8QA 2PMTA 2E2MA 3HKRA 4O5QA 3A2WA 1HQOA 4YKGA 1FVJA 2HT9A 2A2RA 4IVFA 5KN3A 1AQWA 1TOFA 5HFKA 3UIWA 1GL8A 1O7UA 1GNEA 2H1DA 1ZYEA 4LL1B 1V98A 3F4TA 2O8VB 4F9ZA 1B4PA 3LEFA 1HNBA 5IOXA 3IXRA 2FUG2 4MABA 4E8EA 3NOFA 1FW1A 1T3BA 2IFQB 4MP4A 2VL3A 4IJIA 3D0ZA 1VGLA 1YKAA 3ZZXA 2HI7A 4BWSA 13GSA 2HNLA 1PMTA 2CT6A 3D4MA 2VLUA 3EPTA 1ZGNA 5D9XA 4FYUA 2E7PA 5CRWA 2V1MA 2N5BA 1XZOA 5AISA 4GQFA 3Q18A 1K3LA 1XWCA 1F6MC 4DSRA 2EIOA 3U5RE 3QD9A 5JWQB 1Z7RA 2TRXA 4OO5A 4O32A 1TI1A 2JSYA 6GSXA 1V58A 2ON5A 3F63A 3FMWA 2QA1A 2MMOA 1GSEA 2WULA 1PD21 1ZCPA 2FCHA 4ZBBA 2OE3A 3CSIA 4HU9A 3AY8A 3TKSC 3LYKA 1HYUA 1ERWA 2LNTA 3QMXA 1DSBA 1R5AA 4IHUA 1ACVA 3HHVA 1K3YA 1UC7A 4K8MA 2H71A 1PSQA 3L78A 1EEMA 3TJFA 3IK7A 1EV9A 1MD4A 1NSWA 2H6ZA 1XW5A 3FR3A 4CHSA 1ZYQB 1F3BA 2E2GA 4Z7XA 1THOA 1ML6A 1K0CA 1TI3A 3TRPA 4E8HA 1X5EA 2DJKA 3H4KA 2UZ8A 3GKMA 4K5SA 3EE2A 2F8FA 4K1FA 2H72A 3G7IA 3QPMA 1M2DA 4KDXA 3QFBC 4KSMA 2B5YA 1OC3A 2XBQA 2IPAA 2QA2A 1XOBA 1N8JA 4I2UA 4BVXA 5DCGA 3IOSA 3KJYA 3GX8A 4TR0A 4O7HA 4HZ2A 3FYGA 1A8YA 2ZCTA 2ZUPA 2DIYA 1YF0A 5ABRA 2R0PA 3DGQA 2LNSA 5DJLA 4TRXA 4IP6A 3VWWA 5JCGA 2VL9A 1WE0A 3QCPA 4WBRD 2GSTA 5IQYA 1OAZA 3APSA 3C71A 3TJKA 4WR4A 4ECBA 5D93A 4MJCA 4WXTA 4JBBA 2BMXA 3F6DA 2H19A 3UOMA 4XRAA 5ECKB 3GUSA 1A0RP 4J56E 1S3CA 3UL3A 2VL2A 1G7OA 2HLSA 1OC9B 4JR4A 5D96A 2REMA 4MZWA 1YY7A 2FWHA 4EKZA 2DJ3A 3O3TA 1XBSA 2HZFA 4Z2UA 1X9MB 2TRCP 2X8HA 4K0NA 1TRVA 1GRXA 4BPYA 3LQ7A 1EP8A 4LL4B 3ZMLA 2WFCA 3US3A 2V41A 2H1BA 1H75A 2CX4A 4EF0A 5ECRB 1ERVA 4Z2TA 4GRFA 4HJ2A 2YV7A 3FHKA 3EU3A 1GSQA 1PN0A 4TW5A 2O89A 3CBUA 4USSA 4BL7A 3IV4A 2FA4A 4PTSA 1ILOA 3HZ4A 4ID0A 4IP1A 2AV4A 4FO5A 3ZREA 3M9JA 4N10A 3HY2A 2HSMA 3VPTA 2I4AA 3QFAC 2ALBA 2A4VA 1DUGA 3DRNA 4KUNA 4FYBA 3HJOA 5D9VA 2WJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7Y k;  2LJR A;  3F4S A;  3IE3 A;  2WB9 A;  1THX A;  4IQ1 A;  1NW2 A;  3DKS A;  5ECN B;  5IMA A;  4IS0 A;  1T8E B;  3APO A;  3WT2 A;  1E6B A;  3BCK A;  4KSO A;  4PQH A;  1YDK A;  5B6M A;  4HS1 A;  3TJG A;  1WP0 A;  3LGC A;  3TKS A;  5ID2 A;  3RDW A;  3GTU A;  3HCZ A;  2DJJ A;  1R26 A;  1SL1 B;  2KP1 A;  3UAR A;  3GN3 A;  3S9F A;  2G2Q A;  4HEA 2;  2LV3 A;  2R6K A;  4XS4 B;  2LTK A;  4XS6 A;  2K18 A;  1SD9 A;  4L0U A;  2H01 A;  14GS A;  3EMP A;  4KDU A;  4DEJ A;  4LMV A;  4NV5 A;  5F07 A;  2FHE A;  3F3R A;  1TRS A;  1FOV A;  5A4V A;  3TKR A;  4N0Z A;  3WT1 A;  3BCI A;  4XIH A;  3L0H A;  2YZU A;  2KUC A;  1VF2 A;  3KEB A;  1ABA A;  3HA9 A;  5IPG A;  3TOU A;  4KGI A;  3GYK A;  2WCI A;  2C8U A;  2PVQ A;  1DE1 A;  2OKA A;  4ZB9 A;  1DE2 A;  2V32 A;  1EGO A;  2NBS A;  4KDY A;  4POL A;  3J7Y b;  2NPB A;  3GFK A;  3IDV A;  5LD0 A;  1BX9 A;  1B9X C;  1OKD A;  1KTE A;  1TU7 A;  4GQC A;  2JU5 A;  2KP2 A;  3I6A A;  2MBT A;  1FHE A;  1RW1 A;  5AIV A;  2VCQ A;  3NZN A;  2GT6 A;  4V2N A;  1XW9 A;  4PUF C;  5HR0 A;  1QXH A;  1SK1 A;  1VF3 A;  4AF2 A;  4OMV A;  1CQG A;  3VWU A;  3L9S A;  3A2X A;  1T4Z A;  4BA7 A;  5B8B A;  3EUR A;  1AIU A;  3P90 A;  1ZL9 A;  4MH2 A;  3ERW A;  5A4U A;  5AIX A;  3DYR A;  1AC1 A;  2NTO A;  5G5F A;  4TR1 A;  1IYI A;  1R7H A;  3F6F A;  4GXZ A;  4D73 A;  2RUF A;  4ZL7 A;  1UA5 A;  2ON7 A;  5CRE A;  4K6X A;  2GSQ A;  4MZC A;  1F3A A;  3VPQ A;  1W89 A;  3ED3 A;  3U6V A;  3TOT A;  1SEN A;  6GSW A;  4IJ3 A;  3UVT A;  1A8L A;  4CW9 A;  2XBI A;  2O7K A;  4WEY A;  4MPG A;  5DCH A;  3LG6 A;  2Z9S A;  5B7C A;  1H4O A;  4IQA A;  5JWO B;  5J3R A;  4F82 A;  4MA9 A;  3MNG A;  2HYX A;  3CXG A;  1YZX A;  1SJ6 A;  4I5Q A;  2GQL A;  5EPF A;  1O8X A;  3KZQ A;  5EL8 A;  1I5G A;  4GSN A;  4MMM A;  5ENU A;  2DBC A;  1YQ1 A;  2YCD A;  4MZB A;  3F3Q A;  1OE8 A;  2B1L A;  2VCX A;  3N5O A;  2RM5 A;  5IO0 A;  2HXK A;  2I3Y A;  1XWB A;  2HZE A;  1PN9 A;  5ECL B;  5H5R A;  1TU8 A;  2VCV A;  2KOK A;  4JRR A;  3CMI A;  4ZL8 A;  1GLQ A;  4FH8 A;  3WD6 A;  3V1W A;  5KN0 A;  3VLN A;  5IMD A;  3EC3 A;  3O6T A;  5CRH A;  1G6Y A;  4MJB A;  12GS A;  4FYC A;  4ZIL A;  2RM6 A;  3DEX A;  4ACS A;  4K0G A;  4GST A;  1ON4 A;  4POK A;  2WDU A;  4K9Z A;  3CSJ A;  1SKS B;  3ZVJ D;  1OKT A;  4F03 A;  2RLI A;  3H1N A;  1U3A A;  5ECQ B;  2FWE A;  1SD8 A;  4WET A;  3KP9 A;  1V9W A;  3IK9 A;  1FB0 A;  4N0V A;  3DIE A;  3IAM 2;  4J57 E;  1ZMA A;  3TGZ A;  3DML A;  5IMF A;  3IPZ A;  1A24 A;  2R2J A;  1LJR A;  3RHC A;  1PX6 A;  1AW9 A;  1SL0 B;  3GL5 A;  2PVO C;  3CYN A;  1BED A;  2VO4 A;  2CVD A;  4AJ7 A;  4TXO A;  3EU4 A;  2AB6 A;  2QKE A;  2DML A;  2LKU A;  1M2A A;  1WOU A;  3K8N A;  1YJ6 A;  1O73 A;  2CX3 A;  1GH2 A;  4I8B A;  4MK3 A;  3IRA A;  3GSS A;  1YF1 A;  3P2A A;  2ZNM A;  3QDN A;  5J4U A;  1M9A A;  5D9W A;  3EVI A;  3CTG A;  2GS3 A;  3IBH A;  1PQN A;  1PL1 A;  2CVK A;  3D6I A;  5EY6 A;  2MYG A;  3APQ A;  2H76 A;  3RPN A;  2VIM A;  3E0U A;  4PGT A;  1SYX A;  2IMF A;  2IMI A;  3ZFB A;  2N5F A;  4NHW A;  2M46 A;  4POM A;  2ES7 A;  4KB3 A;  2B3S A;  3BJ5 A;  3KH9 A;  5IPH A;  2IJY A;  4OFN A;  4F0B A;  2VLT A;  4JED A;  3O76 A;  4HQZ A;  2MBS A;  4ISD A;  2YN1 A;  2H66 A;  5IO2 A;  1EP7 A;  2C3T A;  2L6C A;  3VWX A;  3EIN A;  2X8C A;  3M9K A;  2VOC A;  1T1V A;  2KLX A;  2PER A;  4I2T A;  2WS2 A;  4Q5Q A;  4EL1 A;  2VD1 A;  4IW9 A;  2JAC A;  3ZMK A;  1Z6N A;  3FR9 A;  4IN0 A;  4YAV A;  5HR3 A;  3PGT A;  1M9B A;  3HVX A;  2K8S A;  1G7E A;  2YNX A;  1U6T A;  2HE3 A;  4PQI A;  2H0G A;  4X43 A;  1AUC A;  2TIR A;  3C8E A;  5ECO B;  3HJP A;  4YQV A;  3F8U A;  4HU7 A;  4NAX A;  3UVH A;  3GNJ A;  2EC4 A;  3GKK A;  4LMW A;  2DMM A;  1WWJ A;  2M72 A;  2L4Q A;  5DAK B;  1O8W A;  2LJK A;  4IEL A;  3ZIV A;  4XHM A;  2OE1 A;  3I43 A;  5FWG A;  2OJL A;  3TB2 A;  1GWC A;  1G0T A;  2IME A;  1TTZ A;  3FW2 A;  5ECS