5HR1A

Crystal structure of thioredoxin l107a mutant
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin-1
publication title Structural variability of E. coli thioredoxin captured in the crystal structures of single-point mutants.
pubmed doi rcsb
source organism Escherichia coli o157:h7
total genus 27
structure length 107
sequence length 107
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2016-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5hr1A00
1THXA 4TOPA 3LXZA 1QMVA 2DIYA 1UN2A 4KAEA 3KTBA 5D8IA 4G2EA 19GSA 5HR1A 2P31A 2H1BA 2RUEA 3H93A 4PX1A 2L4QA 2MBTA 5J9CA 3SWLA 3IPZA 2KUCA 3D6IA 2OE1A 3LEFA 1TI1A 4XRDA 4POBA 4ILFA 2EC4A 3VI7A 2WFCA 4MMMA 5D73A 3DVWA 3IHQA 2VUPA 2E7PA 2LJKA 3UARA 4CW9A 5JCWA 1T3BA 2WS2A 2IN3A 3LXTA 4XCSA 4KGIA 1ZGNA 2HSYA 22GSA 5A4WA 1A2JA 3F4SA 9GSSA 1C72A 3FR6A 5CRHA 1BX9A 5G2ZA 1F3AA 1O85A 2DJ2A 1DUGA 2JSYA 2TRXA 2QKEA 4PXOA 8GSSA 1FB6A 4MP4A 5CP1A 2IMDA 1HD2A 1OE8A 3TGZA 4YQUA 4HUAA 1PMTA 2GZYA 2H66A 5KN3A 1QUWA 1SENA 3UL3A 2AB6A 4KUNA 1O8XA 2QGVA 2RUFA 1MDIA 2JL4A 4JE1A 4MH3A 3H1NA 2WRTA 3IV4A 3IBHA 3DRNA 1JZOA 2MZCA 1AW9A 1EGRA 1QXHA 4HI7A 4IKHA 3VWVA 3IK7A 3KCMA 3MSZA 5IMAA 3QDNA 2PVOC 4MCUA 5ECHB 3DIEA 4IS0A 2LJAA 4DSSA 4YAPA 1KNGA 5ECNB 2A4VA 1WP0A 3HD5A 2CZ2A 3LG6A 4V2MA 4WBRD 3A2WA 5ID2A 1YDKA 4J56E 2XHFA 4DSQA 3IC4A 2MMNA 1LU4A 4MZWA 1K3OA 2C0GA 4EC0A 2L5LA 2L4CA 2O8VB 4OMVA 3E9JB 3GTUB 3FZ4A 1FVJA 1GSDA 3P8WA 4ML6A 3FKFA 2IPAA 2M46A 1TXXA 1SKWB 2VL9A 4MJEA 1ERVA 1Z3EA 2WB9A 2V6OA 3IDVA 2D2ZA 2HI7A 1ML6A 3ERWA 1F9MA 4WR5A 4IJIA 3HJOA 2V2GA 3C71A 2OADA 3BOAA 2C3QA 3RAZA 4OCFA 3KM6A 1HQOA 2KP1A 4GXZA 2HNLA 2PVQA 2LV3A 4I6XA 2CVDA 1GSYA 3APOA 4DSSB 5ELGA 4ZBBA 1SL1B 1V58A 5JWRB 4HJ2A 4POKA 3HVVA 5CRGA 4I5QA 4N0ZA 2RM6A 2G2QA 1H75A 2K18A 1IYHA 1ZMAA 3U6VA 2VL2C 1TI3A 4NMUA 2WDUA 2GQMA 1HYUA 3WGXA 3EMXA 3QCPA 2GTUA 3UOMA 2VOCA 5LNKe 5H5RA 3D21A 2VD1A 2CQ9A 1GSFA 4I2UA 4PNFA 2ZNMA 3FRCA 3F4TA 5DCGA 1A0RP 4NV2A 5AISA 2VAFA 3CXGA 6GSVA 5IPGA 4JEDA 4D73A 3GHAA 1GTUA 1XXUA 1A23A 4PQIA 4OFNA 3VURA 3LYPA 1XW5A 3TJGA 10GSA 4AJ8A 3TKSC 1EOHA 2B5XA 4OO4A 4WBJA 1G6YA 1E6BA 3ZIVA 5J3RA 1WOUA 2X8HA 4N30A 3VPTA 2YOIA 1T4ZA 1X5EA 1AXDA 2C0EA 2YV7A 4BL7A 4TN8A 2TIRA 3W8SA 4K9ZA 3EWLA 2LNTA 2LSTA 2GSSA 4JR4A 1B9YC 2NPBA 1HNBA 5JWQB 1GWCA 4MF7A 1A0FA 5IMVA 3GKXA 4YQVA 3QFBC 2X99A 2JACA 2CVBA 3ME7A 3VK9A 1FG4A 2AUVA 2CZ3A 4D73B 2J23A 5INYA 1GTAA 1HNCA 5DQSA 3H79A 2CX3A 3EU3A 2EIRA 2MYGA 1KTEA 1BEDA 5L71A 2N5AA 5B6MA 4POLA 1Z6NA 2VLTA 3CSJA 3C1SA 4HEA2 3UVHA 4ZB8A 1XOBA 3VI5A 2J9HA 1JZRA 4P3YB 3VLNA 4CHSA 3TB2A 1K3LA 3GL5A 2H74A 5KN1A 1M7TA 1NSWA 2VCQA 2NVLA 4ULXA 1FO5A 3KXOA 5ECMB 4KSOA 5CNWA 3H8QA 3LYKA 1K3YA 1GSSA 4V1Ag 3HDCA 4Q5FA 2LS5A 4GTUA 5FHIA 3W6GA 3HCZA 1DBYA 1GP1A 2F3MA 3GN3A 1Y6EA 1R26A 2AJQB 3CYNA 2VM2A 2R5GA 3L0HA 5GSSA 3KEBA 5ELAA 1A2LA 3UBLA 4KNDA 2PBJA 2H0HA 2MMAA 2L6DA 2K9FA 3LSZA 4TR4A 4TXVA 5CYYA 1DE1A 3I6AA 3KGKA 3VWUA 1J08A 4X1UA 2V41A 1SK1A 1VF4A 1X5CA 3PGTA 4X43A 4KCAA 5IIZA 3ZFBA 1TKDB 4IVFA 1TRVA 3KIJA 2K8VA 1NHOA 5FWGA 4GRFA 1E2YA 1O73A 2H0GA 5J5NA 4IQ1A 4HU9A 3O6TA 1SKRB 2HLSA 2YP6A 3FYGA 4WEYA 5IO0A 3GH9A 2HZEA 3GSSA 2LUSA 5DJMA 3ZMKA 4EF0A 3HVXA 4ECIA 1MTCA 3DD3A 3TJBA 1TK0B 5GSTA 20GSA 3J7Yk 3UAPA 2AV4A 4WXTA 2A2SA 2I4AA 2OBKA 1XFLA 3UMAA 2LRCA 3APQA 3EYTA 1M9BA 2FUG2 2PERA 5IMCA 4RI7A 1Q4JA 3CTGA 4KB3A 5IOXA 3ZITA 3ME8A 2EIOA 3IRAA 3LFLA 1GSQA 2X8CA 4HDEA 3EINA 3NOFA 2NDOA 1RQMA 1XWBA 1GTIA 4GWRA 1OC3A 1PL1A 5IMZA 2RM5A 4HZ4A 2RIIA 4Q5RA 1PSQA 1FHEA 5D96A 3F63A 6GSXA 2HZEB 4G19A 2KP2A 3WGDA 1VRSD 3G7JA 3FR9A 2GSQA 1SU9A 4Z7XA 6GSSA 3LGCA 4WF4A 2FY6A 4F0BA 1FVKA 4RI6A 3CMIA 3MNGA 2ON7A 5ECIB 2YZUA 4IJ3A 3CSHA 2O89A 3NIVA 5HFGA 1H4OA 3KP8A 4F03A 4KW6A 1AAZA 5IQYA 3W8JA 1TK5B 1NHYA 3ZLPA 1YQ1A 1B48A 2LQQA 5ECRB 1WE0A 4NXIA 4GQCA 4FH8A 3QFAC 3GH6A 2YNXA 4OCEA 5D9WA 12GSA 1XIYA 2O85A 4ML1A 1OKTA 1XVQA 4K7IA 4RQRA 3F9UA 3GYKA 3FY7A 2OKAA 1Z7RA 2JZSA 4HJMA 2M80A 1CQGA 4GSTA 4ACSA 1GL8A 4XRAA 3ZVJD 4WKWA 4LL1B 3DVXA 2CAQA 3TRPA 3D4MA 2O7KA 3GTUA 4K7NA 3GNJA 3Q6OA 13GSA 3A2XA 3TOUA 3MWHA 2MMZA 4K2DA 2PUKC 2FNOA 1Z6MA 4JU5A 2FHEA 3GRXA 4N0VA 4V2NA 4TXOA 1PX6A 5LCZA 3UIWA 1VF2A 1V57A 1XWKA 2C0FA 4F82A 2E0QA 4OD7A 2FWHA 2GS3A 2VO4A 2RLIA 3UEMA 3P90A 4TKYA 1O7UA 3F6DA 2PGTA 3D5JA 3GL3A 3RDWA 3ZL5A 4DEJA 1XWAA 5IMFA 1X0RA 3TJJA 3TKRA 2H6XA 1R7HA 3ERGA 5IMDA 2CT6A 2C80A 2HZFA 5CRWA 1PKWA 5FT3A 1Q98A 2HRFA 3GV1A 2I1UA 2VCTA 2VM1A 2JADA 1OKDA 1GSEA 2BTOT 5HFIA 2R37A 2OE3A 1U3IA 2X64A 1Z7PA 4TXOB 2WCIA 4PQHA 11GSA 3P2AA 3IXRA 1M0UA 1PL2A 3D22A 1OC8A 4JRRA 1M99A 3ZMLA 1MD3A 1QGVA 1GSUA 4WR4A 1TU7A 4G10A 2LQOA 1AIUA 1LBKA 4H86A 4TR3A 4EDYA 4KX4A 3TRXA 4LMVA 2TRCP 1PD21 3EE2A 5AIXA 4TR0A 3KD0A 4QQ7A 3Q19A 4FYCA 3FZAA 1V98A 4I8BA 4AJ6A 3N9JA 1TK8B 3H4KA 1RW1A 1R5PA 3JCML 3PR8A 4J2FA 1X5DA 1U87A 4YQMA 3WT2A 3GSTA 1MD4A 3G7YA 3KZQA 2LJRA 2L57A 2DMLA 1NM3A 1FW1A 6GSUA 4MZBA 1W4VA 4ZB9A 3UVTA 2PWJA 3OR5A 2H70A 1K0MA 3GKKA 1S3CA 3HA9A 2AYTA 3F6FA 3TKQA 4MPFA 2OJLA 4E8HA 1JFUA 2K8SA 2HE3A 4IQAA 2B7JA 4KSMA 1KBNA 6GSTA 3FR3A 1THOA 4GSNA 1K0CA 4KDXA 1O8WA 3F4RA 2YWMA 5DDLA 2H0IA 1GTBA 2VCVA 1MDKA 3IAS2 4KA0A 1RK4A 1T7PB 3IOSA 2DIZA 3Q18A 5B8BA 3IE3A 2IIYA 4WETA 4EXJA 2GT5A 4HS1A 4O32A 3DGQA 2IWTA 2B1KA 3KTLA 4FYUA 3BD2A 1PX7A 1Y25A 1S3AA 2VLUA 3ZTLA 4BWSA 4PUAA 2H71A 4K7OA 17GSA 4HOJA 4EKZA 1SD8A 3ZRDA 2B6MA 2CVKA 2GQLA 5GAPD 1TRUA 2FD3A 1YEPA 3ED3A 2PU9C 3GKMA 5DBQA 3HHVA 1JZWA 4ISDA 1B9XC 2FLSA 2IFQA 4MF5A 4IGJA 2C4JA 3FW2A 2L5OA 2XPEA 4N10A 2KLXA 4OFTA 1YF1A 1K0DA 3ISOA 4NPBA 4PURA 3I9V2 1AUCA 3MDKA 1NW2A 4IBPA 5DCHA 2F9SA 1OVNA 2FA8A 3FK8A 4KCEA 2VCWA 2F51A 2ALBA 4MDCA 1A24A 1XVWA 1G7EA 2XC2A 3DMLA 4EL1A 4KDYA 3PH9A 2FA4A 3BCKA 4ECJA 2YWIA 3NZNA 3O3TA 5B8AA 3M3MA 4Q5QA 1WJKA 2H73A 4HQSA 4MJAA 3BBYA 5F0GA 3GUSA 3HJMA 2M72A 2OACA 2V1MA 5HR2A 4EE0A 4LA1A 2PN8A 4MLYA 2IFQB 1YY7A 4IHUA 5KEJA 3FZ9A 1R5AA 1XBSA 1QFNA 2H8LA 1IYIA 3QR6A 4LLRA 1J9BA 2GT6A 3C8EA 2P5QA 1M2AA 1SK2A 4XS4A 4JZQA 5G30A 1SJZA 2GSTA 5KN0A 4K6XA 2FGXA 3RBTA 1ZOFA 2DBCA 1PGTA 3D4TA 4FO5A 2A2RA 2V32A 2H6YA 4POMA 1ST9A 1U88A 1X9SB 1TRSA 3A3TA 1SKSB 1M2DA 1PQNA 3E0UA 4ID0A 5H5SA 4F9ZA 3EC3A 3GMFA 2Z9SA 1F37A 2R2JA 3QPMA 2IMEA 2C0DA 2NBSA 3L4NA 3FZ5A 4WF5A 5AGYA 4MJBA 2YJ7A 2B7KA 3L9VA 1FB0A 1URMA 3CBUA 2IMIA 3HVSA 1GRXA 2MMOA 3TCOA 4YH2A 3ZVJA 4MA9A 1EP7A 2YANA 3C1RA 2H19A 4XS4B 1B8XA 3CTFA 1SL2B 7GSSA 3C73A 4NV5A 1Z9HA 1ERUA 3F3QA 1TRWA 3V1WA 4J57E 1CQHA 2EIQA 1EGOA 2WJUA 1YZXA 4MABA 2XPDA 3A5WA 3GIXA 2FWEA 3M1GA 1V40A 1HNAA 4F2IA 1EP8A 1OE7A 5D9TA 2VL2A 3CRTA 1A8YA 2I9HA 1TDIA 5ECKB 1XCCA 1BQ7A 1EEMA 1M9AA 3QD9A 5EPFA 4G9HA 1I5GA 2WZ9A 1ACVA 1GUKA 2F8AA 1ZYEA 2B5YA 2O87A 5ECPB 3U5RE 5D9VA 3J7Yb 2ON5A 2FWGA 1VF3A 3M0FA 3L9UA 4BVYA 4HU7A 2DJ1A 1M2BA 5ECQB 1YKAA 4BWQA 2XBIA 2CX4A 1XOAA 3KMOA 4RUVA 2JZRA 2R6KA 3PINA 3HKRA 2AAWA 2XBQA 3G9BA 3M8NA 3L78A 3WT1A 1TTZA 2R4VA 2L6CA 4NHWA 18GSA 2K6VA 1B4QA 3EMPA 2KHPA 1GULA 1QK8A 4HQZA 3TKSA 1TJDA 2MBSA 2YV9A 4Q5NA 1N8JA 2X8GA 3QMXA 4TR1A 4KDUA 3O76A 1AQVA 3KH7A 3RPNA 5IM9A 1TW9A 2OBIA 2H1AA 5IO2A 4K0NA 4ECCA 5D9XA 2IMFA 3EU4A 1OC9A 1ERWA 5CREA 4PNGA 4YAVA 2OA7A 4KH7A 1G7OA 4O5RA 1ZZYA 3CSIA 3DEXA 3KP9A 1BG5A 4IW9A 3M9KA 4ZL8A 1WWJA 4MJCA 3IAM2 1ZYQB 2C3TA 3F3RA 4E8EA 1FOVA 4PGTA 5E59A 5G1LA 3TUEA 1YJ6A 5GZZB 5B6NA 3RHBA 3TJFA 2AHEA 1FAAA 2DC5A 3RPPA 2YWOA 5HQPA 2VLVA 2H72A 2N5BA 4TR1B 1SJ6A 2LKUA 1EOGA 2G0FA 4AJ7A 4NHZA 3KMNA 1K0OA 4L8EA 3S9FA 4RQXA 5IPHA 2HFDA 1OC9B 2C1YA 5A4UA 5JCUA 1BJXA 3HJPA 2WULA 3M9JA 1EWXA 5ECSA 3RHCA 4BA7A 3HY2A 2YWNA 1OYJA 3C7MA 3GX0A 4AF2A 1SJIA 4GF0A 3N5OA 2CA8A 1YF0A 4IELA 4L5OA 4ZIJA 4EVMA 2E2MA 1F6MC 1K0AA 3TDGA 4GLTA 2P0GA 1UA5A 1ABAA 5CO3A 1UC7A 5J4UA 1G0TA 4ZL7A 4I2TA 1ON4A 1OAZA 4LL4B 1T1VA 1XWGA 1PRXA 4IP6A 2GVPA 5C00A 5J9BA 3D0ZA 4GCIA 5ECLB 1F3BA 5JWOB 1O81A 1U6TA 4N11A 2P5RA 1K0BA 1JLVA 1DSBA 1YEXA 4OO5A 3L9SA 1SYXA 1PKZA 1GUHA 2REMA 3LJRA 4XS6A 3FEUA 5CAXA 1WPIA 1SL0B 14GSA 1DE2A 4V2LA 5HFKA 5F07A 3A2VA 1EV4A 4BPYA 1KEBA 3LWAA 5ID2B 4OFMA 3GA4A 1JHBA 1F2EA 1SK0A 4KE3A 4L0UA 2IJYA 2H1DA 4O92A 1A8LA 3AY8A 3UJ1A 2V6KA 1MEKA 1U3AA 2LTKA 3TKPA 4ECBA 5ENUA 4F0CA 3QOUA 2BMXA 3UBKA 3ZREA 4EUYA 1AQXA 4AGSA 5DAKA 2HYXA 5LD0A 6GSYA 1K0NA 4JR6A 2BJXA 3F0IA 1ZCPA 1GUMA 4O7HA 3CRUA 3G7IA 1BYEA 5C04A 2FCHA 2DJKA 1GLQA 2H30A 3E3EA 3KH9A 1GNWA 3QAWA 4TRXA 5JCGA 4JBBA 4EDZA 4PQ1A 2JU5A 2LNSA 4IN0A 2GZZA 5DVBA 1WMJA 2CV4A 1GH2A 1I9DA 4IP1A 2C8UA 3P7XA 4K1FA 3GFKA 3BJ5A 5ECOB 5EVOA 2GSRA 2CAIA 1R4WA 4CDOA 2LRNA 3TKSE 4QL9A 3HYPA 1PN9A 2F8FA 4XIHA 1GNEA 2YZHA 5DAKB 5KN2A 2QC7A 1EV9A 3ERFA 2WGRA 4K0GA 4PUFC 4DVCA 1T8EB 1ILOA 4FIWA 1GLPA 5EY6A 3VWXA 2I3YA 3WGEA 3APSA 2HT9A 1BAYA 2H76A 4MH2A 3F8UA 3HZ8A 1V9WA 4QL7A 2PMTA 5ABRA 2FWFA 2R3XA 2GGTA 2I81A 1WRYA 1PA3A 2HSHA 3VPQA 1XW9A 1ERTA 5B7CA 2VL3A 2ES7A 3IA1A 4K8MA 4L0WA 2YJHA 1A2MA 3ZYWA 4GQFA 1MDJA 1EZKA 3GX8A 2KOKA 2GLRA 1Z5YE 4HZ2A 2HXKA 4NAXA 3HZ4A 4MK3A 3TJKA 4XTSA 1X9MB 3DKSA 1USBA 2GZPA 1O6JA 4TVEA 5HR3A 2VIMA 5DQYA 3FHKA 5G31A 1EEJA 2JSZA 3QAVA 4XHMA 1LJRA 4FYBA 2ZCTA 5D93A 4GSSA 5A4VA 2DJ3A 5A5KA 3IR4A 1S3DA 2IL3A 5GAND 4ZILA 3Q74A 1T4YA 2B5EA 3I69A 4MZCA 4ZL9A 5IOWA 4ZBDA 3ZZXA 1AQWA 5CRDA 4DSRA 2IMKA 5F8BA 4EO3A 5G5FA 3MAKA 3WYWA 3DWVA 3LQ7A 1QQ2A 2E2GA 3TOTA 5H5QA 4MF6A 4BVXA 2DMMA 1XZOA 1T00A 3K8NA 3LORA 2H6ZA 3HXSA 3TRQA 2YN1A 3R2QA 5DALA 1TP9A 2N5FA 5G1KA 2VCXA 2OE0A 4L5LA 2VD0A 2GDRA 3DYRA 1X9WB 3ZFLA 2H01A 3BCIA 4NWYA 4ZBAA 4MPGA 3KJYA 5J41A 5F05A 2LEGA 2JZTA 1SD9A 1YKCA 2H1GA 5G5EA 4TW5A 3VFIA 3I43A 6GSWA 3SBCA 2C3NA 2B1LA 3QAGA 3WD6A 1TU8A 1UVZA 2L59A 3ZIJA 1N2AA 5DJLA 2ZUPA 1V2AA 2VCZA 1G6WA 4XS1A 2H75A 5COHA 1SYRA 2PPTA 5HR0A 1JZDA 2HRNA 5DALB 5E4WA 1JLWA 1ZL9A 3DXBA 3GURA 1XPVA 16GSA 3EVIA 1XWCA 2DSAA 5EL8A 1J0FA 2NTOA 1VGLA 3VWWA 1WIKA 1TOFA 5F06A 2LRTA 2YPMA 4V1Ap 4ZXGA 3IK9A 2YCDA 1W89A 2GQKA 5AN1A 1XW6A 1AC1A 1B4PA 4ZB6A 2DLXA 3GKNA 2DJJA 2DJ0A 1VF1A 4X0XA 2B3SA 3EURA 4I97A 3US3A 2QSIA 5AIVA 4OWYA 4LMWA
