5HR1A

Crystal structure of thioredoxin l107a mutant
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
b'SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin-1
publication title Structural variability of E. coli thioredoxin captured in the crystal structures of single-point mutants.
pubmed doi rcsb
source organism Escherichia coli o157:h7
molecule tags Oxidoreductase
total genus 27
structure length 107
sequence length 107
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2016-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5hr1A00
3FYGA 3GTUA 4IELA 3ZFLA 2OE3A 5IPGA 4GXZA 3TUEA 2EIOA 3LYPA 2GTUA 2WRTA 2N5FA 1TRUA 2C8UA 3GL3A 2RUEA 1A24A 3BOAA 4ECBA 3KGKA 3Q19A 3KZQA 4ZILA 4F0BA 4WR4A 2R6KA 4XCSA 2H70A 2O7KA 4LA1A 1PSQA 5D9TA 2GT6A 3TOUA 1XWBA 1TRVA 3TKQA 5IO2A 4OFMA 3ZIJA 3D6IA 2CX3A 4TKYA 2H72A 2C0FA 1A2MA 1E2YA 2IL3A 5A4WA 2C3TA 2DJ2A 4IQ1A 3KMNA 1W89A 5DQYA 3HHVA 3VPTA 3L9VA 5EVOA 1MD3A 3CYNA 2LQQA 3PGTA 3FZ4A 1SK0A 2GZZA 4ML1A 4N0ZA 2ES7A 1Q98A 2H66A 1TK0B 3L9SA 4WBJA 5B8AA 19GSA 4N0VA 3P90A 5A4UA 3ZFBA 2GT5A 1SL0B 2I4AA 2MZCA 5FHIA 2FD3A 4PGTA 2WGRA 3HY2A 4XIHA 1Z7RA 3D0ZA 3VURA 4MH3A 3L9UA 1SD9A 2O8VB 5ENUA 2AHEA 3GFKA 1QGVA 1PMTA 2DJ3A 2HZEA 2LRCA 2YCDA 4WR5A 3A5WA 4X0XA 2E0QA 3LWAA 1OE7A 1KEBA 2L57A 2HLSA 2DBCA 2G0FA 2GVPA 2VCQA 1X9WB 1EP7A 3E3EA 2VM1A 3KIJA 4N30A 3E9JB 3GH6A 4KW6A 1B9XC 1WOUA 1ZYEA 2HE3A 4HS1A 1GSEA 4LMVA 22GSA 4YAPA 1GNEA 2VAFA 1PL2A 1FHEA 5DAKB 2V41A 4EE0A 3M9JA 2H71A 3GHAA 4LLRA 3DWVA 3FZ9A 1FW1A 1WIKA 4X1UA 1AW9A 1QK8A 1AXDA 4POKA 1BQ7A 4ULXA 1VF3A 3FW2A 1SYRA 2IFQB 1XW6A 3KH7A 3WGXA 9GSSA 3WT2A 2OBKA 2YWIA 4ZXGA 1GL8A 4JZQA 1M9AA 4KGIA 4ZBDA 3R2QA 1DUGA 1O85A 4XS4A 4MP4A 4L0WA 1EEMA 2LSTA 1A0RP 1UA5A 4KA0A 5ECSA 5H5SA 1OC9B 1A8LA 3TRXA 3KCMA 1GSUA 2H6YA 3M1GA 1Y25A 1Y6EA 4AJ8A 5DCHA 3RHCA 4OO4A 2R4VA 4CDOA 2XPDA 2OBIA 2PN8A 1F37A 2L4CA 1MEKA 1FVKA 4WBRD 4IVFA 1SL1B 4YQUA 1EWXA 3IE3A 3UAPA 4EKZA 1KTEA 2BMXA 2DC5A 2CVKA 2PUKC 3ZREA 5IMCA 1XXUA 5JWRB 13GSA 2PVOC 1YDKA 3LORA 2QGVA 4K7IA 5JWQB 1FAAA 2OE1A 2DMLA 4MJAA 2F9SA 2E2MA 4XS4B 1XWGA 2C3NA 2EC4A 3FR9A 4OFNA 3QMXA 5IOWA 2PMTA 1BYEA 3KJYA 5IM9A 3LGCA 4ZB9A 1MDJA 4NMUA 2MBSA 3EVIA 1AAZA 4PUFC 1HNCA 2M46A 3U6VA 1ON4A 4HU7A 3RBTA 1I5GA 5C00A 2B7KA 2LRTA 3P8WA 3DGQA 2JACA 1TRWA 2ZNMA 1GTIA 1JFUA 4CW9A 3GKKA 5ECQB 3KP9A 1M2AA 1XIYA 2X64A 4CHSA 5HFGA 2ON7A 2H73A 3ZITA 20GSA 3HDCA 6GSUA 4G19A 3EMPA 4ECCA 3LXTA 4JR4A 5J5NA 5J41A 2B5XA 5IQYA 2LKUA 4K0GA 2KLXA 3LQ7A 5ECNB 1TW9A 5JCGA 3UMAA 1U87A 1OKTA 4AGSA 2H0GA 3C73A 3EURA 3O76A 8GSSA 1E6BA 4PX1A 2FWHA 1YZXA 2VCWA 3IXRA 1EV4A 1YQ1A 2AJQB 1PN9A 4JR6A 3ZMKA 4DSRA 4PQHA 2CZ3A 2AV4A 3KP8A 1WP0A 3ME8A 4KSMA 4LL1B 3BJ5A 4NHZA 1PQNA 1V9WA 4IJ3A 5JCWA 4KDYA 2YV9A 1T4ZA 1F9MA 4MPGA 4WETA 4KCAA 1X5EA 2WULA 2JZTA 4EC0A 4JU5A 2DJ1A 2LEGA 5J9BA 1OE8A 3GUSA 4OWYA 3D21A 2FY6A 3FEUA 2KP2A 4L8EA 3V1WA 1TXXA 4K9ZA 5B7CA 1R4WA 1OKDA 3LXZA 4K8MA 3P7XA 4TR4A 1ERTA 3I9V2 4FYUA 4GLTA 1BX9A 4JEDA 4RQRA 1DE1A 4QL7A 3UOMA 6GSWA 3EU4A 4GRFA 1USBA 4D73A 5DALA 4QL9A 1LBKA 5EY6A 1BAYA 2V6OA 4ZL9A 3O6TA 3K8NA 3ZVJD 1K0BA 4HZ4A 2VO4A 2A2RA 3ZIVA 1FB6A 4TVEA 3QOUA 3KEBA 2O89A 5AIVA 5ECLB 5D9VA 4HZ2A 5F07A 5A4VA 1ZCPA 3C7MA 4ZIJA 18GSA 4EF0A 2AB6A 3TKSE 3M8NA 4HQSA 1SK2A 2XPEA 5ECRB 5HFIA 5B8BA 3KTLA 2JZSA 1PX6A 4GSNA 3FKFA 2HYXA 2I3YA 4NV5A 1X0RA 3GKNA 5IMDA 2VL9A 3C71A 3EU3A 5JWOB 1EV9A 3CMIA 2VCVA 2VL2C 2XBQA 2HSHA 2WJUA 2YWMA 1B9YC 2VCZA 4GCIA 5D8IA 4D73B 5DALB 3EYTA 5E4WA 2BJXA 4K7NA 1GLPA 2H0HA 1AQXA 3EINA 3WT1A 2YNXA 4IQAA 1AIUA 3ERFA 1K0MA 6GSSA 5CYYA 3GL5A 4HUAA 4I2TA 1X5DA 3MDKA 3IAM2 3EC3A 3TJJA 2QSIA 3D4TA 1V58A 1VRSD 2P0GA 4L0UA 3HJOA 5KEJA 2K6VA 5DVBA 1Z7PA 5CRWA 3RPNA 4TXOB 1K0NA 4LMWA 3US3A 2YV7A 2AAWA 4F03A 4O5RA 4L5OA 4Q5NA 4K2DA 2OACA 1EOGA 2TRXA 1RW1A 4FH8A 3IDVA 2VD1A 2DJ0A 3HD5A 1EGRA 3J7Yb 1B4QA 3MAKA 2QKEA 3DEXA 5CAXA 1SD8A 2DJJA 4KDXA 1WE0A 1QQ2A 4GQCA 1F6MC 3Q6OA 4Z7XA 2VCTA 2B3SA 3Q74A 1ZMAA 1PX7A 1Z6MA 4IBPA 1CQHA 4XS6A 4RQXA 1GTUA 1FVJA 1S3CA 5GZZB 1FB0A 3TKRA 1TTZA 3LEFA 5LCZA 4MJBA 4PXOA 4K0NA 5DAKA 4ACSA 2EIRA 2IMKA 4DEJA 4J56E 5ID2A 5LD0A 3ZYWA 3U5RE 3PR8A 4YQVA 4V1Ap 3QR6A 1A2JA 4G10A 4BVYA 2C1YA 1X9MB 4PNFA 3UVHA 1OC8A 1QUWA 2IFQA 1O7UA 4HOJA 11GSA 1B48A 3CRTA 5FT3A 1LU4A 1OVNA 2HNLA 2MBTA 4RI6A 3APQA 4GF0A 2XC2A 5IMZA 1XCCA 1K3OA 3H8QA 5D93A 4GWRA 5COHA 2CZ2A 1TI3A 1YEPA 4Q5FA 1XOAA 5D9WA 3BCKA 4AJ6A 2REMA 1OC9A 4HI7A 1O8XA 4IP6A 4X43A 3CTGA 1SU9A 2PERA 5GSTA 4XS1A 3GKXA 5LNKe 2Z9SA 2NDOA 4NV2A 5AISA 3ZVJA 1AQWA 5ID2B 2LS5A 3TCOA 3KH9A 4MLYA 5G30A 3CBUA 2LTKA 4Q5QA 2FGXA 4I8BA 5HFKA 4EVMA 4NXIA 4ZB8A 1AUCA 1GSDA 2K18A 1O81A 3IA1A 1TOFA 1G7EA 1VF2A 3LSZA 1Z5YE 5IO0A 3HVXA 2VLVA 2GGTA 1XWCA 1GRXA 1XBSA 4K6XA 5HR0A 5D73A 1T3BA 1FOVA 4QQ7A 2YZUA 4O7HA 6GSYA 1SK1A 2XBIA 2VL2A 5JCUA 5CRDA 2YJHA 1HYUA 3DYRA 3W8SA 2CA8A 1OAZA 5D96A 3QCPA 2RUFA 3IAS2 3FRCA 1S3DA 1TDIA 3CRUA 1SJ6A 4IGJA 4POLA 4HJ2A 4ISDA 2AUVA 3QPMA 1GSQA 2RIIA 5KN0A 1R7HA 1TK8B 3DKSA 1JZOA 3HCZA 3F6DA 4MH2A 4ZBBA 2L6DA 3F6FA 4HQZA 2TIRA 3BD2A 1YF1A 3M9KA 3EWLA 4WXTA 1SKSB 5CREA 4JE1A 2H1DA 5HQPA 2VIMA 3C8EA 1IYHA 3KTBA 2JSYA 3GN3A 3D4MA 2GZYA 2IMDA 3F4SA 3KD0A 4GSTA 3VLNA 1GSYA 5CP1A 5ELGA 4BWQA 2HI7A 2WS2A 1SJZA 2F3MA 2C0GA 1GTAA 2P31A 1URMA 1WWJA 3H93A 1TKDB 1VGLA 4MJCA 4G9HA 3IOSA 5ECHB 1XZOA 2CX4A 1T7PB 3ZTLA 4NAXA 2NVLA 3VWWA 2FUG2 3DMLA 1M2BA 5A5KA 1M2DA 1M0UA 2GSRA 3GKMA 1THXA 1PKWA 4IW9A 4DVCA 1R26A 2O85A 1K3YA 5IMFA 3F3RA 2B7JA 4V1Ag 3O3TA 4HJMA 1WJKA 1J08A 4OCEA 2DMMA 4TXVA 3HZ4A 3UL3A 2OE0A 2X8HA 3GH9A 3JCML 4I2UA 2VCXA 1DBYA 5G5FA 4IKHA 3TKPA 4G2EA 2MMZA 1ERWA 5F06A 1N8JA 5L71A 1JLVA 5G31A 5ELAA 4J2FA 2R37A 3HXSA 4KB3A 2L6CA 2VUPA 1V57A 4MK3A 4MDCA 2A2SA 2V6KA 3SWLA 4V2LA 1CQGA 4PNGA 1HD2A 3CSIA 3SBCA 2IIYA 3QAVA 3QFAC 2L5OA 4WF4A 2V2GA 2K8SA 2C3QA 4OCFA 2LNTA 4F9ZA 1T1VA 2MMOA 5CRGA 4POMA 2I81A 3TJKA 2AYTA 1V40A 2PU9C 1U3AA 4OFTA 3RPPA 4IP1A 1SKRB 4V2MA 5IMVA 5KN3A 3L4NA 1THOA 1BJXA 1V2AA 3GIXA 3PH9A 1RK4A 4MZCA 3VI5A 4MF6A 2H0IA 2VLTA 2HT9A 3TKSC 3TGZA 4TN8A 1Q4JA 5EL8A 3TJBA 5J4UA 3IR4A 1GUKA 3RHBA 4XRDA 5IIZA 4HEA2 3GSTA 3E0UA 4H86A 1GWCA 1U3IA 3QD9A 4MABA 4J57E 5IPHA 3HA9A 3F9UA 2L4QA 1U88A 2RM5A 3VWUA 1A0FA 2LV3A 3ERWA 2CT6A 4TR0A 1S3AA 2LQOA 1JHBA 2GQLA 3GYKA 1ERUA 3GRXA 4FO5A 1PD21 1J9BA 3F0IA 3KMOA 2CAQA 3EE2A 5HR3A 5HR1A 3W8JA 1VF1A 3TB2A 1JZRA 2M72A 3D5JA 2VD0A 4DSQA 2QC7A 3UEMA 5ABRA 1YKCA 2K8VA 3GX8A 4KDUA 3QDNA 1A23A 1UN2A 4NHWA 4F2IA 2GQKA 4TXOA 3UVTA 2B5EA 5AN1A 3IPZA 2FLSA 3F4RA 1EGOA 4BL7A 3HZ8A 1ZYQB 2E7PA 1FO5A 2WDUA 4MJEA 1XPVA 2MMAA 2CVBA 3G7JA 3IBHA 4XHMA 1QXHA 3DD3A 4GQFA 4TR1A 3VI7A 1GTBA 2HSYA 1F3AA 7GSSA 3F8UA 4O92A 2H75A 2N5AA 1M9BA 2HZFA 1PGTA 1G0TA 2NPBA 5DCGA 3ME7A 3F63A 2JZRA 3CXGA 1ZL9A 2F8FA 2B1KA 1X5CA 3C1RA 2PGTA 4PUAA 4EDYA 3DXBA 5G2ZA 2IPAA 4MF7A 1XW9A 2DIZA 1T8EB 2HRFA 2FA8A 2X8GA 4ZBAA 1H75A 6GSTA 5ECMB 5C04A 2LRNA 17GSA 3F4TA 3LG6A 4KH7A 1GULA 16GSA 1HQOA 2LJAA 2FCHA 5DBQA 1A8YA 2KOKA 1N2AA 5G1KA 2F51A 1XFLA 3IC4A 1GLQA 1ABAA 2M80A 4TW5A 4TR1B 2YOIA 4BPYA 5B6MA 1NHOA 2CQ9A 2JL4A 3GSSA 3F3QA 3G7YA 4FYBA 4ZL7A 1K0AA 4Q5RA 4IN0A 1JZDA 2H8LA 1Z3EA 2IWTA 2GLRA 2MYGA 2H1BA 3ISOA 4KE3A 2H1AA 1MDKA 4PURA 2R3XA 2DLXA 2L5LA 2CV4A 2O87A 4ILFA 3HJPA 3GTUB 2H30A 3DIEA 1Z6NA 1ML6A 1T4YA 2R5GA 4IJIA 2VM2A 3S9FA 12GSA 1YF0A 5CO3A 1O8WA 3KM6A 4NWYA 4N11A 1GP1A 2P5RA 2DJKA 1U6TA 2H6ZA 2GSQA 2GSSA 2FNOA 6GSXA 3H79A 4HU9A 1EZKA 2KUCA 2FWFA 3AY8A 2H76A 2PBJA 1SYXA 3BBYA 1K3LA 3Q18A 4XRAA 4NPBA 3P2AA 3ZRDA 2X99A 1GSFA 14GSA 4OMVA 5DJMA 5GAPD 3HVVA 4KSOA 2IMEA 4K1FA 2ON5A 1IYIA 2JADA 3I69A 5D9XA 1GUHA 4MCUA 1NW2A 3TKSA 3DVWA 1EEJA 5HR2A 3NIVA 1SJIA 2RLIA 2DIYA 1EP8A 4IS0A 4KX4A 3FK8A 1KBNA 5F05A 2YWOA 5FWGA 2GQMA 3FY7A 3FZ5A 2FWEA 2OJLA 2G2QA 1WMJA 2I1UA 2BTOT 1F3BA 5G1LA 1R5PA 4JBBA 4F0CA 2HRNA 2ALBA 4MZBA 1X9SB 1GNWA 2OA7A 1PL1A 4MMMA 4OD7A 4P3YB 3UJ1A 3UIWA 3LYKA 1OC3A 3GX0A 2L59A 1UVZA 3LJRA 1R5AA 2P5QA 2VOCA 1B4PA 5F0GA 1PA3A 5G5EA 3ZZXA 1Z9HA 3VPQA 1A2LA 1SL2B 1MTCA 3IK7A 4V2NA 2HZEB 3W6GA 3TJGA 3RDWA 5E59A 5J3RA 3FR3A 4ML6A 2KP1A 1DSBA 1TU7A 4DSSA 2GDRA 3ZMLA 3EMXA 3GA4A 4O32A 2FHEA 4EO3A 2YJ7A 2NBSA 4I97A 2K9FA 2MMNA 4K7OA 4JRRA 1YY7A 1DE2A 2CAIA 1PRXA 2WB9A 3CSHA 5AIXA 1MD4A 2J9HA 3IHQA 3CSJA 1TJDA 1M7TA 3FR6A 2RM6A 1G6YA 5J9CA 5INYA 2FWGA 1XVWA 3NOFA 3NZNA 1KNGA 1NM3A 2OADA 2XHFA 3D22A 4MPFA 3TRPA 2VL3A 5ECIB 4ECJA 2GSTA 4EDZA 4EXJA 5GAND 4E8HA 2CVDA 2EIQA 1TP9A 1JZWA 4POBA 2WZ9A 1ERVA 1T00A 2E2GA 1C72A 4DSSB 3PINA 2H19A 1TK5B 2H1GA 4IHUA 1NHYA 4KCEA 2VLUA 3APOA 2X8CA 3N9JA 3M0FA 4I5QA 2WCIA 3ED3A 2I9HA 1V98A 1G7OA 4YQMA 1ILOA 3I6AA 3IK9A 3TDGA 2NTOA 3FZAA 4AJ7A 2OKAA 1J0FA 4FIWA 1FG4A 3TOTA 1GUMA 1BEDA 1GSSA 2IMFA 4KUNA 1K0OA 1B8XA 3ZLPA 10GSA 5IOXA 1YJ6A 3IRAA 4AF2A 1ST9A 1WRYA 2C4JA 2PPTA 4LL4B 5IMAA 4BVXA 3HYPA 3N5OA 3A2WA 2FA4A 1ACVA 2A4VA 3VK9A 4GSSA 3VWXA 2YWNA 2YZHA 2IN3A 1TRSA 4ZL8A 5KN1A 2KHPA 1NSWA 2PVQA 2V32A 2F8AA 1ZZYA 2J23A 1ZOFA 4MA9A 2B6MA 4RUVA 1K0CA 3ZL5A 1W4VA 4TOPA 4KNDA 3RAZA 4BWSA 3MWHA 4FYCA 2V1MA 1F2EA 5H5QA 1HNAA 1XWKA 3WGEA 3TRQA 2IJYA 3DRNA 4RI7A 2LJKA 3ERGA 3QAWA 3MSZA 1UC7A 5AGYA 2ZUPA 2H01A 3LFLA 4E8EA 3H4KA 4GTUA 4KAEA 5CRHA 1G6WA 3H1NA 4L5LA 3TJFA 5CNWA 3C1SA 2C80A 3QAGA 2H6XA 1YEXA 5DJLA 3G7IA 2H74A 4PQ1A 1K0DA 2IMIA 2GS3A 5ECKB 1JLWA 4F82A 2HXKA 1AQVA 1O73A 2PWJA 2YANA 3A2VA 3HKRA 3KXOA 2LUSA 1MDIA 4YH2A 3CTFA 3A3TA 2C0DA 2ZCTA 5ECPB 1H4OA 4TRXA 1QFNA 4ZB6A 1O6JA 2LJRA 3L78A 3VWVA 4ID0A 1M99A 5F8BA 1TU8A 4PQIA 2JU5A 2YN1A 3BCIA 4EUYA 1SENA 1VF4A 2N5BA 5ECOB 4MZWA 1GH2A 1QMVA 3HVSA 3MNGA 4I6XA 4OO5A 3WGDA 4N10A 2YP6A 3UBKA 5H5RA 2DSAA 1AC1A 2JSZA 3L0HA 3VFIA 5KN2A 1XOBA 3J7Yk 4WKWA 5B6NA 3QFBC 1TI1A 5DDLA 5EPFA 4BA7A 2WFCA 3WYWA 1EOHA 2B5YA 4YAVA 5DQSA 3UARA 2HFDA 3I43A 1PKZA 2B1LA 3G9BA 1RQMA 1I9DA 2TRCP 3M3MA 3A2XA 1ZGNA 3HJMA 1XVQA 3WD6A 1SKWB 4HDEA 4MF5A 3GNJA 3DVXA 1YKAA 1BG5A 4WF5A 2LNSA 2D2ZA 2GZPA 3APSA 3GMFA 3IV4A 2R2JA 2C0EA 4ECIA 5GSSA 4XTSA 1XWAA 6GSVA 1XW5A 1WPIA 3FHKA 2YPMA 1HNBA 3GURA 1LJRA 4WEYA 3GV1A 3OR5A 4EL1A 3UBLA 4TR3A 1OYJA