A;  1WIK A;  4HUA A;  1JZW A;  19GS A;  5G2Z A;  3TRQ A;  2DJ1 A;  2OAD A;  3PH9 A;  4QQ7 A;  2H1G A;  5JWR B;  1EGR A;  6GSU A;  1PRX A;  1HNC A;  3ISO A;  4KH7 A;  3TDG A;  3D4T A;  5EVO A;  5CNW A;  4V1A g;  3G7Y A;  4AJ8 A;  3IAS 2;  4ZIJ A;  4PUR A;  1LU4 A;  2AUV A;  3F4R A;  1RK4 A;  2AAW A;  3DXB A;  2P5Q A;  4P3Y B;  2PU9 C;  2B5E A;  4GSS A;  3HJM A;  5IMC A;  4LLR A;  1MTC A;  5DAL B;  3OR5 A;  3FZ9 A;  4I97 A;  3Q19 A;  5HFI A;  5G5E A;  2LQQ A;  1G6W A;  2F51 A;  3FZ5 A;  17GS A;  3H93 A;  4NPB A;  1JZO A;  2JZT A;  5DDL A;  1S3A A;  2V2G A;  5ECM B;  2IFQ A;  2E0Q A;  5F0G A;  4N30 A;  1R4W A;  3LXT A;  4YH2 A;  3F0I A;  2HFD A;  3FY7 A;  2JL4 A;  4GTU A;  1IYH A;  5CRG A;  4HJM A;  2H8L A;  2LST A;  1VF1 A;  2O85 A;  1TK8 B;  1GTA A;  2H6Y A;  2DLX A;  3ME7 A;  1VRS D;  10GS A;  4OCF A;  4WF4 A;  1GTB A;  1JHB A;  2GTU A;  5ECI B;  4YQU A;  3GKX A;  4JR6 A;  4EVM A;  5G1L A;  2CZ3 A;  2FWF A;  4NXI A;  2AYT A;  2PPT A;  3D22 A;  1XIY A;  3PIN A;  2CQ9 A;  2C3Q A;  3WYW A;  4L8E A;  2GDR A;  3MAK A;  6GST A;  5J9B A;  2QGV A;  2H70 A;  2DJ0 A;  3C73 A;  1U3I A;  3UBK A;  3P8W A;  4PX1 A;  3KTB A;  3UMA A;  1PA3 A;  3TKP A;  16GS A;  1B9Y C;  2FA8 A;  4KA0 A;  1YKC A;  1BYE A;  1K0A A;  3HDC A;  5E4W A;  5G30 A;  3VK9 A;  1GTI A;  1GUM A;  3QR6 A;  3D5J A;  3CRU A;  1ERT A;  1AAZ A;  2IWT A;  3UAP A;  1HD2 A;  1K0D A;  4EE0 A;  4F0C A;  3VUR A;  3M1G A;  1USB A;  4XTS A;  2HSY A;  2RUE A;  2R3X A;  4ILF A;  3KGK A;  4HQS A;  4HI7 A;  1GUL A;  1Y25 A;  5D8I A;  3LYP A;  2H74 A;  4H86 A;  4XRD A;  1TKD B;  2GZZ A;  2L5O A;  3KCM A;  7GSS A;  1F37 A;  1TDI A;  2H75 A;  3MSZ A;  5A4W A;  2IIY A;  2VUP A;  4Q5N A;  4ECJ A;  5CP1 A;  1QMV A;  4PQ1 A;  1QQ2 A;  4K7I A;  1M2B A;  5D9T A;  4V2M A;  2PGT A;  4EDZ A;  5J41 A;  2XPD A;  2OBK A;  3VI7 A;  4ML1 A;  1FO5 A;  3C1S A;  3ZVJ A;  3N9J A;  3PR8 A;  3GH9 A;  2L59 A;  5G1K A;  4EUY A;  3W8S A;  4GLT A;  1URM A;  3EMX A;  4MF5 A;  3DVX A;  2YPM A;  5LNK e;  1DBY A;  2CVB A;  1GP1 A;  2GZY A;  2B5X A;  1E2Y A;  2C0D A;  3L9U A;  1PX7 A;  5INY A;  5DQS A;  2CAI A;  3GH6 A;  2FGX A;  3LXZ A;  3KMN A;  1OC9 A;  3QAG A;  3C7M A;  5F05 A;  1GSY A;  3ZLP A;  2DC5 A;  3LFL A;  2I1U A;  4WKW A;  2CAQ A;  4X0X A;  5CAX A;  2NVL A;  3G7J A;  4AGS A;  2FD3 A;  4G19 A;  1HNA A;  2LRN A;  1Z6M A;  4GWR A;  3ZIT A;  5GAN D;  1PKZ A;  2YV9 A;  4QL7 A;  1V40 A;  3FK8 A;  9GSS A;  1NM3 A;  2PWJ A;  2XHF A;  5CO3 A;  2YP6 A;  5ECP B;  2EIQ A;  5KN1 A;  1T00 A;  4DSS B;  4YAP A;  3KH7 A;  2VM2 A;  1TP9 A;  2RII A;  3GKN A;  5F06 A;  1Z3E A;  1JZD A;  1GUK A;  3TUE A;  1JLV A;  2VD0 A;  3RPP A;  3HZ8 A;  1U88 A;  1J9B A;  1TJD A;  6GSS A;  4OWY A;  2J23 A;  4NV2 A;  5HR1 A;  3GV1 A;  4KCE A;  1Z7P A;  2YOI A;  4CDO A;  3P7X A;  2YJ7 A;  1XW6 A;  1VF4 A;  2C1Y A;  2FLS A;  5F8B A;  1F9M A;  3EWL A;  1A0F A;  4TOP A;  1M99 A;  4ZB6 A;  1S3D A;  1J08 A;  1EEJ A;  3VWV A;  1JFU A;  3F9U A;  1TW9 A;  1EOG A;  3M0F A;  4V1A p;  2YWN A;  2IMD A;  4XS4 A;  4WR5 A;  1SL2 B;  2R4V A;  5AGY A;  4RI7 A;  1K0N A;  1I9D A;  2DJ2 A;  3ZRD A;  1ERU A;  3DVW A;  3MDK A;  5AN1 A;  3SWL A;  4MLY A;  1SU9 A;  5HQP A;  5IIZ A;  2K8V A;  5C04 A;  1A2J A;  5FT3 A;  2C3N A;  2JZS A;  1XCC A;  2H73 A;  4V2L A;  4JZQ A;  1MDK A;  3RBT A;  2VAF A;  1TRU A;  2WZ9 A;  2X99 A;  4K7N A;  3FRC A;  4QL9 A;  2HRF A;  1ZZY A;  3BBY A;  3A3T A;  2X8G A;  5KEJ A;  5H5Q A;  4BWQ A;  4AJ6 A;  1PKW A;  2P5R A;  2FNO A;  2L5L A;  5IOW A;  4O92 A;  2OBI A;  1AXD A;  2I81 A;  2XPE A;  4YQM A;  2NDO A;  1O85 A;  4TN8 A;  4MH3 A;  5J9C A;  3L4N A;  5IMV A;  2LQO A;  2B7K A;  2B6M A;  1ST9 A;  1K3O A;  5ECH B;  5DJM A;  2GSS A;  1F2E A;  1A23 A;  2GSR A;  4RQX A;  4OCE A;  1MD3 A;  1UN2 A;  1J0F A;  1KEB A;  2V6O A;  4DSQ A;  4G10 A;  4FIW A;  3I69 A;  1QUW A;  5GZZ B;  2H6X A;  1O6J A;  1SKW B;  1OC8 A;  2IL3 A;  4LA1 A;  1BG5 A;  1B8X A;  1EV4 A;  2IN3 A;  1OE7 A;  5GSS A;  2PBJ A;  1EZK A;  3IR4 A;  4F2I A;  4NMU A;  1K0B A;  3GA4 A;  3CRT A;  1YEP A;  4DSS A;  3I9V 2;  1T7P B;  3QAW A;  2LEG A;  2YWI A;  1XWG A;  3GX0 A;  1PL2 A;  4MPF A;  1SJZ A;  5LCZ A;  5ID2 B;  3GTU B;  1A2L A;  2D2Z A;  1EWX A;  1A2M A;  5JCU A;  2GVP A;  3KMO A;  3ZYW A;  1X5D A;  3ME8 A;  2VM1 A;  4KCA A;  5IMZ A;  3A5W A;  2YZH A;  4RI6 A;  3WGX A;  4GCI A;  2WRT A;  3HVS A;  3UEM A;  3JCM L;  2F3M A;  2YJH A;  3TKS E;  4PXO A;  3CTF A;  1T4Y A;  4EDY A;  2MMN A;  1AQV A;  2F9S A;  5HR2 A;  2M80 A;  3Q6O A;  3DD3 A;  3VFI A;  2H0H A;  2QC7 A;  4HDE A;  2H1A A;  1X9W B;  4KND A;  1N2A A;  1XVW A;  2GQM A;  1X9S B;  4EXJ A;  4PUA A;  5FHI A;  4MDC A;  3W8J A;  1QK8 A;  4ZBD A;  1BJX A;  4L0W A;  4G2E A;  1U87 A;  2LRC A;  3TCO A;  3ZL5 A;  3KTL A;  1GSU A;  4ECC A;  3W6G A;  4TXV A;  5JCW A;  1CQH A;  3BOA A;  5CRD A;  2L57 A;  2X64 A;  4O5R A;  4G9H A;  5KN2 A;  3TKQ A;  2P0G A;  3R2Q A;  4K7O A;  1AQX A;  1XXU A;  3BD2 A;  1KNG A;  4K2D A;  3E9J B;  4KX4 A;  1GLP A;  3LOR A;  1O81 A;  5HFG A;  4TR1 B;  1QGV A;  4D73 B;  3LJR A;  2JZR A;  4MJA A;  2IMK A;  2VCT A;  3MWH A;  1Q98 A;  2JAD A;  1GTU A;  4EO3 A;  3H79 A;  3QAV A;  3LWA A;  4J2F A;  2HSH A;  2VLV A;  1QFN A;  1MEK A;  4I6X A;  2KHP A;  5D73 A;  2H0I A;  3E3E A;  2G0F A;  4XS1 A;  4ECI A;  3QOU A;  2V6K A;  1SYR A;  1JLW A;  4MF6 A;  3KD0 A;  4NHZ A;  5DQY A;  4MCU A;  4OFM A;  3RAZ A;  1XOA A;  2L4C A;  2AHE A;  1R5P A;  1TXX A;  3ZFL A;  1XFL A;  5GST A;  3Q74 A;  1UVZ A;  1X5C A;  2AJQ B;  4IBP A;  2R37 A;  1MDI A;  4TR4 A;  6GSV A;  4BVY A;  2OAC A;  3RHB A;  1V57 A;  3FR6 A;  2F8A A;  3FKF A;  2HZE B;  1LBK A;  2CV4 A;  1GSF A;  2LUS A;  