3A2WA

Peroxiredoxin (c50s) from aeropytum pernix k1 (peroxide-bound form)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
244
structure length
244
Chain Sequence
PGSIPLIGERFPEMEVTTDHGVIKLPDHYVSQGKWFVLFSHPADFTPVSTTEFVSFARRYEDFQRLGVDLIGLSVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLHAESATHTVRGVFIVDARGVIRTMLYYPMELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEIIGEGLIVPPPTTEDQARARMESGQYRCLDWWFCWDTPASRDDVEEARRYLRRAAEKPAKLLYEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Probable peroxiredoxin
publication title Crystal structure of peroxiredoxin from Aeropyrum pernix K1 complexed with its substrate, hydrogen peroxide
pubmed doi rcsb
source organism Aeropyrum pernix
total genus 76
structure length 244
sequence length 244
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2009-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1020.20 Alpha Beta 2-Layer Sandwich Antioxidant, Horf6; Chain A, domain 2 Antioxidant, Horf6; Chain A, domain 2 3a2wA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3a2wA01
3GV1A 4GCIA 4PQ1A 4XRAA 4WF5A 2N5AA 4XS6A 3CRUA 2HSHA 2H75A 3VK9A 2H73A 4LL1B 3GKMA 1R4WA 2M72A 5HR0A 1XVWA 2AYTA 4YH2A 2HZEB 3ZVJA 5IIZA 5J9CA 1M2DA 4KSMA 2H6ZA 2YOIA 2O87A 3GFKA 1EP7A 1T4YA 4LL4B 4KSOA 1XWBA 1T4ZA 3IXRA 1E2YA 4RQRA 3GKXA 2IFQA 4XS4A 1W89A 4DSRA 5IMVA 5IMDA 3QAWA 3TRPA 2BTOT 5CO3A 5IMAA 3MWHA 1GRXA 2C0DA 2ZUPA 3VI5A 3CYNA 3FZAA 3HKRA 3QAGA 5B6MA 1OYJA 5ID2A 2V6OA 4YQUA 3UL3A 5A4VA 4L5LA 3P7XA 2RM5A 2H6YA 1UC7A 2F8AA 1KBNA 4HU7A 1THOA 2L59A 4HJMA 4HS1A 1T7PB 1TP9A 4FIWA 2E2GA 3TOTA 4L0UA 1PA3A 1Z7RA 2RUEA 3WGEA 1YY7A 5DALB 5IMCA 1H4OA 1BG5A 1GWCA 3GKNA 1F2EA 1G0TA 3TDGA 1JFUA 4IW9A 3Q19A 4TR1B 1X9MB 4EVMA 3GX8A 1GH2A 1FOVA 3CTFA 3D4MA 2LRCA 2L57A 1OC9B 3QFAC 2PN8A 2CX3A 1SL1B 4ILFA 5A5KA 3IR4A 1ON4A 5C00A 1SK2A 2X8GA 3GSTA 3LYKA 2CT6A 1U3IA 2P31A 4V1Ap 1JHBA 4PNFA 1WWJA 3CMIA 1XPVA 3HCZA 2DJ1A 1ZYQB 3F6DA 4K2DA 2NPBA 6GSUA 1YEPA 2LRTA 2DC5A 1RQMA 2AB6A 4EUYA 2WB9A 1SK1A 1PSQA 5DAKB 5G30A 2KLXA 2AAWA 3QAVA 4ZILA 4GRFA 1TRSA 1Y6EA 4ECCA 1J9BA 1QGVA 2FA8A 3A2XA 3C1RA 5GAND 1K0BA 5JWRB 4OFNA 2R2JA 3L78A 3PH9A 5B8BA 1XWAA 1TK8B 4PXOA 4K9ZA 1ZZYA 2VUPA 4JZQA 5ABRA 3VLNA 1BAYA 4I2TA 5AIXA 3KP8A 3US3A 2C0FA 1NM3A 2H0HA 5GSSA 4PQHA 2IN3A 4K0GA 5CRGA 2GLRA 1VF2A 1V98A 3ZMKA 3TRXA 1F3AA 5HFGA 1SKSB 2M46A 2YJHA 3HJMA 4GQCA 3WD6A 2PBJA 1A24A 5D96A 2V41A 3QDNA 4L8EA 3WGXA 2DJ3A 2GQMA 4POKA 4QQ7A 2GZZA 4IN0A 3LEFA 4BVXA 5B6NA 1G7EA 2FWEA 2VCZA 3I69A 2DJ2A 4GSNA 5KN2A 4XRDA 2NBSA 2C3TA 1ST9A 2JACA 2DJ0A 4ID0A 1GTUA 2M80A 5GSTA 1VGLA 2JADA 2J9HA 4KNDA 3WT1A 4OCEA 1K3OA 4NHWA 3H1NA 1GP1A 1IYHA 2MMNA 2RLIA 2TRXA 2IMFA 1UN2A 4EXJA 4K7NA 2HFDA 1G6WA 1USBA 5ECPB 1X9SB 4HZ2A 1ZCPA 1LU4A 1YDKA 2FD3A 2FGXA 3L9UA 2IMIA 4MPFA 2J23A 3VPTA 3I9V2 1AIUA 1GLQA 3HY2A 5JCUA 2RIIA 4K7OA 2L5LA 3G7YA 5F06A 3M1GA 3GHAA 2RUFA 4CW9A 1Z7PA 5IO2A 1Q98A 2VCQA 5CREA 1FVJA 1GULA 5ECHB 2YWMA 2GSTA 5HFIA 1IYIA 2DIZA 2D2ZA 3TJGA 1OE8A 3H79A 1JZWA 1Z3EA 1PL2A 2GQLA 3UBLA 5KN1A 1ERTA 1YKCA 2RM6A 2H30A 1K3YA 3ZLPA 1MD3A 5G31A 2VIMA 1HYUA 1KEBA 2ES7A 4AJ8A 1B9XC 2OE3A 1VF1A 1LJRA 5LD0A 1AQWA 2NTOA 3FYGA 3QR6A 1MTCA 1SKRB 2GDRA 3H8QA 1WMJA 4ML6A 3TKSC 3EVIA 4TVEA 1YQ1A 3HD5A 4MF6A 2V32A 2O85A 3APOA 1YF0A 3TGZA 1M7TA 2GSQA 2FLSA 1B48A 10GSA 4PNGA 5IQYA 1TXXA 2CVKA 1WE0A 4MLYA 3ZL5A 4MJAA 5HFKA 1WP0A 1KNGA 3CSJA 1KTEA 3Q18A 3GH6A 1ERVA 2YNXA 6GSTA 2WJUA 1Q4JA 2YN1A 4L5OA 1R5AA 2LKUA 3P2AA 1SYRA 5F8BA 1U3AA 3EU4A 1FVKA 3GSSA 3ZTLA 3DRNA 4K0NA 1AQXA 2B1KA 2LS5A 3OR5A 1ZGNA 3HJOA 1K0MA 2E2MA 2LJKA 3BCKA 1SD9A 3L9SA 2LUSA 3RDWA 4IKHA 2VCTA 5JWQB 3GTUB 4O32A 4IGJA 1W4VA 4KCAA 4POLA 1A23A 5IPHA 2CZ2A 4D73B 5IOXA 4IVFA 4H86A 4OO4A 2NDOA 3CXGA 4V2NA 2EIOA 3IC4A 4BVYA 2H19A 2GGTA 4FYCA 4OMVA 4RQXA 3HVXA 2F3MA 3EWLA 3ERGA 2LV3A 3IHQA 3BD2A 3CTGA 3HHVA 2A2RA 3UMAA 2FCHA 2V1MA 4V2LA 1PX6A 5B7CA 3HXSA 2H0IA 2VOCA 3DXBA 4ECIA 2IMKA 1K0DA 5DJLA 4MJCA 4MJEA 5J41A 2P5RA 3VPQA 4GF0A 2PERA 4J2FA 1TK5B 2Z9SA 3F9UA 4TXVA 3KEBA 2MMAA 2VCVA 5G5FA 1I9DA 5ECQB 3D4TA 2H72A 2QSIA 2A4VA 2R5GA 2OE1A 2DBCA 3C1SA 1ZYEA 3CRTA 3N9JA 3IK7A 4ZBBA 1EGOA 4MZCA 1SJ6A 4LLRA 5ELAA 1X9WB 5J9BA 1SYXA 1PGTA 2GSRA 2JSZA 1O6JA 4TKYA 3IK9A 4NV5A 1GNWA 5ELGA 2KHPA 3E3EA 3I43A 4JU5A 1TTZA 4JR4A 3VWWA 2P5QA 2XHFA 2G2QA 3ERFA 2VCWA 2FNOA 2C0GA 4WEYA 3D5JA 1AAZA 2CAQA 3RBTA 3P8WA 4BL7A 3DIEA 4F2IA 1SD8A 3F63A 2CAIA 3UAPA 4YAPA 1PQNA 2KP1A 1M2AA 4F82A 1NHOA 2KUCA 1X5CA 2VM2A 3FR6A 1UA5A 3UJ1A 4TXOB 1V57A 4QL9A 2ALBA 4FYUA 4MA9A 4GXZA 5CYYA 1GSFA 1X5DA 4DSSA 3GL5A 2VAFA 5DQSA 1GTIA 3UARA 3D0ZA 3HJPA 1PX7A 4NHZA 5DDLA 4FH8A 3R2QA 3F0IA 3TKSE 4EDZA 4JR6A 5AN1A 1QFNA 3DVWA 5D9WA 2REMA 2HXKA 2GQKA 2TRCP 1M9AA 2L4QA 3KD0A 4ECBA 3Q74A 1G6YA 3LXZA 6GSWA 2JSYA 3FW2A 4DEJA 4K1FA 1ZL9A 1LBKA 2HI7A 1WOUA 2VD0A 4KGIA 5J4UA 3LWAA 2YZUA 4GQFA 5H5QA 4F9ZA 4AGSA 4MDCA 3FZ5A 1O8XA 3VWXA 1AQVA 2EIRA 4MJBA 5DQYA 3GN3A 1TRWA 4IP6A 4N0ZA 2B5YA 3TUEA 2HNLA 1GSSA 1XWCA 2DJKA 3PR8A 3ZIJA 3M9JA 4AJ7A 5HR2A 1UVZA 4V1Ag 5DCGA 4TN8A 3LFLA 4N0VA 1B4QA 4FYBA 4ZL9A 4HUAA 2HE3A 2XPEA 2K8VA 5IM9A 5G2ZA 2K8SA 2H1GA 2CVBA 1S3AA 1A0RP 1MD4A 3GIXA 2DSAA 4HOJA 2H76A 4CHSA 1A8LA 4RUVA 3FHKA 19GSA 2YCDA 1JLVA 2IFQB 3G7IA 4TR4A 2QC7A 3LJRA 4KUNA 4N11A 4HDEA 1GUHA 4XS4B 3ME8A 4F03A 1ZMAA 4G2EA 2JU5A 4MH3A 3RAZA 2JZTA 2VM1A 2F8FA 3HA9A 2WZ9A 2DMMA 3PINA 1FHEA 3KIJA 1EOGA 4GSSA 4TRXA 3ZZXA 3ZIVA 5ID2B 3F6FA 12GSA 2E7PA 1VF3A 2PVOC 2ZCTA 4ZB6A 4XTSA 1AW9A 5ECKB 5HR1A 9GSSA 4MPGA 3MDKA 4WR5A 3GUSA 1TOFA 5D9TA 4JEDA 4X0XA 3TJJA 2JZSA 1A0FA 4MABA 1FO5A 2F9SA 3EU3A 3E0UA 4TOPA 5CP1A 2LJAA 1ERUA 2C3NA 4IS0A 1FAAA 3NOFA 3KP9A 2V6KA 1PL1A 3GYKA 3MSZA 4IQ1A 1K0CA 3W8JA 1XOBA 2E0QA 2GZPA 3DKSA 4HEA2 1YJ6A 2YWOA 1SJIA 1M2BA 1PKWA 1SKWB 1URMA 5GAPD 3TJKA 3IPZA 3TKSA 4LA1A 1XVQA 4PGTA 4PQIA 3CSHA 5EVOA 4I97A 1N2AA 5DVBA 2C0EA 3EMPA 1TK0B 2FWGA 3FR3A 22GSA 1CQHA 2B7KA 3FEUA 2VL2C 4POMA 4AF2A 1TU7A 1U87A 1BEDA 1TRUA 1A2LA 3FZ4A 3L0HA 5EY6A 4WKWA 5HQPA 1G7OA 1WPIA 3VI7A 3BBYA 5G1KA 1PKZA 6GSYA 2K9FA 3M8NA 3IBHA 5JCGA 2HLSA 5D73A 1GUMA 2C8UA 5H5SA 3O3TA 4P3YB 3C8EA 4KX4A 2H70A 3TRQA 3ZFBA 1CQGA 2OJLA 3K8NA 3FY7A 4ZXGA 4YAVA 1ABAA 5DCHA 4ZB8A 3WYWA 4BWSA 4MCUA 1QXHA 2C3QA 3FRCA 3I6AA 1EV4A 5D9XA 2H66A 3ZFLA 2LSTA 5ECOB 3VWVA 1TKDB 4J57E 3C7MA 2I3YA 4PX1A 4WETA 1GSUA 2QGVA 4YQMA 2GTUA 4MZWA 1BQ7A 3J7Yk 5AGYA 2I9HA 1HD2A 2L6CA 5H5RA 3C71A 3GH9A 2C4JA 5ECMB 1EEJA 4EF0A 1DSBA 1ML6A 4TR3A 2K18A 3SWLA 2K6VA 4ML1A 3JCML 4IJ3A 5C04A 1F6MC 4LMVA 4QL7A 1DBYA 2OADA 3DMLA 4IJIA 3KH7A 4G10A 3S9FA 3UOMA 3W6GA 4NPBA 5JCWA 1R5PA 2FHEA 4HU9A 4ACSA 4DVCA 1SL2B 1TW9A 1ACVA 5CRDA 2B3SA 4POBA 2IMDA 4WXTA 4TR0A 4IQAA 1TU8A 3V1WA 4JE1A 3LGCA 18GSA 5CAXA 2OBKA 2AV4A 1XW5A 4RI6A 1PD21 1MDJA 1OAZA 1DE2A 3ISOA 1MDIA 3U6VA 3NIVA 1EWXA 2MYGA 4KW6A 4I5QA 3A2VA 1B4PA 2CZ3A 4RI7A 3HZ8A 4CDOA 4N30A 5A4UA 1GL8A 2HZEA 1S3CA 5IMZA 3EC3A 2PWJA 1X0RA 4IP1A 2L6DA 1PMTA 1HNCA 2LNTA 2GT5A 3GRXA 3A5WA 3VWUA 1GUKA 3WGDA 4ULXA 5L71A 5ENUA 2B5XA 4EL1A 3GKKA 1WIKA 4EO3A 2MBTA 2MMOA 1R7HA 1XCCA 1Z6MA 3ZRDA 2IWTA 1QMVA 5LNKe 1AUCA 2GVPA 2FA4A 1B9YC 4X43A 3LORA 4KCEA 4K7IA 1YF1A 3UVHA 1GSYA 2IMEA 1OC8A 4Z7XA 2WDUA 2G0FA 2HRNA 1I5GA 4I2UA 1QUWA 4PUAA 2P0GA 4KH7A 1SK0A 5CRWA 4G19A 2DJJA 2PPTA 4Q5FA 3P90A 5E4WA 3LYPA 4BPYA 5DALA 2PU9C 3QMXA 1THXA 2ON7A 4KB3A 2O7KA 3KMNA 1TJDA 2ON5A 4NAXA 4TR1A 2R6KA 1XIYA 3GMFA 4JRRA 2HRFA 1ZOFA 3WT2A 1OC9A 1FB0A 4HI7A 4KE3A 1GTBA 5AIVA 5J5NA 3GNJA 2VO4A 2CQ9A 4O5RA 2B1LA 2X64A 4EE0A 16GSA 1GSDA 4OD7A 2EC4A 3KH9A 1SL0B 1Z6NA 2IIYA 3H4KA 1XWKA 4MF7A 4I6XA 3RHBA 3F4TA 1YEXA 3PGTA 1TI1A 3TB2A 2FY6A 3IA1A 3A2WA 4PUFC 4KDXA 1YKAA 2PMTA 1NHYA 3APQA 5EL8A 2H1DA 3VFIA 5DAKA 3ME7A 1TI3A 1ERWA 5KN3A 8GSSA 2GSSA 5CRHA 1V40A 3HYPA 4HQSA 2FWFA 5J3RA 1TDIA 3ZITA 20GSA 3TOUA 3RHCA 2R37A 1JZOA 4WF4A 1YZXA 4XS1A 1T00A 2QKEA 4WBJA 3TCOA 1SENA 2WCIA 3KJYA 1XWGA 3DD3A 4BWQA 2PGTA 4L0WA 3HVSA 2I81A 3L9VA 4ZBDA 2OBIA 3QOUA 3O76A 3MNGA 2JZRA 4OWYA 3IE3A 1HNBA 3FR9A 3F4RA 3DGQA 2PUKC 14GSA 2CV4A 4ZL7A 2C80A 3FKFA 4DSQA 1SJZA 3U5RE 4OCFA 3DYRA 5IMFA 2O8VB 4I8BA 1HQOA 1O85A 1V2AA 2VL3A 4EDYA 3QPMA 1A8YA 5CNWA 1JZRA 4GSTA 3GURA 2IJYA 4JBBA 1XW9A 4OO5A 5G1LA 2X99A 3VURA 3ERWA 2MBSA 1ILOA 11GSA 3L4NA 1PRXA 1QQ2A 2YWIA 3IAM2 3KMOA 3D22A 1N8JA 2B6MA 1NSWA 1GSQA 2C1YA 2CVDA 4HZ4A 1GLPA 2BJXA 2YJ7A 5E59A 1F37A 3BOAA 3D21A 4ECJA 1V58A 3HZ4A 2CX4A 5D8IA 1F9MA 3EURA 5FHIA 1XBSA 4LMWA 3KM6A 3HDCA 2IL3A 5D9VA 3F3QA 2WFCA 2VL2A 1QK8A 4F0BA 2TIRA 2AJQB 1DUGA 3LXTA 2JL4A 2VD1A 4DSSB 5F05A 5ECIB 2HZFA 2LRNA 4MK3A 2OA7A 1MDKA 3SBCA 2F51A 3KTLA 3ZREA 5IPGA 2LQOA 2MZCA 3CBUA 2YWNA 4E8HA 1AC1A 4MF5A 2DLXA 3FZ9A 1OC3A 3UVTA 3BJ5A 2VL9A 1X5EA 1OE7A 3G7JA 2R4VA 5F07A 2L4CA 4E8EA 4MH2A 1WJKA 4N10A 3QFBC 5COHA 2ZNMA 4ISDA 3HVVA 4NXIA 2VLUA 3DEXA 2AHEA 1K0OA 2WULA 2VLTA 1EP8A 2B7JA 3N5OA 7GSSA 1O8WA 1RW1A 3EINA 3QCPA 5IOWA 4WBRD 1F3BA 4BA7A 4K6XA 2H74A 3DVXA 1EEMA 1Y25A 4KA0A 1BX9A 3KCMA 4XHMA 2H1AA 3BCIA 1M99A 2LQQA 1OKTA 2YANA 5JWOB 2N5FA 2VLVA 1XFLA 3ZMLA 5ECRB 1GSEA 5F0GA 4MP4A 2YP6A 4MZBA 3TKQA 1XOAA 4IELA 1J08A 1E6BA 3ED3A 3EYTA 1EV9A 5INYA 2H01A 5DJMA 4K8MA 4Q5RA 2HT9A 1XXUA 5KN0A 5LCZA 3QD9A 1XZOA 2FWHA 4OFMA 1A2MA 4XIHA 1VF4A 1NW2A 3GTUA 1AXDA 3GL3A 2H71A 3M9KA 1XW6A 3GA4A 4ZL8A 2R3XA 2XBIA 1B8XA 3ZVJD 1MEKA 2BMXA 4D73A 2WRTA 3APSA 3TKRA 1TRVA 3IAS2 3UEMA 1T3BA 1K0AA 4NWYA 1Z9HA 2EIQA 3Q6OA 1GTAA 5IO0A 2NVLA 3F8UA 1JLWA 1M0UA 2B5EA 3TJFA 6GSSA 13GSA 2H6XA 3TKPA 2I4AA 17GSA 4Q5NA 4TW5A 2H8LA 1V9WA 2KOKA 4KAEA 3C73A 2FUG2 3NZNA 6GSVA 4GWRA 2XPDA 1K0NA 3W8SA 2WS2A 1T8EB 3J7Yb 3UIWA 1EGRA 4KDUA 3E9JB 2GS3A 5DBQA 5ECLB 1M9BA 3IRAA 1K3LA 2GT6A 2V2GA 6GSXA 4IHUA 1U6TA 3KXOA 2LJRA 2XC2A 3IDVA 3CSIA 4NMUA 1FB6A 1A2JA 3EE2A 2LEGA 4PURA 1BJXA 3KTBA 1EZKA 2H0GA 5ECNB 1FG4A 2X8CA 5G5EA 2OACA 2OKAA 4ZBAA 1SU9A 5D93A 3AY8A 1HNAA 2O89A 3F3RA 4IBPA 1DE1A 3A3TA 4MMMA 3RPNA 4ZIJA 2A2SA 3KZQA 3LQ7A 2YV9A 3MAKA 1U88A 5KEJA 2LNSA 5A4WA 3H93A 2HSYA 1VRSD 3FK8A 3UBKA 2XBQA 1RK4A 4J56E 1O81A 2YZHA 1O73A 1EOHA 4NV2A 2YPMA 2WGRA 1FW1A 2OE0A 4EC0A 1GNEA 4AJ6A 1J0FA 3ZYWA 2PVQA 2DIYA 4EKZA 2MMZA 4HJ2A 4ZB9A 3O6TA 2AUVA 4WR4A 2N5BA 4TXOA 4FO5A 4V2MA 3GX0A 4HQZA 1R26A 3M3MA 2H1BA 3M0FA 3IOSA 3RPPA 1Z5YE 5HR3A 1OKDA 2KP2A 1C72A 1T1VA 4OFTA 3LG6A 5FT3A 4XCSA 2DMLA 2X8HA 5FWGA 4O7HA 4Q5QA 5B8AA 2CA8A 1PN9A 1WRYA 4YQVA 2I1UA 2L5OA 2YV7A 4KDYA 4GLTA 1H75A 5EPFA 3TJBA 1O7UA 2LTKA 3DWVA 1BYEA 2GZYA 4GTUA 5AISA 2HYXA 3F4SA 1JZDA 3LSZA 2IPAA 3G9BA 1S3DA 5GZZB 4X1UA 1OVNA 3EMXA 3D6IA 4F0CA 4G9HA 2VCXA 3KGKA 3IV4A 4O92A 5ECSA
