5HR1A

Crystal structure of thioredoxin l107a mutant
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin-1
publication title Structural variability of E. coli thioredoxin captured in the crystal structures of single-point mutants.
pubmed doi rcsb
source organism Escherichia coli o157:h7
molecule tags Oxidoreductase
total genus 27
structure length 107
sequence length 107
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2016-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5hr1A00
2VM2A 1O6JA 1EOHA 2D2ZA 4HU7A 4QQ7A 2OKAA 4HEA2 14GSA 5KN1A 3A3TA 3HVXA 2VCTA 1OC9A 5DQYA 1GUKA 2YP6A 1X5DA 3EMPA 5D8IA 1AIUA 1U88A 3L9UA 2ALBA 1V40A 2M46A 4CW9A 1Y25A 4ZXGA 3VFIA 1QGVA 2IIYA 3UBLA 1GTAA 4GF0A 3ZFBA 2NTOA 3WGEA 1RQMA 4POMA 2E2MA 3DD3A 1LJRA 3ZMKA 2TRCP 5FHIA 1EEJA 1W89A 1EP7A 1AC1A 3IOSA 4IHUA 3D0ZA 2V2GA 1XIYA 5IMFA 1SJIA 1MEKA 4WEYA 4IQ1A 1X5EA 4OO5A 2MMNA 1S3DA 2MMAA 2V41A 17GSA 4G19A 1IYHA 4MF6A 3TKSA 3TKRA 20GSA 4FYUA 3FW2A 2QKEA 3GL5A 3S9FA 2ZUPA 1LBKA 1PRXA 1SYXA 1TRUA 2ZCTA 6GSXA 1XOAA 1XVQA 2CVBA 2YZHA 2AUVA 2WDUA 4ULXA 3UJ1A 2VLUA 4XHMA 1T00A 3EMXA 2HT9A 2LUSA 4LMWA 2VD1A 1BAYA 2B5XA 4IS0A 4LL4B 5GAPD 2QGVA 4OO4A 1R5AA 1ZGNA 1XWBA 2IMDA 2B7KA 1TK8B 4KNDA 2IMIA 2YV7A 2OE3A 1TI1A 1A8YA 4I6XA 3V1WA 1GUHA 3NOFA 5ID2B 2C0FA 6GSSA 1M2AA 5DVBA 3Q19A 1WRYA 1TI3A 3RHCA 3U6VA 3N9JA 1HNAA 3FYGA 3HJMA 2OADA 5G5FA 2LTKA 1ABAA 5F07A 4DSSB 1MTCA 1BJXA 3KD0A 4TXOA 3EWLA 2QSIA 4ID0A 2GVPA 2X99A 3F9UA 2C80A 3LXTA 1ERTA 4RI6A 1ERWA 2H0HA 2JSYA 4XRAA 4N30A 5GSTA 3F63A 1T3BA 5H5SA 1QXHA 3C1SA 1ERUA 1MDIA 2YZUA 4PURA 2F9SA 3A2WA 2PPTA 4GTUA 5EPFA 5A5KA 3ERGA 3H79A 4NAXA 19GSA 3ED3A 2OJLA 2CA8A 4N10A 1SD9A 4TR0A 2VL2C 1ACVA 1ZCPA 2FNOA 1QFNA 4J57E 4GRFA 3M0FA 1EP8A 3G9BA 5F0GA 1K0CA 1V58A 3E3EA 5DQSA 1BQ7A 4AJ6A 2GT6A 2JZRA 3H1NA 4K7NA 2ZNMA 5G1LA 5KN3A 1AUCA 3GKMA 5AIVA 2HZEB 5HFKA 2LQQA 2RM6A 4NHWA 2OA7A 1TU7A 3FEUA 1PL1A 5JWOB 4QL7A 4I2UA 1JZWA 1EWXA 2PWJA 4HUAA 1O81A 1XWCA 5JCUA 3L9VA 5CRGA 3FZ4A 4IP1A 2B1LA 3ZFLA 2AV4A 2CZ3A 3VI5A 5IOXA 1OC8A 2FLSA 2YCDA 1ZYQB 1JHBA 5HQPA 