4OFT A;  1TRW A;  1M0U A;  2PUK C;  1SKR B;  3G9B A;  2B1K A;  2GLR A;  2HRN A;  2YWO A;  2CZ2 A;  1BAY A;  3IC4 A;  1SK2 A;  1M7T A;  1WRY A;  2B7J A;  2P31 A;  4OD7 A;  3HYP A;  4X1U A;  2O87 A;  3KM6 A;  2A2S A;  3KP8 A;  4L5O A;  3TJB A;  1GSS A;  4IGJ A;  2DIZ A;  11GS A;  4MF7 A;  3M3M A;  1JZR A;  2K9F A;  3GUR A;  3IA1 A;  1GSD A;  1EOH A;  1GNW A;  2LRT A;  5DAK A;  1C72 A;  5IM9 A;  3EYT A;  3TJJ A;  4TKY A;  5GAP D;  5H5S A;  5E59 A;  4PNG A;  2R5G A;  4Q5F A;  1WJK A;  2EIR A;  2MMA A;  1X0R A;  2BTO T;  3C1R A;  1OVN A;  3ERG A;  1BQ7 A;  3KXO A;  1TK0 B;  4L5L A;  4POB A;  2OE0 A;  5G31 A;  1W4V A;  2GQK A;  3UBL A;  1PGT A;  3ZTL A;  4XCS A;  1FVK A;  4TXO B;  2YAN A;  3GMF A;  1K0M A;  1XPV A;  1Z5Y E;  5L71 A;  1FB6 A;  1YEX A;  5DAL A;  2GT5 A;  3A2V A;  3M8N A;  2WGR A;  3GST A;  4OO4 A;  1KBN A;  4ZB8 A;  3WGE A;  2N5A A;  2MZC A;  1V2A A;  5COH A;  1FAA A;  5CYY A;  1WPI A;  1NHY A;  3GL3 A;  4DVC A;  4IKH A;  2OA7 A;  2QSI A;  2VCZ A;  2FY6 A;  1Y6E A;  4N11 A;  4JE1 A;  5A5K A;  2LS5 A;  1B48 A;  5ELG A;  3CSH A;  4ZL9 A;  3HXS A;  3FZ4 A;  4ZBA A;  1SK0 A;  2MMZ A;  4ULX A;  1TK5 B;  2H30 A;  4HZ4 A;  3GRX A;  1FG4 A;  3DWV A;  1B4Q A;  3IHQ A;  1Q4J A;  2PN8 A;  1WMJ A;  4MJE A;  2FWG A;  2GGT A;  3D21 A;  5B6N A;  4RUV A;  1RQM A;  5B8A A;  1XWA A;  3TRX A;  4TVE A;  1K0O A;  6GSY A;  2DSA A;  1MDJ A;  2LJA A;  1NHO A;  2C0F A;  2C0G A;  1ZOF A;  5DVB A;  1GUH A;  4JU5 A;  5J5N A;  4RQR A;  4NWY A;  3HD5 A;  1Z9H A;  20GS A;  3LSZ A;  2BJX A;  3SBC A;  2JSZ A;  4GF0 A;  18GS A;  3UJ1 A;  22GS A;  2I9H A;  4EC0 A;  3KIJ A;  4ML6 A;  4WF5 A;  4HOJ A;  4WBJ A;  5ELA A;  2L6D A;  1XVQ A;  3WGD A;  1OYJ A;  3L9V A;  3GIX A;  1SJI A;  4Q5R A;  4KAE A;  3HVV A;  4PNF A;  2YWM A;  3FZA A;  3GHA A;  5DBQ A;  2C0E A;  8GSS A;  2CA8 A;  5C00 A;  3FEU A;  2J9H A;  2K6V A;  3ERF A;  3VI5 A;  4KW6 A;  2C4J A;  3NIV A;  2GZP A;  4ZXG A;  4KE3 A;  2VL2 C;  2XC2 A;  3ZIJ A;  1XWK A;  2C80 A;  2VCW A;  4TR3 A;  3H8Q A;  2PMT A;  2E2M A;  3HKR A;  3A2W A;  1HQO A;  1FVJ A;  2HT9 A;  2A2R A;  4IVF A;  5KN3 A;  1AQW A;  1TOF A;  5HFK A;  3UIW A;  1GL8 A;  1O7U A;  1GNE A;  2H1D A;  1ZYE A;  4LL1 B;  1V98 A;  3F4T A;  2O8V B;  4F9Z A;  1B4P A;  3LEF A;  1HNB A;  5IOX A;  3IXR A;  2FUG 2;  4MAB A;  4E8E A;  3NOF A;  1FW1 A;  1T3B A;  2IFQ B;  4MP4 A;  2VL3 A;  4IJI A;  3D0Z A;  1VGL A;  1YKA A;  3ZZX A;  2HI7 A;  4BWS A;  13GS A;  2HNL A;  1PMT A;  2CT6 A;  3D4M A;  2VLU A;  1ZGN A;  5D9X A;  4FYU A;  2E7P A;  5CRW A;  2V1M A;  2N5B A;  1XZO A;  5AIS A;  4GQF A;  3Q18 A;  1K3L A;  1XWC A;  1F6M C;  4DSR A;  2EIO A;  3U5R E;  3QD9 A;  5JWQ B;  1Z7R A;  2TRX A;  4OO5 A;  4O32 A;  1TI1 A;  2JSY A;  6GSX A;  1V58 A;  2ON5 A;  3F63 A;  2MMO A;  1GSE A;  2WUL A;  1PD2 1;  1ZCP A;  2FCH A;  4ZBB A;  2OE3 A;  3CSI A;  4HU9 A;  3AY8 A;  3TKS C;  3LYK A;  1HYU A;  1ERW A;  2LNT A;  3QMX A;  1DSB A;  1R5A A;  4IHU A;  1ACV A;  3HHV A;  1K3Y A;  1UC7 A;  4K8M A;  2H71 A;  1PSQ A;  3L78 A;  1EEM A;  3TJF A;  3IK7 A;  1EV9 A;  1MD4 A;  1NSW A;  2H6Z A;  1XW5 A;  3FR3 A;  4CHS A;  1ZYQ B;  1F3B A;  2E2G A;  4Z7X A;  1THO A;  1ML6 A;  1K0C A;  1TI3 A;  3TRP A;  4E8H A;  1X5E A;  2DJK A;  3H4K A;  3GKM A;  3EE2 A;  2F8F A;  4K1F A;  2H72 A;  3G7I A;  3QPM A;  1M2D A;  4KDX A;  3QFB C;  4KSM A;  2B5Y A;  1OC3 A;  2XBQ A;  2IPA A;  1XOB A;  1N8J A;  4I2U A;  4BVX A;  5DCG A;  3IOS A;  3KJY A;  3GX8 A;  4TR0 A;  4O7H A;  4HZ2 A;  3FYG A;  1A8Y A;  2ZCT A;  2ZUP A;  2DIY A;  1YF0 A;  5ABR A;  3DGQ A;  2LNS A;  5DJL A;  4TRX A;  4IP6 A;  3VWW A;  5JCG A;  2VL9 A;  1WE0 A;  3QCP A;  4WBR D;  2GST A;  5IQY A;  1OAZ A;  3APS A;  3C71 A;  3TJK A;  4WR4 A;  4ECB A;  5D93 A;  4MJC A;  4WXT A;  4JBB A;  2BMX A;  3F6D A;  2H19 A;  3UOM A;  4XRA A;  5ECK B;  3GUS A;  1A0R P;  4J56 E;  1S3C A;  3UL3 A;  2VL2 A;  1G7O A;  2HLS A;  1OC9 B;  4JR4 A;  5D96 A;  2REM A;  4MZW A;  1YY7 A;  2FWH A;  4EKZ A;  2DJ3 A;  3O3T A;  1XBS A;  2HZF A;  1X9M B;  2TRC P;  2X8H A;  4K0N A;  1TRV A;  1GRX A;  4BPY A;  3LQ7 A;  1EP8 A;  4LL4 B;  3ZML A;  2WFC A;  3US3 A;  2V41 A;  2H1B A;  1H75 A;  2CX4 A;  4EF0 A;  5ECR B;  1ERV A;  4GRF A;  4HJ2 A;  2YV7 A;  3FHK A;  3EU3 A;  1GSQ A;  4TW5 A;  2O89 A;  3CBU A;  4BL7 A;  3IV4 A;  2FA4 A;  1ILO A;  3HZ4 A;  4ID0 A;  4IP1 A;  2AV4 A;  4FO5 A;  3ZRE A;  3M9J A;  4N10 A;  3HY2 A;  3VPT A;  2I4A A;  3QFA C;  2ALB A;  2A4V A;  1DUG A;  3DRN A;  4KUN A;  4FYB A;  3HJO A;  5D9V A;  2WJU A; 
#chains in the Genus database with same CATH topology
 3J7Y k;  2LJR A;  3F4S A;  3IE3 A;  2WB9 A;  1THX A;  4IQ1 A;  1NW2 A;  3DKS A;  5ECN B;  5IMA A;  4IS0 A;  1T8E B;  3APO A;  3WT2 A;  1E6B A;  3BCK A;  4KSO A;  4PQH A;  1YDK A;  5B6M A;  4HS1 A;  3TJG A;  1WP0 A;  3LGC A;  3TKS A;  5ID2 A;  3RDW A;  3GTU A;  3HCZ A;  2DJJ A;  1R26 A;  1SL1 B;  2KP1 A;  3UAR A;  3GN3 A;  3S9F A;  2G2Q A;  2DKH A;  4HEA 2;  2LV3 A;  2R6K A;  4XS4 B;  2LTK A;  4XS6 A;  2K18 A;  1SD9 A;  4L0U A;  2H01 A;  14GS A;  3EMP A;  4KDU A;  4DEJ A;  4LMV A;  4NV5 A;  5F07 A;  2FHE A;  3F3R A;  1TRS A;  1FOV A;  5A4V A;  3TKR A;  4N0Z A;  3WT1 A;  3BCI A;  4XIH A;  3L0H A;  2YZU A;  2KUC A;  1VF2 A;  3KEB A;  1ABA A;  3HA9 A;  5IPG A;  3TOU A;  4KGI A;  3GYK A;  2WCI A;  2C8U A;  2PVQ A;  1DE1 A;  2OKA A;  4ZB9 A;  1DE2 A;  2V32 A;  1EGO A;  2NBS A;  4KDY A;  4POL A;  3J7Y b;  2NPB A;  3GFK A;  3IDV A;  5LD0 A;  1BX9 A;  1B9X C;  1OKD A;  1KTE A;  1TU7 A;  4GQC A;  2JU5 A;  2KP2 A;  3I6A A;  2MBT A;  1FHE A;  1RW1 A;  5AIV A;  2VCQ A;  3NZN A;  2GT6 A;  4V2N A;  1XW9 A;  4PUF C;  5HR0 A;  1QXH A;  1SK1 A;  1VF3 A;  