chains in the Genus database with same CATH superfamily
3FYGA 3GTUA 4IELA 3ZFLA 2OE3A 5IPGA 4GXZA 3TUEA 2EIOA 3LYPA 2GTUA 4FQUA 2WRTA 2N5FA 1TRUA 4BIKA 2C8UA 3GL3A 2RUEA 1A24A 3BOAA 4ECBA 3KGKA 3Q19A 3KZQA 4ZILA 4F0BA 4WR4A 2R6KA 4XCSA 2H70A 2O7KA 4LA1A 1PSQA 5D9TA 2GT6A 3TOUA 1XWBA 1TRVA 3TKQA 5IO2A 4OFMA 3ZIJA 3D6IA 2CX3A 4TKYA 2H72A 2C0FA 1A2MA 1E2YA 2IL3A 5A4WA 2C3TA 2DJ2A 4IQ1A 3KMNA 1W89A 5DQYA 3HHVA 3VPTA 3L9VA 5EVOA 1MD3A 3CYNA 2LQQA 3PGTA 3FZ4A 1SK0A 2GZZA 4ML1A 4N0ZA 2ES7A 1Q98A 2H66A 1TK0B 3L9SA 5KOWA 4WBJA 5B8AA 19GSA 4N0VA 3P90A 5A4UA 3ZFBA 2GT5A 1SL0B 2I4AA 2MZCA 5FHIA 2FD3A 4PGTA 2WGRA 3HY2A 4XIHA 1Z7RA 3D0ZA 3VURA 4MH3A 3L9UA 1SD9A 2O8VB 5ENUA 2AHEA 3GFKA 1QGVA 1PMTA 2DJ3A 2HZEA 2LRCA 2YCDA 4WR5A 3A5WA 4X0XA 2E0QA 3LWAA 1OE7A 1KEBA 2L57A 2HLSA 2DBCA 2G0FA 2GVPA 2VCQA 1X9WB 1EP7A 3E3EA 2VM1A 3KIJA 4N30A 3E9JB 3GH6A 4KW6A 1B9XC 1WOUA 1ZYEA 2HE3A 4HS1A 1GSEA 4LMVA 22GSA 4YAPA 1GNEA 2VAFA 1PL2A 1FHEA 5DAKB 2V41A 4EE0A 3M9JA 2H71A 2X4AA 3GHAA 4LLRA 3DWVA 3FZ9A 1FW1A 1WIKA 4X1UA 1AW9A 1QK8A 1AXDA 4POKA 3CQFA 1BQ7A 4ULXA 4BVYB 1VF3A 3FW2A 1SYRA 2IFQB 1XW6A 2A4HA 3KH7A 3WGXA 9GSSA 3WT2A 2OBKA 2YWIA 4ZXGA 1GL8A 4JZQA 1M9AA 4KGIA 4ZBDA 3R2QA 1DUGA 1O85A 4XS4A 4Z2UA 4MP4A 4L0WA 1EEMA 2LSTA 1A0RP 1UA5A 4KA0A 5ECSA 5H5SA 1OC9B 1A8LA 3TRXA 3KCMA 1GSUA 2H6YA 3M1GA 1Y25A 1Y6EA 4AJ8A 5DCHA 3RHCA 4OO4A 2R4VA 4CDOA 2XPDA 2OBIA 2PN8A 1F37A 2L4CA 1MEKA 1FVKA 4WBRD 4IVFA 1SL1B 4YQUA 1EWXA 3IE3A 3UAPA 4EKZA 1KTEA 2BMXA 2DC5A 2CVKA 2PUKC 3ZREA 5IMCA 1XXUA 5JWRB 13GSA 4EIPA 2PVOC 1YDKA 3LORA 2QGVA 4K7IA 5JWQB 1FAAA 2OE1A 2DMLA 4MJAA 2F9SA 2E2MA 4XS4B 1XWGA 2C3NA 2EC4A 3FR9A 4OFNA 3QMXA 5IOWA 2PMTA 1BYEA 3KJYA 5IM9A 3LGCA 4ZB9A 1MDJA 4NMUA 2MBSA 3EVIA 1AAZA 2HSMA 4PUFC 1HNCA 2M46A 3U6VA 1ON4A 4HU7A 3RBTA 1I5GA 5C00A 2B7KA 2LRTA 3P8WA 3DGQA 2JACA 1TRWA 2ZNMA 1GTIA 1JFUA 4CW9A 3GKKA 5ECQB 3KP9A 4ICYA 1M2AA 1XIYA 2X64A 4K5RA 4CHSA 5HFGA 2ON7A 2H73A 3ZITA 20GSA 3HDCA 6GSUA 4G19A 3EMPA 4ECCA 3LXTA 4JR4A 5J5NA 5J41A 2B5XA 5IQYA 2LKUA 4K0GA 2KLXA 3LQ7A 5ECNB 4CY6A 1TW9A 5JCGA 3UMAA 3HVNA 1U87A 1OKTA 4AGSA 2H0GA 3C73A 3EURA 3O76A 8GSSA 1E6BA 4PX1A 2FWHA 1YZXA 3EPTA 2VCWA 3IXRA 1EV4A 1YQ1A 2AJQB 1PN9A 4JR6A 3ZMKA 4DSRA 4PQHA 2CZ3A 2AV4A 3KP8A 1WP0A 3ME8A 4KSMA 4LL1B 3BJ5A 4NHZA 1PQNA 4O5QA 1V9WA 4IJ3A 5JCWA 4KDYA 2YV9A 1T4ZA 1F9MA 4MPGA 4WETA 4KCAA 1X5EA 2WULA 2JZTA 4EC0A 4JU5A 2DJ1A 2LEGA 5J9BA 1OE8A 3GUSA 4OWYA 4G0LA 3D21A 2FY6A 3FEUA 2KP2A 4L8EA 3V1WA 1TXXA 4K9ZA 5B7CA 1R4WA 1OKDA 3LXZA 4K8MA 3P7XA 4TR4A 1ERTA 3I9V2 4FYUA 4GLTA 1BX9A 4JEDA 4RQRA 1DE1A 4QL7A 3UOMA 6GSWA 3EU4A 4GRFA 1USBA 4D73A 5DALA 4QL9A 1LBKA 5EY6A 1BAYA 2R0GA 2V6OA 4ZL9A 3O6TA 3K8NA 3ZVJD 1K0BA 4HZ4A 2VO4A 2A2RA 3ZIVA 1FB6A 4TVEA 3QOUA 3KEBA 2O89A 5AIVA 5ECLB 5D9VA 4HZ2A 5F07A 5A4VA 1ZCPA 3C7MA 4ZIJA 18GSA 4EF0A 2AB6A 3TKSE 3M8NA 4HQSA 1XG8A 3PPUA 1SK2A 2XPEA 5ECRB 5HFIA 5B8BA 2R0PA 3KTLA 2JZSA 1PX6A 4GSNA 3FKFA 2HYXA 2I3YA 4NV5A 1X0RA 3GKNA 5IMDA 2VL9A 3C71A 3EU3A 5JWOB 1EV9A 4YKGA 3CMIA 2VCVA 2VL2C 2XBQA 2HSHA 2WJUA 2YWMA 1B9YC 2VCZA 4GCIA 5D8IA 4D73B 5DALB 3EYTA 5E4WA 2BJXA 4K7NA 1GLPA 2H0HA 1AQXA 3EINA 3WT1A 1M3IA 2YNXA 4IQAA 1S3RA 1AIUA 3ERFA 1K0MA 6GSSA 5CYYA 3GL5A 4HUAA 4I2TA 1X5DA 3MDKA 3IAM2 3EC3A 3TJJA 2QSIA 3D4TA 1V58A 1VRSD 2P0GA 4L0UA 3HJOA 4CY8A 5KEJA 2K6VA 5DVBA 1Z7PA 5CRWA 3RPNA 4TXOB 4BL7B 1K0NA 4LMWA 3US3A 2YV7A 2AAWA 4F03A 4O5RA 4L5OA 4Q5NA 5BMUA 4K2DA 2OACA 1FOHA 1EOGA 4Z2RA 2TRXA 1RW1A 4FH8A 3IDVA 2VD1A 2DJ0A 3HD5A 1EGRA 3J7Yb 1B4QA 3MAKA 2QKEA 3DEXA 5CAXA 1SD8A 2DJJA 4KDXA 1WE0A 1QQ2A 4GQCA 1F6MC 3Q6OA 4Z7XA 2VCTA 5BRTA 2B3SA 3Q74A 1ZMAA 1PX7A 1Z6MA 4IBPA 1CQHA 4XS6A 4RQXA 1GTUA 1FVJA 1S3CA 5GZZB 1FB0A 3TKRA 4A5PA 1TTZA 3LEFA 5LCZA 4MJBA 4PXOA 4K0NA 5DAKA 4ACSA 2EIRA 2IMKA 4DEJA 4MNNA 1PN0A 4J56E 5ID2A 5LD0A 3ZYWA 3U5RE 3PR8A 4YQVA 4V1Ap 3QR6A 1A2JA 4G10A 4BVYA 2C1YA 1X9MB 4PNFA 3UVHA 1OC8A 1QUWA 4USSA 2IFQA 1O7UA 4HOJA 11GSA 1B48A 3CRTA 5FT3A 1LU4A 1OVNA 2HNLA 2MBTA 4RI6A 3APQA 4GF0A 2XC2A 5IMZA 1XCCA 1K3OA 3H8QA 5D93A 4GWRA 5COHA 2CZ2A 1TI3A 1YEPA 4Q5FA 1XOAA 5D9WA 3BCKA 4AJ6A 2REMA 1OC9A 4HI7A 2QA2A 1O8XA 4IP6A 4X43A 3CTGA 1SU9A 2PERA 5GSTA 4XS1A 3GKXA 5LNKe 2Z9SA 2NDOA 4NV2A 5AISA 3ZVJA 1AQWA 5ID2B 2LS5A 3TCOA 3KH9A 4MLYA 5G30A 3CBUA 2LTKA 4Q5QA 2FGXA 4I8BA 5HFKA 4EVMA 4NXIA 4ZB8A 1AUCA 1GSDA 2K18A 1O81A 3IA1A 1TOFA 1G7EA 1VF2A 3LSZA 1Z5YE 4K5SA 5IO0A 1ZYPA 3HVXA 2VLVA 2GGTA 1XWCA 1GRXA 1XBSA 4K6XA 5HR0A 5D73A 1T3BA 1FOVA 4QQ7A 2YZUA 4O7HA 6GSYA 1SK1A 2XBIA 2VL2A 5JCUA 5CRDA 2YJHA 1HYUA 3DYRA 3W8SA 2CA8A 1OAZA 5D96A 3QCPA 2RUFA 3IAS2 3FRCA 1S3DA 1TDIA 4YKFA 3CRUA 1SJ6A 4IGJA 4POLA 4HJ2A 4ISDA 2AUVA 3QPMA 1GSQA 2RIIA 5KN0A 1R7HA 1TK8B 3DKSA 1JZOA 3HCZA 3MYDA 3F6DA 4MH2A 4ZBBA 2L6DA 3F6FA 4HQZA 2TIRA 3BD2A 1YF1A 3M9KA 3EWLA 4WXTA 1SKSB 5CREA 4JE1A 2H1DA 3IC8A 5HQPA 2R0CA 2VIMA 3C8EA 1IYHA 3KTBA 2JSYA 3GN3A 3D4MA 2GZYA 2IMDA 3F4SA 3KD0A 4GSTA 3VLNA 1GSYA 5CP1A 4G0IA 5ELGA 4BWQA 2HI7A 2WS2A 1SJZA 2F3MA 2C0GA 1GTAA 2P31A 1URMA 1WWJA 3H93A 1TKDB 1VGLA 4MJCA 4G9HA 4PTSA 3IOSA 5ECHB 1XZOA 2X49A 2CX4A 1T7PB 3ZTLA 4NAXA 2NVLA 3VWWA 2FUG2 3DMLA 1M2BA 5A5KA 1M2DA 1M0UA 2GSRA 3GKMA 1THXA 1PKWA 4IW9A 4DVCA 1R26A 2O85A 1K3YA 5IMFA 3F3RA 2B7JA 4V1Ag 3O3TA 4HJMA 1WJKA 1J08A 4OCEA 2DMMA 4TXVA 3HZ4A 3UL3A 2OE0A 2X8HA 3GH9A 3JCML 4I2UA 2VCXA 1DBYA 5G5FA 4IKHA 3TKPA 4G2EA 2MMZA 1ERWA 5F06A 1N8JA 5L71A 1JLVA 5G31A 5ELAA 4J2FA 2R37A 3HXSA 4KB3A 4G0KA 2L6CA 2VUPA 1V57A 4MK3A 4MDCA 2A2SA 4BVXB 2V6KA 3SWLA 4V2LA 1CQGA 4PNGA 1HD2A 3CSIA 3SBCA 2IIYA 3QAVA 3QFAC 2L5OA 4WF4A 2V2GA 2K8SA 2C3QA 4OCFA 2LNTA 4F9ZA 1T1VA 2MMOA 5CRGA 4POMA 5KOXA 2I81A 3TJKA 2AYTA 1V40A 2PU9C 1U3AA 4OFTA 3RPPA 4IP1A 1SKRB 4V2MA 5IMVA 5KN3A 3L4NA 1THOA 1BJXA 1V2AA 3GIXA 4HSCX 3PH9A 1RK4A 4MZCA 3VI5A 4MF6A 2H0IA 2VLTA 2HT9A 3TKSC 3TGZA 4TN8A 1Q4JA 2A2PA 5EL8A 3TJBA 5J4UA 3IR4A 1GUKA 3RHBA 4XRDA 5IIZA 4HEA2 3GSTA 3E0UA 4H86A 1GWCA 2DKIA 1U3IA 3QD9A 4MABA 4J57E 5IPHA 3HA9A 3F9UA 2L4QA 1U88A 2RM5A 3VWUA 1A0FA 2LV3A 3ERWA 4Z2TA 2CT6A 4TR0A 1S3AA 2LQOA 1JHBA 2GQLA 3GYKA 1ERUA 3GRXA 4FO5A 1PD21 1J9BA 3F0IA 3KMOA 2CAQA 3EE2A 5HR3A 5HR1A 3W8JA 1VF1A 3TB2A 1JZRA 2M72A 3D5JA 2VD0A 4DSQA 2QC7A 3UEMA 5ABRA 1YKCA 2K8VA 3GX8A 4KDUA 3QDNA 1A23A 1UN2A 4NHWA 4F2IA 2GQKA 4TXOA 3UVTA 2B5EA 5AN1A 3IPZA 2FLSA 3F4RA 1EGOA 4BL7A 3HZ8A 1ZYQB 2E7PA 1FO5A 2WDUA 4MJEA 1XPVA 2MMAA 2CVBA 3G7JA 3IBHA 4XHMA 1QXHA 3DD3A 4GQFA 4TR1A 3VI7A 1GTBA 2HSYA 1F3AA 7GSSA 3F8UA 4O92A 2H75A 2N5AA 1M9BA 2HZFA 1PGTA 1G0TA 2NPBA 5DCGA 3ME7A 3F63A 2JZRA 3CXGA 1ZL9A 2F8FA 2B1KA 1X5CA 3C1RA 3R3EA 2PGTA 4PUAA 4EDYA 3DXBA 2QA1A 4O5UA 5G2ZA 2IPAA 4MF7A 1XW9A 2DIZA 1T8EB 2HRFA 2FA8A 2X8GA 4ZBAA 1H75A 6GSTA 5ECMB 5C04A 2LRNA 17GSA 3F4TA 3LG6A 1M3JA 4KH7A 1GULA 16GSA 1HQOA 2LJAA 2FCHA 5DBQA 1A8YA 2KOKA 1N2AA 5G1KA 2F51A 1XFLA 3IC4A 1GLQA 1ABAA 2M80A 4TW5A 4TR1B 2YOIA 4BPYA 5B6MA 1NHOA 2CQ9A 2JL4A 3GSSA 3F3QA 3G7YA 4FYBA 4ZL7A 1K0AA 4Q5RA 4IN0A 1JZDA 2H8LA 1Z3EA 2IWTA 2GLRA 2MYGA 2H1BA 3ISOA 4KE3A 2H1AA 1MDKA 4PURA 2R3XA 4EIQA 2DLXA 2L5LA 2CV4A 2O87A 4ILFA 3HJPA 3GTUB 2H30A 3DIEA 1Z6NA 1ML6A 1T4YA 2R5GA 4IJIA 2VM2A 3S9FA 12GSA 1YF0A 5CO3A 1O8WA 3KM6A 4NWYA 4N11A 1GP1A 2P5RA 2DJKA 1U6TA 2H6ZA 2GSQA 2GSSA 2FNOA 6GSXA 3H79A 4HU9A 1EZKA 2KUCA 2FWFA 3AY8A 2H76A 2PBJA 1SYXA 3BBYA 1K3LA 3Q18A 4XRAA 4NPBA 3P2AA 3ZRDA 2X99A 1GSFA 14GSA 4OMVA 5DJMA 5GAPD 3HVVA 4KSOA 2IMEA 4K1FA 2ON5A 1IYIA 2JADA 3I69A 5D9XA 1GUHA 4MCUA 1NW2A 3TKSA 3DVWA 1EEJA 5HR2A 3NIVA 1SJIA 2RLIA 2DIYA 1EP8A 4IS0A 4KX4A 3FK8A 1KBNA 5F05A 2YWOA 5FWGA 2GQMA 3FY7A 3FZ5A 2FWEA 2OJLA 2G2QA 1WMJA 2I1UA 2BTOT 1F3BA 5G1LA 1R5PA 4JBBA 4F0CA 2HRNA 2ALBA 4MZBA 1X9SB 1GNWA 2OA7A 1PL1A 4MMMA 4OD7A 4P3YB 3UJ1A 3UIWA 3LYKA 1OC3A 3GX0A 2L59A 1UVZA 3LJRA 1R5AA 2P5QA 2VOCA 1B4PA 5F0GA 1PA3A 5G5EA 3ZZXA 1Z9HA 3VPQA 1A2LA 1SL2B 1MTCA 3IK7A 4V2NA 2HZEB 3W6GA 3TJGA 3RDWA 5E59A 5J3RA 3FR3A 4ML6A 2KP1A 1DSBA 1TU7A 4DSSA 2GDRA 3ZMLA 3EMXA 3GA4A 4O32A 2FHEA 4EO3A 2YJ7A 2NBSA 4I97A 2K9FA 2MMNA 4K7OA 4JRRA 1YY7A 1DE2A 2CAIA 1PRXA 2WB9A 3CSHA 5AIXA 1MD4A 2J9HA 3IHQA 3CSJA 1TJDA 1M7TA 3FR6A 2RM6A 1G6YA 5J9CA 4X4JA 5INYA 2FWGA 1XVWA 3NOFA 3NZNA 1KNGA 1NM3A 2OADA 2XHFA 3D22A 4MPFA 3TRPA 2VL3A 5ECIB 4ECJA 2GSTA 4EDZA 4EXJA 5GAND 4E8HA 2CVDA 2EIQA 1TP9A 1JZWA 4POBA 2WZ9A 1ERVA 1T00A 2E2GA 1C72A 4DSSB 3PINA 2H19A 1TK5B 2H1GA 4IHUA 1NHYA 4KCEA 2VLUA 3APOA 2X8CA 3N9JA 3M0FA 4I5QA 2WCIA 3ED3A 4KF9A 2I9HA 1V98A 1G7OA 4YQMA 1ILOA 