chains in the Genus database with same CATH superfamily
1THXA 4TOPA 3LXZA 1QMVA 2DIYA 1UN2A 4KAEA 3KTBA 5D8IA 4O5UA 4G2EA 4YKFA 19GSA 5HR1A 2P31A 2H1BA 2RUEA 3H93A 4PX1A 2L4QA 2MBTA 5J9CA 3SWLA 3IPZA 2KUCA 3D6IA 2OE1A 3LEFA 1TI1A 4XRDA 4POBA 4ILFA 2EC4A 3VI7A 2WFCA 4MMMA 5D73A 3DVWA 3IHQA 2VUPA 2E7PA 2LJKA 3UARA 4CW9A 5JCWA 1T3BA 2WS2A 2IN3A 3LXTA 4XCSA 4KGIA 1ZGNA 2HSYA 2DKIA 22GSA 5A4WA 1A2JA 3F4SA 9GSSA 1C72A 3FR6A 5CRHA 1BX9A 5G2ZA 1F3AA 1O85A 2DJ2A 3EPTA 1DUGA 2JSYA 2TRXA 2QKEA 4PXOA 8GSSA 1FB6A 4MP4A 5CP1A 2IMDA 1HD2A 1OE8A 3TGZA 4YQUA 4HUAA 1PMTA 2GZYA 2H66A 5KN3A 1QUWA 1SENA 3UL3A 2AB6A 4KUNA 1O8XA 2QGVA 2RUFA 1MDIA 2JL4A 4JE1A 4MH3A 3H1NA 2WRTA 3IV4A 3IBHA 3DRNA 1JZOA 2MZCA 1AW9A 1EGRA 1QXHA 4HI7A 4IKHA 3VWVA 3IK7A 3KCMA 3MSZA 5IMAA 3QDNA 2PVOC 4MCUA 5ECHB 3DIEA 4IS0A 2LJAA 4DSSA 4YAPA 1KNGA 5ECNB 2A4VA 1WP0A 3HD5A 2CZ2A 3LG6A 4V2MA 4WBRD 3A2WA 5ID2A 1YDKA 4J56E 5KOXA 2XHFA 4DSQA 3IC4A 2MMNA 1LU4A 4MZWA 1K3OA 2C0GA 4EC0A 2L5LA 2L4CA 2O8VB 4OMVA 3E9JB 3GTUB 4K5SA 3FZ4A 1FVJA 1GSDA 3P8WA 4ML6A 3FKFA 2IPAA 2M46A 1TXXA 1SKWB 2VL9A 4MJEA 1ERVA 1Z3EA 4USSA 2WB9A 2V6OA 3IDVA 2D2ZA 2HI7A 1ML6A 3ERWA 1F9MA 4WR5A 4IJIA 3HJOA 2V2GA 3C71A 2OADA 3BOAA 2C3QA 3RAZA 4OCFA 3KM6A 1HQOA 2KP1A 4GXZA 2HNLA 2PVQA 2LV3A 4I6XA 4A5PA 2CVDA 1GSYA 3APOA 4DSSB 5ELGA 4HSCX 4ZBBA 1SL1B 1V58A 5JWRB 4HJ2A 4POKA 3HVVA 5CRGA 4I5QA 4N0ZA 2RM6A 2G2QA 1H75A 2K18A 1IYHA 1ZMAA 3U6VA 2VL2C 1TI3A 4NMUA 2WDUA 2GQMA 1HYUA 3WGXA 3EMXA 3QCPA 2GTUA 3UOMA 2VOCA 5LNKe 5H5RA 3D21A 2VD1A 2CQ9A 1GSFA 4I2UA 4PNFA 2ZNMA 3FRCA 3F4TA 5DCGA 1A0RP 4NV2A 5AISA 2VAFA 3CXGA 6GSVA 4ICYA 5IPGA 4JEDA 4D73A 3GHAA 1GTUA 1XXUA 1A23A 4PQIA 4OFNA 3VURA 3LYPA 1XW5A 3TJGA 10GSA 4AJ8A 3TKSC 1EOHA 2B5XA 4OO4A 4WBJA 1G6YA 1E6BA 3ZIVA 5J3RA 1WOUA 2X8HA 4N30A 3VPTA 2YOIA 1T4ZA 1X5EA 1AXDA 2C0EA 2YV7A 2X49A 4BL7A 4TN8A 2TIRA 3W8SA 4K9ZA 3EWLA 2LNTA 2LSTA 2GSSA 4JR4A 1B9YC 2NPBA 1HNBA 5JWQB 1GWCA 4MF7A 2R0GA 1A0FA 5IMVA 3GKXA 4YQVA 3QFBC 2X99A 2JACA 2CVBA 3ME7A 3VK9A 1FG4A 2AUVA 2CZ3A 4D73B 2J23A 5INYA 1GTAA 1HNCA 5DQSA 3H79A 2CX3A 3EU3A 2EIRA 2MYGA 1KTEA 1BEDA 5L71A 2N5AA 5B6MA 4POLA 1Z6NA 2VLTA 3CSJA 3C1SA 4HEA2 3UVHA 4Z2TA 4ZB8A 1XOBA 3VI5A 2J9HA 1JZRA 4P3YB 3VLNA 4CHSA 3TB2A 1K3LA 3GL5A 2H74A 1ZYPA 5KN1A 4BL7B 1M7TA 1NSWA 2VCQA 2NVLA 4ULXA 1FO5A 3KXOA 5ECMB 4KSOA 5CNWA 3H8QA 3LYKA 1K3YA 1GSSA 4EIPA 4V1Ag 3HDCA 4Q5FA 2LS5A 4GTUA 5FHIA 3W6GA 3HCZA 1DBYA 1GP1A 2F3MA 3GN3A 1Y6EA 1R26A 2AJQB 3CYNA 2VM2A 2R5GA 3L0HA 5GSSA 3KEBA 5ELAA 1A2LA 3UBLA 4KNDA 2PBJA 2H0HA 2MMAA 2L6DA 2K9FA 3LSZA 4G0IA 4TR4A 4TXVA 5CYYA 1DE1A 3I6AA 3KGKA 3VWUA 1J08A 4X1UA 2V41A 1SK1A 1M3JA 1VF4A 1X5CA 3PGTA 4X43A 4KCAA 5IIZA 3ZFBA 1TKDB 4IVFA 1TRVA 3KIJA 2K8VA 1NHOA 5FWGA 4GRFA 1E2YA 1O73A 2H0GA 5J5NA 4IQ1A 4HU9A 3O6TA 1SKRB 2HLSA 2YP6A 3FYGA 4WEYA 5IO0A 3GH9A 2HZEA 3GSSA 2LUSA 5DJMA 3ZMKA 4EF0A 3HVXA 4ECIA 1MTCA 3DD3A 3TJBA 1TK0B 5GSTA 20GSA 3J7Yk 3UAPA 2AV4A 4WXTA 2A2SA 2I4AA 2OBKA 1XFLA 3UMAA 2LRCA 3APQA 3EYTA 1M9BA 2FUG2 2PERA 5IMCA 1PFOA 4RI7A 1Q4JA 3CTGA 4KB3A 5IOXA 3ZITA 3ME8A 2EIOA 3IRAA 3LFLA 1GSQA 2X8CA 4PTSA 4HDEA 3EINA 3NOFA 2NDOA 1RQMA 1XWBA 1GTIA 4GWRA 1OC3A 1PL1A 4X4JA 5IMZA 2RM5A 4HZ4A 2RIIA 4Q5RA 1PSQA 1FHEA 5D96A 3F63A 6GSXA 2HZEB 4G19A 2KP2A 3WGDA 5BRTA 1VRSD 3G7JA 2QA1A 3FR9A 2GSQA 1SU9A 4Z7XA 6GSSA 3LGCA 4WF4A 2FY6A 4F0BA 1FVKA 4RI6A 3CMIA 3MNGA 2ON7A 5ECIB 2YZUA 4IJ3A 3CSHA 2O89A 3NIVA 5HFGA 1H4OA 3KP8A 4F03A 4Z2RA 4KW6A 1AAZA 5IQYA 3W8JA 1TK5B 1NHYA 3ZLPA 1YQ1A 1PN0A 1B48A 2DKHA 2LQQA 5ECRB 1WE0A 4NXIA 4GQCA 4FH8A 3QFAC 3GH6A 2YNXA 4OCEA 5D9WA 12GSA 5KOWA 1XIYA 2O85A 4ML1A 1OKTA 1XVQA 4K7IA 4RQRA 3F9UA 3GYKA 3FY7A 2OKAA 1Z7RA 2JZSA 4HJMA 2M80A 4FQUA 1CQGA 4GSTA 4ACSA 1GL8A 4XRAA 3ZVJD 4WKWA 4LL1B 3DVXA 2CAQA 3TRPA 3D4MA 2O7KA 3GTUA 3R3EA 4K7NA 3GNJA 3Q6OA 13GSA 3A2XA 3TOUA 3MWHA 2MMZA 4K2DA 2PUKC 2FNOA 1Z6MA 4JU5A 2FHEA 3GRXA 4N0VA 1M3IA 4V2NA 4TXOA 1PX6A 5LCZA 4O5QA 3UIWA 1VF2A 1V57A 1XWKA 5BMUA 2C0FA 4F82A 2E0QA 4OD7A 4CY6A 2FWHA 2GS3A 2VO4A 2RLIA 3UEMA 3P90A 4TKYA 1O7UA 3F6DA 2PGTA 3D5JA 3CQFA 3GL3A 3RDWA 3ZL5A 4DEJA 1XWAA 5IMFA 1X0RA 4MNNA 3TJJA 3TKRA 2H6XA 1R7HA 3ERGA 5IMDA 2CT6A 2C80A 2HZFA 5CRWA 1PKWA 4YKGA 5FT3A 1Q98A 2HRFA 3GV1A 2I1UA 2VCTA 2VM1A 2JADA 1OKDA 1GSEA 2BTOT 5HFIA 2R37A 2OE3A 1U3IA 2X64A 1Z7PA 4TXOB 2WCIA 4PQHA 11GSA 3P2AA 3IXRA 1M0UA 1PL2A 3D22A 1OC8A 4JRRA 1M99A 3ZMLA 1MD3A 1QGVA 1GSUA 4WR4A 1TU7A 4G10A 2LQOA 1S3RA 1AIUA 1LBKA 4H86A 4TR3A 4EDYA 4KX4A 3TRXA 4LMVA 2TRCP 1PD21 3EE2A 5AIXA 4TR0A 3KD0A 4QQ7A 3Q19A 4FYCA 3FZAA 1V98A 4I8BA 3LW9A 4AJ6A 2HRAA 3N9JA 1TK8B 3H4KA 1RW1A 1R5PA 3JCML 3PR8A 4J2FA 1X5DA 1U87A 4YQMA 3WT2A 3GSTA 1MD4A 3G7YA 3KZQA 2LJRA 2L57A 2DMLA 1NM3A 1FW1A 6GSUA 4MZBA 1W4VA 4ZB9A 3UVTA 2PWJA 3OR5A 2H70A 1K0MA 3GKKA 1S3CA 3HA9A 2AYTA 3F6FA 3TKQA 4MPFA 2OJLA 4E8HA 1JFUA 2K8SA 2HE3A 4IQAA 2B7JA 4KSMA 1KBNA 4K5RA 6GSTA 3FR3A 1THOA 4GSNA 1K0CA 4KDXA 1O8WA 3F4RA 2YWMA 5DDLA 1XG8A 2H0IA 1GTBA 2VCVA 1MDKA 3IAS2 4KA0A 1RK4A 1T7PB 3IOSA 2DIZA 3Q18A 5B8BA 3IE3A 2IIYA 4WETA 4EXJA 2GT5A 4HS1A 4O32A 3DGQA 2IWTA 2B1KA 3KTLA 4FYUA 4KF9A 3BD2A 1PX7A 1Y25A 1S3AA 2VLUA 3ZTLA 4BWSA 4PUAA 2H71A 4K7OA 17GSA 4HOJA 4EKZA 1SD8A 3ZRDA 2B6MA 2CVKA 2GQLA 5GAPD 1TRUA 2FD3A 1YEPA 3ED3A 2PU9C 3GKMA 5DBQA 3HHVA 1JZWA 4ISDA 1B9XC 2FLSA 2IFQA 4MF5A 4IGJA 2C4JA 3FW2A 2L5OA 2XPEA 4N10A 2KLXA 4OFTA 1YF1A 1K0DA 3ISOA 4NPBA 4PURA 3I9V2 1AUCA 3MDKA 1NW2A 4IBPA 5DCHA 2F9SA 3HVNA 1OVNA 2FA8A 3FK8A 4KCEA 2VCWA 2F51A 2ALBA 4MDCA 1A24A 1XVWA 1G7EA 2XC2A 3DMLA 4EL1A 4KDYA 3PH9A 2FA4A 3BCKA 4ECJA 2YWIA 3NZNA 3O3TA 5B8AA 3M3MA 4Q5QA 1WJKA 2H73A 4HQSA 4MJAA 3BBYA 5F0GA 2UZ8A 3GUSA 3HJMA 2M72A 2OACA 2V1MA 5HR2A 4EE0A 4LA1A 2PN8A 4MLYA 2IFQB 1YY7A 4IHUA 5KEJA 3FZ9A 1R5AA 1XBSA 1QFNA 2H8LA 1IYIA 3QR6A 4LLRA 1J9BA 2GT6A 3C8EA 2P5QA 1M2AA 1SK2A 4XS4A 4JZQA 5G30A 1SJZA 2GSTA 5KN0A 4K6XA 2FGXA 3RBTA 1ZOFA 2DBCA 1PGTA 3D4TA 4FO5A 2A2RA 2V32A 2HSMA 2H6YA 4POMA 1ST9A 1U88A 1X9SB 1TRSA 3A3TA 1SKSB 1M2DA 1PQNA 3E0UA 1ZYNA 4ID0A 5H5SA 4F9ZA 3EC3A 3GMFA 2Z9SA 1F37A 2R2JA 3QPMA 2IMEA 2C0DA 2NBSA 3L4NA 4BIKA 3FZ5A 4WF5A 5AGYA 4MJBA 2YJ7A 2B7KA 3L9VA 1FB0A 1URMA 3CBUA 2IMIA 3HVSA 4K2XA 1GRXA 2MMOA 3TCOA 4YH2A 3ZVJA 4MA9A 1EP7A 2YANA 3C1RA 2H19A 4XS4B 1B8XA 3CTFA 1SL2B 7GSSA 3C73A 4NV5A 1Z9HA 1ERUA 3F3QA 1TRWA 3V1WA 4J57E 1CQHA 2EIQA 1EGOA 2WJUA 3FMWA 1YZXA 4MABA 2XPDA 3A5WA 3GIXA 2FWEA 3M1GA 1V40A 1HNAA 4F2IA 1EP8A 1OE7A 5D9TA 2VL2A 3CRTA 1A8YA 2I9HA 1TDIA 5ECKB 1XCCA 1BQ7A 1EEMA 1M9AA 3QD9A 5EPFA 4G9HA 1I5GA 2WZ9A 1ACVA 1GUKA 2F8AA 2R0PA 1ZYEA 2B5YA 2O87A 5ECPB 3U5RE 5D9VA 3J7Yb 2ON5A 2FWGA 1VF3A 3M0FA 3L9UA 4BVYA 4HU7A 2DJ1A 1M2BA 5ECQB 1YKAA 4BWQA 2XBIA 2CX4A 1XOAA 3KMOA 4RUVA 2JZRA 2R6KA 2HRKA 3PINA 3HKRA 2AAWA 2XBQA 3G9BA 3M8NA 3L78A 3WT1A 1TTZA 2R4VA 2L6CA 2R0CA 4NHWA 18GSA 2K6VA 1B4QA 3EMPA 2KHPA 1GULA 1QK8A 4HQZA 3TKSA 1TJDA 2MBSA 2YV9A 4Q5NA 1N8JA 2X8GA 3QMXA 4TR1A 4KDUA 3O76A 1AQVA 3KH7A 3RPNA 5IM9A 1TW9A 2OBIA 2H1AA 5IO2A 4K0NA 4EIQA 4ECCA 5D9XA 2IMFA 4BVYB 3EU4A 1OC9A 1ERWA 5CREA 4PNGA 4YAVA 2OA7A 4KH7A 1G7OA 4O5RA 1ZZYA 3CSIA 3DEXA 3KP9A 1BG5A 4IW9A 3M9KA 4ZL8A 1WWJA 4MJCA 3IAM2 1ZYQB 2C3TA 3F3RA 4E8EA 1FOVA 4PGTA 5E59A 5G1LA 3TUEA 1YJ6A 5GZZB 5B6NA 3RHBA 3TJFA 2AHEA 1FAAA 2DC5A 3RPPA 2YWOA 5HQPA 2VLVA 2H72A 2N5BA 4TR1B 1SJ6A 2LKUA 1EOGA 2G0FA 4AJ7A 4NHZA 3KMNA 1K0OA 4L8EA 3S9FA 4RQXA 5IPHA 2HFDA 1OC9B 2C1YA 5A4UA 5JCUA 1BJXA 3HJPA 2WULA 3M9JA 1EWXA 5ECSA 3RHCA 4BA7A 3HY2A 2YWNA 1OYJA 3C7MA 3GX0A 4AF2A 1SJIA 4GF0A 3N5OA 2CA8A 1YF0A 4IELA 4L5OA 4ZIJA 4EVMA 2E2MA 1F6MC 1K0AA 3TDGA 4GLTA 2P0GA 1UA5A 1ABAA 5CO3A 1UC7A 5J4UA 1G0TA 4ZL7A 4I2TA 1ON4A 1OAZA 4LL4B 1T1VA 2A4HA 1XWGA 1PRXA 4IP6A 2GVPA 5C00A 5J9BA 3D0ZA 4GCIA 5ECLB 4CY8A 1F3BA 5JWOB 1O81A 1U6TA 4N11A 2P5RA 1K0BA 1JLVA 1DSBA 1YEXA 4OO5A 3L9SA 1SYXA 1PKZA 1GUHA 2REMA 3LJRA 4XS6A 3FEUA 5CAXA 1WPIA 1SL0B 14GSA 1DE2A 4V2LA 5HFKA 5F07A 3A2VA 2X4AA 1EV4A 4BPYA 1KEBA 3LWAA 5ID2B 4OFMA 3GA4A 1JHBA 1F2EA 1SK0A 4KE3A 4L0UA 2IJYA 2H1DA 4O92A 1A8LA 3AY8A 3UJ1A 2V6KA 1MEKA 1U3AA 2LTKA 3TKPA 4ECBA 5ENUA 4F0CA 3QOUA 2BMXA 3UBKA 3ZREA 4EUYA 1AQXA 4AGSA 4Z2UA 5DAKA 2HYXA 5LD0A 6GSYA 1K0NA 4JR6A 2BJXA 3F0IA 1ZCPA 1GUMA 4O7HA 3CRUA 3G7IA 1BYEA 5C04A 2FCHA 2DJKA 1GLQA 2H30A 3E3EA 3KH9A 1FOHA 1GNWA 3QAWA 4TRXA 5JCGA 4JBBA 4EDZA 4PQ1A 2JU5A 2LNSA 4IN0A 2GZZA 5DVBA 1WMJA 2CV4A 1GH2A 1I9DA 4IP1A 2C8UA 3P7XA 4K1FA 3GFKA 3BJ5A 5ECOB 5EVOA 2GSRA 2CAIA 1R4WA 4CDOA 2LRNA 3TKSE 4QL9A 3HYPA 1PN9A 2F8FA 4XIHA 1GNEA 2YZHA 5DAKB 5KN2A 2QC7A 1EV9A 