chains in the Genus database with same CATH superfamily
3GV1A 4GCIA 4PQ1A 4XRAA 4WF5A 2N5AA 4XS6A 3CRUA 2HSHA 2H75A 3VK9A 2H73A 4LL1B 3GKMA 1R4WA 2M72A 5HR0A 1XVWA 2AYTA 3EPTA 4YH2A 2HZEB 3ZVJA 5IIZA 5J9CA 1M2DA 4KSMA 2H6ZA 2YOIA 2O87A 3GFKA 4CY6A 1EP7A 1T4YA 4LL4B 4KSOA 1XWBA 1T4ZA 3IXRA 1E2YA 4RQRA 3GKXA 3LW9A 2IFQA 4XS4A 1W89A 4DSRA 5IMVA 5IMDA 3QAWA 3TRPA 4CY8A 2BTOT 5CO3A 5IMAA 3MWHA 1GRXA 2C0DA 2ZUPA 4EIQA 3VI5A 3CYNA 3FZAA 3HKRA 3QAGA 5B6MA 1OYJA 5ID2A 2V6OA 4YQUA 3UL3A 5A4VA 4L5LA 3P7XA 2RM5A 2H6YA 1UC7A 2F8AA 1KBNA 4HU7A 1THOA 2L59A 4HJMA 4HS1A 1T7PB 1TP9A 4FIWA 2E2GA 3TOTA 4L0UA 1PA3A 1Z7RA 2RUEA 2HRAA 3WGEA 1YY7A 5DALB 5IMCA 1H4OA 1BG5A 1GWCA 3GKNA 1F2EA 1G0TA 3TDGA 1JFUA 4IW9A 3Q19A 4TR1B 1X9MB 4EVMA 3GX8A 1GH2A 1FOVA 4HSCX 3CTFA 3D4MA 2LRCA 2L57A 1OC9B 3QFAC 2PN8A 2CX3A 1SL1B 4ILFA 5A5KA 3IR4A 1ON4A 5C00A 1SK2A 2X8GA 3GSTA 3LYKA 2CT6A 1U3IA 2P31A 4V1Ap 1JHBA 4PNFA 1WWJA 3CMIA 1XPVA 3HCZA 2DJ1A 1ZYQB 3F6DA 4K2DA 2NPBA 6GSUA 1YEPA 2LRTA 2DC5A 1RQMA 2AB6A 4EUYA 2WB9A 1SK1A 1PSQA 5DAKB 5G30A 2KLXA 2AAWA 3QAVA 2QA2A 4ZILA 4GRFA 4Z2TA 1TRSA 1Y6EA 4ECCA 1J9BA 1QGVA 2FA8A 3A2XA 1PN0A 3C1RA 5GAND 1K0BA 5BMUA 5JWRB 4OFNA 2R2JA 3L78A 3PH9A 5B8BA 1XWAA 1TK8B 4PXOA 4K9ZA 1ZZYA 2VUPA 4JZQA 5ABRA 2HRKA 3VLNA 1BAYA 4I2TA 5AIXA 3KP8A 3US3A 2UZ8A 2C0FA 1NM3A 2H0HA 5GSSA 4PQHA 2IN3A 4K0GA 5CRGA 3PPUA 2GLRA 1VF2A 1V98A 3ZMKA 3TRXA 1F3AA 5HFGA 1SKSB 2M46A 2YJHA 3HJMA 4GQCA 3WD6A 2PBJA 1A24A 5D96A 2V41A 3QDNA 4L8EA 3WGXA 2DJ3A 2GQMA 4POKA 4QQ7A 2GZZA 4IN0A 3LEFA 4BVXA 5B6NA 1G7EA 2FWEA 2VCZA 3I69A 2DJ2A 4GSNA 5KN2A 4XRDA 2NBSA 2C3TA 1ST9A 2JACA 2DJ0A 4ID0A 1GTUA 1M3JA 2M80A 5GSTA 1VGLA 2JADA 2J9HA 4KNDA 3WT1A 4OCEA 1K3OA 4NHWA 3H1NA 1GP1A 1IYHA 2MMNA 2RLIA 2TRXA 2IMFA 1UN2A 4EXJA 4K7NA 2HFDA 1G6WA 1USBA 5ECPB 1X9SB 4HZ2A 1ZCPA 1LU4A 1YDKA 2FD3A 2FGXA 3L9UA 2IMIA 4MPFA 2J23A 3VPTA 3I9V2 1AIUA 1GLQA 3HY2A 5JCUA 2RIIA 4K7OA 2L5LA 3G7YA 5F06A 3M1GA 3GHAA 2RUFA 4CW9A 1Z7PA 5IO2A 1Q98A 2VCQA 5CREA 1FVJA 1GULA 5ECHB 2YWMA 2GSTA 5HFIA 1IYIA 2DIZA 2D2ZA 3TJGA 3MYDA 1OE8A 3H79A 1JZWA 1Z3EA 1PL2A 2GQLA 3UBLA 5KN1A 1ERTA 1YKCA 5KOWA 2RM6A 2H30A 1K3YA 3ZLPA 1MD3A 5G31A 2VIMA 1PFOA 1HYUA 4PTSA 1KEBA 2ES7A 4AJ8A 1ZYPA 1B9XC 4FQUA 2OE3A 1VF1A 1LJRA 5LD0A 1AQWA 2NTOA 3FYGA 3QR6A 1MTCA 4ICYA 1SKRB 2GDRA 3H8QA 4ML6A 1WMJA 3TKSC 2R0PA 3EVIA 4TVEA 5KOXA 1YQ1A 3HD5A 4MF6A 2V32A 2O85A 3APOA 1YF0A 3TGZA 1M7TA 2GSQA 2FLSA 1B48A 10GSA 4PNGA 5IQYA 1TXXA 2CVKA 4MLYA 1WE0A 3ZL5A 4MJAA 5HFKA 1WP0A 1KNGA 4Z2UA 3CSJA 1KTEA 3Q18A 3GH6A 1ERVA 2YNXA 4G0LA 6GSTA 2WJUA 1Q4JA 2YN1A 4L5OA 1R5AA 2LKUA 3P2AA 1SYRA 5F8BA 1U3AA 3EU4A 1FVKA 3GSSA 3ZTLA 3HVNA 3DRNA 4K0NA 1AQXA 2B1KA 2LS5A 3OR5A 1ZGNA 3HJOA 1K0MA 2E2MA 2LJKA 3BCKA 1SD9A 3L9SA 4X4JA 2LUSA 3RDWA 4IKHA 2VCTA 5JWQB 3GTUB 4O32A 4IGJA 1W4VA 4KCAA 4POLA 1A23A 5IPHA 2CZ2A 4D73B 5IOXA 4IVFA 4H86A 4OO4A 2NDOA 3CXGA 4V2NA 2EIOA 3IC4A 4BVYA 2H19A 2GGTA 4FYCA 4OMVA 4RQXA 3HVXA 2F3MA 3EWLA 3ERGA 2LV3A 3IHQA 3BD2A 3CTGA 3HHVA 2A2RA 3UMAA 2FCHA 2V1MA 4V2LA 1PX6A 5B7CA 3HXSA 2H0IA 2VOCA 3DXBA 4ECIA 2IMKA 2R0CA 1K0DA 5DJLA 4MJCA 4MJEA 5J41A 2P5RA 3VPQA 4GF0A 2PERA 4J2FA 1TK5B 2Z9SA 3F9UA 4G0IA 4TXVA 3KEBA 2MMAA 2VCVA 5G5FA 1I9DA 5ECQB 3D4TA 2H72A 2QSIA 2DKIA 2A4VA 2R5GA 2OE1A 2DBCA 3C1SA 1ZYEA 3CRTA 3N9JA 3IK7A 4ZBBA 1EGOA 4MZCA 1SJ6A 4LLRA 5ELAA 1X9WB 5J9BA 1SYXA 1PGTA 2GSRA 2JSZA 1O6JA 4TKYA 3IK9A 4Z2RA 2X49A 4NV5A 1GNWA 5ELGA 2KHPA 3E3EA 3I43A 4JU5A 1TTZA 4JR4A 3VWWA 2P5QA 2XHFA 2G2QA 3ERFA 2VCWA 2FNOA 2C0GA 4WEYA 3D5JA 1AAZA 2CAQA 3RBTA 3P8WA 4BL7A 3DIEA 4F2IA 1SD8A 3F63A 2CAIA 3UAPA 4YAPA 1PQNA 2KP1A 1M2AA 4F82A 3IHGA 1NHOA 2KUCA 1X5CA 2VM2A 3FR6A 1UA5A 3UJ1A 4TXOB 1V57A 4QL9A 2ALBA 4FYUA 4MA9A 4GXZA 5CYYA 3IC8A 1GSFA 1X5DA 4DSSA 3GL5A 2VAFA 5DQSA 1GTIA 3UARA 3D0ZA 3HJPA 1PX7A 4NHZA 5DDLA 4FH8A 3R2QA 3F0IA 3TKSE 4EDZA 4JR6A 5AN1A 1QFNA 3DVWA 5D9WA 2REMA 2HXKA 2GQKA 2TRCP 1M9AA 2L4QA 3KD0A 3CQFA 4ECBA 3Q74A 1G6YA 3FMWA 3LXZA 6GSWA 2JSYA 3FW2A 4DEJA 4K1FA 1ZL9A 1LBKA 2HI7A 1WOUA 2VD0A 4KGIA 5J4UA 3LWAA 2YZUA 4GQFA 5H5QA 4F9ZA 4AGSA 4MDCA 3FZ5A 1O8XA 3VWXA 1AQVA 2EIRA 4MJBA 5DQYA 3GN3A 1TRWA 4IP6A 4N0ZA 2B5YA 3TUEA 2HNLA 1GSSA 1XWCA 2DJKA 3PR8A 3ZIJA 3M9JA 4AJ7A 5HR2A 1UVZA 4V1Ag 5DCGA 4TN8A 1S3RA 3LFLA 4N0VA 1B4QA 4FYBA 4ZL9A 4HUAA 2HE3A 2XPEA 2K8VA 5IM9A 5G2ZA 2K8SA 2H1GA 2CVBA 1S3AA 1A0RP 1MD4A 3GIXA 2DSAA 4HOJA 2H76A 4CHSA 1A8LA 4RUVA 3FHKA 19GSA 2YCDA 1JLVA 2IFQB 4YKGA 3G7IA 4TR4A 2QC7A 3LJRA 4KUNA 4N11A 4HDEA 1GUHA 4XS4B 3ME8A 4F03A 1ZMAA 4G2EA 2JU5A 4MH3A 3RAZA 2JZTA 2VM1A 2F8FA 3HA9A 2WZ9A 2DMMA 3PINA 1FHEA 3KIJA 1EOGA 4GSSA 4TRXA 3ZZXA 3ZIVA 5ID2B 3F6FA 12GSA 2E7PA 1VF3A 2PVOC 2ZCTA 4ZB6A 4XTSA 1AW9A 5ECKB 5HR1A 9GSSA 4MPGA 3MDKA 4WR5A 3GUSA 1TOFA 5D9TA 4JEDA 4X0XA 3TJJA 2JZSA 1A0FA 4MABA 1FO5A 2F9SA 3EU3A 3E0UA 4TOPA 5CP1A 2LJAA 1ERUA 2C3NA 4IS0A 1FAAA 3NOFA 3KP9A 2V6KA 1PL1A 3GYKA 3MSZA 3R3EA 4IQ1A 1K0CA 3W8JA 1XOBA 2QA1A 2E0QA 2GZPA 3DKSA 4HEA2 1YJ6A 2YWOA 1SJIA 1M2BA 1PKWA 1SKWB 1URMA 5GAPD 3TJKA 3IPZA 3TKSA 4LA1A 1XVQA 4PGTA 4PQIA 3CSHA 5EVOA 4I97A 1N2AA 3MIXA 5DVBA 1ZYNA 2C0EA 3EMPA 1TK0B 2FWGA 3FR3A 22GSA 1CQHA 2B7KA 3FEUA 2VL2C 4POMA 4AF2A 1TU7A 1U87A 1BEDA 1TRUA 1A2LA 3FZ4A 4KF9A 3L0HA 5EY6A 4WKWA 5HQPA 1G7OA 1WPIA 3VI7A 3BBYA 5G1KA 1PKZA 6GSYA 2K9FA 3M8NA 3IBHA 5JCGA 2HLSA 5D73A 1GUMA 2C8UA 5H5SA 1M3IA 3O3TA 4P3YB 3C8EA 4KX4A 2H70A 3TRQA 3ZFBA 1CQGA 2OJLA 3K8NA 3FY7A 4ZXGA 4YAVA 1ABAA 5DCHA 4ZB8A 3WYWA 4BWSA 4MCUA 1QXHA 2C3QA 3FRCA 3I6AA 1EV4A 5D9XA 2H66A 3ZFLA 2LSTA 5ECOB 3VWVA 1TKDB 4J57E 3C7MA 2I3YA 4PX1A 4WETA 1GSUA 2QGVA 4YQMA 2GTUA 4MZWA 1BQ7A 3J7Yk 5AGYA 4BVXB 2I9HA 1HD2A 2L6CA 5H5RA 3C71A 3GH9A 2C4JA 5ECMB 1EEJA 4EF0A 2A4HA 1DSBA 1ML6A 4TR3A 2K18A 3SWLA 2K6VA 4ML1A 3JCML 4IJ3A 5C04A 1F6MC 4LMVA 4QL7A 1DBYA 2OADA 3DMLA 4O5UA 4IJIA 3KH7A 4G10A 3S9FA 2DKHA 3UOMA 3W6GA 4NPBA 5JCWA 1R5PA 2FHEA 4HU9A 4ACSA 4DVCA 1SL2B 1TW9A 1ACVA 5CRDA 2B3SA 4POBA 2IMDA 4WXTA 4TR0A 4IQAA 1TU8A 3V1WA 4JE1A 3LGCA 18GSA 5CAXA 2OBKA 2AV4A 1XW5A 4RI6A 1PD21 1MDJA 1OAZA 1DE2A 3ISOA 1MDIA 3U6VA 3NIVA 1EWXA 2MYGA 4KW6A 4I5QA 3A2VA 1B4PA 2CZ3A 4RI7A 3HZ8A 4CDOA 4N30A 5A4UA 1GL8A 2HZEA 1S3CA 5IMZA 3EC3A 2PWJA 1X0RA 4IP1A 2L6DA 1PMTA 1HNCA 2LNTA 2GT5A 3GRXA 3A5WA 3VWUA 1GUKA 3WGDA 4ULXA 5L71A 5ENUA 2B5XA 4EL1A 3GKKA 1WIKA 4EO3A 2MBTA 2MMOA 1R7HA 1XCCA 1Z6MA 3ZRDA 2IWTA 1QMVA 5LNKe 1AUCA 2GVPA 2FA4A 1B9YC 4X43A 3LORA 4KCEA 4K7IA 1YF1A 3UVHA 1GSYA 2IMEA 1OC8A 4Z7XA 2WDUA 2G0FA 2HRNA 1I5GA 4I2UA 1QUWA 4PUAA 2HSMA 2P0GA 4KH7A 1SK0A 5CRWA 4G19A 2DJJA 2PPTA 4Q5FA 3P90A 5E4WA 3LYPA 4BPYA 5DALA 2PU9C 3QMXA 1THXA 2ON7A 4KB3A 2O7KA 3KMNA 1TJDA 2ON5A 4NAXA 4TR1A 2R6KA 1XIYA 3GMFA 4JRRA 4EIPA 2HRFA 1ZOFA 3WT2A 1OC9A 3A5IA 1FB0A 4HI7A 4KE3A 1GTBA 5AIVA 5J5NA 3GNJA 2VO4A 2CQ9A 4O5RA 2B1LA 2X64A 4EE0A 16GSA 1GSDA 4OD7A 2EC4A 3KH9A 1SL0B 1Z6NA 2IIYA 3H4KA 1XWKA 4MF7A 4I6XA 3RHBA 3F4TA 1YEXA 3PGTA 1TI1A 3TB2A 2FY6A 3IA1A 3A2WA 4PUFC 4KDXA 1YKAA 2PMTA 1NHYA 3APQA 5EL8A 2H1DA 3VFIA 5DAKA 3ME7A 1TI3A 1ERWA 4BVYB 5KN3A 8GSSA 2GSSA 5CRHA 1V40A 3HYPA 4HQSA 2FWFA 4BIKA 5J3RA 1TDIA 3ZITA 1XG8A 20GSA 3TOUA 3RHCA 2R37A 1JZOA 4WF4A 1YZXA 4XS1A 1T00A 2QKEA 4WBJA 3TCOA 1SENA 2WCIA 3KJYA 4O5QA 1XWGA 3DD3A 4BWQA 2PGTA 4L0WA 3HVSA 2I81A 3L9VA 4ZBDA 2OBIA 3QOUA 3O76A 3MNGA 2JZRA 4OWYA 3IE3A 1HNBA 3FR9A 3F4RA 3DGQA 2PUKC 14GSA 2CV4A 4ZL7A 2C80A 3FKFA 4DSQA 1SJZA 4A5PA 3U5RE 4OCFA 3DYRA 5IMFA 2O8VB 4G0KA 1HQOA 1O85A 4I8BA 1V2AA 2VL3A 4EDYA 3QPMA 1A8YA 5CNWA 1JZRA 4YKFA 4GSTA 3GURA 2IJYA 4JBBA 1XW9A 4OO5A 5G1LA 2X99A 3VURA 3ERWA 2MBSA 1ILOA 11GSA 3L4NA 1PRXA 1QQ2A 2YWIA 3IAM2 3KMOA 3D22A 1N8JA 2B6MA 1NSWA 1GSQA 2C1YA 2CVDA 4HZ4A 1GLPA 2BJXA 2YJ7A 4BL7B 5E59A 1F37A 3BOAA 3D21A 4ECJA 1V58A 3HZ4A 2CX4A 5D8IA 1F9MA 3EURA 5FHIA 1XBSA 4LMWA 3KM6A 3HDCA 2IL3A 5D9VA 3F3QA 2WFCA 2VL2A 1QK8A 4F0BA 2TIRA 2AJQB 1DUGA 3LXTA 2JL4A 2VD1A 4DSSB 5F05A 5ECIB 2HZFA 4K5SA 2LRNA 4MK3A 2OA7A 1MDKA 3SBCA 2F51A 3KTLA 3ZREA 5IPGA 2LQOA 2MZCA 3CBUA 2YWNA 4E8HA 1AC1A 4MF5A 2DLXA 3FZ9A 1OC3A 3UVTA 3BJ5A 2VL9A 1X5EA 1OE7A 3G7JA 2R4VA 