3I6AA 3IK9A 3TDGA 2NTOA 3FZAA 4AJ7A 2OKAA 1J0FA 4FIWA 1FG4A 3TOTA 1GUMA 1BEDA 3MIXA 1GSSA 2IMFA 4KUNA 3IHGA 1K0OA 1B8XA 3ZLPA 10GSA 5IOXA 1YJ6A 2HRKA 3IRAA 4AF2A 1ST9A 1WRYA 2C4JA 2PPTA 4LL4B 5IMAA 4BVXA 3HYPA 3N5OA 3A2WA 2FA4A 1ACVA 2A4VA 3VK9A 4GSSA 3VWXA 2YWNA 2YZHA 2IN3A 1TRSA 4ZL8A 5KN1A 2KHPA 1NSWA 2PVQA 2V32A 2F8AA 1ZZYA 2J23A 1ZOFA 4MA9A 2B6MA 4RUVA 1K0CA 3ZL5A 2UZ8A 1W4VA 4TOPA 4KNDA 3RAZA 4BWSA 3MWHA 4FYCA 2V1MA 3LW9A 1F2EA 1ZYNA 5H5QA 1HNAA 1XWKA 3WGEA 3TRQA 2IJYA 3DRNA 4RI7A 2LJKA 3ERGA 3QAWA 3MSZA 1UC7A 5AGYA 2ZUPA 2H01A 3LFLA 4E8EA 3H4KA 4GTUA 4KAEA 4K2XA 5CRHA 2DKHA 1G6WA 3H1NA 4L5LA 3TJFA 5CNWA 3C1SA 2C80A 3QAGA 2H6XA 1YEXA 5DJLA 3G7IA 2H74A 4PQ1A 1K0DA 2IMIA 2GS3A 5ECKB 1JLWA 4F82A 2HXKA 1AQVA 1O73A 2PWJA 2YANA 3A2VA 3HKRA 3KXOA 2LUSA 1MDIA 4YH2A 3CTFA 3A3TA 2C0DA 2ZCTA 5ECPB 1H4OA 4TRXA 1QFNA 4ZB6A 1O6JA 2LJRA 3L78A 3VWVA 4ID0A 1M99A 5F8BA 1TU8A 4PQIA 2JU5A 2YN1A 3BCIA 4EUYA 1SENA 1VF4A 2N5BA 5ECOB 4MZWA 1GH2A 1QMVA 3HVSA 3MNGA 4I6XA 4OO5A 3WGDA 4N10A 2YP6A 3UBKA 5H5RA 2DSAA 1AC1A 2JSZA 3L0HA 3VFIA 5KN2A 1XOBA 3J7Yk 4WKWA 5B6NA 3QFBC 1TI1A 5DDLA 5EPFA 3FMWA 2WFCA 4BA7A 3WYWA 1EOHA 2B5YA 4YAVA 5DQSA 3UARA 2HFDA 3I43A 1PKZA 2HRAA 2B1LA 3G9BA 1RQMA 3A5IA 1I9DA 2TRCP 3M3MA 3A2XA 1ZGNA 3HJMA 1XVQA 3WD6A 1SKWB 4HDEA 4MF5A 3GNJA 3DVXA 1YKAA 1BG5A 4WF5A 2LNSA 2D2ZA 2GZPA 3APSA 3GMFA 3IV4A 2R2JA 2C0EA 4ECIA 5GSSA 4XTSA 1XWAA 6GSVA 1PFOA 1XW5A 1WPIA 3FHKA 2YPMA 1HNBA 3GURA 1LJRA 4WEYA 3GV1A 3OR5A 4EL1A 3UBLA 4TR3A 1OYJA
chains in the Genus database with same CATH topology
3FYGA 3GTUA 4IELA 3ZFLA 2OE3A 5IPGA 4GXZA 3TUEA 2EIOA 3LYPA 2GTUA 4FQUA 2WRTA 2N5FA 1TRUA 2C8UA 3GL3A 2RUEA 1A24A 3BOAA 4ECBA 3KGKA 3Q19A 3KZQA 4ZILA 4F0BA 4WR4A 2R6KA 4XCSA 2H70A 2O7KA 4LA1A 1PSQA 5D9TA 2GT6A 3TOUA 1XWBA 1TRVA 3TKQA 5IO2A 4OFMA 3ZIJA 3D6IA 2CX3A 4TKYA 2H72A 2C0FA 1A2MA 1E2YA 2IL3A 5A4WA 2C3TA 2DJ2A 4IQ1A 3KMNA 1W89A 5DQYA 3HHVA 3VPTA 3L9VA 5EVOA 1MD3A 3CYNA 2LQQA 3PGTA 3FZ4A 1SK0A 2GZZA 4ML1A 4N0ZA 2ES7A 1Q98A 2H66A 1TK0B 3L9SA 5KOWA 4WBJA 5B8AA 19GSA 4N0VA 3P90A 5A4UA 3ZFBA 2GT5A 1SL0B 2I4AA 2MZCA 5FHIA 2FD3A 4PGTA 2WGRA 3HY2A 4XIHA 1Z7RA 3D0ZA 3VURA 4MH3A 3L9UA 1SD9A 2O8VB 5ENUA 2AHEA 3GFKA 1QGVA 1PMTA 2DJ3A 2HZEA 2LRCA 2YCDA 4WR5A 3A5WA 4X0XA 2E0QA 3LWAA 1OE7A 1KEBA 2L57A 2HLSA 2DBCA 2G0FA 2GVPA 2VCQA 1X9WB 1EP7A 3E3EA 2VM1A 3KIJA 4N30A 3E9JB 3GH6A 4KW6A 1B9XC 1WOUA 1ZYEA 2HE3A 4HS1A 1GSEA 4LMVA 22GSA 4YAPA 1GNEA 2VAFA 1PL2A 1FHEA 5DAKB 2V41A 4EE0A 3M9JA 2H71A 2X4AA 3GHAA 4LLRA 3DWVA 3FZ9A 1FW1A 1WIKA 4X1UA 1AW9A 1QK8A 1AXDA 4POKA 1BQ7A 4ULXA 4BVYB 1VF3A 3FW2A 1SYRA 2IFQB 1XW6A 2A4HA 3KH7A 3WGXA 9GSSA 3WT2A 2OBKA 2YWIA 4ZXGA 1GL8A 4JZQA 1M9AA 4KGIA 4ZBDA 3R2QA 1DUGA 1O85A 4XS4A 4Z2UA 4MP4A 4L0WA 1EEMA 2LSTA 1A0RP 1UA5A 4KA0A 5ECSA 5H5SA 1OC9B 1A8LA 3TRXA 3KCMA 1GSUA 2H6YA 3M1GA 1Y25A 1Y6EA 4AJ8A 5DCHA 3RHCA 4OO4A 2R4VA 4CDOA 2XPDA 2OBIA 2PN8A 1F37A 2L4CA 1MEKA 1FVKA 4WBRD 4IVFA 1SL1B 4YQUA 1EWXA 3IE3A 3UAPA 4EKZA 1KTEA 2BMXA 2DC5A 2CVKA 2PUKC 3ZREA 5IMCA 1XXUA 5JWRB 13GSA 4EIPA 2PVOC 1YDKA 3LORA 2QGVA 4K7IA 5JWQB 1FAAA 2OE1A 2DMLA 4MJAA 2F9SA 2E2MA 4XS4B 1XWGA 2C3NA 2EC4A 3FR9A 4OFNA 3QMXA 5IOWA 2PMTA 1BYEA 3KJYA 5IM9A 3LGCA 4ZB9A 1MDJA 4NMUA 2MBSA 3EVIA 1AAZA 2HSMA 4PUFC 1HNCA 2M46A 3U6VA 1ON4A 4HU7A 3RBTA 1I5GA 5C00A 2B7KA 2LRTA 3P8WA 3DGQA 2JACA 1TRWA 2ZNMA 1GTIA 1JFUA 4CW9A 3GKKA 5ECQB 3KP9A 4ICYA 1M2AA 1XIYA 2X64A 4K5RA 4CHSA 5HFGA 2ON7A 2H73A 3ZITA 20GSA 3HDCA 6GSUA 4G19A 3EMPA 4ECCA 3LXTA 4JR4A 5J5NA 5J41A 2B5XA 5IQYA 2LKUA 4K0GA 2KLXA 3LQ7A 5ECNB 4CY6A 1TW9A 5JCGA 3UMAA 1U87A 1OKTA 4AGSA 2H0GA 3C73A 3EURA 3O76A 8GSSA 1E6BA 4PX1A 2FWHA 1YZXA 3EPTA 2VCWA 3IXRA 1EV4A 1YQ1A 2AJQB 1PN9A 4JR6A 3ZMKA 4DSRA 4PQHA 2CZ3A 2AV4A 3KP8A 1WP0A 3ME8A 4KSMA 4LL1B 3BJ5A 4NHZA 1PQNA 4O5QA 1V9WA 4IJ3A 5JCWA 4KDYA 2YV9A 1T4ZA 1F9MA 4MPGA 4WETA 4KCAA 1X5EA 2WULA 2JZTA 4EC0A 4JU5A 2DJ1A 2LEGA 5J9BA 1OE8A 3GUSA 4OWYA 4G0LA 3D21A 2FY6A 3FEUA 2KP2A 4L8EA 3V1WA 1TXXA 4K9ZA 5B7CA 1R4WA 1OKDA 3LXZA 4K8MA 3P7XA 4TR4A 1ERTA 3I9V2 4FYUA 4GLTA 1BX9A 4JEDA 4RQRA 1DE1A 4QL7A 3UOMA 6GSWA 3EU4A 4GRFA 1USBA 4D73A 5DALA 4QL9A 1LBKA 5EY6A 1BAYA 2R0GA 2V6OA 4ZL9A 3O6TA 3K8NA 3ZVJD 1K0BA 4HZ4A 2VO4A 2A2RA 3ZIVA 1FB6A 4TVEA 3QOUA 3KEBA 2O89A 5AIVA 5ECLB 5D9VA 4HZ2A 5F07A 5A4VA 1ZCPA 3C7MA 4ZIJA 18GSA 4EF0A 2AB6A 3TKSE 3M8NA 4HQSA 3PPUA 1SK2A 2XPEA 5ECRB 5HFIA 5B8BA 2R0PA 3KTLA 2JZSA 1PX6A 4GSNA 3FKFA 2HYXA 2I3YA 4NV5A 1X0RA 3GKNA 5IMDA 2VL9A 3C71A 3EU3A 5JWOB 1EV9A 4YKGA 3CMIA 2VCVA 2VL2C 2XBQA 2HSHA 2WJUA 2YWMA 1B9YC 2VCZA 4GCIA 5D8IA 4D73B 5DALB 3EYTA 5E4WA 2BJXA 4K7NA 1GLPA 2H0HA 1AQXA 3EINA 3WT1A 2YNXA 4IQAA 1AIUA 3ERFA 1K0MA 6GSSA 5CYYA 3GL5A 4HUAA 4I2TA 1X5DA 3MDKA 3IAM2 3EC3A 3TJJA 2QSIA 3D4TA 1V58A 1VRSD 2P0GA 4L0UA 3HJOA 4CY8A 5KEJA 2K6VA 5DVBA 1Z7PA 5CRWA 3RPNA 4TXOB 4BL7B 1K0NA 4LMWA 3US3A 2YV7A 2AAWA 4F03A 4O5RA 4L5OA 4Q5NA 5BMUA 4K2DA 2OACA 1FOHA 1EOGA 4Z2RA 2TRXA 1RW1A 4FH8A 3IDVA 2VD1A 2DJ0A 3HD5A 1EGRA 3J7Yb 1B4QA 3MAKA 2QKEA 3DEXA 5CAXA 1SD8A 2DJJA 4KDXA 1WE0A 1QQ2A 4GQCA 1F6MC 3Q6OA 4Z7XA 2VCTA 5BRTA 2B3SA 3Q74A 1ZMAA 1PX7A 1Z6MA 4IBPA 1CQHA 4XS6A 4RQXA 1GTUA 1FVJA 1S3CA 5GZZB 1FB0A 3TKRA 4A5PA 1TTZA 3LEFA 5LCZA 4MJBA 4PXOA 4K0NA 5DAKA 4ACSA 2EIRA 2IMKA 4DEJA 4MNNA 1PN0A 4J56E 5ID2A 5LD0A 3ZYWA 3U5RE 3PR8A 4YQVA 4V1Ap 3QR6A 1A2JA 4G10A 4BVYA 2C1YA 1X9MB 4PNFA 3UVHA 1OC8A 1QUWA 4USSA 2IFQA 1O7UA 4HOJA 11GSA 1B48A 3CRTA 5FT3A 1LU4A 1OVNA 2HNLA 2MBTA 4RI6A 3APQA 4GF0A 2XC2A 5IMZA 1XCCA 1K3OA 3H8QA 5D93A 4GWRA 5COHA 2CZ2A 1TI3A 1YEPA 4Q5FA 1XOAA 5D9WA 3BCKA 4AJ6A 2REMA 1OC9A 4HI7A 2QA2A 1O8XA 4IP6A 4X43A 3CTGA 1SU9A 2PERA 5GSTA 4XS1A 3GKXA 5LNKe 2Z9SA 2NDOA 4NV2A 5AISA 3ZVJA 1AQWA 5ID2B 2LS5A 3TCOA 3KH9A 4MLYA 5G30A 3CBUA 2LTKA 4Q5QA 2FGXA 4I8BA 5HFKA 4EVMA 4NXIA 4ZB8A 1AUCA 1GSDA 2K18A 1O81A 3IA1A 1TOFA 1G7EA 1VF2A 3LSZA 1Z5YE 4K5SA 5IO0A 1ZYPA 3HVXA 2VLVA 2GGTA 1XWCA 1GRXA 1XBSA 4K6XA 5HR0A 5D73A 1T3BA 1FOVA 4QQ7A 2YZUA 4O7HA 6GSYA 1SK1A 2XBIA 2VL2A 5JCUA 5CRDA 2YJHA 1HYUA 3DYRA 3W8SA 2CA8A 1OAZA 5D96A 3QCPA 2RUFA 3IAS2 3FRCA 1S3DA 1TDIA 4YKFA 3CRUA 1SJ6A 4IGJA 4POLA 4HJ2A 4ISDA 2AUVA 3QPMA 1GSQA 2RIIA 5KN0A 1R7HA 1TK8B 3DKSA 1JZOA 3HCZA 3MYDA 3F6DA 4MH2A 4ZBBA 2L6DA 3F6FA 4HQZA 2TIRA 3BD2A 1YF1A 3M9KA 3EWLA 4WXTA 1SKSB 5CREA 4JE1A 2H1DA 3IC8A 5HQPA 2R0CA 2VIMA 3C8EA 1IYHA 3KTBA 2JSYA 3GN3A 3D4MA 2GZYA 2IMDA 3F4SA 3KD0A 4GSTA 3VLNA 1GSYA 5CP1A 4G0IA 5ELGA 4BWQA 2HI7A 2WS2A 1SJZA 2F3MA 2C0GA 1GTAA 2P31A 1URMA 1WWJA 3H93A 1TKDB 1VGLA 4MJCA 4G9HA 4PTSA 3IOSA 5ECHB 1XZOA 2X49A 2CX4A 1T7PB 3ZTLA 4NAXA 2NVLA 3VWWA 2FUG2 3DMLA 1M2BA 5A5KA 1M2DA 1M0UA 2GSRA 3GKMA 1THXA 1PKWA 4IW9A 4DVCA 1R26A 2O85A 1K3YA 5IMFA 3F3RA 2B7JA 4V1Ag 3O3TA 4HJMA 1WJKA 1J08A 4OCEA 2DMMA 4TXVA 3HZ4A 3UL3A 2OE0A 2X8HA 3GH9A 3JCML 4I2UA 2VCXA 1DBYA 5G5FA 4IKHA 3TKPA 4G2EA 2MMZA 1ERWA 5F06A 1N8JA 5L71A 1JLVA 5G31A 5ELAA 4J2FA 2R37A 3HXSA 4KB3A 4G0KA 2L6CA 2VUPA 1V57A 4MK3A 4MDCA 2A2SA 4BVXB 2V6KA 3SWLA 4V2LA 1CQGA 4PNGA 1HD2A 3CSIA 3SBCA 2IIYA 3QAVA 3QFAC 2L5OA 4WF4A 2V2GA 2K8SA 2C3QA 4OCFA 2LNTA 4F9ZA 1T1VA 2MMOA 5CRGA 4POMA 5KOXA 2I81A 3TJKA 2AYTA 1V40A 2PU9C 1U3AA 4OFTA 3RPPA 4IP1A 1SKRB 4V2MA 5IMVA 5KN3A 3L4NA 1THOA 1BJXA 1V2AA 3GIXA 3PH9A 1RK4A 4MZCA 3VI5A 4MF6A 2H0IA 2VLTA 2HT9A 3TKSC 3TGZA 4TN8A 1Q4JA 2A2PA 5EL8A 3TJBA 5J4UA 3IR4A 1GUKA 3RHBA 4XRDA 5IIZA 4HEA2 3GSTA 3E0UA 4H86A 1GWCA 2DKIA 1U3IA 3QD9A 4MABA 4J57E 5IPHA 3HA9A 3F9UA 2L4QA 1U88A 2RM5A 3VWUA 1A0FA 2LV3A 3ERWA 4Z2TA 2CT6A 4TR0A 1S3AA 2LQOA 1JHBA 2GQLA 3GYKA 1ERUA 3GRXA 4FO5A 1PD21 1J9BA 3F0IA 3KMOA 2CAQA 3EE2A 5HR3A 5HR1A 3W8JA 1VF1A 3TB2A 1JZRA 2M72A 3D5JA 2VD0A 4DSQA 2QC7A 3UEMA 5ABRA 1YKCA 2K8VA 3GX8A 4KDUA 3QDNA 1A23A 1UN2A 4NHWA 4F2IA 2GQKA 4TXOA 3UVTA 2B5EA 5AN1A 3IPZA 2FLSA 3F4RA 1EGOA 4BL7A 3HZ8A 1ZYQB 2E7PA 1FO5A 2WDUA 4MJEA 1XPVA 2MMAA 2CVBA 3G7JA 3IBHA 4XHMA 1QXHA 3DD3A 4GQFA 4TR1A 3VI7A 1GTBA 2HSYA 1F3AA 7GSSA 3F8UA 4O92A 2H75A 2N5AA 1M9BA 2HZFA 1PGTA 1G0TA 2NPBA 5DCGA 3ME7A 3F63A 2JZRA 3CXGA 1ZL9A 2F8FA 2B1KA 1X5CA 3C1RA 3R3EA 2PGTA 4PUAA 4EDYA 3DXBA 2QA1A 4O5UA 5G2ZA 2IPAA 4MF7A 1XW9A 2DIZA 1T8EB 2HRFA 2FA8A 2X8GA 4ZBAA 1H75A 6GSTA 5ECMB 5C04A 2LRNA 17GSA 3F4TA 3LG6A 4KH7A 1GULA 16GSA 1HQOA 2LJAA 2FCHA 5DBQA 1A8YA 2KOKA 1N2AA 5G1KA 2F51A 1XFLA 3IC4A 1GLQA 1ABAA 2M80A 4TW5A 4TR1B 2YOIA 4BPYA 5B6MA 1NHOA 2CQ9A 2JL4A 3GSSA 3F3QA 3G7YA 4FYBA 4ZL7A 1K0AA 4Q5RA 4IN0A 1JZDA 2H8LA 1Z3EA 2IWTA 2GLRA 2MYGA 2H1BA 3ISOA 4KE3A 2H1AA 1MDKA 4PURA 2R3XA 4EIQA 2DLXA 2L5LA 2CV4A 2O87A 4ILFA 3HJPA 3GTUB 2H30A 3DIEA 1Z6NA 1ML6A 1T4YA 2R5GA 4IJIA 2VM2A 3S9FA 12GSA 1YF0A 5CO3A 1O8WA 3KM6A 4NWYA 4N11A 1GP1A 2P5RA 2DJKA 1U6TA 2H6ZA 2GSQA 2GSSA 2FNOA 6GSXA 3H79A 4HU9A 1EZKA 2KUCA 2FWFA 3AY8A 2H76A 2PBJA 1SYXA 3BBYA 1K3LA 3Q18A 4XRAA 4NPBA 3P2AA 3ZRDA 2X99A 1GSFA 14GSA 4OMVA 5DJMA 5GAPD 3HVVA 4KSOA 2IMEA 4K1FA 2ON5A 1IYIA 2JADA 3I69A 5D9XA 1GUHA 4MCUA 1NW2A 3TKSA 3DVWA 1EEJA 5HR2A 3NIVA 1SJIA 2RLIA 2DIYA 1EP8A 4IS0A 4KX4A 3FK8A 1KBNA 5F05A 2YWOA 5FWGA 2GQMA 3FY7A 3FZ5A 2FWEA 2OJLA 2G2QA 1WMJA 2I1UA 2BTOT 1F3BA 5G1LA 1R5PA 4JBBA 4F0CA 2HRNA 2ALBA 4MZBA 1X9SB 1GNWA 2OA7A 1PL1A 4MMMA 4OD7A 4P3YB 3UJ1A 3UIWA 3LYKA 1OC3A 3GX0A 2L59A 1UVZA 3LJRA 1R5AA 2P5QA 2VOCA 1B4PA 5F0GA 