3ERFA 2WGRA 4K0GA 4PUFC 4DVCA 1T8EB 1ILOA 4FIWA 1GLPA 5EY6A 3VWXA 2I3YA 3WGEA 3APSA 2HT9A 1BAYA 2H76A 4MH2A 3F8UA 3HZ8A 1V9WA 4QL7A 2PMTA 5ABRA 2FWFA 2R3XA 2GGTA 2I81A 1WRYA 1PA3A 2HSHA 3VPQA 1XW9A 1ERTA 5B7CA 2VL3A 2ES7A 3IA1A 4K8MA 4L0WA 2YJHA 1A2MA 3ZYWA 4GQFA 1MDJA 1EZKA 3GX8A 2KOKA 2GLRA 1Z5YE 4HZ2A 2HXKA 4NAXA 3HZ4A 3MYDA 4MK3A 3TJKA 4XTSA 1X9MB 3DKSA 1USBA 2GZPA 1O6JA 4TVEA 5HR3A 2VIMA 5DQYA 3FHKA 5G31A 2QA2A 1EEJA 2JSZA 3QAVA 4XHMA 1LJRA 4FYBA 2ZCTA 5D93A 4GSSA 5A4VA 2DJ3A 5A5KA 3IR4A 1S3DA 2IL3A 5GAND 4ZILA 3Q74A 1T4YA 2B5EA 3I69A 4MZCA 4ZL9A 4G0KA 5IOWA 4ZBDA 3ZZXA 1AQWA 5CRDA 4DSRA 2IMKA 5F8BA 4EO3A 5G5FA 3MAKA 3WYWA 3DWVA 3LQ7A 1QQ2A 2E2GA 3TOTA 5H5QA 4MF6A 4BVXA 2DMMA 2A2PA 1XZOA 1T00A 3K8NA 3LORA 2H6ZA 3HXSA 3TRQA 2YN1A 3R2QA 5DALA 1TP9A 2N5FA 5G1KA 2VCXA 2OE0A 4L5LA 2VD0A 2GDRA 3DYRA 1X9WB 3ZFLA 2H01A 3BCIA 4NWYA 4ZBAA 4MPGA 3KJYA 3IC8A 5J41A 4G0LA 5F05A 2LEGA 2JZTA 1SD9A 1YKCA 2H1GA 5G5EA 4TW5A 3VFIA 3I43A 6GSWA 3SBCA 2C3NA 2B1LA 3QAGA 3WD6A 1TU8A 1UVZA 2L59A 3ZIJA 1N2AA 5DJLA 2ZUPA 1V2AA 2VCZA 4BVXB 3MIXA 1G6WA 4XS1A 3PPUA 2H75A 5COHA 1SYRA 2PPTA 5HR0A 1JZDA 2HRNA 5DALB 5E4WA 1JLWA 1ZL9A 3DXBA 3GURA 1XPVA 16GSA 3EVIA 1XWCA 2DSAA 5EL8A 1J0FA 2NTOA 1VGLA 3VWWA 1WIKA 1TOFA 5F06A 2LRTA 2YPMA 4V1Ap 4ZXGA 3IK9A 2YCDA 1W89A 2GQKA 5AN1A 1XW6A 1AC1A 3A5IA 1B4PA 4ZB6A 2DLXA 3GKNA 2DJJA 2DJ0A 1VF1A 4X0XA 2B3SA 3EURA 4I97A 3US3A 2QSIA 5AIVA 4OWYA 4LMWA 3IHGA
chains in the Genus database with same CATH topology
1THXA 4TOPA 3LXZA 1QMVA 2DIYA 1UN2A 4KAEA 3KTBA 5D8IA 4O5UA 4G2EA 4YKFA 19GSA 5HR1A 2P31A 2H1BA 2RUEA 3H93A 4PX1A 2L4QA 2MBTA 5J9CA 3SWLA 3IPZA 2KUCA 3D6IA 2OE1A 3LEFA 1TI1A 4XRDA 4POBA 4ILFA 2EC4A 3VI7A 2WFCA 4MMMA 5D73A 3DVWA 3IHQA 2VUPA 2E7PA 2LJKA 3UARA 4CW9A 5JCWA 1T3BA 2WS2A 2IN3A 3LXTA 4XCSA 4KGIA 1ZGNA 2HSYA 2DKIA 22GSA 5A4WA 1A2JA 3F4SA 9GSSA 1C72A 3FR6A 5CRHA 1BX9A 5G2ZA 1F3AA 1O85A 2DJ2A 3EPTA 1DUGA 2JSYA 2TRXA 2QKEA 4PXOA 8GSSA 1FB6A 4MP4A 5CP1A 2IMDA 1HD2A 1OE8A 3TGZA 4YQUA 4HUAA 1PMTA 2GZYA 2H66A 5KN3A 1QUWA 1SENA 3UL3A 2AB6A 4KUNA 1O8XA 2QGVA 2RUFA 1MDIA 2JL4A 4JE1A 4MH3A 3H1NA 2WRTA 3IV4A 3IBHA 3DRNA 1JZOA 2MZCA 1AW9A 1EGRA 1QXHA 4HI7A 4IKHA 3VWVA 3IK7A 3KCMA 3MSZA 5IMAA 3QDNA 2PVOC 4MCUA 5ECHB 3DIEA 4IS0A 2LJAA 4DSSA 4YAPA 1KNGA 5ECNB 2A4VA 1WP0A 3HD5A 2CZ2A 3LG6A 4V2MA 4WBRD 3A2WA 5ID2A 1YDKA 4J56E 5KOXA 2XHFA 4DSQA 3IC4A 2MMNA 1LU4A 4MZWA 1K3OA 2C0GA 4EC0A 2L5LA 2L4CA 2O8VB 4OMVA 3E9JB 3GTUB 4K5SA 3FZ4A 1FVJA 1GSDA 3P8WA 4ML6A 3FKFA 2IPAA 2M46A 1TXXA 1SKWB 2VL9A 4MJEA 1ERVA 1Z3EA 4USSA 2WB9A 2V6OA 3IDVA 2D2ZA 2HI7A 1ML6A 3ERWA 1F9MA 4WR5A 4IJIA 3HJOA 2V2GA 3C71A 2OADA 3BOAA 2C3QA 3RAZA 4OCFA 3KM6A 1HQOA 2KP1A 4GXZA 2HNLA 2PVQA 2LV3A 4I6XA 4A5PA 2CVDA 1GSYA 3APOA 4DSSB 5ELGA 4ZBBA 1SL1B 1V58A 5JWRB 4HJ2A 4POKA 3HVVA 5CRGA 4I5QA 4N0ZA 2RM6A 2G2QA 1H75A 2K18A 1IYHA 1ZMAA 3U6VA 2VL2C 1TI3A 4NMUA 2WDUA 2GQMA 1HYUA 3WGXA 3EMXA 3QCPA 2GTUA 3UOMA 2VOCA 5LNKe 5H5RA 3D21A 2VD1A 2CQ9A 1GSFA 4I2UA 4PNFA 2ZNMA 3FRCA 3F4TA 5DCGA 1A0RP 4NV2A 5AISA 2VAFA 3CXGA 6GSVA 4ICYA 5IPGA 4JEDA 4D73A 3GHAA 1GTUA 1XXUA 1A23A 4PQIA 4OFNA 3VURA 3LYPA 1XW5A 3TJGA 10GSA 4AJ8A 3TKSC 1EOHA 2B5XA 4OO4A 4WBJA 1G6YA 1E6BA 3ZIVA 5J3RA 1WOUA 2X8HA 4N30A 3VPTA 2YOIA 1T4ZA 1X5EA 1AXDA 2C0EA 2YV7A 2X49A 4BL7A 4TN8A 2TIRA 3W8SA 4K9ZA 3EWLA 2LNTA 2LSTA 2GSSA 4JR4A 1B9YC 2NPBA 1HNBA 5JWQB 1GWCA 4MF7A 2R0GA 1A0FA 5IMVA 3GKXA 4YQVA 3QFBC 2X99A 2JACA 2CVBA 3ME7A 3VK9A 1FG4A 2AUVA 2CZ3A 4D73B 2J23A 5INYA 1GTAA 1HNCA 5DQSA 3H79A 2CX3A 3EU3A 2EIRA 2MYGA 1KTEA 1BEDA 5L71A 2N5AA 5B6MA 4POLA 1Z6NA 2VLTA 3CSJA 3C1SA 4HEA2 3UVHA 4Z2TA 4ZB8A 1XOBA 3VI5A 2J9HA 1JZRA 4P3YB 3VLNA 4CHSA 3TB2A 1K3LA 3GL5A 2H74A 1ZYPA 5KN1A 4BL7B 1M7TA 1NSWA 2VCQA 2NVLA 4ULXA 1FO5A 3KXOA 5ECMB 4KSOA 5CNWA 3H8QA 3LYKA 1K3YA 1GSSA 4EIPA 4V1Ag 3HDCA 4Q5FA 2LS5A 4GTUA 5FHIA 3W6GA 3HCZA 1DBYA 1GP1A 2F3MA 3GN3A 1Y6EA 1R26A 2AJQB 3CYNA 2VM2A 2R5GA 3L0HA 5GSSA 3KEBA 5ELAA 1A2LA 3UBLA 4KNDA 2PBJA 2H0HA 2MMAA 2L6DA 2K9FA 3LSZA 4G0IA 4TR4A 4TXVA 5CYYA 1DE1A 3I6AA 3KGKA 3VWUA 1J08A 4X1UA 2V41A 1SK1A 1VF4A 1X5CA 3PGTA 4X43A 4KCAA 5IIZA 3ZFBA 1TKDB 4IVFA 1TRVA 3KIJA 2K8VA 1NHOA 5FWGA 4GRFA 1E2YA 1O73A 2H0GA 5J5NA 4IQ1A 4HU9A 3O6TA 1SKRB 2HLSA 2YP6A 3FYGA 4WEYA 5IO0A 3GH9A 2HZEA 3GSSA 2LUSA 5DJMA 3ZMKA 4EF0A 3HVXA 4ECIA 1MTCA 3DD3A 3TJBA 1TK0B 5GSTA 20GSA 3J7Yk 3UAPA 2AV4A 4WXTA 2A2SA 2I4AA 2OBKA 1XFLA 3UMAA 2LRCA 3APQA 3EYTA 1M9BA 2FUG2 2PERA 5IMCA 4RI7A 1Q4JA 3CTGA 4KB3A 5IOXA 3ZITA 3ME8A 2EIOA 3IRAA 3LFLA 1GSQA 2X8CA 4PTSA 4HDEA 3EINA 3NOFA 2NDOA 1RQMA 1XWBA 1GTIA 4GWRA 1OC3A 1PL1A 4X4JA 5IMZA 2RM5A 4HZ4A 2RIIA 4Q5RA 1PSQA 1FHEA 5D96A 3F63A 6GSXA 2HZEB 4G19A 2KP2A 3WGDA 5BRTA 1VRSD 3G7JA 2QA1A 3FR9A 2GSQA 1SU9A 4Z7XA 6GSSA 3LGCA 4WF4A 2FY6A 4F0BA 1FVKA 4RI6A 3CMIA 3MNGA 2ON7A 5ECIB 2YZUA 4IJ3A 3CSHA 2O89A 3NIVA 5HFGA 1H4OA 3KP8A 4F03A 4Z2RA 4KW6A 1AAZA 5IQYA 3W8JA 1TK5B 1NHYA 3ZLPA 1YQ1A 1PN0A 1B48A 2DKHA 2LQQA 5ECRB 1WE0A 4NXIA 4GQCA 4FH8A 3QFAC 3GH6A 2YNXA 4OCEA 5D9WA 12GSA 5KOWA 1XIYA 2O85A 4ML1A 1OKTA 1XVQA 4K7IA 4RQRA 3F9UA 3GYKA 3FY7A 2OKAA 1Z7RA 2JZSA 4HJMA 2M80A 4FQUA 1CQGA 4GSTA 4ACSA 1GL8A 4XRAA 3ZVJD 4WKWA 4LL1B 3DVXA 2CAQA 3TRPA 3D4MA 2O7KA 3GTUA 3R3EA 4K7NA 3GNJA 3Q6OA 13GSA 3A2XA 3TOUA 3MWHA 2MMZA 4K2DA 2PUKC 2FNOA 1Z6MA 4JU5A 2FHEA 3GRXA 4N0VA 4V2NA 4TXOA 1PX6A 5LCZA 4O5QA 3UIWA 1VF2A 1V57A 1XWKA 5BMUA 2C0FA 4F82A 2E0QA 4OD7A 4CY6A 2FWHA 2GS3A 2VO4A 2RLIA 3UEMA 3P90A 4TKYA 1O7UA 3F6DA 2PGTA 3D5JA 3GL3A 3RDWA 3ZL5A 4DEJA 1XWAA 5IMFA 1X0RA 4MNNA 3TJJA 3TKRA 2H6XA 1R7HA 3ERGA 5IMDA 2CT6A 2C80A 2HZFA 5CRWA 1PKWA 4YKGA 5FT3A 1Q98A 2HRFA 3GV1A 2I1UA 2VCTA 2VM1A 2JADA 1OKDA 1GSEA 2BTOT 5HFIA 2R37A 2OE3A 1U3IA 2X64A 1Z7PA 4TXOB 2WCIA 4PQHA 11GSA 3P2AA 3IXRA 1M0UA 1PL2A 3D22A 1OC8A 4JRRA 1M99A 3ZMLA 1MD3A 1QGVA 1GSUA 4WR4A 1TU7A 4G10A 2LQOA 1AIUA 1LBKA 4H86A 4TR3A 4EDYA 4KX4A 3TRXA 4LMVA 2TRCP 1PD21 3EE2A 5AIXA 4TR0A 3KD0A 4QQ7A 3Q19A 4FYCA 3FZAA 1V98A 4I8BA 3LW9A 4AJ6A 2HRAA 3N9JA 1TK8B 3H4KA 1RW1A 1R5PA 3JCML 3PR8A 4J2FA 1X5DA 1U87A 4YQMA 3WT2A 3GSTA 1MD4A 3G7YA 3KZQA 2LJRA 2L57A 2DMLA 1NM3A 1FW1A 6GSUA 4MZBA 1W4VA 4ZB9A 3UVTA 2PWJA 3OR5A 2H70A 1K0MA 3GKKA 1S3CA 3HA9A 2AYTA 3F6FA 3TKQA 4MPFA 2OJLA 4E8HA 1JFUA 2K8SA 2HE3A 4IQAA 2B7JA 4KSMA 1KBNA 4K5RA 6GSTA 3FR3A 1THOA 4GSNA 1K0CA 4KDXA 1O8WA 3F4RA 2YWMA 5DDLA 2H0IA 1GTBA 2VCVA 1MDKA 3IAS2 4KA0A 1RK4A 1T7PB 3IOSA 2DIZA 3Q18A 5B8BA 3IE3A 2IIYA 4WETA 4EXJA 2GT5A 4HS1A 4O32A 3DGQA 2IWTA 2B1KA 3KTLA 4FYUA 4KF9A 3BD2A 1PX7A 1Y25A 1S3AA 2VLUA 3ZTLA 4BWSA 4PUAA 2H71A 4K7OA 17GSA 4HOJA 4EKZA 1SD8A 3ZRDA 2B6MA 2CVKA 2GQLA 5GAPD 1TRUA 2FD3A 1YEPA 3ED3A 2PU9C 3GKMA 5DBQA 3HHVA 1JZWA 4ISDA 1B9XC 2FLSA 2IFQA 4MF5A 4IGJA 2C4JA 3FW2A 2L5OA 2XPEA 4N10A 2KLXA 4OFTA 1YF1A 1K0DA 3ISOA 4NPBA 4PURA 3I9V2 1AUCA 3MDKA 1NW2A 4IBPA 5DCHA 2F9SA 1OVNA 2FA8A 3FK8A 4KCEA 2VCWA 2F51A 2ALBA 4MDCA 1A24A 1XVWA 1G7EA 2XC2A 3DMLA 4EL1A 4KDYA 3PH9A 2FA4A 3BCKA 4ECJA 2YWIA 3NZNA 3O3TA 5B8AA 3M3MA 4Q5QA 1WJKA 2H73A 4HQSA 4MJAA 3BBYA 5F0GA 2UZ8A 3GUSA 3HJMA 2M72A 2OACA 2V1MA 5HR2A 4EE0A 4LA1A 2PN8A 4MLYA 2IFQB 1YY7A 4IHUA 5KEJA 3FZ9A 1R5AA 1XBSA 1QFNA 2H8LA 1IYIA 3QR6A 4LLRA 1J9BA 2GT6A 3C8EA 2P5QA 1M2AA 1SK2A 4XS4A 4JZQA 5G30A 1SJZA 2GSTA 5KN0A 4K6XA 2FGXA 3RBTA 1ZOFA 2DBCA 1PGTA 3D4TA 4FO5A 2A2RA 2V32A 2HSMA 2H6YA 4POMA 1ST9A 1U88A 1X9SB 1TRSA 3A3TA 1SKSB 1M2DA 1PQNA 3E0UA 1ZYNA 4ID0A 5H5SA 4F9ZA 3EC3A 3GMFA 2Z9SA 1F37A 2R2JA 3QPMA 2IMEA 2C0DA 2NBSA 3L4NA 3FZ5A 4WF5A 5AGYA 4MJBA 2YJ7A 2B7KA 3L9VA 1FB0A 1URMA 3CBUA 2IMIA 3HVSA 4K2XA 1GRXA 2MMOA 3TCOA 4YH2A 3ZVJA 4MA9A 1EP7A 2YANA 3C1RA 2H19A 4XS4B 1B8XA 3CTFA 1SL2B 7GSSA 3C73A 4NV5A 1Z9HA 1ERUA 3F3QA 1TRWA 3V1WA 4J57E 1CQHA 2EIQA 1EGOA 2WJUA 3FMWA 1YZXA 4MABA 2XPDA 3A5WA 3GIXA 2FWEA 3M1GA 1V40A 1HNAA 4F2IA 1EP8A 1OE7A 5D9TA 2VL2A 3CRTA 1A8YA 2I9HA 1TDIA 5ECKB 1XCCA 1BQ7A 1EEMA 1M9AA 3QD9A 5EPFA 4G9HA 1I5GA 2WZ9A 1ACVA 1GUKA 2F8AA 2R0PA 1ZYEA 2B5YA 2O87A 5ECPB 3U5RE 5D9VA 3J7Yb 2ON5A 2FWGA 1VF3A 3M0FA 3L9UA 4BVYA 4HU7A 2DJ1A 1M2BA 5ECQB 1YKAA 4BWQA 2XBIA 2CX4A 1XOAA 3KMOA 4RUVA 2JZRA 2R6KA 2HRKA 3PINA 3HKRA 2AAWA 2XBQA 3G9BA 3M8NA 3L78A 3WT1A 1TTZA 2R4VA 2L6CA 2R0CA 4NHWA 18GSA 2K6VA 1B4QA 3EMPA 2KHPA 1GULA 1QK8A 4HQZA 3TKSA 1TJDA 2MBSA 2YV9A 4Q5NA 1N8JA 2X8GA 3QMXA 4TR1A 4KDUA 3O76A 1AQVA 3KH7A 3RPNA 5IM9A 1TW9A 2OBIA 2H1AA 5IO2A 4K0NA 4EIQA 4ECCA 5D9XA 2IMFA 4BVYB 3EU4A 1OC9A 1ERWA 5CREA 4PNGA 4YAVA 2OA7A 4KH7A 1G7OA 4O5RA 1ZZYA 3CSIA 3DEXA 3KP9A 1BG5A 4IW9A 3M9KA 4ZL8A 1WWJA 4MJCA 3IAM2 1ZYQB 2C3TA 3F3RA 4E8EA 1FOVA 4PGTA 5E59A 5G1LA 3TUEA 1YJ6A 5GZZB 5B6NA 3RHBA 3TJFA 2AHEA 1FAAA 2DC5A 3RPPA 2YWOA 5HQPA 2VLVA 2H72A 2N5BA 4TR1B 1SJ6A 2LKUA 1EOGA 2G0FA 4AJ7A 4NHZA 3KMNA 1K0OA 4L8EA 3S9FA 4RQXA 5IPHA 2HFDA 1OC9B 2C1YA 5A4UA 5JCUA 1BJXA 3HJPA 2WULA 3M9JA 1EWXA 5ECSA 3RHCA 4BA7A 3HY2A 2YWNA 1OYJA 3C7MA 3GX0A 4AF2A 1SJIA 4GF0A 3N5OA 2CA8A 1YF0A 4IELA 4L5OA 4ZIJA 4EVMA 2E2MA 1F6MC 1K0AA 3TDGA 4GLTA 2P0GA 1UA5A 1ABAA 5CO3A 1UC7A 5J4UA 1G0TA 4ZL7A 4I2TA 1ON4A 1OAZA 4LL4B 1T1VA 2A4HA 1XWGA 1PRXA 4IP6A 2GVPA 5C00A 5J9BA 3D0ZA 4GCIA 5ECLB 4CY8A 1F3BA 5JWOB 1O81A 1U6TA 4N11A 2P5RA 1K0BA 1JLVA 1DSBA 1YEXA 4OO5A 3L9SA 1SYXA 1PKZA 1GUHA 2REMA 3LJRA 4XS6A 3FEUA 