4O92A 5FT3A 2JZSA 1VF3A 1V98A 2M72A 2HE3A 2H1AA 2F8AA 3GN3A 4PNFA 2RM5A 1HYUA 4TR4A 3GKKA 3QFAC 5JCWA 1OE8A 1R26A 3FHKA 3ZVJD 5F06A 2O85A 4BVXA 3HHVA 2YOIA 3FR9A 1O8XA 2EC4A 1SK1A 5HR2A 3I69A 3CTFA 2WFCA 4V1Ap 3IV4A 1F3BA 5IIZA 4CHSA 1WJKA 1E2YA 2N5AA 1M2DA 2VAFA 4YQUA 1H4OA 4AJ8A 3QFBC 3TUEA 2RUEA 2GLRA 2AHEA 3QD9A 1N2AA 4MF5A 4MK3A 1HQOA 4K1FA 5EL8A 4G9HA 3FZ5A 5ECHB 1GTUA 2FWHA 5J5NA 3IA1A 1XW6A 4XRDA 1YKAA 2O7KA 1UC7A 1EGRA 4HI7A 3CRUA 1YEXA 2MBSA 2KLXA 3AY8A 4ECBA 1VRSD 2PUKC 3H8QA 3KP9A 2FWGA 3WGXA 2P0GA 4GLTA 1G0TA 3QAVA 3KP8A 3L9SA 4KDYA 4JBBA 2TRXA 3M9JA 10GSA 3F6DA 4ZL8A 2H76A 4K0GA 1U3AA 1ON4A 3FZ9A 1FOVA 4EVMA 3US3A 3ZIVA 2X8HA 1R4WA 3CSIA 4WXTA 3D4MA 9GSSA 2GZZA 3GSSA 3CMIA 3LYPA 3BCIA 1DBYA 2N5FA 3HKRA 2OACA 2JZTA 3HVSA 1ZMAA 4GSTA 4LLRA 2LQOA 3ZYWA 2V6KA 4NV5A 2XC2A 4L0WA 1XBSA 3KZQA 2LRTA 1HNCA 4O32A 3F6FA 5KN2A 4ZB6A 5C04A 3FRCA 4ZB9A 1Z3EA 3OR5A 1GSEA 5B8AA 2YWOA 2E2GA 2C0DA 3TB2A 2CZ2A 4LMVA 1GSDA 2OE0A 4RUVA 4GXZA 22GSA 4GCIA 3F0IA 1YEPA 1V57A 1EV9A 3QAGA 3IR4A 3IK7A 3TKPA 2DJ2A 1M0UA 2ON5A 3HY2A 1TP9A 4X0XA 4JR6A 3GFKA 3KCMA 5J9BA 3QOUA 1S3CA 4HQZA 4TR1B 5J4UA 3F3RA 4KX4A 2DMLA 3GKNA 3FZAA 4DSRA 2P5RA 2JU5A 1SD8A 1XOBA 3VLNA 1SL1B 3ZVJA 3DKSA 5JCGA 2ES7A 3NZNA 4KAEA 2HRNA 4TVEA 3DRNA 4IJIA 5ECQB 2WGRA 2L4QA 1FVKA 3LG6A 4EE0A 3HYPA 3APQA 5CAXA 4KDUA 1N8JA 4I2TA 4L0UA 5HR1A 1GSQA 2LSTA 1TDIA 1TRSA 2CV4A 1AQXA 3UBKA 3EVIA 2F51A 4K2DA 1ST9A 1XW5A 3GX0A 3APSA 4H86A 1MDKA 3M3MA 3LXZA 1GRXA 2VIMA 4V1Ag 5ID2A 2FWFA 5L71A 3J7Yk 4WETA 1SKRB 1J9BA 1JLVA 4GSSA 2FWEA 1O73A 4ECIA 5CRHA 5HFGA 2PERA 1Q98A 4DSSA 1K3OA 1GULA 4NXIA 4N0VA 4EDZA 3KMOA 4O5RA 3TRXA 2P31A 4MPFA 4JU5A 2LRNA 2H19A 5CNWA 1GNWA 3HVVA 4X1UA 1B9YC 3RDWA 3VWWA 3VWVA 3QR6A 2NDOA 3CXGA 3TOTA 2KP2A 2NPBA 3Q74A 4Z7XA 3TOUA 2H73A 2QC7A 3EU4A 2R37A 2V32A 4WF4A 1TRWA 3P8WA 5IO2A 5CO3A 3ZTLA 3BOAA 2K8SA 4HU9A 3P2AA 2X8CA 3KEBA 2YN1A 1XVWA 5DCGA 1JZRA 5G30A 2R2JA 1AW9A 2FHEA 1XWAA 11GSA 2C4JA 1K0DA 1TJDA 1R5PA 4ZBBA 1GTIA 5HR0A 5FWGA 2YV9A 4OD7A 1SK0A 3LSZA 3ME8A 2AYTA 4TR3A 2PGTA 2DJKA 4Q5FA 4POBA 