5F07A 2L4CA 4E8EA 4MH2A 1WJKA 4N10A 3QFBC 5COHA 2ZNMA 4ISDA 3HVVA 4NXIA 2VLUA 3DEXA 2AHEA 1K0OA 2WULA 2VLTA 1EP8A 2B7JA 3N5OA 7GSSA 1O8WA 1RW1A 3EINA 3QCPA 5IOWA 4WBRD 1F3BA 4BA7A 4K6XA 2H74A 3DVXA 1EEMA 1Y25A 4KA0A 1BX9A 3KCMA 4XHMA 2H1AA 3BCIA 1M99A 2LQQA 1OKTA 2YANA 5JWOB 2N5FA 2VLVA 1XFLA 3ZMLA 5ECRB 1GSEA 5F0GA 4MP4A 2YP6A 4MZBA 3TKQA 1XOAA 4IELA 1J08A 1E6BA 3ED3A 3EYTA 1EV9A 5INYA 2H01A 5DJMA 4K8MA 4Q5RA 2HT9A 1XXUA 4MNNA 5KN0A 5LCZA 3QD9A 1XZOA 2FWHA 4OFMA 1A2MA 4XIHA 1VF4A 1NW2A 3GTUA 1AXDA 3GL3A 2H71A 3M9KA 1FOHA 1XW6A 3GA4A 4ZL8A 2R3XA 2XBIA 1B8XA 3ZVJD 1MEKA 2BMXA 4D73A 2WRTA 3APSA 3TKRA 1TRVA 3IAS2 3UEMA 1T3BA 1K0AA 4NWYA 1Z9HA 2EIQA 3Q6OA 1GTAA 5IO0A 2NVLA 3F8UA 1JLWA 1M0UA 2B5EA 3TJFA 6GSSA 13GSA 2H6XA 3TKPA 2I4AA 17GSA 4Q5NA 4TW5A 2H8LA 1V9WA 2KOKA 4KAEA 3C73A 2FUG2 3NZNA 6GSVA 4GWRA 2XPDA 5BRTA 1K0NA 3W8SA 2WS2A 1T8EB 3J7Yb 3UIWA 1EGRA 4KDUA 3E9JB 2GS3A 5DBQA 5ECLB 1M9BA 3IRAA 1K3LA 2GT6A 2V2GA 6GSXA 4IHUA 1U6TA 3KXOA 2LJRA 2XC2A 3IDVA 3CSIA 4NMUA 1FB6A 1A2JA 3EE2A 2LEGA 4PURA 1BJXA 3KTBA 1EZKA 2H0GA 5ECNB 1FG4A 2X8CA 5G5EA 2OACA 2OKAA 4ZBAA 1SU9A 5D93A 3AY8A 1HNAA 2O89A 3F3RA 4IBPA 1DE1A 3A3TA 4MMMA 3RPNA 4ZIJA 2A2SA 3KZQA 3LQ7A 2YV9A 3MAKA 1U88A 5KEJA 2LNSA 5A4WA 3H93A 4K5RA 2HSYA 1VRSD 3FK8A 3UBKA 2XBQA 1RK4A 4J56E 1O81A 2YZHA 1O73A 1EOHA 4NV2A 2YPMA 2WGRA 1FW1A 2OE0A 4EC0A 1GNEA 4AJ6A 1J0FA 3ZYWA 2PVQA 2DIYA 4EKZA 2MMZA 4HJ2A 4ZB9A 3O6TA 2AUVA 4WR4A 2N5BA 4TXOA 4FO5A 4V2MA 2X4AA 3GX0A 4HQZA 2R0GA 1R26A 3M3MA 2H1BA 3M0FA 3IOSA 2A2PA 3RPPA 1Z5YE 5HR3A 1OKDA 2KP2A 1C72A 1T1VA 4OFTA 3LG6A 5FT3A 4XCSA 2DMLA 2X8HA 5FWGA 4O7HA 4Q5QA 5B8AA 2CA8A 4USSA 1PN9A 1WRYA 4YQVA 2I1UA 2L5OA 2YV7A 4KDYA 4GLTA 1H75A 5EPFA 3TJBA 1O7UA 2LTKA 3DWVA 1BYEA 2GZYA 4K2XA 4GTUA 5AISA 2HYXA 3F4SA 1JZDA 3LSZA 2IPAA 3G9BA 1S3DA 5GZZB 4X1UA 1OVNA 3EMXA 3D6IA 4F0CA 4G9HA 2VCXA 3KGKA 3IV4A 4O92A 5ECSA
chains in the Genus database with same CATH topology
3GV1A 4GCIA 4PQ1A 4XRAA 4WF5A 2N5AA 4XS6A 3CRUA 2HSHA 2H75A 3VK9A 2H73A 4LL1B 3GKMA 1R4WA 2M72A 5HR0A 1XVWA 2AYTA 3EPTA 4YH2A 2HZEB 3ZVJA 5IIZA 5J9CA 1M2DA 4KSMA 2H6ZA 2YOIA 2O87A 3GFKA 4CY6A 1EP7A 1T4YA 4LL4B 4KSOA 1XWBA 1T4ZA 3IXRA 1E2YA 4RQRA 3GKXA 3LW9A 2IFQA 4XS4A 1W89A 4DSRA 5IMVA 5IMDA 3QAWA 3TRPA 4CY8A 2BTOT 5CO3A 5IMAA 3MWHA 1GRXA 2C0DA 2ZUPA 4EIQA 3VI5A 3CYNA 3FZAA 3HKRA 3QAGA 5B6MA 1OYJA 5ID2A 2V6OA 4YQUA 3UL3A 5A4VA 4L5LA 3P7XA 2RM5A 2H6YA 1UC7A 2F8AA 1KBNA 4HU7A 1THOA 2L59A 4HJMA 4HS1A 1T7PB 1TP9A 4FIWA 2E2GA 3TOTA 4L0UA 1PA3A 1Z7RA 2RUEA 2HRAA 3WGEA 1YY7A 5DALB 5IMCA 1H4OA 1BG5A 1GWCA 3GKNA 1F2EA 1G0TA 3TDGA 1JFUA 4IW9A 3Q19A 4TR1B 1X9MB 4EVMA 3GX8A 1GH2A 1FOVA 3CTFA 3D4MA 2LRCA 2L57A 1OC9B 3QFAC 2PN8A 2CX3A 1SL1B 4ILFA 5A5KA 3IR4A 1ON4A 5C00A 1SK2A 2X8GA 3GSTA 3LYKA 2CT6A 1U3IA 2P31A 4V1Ap 1JHBA 4PNFA 1WWJA 3CMIA 1XPVA 3HCZA 2DJ1A 1ZYQB 3F6DA 4K2DA 2NPBA 6GSUA 1YEPA 2LRTA 2DC5A 1RQMA 2AB6A 4EUYA 2WB9A 1SK1A 1PSQA 5DAKB 5G30A 2KLXA 2AAWA 3QAVA 2QA2A 4ZILA 4GRFA 4Z2TA 1TRSA 1Y6EA 4ECCA 1J9BA 1QGVA 2FA8A 3A2XA 1PN0A 3C1RA 5GAND 1K0BA 5BMUA 5JWRB 4OFNA 2R2JA 3L78A 3PH9A 5B8BA 1XWAA 1TK8B 4PXOA 4K9ZA 1ZZYA 2VUPA 4JZQA 5ABRA 2HRKA 3VLNA 1BAYA 4I2TA 5AIXA 3KP8A 3US3A 2UZ8A 2C0FA 1NM3A 2H0HA 5GSSA 4PQHA 2IN3A 4K0GA 5CRGA 3PPUA 2GLRA 1VF2A 1V98A 3ZMKA 3TRXA 1F3AA 5HFGA 1SKSB 2M46A 2YJHA 3HJMA 4GQCA 3WD6A 2PBJA 1A24A 5D96A 2V41A 3QDNA 4L8EA 3WGXA 2DJ3A 2GQMA 4POKA 4QQ7A 2GZZA 4IN0A 3LEFA 4BVXA 5B6NA 1G7EA 2FWEA 2VCZA 3I69A 2DJ2A 4GSNA 5KN2A 4XRDA 2NBSA 2C3TA 1ST9A 2JACA 2DJ0A 4ID0A 1GTUA 2M80A 5GSTA 1VGLA 2JADA 2J9HA 4KNDA 3WT1A 4OCEA 1K3OA 4NHWA 3H1NA 1GP1A 1IYHA 2MMNA 2RLIA 2TRXA 2IMFA 1UN2A 4EXJA 4K7NA 2HFDA 1G6WA 1USBA 5ECPB 1X9SB 4HZ2A 1ZCPA 1LU4A 1YDKA 2FD3A 2FGXA 3L9UA 2IMIA 4MPFA 2J23A 3VPTA 3I9V2 1AIUA 1GLQA 3HY2A 5JCUA 2RIIA 4K7OA 2L5LA 3G7YA 5F06A 3M1GA 3GHAA 2RUFA 4CW9A 1Z7PA 5IO2A 1Q98A 2VCQA 5CREA 1FVJA 1GULA 5ECHB 2YWMA 2GSTA 5HFIA 1IYIA 2DIZA 2D2ZA 3TJGA 3MYDA 1OE8A 3H79A 1JZWA 1Z3EA 1PL2A 2GQLA 3UBLA 5KN1A 1ERTA 1YKCA 5KOWA 2RM6A 2H30A 1K3YA 3ZLPA 1MD3A 5G31A 2VIMA 1HYUA 4PTSA 1KEBA 2ES7A 4AJ8A 1ZYPA 1B9XC 4FQUA 2OE3A 1VF1A 1LJRA 5LD0A 1AQWA 2NTOA 3FYGA 3QR6A 1MTCA 4ICYA 1SKRB 2GDRA 3H8QA 4ML6A 1WMJA 3TKSC 2R0PA 3EVIA 4TVEA 5KOXA 1YQ1A 3HD5A 4MF6A 2V32A 2O85A 3APOA 1YF0A 3TGZA 1M7TA 2GSQA 2FLSA 1B48A 10GSA 4PNGA 5IQYA 1TXXA 2CVKA 4MLYA 1WE0A 3ZL5A 4MJAA 5HFKA 1WP0A 1KNGA 4Z2UA 3CSJA 1KTEA 3Q18A 3GH6A 1ERVA 2YNXA 4G0LA 6GSTA 2WJUA 1Q4JA 2YN1A 4L5OA 1R5AA 2LKUA 3P2AA 1SYRA 5F8BA 1U3AA 3EU4A 1FVKA 3GSSA 3ZTLA 3DRNA 4K0NA 1AQXA 2B1KA 2LS5A 3OR5A 1ZGNA 3HJOA 1K0MA 2E2MA 2LJKA 3BCKA 1SD9A 3L9SA 4X4JA 2LUSA 3RDWA 4IKHA 2VCTA 5JWQB 3GTUB 4O32A 4IGJA 1W4VA 4KCAA 4POLA 1A23A 5IPHA 2CZ2A 4D73B 5IOXA 4IVFA 4H86A 4OO4A 2NDOA 3CXGA 4V2NA 2EIOA 3IC4A 4BVYA 2H19A 2GGTA 4FYCA 4OMVA 4RQXA 3HVXA 2F3MA 3EWLA 3ERGA 2LV3A 3IHQA 3BD2A 3CTGA 3HHVA 2A2RA 3UMAA 2FCHA 2V1MA 4V2LA 1PX6A 5B7CA 3HXSA 2H0IA 2VOCA 3DXBA 4ECIA 2IMKA 2R0CA 1K0DA 5DJLA 4MJCA 4MJEA 5J41A 2P5RA 3VPQA 4GF0A 2PERA 4J2FA 1TK5B 2Z9SA 3F9UA 4G0IA 4TXVA 3KEBA 2MMAA 2VCVA 5G5FA 1I9DA 5ECQB 3D4TA 2H72A 2QSIA 2DKIA 2A4VA 2R5GA 2OE1A 2DBCA 3C1SA 1ZYEA 3CRTA 3N9JA 3IK7A 4ZBBA 1EGOA 4MZCA 1SJ6A 4LLRA 5ELAA 1X9WB 5J9BA 1SYXA 1PGTA 2GSRA 2JSZA 1O6JA 4TKYA 3IK9A 4Z2RA 2X49A 4NV5A 1GNWA 5ELGA 2KHPA 3E3EA 3I43A 4JU5A 1TTZA 4JR4A 3VWWA 2P5QA 2XHFA 2G2QA 3ERFA 2VCWA 2FNOA 2C0GA 4WEYA 3D5JA 1AAZA 2CAQA 3RBTA 3P8WA 4BL7A 3DIEA 4F2IA 1SD8A 3F63A 2CAIA 3UAPA 4YAPA 1PQNA 2KP1A 1M2AA 4F82A 3IHGA 1NHOA 2KUCA 1X5CA 2VM2A 3FR6A 1UA5A 3UJ1A 4TXOB 1V57A 4QL9A 2ALBA 4FYUA 4MA9A 4GXZA 5CYYA 3IC8A 1GSFA 1X5DA 4DSSA 3GL5A 2VAFA 5DQSA 1GTIA 3UARA 3D0ZA 3HJPA 1PX7A 4NHZA 5DDLA 4FH8A 3R2QA 3F0IA 3TKSE 4EDZA 4JR6A 5AN1A 1QFNA 3DVWA 5D9WA 2REMA 2HXKA 2GQKA 2TRCP 1M9AA 2L4QA 3KD0A 4ECBA 3Q74A 1G6YA 3FMWA 3LXZA 6GSWA 2JSYA 3FW2A 4DEJA 4K1FA 1ZL9A 1LBKA 2HI7A 1WOUA 2VD0A 4KGIA 5J4UA 3LWAA 2YZUA 4GQFA 5H5QA 4F9ZA 4AGSA 4MDCA 3FZ5A 1O8XA 3VWXA 1AQVA 2EIRA 4MJBA 5DQYA 3GN3A 1TRWA 4IP6A 4N0ZA 2B5YA 3TUEA 2HNLA 1GSSA 1XWCA 2DJKA 3PR8A 3ZIJA 3M9JA 4AJ7A 5HR2A 1UVZA 4V1Ag 5DCGA 4TN8A 3LFLA 4N0VA 1B4QA 4FYBA 4ZL9A 4HUAA 2HE3A 2XPEA 2K8VA 5IM9A 5G2ZA 2K8SA 2H1GA 2CVBA 1S3AA 1A0RP 1MD4A 3GIXA 2DSAA 4HOJA 2H76A 4CHSA 1A8LA 4RUVA 3FHKA 19GSA 2YCDA 1JLVA 2IFQB 4YKGA 3G7IA 4TR4A 2QC7A 3LJRA 4KUNA 4N11A 4HDEA 1GUHA 4XS4B 3ME8A 4F03A 1ZMAA 4G2EA 2JU5A 4MH3A 3RAZA 2JZTA 2VM1A 2F8FA 3HA9A 2WZ9A 2DMMA 3PINA 1FHEA 3KIJA 1EOGA 4GSSA 4TRXA 3ZZXA 3ZIVA 5ID2B 3F6FA 12GSA 2E7PA 1VF3A 2PVOC 2ZCTA 4ZB6A 4XTSA 1AW9A 5ECKB 5HR1A 9GSSA 4MPGA 3MDKA 4WR5A 3GUSA 1TOFA 5D9TA 4JEDA 4X0XA 3TJJA 2JZSA 1A0FA 4MABA 1FO5A 2F9SA 3EU3A 3E0UA 4TOPA 5CP1A 2LJAA 1ERUA 2C3NA 4IS0A 1FAAA 3NOFA 3KP9A 2V6KA 1PL1A 3GYKA 3MSZA 3R3EA 4IQ1A 1K0CA 3W8JA 1XOBA 2QA1A 2E0QA 2GZPA 3DKSA 4HEA2 1YJ6A 2YWOA 1SJIA 1M2BA 1PKWA 1SKWB 1URMA 5GAPD 3TJKA 3IPZA 3TKSA 4LA1A 1XVQA 4PGTA 4PQIA 3CSHA 5EVOA 4I97A 1N2AA 3MIXA 5DVBA 1ZYNA 2C0EA 3EMPA 1TK0B 2FWGA 3FR3A 22GSA 1CQHA 2B7KA 3FEUA 2VL2C 4POMA 4AF2A 1TU7A 1U87A 1BEDA 1TRUA 1A2LA 3FZ4A 4KF9A 3L0HA 5EY6A 4WKWA 5HQPA 1G7OA 1WPIA 3VI7A 3BBYA 5G1KA 1PKZA 6GSYA 2K9FA 3M8NA 3IBHA 5JCGA 2HLSA 5D73A 1GUMA 2C8UA 5H5SA 3O3TA 4P3YB 3C8EA 4KX4A 2H70A 3TRQA 3ZFBA 1CQGA 2OJLA 3K8NA 3FY7A 4ZXGA 4YAVA 1ABAA 5DCHA 4ZB8A 3WYWA 4BWSA 4MCUA 1QXHA 2C3QA 3FRCA 3I6AA 1EV4A 5D9XA 2H66A 3ZFLA 2LSTA 5ECOB 3VWVA 1TKDB 4J57E 3C7MA 2I3YA 4PX1A 4WETA 1GSUA 2QGVA 4YQMA 2GTUA 4MZWA 1BQ7A 3J7Yk 5AGYA 4BVXB 2I9HA 1HD2A 2L6CA 5H5RA 3C71A 3GH9A 2C4JA 5ECMB 1EEJA 4EF0A 2A4HA 1DSBA 1ML6A 4TR3A 2K18A 3SWLA 2K6VA 4ML1A 3JCML 4IJ3A 5C04A 1F6MC 4LMVA 4QL7A 1DBYA 2OADA 3DMLA 4O5UA 4IJIA 3KH7A 4G10A 3S9FA 2DKHA 3UOMA 3W6GA 4NPBA 5JCWA 1R5PA 2FHEA 4HU9A 4ACSA 4DVCA 1SL2B 1TW9A 1ACVA 5CRDA 2B3SA 4POBA 2IMDA 4WXTA 4TR0A 4IQAA 1TU8A 3V1WA 4JE1A 3LGCA 18GSA 5CAXA 2OBKA 2AV4A 1XW5A 4RI6A 1PD21 1MDJA 1OAZA 1DE2A 3ISOA 1MDIA 3U6VA 3NIVA 1EWXA 2MYGA 4KW6A 4I5QA 3A2VA 1B4PA 2CZ3A 4RI7A 3HZ8A 4CDOA 4N30A 5A4UA 1GL8A 2HZEA 1S3CA 5IMZA 3EC3A 2PWJA 1X0RA 4IP1A 2L6DA 1PMTA 1HNCA 2LNTA 2GT5A 3GRXA 3A5WA 3VWUA 1GUKA 3WGDA 4ULXA 5L71A 5ENUA 2B5XA 4EL1A 3GKKA 1WIKA 4EO3A 2MBTA 2MMOA 1R7HA 1XCCA 1Z6MA 3ZRDA 2IWTA 1QMVA 5LNKe 1AUCA 2GVPA 2FA4A 1B9YC 4X43A 3LORA 4KCEA 4K7IA 1YF1A 3UVHA 1GSYA 2IMEA 1OC8A 4Z7XA 2WDUA 2G0FA 2HRNA 1I5GA 4I2UA 1QUWA 4PUAA 2HSMA 2P0GA 4KH7A 1SK0A 5CRWA 4G19A 2DJJA 2PPTA 4Q5FA 3P90A 5E4WA 3LYPA 4BPYA 5DALA 2PU9C 3QMXA 1THXA 2ON7A 4KB3A 2O7KA 3KMNA 1TJDA 2ON5A 4NAXA 4TR1A 2R6KA 1XIYA 3GMFA 4JRRA 4EIPA 2HRFA 1ZOFA 3WT2A 1OC9A 3A5IA 1FB0A 4HI7A 4KE3A 1GTBA 5AIVA 5J5NA 3GNJA 2VO4A 2CQ9A 4O5RA 2B1LA 2X64A 4EE0A 16GSA 1GSDA 4OD7A 2EC4A 3KH9A 1SL0B 1Z6NA 2IIYA 3H4KA 1XWKA 4MF7A 4I6XA 3RHBA 3F4TA 1YEXA 3PGTA 1TI1A 3TB2A 2FY6A 3IA1A 3A2WA 4PUFC 4KDXA 1YKAA 2PMTA 1NHYA 3APQA 5EL8A 2H1DA 3VFIA 5DAKA 3ME7A 1TI3A 1ERWA 4BVYB 5KN3A 8GSSA 2GSSA 5CRHA 1V40A 3HYPA 4HQSA 2FWFA 5J3RA 1TDIA 3ZITA 20GSA 3TOUA 3RHCA 2R37A 1JZOA 4WF4A 1YZXA 4XS1A 1T00A 2QKEA 4WBJA 3TCOA 1SENA 2WCIA 3KJYA 4O5QA 1XWGA 3DD3A 4BWQA 2PGTA 4L0WA 3HVSA 2I81A 3L9VA 4ZBDA 2OBIA 3QOUA 3O76A 3MNGA 2JZRA 4OWYA 3IE3A 1HNBA 3FR9A 3F4RA 3DGQA 2PUKC 14GSA 2CV4A 4ZL7A 2C80A 3FKFA 4DSQA 1SJZA 4A5PA 3U5RE 4OCFA 3DYRA 5IMFA 2O8VB 4G0KA 1HQOA 1O85A 4I8BA 1V2AA 2VL3A 4EDYA 3QPMA 