5CAXA 1WPIA 1SL0B 14GSA 1DE2A 4V2LA 5HFKA 5F07A 3A2VA 2X4AA 1EV4A 4BPYA 1KEBA 3LWAA 5ID2B 4OFMA 3GA4A 1JHBA 1F2EA 1SK0A 4KE3A 4L0UA 2IJYA 2H1DA 4O92A 1A8LA 3AY8A 3UJ1A 2V6KA 1MEKA 1U3AA 2LTKA 3TKPA 4ECBA 5ENUA 4F0CA 3QOUA 2BMXA 3UBKA 3ZREA 4EUYA 1AQXA 4AGSA 4Z2UA 5DAKA 2HYXA 5LD0A 6GSYA 1K0NA 4JR6A 2BJXA 3F0IA 1ZCPA 1GUMA 4O7HA 3CRUA 3G7IA 1BYEA 5C04A 2FCHA 2DJKA 1GLQA 2H30A 3E3EA 3KH9A 1FOHA 1GNWA 3QAWA 4TRXA 5JCGA 4JBBA 4EDZA 4PQ1A 2JU5A 2LNSA 4IN0A 2GZZA 5DVBA 1WMJA 2CV4A 1GH2A 1I9DA 4IP1A 2C8UA 3P7XA 4K1FA 3GFKA 3BJ5A 5ECOB 5EVOA 2GSRA 2CAIA 1R4WA 4CDOA 2LRNA 3TKSE 4QL9A 3HYPA 1PN9A 2F8FA 4XIHA 1GNEA 2YZHA 5DAKB 5KN2A 2QC7A 1EV9A 3ERFA 2WGRA 4K0GA 4PUFC 4DVCA 1T8EB 1ILOA 4FIWA 1GLPA 5EY6A 3VWXA 2I3YA 3WGEA 3APSA 2HT9A 1BAYA 2H76A 4MH2A 3F8UA 3HZ8A 1V9WA 4QL7A 2PMTA 5ABRA 2FWFA 2R3XA 2GGTA 2I81A 1WRYA 1PA3A 2HSHA 3VPQA 1XW9A 1ERTA 5B7CA 2VL3A 2ES7A 3IA1A 4K8MA 4L0WA 2YJHA 1A2MA 3ZYWA 4GQFA 1MDJA 1EZKA 3GX8A 2KOKA 2GLRA 1Z5YE 4HZ2A 2HXKA 4NAXA 3HZ4A 3MYDA 4MK3A 3TJKA 4XTSA 1X9MB 3DKSA 1USBA 2GZPA 1O6JA 4TVEA 5HR3A 2VIMA 5DQYA 3FHKA 5G31A 2QA2A 1EEJA 2JSZA 3QAVA 4XHMA 1LJRA 4FYBA 2ZCTA 5D93A 4GSSA 5A4VA 2DJ3A 5A5KA 3IR4A 1S3DA 2IL3A 5GAND 4ZILA 3Q74A 1T4YA 2B5EA 3I69A 4MZCA 4ZL9A 4G0KA 5IOWA 4ZBDA 3ZZXA 1AQWA 5CRDA 4DSRA 2IMKA 5F8BA 4EO3A 5G5FA 3MAKA 3WYWA 3DWVA 3LQ7A 1QQ2A 2E2GA 3TOTA 5H5QA 4MF6A 4BVXA 2DMMA 2A2PA 1XZOA 1T00A 3K8NA 3LORA 2H6ZA 3HXSA 3TRQA 2YN1A 3R2QA 5DALA 1TP9A 2N5FA 5G1KA 2VCXA 2OE0A 4L5LA 2VD0A 2GDRA 3DYRA 1X9WB 3ZFLA 2H01A 3BCIA 4NWYA 4ZBAA 4MPGA 3KJYA 3IC8A 5J41A 4G0LA 5F05A 2LEGA 2JZTA 1SD9A 1YKCA 2H1GA 5G5EA 4TW5A 3VFIA 3I43A 6GSWA 3SBCA 2C3NA 2B1LA 3QAGA 3WD6A 1TU8A 1UVZA 2L59A 3ZIJA 1N2AA 5DJLA 2ZUPA 1V2AA 2VCZA 4BVXB 3MIXA 1G6WA 4XS1A 3PPUA 2H75A 5COHA 1SYRA 2PPTA 5HR0A 1JZDA 2HRNA 5DALB 5E4WA 1JLWA 1ZL9A 3DXBA 3GURA 1XPVA 16GSA 3EVIA 1XWCA 2DSAA 5EL8A 1J0FA 2NTOA 1VGLA 3VWWA 1WIKA 1TOFA 5F06A 2LRTA 2YPMA 4V1Ap 4ZXGA 3IK9A 2YCDA 1W89A 2GQKA 5AN1A 1XW6A 1AC1A 3A5IA 1B4PA 4ZB6A 2DLXA 3GKNA 2DJJA 2DJ0A 1VF1A 4X0XA 2B3SA 3EURA 4I97A 3US3A 2QSIA 5AIVA 4OWYA 4LMWA 3IHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1THX A;  4TOP A;  3LXZ A;  1QMV A;  2DIY A;  1UN2 A;  4KAE A;  3KTB A;  5D8I A;  4G2E A;  19GS A;  5HR1 A;  2P31 A;  2H1B A;  2RUE A;  3H93 A;  4PX1 A;  2L4Q A;  2MBT A;  5J9C A;  3SWL A;  3IPZ A;  2KUC A;  3D6I A;  2OE1 A;  3LEF A;  1TI1 A;  4XRD A;  4POB A;  4ILF A;  2EC4 A;  3VI7 A;  2WFC A;  4MMM A;  5D73 A;  3DVW A;  3IHQ A;  2VUP A;  2E7P A;  2LJK A;  3UAR A;  4CW9 A;  5JCW A;  1T3B A;  2WS2 A;  2IN3 A;  3LXT A;  4XCS A;  4KGI A;  1ZGN A;  2HSY A;  22GS A;  5A4W A;  1A2J A;  3F4S A;  9GSS A;  1C72 A;  3FR6 A;  5CRH A;  1BX9 A;  5G2Z A;  1F3A A;  1O85 A;  2DJ2 A;  1DUG A;  2JSY A;  2TRX A;  2QKE A;  4PXO A;  8GSS A;  1FB6 A;  4MP4 A;  5CP1 A;  2IMD A;  1HD2 A;  1OE8 A;  3TGZ A;  4YQU A;  4HUA A;  1PMT A;  2GZY A;  2H66 A;  5KN3 A;  1QUW A;  1SEN A;  3UL3 A;  2AB6 A;  4KUN A;  1O8X A;  2QGV A;  2RUF A;  1MDI A;  2JL4 A;  4JE1 A;  4MH3 A;  3H1N A;  2WRT A;  3IV4 A;  3IBH A;  3DRN A;  1JZO A;  2MZC A;  1AW9 A;  1EGR A;  1QXH A;  4HI7 A;  4IKH A;  3VWV A;  3IK7 A;  3KCM A;  3MSZ A;  5IMA A;  3QDN A;  2PVO C;  4MCU A;  5ECH B;  3DIE A;  4IS0 A;  2LJA A;  4DSS A;  4YAP A;  1KNG A;  5ECN B;  2A4V A;  1WP0 A;  3HD5 A;  2CZ2 A;  3LG6 A;  4V2M A;  4WBR D;  3A2W A;  5ID2 A;  1YDK A;  4J56 E;  2XHF A;  4DSQ A;  3IC4 A;  2MMN A;  1LU4 A;  4MZW A;  1K3O A;  2C0G A;  4EC0 A;  2L5L A;  2L4C A;  2O8V B;  4OMV A;  3E9J B;  3GTU B;  3FZ4 A;  1FVJ A;  1GSD A;  3P8W A;  4ML6 A;  3FKF A;  2IPA A;  2M46 A;  1TXX A;  1SKW B;  2VL9 A;  4MJE A;  1ERV A;  1Z3E A;  2WB9 A;  2V6O A;  3IDV A;  2D2Z A;  2HI7 A;  1ML6 A;  3ERW A;  1F9M A;  4WR5 A;  4IJI A;  3HJO A;  2V2G A;  3C71 A;  2OAD A;  3BOA A;  2C3Q A;  3RAZ A;  4OCF A;  3KM6 A;  1HQO A;  2KP1 A;  4GXZ A;  2HNL A;  2PVQ A;  2LV3 A;  4I6X A;  2CVD A;  1GSY A;  3APO A;  4DSS B;  5ELG A;  4ZBB A;  1SL1 B;  1V58 A;  5JWR B;  4HJ2 A;  4POK A;  3HVV A;  5CRG A;  4I5Q A;  4N0Z A;  2RM6 A;  2G2Q A;  1H75 A;  2K18 A;  1IYH A;  1ZMA A;  3U6V A;  2VL2 C;  1TI3 A;  4NMU A;  2WDU A;  2GQM A;  1HYU A;  3WGX A;  3EMX A;  3QCP A;  2GTU A;  3UOM A;  2VOC A;  5LNK e;  5H5R A;  3D21 A;  2VD1 A;  2CQ9 A;  1GSF A;  4I2U A;  4PNF A;  2ZNM A;  3FRC A;  3F4T A;  5DCG A;  1A0R P;  4NV2 A;  5AIS A;  2VAF A;  3CXG A;  6GSV A;  5IPG A;  4JED A;  4D73 A;  3GHA A;  1GTU A;  1XXU A;  1A23 A;  4PQI A;  4OFN A;  3VUR A;  3LYP A;  1XW5 A;  3TJG A;  10GS A;  4AJ8 A;  3TKS C;  1EOH A;  2B5X A;  4OO4 A;  4WBJ A;  1G6Y A;  1E6B A;  3ZIV A;  5J3R A;  1WOU A;  2X8H A;  4N30 A;  3VPT A;  2YOI A;  1T4Z A;  1X5E A;  1AXD A;  2C0E A;  2YV7 A;  4BL7 A;  4TN8 A;  2TIR A;  3W8S A;  4K9Z A;  3EWL A;  2LNT A;  2LST A;  2GSS A;  4JR4 A;  1B9Y C;  2NPB A;  1HNB A;  5JWQ B;  1GWC A;  4MF7 A;  1A0F A;  5IMV A;  3GKX A;  4YQV A;  3QFB C;  2X99 A;  2JAC A;  2CVB A;  3ME7 A;  3VK9 A;  1FG4 A;  2AUV A;  2CZ3 A;  4D73 B;  2J23 A;  5INY A;  1GTA A;  1HNC A;  5DQS A;  3H79 A;  2CX3 A;  3EU3 A;  2EIR A;  2MYG A;  1KTE A;  1BED A;  5L71 A;  2N5A A;  5B6M A;  4POL A;  1Z6N A;  2VLT A;  3CSJ A;  3C1S A;  4HEA 2;  3UVH A;  4ZB8 A;  1XOB A;  3VI5 A;  2J9H A;  1JZR A;  4P3Y B;  3VLN A;  4CHS A;  3TB2 A;  1K3L A;  3GL5 A;  2H74 A;  5KN1 A;  1M7T A;  1NSW A;  2VCQ A;  2NVL A;  4ULX A;  1FO5 A;  3KXO A;  5ECM B;  4KSO A;  5CNW A;  3H8Q A;  3LYK A;  1K3Y A;  1GSS A;  4V1A g;  3HDC A;  4Q5F A;  2LS5 A;  4GTU A;  5FHI A;  3W6G A;  3HCZ A;  1DBY A;  1GP1 A;  2F3M A;  3GN3 A;  1Y6E A;  1R26 A;  2AJQ B;  3CYN A;  2VM2 A;  2R5G A;  3L0H A;  5GSS A;  3KEB A;  5ELA A;  1A2L A;  3UBL A;  4KND A;  2PBJ A;  2H0H A;  2MMA A;  2L6D A;  2K9F A;  3LSZ A;  4TR4 A;  4TXV A;  5CYY A;  1DE1 A;  3I6A A;  3KGK A;  3VWU A;  1J08 A;  4X1U A;  2V41 A;  1SK1 A;  1VF4 A;  1X5C A;  3PGT A;  4X43 A;  4KCA A;  5IIZ A;  3ZFB A;  1TKD B;  4IVF A;  1TRV A;  3KIJ A;  2K8V A;  1NHO A;  5FWG A;  4GRF A;  1E2Y A;  1O73 A;  2H0G A;  5J5N A;  4IQ1 A;  4HU9 A;  3O6T A;  1SKR B;  2HLS A;  2YP6 A;  3FYG A;  4WEY A;  5IO0 A;  3GH9 A;  2HZE A;  3GSS A;  2LUS A;  5DJM A;  3ZMK A;  4EF0 A;  3HVX A;  4ECI A;  1MTC A;  3DD3 A;  3TJB A;  1TK0 B;  5GST A;  20GS A;  3J7Y k;  3UAP A;  2AV4 A;  4WXT A;  2A2S A;  2I4A A;  2OBK A;  1XFL A;  3UMA A;  2LRC A;  3APQ A;  3EYT A;  1M9B A;  2FUG 2;  2PER A;  5IMC A;  4RI7 A;  1Q4J A;  3CTG A;  4KB3 A;  5IOX A;  3ZIT A;  3ME8 A;  2EIO A;  3IRA A;  3LFL A;  1GSQ A;  2X8C A;  4HDE A;  3EIN A;  3NOF A;  2NDO A;  1RQM A;  1XWB A;  1GTI A;  4GWR A;  1OC3 A;  1PL1 A;  5IMZ A;  2RM5 A;  4HZ4 A;  2RII A;  4Q5R A;  1PSQ A;  1FHE A;  5D96 A;  3F63 A;  6GSX A;  2HZE B;  4G19 A;  2KP2 A;  3WGD A;  1VRS D;  3G7J A;  3FR9 A;  2GSQ A;  1SU9 A;  4Z7X A;  6GSS A;  3LGC A;  4WF4 A;  2FY6 A;  4F0B A;  1FVK A;  4RI6 A;  3CMI A;  3MNG A;  2ON7 A;  5ECI B;  2YZU A;  4IJ3 A;  3CSH A;  2O89 A;  3NIV A;  5HFG A;  1H4O A;  3KP8 A;  4F03 A;  4KW6 A;  1AAZ A;  5IQY A;  3W8J A;  1TK5 B;  1NHY A;  3ZLP A;  1YQ1 A;  1B48 A;  2LQQ A;  5ECR B;  1WE0 A;  4NXI A;  4GQC A;  4FH8 A;  3QFA C;  3GH6 A;  2YNX A;  4OCE A;  5D9W A;  12GS A;  1XIY A;  2O85 A;  4ML1 A;  1OKT A;  1XVQ A;  4K7I A;  4RQR A;  3F9U A;  3GYK A;  3FY7 A;  2OKA A;  1Z7R A;  2JZS A;  4HJM A;  2M80 A;  1CQG A;  4GST A;  4ACS A;  1GL8 A;  4XRA A;  3ZVJ D;  4WKW A;  4LL1 B;  3DVX A;  2CAQ A;  3TRP A;  3D4M A;  2O7K A;  3GTU A;  4K7N A;  3GNJ A;  3Q6O A;  13GS A;  3A2X A;  3TOU A;  3MWH A;  2MMZ A;  4K2D A;  2PUK C;  2FNO A;  1Z6M A;  4JU5 A;  2FHE A;  3GRX A;  4N0V A;  4V2N A;  4TXO A;  1PX6 A;  5LCZ A;  3UIW A;  1VF2 A;  1V57 A;  1XWK A;  2C0F A;  4F82 A;  2E0Q A;  4OD7 A;  2FWH A;  2GS3 A;  2VO4 A;  2RLI A;  3UEM A;  3P90 A;  4TKY A;  1O7U A;  3F6D A;  2PGT A;  3D5J A;  3GL3 A;  3RDW A;  3ZL5 A;  4DEJ A;  1XWA A;  5IMF A;  1X0R A;  3TJJ A;  3TKR A;  2H6X A;  1R7H A;  3ERG A;  5IMD A;  2CT6 A;  2C80 A;  2HZF A;  5CRW A;  1PKW A;  5FT3 A;  1Q98 A;  2HRF A;  3GV1 A;  2I1U A;  2VCT A;  2VM1 A;  2JAD A;  1OKD A;  1GSE A;  2BTO T;  5HFI A;  2R37 A;  2OE3 A;  1U3I A;  2X64 A;  1Z7P A;  4TXO B;  2WCI A;  4PQH A;  11GS A;  3P2A A;  3IXR A;  1M0U A;  1PL2 A;  3D22 A;  1OC8 A;  4JRR A;  1M99 A;  3ZML A;  1MD3 A;  1QGV A;  1GSU A;  4WR4 A;  1TU7 A;  4G10 A;  2LQO A;  1AIU A;  1LBK A;  4H86 A;  4TR3 A;  4EDY A;  4KX4 A;  3TRX A;  4LMV A;  2TRC P;  1PD2 1;  3EE2 A;  5AIX A;  4TR0 A;  3KD0 A;  4QQ7 A;  3Q19 A;  4FYC A;  3FZA A;  1V98 A;  4I8B A;  4AJ6 A;  3N9J A;  1TK8 B;  3H4K A;  1RW1 A;  1R5P A;  3JCM L;  3PR8 A;  4J2F A;  1X5D A;  1U87 A;  4YQM A;  3WT2 A;  3GST A;  1MD4 A;  3G7Y A;  3KZQ A;  2LJR A;  2L57 A;  2DML A;  1NM3 A;  1FW1 A;  6GSU A;  4MZB A;  1W4V A;  4ZB9 A;  3UVT A;  2PWJ A;  3OR5 A;  2H70 A;  1K0M A;  3GKK A;  1S3C A;  3HA9 A;  2AYT A;  3F6F A;  3TKQ A;  4MPF A;  2OJL A;  4E8H A;  1JFU A;  2K8S A;  2HE3 A;  4IQA A;  2B7J A;  4KSM A;  1KBN A;  6GST A;  3FR3 A;  1THO A;  4GSN A;  1K0C A;  4KDX A;  1O8W A;  3F4R A;  2YWM A;  5DDL A;  2H0I A;  1GTB A;  2VCV A;  1MDK A;  3IAS 2;  4KA0 A;  1RK4 A;  1T7P B;  3IOS A;  2DIZ A;  3Q18 A;  5B8B A;  