4AF2 A;  4OMV A;  1CQG A;  3VWU A;  4CY6 A;  3L9S A;  3A2X A;  1T4Z A;  4BA7 A;  5B8B A;  4Z2R A;  3EUR A;  5KOX A;  1AIU A;  3P90 A;  1ZL9 A;  4MH2 A;  3ERW A;  5A4U A;  5AIX A;  3DYR A;  1AC1 A;  2NTO A;  5G5F A;  4TR1 A;  1IYI A;  1R7H A;  3F6F A;  4GXZ A;  4D73 A;  2RUF A;  4ZL7 A;  1UA5 A;  2ON7 A;  5CRE A;  4K6X A;  2GSQ A;  4MZC A;  1F3A A;  3VPQ A;  1W89 A;  3ED3 A;  3U6V A;  3TOT A;  1SEN A;  6GSW A;  4IJ3 A;  3UVT A;  3R3E A;  1A8L A;  4CW9 A;  2XBI A;  2O7K A;  4WEY A;  4MPG A;  5DCH A;  3LG6 A;  2Z9S A;  5B7C A;  1H4O A;  4IQA A;  5JWO B;  5J3R A;  4F82 A;  4MA9 A;  3MNG A;  2HYX A;  3CXG A;  1YZX A;  1SJ6 A;  4A5P A;  4I5Q A;  2GQL A;  5EPF A;  1O8X A;  3KZQ A;  5EL8 A;  1I5G A;  4GSN A;  4MMM A;  5ENU A;  2DBC A;  1YQ1 A;  2YCD A;  4MZB A;  3F3Q A;  1OE8 A;  2B1L A;  2VCX A;  3N5O A;  2A4H A;  2RM5 A;  5IO0 A;  2HXK A;  2I3Y A;  1XWB A;  2HZE A;  1PN9 A;  5ECL B;  5H5R A;  1TU8 A;  2VCV A;  2KOK A;  4JRR A;  3CMI A;  4ZL8 A;  1GLQ A;  4FH8 A;  3WD6 A;  3V1W A;  5KN0 A;  3VLN A;  5IMD A;  3EC3 A;  3O6T A;  1PFO A;  5CRH A;  1G6Y A;  4MJB A;  12GS A;  4FYC A;  4ZIL A;  2RM6 A;  3DEX A;  4ACS A;  4K0G A;  4GST A;  1ON4 A;  4POK A;  2WDU A;  4K9Z A;  3CSJ A;  1SKS B;  3ZVJ D;  1OKT A;  4F03 A;  2RLI A;  3H1N A;  1U3A A;  5ECQ B;  2FWE A;  1SD8 A;  4WET A;  3KP9 A;  1V9W A;  3IK9 A;  1FB0 A;  4N0V A;  3DIE A;  3IAM 2;  4J57 E;  1ZMA A;  3LW9 A;  3TGZ A;  3DML A;  5IMF A;  3IPZ A;  1A24 A;  2R2J A;  1LJR A;  3RHC A;  1PX6 A;  1AW9 A;  1SL0 B;  5BRT A;  3GL5 A;  2PVO C;  3CYN A;  1BED A;  2VO4 A;  2X4A A;  4O5U A;  2CVD A;  4AJ7 A;  4TXO A;  3EU4 A;  2AB6 A;  2QKE A;  2DML A;  2LKU A;  1M2A A;  1WOU A;  3K8N A;  1YJ6 A;  1O73 A;  2CX3 A;  1GH2 A;  4I8B A;  4MK3 A;  3IRA A;  3GSS A;  1YF1 A;  3P2A A;  2ZNM A;  3QDN A;  5J4U A;  1M9A A;  5D9W A;  3EVI A;  3CTG A;  2GS3 A;  3IBH A;  1PQN A;  1PL1 A;  2CVK A;  3D6I A;  5EY6 A;  4G0L A;  2MYG A;  3APQ A;  2H76 A;  3RPN A;  2VIM A;  3E0U A;  4PGT A;  1SYX A;  2IMF A;  2IMI A;  3ZFB A;  2N5F A;  4NHW A;  2M46 A;  4POM A;  2ES7 A;  4KB3 A;  2B3S A;  3BJ5 A;  3KH9 A;  5IPH A;  5KOW A;  2IJY A;  4OFN A;  4F0B A;  4BVY B;  2VLT A;  4JED A;  3O76 A;  4HQZ A;  2MBS A;  4ISD A;  2YN1 A;  2H66 A;  4EIP A;  5IO2 A;  1EP7 A;  2C3T A;  2L6C A;  3VWX A;  3EIN A;  2X8C A;  3M9K A;  2VOC A;  1T1V A;  4KF9 A;  2KLX A;  2PER A;  4I2T A;  2WS2 A;  3IC8 A;  4Q5Q A;  4EL1 A;  2VD1 A;  4IW9 A;  2JAC A;  2HRA A;  4HSC X;  3ZMK A;  1Z6N A;  3FR9 A;  4IN0 A;  4YAV A;  5HR3 A;  3PGT A;  1M9B A;  3HVX A;  2K8S A;  1G7E A;  2YNX A;  1U6T A;  2HE3 A;  4PQI A;  2H0G A;  4X43 A;  1AUC A;  2TIR A;  3C8E A;  5ECO B;  3HJP A;  4YQV A;  3F8U A;  4HU7 A;  4NAX A;  3UVH A;  3GNJ A;  2EC4 A;  3GKK A;  4LMW A;  2DMM A;  1WWJ A;  2M72 A;  2L4Q A;  1O8W A;  5DAK B;  2LJK A;  4IEL A;  3ZIV A;  4XHM A;  2OE1 A;  3I43 A;  5FWG A;  2OJL A;  3TB2 A;  1GWC A;  1G0T A;  2IME A;  1TTZ A;  3FW2 A;  5ECS A;  1WIK A;  4HUA A;  1JZW A;  19GS A;  5G2Z A;  3TRQ A;  1FOH A;  2DJ1 A;  2OAD A;  3PH9 A;  4QQ7 A;  2H1G A;  5JWR B;  1EGR A;  6GSU A;  1PRX A;  1HNC A;  3ISO A;  4KH7 A;  3TDG A;  3D4T A;  5EVO A;  5CNW A;  4V1A g;  3G7Y A;  4AJ8 A;  3IAS 2;  4ZIJ A;  4PUR A;  1LU4 A;  2AUV A;  3F4R A;  1RK4 A;  2AAW A;  3DXB A;  2P5Q A;  4P3Y B;  2PU9 C;  2B5E A;  4GSS A;  3HJM A;  5IMC A;  4LLR A;  1MTC A;  5DAL B;  3OR5 A;  3FZ9 A;  4I97 A;  3Q19 A;  5HFI A;  5G5E A;  2LQQ A;  1G6W A;  2F51 A;  3FZ5 A;  17GS A;  2X49 A;  3H93 A;  4NPB A;  1JZO A;  2JZT A;  5DDL A;  1S3A A;  2V2G A;  5ECM B;  4K2X A;  3A5I A;  2IFQ A;  2E0Q A;  5F0G A;  4N30 A;  1R4W A;  3LXT A;  4YH2 A;  3F0I A;  2HFD A;  3FY7 A;  2JL4 A;  4GTU A;  1IYH A;  5CRG A;  4HJM A;  2H8L A;  2LST A;  1VF1 A;  2O85 A;  1TK8 B;  1GTA A;  2H6Y A;  2DLX A;  3ME7 A;  1VRS D;  10GS A;  4OCF A;  4WF4 A;  1GTB A;  1JHB A;  2GTU A;  5ECI B;  4YQU A;  3GKX A;  4JR6 A;  4EVM A;  5G1L A;  2CZ3 A;  2FWF A;  4NXI A;  2AYT A;  2PPT A;  3D22 A;  1XIY A;  3PIN A;  2CQ9 A;  2C3Q A;  3WYW A;  4L8E A;  2GDR A;  3MAK A;  6GST A;  5J9B A;  2QGV A;  2H70 A;  2DJ0 A;  3C73 A;  1U3I A;  3UBK A;  3P8W A;  4PX1 A;  3KTB A;  3UMA A;  1PA3 A;  3TKP A;  16GS A;  4FQU A;  1B9Y C;  2FA8 A;  4KA0 A;  1YKC A;  1BYE A;  1K0A A;  3HDC A;  5E4W A;  5G30 A;  3VK9 A;  1GTI A;  1GUM A;  3QR6 A;  3D5J A;  3CRU A;  1ERT A;  1AAZ A;  2IWT A;  3UAP A;  1HD2 A;  1K0D A;  4EE0 A;  4F0C A;  3VUR A;  3M1G A;  1USB A;  4XTS A;  2HSY A;  2RUE A;  2R3X A;  4ILF A;  3KGK A;  4HQS A;  4HI7 A;  1GUL A;  1Y25 A;  5D8I A;  3LYP A;  2H74 A;  4H86 A;  4XRD A;  1TKD B;  2GZZ A;  2L5O A;  3KCM A;  7GSS A;  1F37 A;  4G0I A;  1TDI A;  2H75 A;  3MSZ A;  5A4W A;  2IIY A;  2VUP A;  4Q5N A;  4YKF A;  4ECJ A;  5CP1 A;  1QMV A;  4PQ1 A;  1QQ2 A;  4K7I A;  1M2B A;  5D9T A;  4V2M A;  2PGT A;  4EDZ A;  5J41 A;  2XPD A;  2OBK A;  3VI7 A;  4ML1 A;  1FO5 A;  3C1S A;  3ZVJ A;  3N9J A;  3PR8 A;  3HVN A;  3GH9 A;  2L59 A;  5G1K A;  4EUY A;  3W8S A;  4GLT A;  1URM A;  3EMX A;  4MF5 A;  3DVX A;  2YPM A;  5LNK e;  1DBY A;  2CVB A;  1GP1 A;  2GZY A;  2B5X A;  1E2Y A;  2C0D A;  3L9U A;  1PX7 A;  5INY A;  5DQS A;  2CAI A;  3GH6 A;  2FGX A;  3LXZ A;  3KMN A;  1OC9 A;  3QAG A;  5BMU A;  3C7M A;  5F05 A;  1GSY A;  3ZLP A;  2DC5 A;  3LFL A;  2I1U A;  4WKW A;  2CAQ A;  4X0X A;  5CAX A;  1ZYN A;  2NVL A;  3G7J A;  4AGS A;  2FD3 A;  4G19 A;  1HNA A;  2LRN A;  1Z6M A;  4GWR A;  3ZIT A;  5GAN D;  1PKZ A;  2YV9 A;  4QL7 A;  1V40 A;  3FK8 A;  9GSS A;  1NM3 A;  2PWJ A;  2XHF A;  5CO3 A;  2YP6 A;  5ECP B;  2EIQ A;  5KN1 A;  1T00 A;  4DSS B;  4YAP A;  3KH7 A;  2VM2 A;  1TP9 A;  2RII A;  3GKN A;  5F06 A;  1Z3E A;  1JZD