1PA3A 5G5EA 3ZZXA 1Z9HA 3VPQA 1A2LA 1SL2B 1MTCA 3IK7A 4V2NA 2HZEB 3W6GA 3TJGA 3RDWA 5E59A 5J3RA 3FR3A 4ML6A 2KP1A 1DSBA 1TU7A 4DSSA 2GDRA 3ZMLA 3EMXA 3GA4A 4O32A 2FHEA 4EO3A 2YJ7A 2NBSA 4I97A 2K9FA 2MMNA 4K7OA 4JRRA 1YY7A 1DE2A 2CAIA 1PRXA 2WB9A 3CSHA 5AIXA 1MD4A 2J9HA 3IHQA 3CSJA 1TJDA 1M7TA 3FR6A 2RM6A 1G6YA 5J9CA 4X4JA 5INYA 2FWGA 1XVWA 3NOFA 3NZNA 1KNGA 1NM3A 2OADA 2XHFA 3D22A 4MPFA 3TRPA 2VL3A 5ECIB 4ECJA 2GSTA 4EDZA 4EXJA 5GAND 4E8HA 2CVDA 2EIQA 1TP9A 1JZWA 4POBA 2WZ9A 1ERVA 1T00A 2E2GA 1C72A 4DSSB 3PINA 2H19A 1TK5B 2H1GA 4IHUA 1NHYA 4KCEA 2VLUA 3APOA 2X8CA 3N9JA 3M0FA 4I5QA 2WCIA 3ED3A 4KF9A 2I9HA 1V98A 1G7OA 4YQMA 1ILOA 3I6AA 3IK9A 3TDGA 2NTOA 3FZAA 4AJ7A 2OKAA 1J0FA 4FIWA 1FG4A 3TOTA 1GUMA 1BEDA 3MIXA 1GSSA 2IMFA 4KUNA 3IHGA 1K0OA 1B8XA 3ZLPA 10GSA 5IOXA 1YJ6A 2HRKA 3IRAA 4AF2A 1ST9A 1WRYA 2C4JA 2PPTA 4LL4B 5IMAA 4BVXA 3HYPA 3N5OA 3A2WA 2FA4A 1ACVA 2A4VA 3VK9A 4GSSA 3VWXA 2YWNA 2YZHA 2IN3A 1TRSA 4ZL8A 5KN1A 2KHPA 1NSWA 2PVQA 2V32A 2F8AA 1ZZYA 2J23A 1ZOFA 4MA9A 2B6MA 4RUVA 1K0CA 3ZL5A 2UZ8A 1W4VA 4TOPA 4KNDA 3RAZA 4BWSA 3MWHA 4FYCA 2V1MA 3LW9A 1F2EA 1ZYNA 5H5QA 1HNAA 1XWKA 3WGEA 3TRQA 2IJYA 3DRNA 4RI7A 2LJKA 3ERGA 3QAWA 3MSZA 1UC7A 5AGYA 2ZUPA 2H01A 3LFLA 4E8EA 3H4KA 4GTUA 4KAEA 4K2XA 5CRHA 2DKHA 1G6WA 3H1NA 4L5LA 3TJFA 5CNWA 3C1SA 2C80A 3QAGA 2H6XA 1YEXA 5DJLA 3G7IA 2H74A 4PQ1A 1K0DA 2IMIA 2GS3A 5ECKB 1JLWA 4F82A 2HXKA 1AQVA 1O73A 2PWJA 2YANA 3A2VA 3HKRA 3KXOA 2LUSA 1MDIA 4YH2A 3CTFA 3A3TA 2C0DA 2ZCTA 5ECPB 1H4OA 4TRXA 1QFNA 4ZB6A 1O6JA 2LJRA 3L78A 3VWVA 4ID0A 1M99A 5F8BA 1TU8A 4PQIA 2JU5A 2YN1A 3BCIA 4EUYA 1SENA 1VF4A 2N5BA 5ECOB 4MZWA 1GH2A 1QMVA 3HVSA 3MNGA 4I6XA 4OO5A 3WGDA 4N10A 2YP6A 3UBKA 5H5RA 2DSAA 1AC1A 2JSZA 3L0HA 3VFIA 5KN2A 1XOBA 3J7Yk 4WKWA 5B6NA 3QFBC 1TI1A 5DDLA 5EPFA 3FMWA 2WFCA 4BA7A 3WYWA 1EOHA 2B5YA 4YAVA 5DQSA 3UARA 2HFDA 3I43A 1PKZA 2HRAA 2B1LA 3G9BA 1RQMA 3A5IA 1I9DA 2TRCP 3M3MA 3A2XA 1ZGNA 3HJMA 1XVQA 3WD6A 1SKWB 4HDEA 4MF5A 3GNJA 3DVXA 1YKAA 1BG5A 4WF5A 2LNSA 2D2ZA 2GZPA 3APSA 3GMFA 3IV4A 2R2JA 2C0EA 4ECIA 5GSSA 4XTSA 1XWAA 6GSVA 1XW5A 1WPIA 3FHKA 2YPMA 1HNBA 3GURA 1LJRA 4WEYA 3GV1A 3OR5A 4EL1A 3UBLA 4TR3A 1OYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FYG A;  3GTU A;  4IEL A;  3ZFL A;  2OE3 A;  5IPG A;  4GXZ A;  3TUE A;  2EIO A;  3LYP A;  2GTU A;  2WRT A;  2N5F A;  1TRU A;  2C8U A;  3GL3 A;  2RUE A;  1A24 A;  3BOA A;  4ECB A;  3KGK A;  3Q19 A;  3KZQ A;  4ZIL A;  4F0B A;  4WR4 A;  2R6K A;  4XCS A;  2H70 A;  2O7K A;  4LA1 A;  1PSQ A;  5D9T A;  2GT6 A;  3TOU A;  1XWB A;  1TRV A;  3TKQ A;  5IO2 A;  4OFM A;  3ZIJ A;  3D6I A;  2CX3 A;  4TKY A;  2H72 A;  2C0F A;  1A2M A;  1E2Y A;  2IL3 A;  5A4W A;  2C3T A;  2DJ2 A;  4IQ1 A;  3KMN A;  1W89 A;  5DQY A;  3HHV A;  3VPT A;  3L9V A;  5EVO A;  1MD3 A;  3CYN A;  2LQQ A;  3PGT A;  3FZ4 A;  1SK0 A;  2GZZ A;  4ML1 A;  4N0Z A;  2ES7 A;  1Q98 A;  2H66 A;  1TK0 B;  3L9S A;  4WBJ A;  5B8A A;  19GS A;  4N0V A;  3P90 A;  5A4U A;  3ZFB A;  2GT5 A;  1SL0 B;  2I4A A;  2MZC A;  5FHI A;  2FD3 A;  4PGT A;  2WGR A;  3HY2 A;  4XIH A;  1Z7R A;  3D0Z A;  3VUR A;  4MH3 A;  3L9U A;  1SD9 A;  2O8V B;  5ENU A;  2AHE A;  3GFK A;  1QGV A;  1PMT A;  2DJ3 A;  2HZE A;  2LRC A;  2YCD A;  4WR5 A;  3A5W A;  4X0X A;  2E0Q A;  3LWA A;  1OE7 A;  1KEB A;  2L57 A;  2HLS A;  2DBC A;  2G0F A;  2GVP A;  2VCQ A;  1X9W B;  1EP7 A;  3E3E A;  2VM1 A;  3KIJ A;  4N30 A;  3E9J B;  3GH6 A;  4KW6 A;  1B9X C;  1WOU A;  1ZYE A;  2HE3 A;  4HS1 A;  1GSE A;  4LMV A;  22GS A;  4YAP A;  1GNE A;  2VAF A;  1PL2 A;  1FHE A;  5DAK B;  2V41 A;  4EE0 A;  3M9J A;  2H71 A;  3GHA A;  4LLR A;  3DWV A;  3FZ9 A;  1FW1 A;  1WIK A;  4X1U A;  1AW9 A;  1QK8 A;  1AXD A;  4POK A;  1BQ7 A;  4ULX A;  1VF3 A;  3FW2 A;  1SYR A;  2IFQ B;  1XW6 A;  3KH7 A;  3WGX A;  9GSS A;  3WT2 A;  2OBK A;  2YWI A;  4ZXG A;  1GL8 A;  4JZQ A;  1M9A A;  4KGI A;  4ZBD A;  3R2Q A;  1DUG A;  1O85 A;  4XS4 A;  4MP4 A;  4L0W A;  1EEM A;  2LST A;  1A0R P;  1UA5 A;  4KA0 A;  5ECS A;  5H5S A;  1OC9 B;  1A8L A;  3TRX A;  3KCM A;  1GSU A;  2H6Y A;  3M1G A;  1Y25 A;  1Y6E A;  4AJ8 A;  5DCH A;  3RHC A;  4OO4 A;  2R4V A;  4CDO A;  2XPD A;  2OBI A;  2PN8 A;  1F37 A;  2L4C A;  1MEK A;  1FVK A;  4WBR D;  4IVF A;  1SL1 B;  4YQU A;  1EWX A;  3IE3 A;  3UAP A;  4EKZ A;  1KTE A;  2BMX A;  2DC5 A;  2CVK A;  2PUK C;  3ZRE A;  5IMC A;  1XXU A;  5JWR B;  13GS A;  2PVO C;  1YDK A;  3LOR A;  2QGV A;  4K7I A;  5JWQ B;  1FAA A;  2OE1 A;  2DML A;  4MJA A;  2F9S A;  2E2M A;  4XS4 B;  1XWG A;  2C3N A;  2EC4 A;  3FR9 A;  4OFN A;  3QMX A;  5IOW A;  2PMT A;  1BYE A;  3KJY A;  5IM9 A;  3LGC A;  4ZB9 A;  1MDJ A;  4NMU A;  2MBS A;  3EVI A;  1AAZ A;  4PUF C;  1HNC A;  2M46 A;  3U6V A;  1ON4 A;  4HU7 A;  3RBT A;  1I5G A;  5C00 A;  2B7K A;  2LRT A;  3P8W A;  3DGQ A;  2JAC A;  1TRW A;  2ZNM A;  1GTI A;  1JFU A;  4CW9 A;  3GKK A;  5ECQ B;  3KP9 A;  1M2A A;  1XIY A;  2X64 A;  4CHS A;  5HFG A;  2ON7 A;  2H73 A;  3ZIT A;  20GS A;  3HDC A;  6GSU A;  4G19 A;  3EMP A;  4ECC A;  3LXT A;  4JR4 A;  5J5N A;  5J41 A;  2B5X A;  5IQY A;  2LKU A;  4K0G A;  2KLX A;  3LQ7 A;  5ECN B;  1TW9 A;  5JCG A;  3UMA A;  1U87 A;  1OKT A;  4AGS A;  2H0G A;  3C73 A;  3EUR A;  3O76 A;  8GSS A;  1E6B A;  4PX1 A;  2FWH A;  1YZX A;  2VCW A;  3IXR A;  1EV4 A;  1YQ1 A;  2AJQ B;  1PN9 A;  4JR6 A;  3ZMK A;  4DSR A;  4PQH A;  2CZ3 A;  2AV4 A;  3KP8 A;  1WP0 A;  3ME8 A;  4KSM A;  4LL1 B;  3BJ5 A;  4NHZ A;  1PQN A;  1V9W A;  4IJ3 A;  5JCW A;  4KDY A;  2YV9 A;  1T4Z A;  1F9M A;  4MPG A;  4WET A;  4KCA A;  1X5E A;  2WUL A;  2JZT A;  4EC0 A;  4JU5 A;  2DJ1 A;  2LEG A;  5J9B A;  1OE8 A;  3GUS A;  4OWY A;  3D21 A;  2FY6 A;  3FEU A;  2KP2 A;  4L8E A;  3V1W A;  1TXX A;  4K9Z A;  5B7C A;  1R4W A;  1OKD A;  3LXZ A;  4K8M A;  3P7X A;  4TR4 A;  1ERT A;  3I9V 2;  4FYU A;  4GLT A;  1BX9 A;  4JED A;  4RQR A;  1DE1 A;  4QL7 A;  3UOM A;  6GSW A;  3EU4 A;  4GRF A;  1USB A;  4D73 A;  5DAL A;  4QL9 A;  1LBK A;  5EY6 A;  1BAY A;  2V6O A;  4ZL9 A;  3O6T A;  3K8N A;  3ZVJ D;  1K0B A;  4HZ4 A;  2VO4 A;  2A2R A;  3ZIV A;  1FB6 A;  4TVE A;  3QOU A;  3KEB A;  2O89 A;  5AIV A;  5ECL B;  5D9V A;  4HZ2 A;  5F07 A;  5A4V A;  1ZCP A;  3C7M A;  4ZIJ A;  18GS A;  4EF0 A;  2AB6 A;  3TKS E;  3M8N A;  4HQS A;  1SK2 A;  2XPE A;  5ECR B;  5HFI A;  5B8B A;  3KTL A;  2JZS A;  1PX6 A;  4GSN A;  3FKF A;  2HYX A;  2I3Y A;  4NV5 A;  1X0R A;  3GKN A;  5IMD A;  2VL9 A;  3C71 A;  3EU3 A;  5JWO B;  1EV9 A;  3CMI A;  2VCV A;  2VL2 C;  2XBQ A;  2HSH A;  2WJU A;  2YWM A;  1B9Y C;  2VCZ A;  4GCI A;  5D8I A;  4D73 B;  5DAL B;  3EYT A;  5E4W A;  2BJX A;  4K7N A;  1GLP A;  2H0H A;  1AQX A;  3EIN A;  3WT1 A;  2YNX A;  4IQA A;  1AIU A;  3ERF A;  1K0M A;  6GSS A;  5CYY A;  3GL5 A;  4HUA A;  4I2T A;  1X5D A;  3MDK A;  3IAM 2;  3EC3 A;  3TJJ A;  2QSI A;  3D4T A;  1V58 A;  1VRS D;  2P0G A;  4L0U A;  3HJO A;  5KEJ A;  2K6V A;  5DVB A;  1Z7P A;  5CRW A;  3RPN A;  4TXO B;  1K0N A;  4LMW A;  3US3 A;  2YV7 A;  2AAW A;  4F03 A;  4O5R A;  4L5O A;  4Q5N A;  4K2D A;  2OAC A;  1EOG A;  2TRX A;  1RW1 A;  4FH8 A;  3IDV A;  2VD1 A;  2DJ0 A;  3HD5 A;  1EGR A;  3J7Y b;  1B4Q A;  3MAK A;  2QKE A;  3DEX A;  5CAX A;  1SD8 A;  2DJJ A;  4KDX A;  1WE0 A;  1QQ2 A;  4GQC A;  1F6M C;  3Q6O A;  4Z7X A;  2VCT A;  2B3S A;  3Q74 A;  1ZMA A;  1PX7 A;  1Z6M A;  4IBP A;  1CQH A;  4XS6 A;  4RQX A;  1GTU A;  1FVJ A;  1S3C A;  5GZZ B;  1FB0 A;  3TKR A;  1TTZ A;  3LEF A;  5LCZ A;  4MJB A;  4PXO A;  4K0N A;  5DAK A;  4ACS A;  2EIR A;  2IMK A;  4DEJ A;  4J56 E;  5ID2 A;  5LD0 A;  3ZYW A;  3U5R E;  3PR8 A;  4YQV A;  4V1A p;  3QR6 A;  1A2J A;  4G10 A;  4BVY A;  2C1Y A;  1X9M B;  4PNF A;  3UVH A;  1OC8 A;  1QUW A;  2IFQ A;  1O7U A;  4HOJ A;  11GS A;  1B48 A;  3CRT A;  5FT3 A;  1LU4 A;  1OVN A;  2HNL A;  2MBT A;  4RI6 A;  3APQ A;  4GF0 A;  2XC2 A;  5IMZ A;  1XCC A;  1K3O A;  3H8Q A;  5D93 A;  4GWR A;  5COH A;  2CZ2 A;  1TI3 A;  1YEP A;  4Q5F A;  1XOA A;  5D9W A;  3BCK A;  4AJ6 A;  2REM A;  1OC9 A;  4HI7 A;  1O8X A;  4IP6 A;  4X43 A;  3CTG A;  1SU9 A;  2PER A;  5GST A;  4XS1 A;  3GKX A;  5LNK e;  2Z9S A;  2NDO A;  4NV2 A;  5AIS A;  3ZVJ A;  1AQW A;  5ID2 B;  2LS5 A;  3TCO A;  3KH9 A;  4MLY A;  5G30 A;  3CBU A;  2LTK A;  4Q5Q A;  2FGX A;  4I8B A;  5HFK A;  4EVM A;  4NXI A;  4ZB8 A;  1AUC A;  1GSD A;  2K18 A;  1O81 A;  3IA1 A;  1TOF A;  1G7E A;  1VF2 A;  3LSZ A;  1Z5Y E;  5IO0 A;  3HVX A;  2VLV A;  2GGT A;  1XWC A;  1GRX A;  1XBS A;  4K6X A;  5HR0 A;  5D73 A;  1T3B A;  1FOV A;  4QQ7 A;  2YZU A;  4O7H A;  6GSY A;  1SK1 A;  2XBI A;  2VL2 A;  5JCU A;  5CRD A;  2YJH A;  1HYU A;  3DYR A;  3W8S A;  2CA8 A;  1OAZ A;  5D96 A;  3QCP A;  2RUF A;  3IAS 2;  3FRC A;  1S3D A;  1TDI A;  3CRU A;  1SJ6 A;  4IGJ A;  4POL A;  4HJ2 A;  4ISD A;  2AUV A;  3QPM A;  1GSQ A;  2RII A;  5KN0 A;  1R7H A;  1TK8 B;  3DKS A;  1JZO A;  3HCZ A;  3F6D A;  4MH2 A;  4ZBB A;  2L6D A;  3F6F A;  4HQZ A;  2TIR A;  3BD2 A;  1YF1 A;  3M9K A;  3EWL A;  4WXT A;  1SKS B;  5CRE A;  4JE1 A;  2H1D A;  5HQP A;  2VIM A;  3C8E A;  1IYH A;  3KTB A;  2JSY A;  3GN3 A;  3D4M A;  2GZY A;  2IMD A;  3F4S A;  3KD0 A;  4GST A;  3VLN A;  1GSY A;  5CP1 A;  5ELG A;  4BWQ A;  2HI7 A;  2WS2 A;  1SJZ A;  2F3M A;  2C0G A;  1GTA A;  