3IE3 A;  2IIY A;  4WET A;  4EXJ A;  2GT5 A;  4HS1 A;  4O32 A;  3DGQ A;  2IWT A;  2B1K A;  3KTL A;  4FYU A;  3BD2 A;  1PX7 A;  1Y25 A;  1S3A A;  2VLU A;  3ZTL A;  4BWS A;  4PUA A;  2H71 A;  4K7O A;  17GS A;  4HOJ A;  4EKZ A;  1SD8 A;  3ZRD A;  2B6M A;  2CVK A;  2GQL A;  5GAP D;  1TRU A;  2FD3 A;  1YEP A;  3ED3 A;  2PU9 C;  3GKM A;  5DBQ A;  3HHV A;  1JZW A;  4ISD A;  1B9X C;  2FLS A;  2IFQ A;  4MF5 A;  4IGJ A;  2C4J A;  3FW2 A;  2L5O A;  2XPE A;  4N10 A;  2KLX A;  4OFT A;  1YF1 A;  1K0D A;  3ISO A;  4NPB A;  4PUR A;  3I9V 2;  1AUC A;  3MDK A;  1NW2 A;  4IBP A;  5DCH A;  2F9S A;  1OVN A;  2FA8 A;  3FK8 A;  4KCE A;  2VCW A;  2F51 A;  2ALB A;  4MDC A;  1A24 A;  1XVW A;  1G7E A;  2XC2 A;  3DML A;  4EL1 A;  4KDY A;  3PH9 A;  2FA4 A;  3BCK A;  4ECJ A;  2YWI A;  3NZN A;  3O3T A;  5B8A A;  3M3M A;  4Q5Q A;  1WJK A;  2H73 A;  4HQS A;  4MJA A;  3BBY A;  5F0G A;  3GUS A;  3HJM A;  2M72 A;  2OAC A;  2V1M A;  5HR2 A;  4EE0 A;  4LA1 A;  2PN8 A;  4MLY A;  2IFQ B;  1YY7 A;  4IHU A;  5KEJ A;  3FZ9 A;  1R5A A;  1XBS A;  1QFN A;  2H8L A;  1IYI A;  3QR6 A;  4LLR A;  1J9B A;  2GT6 A;  3C8E A;  2P5Q A;  1M2A A;  1SK2 A;  4XS4 A;  4JZQ A;  5G30 A;  1SJZ A;  2GST A;  5KN0 A;  4K6X A;  2FGX A;  3RBT A;  1ZOF A;  2DBC A;  1PGT A;  3D4T A;  4FO5 A;  2A2R A;  2V32 A;  2H6Y A;  4POM A;  1ST9 A;  1U88 A;  1X9S B;  1TRS A;  3A3T A;  1SKS B;  1M2D A;  1PQN A;  3E0U A;  4ID0 A;  5H5S A;  4F9Z A;  3EC3 A;  3GMF A;  2Z9S A;  1F37 A;  2R2J A;  3QPM A;  2IME A;  2C0D A;  2NBS A;  3L4N A;  3FZ5 A;  4WF5 A;  5AGY A;  4MJB A;  2YJ7 A;  2B7K A;  3L9V A;  1FB0 A;  1URM A;  3CBU A;  2IMI A;  3HVS A;  1GRX A;  2MMO A;  3TCO A;  4YH2 A;  3ZVJ A;  4MA9 A;  1EP7 A;  2YAN A;  3C1R A;  2H19 A;  4XS4 B;  1B8X A;  3CTF A;  1SL2 B;  7GSS A;  3C73 A;  4NV5 A;  1Z9H A;  1ERU A;  3F3Q A;  1TRW A;  3V1W A;  4J57 E;  1CQH A;  2EIQ A;  1EGO A;  2WJU A;  1YZX A;  4MAB A;  2XPD A;  3A5W A;  3GIX A;  2FWE A;  3M1G A;  1V40 A;  1HNA A;  4F2I A;  1EP8 A;  1OE7 A;  5D9T A;  2VL2 A;  3CRT A;  1A8Y A;  2I9H A;  1TDI A;  5ECK B;  1XCC A;  1BQ7 A;  1EEM A;  1M9A A;  3QD9 A;  5EPF A;  4G9H A;  1I5G A;  2WZ9 A;  1ACV A;  1GUK A;  2F8A A;  1ZYE A;  2B5Y A;  2O87 A;  5ECP B;  3U5R E;  5D9V A;  3J7Y b;  2ON5 A;  2FWG A;  1VF3 A;  3M0F A;  3L9U A;  4BVY A;  4HU7 A;  2DJ1 A;  1M2B A;  5ECQ B;  1YKA A;  4BWQ A;  2XBI A;  2CX4 A;  1XOA A;  3KMO A;  4RUV A;  2JZR A;  2R6K A;  3PIN A;  3HKR A;  2AAW A;  2XBQ A;  3G9B A;  3M8N A;  3L78 A;  3WT1 A;  1TTZ A;  2R4V A;  2L6C A;  4NHW A;  18GS A;  2K6V A;  1B4Q A;  3EMP A;  2KHP A;  1GUL A;  1QK8 A;  4HQZ A;  3TKS A;  1TJD A;  2MBS A;  2YV9 A;  4Q5N A;  1N8J A;  2X8G A;  3QMX A;  4TR1 A;  4KDU A;  3O76 A;  1AQV A;  3KH7 A;  3RPN A;  5IM9 A;  1TW9 A;  2OBI A;  2H1A A;  5IO2 A;  4K0N A;  4ECC A;  5D9X A;  2IMF A;  3EU4 A;  1OC9 A;  1ERW A;  5CRE A;  4PNG A;  4YAV A;  2OA7 A;  4KH7 A;  1G7O A;  4O5R A;  1ZZY A;  3CSI A;  3DEX A;  3KP9 A;  1BG5 A;  4IW9 A;  3M9K A;  4ZL8 A;  1WWJ A;  4MJC A;  3IAM 2;  1ZYQ B;  2C3T A;  3F3R A;  4E8E A;  1FOV A;  4PGT A;  5E59 A;  5G1L A;  3TUE A;  1YJ6 A;  5GZZ B;  5B6N A;  3RHB A;  3TJF A;  2AHE A;  1FAA A;  2DC5 A;  3RPP A;  2YWO A;  5HQP A;  2VLV A;  2H72 A;  2N5B A;  4TR1 B;  1SJ6 A;  2LKU A;  1EOG A;  2G0F A;  4AJ7 A;  4NHZ A;  3KMN A;  1K0O A;  4L8E A;  3S9F A;  4RQX A;  5IPH A;  2HFD A;  1OC9 B;  2C1Y A;  5A4U A;  5JCU A;  1BJX A;  3HJP A;  2WUL A;  3M9J A;  1EWX A;  5ECS A;  3RHC A;  4BA7 A;  3HY2 A;  2YWN A;  1OYJ A;  3C7M A;  3GX0 A;  4AF2 A;  1SJI A;  4GF0 A;  3N5O A;  2CA8 A;  1YF0 A;  4IEL A;  4L5O A;  4ZIJ A;  4EVM A;  2E2M A;  1F6M C;  1K0A A;  3TDG A;  4GLT A;  2P0G A;  1UA5 A;  1ABA A;  5CO3 A;  1UC7 A;  5J4U A;  1G0T A;  4ZL7 A;  4I2T A;  1ON4 A;  1OAZ A;  4LL4 B;  1T1V A;  1XWG A;  1PRX A;  4IP6 A;  2GVP A;  5C00 A;  5J9B A;  3D0Z A;  4GCI A;  5ECL B;  1F3B A;  5JWO B;  1O81 A;  1U6T A;  4N11 A;  2P5R A;  1K0B A;  1JLV A;  1DSB A;  1YEX A;  4OO5 A;  3L9S A;  1SYX A;  1PKZ A;  1GUH A;  2REM A;  3LJR A;  4XS6 A;  3FEU A;  5CAX A;  1WPI A;  1SL0 B;  14GS A;  1DE2 A;  4V2L A;  5HFK A;  5F07 A;  3A2V A;  1EV4 A;  4BPY A;  1KEB A;  3LWA A;  5ID2 B;  4OFM A;  3GA4 A;  1JHB A;  1F2E A;  1SK0 A;  4KE3 A;  4L0U A;  2IJY A;  2H1D A;  4O92 A;  1A8L A;  3AY8 A;  3UJ1 A;  2V6K A;  1MEK A;  1U3A A;  2LTK A;  3TKP A;  4ECB A;  5ENU A;  4F0C A;  3QOU A;  2BMX A;  3UBK A;  3ZRE A;  4EUY A;  1AQX A;  4AGS A;  5DAK A;  2HYX A;  5LD0 A;  6GSY A;  1K0N A;  4JR6 A;  2BJX A;  3F0I A;  1ZCP A;  1GUM A;  4O7H A;  3CRU A;  3G7I A;  1BYE A;  5C04 A;  2FCH A;  2DJK A;  1GLQ A;  2H30 A;  3E3E A;  3KH9 A;  1GNW A;  3QAW A;  4TRX A;  5JCG A;  4JBB A;  4EDZ A;  4PQ1 A;  2JU5 A;  2LNS A;  4IN0 A;  2GZZ A;  5DVB A;  1WMJ A;  2CV4 A;  1GH2 A;  1I9D A;  4IP1 A;  2C8U A;  3P7X A;  4K1F A;  3GFK A;  3BJ5 A;  5ECO B;  5EVO A;  2GSR A;  2CAI A;  1R4W A;  4CDO A;  2LRN A;  3TKS E;  4QL9 A;  3HYP A;  1PN9 A;  2F8F A;  4XIH A;  1GNE A;  2YZH A;  5DAK B;  5KN2 A;  2QC7 A;  1EV9 A;  3ERF A;  2WGR A;  4K0G A;  4PUF C;  4DVC A;  1T8E B;  1ILO A;  4FIW A;  1GLP A;  5EY6 A;  3VWX A;  2I3Y A;  3WGE A;  3APS A;  2HT9 A;  1BAY A;  2H76 A;  4MH2 A;  3F8U A;  3HZ8 A;  1V9W A;  4QL7 A;  2PMT A;  5ABR A;  2FWF A;  2R3X A;  2GGT A;  2I81 A;  1WRY A;  1PA3 A;  2HSH A;  3VPQ A;  1XW9 A;  1ERT A;  5B7C A;  2VL3 A;  2ES7 A;  3IA1 A;  4K8M A;  4L0W A;  2YJH A;  1A2M A;  3ZYW A;  4GQF A;  1MDJ A;  1EZK A;  3GX8 A;  2KOK A;  2GLR A;  1Z5Y E;  4HZ2 A;  2HXK A;  4NAX A;  3HZ4 A;  4MK3 A;  3TJK A;  4XTS A;  1X9M B;  3DKS A;  1USB A;  2GZP A;  1O6J A;  4TVE A;  5HR3 A;  2VIM A;  5DQY A;  3FHK A;  5G31 A;  1EEJ A;  2JSZ A;  3QAV A;  4XHM A;  1LJR A;  4FYB A;  2ZCT A;  5D93 A;  4GSS A;  5A4V A;  2DJ3 A;  5A5K A;  3IR4 A;  1S3D A;  2IL3 A;  5GAN D;  4ZIL A;  3Q74 A;  1T4Y A;  2B5E A;  3I69 A;  4MZC A;  4ZL9 A;  5IOW A;  4ZBD A;  3ZZX A;  1AQW A;  5CRD A;  4DSR A;  2IMK A;  5F8B A;  4EO3 A;  5G5F A;  3MAK A;  3WYW A;  3DWV A;  3LQ7 A;  1QQ2 A;  2E2G A;  3TOT A;  5H5Q A;  4MF6 A;  4BVX A;  2DMM A;  1XZO A;  1T00 A;  3K8N A;  3LOR A;  2H6Z A;  3HXS A;  3TRQ A;  2YN1 A;  3R2Q A;  5DAL A;  1TP9 A;  2N5F A;  5G1K A;  2VCX A;  2OE0 A;  4L5L A;  2VD0 A;  2GDR A;  3DYR A;  1X9W B;  3ZFL A;  2H01 A;  3BCI A;  4NWY A;  4ZBA A;  4MPG A;  3KJY A;  5J41 A;  5F05 A;  2LEG A;  2JZT A;  1SD9 A;  1YKC A;  2H1G A;  5G5E A;  4TW5 A;  3VFI A;  3I43 A;  6GSW A;  3SBC A;  2C3N A;  2B1L A;  3QAG A;  3WD6 A;  1TU8 A;  1UVZ A;  2L59 A;  3ZIJ A;  1N2A A;  5DJL A;  2ZUP A;  1V2A A;  2VCZ A;  1G6W A;  4XS1 A;  2H75 A;  5COH A;  1SYR A;  2PPT A;  5HR0 A;  1JZD A;  2HRN A;  5DAL B;  5E4W A;  1JLW A;  1ZL9 A;  3DXB A;  3GUR A;  1XPV A;  16GS A;  3EVI A;  1XWC A;  2DSA A;  5EL8 A;  1J0F A;  2NTO A;  1VGL A;  3VWW A;  1WIK A;  1TOF A;  5F06 A;  2LRT A;  2YPM A;  4V1A p;  4ZXG A;  3IK9 A;  2YCD A;  1W89 A;  2GQK A;  5AN1 A;  1XW6 A;  1AC1 A;  1B4P A;  4ZB6 A;  2DLX A;  3GKN A;  2DJJ A;  2DJ0 A;  1VF1 A;  4X0X A;  2B3S A;  3EUR A;  4I97 A;  3US3 A;  2QSI A;  5AIV A;  4OWY A;  4LMW A; 
#chains in the Genus database with same CATH topology
 1THX A;  4TOP A;  3LXZ A;  1QMV A;  2DIY A;  1UN2 A;  4KAE A;  3KTB A;  5D8I A;  4O5U A;  4G2E A;  4YKF A;  19GS A;  5HR1 A;  2P31 A;  2H1B A;  2RUE A;  3H93 A;  4PX1 A;  2L4Q A;  2MBT A;  5J9C A;  3SWL A;  3IPZ A;  2KUC A;  3D6I A;  2OE1 A;  3LEF A;  1TI1 A;  4XRD A;  4POB A;  4ILF A;  2EC4 A;  3VI7 A;  2WFC A;  4MMM A;  5D73 A;  3DVW A;  3IHQ A;  2VUP A;  2E7P A;  2LJK A;  3UAR A;  4CW9 A;  5JCW A;  1T3B A;  2WS2 A;  2IN3 A;  3LXT A;  4XCS A;  4KGI A;  1ZGN A;  2HSY A;  2DKI A;  22GS A;  5A4W A;  1A2J A;  3F4S A;  9GSS A;  1C72 A;  3FR6 A;  5CRH A;  1BX9 A;  5G2Z A;  1F3A A;  1O85 A;  2DJ2 A;  3EPT A;  1DUG A;  2JSY A;  2TRX A;  2QKE A;  4PXO A;  8GSS A;  1FB6 A;  4MP4 A;  5CP1 A;  2IMD A;  1HD2 A;  1OE8 A;  3TGZ A;  4YQU A;  4HUA A;  1PMT A;  2GZY A;  2H66 A;  5KN3 A;  1QUW A;  1SEN A;  3UL3 A;  2AB6 A;  4KUN A;  1O8X A;  2QGV A;  2RUF A;  1MDI A;  2JL4 A;  4JE1 A;  4MH3 A;  3H1N A;  2WRT A;  3IV4 A;  3IBH A;  3DRN A;  1JZO A;  2MZC A;  1AW9 A;  1EGR A;  1QXH A;  4HI7 A;  4IKH A;  3VWV A;  3IK7 A;  3KCM A;  3MSZ A;  5IMA A;  3QDN A;  2PVO C;  4MCU A;  5ECH B;  3DIE A;  4IS0 A;  2LJA A;  4DSS A;  4YAP A;  1KNG A;  5ECN B;  2A4V A;  1WP0 A;  3HD5 A;  2CZ2 A;  3LG6 A;  4V2M A;  4WBR D;  3A2W A;  5ID2 A;  1YDK A;  4J56 E;  5KOX A;  2XHF A;  4DSQ A;  3IC4 A;  2MMN A;  1LU4 A;  4MZW A;  1K3O A;  2C0G A;  4EC0 A;  2L5L A;  2L4C A;  2O8V B;  4OMV A;  3E9J B;  3GTU B;  4K5S A;  3FZ4 A;  1FVJ A;  1GSD A;  3P8W A;  4ML6 A;  3FKF A;  2IPA A;  2M46 A;  1TXX A;  1SKW B;  2VL9 A;  4MJE A;  1ERV A;  1Z3E A;  4USS A;  2WB9 A;  2V6O A;  3IDV A;  2D2Z A;  2HI7 A;  1ML6 A;  3ERW A;  1F9M A;  4WR5 A;  4IJI A;  3HJO A;  2V2G A;  3C71 A;  2OAD A;  3BOA A;  2C3Q A;  3RAZ A;  4OCF A;  3KM6 A;  1HQO A;  2KP1 A;  4GXZ A;  2HNL A;  2PVQ A;  2LV3 A;  4I6X A;  4A5P A;  2CVD A;  1GSY A;  3APO A;  4DSS B;  5ELG A;  4HSC X;  4ZBB A;  1SL1 B;  1V58 A;  5JWR B;  4HJ2 A;  4POK A;  3HVV A;  5CRG A;  4I5Q A;  4N0Z A;  2RM6 A;  2G2Q A;  1H75 A;  2K18 