1A8YA 5CNWA 1JZRA 4YKFA 4GSTA 3GURA 2IJYA 4JBBA 1XW9A 4OO5A 5G1LA 2X99A 3VURA 3ERWA 2MBSA 1ILOA 11GSA 3L4NA 1PRXA 1QQ2A 2YWIA 3IAM2 3KMOA 3D22A 1N8JA 2B6MA 1NSWA 1GSQA 2C1YA 2CVDA 4HZ4A 1GLPA 2BJXA 2YJ7A 4BL7B 5E59A 1F37A 3BOAA 3D21A 4ECJA 1V58A 3HZ4A 2CX4A 5D8IA 1F9MA 3EURA 5FHIA 1XBSA 4LMWA 3KM6A 3HDCA 2IL3A 5D9VA 3F3QA 2WFCA 2VL2A 1QK8A 4F0BA 2TIRA 2AJQB 1DUGA 3LXTA 2JL4A 2VD1A 4DSSB 5F05A 5ECIB 2HZFA 4K5SA 2LRNA 4MK3A 2OA7A 1MDKA 3SBCA 2F51A 3KTLA 3ZREA 5IPGA 2LQOA 2MZCA 3CBUA 2YWNA 4E8HA 1AC1A 4MF5A 2DLXA 3FZ9A 1OC3A 3UVTA 3BJ5A 2VL9A 1X5EA 1OE7A 3G7JA 2R4VA 5F07A 2L4CA 4E8EA 4MH2A 1WJKA 4N10A 3QFBC 5COHA 2ZNMA 4ISDA 3HVVA 4NXIA 2VLUA 3DEXA 2AHEA 1K0OA 2WULA 2VLTA 1EP8A 2B7JA 3N5OA 7GSSA 1O8WA 1RW1A 3EINA 3QCPA 5IOWA 4WBRD 1F3BA 4BA7A 4K6XA 2H74A 3DVXA 1EEMA 1Y25A 4KA0A 1BX9A 3KCMA 4XHMA 2H1AA 3BCIA 1M99A 2LQQA 1OKTA 2YANA 5JWOB 2N5FA 2VLVA 1XFLA 3ZMLA 5ECRB 1GSEA 5F0GA 4MP4A 2YP6A 4MZBA 3TKQA 1XOAA 4IELA 1J08A 1E6BA 3ED3A 3EYTA 1EV9A 5INYA 2H01A 5DJMA 4K8MA 4Q5RA 2HT9A 1XXUA 4MNNA 5KN0A 5LCZA 3QD9A 1XZOA 2FWHA 4OFMA 1A2MA 4XIHA 1VF4A 1NW2A 3GTUA 1AXDA 3GL3A 2H71A 3M9KA 1FOHA 1XW6A 3GA4A 4ZL8A 2R3XA 2XBIA 1B8XA 3ZVJD 1MEKA 2BMXA 4D73A 2WRTA 3APSA 3TKRA 1TRVA 3IAS2 3UEMA 1T3BA 1K0AA 4NWYA 1Z9HA 2EIQA 3Q6OA 1GTAA 5IO0A 2NVLA 3F8UA 1JLWA 1M0UA 2B5EA 3TJFA 6GSSA 13GSA 2H6XA 3TKPA 2I4AA 17GSA 4Q5NA 4TW5A 2H8LA 1V9WA 2KOKA 4KAEA 3C73A 2FUG2 3NZNA 6GSVA 4GWRA 2XPDA 5BRTA 1K0NA 3W8SA 2WS2A 1T8EB 3J7Yb 3UIWA 1EGRA 4KDUA 3E9JB 2GS3A 5DBQA 5ECLB 1M9BA 3IRAA 1K3LA 2GT6A 2V2GA 6GSXA 4IHUA 1U6TA 3KXOA 2LJRA 2XC2A 3IDVA 3CSIA 4NMUA 1FB6A 1A2JA 3EE2A 2LEGA 4PURA 1BJXA 3KTBA 1EZKA 2H0GA 5ECNB 1FG4A 2X8CA 5G5EA 2OACA 2OKAA 4ZBAA 1SU9A 5D93A 3AY8A 1HNAA 2O89A 3F3RA 4IBPA 1DE1A 3A3TA 4MMMA 3RPNA 4ZIJA 2A2SA 3KZQA 3LQ7A 2YV9A 3MAKA 1U88A 5KEJA 2LNSA 5A4WA 3H93A 4K5RA 2HSYA 1VRSD 3FK8A 3UBKA 2XBQA 1RK4A 4J56E 1O81A 2YZHA 1O73A 1EOHA 4NV2A 2YPMA 2WGRA 1FW1A 2OE0A 4EC0A 1GNEA 4AJ6A 1J0FA 3ZYWA 2PVQA 2DIYA 4EKZA 2MMZA 4HJ2A 4ZB9A 3O6TA 2AUVA 4WR4A 2N5BA 4TXOA 4FO5A 4V2MA 2X4AA 3GX0A 4HQZA 2R0GA 1R26A 3M3MA 2H1BA 3M0FA 3IOSA 2A2PA 3RPPA 1Z5YE 5HR3A 1OKDA 2KP2A 1C72A 1T1VA 4OFTA 3LG6A 5FT3A 4XCSA 2DMLA 2X8HA 5FWGA 4O7HA 4Q5QA 5B8AA 2CA8A 4USSA 1PN9A 1WRYA 4YQVA 2I1UA 2L5OA 2YV7A 4KDYA 4GLTA 1H75A 5EPFA 3TJBA 1O7UA 2LTKA 3DWVA 1BYEA 2GZYA 4K2XA 4GTUA 5AISA 2HYXA 3F4SA 1JZDA 3LSZA 2IPAA 3G9BA 1S3DA 5GZZB 4X1UA 1OVNA 3EMXA 3D6IA 4F0CA 4G9HA 2VCXA 3KGKA 3IV4A 4O92A 5ECSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GV1 A;  4GCI A;  4PQ1 A;  4XRA A;  4WF5 A;  2N5A A;  4XS6 A;  3CRU A;  2HSH A;  2H75 A;  3VK9 A;  2H73 A;  4LL1 B;  3GKM A;  1R4W A;  2M72 A;  5HR0 A;  1XVW A;  2AYT A;  4YH2 A;  2HZE B;  3ZVJ A;  5IIZ A;  5J9C A;  1M2D A;  4KSM A;  2H6Z A;  2YOI A;  2O87 A;  3GFK A;  1EP7 A;  1T4Y A;  4LL4 B;  4KSO A;  1XWB A;  1T4Z A;  3IXR A;  1E2Y A;  4RQR A;  3GKX A;  2IFQ A;  4XS4 A;  1W89 A;  4DSR A;  5IMV A;  5IMD A;  3QAW A;  3TRP A;  2BTO T;  5CO3 A;  5IMA A;  3MWH A;  1GRX A;  2C0D A;  2ZUP A;  3VI5 A;  3CYN A;  3FZA A;  3HKR A;  3QAG A;  5B6M A;  1OYJ A;  5ID2 A;  2V6O A;  4YQU A;  3UL3 A;  5A4V A;  4L5L A;  3P7X A;  2RM5 A;  2H6Y A;  1UC7 A;  2F8A A;  1KBN A;  4HU7 A;  1THO A;  2L59 A;  4HJM A;  4HS1 A;  1T7P B;  1TP9 A;  4FIW A;  2E2G A;  3TOT A;  4L0U A;  1PA3 A;  1Z7R A;  2RUE A;  3WGE A;  1YY7 A;  5DAL B;  5IMC A;  1H4O A;  1BG5 A;  1GWC A;  3GKN A;  1F2E A;  1G0T A;  3TDG A;  1JFU A;  4IW9 A;  3Q19 A;  4TR1 B;  1X9M B;  4EVM A;  3GX8 A;  1GH2 A;  1FOV A;  3CTF A;  3D4M A;  2LRC A;  2L57 A;  1OC9 B;  3QFA C;  2PN8 A;  2CX3 A;  1SL1 B;  4ILF A;  5A5K A;  3IR4 A;  1ON4 A;  5C00 A;  1SK2 A;  2X8G A;  3GST A;  3LYK A;  2CT6 A;  1U3I A;  2P31 A;  4V1A p;  1JHB A;  4PNF A;  1WWJ A;  3CMI A;  1XPV A;  3HCZ A;  2DJ1 A;  1ZYQ B;  3F6D A;  4K2D A;  2NPB A;  6GSU A;  1YEP A;  2LRT A;  2DC5 A;  1RQM A;  2AB6 A;  4EUY A;  2WB9 A;  1SK1 A;  1PSQ A;  5DAK B;  5G30 A;  2KLX A;  2AAW A;  3QAV A;  4ZIL A;  4GRF A;  1TRS A;  1Y6E A;  4ECC A;  1J9B A;  1QGV A;  2FA8 A;  3A2X A;  3C1R A;  5GAN D;  1K0B A;  5JWR B;  4OFN A;  2R2J A;  3L78 A;  3PH9 A;  5B8B A;  1XWA A;  1TK8 B;  4PXO A;  4K9Z A;  1ZZY A;  2VUP A;  4JZQ A;  5ABR A;  3VLN A;  1BAY A;  4I2T A;  5AIX A;  3KP8 A;  3US3 A;  2C0F A;  1NM3 A;  2H0H A;  5GSS A;  4PQH A;  2IN3 A;  4K0G A;  5CRG A;  2GLR A;  1VF2 A;  1V98 A;  3ZMK A;  3TRX A;  1F3A A;  5HFG A;  1SKS B;  2M46 A;  2YJH A;  3HJM A;  4GQC A;  3WD6 A;  2PBJ A;  1A24 A;  5D96 A;  2V41 A;  3QDN A;  4L8E A;  3WGX A;  2DJ3 A;  2GQM A;  4POK A;  4QQ7 A;  2GZZ A;  4IN0 A;  3LEF A;  4BVX A;  5B6N A;  1G7E A;  2FWE A;  2VCZ A;  3I69 A;  2DJ2 A;  4GSN A;  5KN2 A;  4XRD A;  2NBS A;  2C3T A;  1ST9 A;  2JAC A;  2DJ0 A;  4ID0 A;  1GTU A;  2M80 A;  5GST A;  1VGL A;  2JAD A;  2J9H A;  4KND A;  3WT1 A;  4OCE A;  1K3O A;  4NHW A;  3H1N A;  1GP1 A;  1IYH A;  2MMN A;  2RLI A;  2TRX A;  2IMF A;  1UN2 A;  4EXJ A;  4K7N A;  2HFD A;  1G6W A;  1USB A;  5ECP B;  1X9S B;  4HZ2 A;  1ZCP A;  1LU4 A;  1YDK A;  2FD3 A;  2FGX A;  3L9U A;  2IMI A;  4MPF A;  2J23 A;  3VPT A;  3I9V 2;  1AIU A;  1GLQ A;  3HY2 A;  5JCU A;  2RII A;  4K7O A;  2L5L A;  3G7Y A;  5F06 A;  3M1G A;  3GHA A;  2RUF A;  4CW9 A;  1Z7P A;  5IO2 A;  1Q98 A;  2VCQ A;  5CRE A;  1FVJ A;  1GUL A;  5ECH B;  2YWM A;  2GST A;  5HFI A;  1IYI A;  2DIZ A;  2D2Z A;  3TJG A;  1OE8 A;  3H79 A;  1JZW A;  1Z3E A;  1PL2 A;  2GQL A;  3UBL A;  5KN1 A;  1ERT A;  1YKC A;  2RM6 A;  2H30 A;  1K3Y A;  3ZLP A;  1MD3 A;  5G31 A;  2VIM A;  1HYU A;  1KEB A;  2ES7 A;  4AJ8 A;  1B9X C;  2OE3 A;  1VF1 A;  1LJR A;  5LD0 A;  1AQW A;  2NTO A;  3FYG A;  3QR6 A;  1MTC A;  1SKR B;  2GDR A;  3H8Q A;  1WMJ A;  4ML6 A;  3TKS C;  3EVI A;  4TVE A;  1YQ1 A;  3HD5 A;  4MF6 A;  2V32 A;  2O85 A;  3APO A;  1YF0 A;  3TGZ A;  1M7T A;  2GSQ A;  2FLS A;  1B48 A;  10GS A;  4PNG A;  5IQY A;  1TXX A;  2CVK A;  1WE0 A;  4MLY A;  3ZL5 A;  4MJA A;  5HFK A;  1WP0 A;  1KNG A;  3CSJ A;  1KTE A;  3Q18 A;  3GH6 A;  1ERV A;  2YNX A;  6GST A;  2WJU A;  1Q4J A;  2YN1 A;  4L5O A;  1R5A A;  2LKU A;  3P2A A;  1SYR A;  5F8B A;  1U3A A;  3EU4 A;  1FVK A;  3GSS A;  3ZTL A;  3DRN A;  4K0N A;  1AQX A;  2B1K A;  2LS5 A;  3OR5 A;  1ZGN A;  3HJO A;  1K0M A;  2E2M A;  2LJK A;  3BCK A;  1SD9 A;  3L9S A;  2LUS A;  3RDW A;  4IKH A;  2VCT A;  5JWQ B;  3GTU B;  4O32 A;  4IGJ A;  1W4V A;  4KCA A;  4POL A;  1A23 A;  5IPH A;  2CZ2 A;  4D73 B;  5IOX A;  4IVF A;  4H86 A;  4OO4 A;  2NDO A;  3CXG A;  4V2N A;  2EIO A;  3IC4 A;  4BVY A;  2H19 A;  2GGT A;  4FYC A;  4OMV A;  4RQX A;  3HVX A;  2F3M A;  3EWL A;  3ERG A;  2LV3 A;  3IHQ A;  3BD2 A;  3CTG A;  3HHV A;  2A2R A;  3UMA A;  2FCH A;  2V1M A;  4V2L A;  1PX6 A;  5B7C A;  3HXS A;  2H0I A;  2VOC A;  3DXB A;  4ECI A;  2IMK A;  1K0D A;  5DJL A;  4MJC A;  4MJE A;  5J41 A;  2P5R A;  3VPQ A;  4GF0 A;  2PER A;  4J2F A;  1TK5 B;  2Z9S A;  3F9U A;  4TXV A;  3KEB A;  2MMA A;  2VCV A;  5G5F A;  1I9D A;  5ECQ B;  3D4T A;  2H72 A;  2QSI A;  2A4V A;  2R5G A;  2OE1 A;  2DBC A;  3C1S A;  1ZYE A;  3CRT A;  3N9J A;  3IK7 A;  4ZBB A;  1EGO A;  4MZC A;  1SJ6 A;  4LLR A;  5ELA A;  1X9W B;  5J9B A;  1SYX A;  1PGT A;  2GSR A;  2JSZ A;  1O6J A;  4TKY A;  3IK9 A;  4NV5 A;  1GNW A;  5ELG A;  2KHP A;  3E3E A;  3I43 A;  4JU5 A;  1TTZ A;  4JR4 A;  3VWW A;  2P5Q A;  2XHF A;  2G2Q A;  3ERF A;  2VCW A;  2FNO A;  2C0G A;  4WEY A;  3D5J A;  1AAZ A;  2CAQ A;  3RBT A;  3P8W A;  4BL7 A;  3DIE A;  4F2I A;  1SD8 A;  3F63 A;  2CAI A;  3UAP A;  4YAP A;  1PQN A;  2KP1 A;  1M2A A;  4F82 A;  1NHO A;  2KUC A;  1X5C A;  2VM2 A;  3FR6 A;  1UA5 A;  3UJ1 A;  4TXO B;  1V57 A;  4QL9 A;  2ALB A;  4FYU A;  4MA9 A;  4GXZ A;  5CYY A;  1GSF A;  1X5D A;  4DSS A;  3GL5 A;  2VAF A;  5DQS A;  1GTI A;  3UAR A;  3D0Z A;  3HJP A;  1PX7 A;  4NHZ A;  5DDL A;  4FH8 A;  3R2Q A;  3F0I A;  3TKS E;  4EDZ A;  4JR6 A;  5AN1 A;  1QFN A;  3DVW A;  5D9W A;  2REM A;  2HXK A;  2GQK A;  2TRC P;  1M9A A;  2L4Q A;  3KD0 A;  4ECB A;  3Q74 A;  1G6Y A;  3LXZ A;  6GSW A;  2JSY A;  3FW2 A;  4DEJ A;  4K1F A;  1ZL9 A;  1LBK A;  2HI7 A;  1WOU A;  2VD0 A;  4KGI A;  5J4U A;  3LWA A;  2YZU A;  4GQF A;  5H5Q A;  4F9Z A;  4AGS A;  4MDC A;  3FZ5 A;  1O8X A;  3VWX A;  1AQV A;  2EIR A;  4MJB A;  5DQY A;  3GN3 A;  1TRW A;  4IP6 A;  4N0Z A;  2B5Y A;  3TUE A;  2HNL A;  1GSS A;  1XWC A;  2DJK A;  3PR8 A;  3ZIJ A;  3M9J A;  4AJ7 A;  5HR2 A;  1UVZ A;  4V1A g;  5DCG A;  4TN8 A;  3LFL A;  4N0V A;  1B4Q A;  4FYB A;  4ZL9 A;  4HUA A;  2HE3 A;  2XPE A;  2K8V A;  5IM9 A;  5G2Z A;  2K8S A;  2H1G A;  2CVB A;  1S3A A;  1A0R P;  1MD4 A;  3GIX A;  2DSA A;  4HOJ A;  2H76 A;  4CHS A;  1A8L A;  4RUV A;  3FHK A;  19GS A;  2YCD A;  1JLV A;  2IFQ B;  3G7I A;  4TR4 A;  2QC7 A;  3LJR A;  4KUN A;  4N11 A;  4HDE A;  1GUH A;  4XS4 B;  3ME8 A;  4F03 A;  1ZMA A;  4G2E A;  2JU5 A;  4MH3 A;  3RAZ A;  2JZT A;  2VM1 A;  2F8F A;  3HA9 A;  2WZ9 A;  2DMM A;  3PIN A;  1FHE A;  3KIJ A;  1EOG A;  4GSS A;  4TRX A;  3ZZX A;  3ZIV A;  5ID2 B;  3F6F A;  12GS A;  2E7P A;  1VF3 A;  2PVO C;  2ZCT A;  4ZB6 A;  4XTS A;  1AW9 A;  5ECK B;  5HR1 A;  9GSS A;  4MPG A;  3MDK A;  4WR5 A;  3GUS A;  1TOF A;  5D9T A;  4JED A;  4X0X A;  3TJJ A;  2JZS A;  1A0F A;  4MAB A;  1FO5 A;  2F9S A;  3EU3 A;  