A;  1GUK A;  3TUE A;  1JLV A;  2VD0 A;  3RPP A;  3HZ8 A;  1U88 A;  1J9B A;  1TJD A;  6GSS A;  4OWY A;  2J23 A;  4NV2 A;  5HR1 A;  3GV1 A;  4KCE A;  1Z7P A;  2YOI A;  4CDO A;  3P7X A;  2YJ7 A;  1XW6 A;  1VF4 A;  2C1Y A;  2FLS A;  5F8B A;  1F9M A;  4BVX B;  3EWL A;  4TOP A;  1A0F A;  1M99 A;  4ZB6 A;  1S3D A;  3MYD A;  1J08 A;  1EEJ A;  3VWV A;  1JFU A;  3F9U A;  1TW9 A;  1EOG A;  3M0F A;  4V1A p;  2YWN A;  2IMD A;  1ZYP A;  4XS4 A;  4WR5 A;  1S3R A;  1SL2 B;  2R4V A;  5AGY A;  4RI7 A;  1K0N A;  1I9D A;  2DJ2 A;  3ZRD A;  1ERU A;  3DVW A;  3MDK A;  5AN1 A;  3SWL A;  4MLY A;  1SU9 A;  5HQP A;  5IIZ A;  4MNN A;  4BIK A;  2K8V A;  5C04 A;  1A2J A;  5FT3 A;  2C3N A;  2JZS A;  2DKI A;  1XCC A;  2H73 A;  4V2L A;  4JZQ A;  1MDK A;  3RBT A;  2VAF A;  1TRU A;  2WZ9 A;  2X99 A;  4K7N A;  3FRC A;  4QL9 A;  2HRF A;  1ZZY A;  3BBY A;  3A3T A;  2X8G A;  5KEJ A;  5H5Q A;  4BWQ A;  4AJ6 A;  1PKW A;  2P5R A;  2FNO A;  2L5L A;  5IOW A;  4O92 A;  2OBI A;  1AXD A;  2I81 A;  2XPE A;  4YQM A;  2NDO A;  1O85 A;  4TN8 A;  4MH3 A;  5J9C A;  3L4N A;  5IMV A;  2LQO A;  2B7K A;  2B6M A;  4BL7 B;  1ST9 A;  1K3O A;  5ECH B;  5DJM A;  2GSS A;  1F2E A;  1A23 A;  2GSR A;  4RQX A;  4OCE A;  1MD3 A;  1UN2 A;  1J0F A;  1KEB A;  2V6O A;  4DSQ A;  4G10 A;  4FIW A;  3I69 A;  1QUW A;  5GZZ B;  2H6X A;  1O6J A;  1SKW B;  1OC8 A;  2IL3 A;  4LA1 A;  1BG5 A;  4EIQ A;  1B8X A;  1EV4 A;  2IN3 A;  1OE7 A;  5GSS A;  2HRK A;  2PBJ A;  1EZK A;  3IR4 A;  4F2I A;  4NMU A;  1K0B A;  3GA4 A;  3CRT A;  1YEP A;  4DSS A;  3I9V 2;  1T7P B;  3QAW A;  2LEG A;  2YWI A;  1XWG A;  3GX0 A;  1PL2 A;  4MPF A;  1SJZ A;  5LCZ A;  5ID2 B;  3GTU B;  1A2L A;  2D2Z A;  1EWX A;  1A2M A;  5JCU A;  2A2P A;  2GVP A;  3KMO A;  3ZYW A;  1X5D A;  3ME8 A;  2VM1 A;  4KCA A;  5IMZ A;  3A5W A;  2YZH A;  4RI6 A;  3WGX A;  4GCI A;  2WRT A;  3HVS A;  3UEM A;  3JCM L;  2F3M A;  2YJH A;  3TKS E;  4PXO A;  3CTF A;  1T4Y A;  4EDY A;  4ICY A;  2MMN A;  1AQV A;  2F9S A;  5HR2 A;  2M80 A;  3Q6O A;  3DD3 A;  3VFI A;  2H0H A;  2QC7 A;  4HDE A;  2H1A A;  1X9W B;  4KND A;  1N2A A;  1XVW A;  2GQM A;  1X9S B;  1XG8 A;  4EXJ A;  4PUA A;  5FHI A;  4MDC A;  3W8J A;  1QK8 A;  4ZBD A;  1BJX A;  4L0W A;  4G2E A;  1U87 A;  2LRC A;  3TCO A;  3ZL5 A;  3KTL A;  1GSU A;  4ECC A;  3W6G A;  4TXV A;  5JCW A;  1CQH A;  3BOA A;  3MIX A;  5CRD A;  2L57 A;  2X64 A;  4O5R A;  4G9H A;  5KN2 A;  3TKQ A;  2P0G A;  3R2Q A;  4K7O A;  1AQX A;  1XXU A;  3BD2 A;  1KNG A;  4K2D A;  3E9J B;  4KX4 A;  1GLP A;  3LOR A;  1O81 A;  5HFG A;  4TR1 B;  1QGV A;  4D73 B;  3LJR A;  2JZR A;  4MJA A;  2IMK A;  2VCT A;  3MWH A;  1Q98 A;  2JAD A;  1GTU A;  4EO3 A;  3H79 A;  3QAV A;  3LWA A;  4J2F A;  2HSH A;  2VLV A;  1QFN A;  1MEK A;  4I6X A;  2KHP A;  5D73 A;  2H0I A;  3E3E A;  2G0F A;  4XS1 A;  4ECI A;  3QOU A;  2V6K A;  1SYR A;  1JLW A;  4MF6 A;  3KD0 A;  4NHZ A;  4X4J A;  5DQY A;  4MCU A;  4OFM A;  3RAZ A;  1XOA A;  2L4C A;  2AHE A;  1R5P A;  1TXX A;  3ZFL A;  1XFL A;  4K5R A;  5GST A;  3Q74 A;  1UVZ A;  1X5C A;  2AJQ B;  4IBP A;  2R37 A;  1MDI A;  4TR4 A;  6GSV A;  4BVY A;  2OAC A;  3RHB A;  1V57 A;  3FR6 A;  2F8A A;  3FKF A;  2HZE B;  1LBK A;  2CV4 A;  1GSF A;  2LUS A;  4OFT A;  1TRW A;  1M0U A;  2PUK C;  1SKR B;  3G9B A;  2B1K A;  2GLR A;  2HRN A;  2YWO A;  2CZ2 A;  1BAY A;  3IC4 A;  1SK2 A;  1M7T A;  1WRY A;  2B7J A;  2P31 A;  4OD7 A;  3HYP A;  4X1U A;  2O87 A;  3KM6 A;  2A2S A;  3KP8 A;  4L5O A;  3TJB A;  1GSS A;  4IGJ A;  2DIZ A;  11GS A;  4MF7 A;  3M3M A;  1JZR A;  2K9F A;  3GUR A;  3IA1 A;  1M3I A;  1GSD A;  1EOH A;  1GNW A;  2LRT A;  5DAK A;  1C72 A;  5IM9 A;  3EYT A;  3TJJ A;  4TKY A;  5GAP D;  5H5S A;  5E59 A;  4PNG A;  2R5G A;  4G0K A;  4Q5F A;  1WJK A;  2EIR A;  2MMA A;  1X0R A;  2BTO T;  3C1R A;  1OVN A;  3ERG A;  1BQ7 A;  3KXO A;  1TK0 B;  4L5L A;  4POB A;  2OE0 A;  5G31 A;  1W4V A;  2GQK A;  3UBL A;  1PGT A;  3ZTL A;  4XCS A;  1FVK A;  4TXO B;  2R0G A;  3PPU A;  2YAN A;  3GMF A;  1K0M A;  1XPV A;  1Z5Y E;  5L71 A;  1FB6 A;  1YEX A;  5DAL A;  2GT5 A;  3A2V A;  3M8N A;  2WGR A;  3GST A;  4OO4 A;  1KBN A;  4ZB8 A;  3WGE A;  2N5A A;  2MZC A;  1V2A A;  5COH A;  1FAA A;  5CYY A;  1WPI A;  1NHY A;  3GL3 A;  4DVC A;  4IKH A;  2OA7 A;  2QSI A;  2VCZ A;  2FY6 A;  1Y6E A;  4N11 A;  4JE1 A;  5A5K A;  2LS5 A;  1B48 A;  5ELG A;  3CSH A;  4ZL9 A;  3HXS A;  3FZ4 A;  4ZBA A;  1SK0 A;  2MMZ A;  4ULX A;  1TK5 B;  2H30 A;  4HZ4 A;  3GRX A;  1FG4 A;  3DWV A;  1B4Q A;  3IHQ A;  1Q4J A;  2PN8 A;  1WMJ A;  4MJE A;  2FWG A;  2GGT A;  3D21 A;  5B6N A;  4RUV A;  1RQM A;  5B8A A;  1XWA A;  3TRX A;  4TVE A;  1K0O A;  6GSY A;  2DSA A;  1MDJ A;  2LJA A;  1NHO A;  2C0F A;  2C0G A;  1ZOF A;  5DVB A;  1GUH A;  4JU5 A;  5J5N A;  4RQR A;  4NWY A;  3HD5 A;  1Z9H A;  20GS A;  3LSZ A;  2BJX A;  3SBC A;  2JSZ A;  4GF0 A;  18GS A;  3UJ1 A;  22GS A;  2I9H A;  4EC0 A;  4CY8 A;  3KIJ A;  4ML6 A;  4WF5 A;  4HOJ A;  3IHG A;  4WBJ A;  5ELA A;  2L6D A;  1XVQ A;  3WGD A;  1OYJ A;  3L9V A;  3GIX A;  1SJI A;  4Q5R A;  4KAE A;  3HVV A;  4PNF A;  2YWM A;  3FZA A;  3GHA A;  5DBQ A;  2C0E A;  8GSS A;  2CA8 A;  5C00 A;  3FEU A;  2J9H A;  2K6V A;  2R0C A;  3ERF A;  3VI5 A;  4KW6 A;  2C4J A;  3NIV A;  2GZP A;  4ZXG A;  4KE3 A;  2VL2 C;  2XC2 A;  3ZIJ A;  1XWK A;  2C80 A;  2VCW A;  4TR3 A;  3H8Q A;  2PMT A;  2E2M A;  3HKR A;  4O5Q A;  3A2W A;  1HQO A;  4YKG A;  1FVJ A;  2HT9 A;  2A2R A;  4IVF A;  5KN3 A;  1AQW A;  1TOF A;  5HFK A;  3UIW A;  1GL8 A;  1O7U A;  1GNE A;  2H1D A;  1ZYE A;  4LL1 B;  1V98 A;  3F4T A;  2O8V B;  4F9Z A;  1B4P A;  3LEF A;  1HNB A;  5IOX A;  3IXR A;  2FUG 2;  4MAB A;  4E8E A;  3NOF A;  1FW1 A;  1T3B A;  2IFQ B;  4MP4 A;  2VL3 