A;  1IYH A;  1ZMA A;  3U6V A;  2VL2 C;  1TI3 A;  4NMU A;  2WDU A;  2GQM A;  1HYU A;  3WGX A;  3EMX A;  3QCP A;  2GTU A;  3UOM A;  2VOC A;  5LNK e;  5H5R A;  3D21 A;  2VD1 A;  2CQ9 A;  1GSF A;  4I2U A;  4PNF A;  2ZNM A;  3FRC A;  3F4T A;  5DCG A;  1A0R P;  4NV2 A;  5AIS A;  2VAF A;  3CXG A;  6GSV A;  4ICY A;  5IPG A;  4JED A;  4D73 A;  3GHA A;  1GTU A;  1XXU A;  1A23 A;  4PQI A;  4OFN A;  3VUR A;  3LYP A;  1XW5 A;  3TJG A;  10GS A;  4AJ8 A;  3TKS C;  1EOH A;  2B5X A;  4OO4 A;  4WBJ A;  1G6Y A;  1E6B A;  3ZIV A;  5J3R A;  1WOU A;  2X8H A;  4N30 A;  3VPT A;  2YOI A;  1T4Z A;  1X5E A;  1AXD A;  2C0E A;  2YV7 A;  2X49 A;  4BL7 A;  4TN8 A;  2TIR A;  3W8S A;  4K9Z A;  3EWL A;  2LNT A;  2LST A;  2GSS A;  4JR4 A;  1B9Y C;  2NPB A;  1HNB A;  5JWQ B;  1GWC A;  4MF7 A;  2R0G A;  1A0F A;  5IMV A;  3GKX A;  4YQV A;  3QFB C;  2X99 A;  2JAC A;  2CVB A;  3ME7 A;  3VK9 A;  1FG4 A;  2AUV A;  2CZ3 A;  4D73 B;  2J23 A;  5INY A;  1GTA A;  1HNC A;  5DQS A;  3H79 A;  2CX3 A;  3EU3 A;  2EIR A;  2MYG A;  1KTE A;  1BED A;  5L71 A;  2N5A A;  5B6M A;  4POL A;  1Z6N A;  2VLT A;  3CSJ A;  3C1S A;  4HEA 2;  3UVH A;  4Z2T A;  4ZB8 A;  1XOB A;  3VI5 A;  2J9H A;  1JZR A;  4P3Y B;  3VLN A;  4CHS A;  3TB2 A;  1K3L A;  3GL5 A;  2H74 A;  1ZYP A;  5KN1 A;  4BL7 B;  1M7T A;  1NSW A;  2VCQ A;  2NVL A;  4ULX A;  1FO5 A;  3KXO A;  5ECM B;  4KSO A;  5CNW A;  3H8Q A;  3LYK A;  1K3Y A;  1GSS A;  4EIP A;  4V1A g;  3HDC A;  4Q5F A;  2LS5 A;  4GTU A;  5FHI A;  3W6G A;  3HCZ A;  1DBY A;  1GP1 A;  2F3M A;  3GN3 A;  1Y6E A;  1R26 A;  2AJQ B;  3CYN A;  2VM2 A;  2R5G A;  3L0H A;  5GSS A;  3KEB A;  5ELA A;  1A2L A;  3UBL A;  4KND A;  2PBJ A;  2H0H A;  2MMA A;  2L6D A;  2K9F A;  3LSZ A;  4G0I A;  4TR4 A;  4TXV A;  5CYY A;  1DE1 A;  3I6A A;  3KGK A;  3VWU A;  1J08 A;  4X1U A;  2V41 A;  1SK1 A;  1M3J A;  1VF4 A;  1X5C A;  3PGT A;  4X43 A;  4KCA A;  5IIZ A;  3ZFB A;  1TKD B;  4IVF A;  1TRV A;  3KIJ A;  2K8V A;  1NHO A;  5FWG A;  4GRF A;  1E2Y A;  1O73 A;  2H0G A;  5J5N A;  4IQ1 A;  4HU9 A;  3O6T A;  1SKR B;  2HLS A;  2YP6 A;  3FYG A;  4WEY A;  5IO0 A;  3GH9 A;  2HZE A;  3GSS A;  2LUS A;  5DJM A;  3ZMK A;  4EF0 A;  3HVX A;  4ECI A;  1MTC A;  3DD3 A;  3TJB A;  1TK0 B;  5GST A;  20GS A;  3J7Y k;  3UAP A;  2AV4 A;  4WXT A;  2A2S A;  2I4A A;  2OBK A;  1XFL A;  3UMA A;  2LRC A;  3APQ A;  3EYT A;  1M9B A;  2FUG 2;  2PER A;  5IMC A;  1PFO A;  4RI7 A;  1Q4J A;  3CTG A;  4KB3 A;  5IOX A;  3ZIT A;  3ME8 A;  2EIO A;  3IRA A;  3LFL A;  1GSQ A;  2X8C A;  4PTS A;  4HDE A;  3EIN A;  3NOF A;  2NDO A;  1RQM A;  1XWB A;  1GTI A;  4GWR A;  1OC3 A;  1PL1 A;  4X4J A;  5IMZ A;  2RM5 A;  4HZ4 A;  2RII A;  4Q5R A;  1PSQ A;  1FHE A;  5D96 A;  3F63 A;  6GSX A;  2HZE B;  4G19 A;  2KP2 A;  3WGD A;  5BRT A;  1VRS D;  3G7J A;  2QA1 A;  3FR9 A;  2GSQ A;  1SU9 A;  4Z7X A;  6GSS A;  3LGC A;  4WF4 A;  2FY6 A;  4F0B A;  1FVK A;  4RI6 A;  3CMI A;  3MNG A;  2ON7 A;  5ECI B;  2YZU A;  4IJ3 A;  3CSH A;  2O89 A;  3NIV A;  5HFG A;  1H4O A;  3KP8 A;  4F03 A;  4Z2R A;  4KW6 A;  1AAZ A;  5IQY A;  3W8J A;  1TK5 B;  1NHY A;  3ZLP A;  1YQ1 A;  1PN0 A;  1B48 A;  2DKH A;  2LQQ A;  5ECR B;  1WE0 A;  4NXI A;  4GQC A;  4FH8 A;  3QFA C;  3GH6 A;  2YNX A;  4OCE A;  5D9W A;  12GS A;  5KOW A;  1XIY A;  2O85 A;  4ML1 A;  1OKT A;  1XVQ A;  4K7I A;  4RQR A;  3F9U A;  3GYK A;  3FY7 A;  2OKA A;  1Z7R A;  2JZS A;  4HJM A;  2M80 A;  4FQU A;  1CQG A;  4GST A;  4ACS A;  1GL8 A;  4XRA A;  3ZVJ D;  4WKW A;  4LL1 B;  3DVX A;  2CAQ A;  3TRP A;  3D4M A;  2O7K A;  3GTU A;  3R3E A;  4K7N A;  3GNJ A;  3Q6O A;  13GS A;  3A2X A;  3TOU A;  3MWH A;  2MMZ A;  4K2D A;  2PUK C;  2FNO A;  1Z6M A;  4JU5 A;  2FHE A;  3GRX A;  4N0V A;  1M3I A;  4V2N A;  4TXO A;  1PX6 A;  5LCZ A;  4O5Q A;  3UIW A;  1VF2 A;  1V57 A;  1XWK A;  5BMU A;  2C0F A;  4F82 A;  2E0Q A;  4OD7 A;  4CY6 A;  2FWH A;  2GS3 A;  2VO4 A;  2RLI A;  3UEM A;  3P90 A;  4TKY A;  1O7U A;  3F6D A;  2PGT A;  3D5J A;  3CQF A;  3GL3 A;  3RDW A;  3ZL5 A;  4DEJ A;  1XWA A;  5IMF A;  1X0R A;  4MNN A;  3TJJ A;  3TKR A;  2H6X A;  1R7H A;  3ERG A;  5IMD A;  2CT6 A;  2C80 A;  2HZF A;  5CRW A;  1PKW A;  4YKG A;  5FT3 A;  1Q98 A;  2HRF A;  3GV1 A;  2I1U A;  2VCT A;  2VM1 A;  2JAD A;  1OKD A;  1GSE A;  2BTO T;  5HFI A;  2R37 A;  2OE3 A;  1U3I A;  2X64 A;  1Z7P A;  4TXO B;  2WCI A;  4PQH A;  11GS A;  3P2A A;  3IXR A;  1M0U A;  1PL2 A;  3D22 A;  1OC8 A;  4JRR A;  1M99 A;  3ZML A;  1MD3 A;  1QGV A;  1GSU A;  4WR4 A;  1TU7 A;  4G10 A;  2LQO A;  1S3R A;  1AIU A;  1LBK A;  4H86 A;  4TR3 A;  4EDY A;  4KX4 A;  3TRX A;  4LMV A;  2TRC P;  1PD2 1;  3EE2 A;  5AIX A;  4TR0 A;  3KD0 A;  4QQ7 A;  3Q19 A;  4FYC A;  3FZA A;  1V98 A;  4I8B A;  3LW9 A;  4AJ6 A;  2HRA A;  3N9J A;  1TK8 B;  3H4K A;  1RW1 A;  1R5P A;  3JCM L;  3PR8 A;  4J2F A;  1X5D A;  1U87 A;  4YQM A;  3WT2 A;  3GST A;  1MD4 A;  3G7Y A;  3KZQ A;  2LJR A;  2L57 A;  2DML A;  1NM3 A;  1FW1 A;  6GSU A;  4MZB A;  1W4V A;  4ZB9 A;  3UVT A;  2PWJ A;  3OR5 A;  2H70 A;  1K0M A;  3GKK A;  1S3C A;  3HA9 A;  2AYT A;  3F6F A;  3TKQ A;  4MPF A;  2OJL A;  4E8H A;  1JFU A;  2K8S A;  2HE3 A;  4IQA A;  2B7J A;  4KSM A;  1KBN A;  4K5R A;  6GST A;  3FR3 A;  1THO A;  4GSN A;  1K0C A;  4KDX A;  1O8W A;  3F4R A;  2YWM A;  5DDL A;  1XG8 A;  2H0I A;  1GTB A;  2VCV A;  1MDK A;  3IAS 2;  4KA0 A;  1RK4 A;  1T7P B;  3IOS A;  2DIZ A;  3Q18 A;  5B8B A;  3IE3 A;  2IIY A;  4WET A;  4EXJ A;  2GT5 A;  4HS1 A;  4O32 A;  3DGQ A;  2IWT A;  2B1K A;  3KTL A;  4FYU A;  4KF9 A;  3BD2 A;  1PX7 A;  1Y25 A;  1S3A A;  2VLU A;  3ZTL A;  4BWS A;  4PUA A;  2H71 A;  4K7O A;  17GS A;  4HOJ A;  4EKZ A;  1SD8 A;  3ZRD A;  2B6M A;  2CVK A;  2GQL A;  5GAP D;  1TRU A;  2FD3 A;  1YEP A;  3ED3 A;  2PU9 C;  3GKM A;  5DBQ A;  3HHV A;  1JZW A;  4ISD A;  1B9X C;  2FLS A;  2IFQ A;  4MF5 A;  4IGJ A;  2C4J A;  3FW2 A;  2L5O A;  2XPE A;  4N10 A;  2KLX A;  4OFT A;  1YF1 A;  1K0D A;  3ISO A;  4NPB A;  4PUR A;  3I9V 2;  1AUC A;  3MDK A;  1NW2 A;  4IBP A;  5DCH A;  2F9S A;  3HVN A;  1OVN A;  2FA8 A;  3FK8 A;  4KCE A;  2VCW A;  2F51 A;  2ALB A;  4MDC A;  1A24 A;  1XVW A;  1G7E A;  2XC2 A;  3DML A;  4EL1 A;  4KDY A;  3PH9 A;  2FA4 A;  3BCK A;  4ECJ A;  2YWI A;  3NZN A;  3O3T A;  5B8A A;  3M3M A;  4Q5Q A;  1WJK A;  2H73 A;  4HQS A;  4MJA A;  3BBY A;  5F0G A;  2UZ8 A;  3GUS A;  3HJM A;  2M72 A;  2OAC A;  2V1M A;  5HR2 A;  4EE0 A;  4LA1 A;  2PN8 A;  4MLY A;  2IFQ B;  1YY7 A;  4IHU A;  5KEJ A;  3FZ9 A;  1R5A A;  1XBS A;  1QFN A;  2H8L A;  1IYI A;  3QR6 A;  4LLR A;  1J9B A;  2GT6 A;  3C8E A;  2P5Q A;  1M2A A;  1SK2 A;  4XS4 A;  4JZQ A;  5G30 A;  1SJZ A;  2GST A;  5KN0 A;  4K6X A;  2FGX A;  3RBT A;  1ZOF A;  2DBC A;  1PGT A;  3D4T A;  4FO5 A;  2A2R A;  2V32 A;  2HSM A;  2H6Y A;  4POM A;  1ST9 A;  1U88 A;  1X9S B;  1TRS A;  3A3T A;  1SKS B;  1M2D A;  1PQN A;  3E0U A;  1ZYN A;  4ID0 A;  5H5S A;  4F9Z A;  3EC3 A;  3GMF A;  2Z9S A;  1F37 A;  2R2J A;  3QPM A;  2IME A;  2C0D A;  2NBS A;  3L4N A;  4BIK A;  3FZ5 A;  4WF5 A;  5AGY A;  4MJB A;  2YJ7 A;  2B7K A;  3L9V A;  1FB0 A;  1URM A;  3CBU A;  2IMI A;  3HVS A;  4K2X A;  1GRX A;  2MMO A;  3TCO A;  4YH2 A;  3ZVJ A;  4MA9 A;  1EP7 A;  2YAN A;  3C1R A;  2H19 A;  4XS4 B;  1B8X A;  3CTF A;  1SL2 B;  7GSS A;  3C73 A;  4NV5 A;  1Z9H A;  1ERU A;  3F3Q A;  1TRW A;  3V1W A;  4J57 E;  1CQH A;  2EIQ A;  1EGO A;  2WJU A;  3FMW A;  1YZX A;  4MAB A;  2XPD A;  3A5W A;  3GIX A;  2FWE A;  3M1G A;  1V40 A;  1HNA A;  4F2I A;  1EP8 A;  1OE7 A;  5D9T A;  2VL2 A;  3CRT A;  1A8Y A;  2I9H A;  1TDI A;  5ECK B;  1XCC A;  1BQ7 A;  1EEM A;  1M9A A;  3QD9 A;  5EPF A;  4G9H A;  1I5G A;  2WZ9 A;  1ACV A;  1GUK A;  2F8A A;  2R0P A;  1ZYE A;  2B5Y A;  2O87 A;  5ECP B;  3U5R E;  5D9V A;  3J7Y b;  2ON5 A;  2FWG A;  1VF3 A;  3M0F A;  3L9U A;  4BVY A;  4HU7 A;  2DJ1 A;  1M2B A;  5ECQ B;  1YKA A;  4BWQ A;  2XBI A;  2CX4 A;  1XOA A;  3KMO A;  4RUV A;  2JZR A;  2R6K A;  2HRK A;  3PIN A;  3HKR A;  2AAW A;  2XBQ A;  3G9B A;  3M8N A;  3L78 A;  3WT1 A;  1TTZ A;  2R4V A;  2L6C A;  2R0C A;  4NHW A;  18GS A;  2K6V A;  1B4Q A;  3EMP A;  2KHP A;  1GUL A;  1QK8 A;  4HQZ A;  3TKS A;  1TJD A;  2MBS A;  2YV9 A;  4Q5N A;  1N8J A;  2X8G A;  3QMX A;  4TR1 A;  4KDU A;  3O76 A;  1AQV A;  3KH7 A;  3RPN A;  5IM9 A;  1TW9 A;  2OBI A;  2H1A A;  5IO2 A;  4K0N A;  4EIQ A;  4ECC A;  5D9X A;  2IMF A;  4BVY B;  3EU4 A;  1OC9 A;  1ERW A;  5CRE A;  4PNG A;  4YAV A;  2OA7 A;  4KH7 A;  1G7O A;  4O5R A;  1ZZY A;  3CSI A;  3DEX A;  3KP9 A;  1BG5 A;  4IW9 A;  3M9K A;  4ZL8 A;  1WWJ A;  4MJC A;  3IAM 2;  1ZYQ B;  2C3T A;  3F3R A;  4E8E A;  1FOV A;  4PGT A;  5E59 A;  5G1L A;  3TUE A;  1YJ6 A;  5GZZ B;  5B6N A;  3RHB A;  3TJF A;  2AHE A;  1FAA A;  2DC5 A;  3RPP A;  2YWO A;  5HQP A;  2VLV A;  2H72 A;  2N5B A;  4TR1 B;  1SJ6 A;  2LKU A;  1EOG A;  2G0F A;  4AJ7 A;  4NHZ A;  3KMN A;  1K0O A;  4L8E A;  3S9F A;  4RQX A;  5IPH A;  2HFD A;  1OC9 B;  2C1Y A;  5A4U A;  5JCU A;  1BJX A;  3HJP A;  2WUL A;  3M9J A;  1EWX A;  5ECS A;  3RHC A;  4BA7 A;  3HY2 A;  2YWN A;  1OYJ A;  3C7M A;  3GX0 A;  4AF2 A;  1SJI A;  4GF0 A;  3N5O A;  2CA8 A;  1YF0 A;  4IEL A;  4L5O A;  4ZIJ A;  4EVM A;  2E2M A;  1F6M C;  1K0A A;  3TDG A;  4GLT A;  