3E0U A;  4TOP A;  5CP1 A;  2LJA A;  1ERU A;  2C3N A;  4IS0 A;  1FAA A;  3NOF A;  3KP9 A;  2V6K A;  1PL1 A;  3GYK A;  3MSZ A;  4IQ1 A;  1K0C A;  3W8J A;  1XOB A;  2E0Q A;  2GZP A;  3DKS A;  4HEA 2;  1YJ6 A;  2YWO A;  1SJI A;  1M2B A;  1PKW A;  1SKW B;  1URM A;  5GAP D;  3TJK A;  3IPZ A;  3TKS A;  4LA1 A;  1XVQ A;  4PGT A;  4PQI A;  3CSH A;  5EVO A;  4I97 A;  1N2A A;  5DVB A;  2C0E A;  3EMP A;  1TK0 B;  2FWG A;  3FR3 A;  22GS A;  1CQH A;  2B7K A;  3FEU A;  2VL2 C;  4POM A;  4AF2 A;  1TU7 A;  1U87 A;  1BED A;  1TRU A;  1A2L A;  3FZ4 A;  3L0H A;  5EY6 A;  4WKW A;  5HQP A;  1G7O A;  1WPI A;  3VI7 A;  3BBY A;  5G1K A;  1PKZ A;  6GSY A;  2K9F A;  3M8N A;  3IBH A;  5JCG A;  2HLS A;  5D73 A;  1GUM A;  2C8U A;  5H5S A;  3O3T A;  4P3Y B;  3C8E A;  4KX4 A;  2H70 A;  3TRQ A;  3ZFB A;  1CQG A;  2OJL A;  3K8N A;  3FY7 A;  4ZXG A;  4YAV A;  1ABA A;  5DCH A;  4ZB8 A;  3WYW A;  4BWS A;  4MCU A;  1QXH A;  2C3Q A;  3FRC A;  3I6A A;  1EV4 A;  5D9X A;  2H66 A;  3ZFL A;  2LST A;  5ECO B;  3VWV A;  1TKD B;  4J57 E;  3C7M A;  2I3Y A;  4PX1 A;  4WET A;  1GSU A;  2QGV A;  4YQM A;  2GTU A;  4MZW A;  1BQ7 A;  3J7Y k;  5AGY A;  2I9H A;  1HD2 A;  2L6C A;  5H5R A;  3C71 A;  3GH9 A;  2C4J A;  5ECM B;  1EEJ A;  4EF0 A;  1DSB A;  1ML6 A;  4TR3 A;  2K18 A;  3SWL A;  2K6V A;  4ML1 A;  3JCM L;  4IJ3 A;  5C04 A;  1F6M C;  4LMV A;  4QL7 A;  1DBY A;  2OAD A;  3DML A;  4IJI A;  3KH7 A;  4G10 A;  3S9F A;  3UOM A;  3W6G A;  4NPB A;  5JCW A;  1R5P A;  2FHE A;  4HU9 A;  4ACS A;  4DVC A;  1SL2 B;  1TW9 A;  1ACV A;  5CRD A;  2B3S A;  4POB A;  2IMD A;  4WXT A;  4TR0 A;  4IQA A;  1TU8 A;  3V1W A;  4JE1 A;  3LGC A;  18GS A;  5CAX A;  2OBK A;  2AV4 A;  1XW5 A;  4RI6 A;  1PD2 1;  1MDJ A;  1OAZ A;  1DE2 A;  3ISO A;  1MDI A;  3U6V A;  3NIV A;  1EWX A;  2MYG A;  4KW6 A;  4I5Q A;  3A2V A;  1B4P A;  2CZ3 A;  4RI7 A;  3HZ8 A;  4CDO A;  4N30 A;  5A4U A;  1GL8 A;  2HZE A;  1S3C A;  5IMZ A;  3EC3 A;  2PWJ A;  1X0R A;  4IP1 A;  2L6D A;  1PMT A;  1HNC A;  2LNT A;  2GT5 A;  3GRX A;  3A5W A;  3VWU A;  1GUK A;  3WGD A;  4ULX A;  5L71 A;  5ENU A;  2B5X A;  4EL1 A;  3GKK A;  1WIK A;  4EO3 A;  2MBT A;  2MMO A;  1R7H A;  1XCC A;  1Z6M A;  3ZRD A;  2IWT A;  1QMV A;  5LNK e;  1AUC A;  2GVP A;  2FA4 A;  1B9Y C;  4X43 A;  3LOR A;  4KCE A;  4K7I A;  1YF1 A;  3UVH A;  1GSY A;  2IME A;  1OC8 A;  4Z7X A;  2WDU A;  2G0F A;  2HRN A;  1I5G A;  4I2U A;  1QUW A;  4PUA A;  2P0G A;  4KH7 A;  1SK0 A;  5CRW A;  4G19 A;  2DJJ A;  2PPT A;  4Q5F A;  3P90 A;  5E4W A;  3LYP A;  4BPY A;  5DAL A;  2PU9 C;  3QMX A;  1THX A;  2ON7 A;  4KB3 A;  2O7K A;  3KMN A;  1TJD A;  2ON5 A;  4NAX A;  4TR1 A;  2R6K A;  1XIY A;  3GMF A;  4JRR A;  2HRF A;  1ZOF A;  3WT2 A;  1OC9 A;  1FB0 A;  4HI7 A;  4KE3 A;  1GTB A;  5AIV A;  5J5N A;  3GNJ A;  2VO4 A;  2CQ9 A;  4O5R A;  2B1L A;  2X64 A;  4EE0 A;  16GS A;  1GSD A;  4OD7 A;  2EC4 A;  3KH9 A;  1SL0 B;  1Z6N A;  2IIY A;  3H4K A;  1XWK A;  4MF7 A;  4I6X A;  3RHB A;  3F4T A;  1YEX A;  3PGT A;  1TI1 A;  3TB2 A;  2FY6 A;  3IA1 A;  3A2W A;  4PUF C;  4KDX A;  1YKA A;  2PMT A;  1NHY A;  3APQ A;  5EL8 A;  2H1D A;  3VFI A;  5DAK A;  3ME7 A;  1TI3 A;  1ERW A;  5KN3 A;  8GSS A;  2GSS A;  5CRH A;  1V40 A;  3HYP A;  4HQS A;  2FWF A;  5J3R A;  1TDI A;  3ZIT A;  20GS A;  3TOU A;  3RHC A;  2R37 A;  1JZO A;  4WF4 A;  1YZX A;  4XS1 A;  1T00 A;  2QKE A;  4WBJ A;  3TCO A;  1SEN A;  2WCI A;  3KJY A;  1XWG A;  3DD3 A;  4BWQ A;  2PGT A;  4L0W A;  3HVS A;  2I81 A;  3L9V A;  4ZBD A;  2OBI A;  3QOU A;  3O76 A;  3MNG A;  2JZR A;  4OWY A;  3IE3 A;  1HNB A;  3FR9 A;  3F4R A;  3DGQ A;  2PUK C;  14GS A;  2CV4 A;  4ZL7 A;  2C80 A;  3FKF A;  4DSQ A;  1SJZ A;  3U5R E;  4OCF A;  3DYR A;  5IMF A;  2O8V B;  4I8B A;  1HQO A;  1O85 A;  1V2A A;  2VL3 A;  4EDY A;  3QPM A;  1A8Y A;  5CNW A;  1JZR A;  4GST A;  3GUR A;  2IJY A;  4JBB A;  1XW9 A;  4OO5 A;  5G1L A;  2X99 A;  3VUR A;  3ERW A;  2MBS A;  1ILO A;  11GS A;  3L4N A;  1PRX A;  1QQ2 A;  2YWI A;  3IAM 2;  3KMO A;  3D22 A;  1N8J A;  2B6M A;  1NSW A;  1GSQ A;  2C1Y A;  2CVD A;  4HZ4 A;  1GLP A;  2BJX A;  2YJ7 A;  5E59 A;  1F37 A;  3BOA A;  3D21 A;  4ECJ A;  1V58 A;  3HZ4 A;  2CX4 A;  5D8I A;  1F9M A;  3EUR A;  5FHI A;  1XBS A;  4LMW A;  3KM6 A;  3HDC A;  2IL3 A;  5D9V A;  3F3Q A;  2WFC A;  2VL2 A;  1QK8 A;  4F0B A;  2TIR A;  2AJQ B;  1DUG A;  3LXT A;  2JL4 A;  2VD1 A;  4DSS B;  5F05 A;  5ECI B;  2HZF A;  2LRN A;  4MK3 A;  2OA7 A;  1MDK A;  3SBC A;  2F51 A;  3KTL A;  3ZRE A;  5IPG A;  2LQO A;  2MZC A;  3CBU A;  2YWN A;  4E8H A;  1AC1 A;  4MF5 A;  2DLX A;  3FZ9 A;  1OC3 A;  3UVT A;  3BJ5 A;  2VL9 A;  1X5E A;  1OE7 A;  3G7J A;  2R4V A;  5F07 A;  2L4C A;  4E8E A;  4MH2 A;  1WJK A;  4N10 A;  3QFB C;  5COH A;  2ZNM A;  4ISD A;  3HVV A;  4NXI A;  2VLU A;  3DEX A;  2AHE A;  1K0O A;  2WUL A;  2VLT A;  1EP8 A;  2B7J A;  3N5O A;  7GSS A;  1O8W A;  1RW1 A;  3EIN A;  3QCP A;  5IOW A;  4WBR D;  1F3B A;  4BA7 A;  4K6X A;  2H74 A;  3DVX A;  1EEM A;  1Y25 A;  4KA0 A;  1BX9 A;  3KCM A;  4XHM A;  2H1A A;  3BCI A;  1M99 A;  2LQQ A;  1OKT A;  2YAN A;  5JWO B;  2N5F A;  2VLV A;  1XFL A;  3ZML A;  5ECR B;  1GSE A;  5F0G A;  4MP4 A;  2YP6 A;  4MZB A;  3TKQ A;  1XOA A;  4IEL A;  1J08 A;  1E6B A;  3ED3 A;  3EYT A;  1EV9 A;  5INY A;  2H01 A;  5DJM A;  4K8M A;  4Q5R A;  2HT9 A;  1XXU A;  5KN0 A;  5LCZ A;  3QD9 A;  1XZO A;  2FWH A;  4OFM A;  1A2M A;  4XIH A;  1VF4 A;  1NW2 A;  3GTU A;  1AXD A;  3GL3 A;  2H71 A;  3M9K A;  1XW6 A;  3GA4 A;  4ZL8 A;  2R3X A;  2XBI A;  1B8X A;  3ZVJ D;  1MEK A;  2BMX A;  4D73 A;  2WRT A;  3APS A;  3TKR A;  1TRV A;  3IAS 2;  3UEM A;  1T3B A;  1K0A A;  4NWY A;  1Z9H A;  2EIQ A;  3Q6O A;  1GTA A;  5IO0 A;  2NVL A;  3F8U A;  1JLW A;  1M0U A;  2B5E A;  3TJF A;  6GSS A;  13GS A;  2H6X A;  3TKP A;  2I4A A;  17GS A;  4Q5N A;  4TW5 A;  2H8L A;  1V9W A;  2KOK A;  4KAE A;  3C73 A;  2FUG 2;  3NZN A;  6GSV A;  4GWR A;  2XPD A;  1K0N A;  3W8S A;  2WS2 A;  1T8E B;  3J7Y b;  3UIW A;  1EGR A;  4KDU A;  3E9J B;  2GS3 A;  5DBQ A;  5ECL B;  1M9B A;  3IRA A;  1K3L A;  2GT6 A;  2V2G A;  6GSX A;  4IHU A;  1U6T A;  3KXO A;  2LJR A;  2XC2 A;  3IDV A;  3CSI A;  4NMU A;  1FB6 A;  1A2J A;  3EE2 A;  2LEG A;  4PUR A;  1BJX A;  3KTB A;  1EZK A;  2H0G A;  5ECN B;  1FG4 A;  2X8C A;  5G5E A;  2OAC A;  2OKA A;  4ZBA A;  1SU9 A;  5D93 A;  3AY8 A;  1HNA A;  2O89 A;  3F3R A;  4IBP A;  1DE1 A;  3A3T A;  4MMM A;  3RPN A;  4ZIJ A;  2A2S A;  3KZQ A;  3LQ7 A;  2YV9 A;  3MAK A;  1U88 A;  5KEJ A;  2LNS A;  5A4W A;  3H93 A;  2HSY A;  1VRS D;  3FK8 A;  3UBK A;  2XBQ A;  1RK4 A;  4J56 E;  1O81 A;  2YZH A;  1O73 A;  1EOH A;  4NV2 A;  2YPM A;  2WGR A;  1FW1 A;  2OE0 A;  4EC0 A;  1GNE A;  4AJ6 A;  1J0F A;  3ZYW A;  2PVQ A;  2DIY A;  4EKZ A;  2MMZ A;  4HJ2 A;  4ZB9 A;  3O6T A;  2AUV A;  4WR4 A;  2N5B A;  4TXO A;  4FO5 A;  4V2M A;  3GX0 A;  4HQZ A;  1R26 A;  3M3M A;  2H1B A;  3M0F A;  3IOS A;  3RPP A;  1Z5Y E;  5HR3 A;  1OKD A;  2KP2 A;  1C72 A;  1T1V A;  4OFT A;  3LG6 A;  5FT3 A;  4XCS A;  2DML A;  2X8H A;  5FWG A;  4O7H A;  4Q5Q A;  5B8A A;  2CA8 A;  1PN9 A;  1WRY A;  4YQV A;  2I1U A;  2L5O A;  2YV7 A;  4KDY A;  4GLT A;  1H75 A;  5EPF A;  3TJB A;  1O7U A;  2LTK A;  3DWV A;  1BYE A;  2GZY A;  4GTU A;  5AIS A;  2HYX A;  3F4S A;  1JZD A;  3LSZ A;  2IPA A;  3G9B A;  1S3D A;  5GZZ B;  4X1U A;  1OVN A;  3EMX A;  3D6I A;  4F0C A;  4G9H A;  2VCX A;  3KGK A;  3IV4 A;  4O92 A;  5ECS A; 
#chains in the Genus database with same CATH topology
 3GV1 A;  4GCI A;  4PQ1 A;  4XRA A;  4WF5 A;  2N5A A;  4XS6 A;  3CRU A;  2HSH A;  2H75 A;  3VK9 A;  2H73 A;  4LL1 B;  3GKM A;  1R4W A;  2M72 A;  5HR0 A;  1XVW A;  2AYT A;  3EPT A;  4YH2 A;  2HZE B;  3ZVJ A;  5IIZ A;  5J9C A;  1M2D A;  4KSM A;  2H6Z A;  2YOI A;  2O87 A;  3GFK A;  4CY6 A;  1EP7 A;  1T4Y A;  4LL4 B;  4KSO A;  1XWB A;  1T4Z A;  3IXR A;  1E2Y A;  4RQR A;  3GKX A;  3LW9 A;  2IFQ A;  4XS4 A;  1W89 A;  4DSR A;  5IMV A;  5IMD A;  3QAW A;  3TRP A;  4CY8 A;  2BTO T;  5CO3 A;  5IMA A;  3MWH A;  1GRX A;  2C0D A;  2ZUP A;  4EIQ A;  3VI5 A;  3CYN A;  3FZA A;  3HKR A;  3QAG A;  5B6M A;  1OYJ A;  5ID2 A;  2V6O A;  4YQU A;  3UL3 A;  5A4V A;  4L5L A;  3P7X A;  2RM5 A;  2H6Y A;  1UC7 A;  2F8A A;  1KBN A;  4HU7 A;  1THO A;  2L59 A;  4HJM A;  4HS1 A;  1T7P B;  1TP9 A;  4FIW A;  2E2G A;  3TOT A;  4L0U A;  1PA3 A;  1Z7R A;  2RUE A;  2HRA A;  3WGE A;  1YY7 A;  5DAL B;  5IMC A;  1H4O A;  1BG5 A;  1GWC A;  3GKN A;  1F2E A;  1G0T A;  3TDG A;  1JFU A;  4IW9 A;  3Q19 A;  4TR1 B;  1X9M B;  4EVM A;  3GX8 A;  1GH2 A;  1FOV A;  4HSC X;  3CTF A;  3D4M A;  2LRC A;  2L57 A;  1OC9 B;  3QFA C;  2PN8 A;  2CX3 A;  1SL1 B;  4ILF A;  5A5K A;  3IR4 A;  1ON4 A;  5C00 A;  1SK2 A;  2X8G A;  3GST A;  3LYK A;  2CT6 A;  1U3I A;  2P31 A;  4V1A p;  1JHB A;  4PNF A;  1WWJ A;  3CMI A;  1XPV A;  3HCZ A;  2DJ1 A;  1ZYQ B;  3F6D A;  4K2D A;  2NPB A;  6GSU A;  1YEP A;  2LRT A;  2DC5 A;  1RQM A;  2AB6 A;  4EUY A;  2WB9 A;  1SK1 A;  1PSQ A;  5DAK B;  5G30 A;  2KLX A;  2AAW A;  3QAV A;  2QA2 A;  4ZIL A;  4GRF A;  4Z2T A;  1TRS A;  1Y6E A;  4ECC A;  1J9B A;  1QGV A;  2FA8 A;  3A2X A;  1PN0 A;  3C1R A;  5GAN D;  1K0B A;  5BMU A;  5JWR B;  4OFN A;  2R2J A;  3L78 A;  3PH9 A;  5B8B A;  1XWA A;  1TK8 B;  4PXO A;  4K9Z A;  1ZZY A;  2VUP A;  4JZQ A;  5ABR