A;  4IJI A;  3D0Z A;  1VGL A;  1YKA A;  3ZZX A;  2HI7 A;  4BWS A;  13GS A;  2HNL A;  1PMT A;  2CT6 A;  3D4M A;  2VLU A;  3EPT A;  1ZGN A;  5D9X A;  4FYU A;  2E7P A;  5CRW A;  2V1M A;  2N5B A;  1XZO A;  5AIS A;  4GQF A;  3Q18 A;  1K3L A;  1XWC A;  1F6M C;  4DSR A;  2EIO A;  3U5R E;  3QD9 A;  5JWQ B;  1Z7R A;  2TRX A;  4OO5 A;  4O32 A;  1TI1 A;  2JSY A;  6GSX A;  1V58 A;  2ON5 A;  3F63 A;  3FMW A;  2QA1 A;  2MMO A;  1GSE A;  2WUL A;  1PD2 1;  1ZCP A;  2FCH A;  4ZBB A;  2OE3 A;  3CSI A;  4HU9 A;  3AY8 A;  3TKS C;  3LYK A;  1HYU A;  1ERW A;  2LNT A;  3QMX A;  1DSB A;  1R5A A;  4IHU A;  1ACV A;  3HHV A;  1K3Y A;  1UC7 A;  4K8M A;  2H71 A;  1PSQ A;  3L78 A;  1EEM A;  3TJF A;  3IK7 A;  1EV9 A;  1MD4 A;  1NSW A;  2H6Z A;  1XW5 A;  3FR3 A;  4CHS A;  1ZYQ B;  1F3B A;  2E2G A;  4Z7X A;  1THO A;  1ML6 A;  1K0C A;  1TI3 A;  3TRP A;  4E8H A;  1X5E A;  2DJK A;  3H4K A;  2UZ8 A;  3GKM A;  4K5S A;  3EE2 A;  2F8F A;  4K1F A;  2H72 A;  3G7I A;  3QPM A;  1M2D A;  4KDX A;  3QFB C;  4KSM A;  2B5Y A;  1M3J A;  1OC3 A;  2XBQ A;  2IPA A;  2QA2 A;  1XOB A;  1N8J A;  4I2U A;  4BVX A;  5DCG A;  3IOS A;  3KJY A;  3GX8 A;  4TR0 A;  4O7H A;  4HZ2 A;  3FYG A;  1A8Y A;  2ZCT A;  2ZUP A;  2DIY A;  1YF0 A;  5ABR A;  2R0P A;  3DGQ A;  2LNS A;  5DJL A;  4TRX A;  4IP6 A;  3VWW A;  5JCG A;  2VL9 A;  1WE0 A;  3QCP A;  4WBR D;  2GST A;  5IQY A;  1OAZ A;  3APS A;  3C71 A;  3TJK A;  4WR4 A;  4ECB A;  5D93 A;  4MJC A;  4WXT A;  4JBB A;  2BMX A;  3F6D A;  2H19 A;  3UOM A;  4XRA A;  5ECK B;  3GUS A;  1A0R P;  4J56 E;  1S3C A;  3UL3 A;  2VL2 A;  1G7O A;  2HLS A;  1OC9 B;  4JR4 A;  5D96 A;  2REM A;  4MZW A;  1YY7 A;  2FWH A;  4EKZ A;  2DJ3 A;  3O3T A;  1XBS A;  2HZF A;  4Z2U A;  1X9M B;  2TRC P;  2X8H A;  4K0N A;  1TRV A;  1GRX A;  4BPY A;  3LQ7 A;  1EP8 A;  4LL4 B;  3ZML A;  2WFC A;  3US3 A;  2V41 A;  2H1B A;  1H75 A;  2CX4 A;  4EF0 A;  5ECR B;  1ERV A;  4Z2T A;  3CQF A;  4GRF A;  4HJ2 A;  2YV7 A;  3FHK A;  3EU3 A;  1GSQ A;  1PN0 A;  4TW5 A;  2O89 A;  3CBU A;  4USS A;  4BL7 A;  3IV4 A;  2FA4 A;  4PTS A;  1ILO A;  3HZ4 A;  4ID0 A;  4IP1 A;  2AV4 A;  4FO5 A;  3ZRE A;  3M9J A;  4N10 A;  3HY2 A;  2HSM A;  3VPT A;  2I4A A;  3QFA C;  2ALB A;  2A4V A;  1DUG A;  3DRN A;  4KUN A;  4FYB A;  3HJO A;  5D9V A;  2WJU A; 
#chains in the Genus database with same CATH homology
 3J7Y k;  2LJR A;  3F4S A;  3IE3 A;  2WB9 A;  1THX A;  4IQ1 A;  1NW2 A;  3DKS A;  5ECN B;  5IMA A;  4IS0 A;  1T8E B;  3APO A;  3WT2 A;  1E6B A;  3BCK A;  4KSO A;  4PQH A;  1YDK A;  5B6M A;  4HS1 A;  3TJG A;  1WP0 A;  3LGC A;  3TKS A;  5ID2 A;  3RDW A;  3GTU A;  3HCZ A;  2DJJ A;  1R26 A;  1SL1 B;  2KP1 A;  3UAR A;  3GN3 A;  3S9F A;  2G2Q A;  2DKH A;  4HEA 2;  2LV3 A;  2R6K A;  4XS4 B;  2LTK A;  4XS6 A;  2K18 A;  1SD9 A;  4L0U A;  2H01 A;  14GS A;  3EMP A;  4KDU A;  4DEJ A;  4LMV A;  4NV5 A;  5F07 A;  2FHE A;  3F3R A;  1TRS A;  1FOV A;  5A4V A;  3TKR A;  4N0Z A;  3WT1 A;  3BCI A;  4XIH A;  3L0H A;  2YZU A;  2KUC A;  1VF2 A;  3KEB A;  1ABA A;  3HA9 A;  5IPG A;  3TOU A;  4KGI A;  3GYK A;  2WCI A;  2C8U A;  2PVQ A;  1DE1 A;  2OKA A;  4ZB9 A;  1DE2 A;  2V32 A;  1EGO A;  2NBS A;  4KDY A;  4POL A;  3J7Y b;  2NPB A;  3GFK A;  3IDV A;  5LD0 A;  1BX9 A;  1B9X C;  1OKD A;  1KTE A;  1TU7 A;  4GQC A;  2JU5 A;  2KP2 A;  3I6A A;  2MBT A;  1FHE A;  1RW1 A;  5AIV A;  2VCQ A;  3NZN A;  2GT6 A;  4V2N A;  1XW9 A;  4PUF C;  5HR0 A;  1QXH A;  1SK1 A;  1VF3 A;  4AF2 A;  4OMV A;  1CQG A;  3VWU A;  4CY6 A;  3L9S A;  3A2X A;  1T4Z A;  4BA7 A;  5B8B A;  4Z2R A;  3EUR A;  5KOX A;  1AIU A;  3P90 A;  1ZL9 A;  4MH2 A;  3ERW A;  5A4U A;  5AIX A;  3DYR A;  1AC1 A;  2NTO A;  5G5F A;  4TR1 A;  1IYI A;  1R7H A;  3F6F A;  4GXZ A;  4D73 A;  2RUF A;  4ZL7 A;  1UA5 A;  2ON7 A;  5CRE A;  4K6X A;  2GSQ A;  4MZC A;  1F3A A;  3VPQ A;  1W89 A;  3ED3 A;  3U6V A;  3TOT A;  1SEN A;  6GSW A;  4IJ3 A;  3UVT A;  3R3E A;  1A8L A;  4CW9 A;  2XBI A;  2O7K A;  4WEY A;  4MPG A;  5DCH A;  3LG6 A;  2Z9S A;  5B7C A;  1H4O A;  4IQA A;  5JWO B;  5J3R A;  4F82 A;  4MA9 A;  3MNG A;  2HYX A;  3CXG A;  1YZX A;  1SJ6 A;  4A5P A;  4I5Q A;  2GQL A;  5EPF A;  1O8X A;  3KZQ A;  5EL8 A;  1I5G A;  4GSN A;  4MMM A;  5ENU A;  2DBC A;  1YQ1 A;  2YCD A;  4MZB A;  3F3Q A;  1OE8 A;  2B1L A;  2VCX A;  3N5O A;  2A4H A;  2RM5 A;  5IO0 A;  2HXK A;  2I3Y A;  1XWB A;  2HZE A;  1PN9 A;  5ECL B;  5H5R A;  1TU8 A;  2VCV A;  2KOK A;  4JRR A;  3CMI A;  4ZL8 A;  1GLQ A;  4FH8 A;  3WD6 A;  3V1W A;  5KN0 A;  3VLN A;  5IMD A;  3EC3 A;  3O6T A;  5CRH A;  1G6Y A;  4MJB A;  12GS A;  4FYC A;  4ZIL A;  2RM6 A;  3DEX A;  4ACS A;  4K0G A;  4GST A;  1ON4 A;  4POK A;  2WDU A;  4K9Z A;  3CSJ A;  1SKS B;  3ZVJ D;  1OKT A;  4F03 A;  2RLI A;  3H1N A;  1U3A A;  5ECQ B;  2FWE A;  1SD8 A;  4WET A;  3KP9 A;  1V9W A;  3IK9 A;  1FB0 A;  4N0V A;  3DIE A;  3IAM 2;  4J57 E;  1ZMA A;  3LW9 A;  3TGZ A;  3DML A;  5IMF A;  3IPZ A;  1A24 A;  2R2J A;  1LJR A;  3RHC A;  1PX6 A;  1AW9 A;  1SL0 B;  5BRT A;  3GL5 A;  2PVO C;  3CYN A;  1BED A;  2VO4 A;  2X4A A;  4O5U A;  2CVD A;  4AJ7 A;  4TXO A;  3EU4 A;  2AB6 A;  2QKE A;  2DML A;  2LKU A;  1M2A A;  1WOU A;  3K8N A;  1YJ6 A;  1O73 A;  2CX3 A;  1GH2 A;  4I8B A;  4MK3 A;  3IRA A;  3GSS A;  1YF1 A;  3P2A A;  2ZNM A;  3QDN A;  5J4U A;  1M9A A;  5D9W A;  3EVI A;  3CTG A;  2GS3 A;  3IBH A;  1PQN A;  1PL1 A;  2CVK A;  3D6I A;  5EY6 A;  4G0L A;  2MYG A;  3APQ A;  2H76 A;  3RPN A;  2VIM A;  3E0U A;  4PGT A;  1SYX A;  2IMF A;  2IMI A;  3ZFB A;  2N5F A;  4NHW A;  2M46 A;  4POM A;  2ES7 A;  4KB3 A;  2B3S A;  3BJ5 A;  3KH9 A;  5IPH A;  5KOW A;  2IJY A;  4OFN A;  4F0B A;  4BVY B;  2VLT A;  4JED A;  3O76 A;  4HQZ A;  2MBS A;  4ISD A;  2YN1 A;  2H66 A;  