2P0G A;  1UA5 A;  1ABA A;  5CO3 A;  1UC7 A;  5J4U A;  1G0T A;  4ZL7 A;  4I2T A;  1ON4 A;  1OAZ A;  4LL4 B;  1T1V A;  2A4H A;  1XWG A;  1PRX A;  4IP6 A;  2GVP A;  5C00 A;  5J9B A;  3D0Z A;  4GCI A;  5ECL B;  4CY8 A;  1F3B A;  5JWO B;  1O81 A;  1U6T A;  4N11 A;  2P5R A;  1K0B A;  1JLV A;  1DSB A;  1YEX A;  4OO5 A;  3L9S A;  1SYX A;  1PKZ A;  1GUH A;  2REM A;  3LJR A;  4XS6 A;  3FEU A;  5CAX A;  1WPI A;  1SL0 B;  14GS A;  1DE2 A;  4V2L A;  5HFK A;  5F07 A;  3A2V A;  2X4A A;  1EV4 A;  4BPY A;  1KEB A;  3LWA A;  5ID2 B;  4OFM A;  3GA4 A;  1JHB A;  1F2E A;  1SK0 A;  4KE3 A;  4L0U A;  2IJY A;  2H1D A;  4O92 A;  1A8L A;  3AY8 A;  3UJ1 A;  2V6K A;  1MEK A;  1U3A A;  2LTK A;  3TKP A;  4ECB A;  5ENU A;  4F0C A;  3QOU A;  2BMX A;  3UBK A;  3ZRE A;  4EUY A;  1AQX A;  4AGS A;  4Z2U A;  5DAK A;  2HYX A;  5LD0 A;  6GSY A;  1K0N A;  4JR6 A;  2BJX A;  3F0I A;  1ZCP A;  1GUM A;  4O7H A;  3CRU A;  3G7I A;  1BYE A;  5C04 A;  2FCH A;  2DJK A;  1GLQ A;  2H30 A;  3E3E A;  3KH9 A;  1FOH A;  1GNW A;  3QAW A;  4TRX A;  5JCG A;  4JBB A;  4EDZ A;  4PQ1 A;  2JU5 A;  2LNS A;  4IN0 A;  2GZZ A;  5DVB A;  1WMJ A;  2CV4 A;  1GH2 A;  1I9D A;  4IP1 A;  2C8U A;  3P7X A;  4K1F A;  3GFK A;  3BJ5 A;  5ECO B;  5EVO A;  2GSR A;  2CAI A;  1R4W A;  4CDO A;  2LRN A;  3TKS E;  4QL9 A;  3HYP A;  1PN9 A;  2F8F A;  4XIH A;  1GNE A;  2YZH A;  5DAK B;  5KN2 A;  2QC7 A;  1EV9 A;  3ERF A;  2WGR A;  4K0G A;  4PUF C;  4DVC A;  1T8E B;  1ILO A;  4FIW A;  1GLP A;  5EY6 A;  3VWX A;  2I3Y A;  3WGE A;  3APS A;  2HT9 A;  1BAY A;  2H76 A;  4MH2 A;  3F8U A;  3HZ8 A;  1V9W A;  4QL7 A;  2PMT A;  5ABR A;  2FWF A;  2R3X A;  2GGT A;  2I81 A;  1WRY A;  1PA3 A;  2HSH A;  3VPQ A;  1XW9 A;  1ERT A;  5B7C A;  2VL3 A;  2ES7 A;  3IA1 A;  4K8M A;  4L0W A;  2YJH A;  1A2M A;  3ZYW A;  4GQF A;  1MDJ A;  1EZK A;  3GX8 A;  2KOK A;  2GLR A;  1Z5Y E;  4HZ2 A;  2HXK A;  4NAX A;  3HZ4 A;  3MYD A;  4MK3 A;  3TJK A;  4XTS A;  1X9M B;  3DKS A;  1USB A;  2GZP A;  1O6J A;  4TVE A;  5HR3 A;  2VIM A;  5DQY A;  3FHK A;  5G31 A;  2QA2 A;  1EEJ A;  2JSZ A;  3QAV A;  4XHM A;  1LJR A;  4FYB A;  2ZCT A;  5D93 A;  4GSS A;  5A4V A;  2DJ3 A;  5A5K A;  3IR4 A;  1S3D A;  2IL3 A;  5GAN D;  4ZIL A;  3Q74 A;  1T4Y A;  2B5E A;  3I69 A;  4MZC A;  4ZL9 A;  4G0K A;  5IOW A;  4ZBD A;  3ZZX A;  1AQW A;  5CRD A;  4DSR A;  2IMK A;  5F8B A;  4EO3 A;  5G5F A;  3MAK A;  3WYW A;  3DWV A;  3LQ7 A;  1QQ2 A;  2E2G A;  3TOT A;  5H5Q A;  4MF6 A;  4BVX A;  2DMM A;  2A2P A;  1XZO A;  1T00 A;  3K8N A;  3LOR A;  2H6Z A;  3HXS A;  3TRQ A;  2YN1 A;  3R2Q A;  5DAL A;  1TP9 A;  2N5F A;  5G1K A;  2VCX A;  2OE0 A;  4L5L A;  2VD0 A;  2GDR A;  3DYR A;  1X9W B;  3ZFL A;  2H01 A;  3BCI A;  4NWY A;  4ZBA A;  4MPG A;  3KJY A;  3IC8 A;  5J41 A;  4G0L A;  5F05 A;  2LEG A;  2JZT A;  1SD9 A;  1YKC A;  2H1G A;  5G5E A;  4TW5 A;  3VFI A;  3I43 A;  6GSW A;  3SBC A;  2C3N A;  2B1L A;  3QAG A;  3WD6 A;  1TU8 A;  1UVZ A;  2L59 A;  3ZIJ A;  1N2A A;  5DJL A;  2ZUP A;  1V2A A;  2VCZ A;  4BVX B;  3MIX A;  1G6W A;  4XS1 A;  3PPU A;  2H75 A;  5COH A;  1SYR A;  2PPT A;  5HR0 A;  1JZD A;  2HRN A;  5DAL B;  5E4W A;  1JLW A;  1ZL9 A;  3DXB A;  3GUR A;  1XPV A;  16GS A;  3EVI A;  1XWC A;  2DSA A;  5EL8 A;  1J0F A;  2NTO A;  1VGL A;  3VWW A;  1WIK A;  1TOF A;  5F06 A;  2LRT A;  2YPM A;  4V1A p;  4ZXG A;  3IK9 A;  2YCD A;  1W89 A;  2GQK A;  5AN1 A;  1XW6 A;  1AC1 A;  3A5I A;  1B4P A;  4ZB6 A;  2DLX A;  3GKN A;  2DJJ A;  2DJ0 A;  1VF1 A;  4X0X A;  2B3S A;  3EUR A;  4I97 A;  3US3 A;  2QSI A;  5AIV A;  4OWY A;  4LMW A;  3IHG A; 
#chains in the Genus database with same CATH homology
 1THX A;  4TOP A;  3LXZ A;  1QMV A;  2DIY A;  1UN2 A;  4KAE A;  3KTB A;  5D8I A;  4O5U A;  4G2E A;  4YKF A;  19GS A;  5HR1 A;  2P31 A;  2H1B A;  2RUE A;  3H93 A;  4PX1 A;  2L4Q A;  2MBT A;  5J9C A;  3SWL A;  3IPZ A;  2KUC A;  3D6I A;  2OE1 A;  3LEF A;  1TI1 A;  4XRD A;  4POB A;  4ILF A;  2EC4 A;  3VI7 A;  2WFC A;  4MMM A;  5D73 A;  3DVW A;  3IHQ A;  2VUP A;  2E7P A;  2LJK A;  3UAR A;  4CW9 A;  5JCW A;  1T3B A;  2WS2 A;  2IN3 A;  3LXT A;  4XCS A;  4KGI A;  1ZGN A;  2HSY A;  2DKI A;  22GS A;  5A4W A;  1A2J A;  3F4S A;  9GSS A;  1C72 A;  3FR6 A;  5CRH A;  1BX9 A;  5G2Z A;  1F3A A;  1O85 A;  2DJ2 A;  3EPT A;  1DUG A;  2JSY A;  2TRX A;  2QKE A;  4PXO A;  8GSS A;  1FB6 A;  4MP4 A;  5CP1 A;  2IMD A;  1HD2 A;  1OE8 A;  3TGZ A;  4YQU A;  4HUA A;  1PMT A;  2GZY A;  2H66 A;  5KN3 A;  1QUW A;  1SEN A;  3UL3 A;  2AB6 A;  4KUN A;  1O8X A;  2QGV A;  2RUF A;  1MDI A;  2JL4 A;  4JE1 A;  4MH3 A;  3H1N A;  2WRT A;  3IV4 A;  3IBH A;  3DRN A;  1JZO A;  2MZC A;  1AW9 A;  1EGR A;  1QXH A;  4HI7 A;  4IKH A;  3VWV A;  3IK7 A;  3KCM A;  3MSZ A;  5IMA A;  3QDN A;  2PVO C;  4MCU A;  5ECH B;  3DIE A;  4IS0 A;  2LJA A;  4DSS A;  4YAP A;  1KNG A;  5ECN B;  2A4V A;  1WP0 A;  3HD5 A;  2CZ2 A;  3LG6 A;  4V2M A;  4WBR D;  3A2W A;  5ID2 A;  1YDK A;  4J56 E;  5KOX A;  2XHF A;  4DSQ A;  3IC4 A;  2MMN A;  1LU4 A;  4MZW A;  1K3O A;  2C0G A;  4EC0 A;  2L5L A;  2L4C A;  2O8V B;  4OMV A;  3E9J B;  3GTU B;  4K5S A;  3FZ4 A;  1FVJ A;  1GSD A;  3P8W A;  4ML6 A;  3FKF A;  2IPA A;  2M46 A;  1TXX A;  1SKW B;  2VL9 A;  4MJE A;  1ERV A;  1Z3E A;  4USS A;  2WB9 A;  2V6O A;  3IDV A;  2D2Z A;  2HI7 A;  1ML6 A;  3ERW A;  1F9M A;  4WR5 A;  4IJI A;  3HJO A;  2V2G A;  3C71 A;  2OAD A;  3BOA A;  2C3Q A;  3RAZ A;  4OCF A;  3KM6 A;  1HQO A;  2KP1 A;  4GXZ A;  2HNL A;  2PVQ A;  2LV3 A;  4I6X A;  4A5P A;  2CVD A;  1GSY A;  3APO A;  4DSS B;  5ELG A;  4ZBB A;  1SL1 B;  1V58 A;  5JWR B;  4HJ2 A;  4POK A;  3HVV A;  5CRG A;  4I5Q A;  4N0Z A;  2RM6 A;  2G2Q A;  1H75 A;  2K18 A;  1IYH A;  1ZMA A;  3U6V A;  2VL2 C;  1TI3 A;  4NMU A;  2WDU A;  2GQM A;  1HYU A;  3WGX A;  3EMX A;  3QCP A;  2GTU A;  3UOM A;  2VOC A;  5LNK e;  5H5R A;  3D21 A;  2VD1 A;  2CQ9 A;  1GSF A;  4I2U A;  4PNF A;  2ZNM A;  3FRC A;  3F4T A;  5DCG A;  1A0R P;  4NV2 A;  5AIS A;  2VAF A;  3CXG A;  6GSV A;  4ICY A;  5IPG A;  4JED A;  4D73 A;  3GHA A;  1GTU A;  1XXU A;  1A23 A;  4PQI A;  4OFN A;  3VUR A;  3LYP A;  1XW5 A;  3TJG A;  10GS A;  4AJ8 A;  3TKS C;  1EOH A;  2B5X A;  4OO4 A;  4WBJ A;  1G6Y A;  1E6B A;  3ZIV A;  5J3R A;  1WOU A;  2X8H A;  4N30 A;  3VPT A;  2YOI A;  1T4Z A;  1X5E A;  1AXD A;  2C0E A;  2YV7 A;  2X49 A;  4BL7 A;  4TN8 A;  2TIR A;  3W8S A;  4K9Z A;  3EWL A;  2LNT A;  2LST A;  2GSS A;  4JR4 A;  1B9Y C;  2NPB A;  1HNB A;  5JWQ B;  1GWC A;  4MF7 A;  2R0G A;  1A0F A;  5IMV A;  3GKX A;  4YQV A;  3QFB C;  2X99 A;  2JAC A;  2CVB A;  3ME7 A;  3VK9 A;  1FG4 A;  2AUV A;  2CZ3 A;  4D73 B;  2J23 A;  5INY A;  1GTA A;  1HNC A;  5DQS A;  3H79 A;  2CX3 A;  3EU3 A;  2EIR A;  2MYG A;  1KTE A;  1BED A;  5L71 A;  2N5A A;  5B6M A;  4POL A;  1Z6N A;  2VLT A;  3CSJ A;  3C1S A;  4HEA 2;  3UVH A;  4Z2T A;  4ZB8 A;  1XOB A;  3VI5 A;  2J9H A;  1JZR A;  4P3Y B;  3VLN A;  4CHS A;  3TB2 A;  1K3L A;  3GL5 A;  2H74 A;  1ZYP A;  5KN1 A;  4BL7 B;  1M7T A;  1NSW A;  2VCQ A;  2NVL A;  4ULX A;  1FO5 A;  3KXO A;  5ECM B;  4KSO A;  5CNW A;  3H8Q A;  3LYK A;  1K3Y A;  1GSS A;  4EIP A;  4V1A g;  3HDC A;  4Q5F A;  2LS5 A;  4GTU A;  5FHI A;  3W6G A;  3HCZ A;  1DBY A;  1GP1 A;  2F3M A;  3GN3 A;  1Y6E A;  1R26 A;  2AJQ B;  3CYN A;  2VM2 A;  2R5G A;  3L0H A;  5GSS A;  3KEB A;  5ELA A;  1A2L A;  3UBL A;  4KND A;  2PBJ A;  2H0H A;  2MMA A;  2L6D A;  2K9F A;  3LSZ A;  4G0I A;  4TR4 A;  4TXV A;  5CYY A;  1DE1 A;  3I6A A;  3KGK A;  3VWU A;  1J08 A;  4X1U A;  2V41 A;  1SK1 A;  1VF4 A;  1X5C A;  3PGT A;  4X43 A;  4KCA A;  5IIZ A;  3ZFB A;  1TKD B;  4IVF A;  1TRV A;  3KIJ A;  2K8V A;  1NHO A;  5FWG A;  4GRF A;  1E2Y A;  1O73 A;  2H0G A;  5J5N A;  4IQ1 A;  4HU9 A;  3O6T A;  1SKR B;  2HLS A;  2YP6 A;  3FYG A;  4WEY A;  5IO0 A;  3GH9 A;  2HZE A;  3GSS A;  2LUS A;  5DJM A;  3ZMK A;  4EF0 A;  3HVX A;  4ECI A;  1MTC A;  3DD3 A;  3TJB A;  1TK0 B;  5GST A;  20GS A;  3J7Y k;  3UAP A;  2AV4 A;  4WXT A;  2A2S A;  2I4A A;  2OBK A;  1XFL A;  3UMA A;  2LRC A;  3APQ A;  3EYT A;  1M9B A;  2FUG 2;  2PER A;  5IMC A;  4RI7 A;  1Q4J A;  3CTG A;  4KB3 A;  5IOX A;  3ZIT A;  3ME8 A;  2EIO A;  3IRA A;  3LFL A;  1GSQ A;  2X8C A;  4PTS A;  4HDE A;  3EIN A;  3NOF A;  2NDO A;  1RQM A;  1XWB A;  1GTI A;  4GWR A;  1OC3 A;  1PL1 A;  4X4J A;  5IMZ A;  2RM5 A;  4HZ4 A;  2RII A;  4Q5R A;  1PSQ A;  1FHE A;  5D96 A;  3F63 A;  6GSX A;  2HZE B;  4G19 A;  2KP2 A;  3WGD A;  5BRT A;  1VRS D;  3G7J A;  2QA1 A;  3FR9 A;  2GSQ A;  1SU9 A;  4Z7X A;  6GSS A;  3LGC A;  4WF4 A;  2FY6 A;  4F0B A;  1FVK A;  4RI6 A;  3CMI A;  3MNG A;  2ON7 A;  5ECI B;  2YZU A;  4IJ3 A;  3CSH A;  2O89 A;  3NIV A;  5HFG A;  1H4O A;  3KP8 A;  4F03 A;  4Z2R A;  4KW6 A;  1AAZ A;  5IQY A;  3W8J A;  1TK5 B;  1NHY A;  3ZLP A;  1YQ1 A;  1PN0 A;  1B48 A;  2DKH A;  2LQQ A;  5ECR B;  1WE0 A;  4NXI A;  4GQC A;  4FH8 A;  3QFA C;  3GH6 A;  2YNX A;  4OCE A;  5D9W A;  12GS A;  5KOW A;  1XIY A;  2O85 A;  4ML1 A;  1OKT A;  1XVQ A;  4K7I A;  4RQR A;  3F9U A;  3GYK A;  3FY7 A;  2OKA A;  1Z7R A;  2JZS A;  4HJM A;  2M80 A;  4FQU A;  1CQG A;  4GST A;  4ACS A;  1GL8 A;  4XRA A;  3ZVJ D;  4WKW A;  4LL1 B;  3DVX A;  2CAQ A;  3TRP A;  3D4M A;  2O7K A;  3GTU A;  3R3E A;  4K7N A;  