2P31 A;  1URM A;  1WWJ A;  3H93 A;  1TKD B;  1VGL A;  4MJC A;  4G9H A;  3IOS A;  5ECH B;  1XZO A;  2CX4 A;  1T7P B;  3ZTL A;  4NAX A;  2NVL A;  3VWW A;  2FUG 2;  3DML A;  1M2B A;  5A5K A;  1M2D A;  1M0U A;  2GSR A;  3GKM A;  1THX A;  1PKW A;  4IW9 A;  4DVC A;  1R26 A;  2O85 A;  1K3Y A;  5IMF A;  3F3R A;  2B7J A;  4V1A g;  3O3T A;  4HJM A;  1WJK A;  1J08 A;  4OCE A;  2DMM A;  4TXV A;  3HZ4 A;  3UL3 A;  2OE0 A;  2X8H A;  3GH9 A;  3JCM L;  4I2U A;  2VCX A;  1DBY A;  5G5F A;  4IKH A;  3TKP A;  4G2E A;  2MMZ A;  1ERW A;  5F06 A;  1N8J A;  5L71 A;  1JLV A;  5G31 A;  5ELA A;  4J2F A;  2R37 A;  3HXS A;  4KB3 A;  2L6C A;  2VUP A;  1V57 A;  4MK3 A;  4MDC A;  2A2S A;  2V6K A;  3SWL A;  4V2L A;  1CQG A;  4PNG A;  1HD2 A;  3CSI A;  3SBC A;  2IIY A;  3QAV A;  3QFA C;  2L5O A;  4WF4 A;  2V2G A;  2K8S A;  2C3Q A;  4OCF A;  2LNT A;  4F9Z A;  1T1V A;  2MMO A;  5CRG A;  4POM A;  2I81 A;  3TJK A;  2AYT A;  1V40 A;  2PU9 C;  1U3A A;  4OFT A;  3RPP A;  4IP1 A;  1SKR B;  4V2M A;  5IMV A;  5KN3 A;  3L4N A;  1THO A;  1BJX A;  1V2A A;  3GIX A;  3PH9 A;  1RK4 A;  4MZC A;  3VI5 A;  4MF6 A;  2H0I A;  2VLT A;  2HT9 A;  3TKS C;  3TGZ A;  4TN8 A;  1Q4J A;  5EL8 A;  3TJB A;  5J4U A;  3IR4 A;  1GUK A;  3RHB A;  4XRD A;  5IIZ A;  4HEA 2;  3GST A;  3E0U A;  4H86 A;  1GWC A;  1U3I A;  3QD9 A;  4MAB A;  4J57 E;  5IPH A;  3HA9 A;  3F9U A;  2L4Q A;  1U88 A;  2RM5 A;  3VWU A;  1A0F A;  2LV3 A;  3ERW A;  2CT6 A;  4TR0 A;  1S3A A;  2LQO A;  1JHB A;  2GQL A;  3GYK A;  1ERU A;  3GRX A;  4FO5 A;  1PD2 1;  1J9B A;  3F0I A;  3KMO A;  2CAQ A;  3EE2 A;  5HR3 A;  5HR1 A;  3W8J A;  1VF1 A;  3TB2 A;  1JZR A;  2M72 A;  3D5J A;  2VD0 A;  4DSQ A;  2QC7 A;  3UEM A;  5ABR A;  1YKC A;  2K8V A;  3GX8 A;  4KDU A;  3QDN A;  1A23 A;  1UN2 A;  4NHW A;  4F2I A;  2GQK A;  4TXO A;  3UVT A;  2B5E A;  5AN1 A;  3IPZ A;  2FLS A;  3F4R A;  1EGO A;  4BL7 A;  3HZ8 A;  1ZYQ B;  2E7P A;  1FO5 A;  2WDU A;  4MJE A;  1XPV A;  2MMA A;  2CVB A;  3G7J A;  3IBH A;  4XHM A;  1QXH A;  3DD3 A;  4GQF A;  4TR1 A;  3VI7 A;  1GTB A;  2HSY A;  1F3A A;  7GSS A;  3F8U A;  4O92 A;  2H75 A;  2N5A A;  1M9B A;  2HZF A;  1PGT A;  1G0T A;  2NPB A;  5DCG A;  3ME7 A;  3F63 A;  2JZR A;  3CXG A;  1ZL9 A;  2F8F A;  2B1K A;  1X5C A;  3C1R A;  2PGT A;  4PUA A;  4EDY A;  3DXB A;  5G2Z A;  2IPA A;  4MF7 A;  1XW9 A;  2DIZ A;  1T8E B;  2HRF A;  2FA8 A;  2X8G A;  4ZBA A;  1H75 A;  6GST A;  5ECM B;  5C04 A;  2LRN A;  17GS A;  3F4T A;  3LG6 A;  4KH7 A;  1GUL A;  16GS A;  1HQO A;  2LJA A;  2FCH A;  5DBQ A;  1A8Y A;  2KOK A;  1N2A A;  5G1K A;  2F51 A;  1XFL A;  3IC4 A;  1GLQ A;  1ABA A;  2M80 A;  4TW5 A;  4TR1 B;  2YOI A;  4BPY A;  5B6M A;  1NHO A;  2CQ9 A;  2JL4 A;  3GSS A;  3F3Q A;  3G7Y A;  4FYB A;  4ZL7 A;  1K0A A;  4Q5R A;  4IN0 A;  1JZD A;  2H8L A;  1Z3E A;  2IWT A;  2GLR A;  2MYG A;  2H1B A;  3ISO A;  4KE3 A;  2H1A A;  1MDK A;  4PUR A;  2R3X A;  2DLX A;  2L5L A;  2CV4 A;  2O87 A;  4ILF A;  3HJP A;  3GTU B;  2H30 A;  3DIE A;  1Z6N A;  1ML6 A;  1T4Y A;  2R5G A;  4IJI A;  2VM2 A;  3S9F A;  12GS A;  1YF0 A;  5CO3 A;  1O8W A;  3KM6 A;  4NWY A;  4N11 A;  1GP1 A;  2P5R A;  2DJK A;  1U6T A;  2H6Z A;  2GSQ A;  2GSS A;  2FNO A;  6GSX A;  3H79 A;  4HU9 A;  1EZK A;  2KUC A;  2FWF A;  3AY8 A;  2H76 A;  2PBJ A;  1SYX A;  3BBY A;  1K3L A;  3Q18 A;  4XRA A;  4NPB A;  3P2A A;  3ZRD A;  2X99 A;  1GSF A;  14GS A;  4OMV A;  5DJM A;  5GAP D;  3HVV A;  4KSO A;  2IME A;  4K1F A;  2ON5 A;  1IYI A;  2JAD A;  3I69 A;  5D9X A;  1GUH A;  4MCU A;  1NW2 A;  3TKS A;  3DVW A;  1EEJ A;  5HR2 A;  3NIV A;  1SJI A;  2RLI A;  2DIY A;  1EP8 A;  4IS0 A;  4KX4 A;  3FK8 A;  1KBN A;  5F05 A;  2YWO A;  5FWG A;  2GQM A;  3FY7 A;  3FZ5 A;  2FWE A;  2OJL A;  2G2Q A;  1WMJ A;  2I1U A;  2BTO T;  1F3B A;  5G1L A;  1R5P A;  4JBB A;  4F0C A;  2HRN A;  2ALB A;  4MZB A;  1X9S B;  1GNW A;  2OA7 A;  1PL1 A;  4MMM A;  4OD7 A;  4P3Y B;  3UJ1 A;  3UIW A;  3LYK A;  1OC3 A;  3GX0 A;  2L59 A;  1UVZ A;  3LJR A;  1R5A A;  2P5Q A;  2VOC A;  1B4P A;  5F0G A;  1PA3 A;  5G5E A;  3ZZX A;  1Z9H A;  3VPQ A;  1A2L A;  1SL2 B;  1MTC A;  3IK7 A;  4V2N A;  2HZE B;  3W6G A;  3TJG A;  3RDW A;  5E59 A;  5J3R A;  3FR3 A;  4ML6 A;  2KP1 A;  1DSB A;  1TU7 A;  4DSS A;  2GDR A;  3ZML A;  3EMX A;  3GA4 A;  4O32 A;  2FHE A;  4EO3 A;  2YJ7 A;  2NBS A;  4I97 A;  2K9F A;  2MMN A;  4K7O A;  4JRR A;  1YY7 A;  1DE2 A;  2CAI A;  1PRX A;  2WB9 A;  3CSH A;  5AIX A;  1MD4 A;  2J9H A;  3IHQ A;  3CSJ A;  1TJD A;  1M7T A;  3FR6 A;  2RM6 A;  1G6Y A;  5J9C A;  5INY A;  2FWG A;  1XVW A;  3NOF A;  3NZN A;  1KNG A;  1NM3 A;  2OAD A;  2XHF A;  3D22 A;  4MPF A;  3TRP A;  2VL3 A;  5ECI B;  4ECJ A;  2GST A;  4EDZ A;  4EXJ A;  5GAN D;  4E8H A;  2CVD A;  2EIQ A;  1TP9 A;  1JZW A;  4POB A;  2WZ9 A;  1ERV A;  1T00 A;  2E2G A;  1C72 A;  4DSS B;  3PIN A;  2H19 A;  1TK5 B;  2H1G A;  4IHU A;  1NHY A;  4KCE A;  2VLU A;  3APO A;  2X8C A;  3N9J A;  3M0F A;  4I5Q A;  2WCI A;  3ED3 A;  2I9H A;  1V98 A;  1G7O A;  4YQM A;  1ILO A;  3I6A A;  3IK9 A;  3TDG A;  2NTO A;  3FZA A;  4AJ7 A;  2OKA A;  1J0F A;  4FIW A;  1FG4 A;  3TOT A;  1GUM A;  1BED A;  1GSS A;  2IMF A;  4KUN A;  1K0O A;  1B8X A;  3ZLP A;  10GS A;  5IOX A;  1YJ6 A;  3IRA A;  4AF2 A;  1ST9 A;  1WRY A;  2C4J A;  2PPT A;  4LL4 B;  5IMA A;  4BVX A;  3HYP A;  3N5O A;  3A2W A;  2FA4 A;  1ACV A;  2A4V A;  3VK9 A;  4GSS A;  3VWX A;  2YWN A;  2YZH A;  2IN3 A;  1TRS A;  4ZL8 A;  5KN1 A;  2KHP A;  1NSW A;  2PVQ A;  2V32 A;  2F8A A;  1ZZY A;  2J23 A;  1ZOF A;  4MA9 A;  2B6M A;  4RUV A;  1K0C A;  3ZL5 A;  1W4V A;  4TOP A;  4KND A;  3RAZ A;  4BWS A;  3MWH A;  4FYC A;  2V1M A;  1F2E A;  5H5Q A;  1HNA A;  1XWK A;  3WGE A;  3TRQ A;  2IJY A;  3DRN A;  4RI7 A;  2LJK A;  3ERG A;  3QAW A;  3MSZ A;  1UC7 A;  5AGY A;  2ZUP A;  2H01 A;  3LFL A;  4E8E A;  3H4K A;  4GTU A;  4KAE A;  5CRH A;  1G6W A;  3H1N A;  4L5L A;  3TJF A;  5CNW A;  3C1S A;  2C80 A;  3QAG A;  2H6X A;  1YEX A;  5DJL A;  3G7I A;  2H74 A;  4PQ1 A;  1K0D A;  2IMI A;  2GS3 A;  5ECK B;  1JLW A;  4F82 A;  2HXK A;  1AQV A;  1O73 A;  2PWJ A;  2YAN A;  3A2V A;  3HKR A;  3KXO A;  2LUS A;  1MDI A;  4YH2 A;  3CTF A;  3A3T A;  2C0D A;  2ZCT A;  5ECP B;  1H4O A;  4TRX A;  1QFN A;  4ZB6 A;  1O6J A;  2LJR A;  3L78 A;  3VWV A;  4ID0 A;  1M99 A;  5F8B A;  1TU8 A;  4PQI A;  2JU5 A;  2YN1 A;  3BCI A;  4EUY A;  1SEN A;  1VF4 A;  2N5B A;  5ECO B;  4MZW A;  1GH2 A;  1QMV A;  3HVS A;  3MNG A;  4I6X A;  4OO5 A;  3WGD A;  4N10 A;  2YP6 A;  3UBK A;  5H5R A;  2DSA A;  1AC1 A;  2JSZ A;  3L0H A;  3VFI A;  5KN2 A;  1XOB A;  3J7Y k;  4WKW A;  5B6N A;  3QFB C;  1TI1 A;  5DDL A;  5EPF A;  4BA7 A;  2WFC A;  3WYW A;  1EOH A;  2B5Y A;  4YAV A;  5DQS A;  3UAR A;  2HFD A;  3I43 A;  1PKZ A;  2B1L A;  3G9B A;  1RQM A;  1I9D A;  2TRC P;  3M3M A;  3A2X A;  1ZGN A;  3HJM A;  1XVQ A;  3WD6 A;  1SKW B;  4HDE A;  4MF5 A;  3GNJ A;  3DVX A;  1YKA A;  1BG5 A;  4WF5 A;  2LNS A;  2D2Z A;  2GZP A;  3APS A;  3GMF A;  3IV4 A;  2R2J A;  2C0E A;  4ECI A;  5GSS A;  4XTS A;  1XWA A;  6GSV A;  1XW5 A;  1WPI A;  3FHK A;  2YPM A;  1HNB A;  3GUR A;  1LJR A;  4WEY A;  3GV1 A;  3OR5 A;  4EL1 A;  3UBL A;  4TR3 A;  1OYJ A; 
#chains in the Genus database with same CATH topology
 3FYG A;  3GTU A;  4IEL A;  3ZFL A;  2OE3 A;  5IPG A;  4GXZ A;  3TUE A;  2EIO A;  3LYP A;  2GTU A;  4FQU A;  2WRT A;  2N5F A;  1TRU A;  4BIK A;  2C8U A;  3GL3 A;  2RUE A;  1A24 A;  3BOA A;  4ECB A;  3KGK A;  3Q19 A;  3KZQ A;  4ZIL A;  4F0B A;  4WR4 A;  2R6K A;  4XCS A;  2H70 A;  2O7K A;  4LA1 A;  1PSQ A;  5D9T A;  2GT6 A;  3TOU A;  1XWB A;  1TRV A;  3TKQ A;  5IO2 A;  4OFM A;  3ZIJ A;  3D6I A;  2CX3 A;  4TKY A;  2H72 A;  2C0F A;  1A2M A;  1E2Y A;  2IL3 A;  5A4W A;  2C3T A;  2DJ2 A;  4IQ1 A;  3KMN A;  1W89 A;  5DQY A;  3HHV A;  3VPT A;  3L9V A;  5EVO A;  1MD3 A;  3CYN A;  2LQQ A;  3PGT A;  3FZ4 A;  1SK0 A;  2GZZ A;  4ML1 A;  4N0Z A;  2ES7 A;  1Q98 A;  2H66 A;  1TK0 B;  3L9S A;  5KOW A;  4WBJ A;  5B8A A;  19GS A;  4N0V A;  3P90 A;  5A4U A;  3ZFB A;  2GT5 A;  1SL0 B;  2I4A A;  2MZC A;  5FHI A;  2FD3 A;  4PGT A;  2WGR A;  3HY2 A;  4XIH A;  1Z7R A;  3D0Z A;  3VUR A;  4MH3 A;  3L9U A;  1SD9 A;  2O8V B;  5ENU A;  2AHE A;  3GFK A;  1QGV A;  1PMT A;  2DJ3 A;  2HZE A;  2LRC A;  2YCD A;  4WR5 A;  3A5W A;  4X0X A;  2E0Q A;  3LWA A;  1OE7 A;  1KEB A;  2L57 A;  2HLS A;  2DBC A;  2G0F A;  2GVP A;  2VCQ A;  1X9W B;  1EP7 A;  3E3E A;  2VM1 A;  3KIJ A;  4N30 A;  3E9J B;  3GH6 A;  4KW6 A;  1B9X C;  1WOU A;  1ZYE A;  2HE3 A;  4HS1 A;  1GSE A;  4LMV A;  22GS A;  4YAP A;  1GNE A;  2VAF A;  1PL2 A;  1FHE A;  5DAK B;  2V41 A;  4EE0 A;  3M9J A;  2H71 A;  2X4A A;  3GHA A;  4LLR A;  3DWV A;  3FZ9 A;  1FW1 A;  1WIK A;  4X1U A;  1AW9 A;  1QK8 A;  1AXD A;  4POK A;  3CQF A;  1BQ7 A;  4ULX A;  4BVY B;  1VF3 A;  3FW2 A;  1SYR A;  2IFQ B;  1XW6 A;  2A4H A;  3KH7 A;  3WGX A;  9GSS A;  3WT2 A;  2OBK A;  2YWI A;  4ZXG A;  1GL8 A;  4JZQ A;  1M9A A;  4KGI A;  4ZBD A;  3R2Q A;  1DUG A;  1O85 A;  4XS4 A;  4Z2U A;  4MP4 A;  4L0W A;  1EEM A;  2LST A;  1A0R P;  1UA5 A;  4KA0 A;  5ECS A;  5H5S A;  1OC9 B;  1A8L A;  3TRX A;  3KCM A;  1GSU A;  2H6Y A;  3M1G A;  1Y25 A;  1Y6E A;  4AJ8 A;  5DCH A;  3RHC A;  4OO4 A;  2R4V A;  4CDO A;  