4EIP A;  5IO2 A;  1EP7 A;  2C3T A;  2L6C A;  3VWX A;  3EIN A;  2X8C A;  3M9K A;  2VOC A;  1T1V A;  4KF9 A;  2KLX A;  2PER A;  4I2T A;  2WS2 A;  3IC8 A;  4Q5Q A;  4EL1 A;  2VD1 A;  4IW9 A;  2JAC A;  2HRA A;  3ZMK A;  1Z6N A;  3FR9 A;  4IN0 A;  4YAV A;  5HR3 A;  3PGT A;  1M9B A;  3HVX A;  2K8S A;  1G7E A;  2YNX A;  1U6T A;  2HE3 A;  4PQI A;  2H0G A;  4X43 A;  1AUC A;  2TIR A;  3C8E A;  5ECO B;  3HJP A;  4YQV A;  3F8U A;  4HU7 A;  4NAX A;  3UVH A;  3GNJ A;  2EC4 A;  3GKK A;  4LMW A;  2DMM A;  1WWJ A;  2M72 A;  2L4Q A;  1O8W A;  5DAK B;  2LJK A;  4IEL A;  3ZIV A;  4XHM A;  2OE1 A;  3I43 A;  5FWG A;  2OJL A;  3TB2 A;  1GWC A;  1G0T A;  2IME A;  1TTZ A;  3FW2 A;  5ECS A;  1WIK A;  4HUA A;  1JZW A;  19GS A;  5G2Z A;  3TRQ A;  1FOH A;  2DJ1 A;  2OAD A;  3PH9 A;  4QQ7 A;  2H1G A;  5JWR B;  1EGR A;  6GSU A;  1PRX A;  1HNC A;  3ISO A;  4KH7 A;  3TDG A;  3D4T A;  5EVO A;  5CNW A;  4V1A g;  3G7Y A;  4AJ8 A;  3IAS 2;  4ZIJ A;  4PUR A;  1LU4 A;  2AUV A;  3F4R A;  1RK4 A;  2AAW A;  3DXB A;  2P5Q A;  4P3Y B;  2PU9 C;  2B5E A;  4GSS A;  3HJM A;  5IMC A;  4LLR A;  1MTC A;  5DAL B;  3OR5 A;  3FZ9 A;  4I97 A;  3Q19 A;  5HFI A;  5G5E A;  2LQQ A;  1G6W A;  2F51 A;  3FZ5 A;  17GS A;  2X49 A;  3H93 A;  4NPB A;  1JZO A;  2JZT A;  5DDL A;  1S3A A;  2V2G A;  5ECM B;  4K2X A;  3A5I A;  2IFQ A;  2E0Q A;  5F0G A;  4N30 A;  1R4W A;  3LXT A;  4YH2 A;  3F0I A;  2HFD A;  3FY7 A;  2JL4 A;  4GTU A;  1IYH A;  5CRG A;  4HJM A;  2H8L A;  2LST A;  1VF1 A;  2O85 A;  1TK8 B;  1GTA A;  2H6Y A;  2DLX A;  3ME7 A;  1VRS D;  10GS A;  4OCF A;  4WF4 A;  1GTB A;  1JHB A;  2GTU A;  5ECI B;  4YQU A;  3GKX A;  4JR6 A;  4EVM A;  5G1L A;  2CZ3 A;  2FWF A;  4NXI A;  2AYT A;  2PPT A;  3D22 A;  1XIY A;  3PIN A;  2CQ9 A;  2C3Q A;  3WYW A;  4L8E A;  2GDR A;  3MAK A;  6GST A;  5J9B A;  2QGV A;  2H70 A;  2DJ0 A;  3C73 A;  1U3I A;  3UBK A;  3P8W A;  4PX1 A;  3KTB A;  3UMA A;  1PA3 A;  3TKP A;  16GS A;  4FQU A;  1B9Y C;  2FA8 A;  4KA0 A;  1YKC A;  1BYE A;  1K0A A;  3HDC A;  5E4W A;  5G30 A;  3VK9 A;  1GTI A;  1GUM A;  3QR6 A;  3D5J A;  3CRU A;  1ERT A;  1AAZ A;  2IWT A;  3UAP A;  1HD2 A;  1K0D A;  4EE0 A;  4F0C A;  3VUR A;  3M1G A;  1USB A;  4XTS A;  2HSY A;  2RUE A;  2R3X A;  4ILF A;  3KGK A;  4HQS A;  4HI7 A;  1GUL A;  1Y25 A;  5D8I A;  3LYP A;  2H74 A;  4H86 A;  4XRD A;  1TKD B;  2GZZ A;  2L5O A;  3KCM A;  7GSS A;  1F37 A;  4G0I A;  1TDI A;  2H75 A;  3MSZ A;  5A4W A;  2IIY A;  2VUP A;  4Q5N A;  4YKF A;  4ECJ A;  5CP1 A;  1QMV A;  4PQ1 A;  1QQ2 A;  4K7I A;  1M2B A;  5D9T A;  4V2M A;  2PGT A;  4EDZ A;  5J41 A;  2XPD A;  2OBK A;  3VI7 A;  4ML1 A;  1FO5 A;  3C1S A;  3ZVJ A;  3N9J A;  3PR8 A;  3GH9 A;  2L59 A;  5G1K A;  4EUY A;  3W8S A;  4GLT A;  1URM A;  3EMX A;  4MF5 A;  3DVX A;  2YPM A;  5LNK e;  1DBY A;  2CVB A;  1GP1 A;  2GZY A;  2B5X A;  1E2Y A;  2C0D A;  3L9U A;  1PX7 A;  5INY A;  5DQS A;  2CAI A;  3GH6 A;  2FGX A;  3LXZ A;  3KMN A;  1OC9 A;  3QAG A;  5BMU A;  3C7M A;  5F05 A;  1GSY A;  3ZLP A;  2DC5 A;  3LFL A;  2I1U A;  4WKW A;  2CAQ A;  4X0X A;  5CAX A;  1ZYN A;  2NVL A;  3G7J A;  4AGS A;  2FD3 A;  4G19 A;  1HNA A;  2LRN A;  1Z6M A;  4GWR A;  3ZIT A;  5GAN D;  1PKZ A;  2YV9 A;  4QL7 A;  1V40 A;  3FK8 A;  9GSS A;  1NM3 A;  2PWJ A;  2XHF A;  5CO3 A;  2YP6 A;  5ECP B;  2EIQ A;  5KN1 A;  1T00 A;  4DSS B;  4YAP A;  3KH7 A;  2VM2 A;  1TP9 A;  2RII A;  3GKN A;  5F06 A;  1Z3E A;  1JZD A;  1GUK A;  3TUE A;  1JLV A;  2VD0 A;  3RPP A;  3HZ8 A;  1U88 A;  1J9B A;  1TJD A;  6GSS A;  4OWY A;  2J23 A;  4NV2 A;  5HR1 A;  3GV1 A;  4KCE A;  1Z7P A;  2YOI A;  4CDO A;  3P7X A;  2YJ7 A;  1XW6 A;  1VF4 A;  2C1Y A;  2FLS A;  5F8B A;  1F9M A;  4BVX B;  3EWL A;  4TOP A;  1A0F A;  1M99 A;  4ZB6 A;  1S3D A;  3MYD A;  1J08 A;  1EEJ A;  3VWV A;  1JFU A;  3F9U A;  1TW9 A;  1EOG A;  3M0F A;  4V1A p;  2YWN A;  2IMD A;  1ZYP A;  4XS4 A;  4WR5 A;  1SL2 B;  2R4V A;  5AGY A;  4RI7 A;  1K0N A;  1I9D A;  2DJ2 A;  3ZRD A;  1ERU A;  3DVW A;  3MDK A;  5AN1 A;  3SWL A;  4MLY A;  1SU9 A;  5HQP A;  5IIZ A;  4MNN A;  2K8V A;  5C04 A;  1A2J A;  5FT3 A;  2C3N A;  2JZS A;  2DKI A;  1XCC A;  2H73 A;  4V2L A;  4JZQ A;  1MDK A;  3RBT A;  2VAF A;  1TRU A;  2WZ9 A;  2X99 A;  4K7N A;  3FRC A;  4QL9 A;  2HRF A;  1ZZY A;  3BBY A;  3A3T A;  2X8G A;  5KEJ A;  5H5Q A;  4BWQ A;  4AJ6 A;  1PKW A;  2P5R A;  2FNO A;  2L5L A;  5IOW A;  4O92 A;  2OBI A;  1AXD A;  2I81 A;  2XPE A;  4YQM A;  2NDO A;  1O85 A;  4TN8 A;  4MH3 A;  5J9C A;  3L4N A;  5IMV A;  2LQO A;  2B7K A;  2B6M A;  4BL7 B;  1ST9 A;  1K3O A;  5ECH B;  5DJM A;  2GSS A;  1F2E A;  1A23 A;  2GSR A;  4RQX A;  4OCE A;  1MD3 A;  1UN2 A;  1J0F A;  1KEB A;  2V6O A;  4DSQ A;  4G10 A;  4FIW A;  3I69 A;  1QUW A;  5GZZ B;  2H6X A;  1O6J A;  1SKW B;  1OC8 A;  2IL3 A;  4LA1 A;  1BG5 A;  4EIQ A;  1B8X A;  1EV4 A;  2IN3 A;  1OE7 A;  5GSS A;  2HRK A;  2PBJ A;  1EZK A;  3IR4 A;  4F2I A;  4NMU A;  1K0B A;  3GA4 A;  3CRT A;  1YEP A;  4DSS A;  3I9V 2;  1T7P B;  3QAW A;  2LEG A;  2YWI A;  1XWG A;  3GX0 A;  1PL2 A;  4MPF A;  1SJZ A;  5LCZ A;  5ID2 B;  3GTU B;  1A2L A;  2D2Z A;  1EWX A;  1A2M A;  5JCU A;  2A2P A;  2GVP A;  3KMO A;  3ZYW A;  1X5D A;  3ME8 A;  2VM1 A;  4KCA A;  5IMZ A;  3A5W A;  2YZH A;  4RI6 A;  3WGX A;  4GCI A;  2WRT A;  3HVS A;  3UEM A;  3JCM L;  2F3M A;  2YJH A;  3TKS E;  4PXO A;  3CTF A;  1T4Y A;  4EDY A;  4ICY A;  2MMN A;  1AQV A;  2F9S A;  5HR2 A;  2M80 A;  3Q6O A;  3DD3 A;  3VFI A;  2H0H A;  2QC7 A;  4HDE A;  2H1A A;  1X9W B;  4KND A;  1N2A A;  1XVW A;  2GQM A;  1X9S B;  4EXJ A;  4PUA A;  5FHI A;  4MDC A;  3W8J A;  1QK8 A;  4ZBD A;  1BJX A;  4L0W A;  4G2E A;  1U87 A;  2LRC A;  3TCO A;  3ZL5 A;  3KTL A;  1GSU A;  4ECC A;  3W6G A;  