A;  2HRK A;  3VLN A;  1BAY A;  4I2T A;  5AIX A;  3KP8 A;  3US3 A;  2UZ8 A;  2C0F A;  1NM3 A;  2H0H A;  5GSS A;  4PQH A;  2IN3 A;  4K0G A;  5CRG A;  3PPU A;  2GLR A;  1VF2 A;  1V98 A;  3ZMK A;  3TRX A;  1F3A A;  5HFG A;  1SKS B;  2M46 A;  2YJH A;  3HJM A;  4GQC A;  3WD6 A;  2PBJ A;  1A24 A;  5D96 A;  2V41 A;  3QDN A;  4L8E A;  3WGX A;  2DJ3 A;  2GQM A;  4POK A;  4QQ7 A;  2GZZ A;  4IN0 A;  3LEF A;  4BVX A;  5B6N A;  1G7E A;  2FWE A;  2VCZ A;  3I69 A;  2DJ2 A;  4GSN A;  5KN2 A;  4XRD A;  2NBS A;  2C3T A;  1ST9 A;  2JAC A;  2DJ0 A;  4ID0 A;  1GTU A;  1M3J A;  2M80 A;  5GST A;  1VGL A;  2JAD A;  2J9H A;  4KND A;  3WT1 A;  4OCE A;  1K3O A;  4NHW A;  3H1N A;  1GP1 A;  1IYH A;  2MMN A;  2RLI A;  2TRX A;  2IMF A;  1UN2 A;  4EXJ A;  4K7N A;  2HFD A;  1G6W A;  1USB A;  5ECP B;  1X9S B;  4HZ2 A;  1ZCP A;  1LU4 A;  1YDK A;  2FD3 A;  2FGX A;  3L9U A;  2IMI A;  4MPF A;  2J23 A;  3VPT A;  3I9V 2;  1AIU A;  1GLQ A;  3HY2 A;  5JCU A;  2RII A;  4K7O A;  2L5L A;  3G7Y A;  5F06 A;  3M1G A;  3GHA A;  2RUF A;  4CW9 A;  1Z7P A;  5IO2 A;  1Q98 A;  2VCQ A;  5CRE A;  1FVJ A;  1GUL A;  5ECH B;  2YWM A;  2GST A;  5HFI A;  1IYI A;  2DIZ A;  2D2Z A;  3TJG A;  3MYD A;  1OE8 A;  3H79 A;  1JZW A;  1Z3E A;  1PL2 A;  2GQL A;  3UBL A;  5KN1 A;  1ERT A;  1YKC A;  5KOW A;  2RM6 A;  2H30 A;  1K3Y A;  3ZLP A;  1MD3 A;  5G31 A;  2VIM A;  1PFO A;  1HYU A;  4PTS A;  1KEB A;  2ES7 A;  4AJ8 A;  1ZYP A;  1B9X C;  4FQU A;  2OE3 A;  1VF1 A;  1LJR A;  5LD0 A;  1AQW A;  2NTO A;  3FYG A;  3QR6 A;  1MTC A;  4ICY A;  1SKR B;  2GDR A;  3H8Q A;  4ML6 A;  1WMJ A;  3TKS C;  2R0P A;  3EVI A;  4TVE A;  5KOX A;  1YQ1 A;  3HD5 A;  4MF6 A;  2V32 A;  2O85 A;  3APO A;  1YF0 A;  3TGZ A;  1M7T A;  2GSQ A;  2FLS A;  1B48 A;  10GS A;  4PNG A;  5IQY A;  1TXX A;  2CVK A;  4MLY A;  1WE0 A;  3ZL5 A;  4MJA A;  5HFK A;  1WP0 A;  1KNG A;  4Z2U A;  3CSJ A;  1KTE A;  3Q18 A;  3GH6 A;  1ERV A;  2YNX A;  4G0L A;  6GST A;  2WJU A;  1Q4J A;  2YN1 A;  4L5O A;  1R5A A;  2LKU A;  3P2A A;  1SYR A;  5F8B A;  1U3A A;  3EU4 A;  1FVK A;  3GSS A;  3ZTL A;  3HVN A;  3DRN A;  4K0N A;  1AQX A;  2B1K A;  2LS5 A;  3OR5 A;  1ZGN A;  3HJO A;  1K0M A;  2E2M A;  2LJK A;  3BCK A;  1SD9 A;  3L9S A;  4X4J A;  2LUS A;  3RDW A;  4IKH A;  2VCT A;  5JWQ B;  3GTU B;  4O32 A;  4IGJ A;  1W4V A;  4KCA A;  4POL A;  1A23 A;  5IPH A;  2CZ2 A;  4D73 B;  5IOX A;  4IVF A;  4H86 A;  4OO4 A;  2NDO A;  3CXG A;  4V2N A;  2EIO A;  3IC4 A;  4BVY A;  2H19 A;  2GGT A;  4FYC A;  4OMV A;  4RQX A;  3HVX A;  2F3M A;  3EWL A;  3ERG A;  2LV3 A;  3IHQ A;  3BD2 A;  3CTG A;  3HHV A;  2A2R A;  3UMA A;  2FCH A;  2V1M A;  4V2L A;  1PX6 A;  5B7C A;  3HXS A;  2H0I A;  2VOC A;  3DXB A;  4ECI A;  2IMK A;  2R0C A;  1K0D A;  5DJL A;  4MJC A;  4MJE A;  5J41 A;  2P5R A;  3VPQ A;  4GF0 A;  2PER A;  4J2F A;  1TK5 B;  2Z9S A;  3F9U A;  4G0I A;  4TXV A;  3KEB A;  2MMA A;  2VCV A;  5G5F A;  1I9D A;  5ECQ B;  3D4T A;  2H72 A;  2QSI A;  2DKI A;  2A4V A;  2R5G A;  2OE1 A;  2DBC A;  3C1S A;  1ZYE A;  3CRT A;  3N9J A;  3IK7 A;  4ZBB A;  1EGO A;  4MZC A;  1SJ6 A;  4LLR A;  5ELA A;  1X9W B;  5J9B A;  1SYX A;  1PGT A;  2GSR A;  2JSZ A;  1O6J A;  4TKY A;  3IK9 A;  4Z2R A;  2X49 A;  4NV5 A;  1GNW A;  5ELG A;  2KHP A;  3E3E A;  3I43 A;  4JU5 A;  1TTZ A;  4JR4 A;  3VWW A;  2P5Q A;  2XHF A;  2G2Q A;  3ERF A;  2VCW A;  2FNO A;  2C0G A;  4WEY A;  3D5J A;  1AAZ A;  2CAQ A;  3RBT A;  3P8W A;  4BL7 A;  3DIE A;  4F2I A;  1SD8 A;  3F63 A;  2CAI A;  3UAP A;  4YAP A;  1PQN A;  2KP1 A;  1M2A A;  4F82 A;  3IHG A;  1NHO A;  2KUC A;  1X5C A;  2VM2 A;  3FR6 A;  1UA5 A;  3UJ1 A;  4TXO B;  1V57 A;  4QL9 A;  2ALB A;  4FYU A;  4MA9 A;  4GXZ A;  5CYY A;  3IC8 A;  1GSF A;  1X5D A;  4DSS A;  3GL5 A;  2VAF A;  5DQS A;  1GTI A;  3UAR A;  3D0Z A;  3HJP A;  1PX7 A;  4NHZ A;  5DDL A;  4FH8 A;  3R2Q A;  3F0I A;  3TKS E;  4EDZ A;  4JR6 A;  5AN1 A;  1QFN A;  3DVW A;  5D9W A;  2REM A;  2HXK A;  2GQK A;  2TRC P;  1M9A A;  2L4Q A;  3KD0 A;  3CQF A;  4ECB A;  3Q74 A;  1G6Y A;  3FMW A;  3LXZ A;  6GSW A;  2JSY A;  3FW2 A;  4DEJ A;  4K1F A;  1ZL9 A;  1LBK A;  2HI7 A;  1WOU A;  2VD0 A;  4KGI A;  5J4U A;  3LWA A;  2YZU A;  4GQF A;  5H5Q A;  4F9Z A;  4AGS A;  4MDC A;  3FZ5 A;  1O8X A;  3VWX A;  1AQV A;  2EIR A;  4MJB A;  5DQY A;  3GN3 A;  1TRW A;  4IP6 A;  4N0Z A;  2B5Y A;  3TUE A;  2HNL A;  1GSS A;  1XWC A;  2DJK A;  3PR8 A;  3ZIJ A;  3M9J A;  4AJ7 A;  5HR2 A;  1UVZ A;  4V1A g;  5DCG A;  4TN8 A;  1S3R A;  3LFL A;  4N0V A;  1B4Q A;  4FYB A;  4ZL9 A;  4HUA A;  2HE3 A;  2XPE A;  2K8V A;  5IM9 A;  5G2Z A;  2K8S A;  2H1G A;  2CVB A;  1S3A A;  1A0R P;  1MD4 A;  3GIX A;  2DSA A;  4HOJ A;  2H76 A;  4CHS A;  1A8L A;  4RUV A;  3FHK A;  19GS A;  2YCD A;  1JLV A;  2IFQ B;  4YKG A;  3G7I A;  4TR4 A;  2QC7 A;  3LJR A;  4KUN A;  4N11 A;  4HDE A;  1GUH A;  4XS4 B;  3ME8 A;  4F03 A;  1ZMA A;  4G2E A;  2JU5 A;  4MH3 A;  3RAZ A;  2JZT A;  2VM1 A;  2F8F A;  3HA9 A;  2WZ9 A;  2DMM A;  3PIN A;  1FHE A;  3KIJ A;  1EOG A;  4GSS A;  4TRX A;  3ZZX A;  3ZIV A;  5ID2 B;  3F6F A;  12GS A;  2E7P A;  1VF3 A;  2PVO C;  2ZCT A;  4ZB6 A;  4XTS A;  1AW9 A;  5ECK B;  5HR1 A;  9GSS A;  4MPG A;  3MDK A;  4WR5 A;  3GUS A;  1TOF A;  5D9T A;  4JED A;  4X0X A;  3TJJ A;  2JZS A;  1A0F A;  4MAB A;  1FO5 A;  2F9S A;  3EU3 A;  3E0U A;  4TOP A;  5CP1 A;  2LJA A;  1ERU A;  2C3N A;  4IS0 A;  1FAA A;  3NOF A;  3KP9 A;  2V6K A;  1PL1 A;  3GYK A;  3MSZ A;  3R3E A;  4IQ1 A;  1K0C A;  3W8J A;  1XOB A;  2QA1 A;  2E0Q A;  2GZP A;  3DKS A;  4HEA 2;  1YJ6 A;  2YWO A;  1SJI A;  1M2B A;  1PKW A;  1SKW B;  1URM A;  5GAP D;  3TJK A;  3IPZ A;  3TKS A;  4LA1 A;  1XVQ A;  4PGT A;  4PQI A;  3CSH A;  5EVO A;  4I97 A;  1N2A A;  3MIX A;  5DVB A;  1ZYN A;  2C0E A;  3EMP A;  1TK0 B;  2FWG A;  3FR3 A;  22GS A;  1CQH A;  2B7K A;  3FEU A;  2VL2 C;  4POM A;  4AF2 A;  1TU7 A;  1U87 A;  1BED A;  1TRU A;  1A2L A;  3FZ4 A;  4KF9 A;  3L0H A;  5EY6 A;  4WKW A;  5HQP A;  1G7O A;  1WPI A;  3VI7 A;  3BBY A;  5G1K A;  1PKZ A;  6GSY A;  2K9F A;  3M8N A;  3IBH A;  5JCG A;  2HLS A;  5D73 A;  1GUM A;  2C8U A;  5H5S A;  1M3I A;  3O3T A;  4P3Y B;  3C8E A;  4KX4 A;  2H70 A;  3TRQ A;  3ZFB A;  1CQG A;  2OJL A;  3K8N A;  3FY7 A;  4ZXG A;  4YAV A;  1ABA A;  5DCH A;  4ZB8 A;  3WYW A;  4BWS A;  4MCU A;  1QXH A;  2C3Q A;  3FRC A;  3I6A A;  1EV4 A;  5D9X A;  2H66 A;  3ZFL A;  2LST A;  5ECO B;  3VWV A;  1TKD B;  4J57 E;  3C7M A;  2I3Y A;  4PX1 A;  4WET A;  1GSU A;  2QGV A;  4YQM A;  2GTU A;  4MZW A;  1BQ7 A;  3J7Y k;  5AGY A;  4BVX B;  2I9H A;  1HD2 A;  2L6C A;  5H5R A;  3C71 A;  3GH9 A;  2C4J A;  5ECM B;  1EEJ A;  4EF0 A;  2A4H A;  1DSB A;  1ML6 A;  4TR3 A;  2K18 A;  3SWL A;  2K6V A;  4ML1 A;  3JCM L;  4IJ3 A;  5C04 A;  1F6M C;  4LMV A;  4QL7 A;  1DBY A;  2OAD A;  3DML A;  4O5U A;  4IJI A;  3KH7 A;  4G10 A;  3S9F A;  2DKH A;  3UOM A;  3W6G A;  4NPB A;  5JCW A;  1R5P A;  2FHE A;  4HU9 A;  4ACS A;  4DVC A;  1SL2 B;  1TW9 A;  1ACV A;  5CRD A;  2B3S A;  4POB A;  2IMD A;  4WXT A;  4TR0 A;  4IQA A;  1TU8 A;  3V1W A;  4JE1 A;  3LGC A;  18GS A;  5CAX A;  2OBK A;  2AV4 A;  1XW5 A;  4RI6 A;  1PD2 1;  1MDJ A;  1OAZ A;  1DE2 A;  3ISO A;  1MDI A;  3U6V A;  3NIV A;  1EWX A;  2MYG A;  4KW6 A;  4I5Q A;  3A2V A;  1B4P A;  2CZ3 A;  4RI7 A;  3HZ8 A;  4CDO A;  4N30 A;  5A4U A;  1GL8 A;  2HZE A;  1S3C A;  5IMZ A;  3EC3 A;  2PWJ A;  1X0R A;  4IP1 A;  2L6D A;  1PMT A;  1HNC A;  2LNT A;  2GT5 A;  3GRX A;  3A5W A;  3VWU A;  1GUK A;  3WGD A;  4ULX A;  5L71 A;  5ENU A;  2B5X A;  4EL1 A;  3GKK A;  1WIK A;  4EO3 A;  2MBT A;  2MMO A;  1R7H A;  1XCC A;  1Z6M A;  3ZRD A;  2IWT A;  1QMV A;  5LNK e;  1AUC A;  2GVP A;  2FA4 A;  1B9Y C;  4X43 A;  3LOR A;  4KCE A;  4K7I A;  1YF1 A;  3UVH A;  1GSY A;  2IME A;  1OC8 A;  4Z7X A;  2WDU A;  2G0F A;  2HRN A;  1I5G A;  4I2U A;  1QUW A;  4PUA A;  2HSM A;  2P0G A;  4KH7 A;  1SK0 A;  5CRW A;  4G19 A;  2DJJ A;  2PPT A;  4Q5F A;  3P90 A;  5E4W A;  3LYP A;  4BPY A;  5DAL A;  2PU9 C;  3QMX A;  1THX A;  2ON7 A;  4KB3 A;  2O7K A;  3KMN A;  1TJD A;  2ON5 A;  4NAX A;  4TR1 A;  2R6K A;  1XIY A;  3GMF A;  4JRR A;  4EIP A;  2HRF A;  1ZOF A;  3WT2 A;  1OC9 A;  3A5I A;  1FB0 A;  4HI7 A;  4KE3 A;  1GTB A;  5AIV A;  5J5N A;  3GNJ A;  2VO4 A;  2CQ9 A;  4O5R A;  2B1L A;  2X64 A;  4EE0 A;  16GS A;  1GSD A;  4OD7 A;  2EC4 A;  3KH9 A;  1SL0 B;  1Z6N A;  2IIY A;  3H4K A;  1XWK A;  4MF7 A;  4I6X A;  3RHB A;  3F4T A;  1YEX A;  3PGT A;  1TI1 A;  3TB2 A;  2FY6 A;  3IA1 A;  3A2W A;  4PUF C;  4KDX A;  1YKA A;  2PMT A;  1NHY A;  3APQ A;  5EL8 A;  2H1D A;  3VFI A;  5DAK A;  3ME7 A;  1TI3 A;  1ERW A;  4BVY B;  5KN3 A;  8GSS A;  2GSS A;  5CRH A;  1V40 A;  3HYP A;  4HQS A;  2FWF A;  4BIK A;  5J3R A;  1TDI A;  3ZIT A;  1XG8 A;  20GS A;  3TOU A;  3RHC A;  2R37 A;  1JZO A;  4WF4 A;  1YZX A;  4XS1 A;  1T00 A;  2QKE A;  4WBJ A;  3TCO A;  1SEN A;  2WCI A;  3KJY A;  4O5Q A;  1XWG A;  3DD3 A;  4BWQ A;  2PGT A;  4L0W A;  3HVS A;  2I81 A;  3L9V A;  4ZBD A;  2OBI A;  3QOU A;  3O76 A;  3MNG A;  2JZR A;  4OWY A;  3IE3 A;  1HNB A;  3FR9 A;  3F4R A;  3DGQ A;  2PUK C;  14GS A;  2CV4 A;  4ZL7 A;  2C80 A;  3FKF A;  4DSQ A;  1SJZ A;  4A5P A;  3U5R E;  4OCF A;  3DYR A;  5IMF A;  2O8V B;  4G0K A;  1HQO A;  1O85 A;  4I8B A;  1V2A A;  2VL3 A;  4EDY A;  3QPM A;  1A8Y A;  5CNW