2XPD A;  2OBI A;  2PN8 A;  1F37 A;  2L4C A;  1MEK A;  1FVK A;  4WBR D;  4IVF A;  1SL1 B;  4YQU A;  1EWX A;  3IE3 A;  3UAP A;  4EKZ A;  1KTE A;  2BMX A;  2DC5 A;  2CVK A;  2PUK C;  3ZRE A;  5IMC A;  1XXU A;  5JWR B;  13GS A;  4EIP A;  2PVO C;  1YDK A;  3LOR A;  2QGV A;  4K7I A;  5JWQ B;  1FAA A;  2OE1 A;  2DML A;  4MJA A;  2F9S A;  2E2M A;  4XS4 B;  1XWG A;  2C3N A;  2EC4 A;  3FR9 A;  4OFN A;  3QMX A;  5IOW A;  2PMT A;  1BYE A;  3KJY A;  5IM9 A;  3LGC A;  4ZB9 A;  1MDJ A;  4NMU A;  2MBS A;  3EVI A;  1AAZ A;  2HSM A;  4PUF C;  1HNC A;  2M46 A;  3U6V A;  1ON4 A;  4HU7 A;  3RBT A;  1I5G A;  5C00 A;  2B7K A;  2LRT A;  3P8W A;  3DGQ A;  2JAC A;  1TRW A;  2ZNM A;  1GTI A;  1JFU A;  4CW9 A;  3GKK A;  5ECQ B;  3KP9 A;  4ICY A;  1M2A A;  1XIY A;  2X64 A;  4K5R A;  4CHS A;  5HFG A;  2ON7 A;  2H73 A;  3ZIT A;  20GS A;  3HDC A;  6GSU A;  4G19 A;  3EMP A;  4ECC A;  3LXT A;  4JR4 A;  5J5N A;  5J41 A;  2B5X A;  5IQY A;  2LKU A;  4K0G A;  2KLX A;  3LQ7 A;  5ECN B;  4CY6 A;  1TW9 A;  5JCG A;  3UMA A;  3HVN A;  1U87 A;  1OKT A;  4AGS A;  2H0G A;  3C73 A;  3EUR A;  3O76 A;  8GSS A;  1E6B A;  4PX1 A;  2FWH A;  1YZX A;  3EPT A;  2VCW A;  3IXR A;  1EV4 A;  1YQ1 A;  2AJQ B;  1PN9 A;  4JR6 A;  3ZMK A;  4DSR A;  4PQH A;  2CZ3 A;  2AV4 A;  3KP8 A;  1WP0 A;  3ME8 A;  4KSM A;  4LL1 B;  3BJ5 A;  4NHZ A;  1PQN A;  4O5Q A;  1V9W A;  4IJ3 A;  5JCW A;  4KDY A;  2YV9 A;  1T4Z A;  1F9M A;  4MPG A;  4WET A;  4KCA A;  1X5E A;  2WUL A;  2JZT A;  4EC0 A;  4JU5 A;  2DJ1 A;  2LEG A;  5J9B A;  1OE8 A;  3GUS A;  4OWY A;  4G0L A;  3D21 A;  2FY6 A;  3FEU A;  2KP2 A;  4L8E A;  3V1W A;  1TXX A;  4K9Z A;  5B7C A;  1R4W A;  1OKD A;  3LXZ A;  4K8M A;  3P7X A;  4TR4 A;  1ERT A;  3I9V 2;  4FYU A;  4GLT A;  1BX9 A;  4JED A;  4RQR A;  1DE1 A;  4QL7 A;  3UOM A;  6GSW A;  3EU4 A;  4GRF A;  1USB A;  4D73 A;  5DAL A;  4QL9 A;  1LBK A;  5EY6 A;  1BAY A;  2R0G A;  2V6O A;  4ZL9 A;  3O6T A;  3K8N A;  3ZVJ D;  1K0B A;  4HZ4 A;  2VO4 A;  2A2R A;  3ZIV A;  1FB6 A;  4TVE A;  3QOU A;  3KEB A;  2O89 A;  5AIV A;  5ECL B;  5D9V A;  4HZ2 A;  5F07 A;  5A4V A;  1ZCP A;  3C7M A;  4ZIJ A;  18GS A;  4EF0 A;  2AB6 A;  3TKS E;  3M8N A;  4HQS A;  1XG8 A;  3PPU A;  1SK2 A;  2XPE A;  5ECR B;  5HFI A;  5B8B A;  2R0P A;  3KTL A;  2JZS A;  1PX6 A;  4GSN A;  3FKF A;  2HYX A;  2I3Y A;  4NV5 A;  1X0R A;  3GKN A;  5IMD A;  2VL9 A;  3C71 A;  3EU3 A;  5JWO B;  1EV9 A;  4YKG A;  3CMI A;  2VCV A;  2VL2 C;  2XBQ A;  2HSH A;  2WJU A;  2YWM A;  1B9Y C;  2VCZ A;  4GCI A;  5D8I A;  4D73 B;  5DAL B;  3EYT A;  5E4W A;  2BJX A;  4K7N A;  1GLP A;  2H0H A;  1AQX A;  3EIN A;  3WT1 A;  1M3I A;  2YNX A;  4IQA A;  1S3R A;  1AIU A;  3ERF A;  1K0M A;  6GSS A;  5CYY A;  3GL5 A;  4HUA A;  4I2T A;  1X5D A;  3MDK A;  3IAM 2;  3EC3 A;  3TJJ A;  2QSI A;  3D4T A;  1V58 A;  1VRS D;  2P0G A;  4L0U A;  3HJO A;  4CY8 A;  5KEJ A;  2K6V A;  5DVB A;  1Z7P A;  5CRW A;  3RPN A;  4TXO B;  4BL7 B;  1K0N A;  4LMW A;  3US3 A;  2YV7 A;  2AAW A;  4F03 A;  4O5R A;  4L5O A;  4Q5N A;  5BMU A;  4K2D A;  2OAC A;  1FOH A;  1EOG A;  4Z2R A;  2TRX A;  1RW1 A;  4FH8 A;  3IDV A;  2VD1 A;  2DJ0 A;  3HD5 A;  1EGR A;  3J7Y b;  1B4Q A;  3MAK A;  2QKE A;  3DEX A;  5CAX A;  1SD8 A;  2DJJ A;  4KDX A;  1WE0 A;  1QQ2 A;  4GQC A;  1F6M C;  3Q6O A;  4Z7X A;  2VCT A;  5BRT A;  2B3S A;  3Q74 A;  1ZMA A;  1PX7 A;  1Z6M A;  4IBP A;  1CQH A;  4XS6 A;  4RQX A;  1GTU A;  1FVJ A;  1S3C A;  5GZZ B;  1FB0 A;  3TKR A;  4A5P A;  1TTZ A;  3LEF A;  5LCZ A;  4MJB A;  4PXO A;  4K0N A;  5DAK A;  4ACS A;  2EIR A;  2IMK A;  4DEJ A;  4MNN A;  1PN0 A;  4J56 E;  5ID2 A;  5LD0 A;  3ZYW A;  3U5R E;  3PR8 A;  4YQV A;  4V1A p;  3QR6 A;  1A2J A;  4G10 A;  4BVY A;  2C1Y A;  1X9M B;  4PNF A;  3UVH A;  1OC8 A;  1QUW A;  4USS A;  2IFQ A;  1O7U A;  4HOJ A;  11GS A;  1B48 A;  3CRT A;  5FT3 A;  1LU4 A;  1OVN A;  2HNL A;  2MBT A;  4RI6 A;  3APQ A;  4GF0 A;  2XC2 A;  5IMZ A;  1XCC A;  1K3O A;  3H8Q A;  5D93 A;  4GWR A;  5COH A;  2CZ2 A;  1TI3 A;  1YEP A;  4Q5F A;  1XOA A;  5D9W A;  3BCK A;  4AJ6 A;  2REM A;  1OC9 A;  4HI7 A;  2QA2 A;  1O8X A;  4IP6 A;  4X43 A;  3CTG A;  1SU9 A;  2PER A;  5GST A;  4XS1 A;  3GKX A;  5LNK e;  2Z9S A;  2NDO A;  4NV2 A;  5AIS A;  3ZVJ A;  1AQW A;  5ID2 B;  2LS5 A;  3TCO A;  3KH9 A;  4MLY A;  5G30 A;  3CBU A;  2LTK A;  4Q5Q A;  2FGX A;  4I8B A;  5HFK A;  4EVM A;  4NXI A;  4ZB8 A;  1AUC A;  1GSD A;  2K18 A;  1O81 A;  3IA1 A;  1TOF A;  1G7E A;  1VF2 A;  3LSZ A;  1Z5Y E;  4K5S A;  5IO0 A;  1ZYP A;  3HVX A;  2VLV A;  2GGT A;  1XWC A;  1GRX A;  1XBS A;  4K6X A;  5HR0 A;  5D73 A;  1T3B A;  1FOV A;  4QQ7 A;  2YZU A;  4O7H A;  6GSY A;  1SK1 A;  2XBI A;  2VL2 A;  5JCU A;  5CRD A;  2YJH A;  1HYU A;  3DYR A;  3W8S A;  2CA8 A;  1OAZ A;  5D96 A;  3QCP A;  2RUF A;  3IAS 2;  3FRC A;  1S3D A;  1TDI A;  4YKF A;  3CRU A;  1SJ6 A;  4IGJ A;  4POL A;  4HJ2 A;  4ISD A;  2AUV A;  3QPM A;  1GSQ A;  2RII A;  5KN0 A;  1R7H A;  1TK8 B;  3DKS A;  1JZO A;  3HCZ A;  3MYD A;  3F6D A;  4MH2 A;  4ZBB A;  2L6D A;  3F6F A;  4HQZ A;  2TIR A;  3BD2 A;  1YF1 A;  3M9K A;  3EWL A;  4WXT A;  1SKS B;  5CRE A;  4JE1 A;  2H1D A;  3IC8 A;  5HQP A;  2R0C A;  2VIM A;  3C8E A;  1IYH A;  3KTB A;  2JSY A;  3GN3 A;  3D4M A;  2GZY A;  2IMD A;  3F4S A;  3KD0 A;  4GST A;  3VLN A;  1GSY A;  5CP1 A;  4G0I A;  5ELG A;  4BWQ A;  2HI7 A;  2WS2 A;  1SJZ A;  2F3M A;  2C0G A;  1GTA A;  2P31 A;  1URM A;  1WWJ A;  3H93 A;  1TKD B;  1VGL A;  4MJC A;  4G9H A;  4PTS A;  3IOS A;  5ECH B;  1XZO A;  2X49 A;  2CX4 A;  1T7P B;  3ZTL A;  4NAX A;  2NVL A;  3VWW A;  2FUG 2;  3DML A;  1M2B A;  5A5K A;  1M2D A;  1M0U A;  2GSR A;  3GKM A;  1THX A;  1PKW A;  4IW9 A;  4DVC A;  1R26 A;  2O85 A;  1K3Y A;  5IMF A;  3F3R A;  2B7J A;  4V1A g;  3O3T A;  4HJM A;  1WJK A;  1J08 A;  4OCE A;  2DMM A;  4TXV A;  3HZ4 A;  3UL3 A;  2OE0 A;  2X8H A;  3GH9 A;  3JCM L;  4I2U A;  2VCX A;  1DBY A;  5G5F A;  4IKH A;  3TKP A;  4G2E A;  2MMZ A;  1ERW A;  5F06 A;  1N8J A;  5L71 A;  1JLV A;  5G31 A;  5ELA A;  4J2F A;  2R37 A;  3HXS A;  4KB3 A;  4G0K A;  2L6C A;  2VUP A;  1V57 A;  4MK3 A;  4MDC A;  2A2S A;  4BVX B;  2V6K A;  3SWL A;  4V2L A;  1CQG A;  4PNG A;  1HD2 A;  3CSI A;  3SBC A;  2IIY A;  3QAV A;  3QFA C;  2L5O A;  4WF4 A;  2V2G A;  2K8S A;  2C3Q A;  4OCF A;  2LNT A;  4F9Z A;  1T1V A;  2MMO A;  5CRG A;  4POM A;  5KOX A;  2I81 A;  3TJK A;  2AYT A;  1V40 A;  2PU9 C;  1U3A A;  4OFT A;  3RPP A;  4IP1 A;  1SKR B;  4V2M A;  5IMV A;  5KN3 A;  3L4N A;  1THO A;  1BJX A;  1V2A A;  3GIX A;  4HSC X;  3PH9 A;  1RK4 A;  4MZC A;  3VI5 A;  4MF6 A;  2H0I A;  2VLT A;  2HT9 A;  3TKS C;  3TGZ A;  4TN8 A;  1Q4J A;  2A2P A;  5EL8 A;  3TJB A;  5J4U A;  3IR4 A;  1GUK A;  3RHB A;  4XRD A;  5IIZ A;  4HEA 2;  3GST A;  3E0U A;  4H86 A;  1GWC A;  2DKI A;  1U3I A;  3QD9 A;  4MAB A;  4J57 E;  5IPH A;  3HA9 A;  3F9U A;  2L4Q A;  1U88 A;  2RM5 A;  3VWU A;  1A0F A;  2LV3 A;  3ERW A;  4Z2T A;  2CT6 A;  4TR0 A;  1S3A A;  2LQO A;  1JHB A;  2GQL A;  3GYK A;  1ERU A;  3GRX A;  4FO5 A;  1PD2 1;  1J9B A;  3F0I A;  3KMO A;  2CAQ A;  3EE2 A;  5HR3 A;  5HR1 A;  3W8J A;  1VF1 A;  3TB2 A;  1JZR A;  2M72 A;  3D5J A;  2VD0 A;  4DSQ A;  2QC7 A;  3UEM A;  5ABR A;  1YKC A;  2K8V A;  3GX8 A;  4KDU A;  3QDN A;  1A23 A;  1UN2 A;  4NHW A;  4F2I A;  2GQK A;  4TXO A;  3UVT A;  2B5E A;  5AN1 A;  3IPZ A;  2FLS A;  3F4R A;  1EGO A;  4BL7 A;  3HZ8 A;  1ZYQ B;  2E7P A;  1FO5 A;  2WDU A;  4MJE A;  1XPV A;  2MMA A;  2CVB A;  3G7J A;  3IBH A;  4XHM A;  1QXH A;  3DD3 A;  4GQF A;  4TR1 A;  3VI7 A;  1GTB A;  2HSY A;  1F3A A;  7GSS A;  3F8U A;  4O92 A;  2H75 A;  2N5A A;  1M9B A;  2HZF A;  1PGT A;  1G0T A;  2NPB A;  5DCG A;  3ME7 A;  3F63 A;  2JZR A;  3CXG A;  1ZL9 A;  2F8F A;  2B1K A;  1X5C A;  3C1R A;  3R3E A;  2PGT A;  4PUA A;  4EDY A;  3DXB A;  2QA1 A;  4O5U A;  5G2Z A;  2IPA A;  4MF7 A;  1XW9 A;  2DIZ A;  1T8E B;  2HRF A;  2FA8 A;  2X8G A;  4ZBA A;  1H75 A;  6GST A;  5ECM B;  5C04 A;  2LRN A;  17GS A;  3F4T A;  3LG6 A;  1M3J A;  4KH7 A;  1GUL A;  16GS A;  1HQO A;  2LJA A;  2FCH A;  5DBQ A;  1A8Y A;  2KOK A;  1N2A A;  5G1K A;  2F51 A;  1XFL A;  3IC4 A;  1GLQ A;  1ABA A;  2M80 A;  4TW5 A;  4TR1 B;  2YOI A;  4BPY A;  5B6M A;  1NHO A;  2CQ9 A;  2JL4 A;  3GSS A;  3F3Q A;  3G7Y A;  4FYB A;  4ZL7 A;  1K0A A;  4Q5R A;  4IN0 A;  1JZD A;  2H8L A;  1Z3E A;  2IWT A;  2GLR A;  2MYG A;  2H1B A;  3ISO A;  4KE3 A;  2H1A A;  1MDK A;  4PUR A;  2R3X A;  4EIQ A;  2DLX A;  2L5L A;  2CV4 A;  2O87 A;  4ILF A;  3HJP A;  3GTU B;  2H30 A;  3DIE A;  1Z6N A;  1ML6 A;  1T4Y A;  2R5G A;  4IJI A;  2VM2 A;  3S9F A;  12GS A;  1YF0 A;  5CO3 A;  1O8W A;  3KM6 A;  4NWY A;  4N11 A;  1GP1 A;  2P5R A;  2DJK A;  1U6T A;  2H6Z A;  2GSQ A;  2GSS A;  2FNO A;  6GSX A;  3H79 A;  4HU9 A;  1EZK A;  2KUC A;  2FWF A;  3AY8 A;  2H76 A;  2PBJ A;  1SYX A;  3BBY A;  1K3L A;  3Q18 A;  4XRA A;  4NPB A;  3P2A A;  3ZRD A;  2X99 A;  1GSF A;  14GS A;  4OMV A;  5DJM A;  5GAP D;  3HVV A;  4KSO A;  2IME A;  4K1F A;  2ON5 A;  1IYI A;  2JAD A;  3I69 A;  5D9X A;  1GUH A;  4MCU A;  1NW2 A;  3TKS A;  3DVW A;  1EEJ A;  5HR2 A;  3NIV A;  1SJI A;  2RLI A;  2DIY A;  1EP8 A;  4IS0 A;  4KX4 A;  3FK8 A;  1KBN A;  5F05 A;  2YWO A;  5FWG A;  2GQM A;  3FY7 A;  