4TXV A;  5JCW A;  1CQH A;  3BOA A;  3MIX A;  5CRD A;  2L57 A;  2X64 A;  4O5R A;  4G9H A;  5KN2 A;  3TKQ A;  2P0G A;  3R2Q A;  4K7O A;  1AQX A;  1XXU A;  3BD2 A;  1KNG A;  4K2D A;  3E9J B;  4KX4 A;  1GLP A;  3LOR A;  1O81 A;  5HFG A;  4TR1 B;  1QGV A;  4D73 B;  3LJR A;  2JZR A;  4MJA A;  2IMK A;  2VCT A;  3MWH A;  1Q98 A;  2JAD A;  1GTU A;  4EO3 A;  3H79 A;  3QAV A;  3LWA A;  4J2F A;  2HSH A;  2VLV A;  1QFN A;  1MEK A;  4I6X A;  2KHP A;  5D73 A;  2H0I A;  3E3E A;  2G0F A;  4XS1 A;  4ECI A;  3QOU A;  2V6K A;  1SYR A;  1JLW A;  4MF6 A;  3KD0 A;  4NHZ A;  4X4J A;  5DQY A;  4MCU A;  4OFM A;  3RAZ A;  1XOA A;  2L4C A;  2AHE A;  1R5P A;  1TXX A;  3ZFL A;  1XFL A;  4K5R A;  5GST A;  3Q74 A;  1UVZ A;  1X5C A;  2AJQ B;  4IBP A;  2R37 A;  1MDI A;  4TR4 A;  6GSV A;  4BVY A;  2OAC A;  3RHB A;  1V57 A;  3FR6 A;  2F8A A;  3FKF A;  2HZE B;  1LBK A;  2CV4 A;  1GSF A;  2LUS A;  4OFT A;  1TRW A;  1M0U A;  2PUK C;  1SKR B;  3G9B A;  2B1K A;  2GLR A;  2HRN A;  2YWO A;  2CZ2 A;  1BAY A;  3IC4 A;  1SK2 A;  1M7T A;  1WRY A;  2B7J A;  2P31 A;  4OD7 A;  3HYP A;  4X1U A;  2O87 A;  3KM6 A;  2A2S A;  3KP8 A;  4L5O A;  3TJB A;  1GSS A;  4IGJ A;  2DIZ A;  11GS A;  4MF7 A;  3M3M A;  1JZR A;  2K9F A;  3GUR A;  3IA1 A;  1GSD A;  1EOH A;  1GNW A;  2LRT A;  5DAK A;  1C72 A;  5IM9 A;  3EYT A;  3TJJ A;  4TKY A;  5GAP D;  5H5S A;  5E59 A;  4PNG A;  2R5G A;  4G0K A;  4Q5F A;  1WJK A;  2EIR A;  2MMA A;  1X0R A;  2BTO T;  3C1R A;  1OVN A;  3ERG A;  1BQ7 A;  3KXO A;  1TK0 B;  4L5L A;  4POB A;  2OE0 A;  5G31 A;  1W4V A;  2GQK A;  3UBL A;  1PGT A;  3ZTL A;  4XCS A;  1FVK A;  4TXO B;  2R0G A;  3PPU A;  2YAN A;  3GMF A;  1K0M A;  1XPV A;  1Z5Y E;  5L71 A;  1FB6 A;  1YEX A;  5DAL A;  2GT5 A;  3A2V A;  3M8N A;  2WGR A;  3GST A;  4OO4 A;  1KBN A;  4ZB8 A;  3WGE A;  2N5A A;  2MZC A;  1V2A A;  5COH A;  1FAA A;  5CYY A;  1WPI A;  1NHY A;  3GL3 A;  4DVC A;  4IKH A;  2OA7 A;  2QSI A;  2VCZ A;  2FY6 A;  1Y6E A;  4N11 A;  4JE1 A;  5A5K A;  2LS5 A;  1B48 A;  5ELG A;  3CSH A;  4ZL9 A;  3HXS A;  3FZ4 A;  4ZBA A;  1SK0 A;  2MMZ A;  4ULX A;  1TK5 B;  2H30 A;  4HZ4 A;  3GRX A;  1FG4 A;  3DWV A;  1B4Q A;  3IHQ A;  1Q4J A;  2PN8 A;  1WMJ A;  4MJE A;  2FWG A;  2GGT A;  3D21 A;  5B6N A;  4RUV A;  1RQM A;  5B8A A;  1XWA A;  3TRX A;  4TVE A;  1K0O A;  6GSY A;  2DSA A;  1MDJ A;  2LJA A;  1NHO A;  2C0F A;  2C0G A;  1ZOF A;  5DVB A;  1GUH A;  4JU5 A;  5J5N A;  4RQR A;  4NWY A;  3HD5 A;  1Z9H A;  20GS A;  3LSZ A;  2BJX A;  3SBC A;  2JSZ A;  4GF0 A;  18GS A;  3UJ1 A;  22GS A;  2I9H A;  4EC0 A;  4CY8 A;  3KIJ A;  4ML6 A;  4WF5 A;  4HOJ A;  3IHG A;  4WBJ A;  5ELA A;  2L6D A;  1XVQ A;  3WGD A;  1OYJ A;  3L9V A;  3GIX A;  1SJI A;  4Q5R A;  4KAE A;  3HVV A;  4PNF A;  2YWM A;  3FZA A;  3GHA A;  5DBQ A;  2C0E A;  8GSS A;  2CA8 A;  5C00 A;  3FEU A;  2J9H A;  2K6V A;  2R0C A;  3ERF A;  3VI5 A;  4KW6 A;  2C4J A;  3NIV A;  2GZP A;  4ZXG A;  4KE3 A;  2VL2 C;  2XC2 A;  3ZIJ A;  1XWK A;  2C80 A;  2VCW A;  4TR3 A;  3H8Q A;  2PMT A;  2E2M A;  3HKR A;  4O5Q A;  3A2W A;  1HQO A;  4YKG A;  1FVJ A;  2HT9 A;  2A2R A;  4IVF A;  5KN3 A;  1AQW A;  1TOF A;  5HFK A;  3UIW A;  1GL8 A;  1O7U A;  1GNE A;  2H1D A;  1ZYE A;  4LL1 B;  1V98 A;  3F4T A;  2O8V B;  4F9Z A;  1B4P A;  3LEF A;  1HNB A;  5IOX A;  3IXR A;  2FUG 2;  4MAB A;  4E8E A;  3NOF A;  1FW1 A;  1T3B A;  2IFQ B;  4MP4 A;  2VL3 A;  4IJI A;  3D0Z A;  1VGL A;  1YKA A;  3ZZX A;  2HI7 A;  4BWS A;  13GS A;  2HNL A;  1PMT A;  2CT6 A;  3D4M A;  2VLU A;  3EPT A;  1ZGN A;  5D9X A;  4FYU A;  2E7P A;  5CRW A;  2V1M A;  2N5B A;  1XZO A;  5AIS A;  4GQF A;  3Q18 A;  1K3L A;  1XWC A;  1F6M C;  4DSR A;  2EIO A;  3U5R E;  3QD9 A;  5JWQ B;  1Z7R A;  2TRX A;  4OO5 A;  4O32 A;  1TI1 A;  2JSY A;  6GSX A;  1V58 A;  2ON5 A;  3F63 A;  3FMW A;  2QA1 A;  2MMO A;  1GSE A;  2WUL A;  1PD2 1;  1ZCP A;  2FCH A;  4ZBB A;  2OE3 A;  3CSI A;  4HU9 A;  3AY8 A;  3TKS C;  3LYK A;  1HYU A;  1ERW A;  2LNT A;  3QMX A;  1DSB A;  1R5A A;  4IHU A;  1ACV A;  3HHV A;  1K3Y A;  1UC7 A;  4K8M A;  2H71 A;  1PSQ A;  3L78 A;  1EEM A;  3TJF A;  3IK7 A;  1EV9 A;  1MD4 A;  1NSW A;  2H6Z A;  1XW5 A;  3FR3 A;  4CHS A;  1ZYQ B;  1F3B A;  2E2G A;  4Z7X A;  1THO A;  1ML6 A;  1K0C A;  1TI3 A;  3TRP A;  4E8H A;  1X5E A;  2DJK A;  3H4K A;  2UZ8 A;  3GKM A;  4K5S A;  3EE2 A;  2F8F A;  4K1F A;  2H72 A;  3G7I A;  3QPM A;  1M2D A;  4KDX A;  3QFB C;  4KSM A;  2B5Y A;  1OC3 A;  2XBQ A;  2IPA A;  2QA2 A;  1XOB A;  1N8J A;  4I2U A;  4BVX A;  5DCG A;  3IOS A;  3KJY A;  3GX8 A;  4TR0 A;  4O7H A;  4HZ2 A;  3FYG A;  1A8Y A;  2ZCT A;  2ZUP A;  2DIY A;  1YF0 A;  5ABR A;  2R0P A;  3DGQ A;  2LNS A;  5DJL A;  4TRX A;  4IP6 A;  3VWW A;  5JCG A;  2VL9 A;  1WE0 A;  3QCP A;  4WBR D;  2GST A;  5IQY A;  1OAZ A;  3APS A;  3C71 A;  3TJK A;  4WR4 A;  4ECB A;  5D93 A;  4MJC A;  4WXT A;  4JBB A;  2BMX A;  3F6D A;  2H19 A;  3UOM A;  4XRA A;  5ECK B;  3GUS A;  1A0R P;  4J56 E;  1S3C A;  3UL3 A;  2VL2 A;  1G7O A;  2HLS A;  1OC9 B;  4JR4 A;  5D96 A;  2REM A;  4MZW A;  1YY7 A;  2FWH A;  4EKZ A;  2DJ3 A;  3O3T A;  1XBS A;  2HZF A;  4Z2U A;  1X9M B;  2TRC P;  2X8H A;  4K0N A;  1TRV A;  1GRX A;  4BPY A;  3LQ7 A;  1EP8 A;  4LL4 B;  3ZML A;  2WFC A;  3US3 A;  2V41 A;  2H1B A;  1H75 A;  2CX4 A;  4EF0 A;  5ECR B;  1ERV A;  4Z2T A;  4GRF A;  4HJ2 A;  2YV7 A;  3FHK A;  3EU3 A;  1GSQ A;  1PN0 A;  4TW5 A;  2O89 A;  3CBU A;  4USS A;  4BL7 A;  3IV4 A;  2FA4 A;  4PTS A;  1ILO A;  3HZ4 A;  4ID0 A;  4IP1 A;  2AV4 A;  4FO5 A;  3ZRE A;  3M9J A;  4N10 A;  3HY2 A;  2HSM A;  3VPT A;  2I4A A;  3QFA C;  2ALB A;  2A4V A;  1DUG A;  3DRN A;  4KUN A;  4FYB A;  3HJO A;  5D9V A;  2WJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...