A;  1JZR A;  4YKF A;  4GST A;  3GUR A;  2IJY A;  4JBB A;  1XW9 A;  4OO5 A;  5G1L A;  2X99 A;  3VUR A;  3ERW A;  2MBS A;  1ILO A;  11GS A;  3L4N A;  1PRX A;  1QQ2 A;  2YWI A;  3IAM 2;  3KMO A;  3D22 A;  1N8J A;  2B6M A;  1NSW A;  1GSQ A;  2C1Y A;  2CVD A;  4HZ4 A;  1GLP A;  2BJX A;  2YJ7 A;  4BL7 B;  5E59 A;  1F37 A;  3BOA A;  3D21 A;  4ECJ A;  1V58 A;  3HZ4 A;  2CX4 A;  5D8I A;  1F9M A;  3EUR A;  5FHI A;  1XBS A;  4LMW A;  3KM6 A;  3HDC A;  2IL3 A;  5D9V A;  3F3Q A;  2WFC A;  2VL2 A;  1QK8 A;  4F0B A;  2TIR A;  2AJQ B;  1DUG A;  3LXT A;  2JL4 A;  2VD1 A;  4DSS B;  5F05 A;  5ECI B;  2HZF A;  4K5S A;  2LRN A;  4MK3 A;  2OA7 A;  1MDK A;  3SBC A;  2F51 A;  3KTL A;  3ZRE A;  5IPG A;  2LQO A;  2MZC A;  3CBU A;  2YWN A;  4E8H A;  1AC1 A;  4MF5 A;  2DLX A;  3FZ9 A;  1OC3 A;  3UVT A;  3BJ5 A;  2VL9 A;  1X5E A;  1OE7 A;  3G7J A;  2R4V A;  5F07 A;  2L4C A;  4E8E A;  4MH2 A;  1WJK A;  4N10 A;  3QFB C;  5COH A;  2ZNM A;  4ISD A;  3HVV A;  4NXI A;  2VLU A;  3DEX A;  2AHE A;  1K0O A;  2WUL A;  2VLT A;  1EP8 A;  2B7J A;  3N5O A;  7GSS A;  1O8W A;  1RW1 A;  3EIN A;  3QCP A;  5IOW A;  4WBR D;  1F3B A;  4BA7 A;  4K6X A;  2H74 A;  3DVX A;  1EEM A;  1Y25 A;  4KA0 A;  1BX9 A;  3KCM A;  4XHM A;  2H1A A;  3BCI A;  1M99 A;  2LQQ A;  1OKT A;  2YAN A;  5JWO B;  2N5F A;  2VLV A;  1XFL A;  3ZML A;  5ECR B;  1GSE A;  5F0G A;  4MP4 A;  2YP6 A;  4MZB A;  3TKQ A;  1XOA A;  4IEL A;  1J08 A;  1E6B A;  3ED3 A;  3EYT A;  1EV9 A;  5INY A;  2H01 A;  5DJM A;  4K8M A;  4Q5R A;  2HT9 A;  1XXU A;  4MNN A;  5KN0 A;  5LCZ A;  3QD9 A;  1XZO A;  2FWH A;  4OFM A;  1A2M A;  4XIH A;  1VF4 A;  1NW2 A;  3GTU A;  1AXD A;  3GL3 A;  2H71 A;  3M9K A;  1FOH A;  1XW6 A;  3GA4 A;  4ZL8 A;  2R3X A;  2XBI A;  1B8X A;  3ZVJ D;  1MEK A;  2BMX A;  4D73 A;  2WRT A;  3APS A;  3TKR A;  1TRV A;  3IAS 2;  3UEM A;  1T3B A;  1K0A A;  4NWY A;  1Z9H A;  2EIQ A;  3Q6O A;  1GTA A;  5IO0 A;  2NVL A;  3F8U A;  1JLW A;  1M0U A;  2B5E A;  3TJF A;  6GSS A;  13GS A;  2H6X A;  3TKP A;  2I4A A;  17GS A;  4Q5N A;  4TW5 A;  2H8L A;  1V9W A;  2KOK A;  4KAE A;  3C73 A;  2FUG 2;  3NZN A;  6GSV A;  4GWR A;  2XPD A;  5BRT A;  1K0N A;  3W8S A;  2WS2 A;  1T8E B;  3J7Y b;  3UIW A;  1EGR A;  4KDU A;  3E9J B;  2GS3 A;  5DBQ A;  5ECL B;  1M9B A;  3IRA A;  1K3L A;  2GT6 A;  2V2G A;  6GSX A;  4IHU A;  1U6T A;  3KXO A;  2LJR A;  2XC2 A;  3IDV A;  3CSI A;  4NMU A;  1FB6 A;  1A2J A;  3EE2 A;  2LEG A;  4PUR A;  1BJX A;  3KTB A;  1EZK A;  2H0G A;  5ECN B;  1FG4 A;  2X8C A;  5G5E A;  2OAC A;  2OKA A;  4ZBA A;  1SU9 A;  5D93 A;  3AY8 A;  1HNA A;  2O89 A;  3F3R A;  4IBP A;  1DE1 A;  3A3T A;  4MMM A;  3RPN A;  4ZIJ A;  2A2S A;  3KZQ A;  3LQ7 A;  2YV9 A;  3MAK A;  1U88 A;  5KEJ A;  2LNS A;  5A4W A;  3H93 A;  4K5R A;  2HSY A;  1VRS D;  3FK8 A;  3UBK A;  2XBQ A;  1RK4 A;  4J56 E;  1O81 A;  2YZH A;  1O73 A;  1EOH A;  4NV2 A;  2YPM A;  2WGR A;  1FW1 A;  2OE0 A;  4EC0 A;  1GNE A;  4AJ6 A;  1J0F A;  3ZYW A;  2PVQ A;  2DIY A;  4EKZ A;  2MMZ A;  4HJ2 A;  4ZB9 A;  3O6T A;  2AUV A;  4WR4 A;  2N5B A;  4TXO A;  4FO5 A;  4V2M A;  2X4A A;  3GX0 A;  4HQZ A;  2R0G A;  1R26 A;  3M3M A;  2H1B A;  3M0F A;  3IOS A;  2A2P A;  3RPP A;  1Z5Y E;  5HR3 A;  1OKD A;  2KP2 A;  1C72 A;  1T1V A;  4OFT A;  3LG6 A;  5FT3 A;  4XCS A;  2DML A;  2X8H A;  5FWG A;  4O7H A;  4Q5Q A;  5B8A A;  2CA8 A;  4USS A;  1PN9 A;  1WRY A;  4YQV A;  2I1U A;  2L5O A;  2YV7 A;  4KDY A;  4GLT A;  1H75 A;  5EPF A;  3TJB A;  1O7U A;  2LTK A;  3DWV A;  1BYE A;  2GZY A;  4K2X A;  4GTU A;  5AIS A;  2HYX A;  3F4S A;  1JZD A;  3LSZ A;  2IPA A;  3G9B A;  1S3D A;  5GZZ B;  4X1U A;  1OVN A;  3EMX A;  3D6I A;  4F0C A;  4G9H A;  2VCX A;  3KGK A;  3IV4 A;  4O92 A;  5ECS A; 
#chains in the Genus database with same CATH homology
 3GV1 A;  4GCI A;  4PQ1 A;  4XRA A;  4WF5 A;  2N5A A;  4XS6 A;  3CRU A;  2HSH A;  2H75 A;  3VK9 A;  2H73 A;  4LL1 B;  3GKM A;  1R4W A;  2M72 A;  5HR0 A;  1XVW A;  2AYT A;  3EPT A;  4YH2 A;  2HZE B;  3ZVJ A;  5IIZ A;  5J9C A;  1M2D A;  4KSM A;  2H6Z A;  2YOI A;  2O87 A;  3GFK A;  4CY6 A;  1EP7 A;  1T4Y A;  4LL4 B;  4KSO A;  1XWB A;  1T4Z A;  3IXR A;  1E2Y A;  4RQR A;  3GKX A;  3LW9 A;  2IFQ A;  4XS4 A;  1W89 A;  4DSR A;  5IMV A;  5IMD A;  3QAW A;  3TRP A;  4CY8 A;  2BTO T;  5CO3 A;  5IMA A;  3MWH A;  1GRX A;  2C0D A;  2ZUP A;  4EIQ A;  3VI5 A;  3CYN A;  3FZA A;  3HKR A;  3QAG A;  5B6M A;  1OYJ A;  5ID2 A;  2V6O A;  4YQU A;  3UL3 A;  5A4V A;  4L5L A;  3P7X A;  2RM5 A;  2H6Y A;  1UC7 A;  2F8A A;  1KBN A;  4HU7 A;  1THO A;  2L59 A;  4HJM A;  4HS1 A;  1T7P B;  1TP9 A;  4FIW A;  2E2G A;  3TOT A;  4L0U A;  1PA3 A;  1Z7R A;  2RUE A;  2HRA A;  3WGE A;  1YY7 A;  5DAL B;  5IMC A;  1H4O A;  1BG5 A;  1GWC A;  3GKN A;  1F2E A;  1G0T A;  3TDG A;  1JFU A;  4IW9 A;  3Q19 A;  4TR1 B;  1X9M B;  4EVM A;  3GX8 A;  1GH2 A;  1FOV A;  3CTF A;  3D4M A;  2LRC A;  2L57 A;  1OC9 B;  3QFA C;  2PN8 A;  2CX3 A;  1SL1 B;  4ILF A;  5A5K A;  3IR4 A;  1ON4 A;  5C00 A;  1SK2 A;  2X8G A;  3GST A;  3LYK A;  2CT6 A;  1U3I A;  2P31 A;  4V1A p;  1JHB A;  4PNF A;  1WWJ A;  3CMI A;  1XPV A;  3HCZ A;  2DJ1 A;  1ZYQ B;  3F6D A;  4K2D A;  2NPB A;  6GSU A;  1YEP A;  2LRT A;  2DC5 A;  1RQM A;  2AB6 A;  4EUY A;  2WB9 A;  1SK1 A;  1PSQ A;  5DAK B;  5G30 A;  2KLX A;  2AAW A;  3QAV A;  2QA2 A;  4ZIL A;  4GRF A;  4Z2T A;  1TRS A;  1Y6E A;  4ECC A;  1J9B A;  1QGV A;  2FA8 A;  3A2X A;  1PN0 A;  3C1R A;  5GAN D;  1K0B A;  5BMU A;  5JWR B;  4OFN A;  2R2J A;  3L78 A;  3PH9 A;  5B8B A;  1XWA A;  1TK8 B;  4PXO A;  4K9Z A;  1ZZY A;  2VUP A;  4JZQ A;  5ABR A;  2HRK A;  3VLN A;  1BAY A;  4I2T A;  5AIX A;  3KP8 A;  3US3 A;  2UZ8 A;  2C0F A;  1NM3 A;  2H0H A;  5GSS A;  4PQH A;  2IN3 A;  4K0G A;  5CRG A;  3PPU A;  2GLR A;  1VF2 A;  1V98 A;  3ZMK A;  3TRX A;  1F3A A;  5HFG A;  1SKS B;  2M46 A;  2YJH A;  3HJM A;  4GQC A;  3WD6 A;  2PBJ A;  1A24 A;  5D96 A;  2V41 A;  3QDN A;  4L8E A;  3WGX A;  2DJ3 A;  2GQM A;  4POK A;  4QQ7 A;  2GZZ A;  4IN0 A;  3LEF A;  4BVX A;  5B6N A;  1G7E A;  2FWE A;  2VCZ A;  3I69 A;  2DJ2 A;  4GSN A;  5KN2 A;  4XRD A;  2NBS A;  2C3T A;  1ST9 A;  2JAC A;  2DJ0 A;  4ID0 A;  1GTU A;  2M80 A;  5GST A;  1VGL A;  2JAD A;  2J9H A;  4KND A;  3WT1 A;  4OCE A;  1K3O A;  4NHW A;  3H1N A;  1GP1 A;  1IYH A;  2MMN A;  2RLI A;  2TRX A;  2IMF A;  1UN2 A;  4EXJ A;  4K7N A;  2HFD A;  1G6W A;  1USB A;  5ECP B;  1X9S B;  4HZ2 A;  1ZCP A;  1LU4 A;  1YDK A;  2FD3 A;  2FGX A;  3L9U A;  2IMI A;  4MPF A;  2J23 A;  3VPT A;  3I9V 2;  1AIU A;  1GLQ A;  3HY2 A;  5JCU A;  2RII A;  4K7O A;  2L5L A;  3G7Y A;  5F06 A;  3M1G A;  3GHA A;  2RUF A;  4CW9 A;  1Z7P A;  5IO2 A;  1Q98 A;  2VCQ A;  5CRE A;  1FVJ A;  1GUL A;  5ECH B;  2YWM A;  2GST A;  5HFI A;  1IYI A;  2DIZ A;  2D2Z A;  3TJG A;  3MYD A;  1OE8 A;  3H79 A;  1JZW A;  1Z3E A;  1PL2 A;  2GQL A;  3UBL A;  5KN1 A;  1ERT A;  1YKC A;  5KOW A;  2RM6 A;  2H30 A;  1K3Y A;  3ZLP A;  1MD3 A;  5G31 A;  2VIM A;  1HYU A;  4PTS A;  1KEB A;  2ES7 A;  4AJ8 A;  1ZYP A;  1B9X C;  4FQU A;  2OE3 A;  1VF1 A;  1LJR A;  5LD0 A;  1AQW A;  2NTO A;  3FYG A;  3QR6 A;  1MTC A;  4ICY A;  1SKR B;  2GDR A;  3H8Q A;  4ML6 A;  1WMJ A;  3TKS C;  2R0P A;  3EVI A;  4TVE A;  5KOX A;  1YQ1 A;  3HD5 A;  4MF6 A;  2V32 A;  2O85 A;  3APO A;  1YF0 A;  3TGZ A;  1M7T A;  2GSQ A;  2FLS A;  1B48 A;  10GS A;  4PNG A;  5IQY A;  1TXX A;  2CVK A;  4MLY A;  1WE0 A;  3ZL5 A;  4MJA A;  5HFK A;  1WP0 A;  1KNG A;  4Z2U A;  3CSJ A;  1KTE A;  3Q18 A;  3GH6 A;  1ERV A;  2YNX A;  4G0L A;  6GST A;  2WJU A;  1Q4J A;  2YN1 A;  4L5O A;  1R5A A;  2LKU A;  3P2A A;  1SYR A;  5F8B A;  1U3A A;  3EU4 A;  1FVK A;  3GSS A;  3ZTL A;  3DRN A;  4K0N A;  1AQX A;  2B1K A;  2LS5 A;  3OR5 A;  1ZGN A;  3HJO A;  1K0M A;  2E2M A;  2LJK A;  3BCK A;  1SD9 A;  3L9S A;  4X4J A;  2LUS A;  3RDW A;  4IKH A;  2VCT A;  5JWQ B;  3GTU B;  4O32 A;  4IGJ A;  1W4V A;  4KCA A;  4POL A;  1A23 A;  5IPH A;  2CZ2 A;  4D73 B;  5IOX A;  4IVF A;  4H86 A;  4OO4 A;  2NDO A;  3CXG A;  4V2N A;  2EIO A;  3IC4 A;  4BVY A;  2H19 A;  2GGT A;  4FYC A;  4OMV A;  4RQX A;  3HVX A;  2F3M A;  3EWL A;  3ERG A;  2LV3 A;  3IHQ A;  3BD2 A;  3CTG A;  3HHV A;  2A2R A;  3UMA A;  2FCH A;  2V1M A;  4V2L A;  1PX6 A;  5B7C A;  3HXS A;  2H0I A;  2VOC A;  3DXB A;  4ECI A;  2IMK A;  2R0C A;  1K0D A;  5DJL A;  4MJC A;  4MJE A;  5J41 A;  2P5R A;  3VPQ A;  4GF0 A;  2PER A;  4J2F A;  1TK5 B;  2Z9S A;  3F9U A;  4G0I A;  4TXV A;  3KEB A;  2MMA A;  2VCV A;  5G5F A;  1I9D A;  5ECQ B;  3D4T A;  2H72 A;  2QSI A;  2DKI A;  2A4V A;  2R5G A;  2OE1 A;  2DBC A;  3C1S A;  1ZYE A;  3CRT A;  3N9J A;  3IK7 A;  4ZBB A;  1EGO A;  4MZC A;  1SJ6 A;  4LLR A;  5ELA A;  1X9W B;  5J9B A;  1SYX A;  1PGT A;  2GSR A;  2JSZ A;  1O6J A;  4TKY A;  3IK9 A;  4Z2R A;  2X49 A;  4NV5 A;  1GNW A;  5ELG A;  2KHP A;  3E3E A;  3I43 A;  4JU5 A;  1TTZ A;  4JR4 A;  3VWW A;  2P5Q A;  2XHF A;  2G2Q A;  3ERF A;  2VCW A;  2FNO A;  2C0G A;  4WEY A;  3D5J A;  1AAZ A;  2CAQ A;  3RBT A;  3P8W A;  4BL7 A;  3DIE A;  4F2I A;  1SD8 A;  3F63 A;  2CAI A;  3UAP A;  4YAP A;  1PQN A;  2KP1 A;  1M2A A;  4F82 A;  3IHG A;  1NHO A;  2KUC A;  1X5C A;  2VM2 A;  3FR6 A;  1UA5 A;  3UJ1 A;  4TXO B;  1V57 A;  4QL9 A;  2ALB A;  4FYU A;  4MA9 A;  4GXZ A;  5CYY A;  3IC8 A;  1GSF A;  1X5D A;  4DSS A;  