3FZ5 A;  2FWE A;  2OJL A;  2G2Q A;  1WMJ A;  2I1U A;  2BTO T;  1F3B A;  5G1L A;  1R5P A;  4JBB A;  4F0C A;  2HRN A;  2ALB A;  4MZB A;  1X9S B;  1GNW A;  2OA7 A;  1PL1 A;  4MMM A;  4OD7 A;  4P3Y B;  3UJ1 A;  3UIW A;  3LYK A;  1OC3 A;  3GX0 A;  2L59 A;  1UVZ A;  3LJR A;  1R5A A;  2P5Q A;  2VOC A;  1B4P A;  5F0G A;  1PA3 A;  5G5E A;  3ZZX A;  1Z9H A;  3VPQ A;  1A2L A;  1SL2 B;  1MTC A;  3IK7 A;  4V2N A;  2HZE B;  3W6G A;  3TJG A;  3RDW A;  5E59 A;  5J3R A;  3FR3 A;  4ML6 A;  2KP1 A;  1DSB A;  1TU7 A;  4DSS A;  2GDR A;  3ZML A;  3EMX A;  3GA4 A;  4O32 A;  2FHE A;  4EO3 A;  2YJ7 A;  2NBS A;  4I97 A;  2K9F A;  2MMN A;  4K7O A;  4JRR A;  1YY7 A;  1DE2 A;  2CAI A;  1PRX A;  2WB9 A;  3CSH A;  5AIX A;  1MD4 A;  2J9H A;  3IHQ A;  3CSJ A;  1TJD A;  1M7T A;  3FR6 A;  2RM6 A;  1G6Y A;  5J9C A;  4X4J A;  5INY A;  2FWG A;  1XVW A;  3NOF A;  3NZN A;  1KNG A;  1NM3 A;  2OAD A;  2XHF A;  3D22 A;  4MPF A;  3TRP A;  2VL3 A;  5ECI B;  4ECJ A;  2GST A;  4EDZ A;  4EXJ A;  5GAN D;  4E8H A;  2CVD A;  2EIQ A;  1TP9 A;  1JZW A;  4POB A;  2WZ9 A;  1ERV A;  1T00 A;  2E2G A;  1C72 A;  4DSS B;  3PIN A;  2H19 A;  1TK5 B;  2H1G A;  4IHU A;  1NHY A;  4KCE A;  2VLU A;  3APO A;  2X8C A;  3N9J A;  3M0F A;  4I5Q A;  2WCI A;  3ED3 A;  4KF9 A;  2I9H A;  1V98 A;  1G7O A;  4YQM A;  1ILO A;  3I6A A;  3IK9 A;  3TDG A;  2NTO A;  3FZA A;  4AJ7 A;  2OKA A;  1J0F A;  4FIW A;  1FG4 A;  3TOT A;  1GUM A;  1BED A;  3MIX A;  1GSS A;  2IMF A;  4KUN A;  3IHG A;  1K0O A;  1B8X A;  3ZLP A;  10GS A;  5IOX A;  1YJ6 A;  2HRK A;  3IRA A;  4AF2 A;  1ST9 A;  1WRY A;  2C4J A;  2PPT A;  4LL4 B;  5IMA A;  4BVX A;  3HYP A;  3N5O A;  3A2W A;  2FA4 A;  1ACV A;  2A4V A;  3VK9 A;  4GSS A;  3VWX A;  2YWN A;  2YZH A;  2IN3 A;  1TRS A;  4ZL8 A;  5KN1 A;  2KHP A;  1NSW A;  2PVQ A;  2V32 A;  2F8A A;  1ZZY A;  2J23 A;  1ZOF A;  4MA9 A;  2B6M A;  4RUV A;  1K0C A;  3ZL5 A;  2UZ8 A;  1W4V A;  4TOP A;  4KND A;  3RAZ A;  4BWS A;  3MWH A;  4FYC A;  2V1M A;  3LW9 A;  1F2E A;  1ZYN A;  5H5Q A;  1HNA A;  1XWK A;  3WGE A;  3TRQ A;  2IJY A;  3DRN A;  4RI7 A;  2LJK A;  3ERG A;  3QAW A;  3MSZ A;  1UC7 A;  5AGY A;  2ZUP A;  2H01 A;  3LFL A;  4E8E A;  3H4K A;  4GTU A;  4KAE A;  4K2X A;  5CRH A;  2DKH A;  1G6W A;  3H1N A;  4L5L A;  3TJF A;  5CNW A;  3C1S A;  2C80 A;  3QAG A;  2H6X A;  1YEX A;  5DJL A;  3G7I A;  2H74 A;  4PQ1 A;  1K0D A;  2IMI A;  2GS3 A;  5ECK B;  1JLW A;  4F82 A;  2HXK A;  1AQV A;  1O73 A;  2PWJ A;  2YAN A;  3A2V A;  3HKR A;  3KXO A;  2LUS A;  1MDI A;  4YH2 A;  3CTF A;  3A3T A;  2C0D A;  2ZCT A;  5ECP B;  1H4O A;  4TRX A;  1QFN A;  4ZB6 A;  1O6J A;  2LJR A;  3L78 A;  3VWV A;  4ID0 A;  1M99 A;  5F8B A;  1TU8 A;  4PQI A;  2JU5 A;  2YN1 A;  3BCI A;  4EUY A;  1SEN A;  1VF4 A;  2N5B A;  5ECO B;  4MZW A;  1GH2 A;  1QMV A;  3HVS A;  3MNG A;  4I6X A;  4OO5 A;  3WGD A;  4N10 A;  2YP6 A;  3UBK A;  5H5R A;  2DSA A;  1AC1 A;  2JSZ A;  3L0H A;  3VFI A;  5KN2 A;  1XOB A;  3J7Y k;  4WKW A;  5B6N A;  3QFB C;  1TI1 A;  5DDL A;  5EPF A;  3FMW A;  2WFC A;  4BA7 A;  3WYW A;  1EOH A;  2B5Y A;  4YAV A;  5DQS A;  3UAR A;  2HFD A;  3I43 A;  1PKZ A;  2HRA A;  2B1L A;  3G9B A;  1RQM A;  3A5I A;  1I9D A;  2TRC P;  3M3M A;  3A2X A;  1ZGN A;  3HJM A;  1XVQ A;  3WD6 A;  1SKW B;  4HDE A;  4MF5 A;  3GNJ A;  3DVX A;  1YKA A;  1BG5 A;  4WF5 A;  2LNS A;  2D2Z A;  2GZP A;  3APS A;  3GMF A;  3IV4 A;  2R2J A;  2C0E A;  4ECI A;  5GSS A;  4XTS A;  1XWA A;  6GSV A;  1PFO A;  1XW5 A;  1WPI A;  3FHK A;  2YPM A;  1HNB A;  3GUR A;  1LJR A;  4WEY A;  3GV1 A;  3OR5 A;  4EL1 A;  3UBL A;  4TR3 A;  1OYJ A; 
#chains in the Genus database with same CATH homology
 3FYG A;  3GTU A;  4IEL A;  3ZFL A;  2OE3 A;  5IPG A;  4GXZ A;  3TUE A;  2EIO A;  3LYP A;  2GTU A;  4FQU A;  2WRT A;  2N5F A;  1TRU A;  2C8U A;  3GL3 A;  2RUE A;  1A24 A;  3BOA A;  4ECB A;  3KGK A;  3Q19 A;  3KZQ A;  4ZIL A;  4F0B A;  4WR4 A;  2R6K A;  4XCS A;  2H70 A;  2O7K A;  4LA1 A;  1PSQ A;  5D9T A;  2GT6 A;  3TOU A;  1XWB A;  1TRV A;  3TKQ A;  5IO2 A;  4OFM A;  3ZIJ A;  3D6I A;  2CX3 A;  4TKY A;  2H72 A;  2C0F A;  1A2M A;  1E2Y A;  2IL3 A;  5A4W A;  2C3T A;  2DJ2 A;  4IQ1 A;  3KMN A;  1W89 A;  5DQY A;  3HHV A;  3VPT A;  3L9V A;  5EVO A;  1MD3 A;  3CYN A;  2LQQ A;  3PGT A;  3FZ4 A;  1SK0 A;  2GZZ A;  4ML1 A;  4N0Z A;  2ES7 A;  1Q98 A;  2H66 A;  1TK0 B;  3L9S A;  5KOW A;  4WBJ A;  5B8A A;  19GS A;  4N0V A;  3P90 A;  5A4U A;  3ZFB A;  2GT5 A;  1SL0 B;  2I4A A;  2MZC A;  5FHI A;  2FD3 A;  4PGT A;  2WGR A;  3HY2 A;  4XIH A;  1Z7R A;  3D0Z A;  3VUR A;  4MH3 A;  3L9U A;  1SD9 A;  2O8V B;  5ENU A;  2AHE A;  3GFK A;  1QGV A;  1PMT A;  2DJ3 A;  2HZE A;  2LRC A;  2YCD A;  4WR5 A;  3A5W A;  4X0X A;  2E0Q A;  3LWA A;  1OE7 A;  1KEB A;  2L57 A;  2HLS A;  2DBC A;  2G0F A;  2GVP A;  2VCQ A;  1X9W B;  1EP7 A;  3E3E A;  2VM1 A;  3KIJ A;  4N30 A;  3E9J B;  3GH6 A;  4KW6 A;  1B9X C;  1WOU A;  1ZYE A;  2HE3 A;  4HS1 A;  1GSE A;  4LMV A;  22GS A;  4YAP A;  1GNE A;  2VAF A;  1PL2 A;  1FHE A;  5DAK B;  2V41 A;  4EE0 A;  3M9J A;  2H71 A;  2X4A A;  3GHA A;  4LLR A;  3DWV A;  3FZ9 A;  1FW1 A;  1WIK A;  4X1U A;  1AW9 A;  1QK8 A;  1AXD A;  4POK A;  1BQ7 A;  4ULX A;  4BVY B;  1VF3 A;  3FW2 A;  1SYR A;  2IFQ B;  1XW6 A;  2A4H A;  3KH7 A;  3WGX A;  9GSS A;  3WT2 A;  2OBK A;  2YWI A;  4ZXG A;  1GL8 A;  4JZQ A;  1M9A A;  4KGI A;  4ZBD A;  3R2Q A;  1DUG A;  1O85 A;  4XS4 A;  4Z2U A;  4MP4 A;  4L0W A;  1EEM A;  2LST A;  1A0R P;  1UA5 A;  4KA0 A;  5ECS A;  5H5S A;  1OC9 B;  1A8L A;  3TRX A;  3KCM A;  1GSU A;  2H6Y A;  3M1G A;  1Y25 A;  1Y6E A;  4AJ8 A;  5DCH A;  3RHC A;  4OO4 A;  2R4V A;  4CDO A;  2XPD A;  2OBI A;  2PN8 A;  1F37 A;  2L4C A;  1MEK A;  1FVK A;  4WBR D;  4IVF A;  1SL1 B;  4YQU A;  1EWX A;  3IE3 A;  3UAP A;  4EKZ A;  1KTE A;  2BMX A;  2DC5 A;  2CVK A;  2PUK C;  3ZRE A;  5IMC A;  1XXU A;  5JWR B;  13GS A;  4EIP A;  2PVO C;  1YDK A;  3LOR A;  2QGV A;  4K7I A;  5JWQ B;  1FAA A;  2OE1 A;  2DML A;  4MJA A;  2F9S A;  2E2M A;  4XS4 B;  1XWG A;  2C3N A;  2EC4 A;  3FR9 A;  4OFN A;  3QMX A;  5IOW A;  2PMT A;  1BYE A;  3KJY A;  5IM9 A;  3LGC A;  4ZB9 A;  1MDJ A;  4NMU A;  2MBS A;  3EVI A;  1AAZ A;  2HSM A;  4PUF C;  1HNC A;  2M46 A;  3U6V A;  1ON4 A;  4HU7 A;  3RBT A;  1I5G A;  5C00 A;  2B7K A;  2LRT A;  3P8W A;  3DGQ A;  2JAC A;  1TRW A;  2ZNM A;  1GTI A;  1JFU A;  4CW9 A;  3GKK A;  5ECQ B;  3KP9 A;  4ICY A;  1M2A A;  1XIY A;  2X64 A;  4K5R A;  4CHS A;  5HFG A;  2ON7 A;  2H73 A;  3ZIT A;  20GS A;  3HDC A;  6GSU A;  4G19 A;  3EMP A;  4ECC A;  3LXT A;  4JR4 A;  5J5N A;  5J41 A;  2B5X A;  5IQY A;  2LKU A;  4K0G A;  2KLX A;  3LQ7 A;  5ECN B;  4CY6 A;  1TW9 A;  5JCG A;  3UMA A;  1U87 A;  1OKT A;  4AGS A;  2H0G A;  3C73 A;  3EUR A;  3O76 A;  8GSS A;  1E6B A;  4PX1 A;  2FWH A;  1YZX A;  3EPT A;  2VCW A;  3IXR A;  1EV4 A;  1YQ1 A;  2AJQ B;  1PN9 A;  4JR6 A;  3ZMK A;  4DSR A;  4PQH A;  2CZ3 A;  2AV4 A;  3KP8 A;  1WP0 A;  3ME8 A;  4KSM A;  4LL1 B;  3BJ5 A;  4NHZ A;  1PQN A;  4O5Q A;  1V9W A;  4IJ3 A;  5JCW A;  4KDY A;  2YV9 A;  1T4Z A;  1F9M A;  4MPG A;  4WET A;  4KCA A;  1X5E A;  2WUL A;  2JZT A;  4EC0 A;  4JU5 A;  2DJ1 A;  2LEG A;  5J9B A;  1OE8 A;  3GUS A;  4OWY A;  4G0L A;  3D21 A;  2FY6 A;  3FEU A;  2KP2 A;  4L8E A;  3V1W A;  1TXX A;  4K9Z A;  5B7C A;  1R4W A;  1OKD A;  3LXZ A;  4K8M A;  3P7X A;  4TR4 A;  1ERT A;  3I9V 2;  4FYU A;  4GLT A;  1BX9 A;  4JED A;  4RQR A;  1DE1 A;  4QL7 A;  3UOM A;  6GSW A;  3EU4 A;  4GRF A;  1USB A;  4D73 A;  5DAL A;  4QL9 A;  1LBK A;  5EY6 A;  1BAY A;  2R0G A;  2V6O A;  4ZL9 A;  3O6T A;  3K8N A;  3ZVJ D;  1K0B A;  4HZ4 A;  2VO4 A;  2A2R A;  3ZIV A;  1FB6 A;  4TVE A;  3QOU A;  3KEB A;  2O89 A;  5AIV A;  5ECL B;  5D9V A;  4HZ2 A;  5F07 A;  5A4V A;  1ZCP A;  3C7M A;  4ZIJ A;  18GS A;  4EF0 A;  2AB6 A;  3TKS E;  3M8N A;  4HQS A;  3PPU A;  1SK2 A;  2XPE A;  5ECR B;  5HFI A;  5B8B A;  2R0P A;  3KTL A;  2JZS A;  1PX6 A;  4GSN A;  3FKF A;  2HYX A;  2I3Y A;  4NV5 A;  1X0R A;  3GKN A;  5IMD A;  2VL9 A;  3C71 A;  3EU3 A;  5JWO B;  1EV9 A;  4YKG A;  3CMI A;  2VCV A;  2VL2 C;  2XBQ A;  2HSH A;  2WJU A;  2YWM A;  1B9Y C;  2VCZ A;  4GCI A;  5D8I A;  4D73 B;  5DAL B;  3EYT A;  5E4W A;  2BJX A;  4K7N A;  1GLP A;  2H0H A;  1AQX A;  3EIN A;  3WT1 A;  2YNX A;  4IQA A;  1AIU A;  3ERF A;  1K0M A;  6GSS A;  5CYY A;  3GL5 A;  4HUA A;  4I2T A;  1X5D A;  3MDK A;  3IAM 2;  3EC3 A;  3TJJ A;  2QSI A;  3D4T A;  1V58 A;  1VRS D;  2P0G A;  4L0U A;  3HJO A;  4CY8 A;  5KEJ A;  2K6V A;  5DVB A;  1Z7P A;  5CRW A;  3RPN A;  4TXO B;  4BL7 B;  1K0N A;  4LMW A;  3US3 A;  2YV7 A;  2AAW A;  4F03 A;  4O5R A;  4L5O A;  4Q5N A;  5BMU A;  4K2D A;  2OAC A;  1FOH A;  1EOG A;  4Z2R A;  2TRX A;  1RW1 A;  4FH8 A;  3IDV A;  2VD1 A;  2DJ0 A;  3HD5 A;  1EGR A;  3J7Y b;  1B4Q A;  3MAK A;  2QKE A;  3DEX A;  5CAX A;  1SD8 A;  2DJJ A;  4KDX A;  1WE0 A;  1QQ2 A;  4GQC A;  1F6M C;  3Q6O A;  4Z7X A;  2VCT A;  5BRT A;  2B3S A;  3Q74 A;  1ZMA A;  1PX7 A;  1Z6M A;  4IBP A;  1CQH A;  4XS6 A;  4RQX A;  1GTU A;  1FVJ A;  1S3C A;  5GZZ B;  1FB0 A;  3TKR A;  4A5P A;  1TTZ A;  3LEF A;  5LCZ A;  4MJB A;  4PXO A;  4K0N A;  5DAK A;  4ACS A;  2EIR A;  2IMK A;  4DEJ A;  4MNN A;  1PN0 A;  4J56 E;  5ID2 A;  5LD0 