3GNJ A;  3Q6O A;  13GS A;  3A2X A;  3TOU A;  3MWH A;  2MMZ A;  4K2D A;  2PUK C;  2FNO A;  1Z6M A;  4JU5 A;  2FHE A;  3GRX A;  4N0V A;  4V2N A;  4TXO A;  1PX6 A;  5LCZ A;  4O5Q A;  3UIW A;  1VF2 A;  1V57 A;  1XWK A;  5BMU A;  2C0F A;  4F82 A;  2E0Q A;  4OD7 A;  4CY6 A;  2FWH A;  2GS3 A;  2VO4 A;  2RLI A;  3UEM A;  3P90 A;  4TKY A;  1O7U A;  3F6D A;  2PGT A;  3D5J A;  3GL3 A;  3RDW A;  3ZL5 A;  4DEJ A;  1XWA A;  5IMF A;  1X0R A;  4MNN A;  3TJJ A;  3TKR A;  2H6X A;  1R7H A;  3ERG A;  5IMD A;  2CT6 A;  2C80 A;  2HZF A;  5CRW A;  1PKW A;  4YKG A;  5FT3 A;  1Q98 A;  2HRF A;  3GV1 A;  2I1U A;  2VCT A;  2VM1 A;  2JAD A;  1OKD A;  1GSE A;  2BTO T;  5HFI A;  2R37 A;  2OE3 A;  1U3I A;  2X64 A;  1Z7P A;  4TXO B;  2WCI A;  4PQH A;  11GS A;  3P2A A;  3IXR A;  1M0U A;  1PL2 A;  3D22 A;  1OC8 A;  4JRR A;  1M99 A;  3ZML A;  1MD3 A;  1QGV A;  1GSU A;  4WR4 A;  1TU7 A;  4G10 A;  2LQO A;  1AIU A;  1LBK A;  4H86 A;  4TR3 A;  4EDY A;  4KX4 A;  3TRX A;  4LMV A;  2TRC P;  1PD2 1;  3EE2 A;  5AIX A;  4TR0 A;  3KD0 A;  4QQ7 A;  3Q19 A;  4FYC A;  3FZA A;  1V98 A;  4I8B A;  3LW9 A;  4AJ6 A;  2HRA A;  3N9J A;  1TK8 B;  3H4K A;  1RW1 A;  1R5P A;  3JCM L;  3PR8 A;  4J2F A;  1X5D A;  1U87 A;  4YQM A;  3WT2 A;  3GST A;  1MD4 A;  3G7Y A;  3KZQ A;  2LJR A;  2L57 A;  2DML A;  1NM3 A;  1FW1 A;  6GSU A;  4MZB A;  1W4V A;  4ZB9 A;  3UVT A;  2PWJ A;  3OR5 A;  2H70 A;  1K0M A;  3GKK A;  1S3C A;  3HA9 A;  2AYT A;  3F6F A;  3TKQ A;  4MPF A;  2OJL A;  4E8H A;  1JFU A;  2K8S A;  2HE3 A;  4IQA A;  2B7J A;  4KSM A;  1KBN A;  4K5R A;  6GST A;  3FR3 A;  1THO A;  4GSN A;  1K0C A;  4KDX A;  1O8W A;  3F4R A;  2YWM A;  5DDL A;  2H0I A;  1GTB A;  2VCV A;  1MDK A;  3IAS 2;  4KA0 A;  1RK4 A;  1T7P B;  3IOS A;  2DIZ A;  3Q18 A;  5B8B A;  3IE3 A;  2IIY A;  4WET A;  4EXJ A;  2GT5 A;  4HS1 A;  4O32 A;  3DGQ A;  2IWT A;  2B1K A;  3KTL A;  4FYU A;  4KF9 A;  3BD2 A;  1PX7 A;  1Y25 A;  1S3A A;  2VLU A;  3ZTL A;  4BWS A;  4PUA A;  2H71 A;  4K7O A;  17GS A;  4HOJ A;  4EKZ A;  1SD8 A;  3ZRD A;  2B6M A;  2CVK A;  2GQL A;  5GAP D;  1TRU A;  2FD3 A;  1YEP A;  3ED3 A;  2PU9 C;  3GKM A;  5DBQ A;  3HHV A;  1JZW A;  4ISD A;  1B9X C;  2FLS A;  2IFQ A;  4MF5 A;  4IGJ A;  2C4J A;  3FW2 A;  2L5O A;  2XPE A;  4N10 A;  2KLX A;  4OFT A;  1YF1 A;  1K0D A;  3ISO A;  4NPB A;  4PUR A;  3I9V 2;  1AUC A;  3MDK A;  1NW2 A;  4IBP A;  5DCH A;  2F9S A;  1OVN A;  2FA8 A;  3FK8 A;  4KCE A;  2VCW A;  2F51 A;  2ALB A;  4MDC A;  1A24 A;  1XVW A;  1G7E A;  2XC2 A;  3DML A;  4EL1 A;  4KDY A;  3PH9 A;  2FA4 A;  3BCK A;  4ECJ A;  2YWI A;  3NZN A;  3O3T A;  5B8A A;  3M3M A;  4Q5Q A;  1WJK A;  2H73 A;  4HQS A;  4MJA A;  3BBY A;  5F0G A;  2UZ8 A;  3GUS A;  3HJM A;  2M72 A;  2OAC A;  2V1M A;  5HR2 A;  4EE0 A;  4LA1 A;  2PN8 A;  4MLY A;  2IFQ B;  1YY7 A;  4IHU A;  5KEJ A;  3FZ9 A;  1R5A A;  1XBS A;  1QFN A;  2H8L A;  1IYI A;  3QR6 A;  4LLR A;  1J9B A;  2GT6 A;  3C8E A;  2P5Q A;  1M2A A;  1SK2 A;  4XS4 A;  4JZQ A;  5G30 A;  1SJZ A;  2GST A;  5KN0 A;  4K6X A;  2FGX A;  3RBT A;  1ZOF A;  2DBC A;  1PGT A;  3D4T A;  4FO5 A;  2A2R A;  2V32 A;  2HSM A;  2H6Y A;  4POM A;  1ST9 A;  1U88 A;  1X9S B;  1TRS A;  3A3T A;  1SKS B;  1M2D A;  1PQN A;  3E0U A;  1ZYN A;  4ID0 A;  5H5S A;  4F9Z A;  3EC3 A;  3GMF A;  2Z9S A;  1F37 A;  2R2J A;  3QPM A;  2IME A;  2C0D A;  2NBS A;  3L4N A;  3FZ5 A;  4WF5 A;  5AGY A;  4MJB A;  2YJ7 A;  2B7K A;  3L9V A;  1FB0 A;  1URM A;  3CBU A;  2IMI A;  3HVS A;  4K2X A;  1GRX A;  2MMO A;  3TCO A;  4YH2 A;  3ZVJ A;  4MA9 A;  1EP7 A;  2YAN A;  3C1R A;  2H19 A;  4XS4 B;  1B8X A;  3CTF A;  1SL2 B;  7GSS A;  3C73 A;  4NV5 A;  1Z9H A;  1ERU A;  3F3Q A;  1TRW A;  3V1W A;  4J57 E;  1CQH A;  2EIQ A;  1EGO A;  2WJU A;  3FMW A;  1YZX A;  4MAB A;  2XPD A;  3A5W A;  3GIX A;  2FWE A;  3M1G A;  1V40 A;  1HNA A;  4F2I A;  1EP8 A;  1OE7 A;  5D9T A;  2VL2 A;  3CRT A;  1A8Y A;  2I9H A;  1TDI A;  5ECK B;  1XCC A;  1BQ7 A;  1EEM A;  1M9A A;  3QD9 A;  5EPF A;  4G9H A;  1I5G A;  2WZ9 A;  1ACV A;  1GUK A;  2F8A A;  2R0P A;  1ZYE A;  2B5Y A;  2O87 A;  5ECP B;  3U5R E;  5D9V A;  3J7Y b;  2ON5 A;  2FWG A;  1VF3 A;  3M0F A;  3L9U A;  4BVY A;  4HU7 A;  2DJ1 A;  1M2B A;  5ECQ B;  1YKA A;  4BWQ A;  2XBI A;  2CX4 A;  1XOA A;  3KMO A;  4RUV A;  2JZR A;  2R6K A;  2HRK A;  3PIN A;  3HKR A;  2AAW A;  2XBQ A;  3G9B A;  3M8N A;  3L78 A;  3WT1 A;  1TTZ A;  2R4V A;  2L6C A;  2R0C A;  4NHW A;  18GS A;  2K6V A;  1B4Q A;  3EMP A;  2KHP A;  1GUL A;  1QK8 A;  4HQZ A;  3TKS A;  1TJD A;  2MBS A;  2YV9 A;  4Q5N A;  1N8J A;  2X8G A;  3QMX A;  4TR1 A;  4KDU A;  3O76 A;  1AQV A;  3KH7 A;  3RPN A;  5IM9 A;  1TW9 A;  2OBI A;  2H1A A;  5IO2 A;  4K0N A;  4EIQ A;  4ECC A;  5D9X A;  2IMF A;  4BVY B;  3EU4 A;  1OC9 A;  1ERW A;  5CRE A;  4PNG A;  4YAV A;  2OA7 A;  4KH7 A;  1G7O A;  4O5R A;  1ZZY A;  3CSI A;  3DEX A;  3KP9 A;  1BG5 A;  4IW9 A;  3M9K A;  4ZL8 A;  1WWJ A;  4MJC A;  3IAM 2;  1ZYQ B;  2C3T A;  3F3R A;  4E8E A;  1FOV A;  4PGT A;  5E59 A;  5G1L A;  3TUE A;  1YJ6 A;  5GZZ B;  5B6N A;  3RHB A;  3TJF A;  2AHE A;  1FAA A;  2DC5 A;  3RPP A;  2YWO A;  5HQP A;  2VLV A;  2H72 A;  2N5B A;  4TR1 B;  1SJ6 A;  2LKU A;  1EOG A;  2G0F A;  4AJ7 A;  4NHZ A;  3KMN A;  1K0O A;  4L8E A;  3S9F A;  4RQX A;  5IPH A;  2HFD A;  1OC9 B;  2C1Y A;  5A4U A;  5JCU A;  1BJX A;  3HJP A;  2WUL A;  3M9J A;  1EWX A;  5ECS A;  3RHC A;  4BA7 A;  3HY2 A;  2YWN A;  1OYJ A;  3C7M A;  3GX0 A;  4AF2 A;  1SJI A;  4GF0 A;  3N5O A;  2CA8 A;  1YF0 A;  4IEL A;  4L5O A;  4ZIJ A;  4EVM A;  2E2M A;  1F6M C;  1K0A A;  3TDG A;  4GLT A;  2P0G A;  1UA5 A;  1ABA A;  5CO3 A;  1UC7 A;  5J4U A;  1G0T A;  4ZL7 A;  4I2T A;  1ON4 A;  1OAZ A;  4LL4 B;  1T1V A;  2A4H A;  1XWG A;  1PRX A;  4IP6 A;  2GVP A;  5C00 A;  5J9B A;  3D0Z A;  4GCI A;  5ECL B;  4CY8 A;  1F3B A;  5JWO B;  1O81 A;  1U6T A;  4N11 A;  2P5R A;  1K0B A;  1JLV A;  1DSB A;  1YEX A;  4OO5 A;  3L9S A;  1SYX A;  1PKZ A;  1GUH A;  2REM A;  3LJR A;  4XS6 A;  3FEU A;  5CAX A;  1WPI A;  1SL0 B;  14GS A;  1DE2 A;  4V2L A;  5HFK A;  5F07 A;  3A2V A;  2X4A A;  1EV4 A;  4BPY A;  1KEB A;  3LWA A;  5ID2 B;  4OFM A;  3GA4 A;  1JHB A;  1F2E A;  1SK0 A;  4KE3 A;  4L0U A;  2IJY A;  2H1D A;  4O92 A;  1A8L A;  3AY8 A;  3UJ1 A;  2V6K A;  1MEK A;  1U3A A;  2LTK A;  3TKP A;  4ECB A;  5ENU A;  4F0C A;  3QOU A;  2BMX A;  3UBK A;  3ZRE A;  4EUY A;  1AQX A;  4AGS A;  4Z2U A;  5DAK A;  2HYX A;  5LD0 A;  6GSY A;  1K0N A;  4JR6 A;  2BJX A;  3F0I A;  1ZCP A;  1GUM A;  4O7H A;  3CRU A;  3G7I A;  1BYE A;  5C04 A;  2FCH A;  2DJK A;  1GLQ A;  2H30 A;  3E3E A;  3KH9 A;  1FOH A;  1GNW A;  3QAW A;  4TRX A;  5JCG A;  4JBB A;  4EDZ A;  4PQ1 A;  2JU5 A;  2LNS A;  4IN0 A;  2GZZ A;  5DVB A;  1WMJ A;  2CV4 A;  1GH2 A;  1I9D A;  4IP1 A;  2C8U A;  3P7X A;  4K1F A;  3GFK A;  3BJ5 A;  5ECO B;  5EVO A;  2GSR A;  2CAI A;  1R4W A;  4CDO A;  2LRN A;  3TKS E;  4QL9 A;  3HYP A;  1PN9 A;  2F8F A;  4XIH A;  1GNE A;  2YZH A;  5DAK B;  5KN2 A;  2QC7 A;  1EV9 A;  3ERF A;  2WGR A;  4K0G A;  4PUF C;  4DVC A;  1T8E B;  1ILO A;  4FIW A;  1GLP A;  5EY6 A;  3VWX A;  2I3Y A;  3WGE A;  3APS A;  2HT9 A;  1BAY A;  2H76 A;  4MH2 A;  3F8U A;  3HZ8 A;  1V9W A;  4QL7 A;  2PMT A;  5ABR A;  2FWF A;  2R3X A;  2GGT A;  2I81 A;  1WRY A;  1PA3 A;  2HSH A;  3VPQ A;  1XW9 A;  1ERT A;  5B7C A;  2VL3 A;  2ES7 A;  3IA1 A;  4K8M A;  4L0W A;  2YJH A;  1A2M A;  3ZYW A;  4GQF A;  1MDJ A;  1EZK A;  3GX8 A;  2KOK A;  2GLR A;  1Z5Y E;  4HZ2 A;  2HXK A;  4NAX A;  3HZ4 A;  3MYD A;  4MK3 A;  3TJK A;  4XTS A;  1X9M B;  3DKS A;  1USB A;  2GZP A;  1O6J A;  4TVE A;  5HR3 A;  2VIM A;  5DQY A;  3FHK A;  5G31 A;  2QA2 A;  1EEJ A;  2JSZ A;  3QAV A;  4XHM A;  1LJR A;  4FYB A;  2ZCT A;  5D93 A;  4GSS A;  5A4V A;  2DJ3 A;  5A5K A;  3IR4 A;  1S3D A;  2IL3 A;  5GAN D;  4ZIL A;  3Q74 A;  1T4Y A;  2B5E A;  3I69 A;  4MZC A;  4ZL9 A;  4G0K A;  5IOW A;  4ZBD A;  3ZZX A;  1AQW A;  5CRD A;  4DSR A;  2IMK A;  5F8B A;  4EO3 A;  5G5F A;  3MAK A;  3WYW A;  3DWV A;  3LQ7 A;  1QQ2 A;  2E2G A;  3TOT A;  5H5Q A;  4MF6 A;  4BVX A;  2DMM A;  2A2P A;  1XZO A;  1T00 A;  3K8N A;  3LOR A;  2H6Z A;  3HXS A;  3TRQ A;  2YN1 A;  3R2Q A;  5DAL A;  1TP9 A;  2N5F A;  5G1K A;  2VCX A;  2OE0 A;  4L5L A;  2VD0 A;  2GDR A;  3DYR A;  1X9W B;  3ZFL A;  2H01 A;  3BCI A;  4NWY A;  4ZBA A;  4MPG A;  3KJY A;  3IC8 A;  5J41 A;  4G0L A;  5F05 A;  2LEG A;  2JZT A;  1SD9 A;  1YKC A;  2H1G A;  5G5E A;  4TW5 A;  3VFI A;  3I43 A;  6GSW A;  3SBC A;  2C3N A;  2B1L A;  3QAG A;  3WD6 A;  1TU8 A;  1UVZ A;  2L59 A;  3ZIJ A;  1N2A A;  5DJL A;  2ZUP A;  1V2A A;  2VCZ A;  4BVX B;  3MIX A;  1G6W A;  4XS1 A;  3PPU A;  2H75 A;  5COH A;  1SYR A;  2PPT A;  5HR0 A;  1JZD A;  2HRN A;  5DAL B;  5E4W A;  1JLW A;  1ZL9 A;  3DXB A;  3GUR A;  1XPV A;  16GS A;  3EVI A;  1XWC A;  2DSA A;  5EL8 A;  1J0F A;  2NTO A;  1VGL A;  3VWW A;  1WIK A;  1TOF A;  5F06 A;  2LRT A;  2YPM A;  4V1A p;  4ZXG A;  3IK9 A;  2YCD A;  1W89 A;  2GQK A;  5AN1 A;  1XW6 A;  1AC1 A;  3A5I A;  1B4P A;  4ZB6 A;  2DLX A;  3GKN A;  2DJJ A;  2DJ0 A;  1VF1 A;  4X0X A;  2B3S A;  3EUR A;  4I97 A;  3US3 A;  2QSI A;  5AIV A;  4OWY A;  4LMW A;  3IHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...