3GL5 A;  2VAF A;  5DQS A;  1GTI A;  3UAR A;  3D0Z A;  3HJP A;  1PX7 A;  4NHZ A;  5DDL A;  4FH8 A;  3R2Q A;  3F0I A;  3TKS E;  4EDZ A;  4JR6 A;  5AN1 A;  1QFN A;  3DVW A;  5D9W A;  2REM A;  2HXK A;  2GQK A;  2TRC P;  1M9A A;  2L4Q A;  3KD0 A;  4ECB A;  3Q74 A;  1G6Y A;  3FMW A;  3LXZ A;  6GSW A;  2JSY A;  3FW2 A;  4DEJ A;  4K1F A;  1ZL9 A;  1LBK A;  2HI7 A;  1WOU A;  2VD0 A;  4KGI A;  5J4U A;  3LWA A;  2YZU A;  4GQF A;  5H5Q A;  4F9Z A;  4AGS A;  4MDC A;  3FZ5 A;  1O8X A;  3VWX A;  1AQV A;  2EIR A;  4MJB A;  5DQY A;  3GN3 A;  1TRW A;  4IP6 A;  4N0Z A;  2B5Y A;  3TUE A;  2HNL A;  1GSS A;  1XWC A;  2DJK A;  3PR8 A;  3ZIJ A;  3M9J A;  4AJ7 A;  5HR2 A;  1UVZ A;  4V1A g;  5DCG A;  4TN8 A;  3LFL A;  4N0V A;  1B4Q A;  4FYB A;  4ZL9 A;  4HUA A;  2HE3 A;  2XPE A;  2K8V A;  5IM9 A;  5G2Z A;  2K8S A;  2H1G A;  2CVB A;  1S3A A;  1A0R P;  1MD4 A;  3GIX A;  2DSA A;  4HOJ A;  2H76 A;  4CHS A;  1A8L A;  4RUV A;  3FHK A;  19GS A;  2YCD A;  1JLV A;  2IFQ B;  4YKG A;  3G7I A;  4TR4 A;  2QC7 A;  3LJR A;  4KUN A;  4N11 A;  4HDE A;  1GUH A;  4XS4 B;  3ME8 A;  4F03 A;  1ZMA A;  4G2E A;  2JU5 A;  4MH3 A;  3RAZ A;  2JZT A;  2VM1 A;  2F8F A;  3HA9 A;  2WZ9 A;  2DMM A;  3PIN A;  1FHE A;  3KIJ A;  1EOG A;  4GSS A;  4TRX A;  3ZZX A;  3ZIV A;  5ID2 B;  3F6F A;  12GS A;  2E7P A;  1VF3 A;  2PVO C;  2ZCT A;  4ZB6 A;  4XTS A;  1AW9 A;  5ECK B;  5HR1 A;  9GSS A;  4MPG A;  3MDK A;  4WR5 A;  3GUS A;  1TOF A;  5D9T A;  4JED A;  4X0X A;  3TJJ A;  2JZS A;  1A0F A;  4MAB A;  1FO5 A;  2F9S A;  3EU3 A;  3E0U A;  4TOP A;  5CP1 A;  2LJA A;  1ERU A;  2C3N A;  4IS0 A;  1FAA A;  3NOF A;  3KP9 A;  2V6K A;  1PL1 A;  3GYK A;  3MSZ A;  3R3E A;  4IQ1 A;  1K0C A;  3W8J A;  1XOB A;  2QA1 A;  2E0Q A;  2GZP A;  3DKS A;  4HEA 2;  1YJ6 A;  2YWO A;  1SJI A;  1M2B A;  1PKW A;  1SKW B;  1URM A;  5GAP D;  3TJK A;  3IPZ A;  3TKS A;  4LA1 A;  1XVQ A;  4PGT A;  4PQI A;  3CSH A;  5EVO A;  4I97 A;  1N2A A;  3MIX A;  5DVB A;  1ZYN A;  2C0E A;  3EMP A;  1TK0 B;  2FWG A;  3FR3 A;  22GS A;  1CQH A;  2B7K A;  3FEU A;  2VL2 C;  4POM A;  4AF2 A;  1TU7 A;  1U87 A;  1BED A;  1TRU A;  1A2L A;  3FZ4 A;  4KF9 A;  3L0H A;  5EY6 A;  4WKW A;  5HQP A;  1G7O A;  1WPI A;  3VI7 A;  3BBY A;  5G1K A;  1PKZ A;  6GSY A;  2K9F A;  3M8N A;  3IBH A;  5JCG A;  2HLS A;  5D73 A;  1GUM A;  2C8U A;  5H5S A;  3O3T A;  4P3Y B;  3C8E A;  4KX4 A;  2H70 A;  3TRQ A;  3ZFB A;  1CQG A;  2OJL A;  3K8N A;  3FY7 A;  4ZXG A;  4YAV A;  1ABA A;  5DCH A;  4ZB8 A;  3WYW A;  4BWS A;  4MCU A;  1QXH A;  2C3Q A;  3FRC A;  3I6A A;  1EV4 A;  5D9X A;  2H66 A;  3ZFL A;  2LST A;  5ECO B;  3VWV A;  1TKD B;  4J57 E;  3C7M A;  2I3Y A;  4PX1 A;  4WET A;  1GSU A;  2QGV A;  4YQM A;  2GTU A;  4MZW A;  1BQ7 A;  3J7Y k;  5AGY A;  4BVX B;  2I9H A;  1HD2 A;  2L6C A;  5H5R A;  3C71 A;  3GH9 A;  2C4J A;  5ECM B;  1EEJ A;  4EF0 A;  2A4H A;  1DSB A;  1ML6 A;  4TR3 A;  2K18 A;  3SWL A;  2K6V A;  4ML1 A;  3JCM L;  4IJ3 A;  5C04 A;  1F6M C;  4LMV A;  4QL7 A;  1DBY A;  2OAD A;  3DML A;  4O5U A;  4IJI A;  3KH7 A;  4G10 A;  3S9F A;  2DKH A;  3UOM A;  3W6G A;  4NPB A;  5JCW A;  1R5P A;  2FHE A;  4HU9 A;  4ACS A;  4DVC A;  1SL2 B;  1TW9 A;  1ACV A;  5CRD A;  2B3S A;  4POB A;  2IMD A;  4WXT A;  4TR0 A;  4IQA A;  1TU8 A;  3V1W A;  4JE1 A;  3LGC A;  18GS A;  5CAX A;  2OBK A;  2AV4 A;  1XW5 A;  4RI6 A;  1PD2 1;  1MDJ A;  1OAZ A;  1DE2 A;  3ISO A;  1MDI A;  3U6V A;  3NIV A;  1EWX A;  2MYG A;  4KW6 A;  4I5Q A;  3A2V A;  1B4P A;  2CZ3 A;  4RI7 A;  3HZ8 A;  4CDO A;  4N30 A;  5A4U A;  1GL8 A;  2HZE A;  1S3C A;  5IMZ A;  3EC3 A;  2PWJ A;  1X0R A;  4IP1 A;  2L6D A;  1PMT A;  1HNC A;  2LNT A;  2GT5 A;  3GRX A;  3A5W A;  3VWU A;  1GUK A;  3WGD A;  4ULX A;  5L71 A;  5ENU A;  2B5X A;  4EL1 A;  3GKK A;  1WIK A;  4EO3 A;  2MBT A;  2MMO A;  1R7H A;  1XCC A;  1Z6M A;  3ZRD A;  2IWT A;  1QMV A;  5LNK e;  1AUC A;  2GVP A;  2FA4 A;  1B9Y C;  4X43 A;  3LOR A;  4KCE A;  4K7I A;  1YF1 A;  3UVH A;  1GSY A;  2IME A;  1OC8 A;  4Z7X A;  2WDU A;  2G0F A;  2HRN A;  1I5G A;  4I2U A;  1QUW A;  4PUA A;  2HSM A;  2P0G A;  4KH7 A;  1SK0 A;  5CRW A;  4G19 A;  2DJJ A;  2PPT A;  4Q5F A;  3P90 A;  5E4W A;  3LYP A;  4BPY A;  5DAL A;  2PU9 C;  3QMX A;  1THX A;  2ON7 A;  4KB3 A;  2O7K A;  3KMN A;  1TJD A;  2ON5 A;  4NAX A;  4TR1 A;  2R6K A;  1XIY A;  3GMF A;  4JRR A;  4EIP A;  2HRF A;  1ZOF A;  3WT2 A;  1OC9 A;  3A5I A;  1FB0 A;  4HI7 A;  4KE3 A;  1GTB A;  5AIV A;  5J5N A;  3GNJ A;  2VO4 A;  2CQ9 A;  4O5R A;  2B1L A;  2X64 A;  4EE0 A;  16GS A;  1GSD A;  4OD7 A;  2EC4 A;  3KH9 A;  1SL0 B;  1Z6N A;  2IIY A;  3H4K A;  1XWK A;  4MF7 A;  4I6X A;  3RHB A;  3F4T A;  1YEX A;  3PGT A;  1TI1 A;  3TB2 A;  2FY6 A;  3IA1 A;  3A2W A;  4PUF C;  4KDX A;  1YKA A;  2PMT A;  1NHY A;  3APQ A;  5EL8 A;  2H1D A;  3VFI A;  5DAK A;  3ME7 A;  1TI3 A;  1ERW A;  4BVY B;  5KN3 A;  8GSS A;  2GSS A;  5CRH A;  1V40 A;  3HYP A;  4HQS A;  2FWF A;  5J3R A;  1TDI A;  3ZIT A;  20GS A;  3TOU A;  3RHC A;  2R37 A;  1JZO A;  4WF4 A;  1YZX A;  4XS1 A;  1T00 A;  2QKE A;  4WBJ A;  3TCO A;  1SEN A;  2WCI A;  3KJY A;  4O5Q A;  1XWG A;  3DD3 A;  4BWQ A;  2PGT A;  4L0W A;  3HVS A;  2I81 A;  3L9V A;  4ZBD A;  2OBI A;  3QOU A;  3O76 A;  3MNG A;  2JZR A;  4OWY A;  3IE3 A;  1HNB A;  3FR9 A;  3F4R A;  3DGQ A;  2PUK C;  14GS A;  2CV4 A;  4ZL7 A;  2C80 A;  3FKF A;  4DSQ A;  1SJZ A;  4A5P A;  3U5R E;  4OCF A;  3DYR A;  5IMF A;  2O8V B;  4G0K A;  1HQO A;  1O85 A;  4I8B A;  1V2A A;  2VL3 A;  4EDY A;  3QPM A;  1A8Y A;  5CNW A;  1JZR A;  4YKF A;  4GST A;  3GUR A;  2IJY A;  4JBB A;  1XW9 A;  4OO5 A;  5G1L A;  2X99 A;  3VUR A;  3ERW A;  2MBS A;  1ILO A;  11GS A;  3L4N A;  1PRX A;  1QQ2 A;  2YWI A;  3IAM 2;  3KMO A;  3D22 A;  1N8J A;  2B6M A;  1NSW A;  1GSQ A;  2C1Y A;  2CVD A;  4HZ4 A;  1GLP A;  2BJX A;  2YJ7 A;  4BL7 B;  5E59 A;  1F37 A;  3BOA A;  3D21 A;  4ECJ A;  1V58 A;  3HZ4 A;  2CX4 A;  5D8I A;  1F9M A;  3EUR A;  5FHI A;  1XBS A;  4LMW A;  3KM6 A;  3HDC A;  2IL3 A;  5D9V A;  3F3Q A;  2WFC A;  2VL2 A;  1QK8 A;  4F0B A;  2TIR A;  2AJQ B;  1DUG A;  3LXT A;  2JL4 A;  2VD1 A;  4DSS B;  5F05 A;  5ECI B;  2HZF A;  4K5S A;  2LRN A;  4MK3 A;  2OA7 A;  1MDK A;  3SBC A;  2F51 A;  3KTL A;  3ZRE A;  5IPG A;  2LQO A;  2MZC A;  3CBU A;  2YWN A;  4E8H A;  1AC1 A;  4MF5 A;  2DLX A;  3FZ9 A;  1OC3 A;  3UVT A;  3BJ5 A;  2VL9 A;  1X5E A;  1OE7 A;  3G7J A;  2R4V A;  5F07 A;  2L4C A;  4E8E A;  4MH2 A;  1WJK A;  4N10 A;  3QFB C;  5COH A;  2ZNM A;  4ISD A;  3HVV A;  4NXI A;  2VLU A;  3DEX A;  2AHE A;  1K0O A;  2WUL A;  2VLT A;  1EP8 A;  2B7J A;  3N5O A;  7GSS A;  1O8W A;  1RW1 A;  3EIN A;  3QCP A;  5IOW A;  4WBR D;  1F3B A;  4BA7 A;  4K6X A;  2H74 A;  3DVX A;  1EEM A;  1Y25 A;  4KA0 A;  1BX9 A;  3KCM A;  4XHM A;  2H1A A;  3BCI A;  1M99 A;  2LQQ A;  1OKT A;  2YAN A;  5JWO B;  2N5F A;  2VLV A;  1XFL A;  3ZML A;  5ECR B;  1GSE A;  5F0G A;  4MP4 A;  2YP6 A;  4MZB A;  3TKQ A;  1XOA A;  4IEL A;  1J08 A;  1E6B A;  3ED3 A;  3EYT A;  1EV9 A;  5INY A;  2H01 A;  5DJM A;  4K8M A;  4Q5R A;  2HT9 A;  1XXU A;  4MNN A;  5KN0 A;  5LCZ A;  3QD9 A;  1XZO A;  2FWH A;  4OFM A;  1A2M A;  4XIH A;  1VF4 A;  1NW2 A;  3GTU A;  1AXD A;  3GL3 A;  2H71 A;  3M9K A;  1FOH A;  1XW6 A;  3GA4 A;  4ZL8 A;  2R3X A;  2XBI A;  1B8X A;  3ZVJ D;  1MEK A;  2BMX A;  4D73 A;  2WRT A;  3APS A;  3TKR A;  1TRV A;  3IAS 2;  3UEM A;  1T3B A;  1K0A A;  4NWY A;  1Z9H A;  2EIQ A;  3Q6O A;  1GTA A;  5IO0 A;  2NVL A;  3F8U A;  1JLW A;  1M0U A;  2B5E A;  3TJF A;  6GSS A;  13GS A;  2H6X A;  3TKP A;  2I4A A;  17GS A;  4Q5N A;  4TW5 A;  2H8L A;  1V9W A;  2KOK A;  4KAE A;  3C73 A;  2FUG 2;  3NZN A;  6GSV A;  4GWR A;  2XPD A;  5BRT A;  1K0N A;  3W8S A;  2WS2 A;  1T8E B;  3J7Y b;  3UIW A;  1EGR A;  4KDU A;  3E9J B;  2GS3 A;  5DBQ A;  5ECL B;  1M9B A;  3IRA A;  1K3L A;  2GT6 A;  2V2G A;  6GSX A;  4IHU A;  1U6T A;  3KXO A;  2LJR A;  2XC2 A;  3IDV A;  3CSI A;  4NMU A;  1FB6 A;  1A2J A;  3EE2 A;  2LEG A;  4PUR A;  1BJX A;  3KTB A;  1EZK A;  2H0G A;  5ECN B;  1FG4 A;  2X8C A;  5G5E A;  2OAC A;  2OKA A;  4ZBA A;  1SU9 A;  5D93 A;  3AY8 A;  1HNA A;  2O89 A;  3F3R A;  4IBP A;  1DE1 A;  3A3T A;  4MMM A;  3RPN A;  4ZIJ A;  2A2S A;  3KZQ A;  3LQ7 A;  2YV9 A;  3MAK A;  1U88 A;  5KEJ A;  2LNS A;  5A4W A;  3H93 A;  4K5R A;  2HSY A;  1VRS D;  3FK8 A;  3UBK A;  2XBQ A;  1RK4 A;  4J56 E;  1O81 A;  2YZH A;  1O73 A;  1EOH A;  4NV2 A;  2YPM A;  2WGR A;  1FW1 A;  2OE0 A;  4EC0 A;  1GNE A;  4AJ6 A;  1J0F A;  3ZYW A;  2PVQ A;  2DIY A;  4EKZ A;  2MMZ A;  4HJ2 A;  4ZB9 A;  3O6T A;  2AUV A;  4WR4 A;  2N5B A;  4TXO A;  4FO5 A;  4V2M A;  2X4A A;  3GX0 A;  4HQZ A;  2R0G A;  1R26 A;  3M3M A;  2H1B A;  3M0F A;  3IOS A;  2A2P A;  3RPP A;  1Z5Y E;  5HR3 A;  1OKD A;  2KP2 A;  1C72 A;  1T1V A;  4OFT A;  3LG6 A;  5FT3 A;  4XCS A;  2DML A;  2X8H A;  5FWG A;  4O7H A;  4Q5Q A;  5B8A A;  2CA8 A;  4USS A;  1PN9 A;  1WRY A;  4YQV A;  2I1U A;  2L5O A;  2YV7 A;  4KDY A;  4GLT A;  1H75 A;  5EPF A;  3TJB A;  1O7U A;  2LTK A;  3DWV A;  1BYE A;  2GZY A;  4K2X A;  4GTU A;  5AIS A;  2HYX A;  3F4S A;  1JZD A;  3LSZ A;  2IPA A;  3G9B A;  1S3D A;  5GZZ B;  4X1U A;  1OVN A;  3EMX A;  3D6I A;  4F0C A;  4G9H A;  2VCX A;  3KGK A;  3IV4 A;  4O92 A;  5ECS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...