A;  3ZYW A;  3U5R E;  3PR8 A;  4YQV A;  4V1A p;  3QR6 A;  1A2J A;  4G10 A;  4BVY A;  2C1Y A;  1X9M B;  4PNF A;  3UVH A;  1OC8 A;  1QUW A;  4USS A;  2IFQ A;  1O7U A;  4HOJ A;  11GS A;  1B48 A;  3CRT A;  5FT3 A;  1LU4 A;  1OVN A;  2HNL A;  2MBT A;  4RI6 A;  3APQ A;  4GF0 A;  2XC2 A;  5IMZ A;  1XCC A;  1K3O A;  3H8Q A;  5D93 A;  4GWR A;  5COH A;  2CZ2 A;  1TI3 A;  1YEP A;  4Q5F A;  1XOA A;  5D9W A;  3BCK A;  4AJ6 A;  2REM A;  1OC9 A;  4HI7 A;  2QA2 A;  1O8X A;  4IP6 A;  4X43 A;  3CTG A;  1SU9 A;  2PER A;  5GST A;  4XS1 A;  3GKX A;  5LNK e;  2Z9S A;  2NDO A;  4NV2 A;  5AIS A;  3ZVJ A;  1AQW A;  5ID2 B;  2LS5 A;  3TCO A;  3KH9 A;  4MLY A;  5G30 A;  3CBU A;  2LTK A;  4Q5Q A;  2FGX A;  4I8B A;  5HFK A;  4EVM A;  4NXI A;  4ZB8 A;  1AUC A;  1GSD A;  2K18 A;  1O81 A;  3IA1 A;  1TOF A;  1G7E A;  1VF2 A;  3LSZ A;  1Z5Y E;  4K5S A;  5IO0 A;  1ZYP A;  3HVX A;  2VLV A;  2GGT A;  1XWC A;  1GRX A;  1XBS A;  4K6X A;  5HR0 A;  5D73 A;  1T3B A;  1FOV A;  4QQ7 A;  2YZU A;  4O7H A;  6GSY A;  1SK1 A;  2XBI A;  2VL2 A;  5JCU A;  5CRD A;  2YJH A;  1HYU A;  3DYR A;  3W8S A;  2CA8 A;  1OAZ A;  5D96 A;  3QCP A;  2RUF A;  3IAS 2;  3FRC A;  1S3D A;  1TDI A;  4YKF A;  3CRU A;  1SJ6 A;  4IGJ A;  4POL A;  4HJ2 A;  4ISD A;  2AUV A;  3QPM A;  1GSQ A;  2RII A;  5KN0 A;  1R7H A;  1TK8 B;  3DKS A;  1JZO A;  3HCZ A;  3MYD A;  3F6D A;  4MH2 A;  4ZBB A;  2L6D A;  3F6F A;  4HQZ A;  2TIR A;  3BD2 A;  1YF1 A;  3M9K A;  3EWL A;  4WXT A;  1SKS B;  5CRE A;  4JE1 A;  2H1D A;  3IC8 A;  5HQP A;  2R0C A;  2VIM A;  3C8E A;  1IYH A;  3KTB A;  2JSY A;  3GN3 A;  3D4M A;  2GZY A;  2IMD A;  3F4S A;  3KD0 A;  4GST A;  3VLN A;  1GSY A;  5CP1 A;  4G0I A;  5ELG A;  4BWQ A;  2HI7 A;  2WS2 A;  1SJZ A;  2F3M A;  2C0G A;  1GTA A;  2P31 A;  1URM A;  1WWJ A;  3H93 A;  1TKD B;  1VGL A;  4MJC A;  4G9H A;  4PTS A;  3IOS A;  5ECH B;  1XZO A;  2X49 A;  2CX4 A;  1T7P B;  3ZTL A;  4NAX A;  2NVL A;  3VWW A;  2FUG 2;  3DML A;  1M2B A;  5A5K A;  1M2D A;  1M0U A;  2GSR A;  3GKM A;  1THX A;  1PKW A;  4IW9 A;  4DVC A;  1R26 A;  2O85 A;  1K3Y A;  5IMF A;  3F3R A;  2B7J A;  4V1A g;  3O3T A;  4HJM A;  1WJK A;  1J08 A;  4OCE A;  2DMM A;  4TXV A;  3HZ4 A;  3UL3 A;  2OE0 A;  2X8H A;  3GH9 A;  3JCM L;  4I2U A;  2VCX A;  1DBY A;  5G5F A;  4IKH A;  3TKP A;  4G2E A;  2MMZ A;  1ERW A;  5F06 A;  1N8J A;  5L71 A;  1JLV A;  5G31 A;  5ELA A;  4J2F A;  2R37 A;  3HXS A;  4KB3 A;  4G0K A;  2L6C A;  2VUP A;  1V57 A;  4MK3 A;  4MDC A;  2A2S A;  4BVX B;  2V6K A;  3SWL A;  4V2L A;  1CQG A;  4PNG A;  1HD2 A;  3CSI A;  3SBC A;  2IIY A;  3QAV A;  3QFA C;  2L5O A;  4WF4 A;  2V2G A;  2K8S A;  2C3Q A;  4OCF A;  2LNT A;  4F9Z A;  1T1V A;  2MMO A;  5CRG A;  4POM A;  5KOX A;  2I81 A;  3TJK A;  2AYT A;  1V40 A;  2PU9 C;  1U3A A;  4OFT A;  3RPP A;  4IP1 A;  1SKR B;  4V2M A;  5IMV A;  5KN3 A;  3L4N A;  1THO A;  1BJX A;  1V2A A;  3GIX A;  3PH9 A;  1RK4 A;  4MZC A;  3VI5 A;  4MF6 A;  2H0I A;  2VLT A;  2HT9 A;  3TKS C;  3TGZ A;  4TN8 A;  1Q4J A;  2A2P A;  5EL8 A;  3TJB A;  5J4U A;  3IR4 A;  1GUK A;  3RHB A;  4XRD A;  5IIZ A;  4HEA 2;  3GST A;  3E0U A;  4H86 A;  1GWC A;  2DKI A;  1U3I A;  3QD9 A;  4MAB A;  4J57 E;  5IPH A;  3HA9 A;  3F9U A;  2L4Q A;  1U88 A;  2RM5 A;  3VWU A;  1A0F A;  2LV3 A;  3ERW A;  4Z2T A;  2CT6 A;  4TR0 A;  1S3A A;  2LQO A;  1JHB A;  2GQL A;  3GYK A;  1ERU A;  3GRX A;  4FO5 A;  1PD2 1;  1J9B A;  3F0I A;  3KMO A;  2CAQ A;  3EE2 A;  5HR3 A;  5HR1 A;  3W8J A;  1VF1 A;  3TB2 A;  1JZR A;  2M72 A;  3D5J A;  2VD0 A;  4DSQ A;  2QC7 A;  3UEM A;  5ABR A;  1YKC A;  2K8V A;  3GX8 A;  4KDU A;  3QDN A;  1A23 A;  1UN2 A;  4NHW A;  4F2I A;  2GQK A;  4TXO A;  3UVT A;  2B5E A;  5AN1 A;  3IPZ A;  2FLS A;  3F4R A;  1EGO A;  4BL7 A;  3HZ8 A;  1ZYQ B;  2E7P A;  1FO5 A;  2WDU A;  4MJE A;  1XPV A;  2MMA A;  2CVB A;  3G7J A;  3IBH A;  4XHM A;  1QXH A;  3DD3 A;  4GQF A;  4TR1 A;  3VI7 A;  1GTB A;  2HSY A;  1F3A A;  7GSS A;  3F8U A;  4O92 A;  2H75 A;  2N5A A;  1M9B A;  2HZF A;  1PGT A;  1G0T A;  2NPB A;  5DCG A;  3ME7 A;  3F63 A;  2JZR A;  3CXG A;  1ZL9 A;  2F8F A;  2B1K A;  1X5C A;  3C1R A;  3R3E A;  2PGT A;  4PUA A;  4EDY A;  3DXB A;  2QA1 A;  4O5U A;  5G2Z A;  2IPA A;  4MF7 A;  1XW9 A;  2DIZ A;  1T8E B;  2HRF A;  2FA8 A;  2X8G A;  4ZBA A;  1H75 A;  6GST A;  5ECM B;  5C04 A;  2LRN A;  17GS A;  3F4T A;  3LG6 A;  4KH7 A;  1GUL A;  16GS A;  1HQO A;  2LJA A;  2FCH A;  5DBQ A;  1A8Y A;  2KOK A;  1N2A A;  5G1K A;  2F51 A;  1XFL A;  3IC4 A;  1GLQ A;  1ABA A;  2M80 A;  4TW5 A;  4TR1 B;  2YOI A;  4BPY A;  5B6M A;  1NHO A;  2CQ9 A;  2JL4 A;  3GSS A;  3F3Q A;  3G7Y A;  4FYB A;  4ZL7 A;  1K0A A;  4Q5R A;  4IN0 A;  1JZD A;  2H8L A;  1Z3E A;  2IWT A;  2GLR A;  2MYG A;  2H1B A;  3ISO A;  4KE3 A;  2H1A A;  1MDK A;  4PUR A;  2R3X A;  4EIQ A;  2DLX A;  2L5L A;  2CV4 A;  2O87 A;  4ILF A;  3HJP A;  3GTU B;  2H30 A;  3DIE A;  1Z6N A;  1ML6 A;  1T4Y A;  2R5G A;  4IJI A;  2VM2 A;  3S9F A;  12GS A;  1YF0 A;  5CO3 A;  1O8W A;  3KM6 A;  4NWY A;  4N11 A;  1GP1 A;  2P5R A;  2DJK A;  1U6T A;  2H6Z A;  2GSQ A;  2GSS A;  2FNO A;  6GSX A;  3H79 A;  4HU9 A;  1EZK A;  2KUC A;  2FWF A;  3AY8 A;  2H76 A;  2PBJ A;  1SYX A;  3BBY A;  1K3L A;  3Q18 A;  4XRA A;  4NPB A;  3P2A A;  3ZRD A;  2X99 A;  1GSF A;  14GS A;  4OMV A;  5DJM A;  5GAP D;  3HVV A;  4KSO A;  2IME A;  4K1F A;  2ON5 A;  1IYI A;  2JAD A;  3I69 A;  5D9X A;  1GUH A;  4MCU A;  1NW2 A;  3TKS A;  3DVW A;  1EEJ A;  5HR2 A;  3NIV A;  1SJI A;  2RLI A;  2DIY A;  1EP8 A;  4IS0 A;  4KX4 A;  3FK8 A;  1KBN A;  5F05 A;  2YWO A;  5FWG A;  2GQM A;  3FY7 A;  3FZ5 A;  2FWE A;  2OJL A;  2G2Q A;  1WMJ A;  2I1U A;  2BTO T;  1F3B A;  5G1L A;  1R5P A;  4JBB A;  4F0C A;  2HRN A;  2ALB A;  4MZB A;  1X9S B;  1GNW A;  2OA7 A;  1PL1 A;  4MMM A;  4OD7 A;  4P3Y B;  3UJ1 A;  3UIW A;  3LYK A;  1OC3 A;  3GX0 A;  2L59 A;  1UVZ A;  3LJR A;  1R5A A;  2P5Q A;  2VOC A;  1B4P A;  5F0G A;  1PA3 A;  5G5E A;  3ZZX A;  1Z9H A;  3VPQ A;  1A2L A;  1SL2 B;  1MTC A;  3IK7 A;  4V2N A;  2HZE B;  3W6G A;  3TJG A;  3RDW A;  5E59 A;  5J3R A;  3FR3 A;  4ML6 A;  2KP1 A;  1DSB A;  1TU7 A;  4DSS A;  2GDR A;  3ZML A;  3EMX A;  3GA4 A;  4O32 A;  2FHE A;  4EO3 A;  2YJ7 A;  2NBS A;  4I97 A;  2K9F A;  2MMN A;  4K7O A;  4JRR A;  1YY7 A;  1DE2 A;  2CAI A;  1PRX A;  2WB9 A;  3CSH A;  5AIX A;  1MD4 A;  2J9H A;  3IHQ A;  3CSJ A;  1TJD A;  1M7T A;  3FR6 A;  2RM6 A;  1G6Y A;  5J9C A;  4X4J A;  5INY A;  2FWG A;  1XVW A;  3NOF A;  3NZN A;  1KNG A;  1NM3 A;  2OAD A;  2XHF A;  3D22 A;  4MPF A;  3TRP A;  2VL3 A;  5ECI B;  4ECJ A;  2GST A;  4EDZ A;  4EXJ A;  5GAN D;  4E8H A;  2CVD A;  2EIQ A;  1TP9 A;  1JZW A;  4POB A;  2WZ9 A;  1ERV A;  1T00 A;  2E2G A;  1C72 A;  4DSS B;  3PIN A;  2H19 A;  1TK5 B;  2H1G A;  4IHU A;  1NHY A;  4KCE A;  2VLU A;  3APO A;  2X8C A;  3N9J A;  3M0F A;  4I5Q A;  2WCI A;  3ED3 A;  4KF9 A;  2I9H A;  1V98 A;  1G7O A;  4YQM A;  1ILO A;  3I6A A;  3IK9 A;  3TDG A;  2NTO A;  3FZA A;  4AJ7 A;  2OKA A;  1J0F A;  4FIW A;  1FG4 A;  3TOT A;  1GUM A;  1BED A;  3MIX A;  1GSS A;  2IMF A;  4KUN A;  3IHG A;  1K0O A;  1B8X A;  3ZLP A;  10GS A;  5IOX A;  1YJ6 A;  2HRK A;  3IRA A;  4AF2 A;  1ST9 A;  1WRY A;  2C4J A;  2PPT A;  4LL4 B;  5IMA A;  4BVX A;  3HYP A;  3N5O A;  3A2W A;  2FA4 A;  1ACV A;  2A4V A;  3VK9 A;  4GSS A;  3VWX A;  2YWN A;  2YZH A;  2IN3 A;  1TRS A;  4ZL8 A;  5KN1 A;  2KHP A;  1NSW A;  2PVQ A;  2V32 A;  2F8A A;  1ZZY A;  2J23 A;  1ZOF A;  4MA9 A;  2B6M A;  4RUV A;  1K0C A;  3ZL5 A;  2UZ8 A;  1W4V A;  4TOP A;  4KND A;  3RAZ A;  4BWS A;  3MWH A;  4FYC A;  2V1M A;  3LW9 A;  1F2E A;  1ZYN A;  5H5Q A;  1HNA A;  1XWK A;  3WGE A;  3TRQ A;  2IJY A;  3DRN A;  4RI7 A;  2LJK A;  3ERG A;  3QAW A;  3MSZ A;  1UC7 A;  5AGY A;  2ZUP A;  2H01 A;  3LFL A;  4E8E A;  3H4K A;  4GTU A;  4KAE A;  4K2X A;  5CRH A;  2DKH A;  1G6W A;  3H1N A;  4L5L A;  3TJF A;  5CNW A;  3C1S A;  2C80 A;  3QAG A;  2H6X A;  1YEX A;  5DJL A;  3G7I A;  2H74 A;  4PQ1 A;  1K0D A;  2IMI A;  2GS3 A;  5ECK B;  1JLW A;  4F82 A;  2HXK A;  1AQV A;  1O73 A;  2PWJ A;  2YAN A;  3A2V A;  3HKR A;  3KXO A;  2LUS A;  1MDI A;  4YH2 A;  3CTF A;  3A3T A;  2C0D A;  2ZCT A;  5ECP B;  1H4O A;  4TRX A;  1QFN A;  4ZB6 A;  1O6J A;  2LJR A;  3L78 A;  3VWV A;  4ID0 A;  1M99 A;  5F8B A;  1TU8 A;  4PQI A;  2JU5 A;  2YN1 A;  3BCI A;  4EUY A;  1SEN A;  1VF4 A;  2N5B A;  5ECO B;  4MZW A;  1GH2 A;  1QMV A;  3HVS A;  3MNG A;  4I6X A;  4OO5 A;  3WGD A;  4N10 A;  2YP6 A;  3UBK A;  5H5R A;  2DSA A;  1AC1 A;  2JSZ A;  3L0H A;  3VFI A;  5KN2 A;  1XOB A;  3J7Y k;  4WKW A;  5B6N A;  3QFB C;  1TI1 A;  5DDL A;  5EPF A;  3FMW A;  2WFC A;  4BA7 A;  3WYW A;  1EOH A;  2B5Y A;  4YAV A;  5DQS A;  3UAR A;  2HFD A;  3I43 A;  1PKZ A;  2HRA A;  2B1L A;  3G9B A;  1RQM A;  3A5I A;  1I9D A;  2TRC P;  3M3M A;  3A2X A;  1ZGN A;  3HJM A;  1XVQ A;  3WD6 A;  1SKW B;  4HDE A;  4MF5 A;  3GNJ A;  3DVX A;  1YKA A;  1BG5 A;  4WF5 A;  2LNS A;  2D2Z A;  2GZP A;  3APS A;  3GMF A;  3IV4 A;  2R2J A;  2C0E A;  4ECI A;  5GSS A;  4XTS A;  1XWA A;  6GSV A;  1XW5 A;  1WPI A;  3FHK A;  2YPM A;  1HNB A;  3GUR A;  1LJR A;  4WEY A;  3GV1 A;  3OR5 A;  4EL1 A;  3UBL A;  4TR3 A;  1OYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...