1BX9A 3Q18A 7GSSA 1DSBA 2MBTA 1AQVA 3N5OA 2R3XA 5C00A 2PU9C 4EUYA 3IPZA 2HZEA 4TW5A 2C3NA 3R2QA 2DC5A 3ZL5A 3EU3A 3TDGA 1A2JA 2FY6A 4HOJA 4XTSA 3LORA 3GURA 5DAKB 2GSRA 2YWMA 1X9SB 4OWYA 1ERVA 4I5QA 5B7CA 4XS4B 1K3YA 1PL2A 4MLYA 1OKDA 2RIIA 1A2MA 3KGKA 5H5RA 1SL0B 1VF4A 2EIQA 3TJJA 4YH2A 5IPHA 4MH3A 1ILOA 3WT2A 4KGIA 3ZRDA 4HDEA 4RQXA 1THXA 4JZQA 4MABA 2KOKA 2IJYA 5AGYA 1J08A 3EINA 1OC3A 2CQ9A 1SYRA 5ENUA 4AGSA 4XCSA 2C1YA 1I9DA 5ECIB 4MJCA 4F03A 1XCCA 1PX6A 3IC4A 1PMTA 3TGZA 4MH2A 4HJMA 5JWRB 1F2EA 4ISDA 4ZL7A 4JE1A 2LS5A 3TJBA 4EKZA 2VCZA 3UVHA 3RPNA 2H66A 4PXOA 4P3YB 3GMFA 3KH9A 3EE2A 3HZ4A 1J0FA 1CQHA 4JRRA 1JLWA 1UA5A 3LGCA 2B6MA 1H75A 3UOMA 5AISA 1X5CA 5ECMB 3UMAA 5EY6A 5G5EA 4BWSA 4WBRD 1BG5A 4KSMA 3J7Yb 2BTOT 2CT6A 2LKUA 1O8WA 1F37A 1G6WA 3ZIJA 4IGJA 3ZZXA 1SKWB 2GDRA 4POKA 1QUWA 4N11A 5DBQA 4ECJA 4D73B 1S3AA 2LNTA 2I9HA 5IM9A 3LFLA 1R7HA 2GGTA 4KB3A 1A8LA 4ECCA 2M80A 2IWTA 1K0BA 4DSQA 2H72A 3ERFA 2VLVA 2FUG2 1GP1A 1T8EB 5D93A 2IFQB 2X64A 3E9JB 5CREA 2HI7A 3QPMA 1G6YA 3I6AA 1QQ2A 2JADA 4TN8A 5DJMA 2HNLA 2H1BA 4CDOA 3BCKA 4NMUA 1FB0A 3PH9A 1T4ZA 1PA3A 3L4NA 4OFTA 1M9BA 4PGTA 2KHPA 1GSUA 5A4VA 4YQVA 1FAAA 5CRDA 4RQRA 4MDCA 4KUNA 1BYEA 4NWYA 2BMXA 2FA4A 2H1GA 5DJLA 4J2FA 2I1UA 4ACSA 5ECRB 3GSTA 2J9HA 5IMZA 2CAQA 3TKQA 2X8GA 1XW9A 1PN9A 1TOFA 2G2QA 2A2SA 1YF1A 2VO4A 2L57A 2I81A 1YJ6A 4X43A 2YWNA 1W4VA 6GSTA 5IOWA 3LEFA 5B6MA 3H93A 2VL3A 4WBJA 4EO3A 2XPDA 1TTZA 2VL2A 2DSAA 1ZL9A 1USBA 4TR1A 3HA9A 3GRXA 4NHZA 5G31A 3VPTA 1URMA 1UN2A 2HFDA 3UL3A 2VLTA 1TRVA 1DUGA 1GUMA 4K9ZA 1SU9A 3I9V2 4POLA 4I8BA 1XZOA 1GLQA 2VUPA 3VI7A 2WB9A 2A4VA 1FO5A 2DLXA 5CRWA 1YQ1A 2P5QA 3D5JA 3GL3A 4ZBDA 2KUCA 6GSYA 2FD3A 1U6TA 3HZ8A 5IO0A 1M2BA 5DCHA 4Q5RA 1SL2B 3G7JA 2K9FA 4F2IA 5D9XA 4Q5QA 4YAPA 3D22A 4PX1A 4JR4A 2IN3A 1YY7A 1B4QA 4MZCA 2H70A 3EURA 2DIYA 2LRCA 1HD2A 3IHQA 3RBTA 4LL1B 3A5WA 3TKSC 5H5QA 2JACA 4I97A 1E6BA 3IAS2 3PINA 4OCEA 4V2NA 5GSSA 1AQWA 4IP6A 3W6GA 1T1VA 1MDJA 3EYTA 1GWCA 1Z7RA 2WCIA 3ZMLA 3KMNA 5D9WA 2DJ0A 4HZ4A 1XXUA 4OCFA 2KP1A 5J41A 2LNSA 4KSOA 4EDYA 6GSWA 5DALB 1SJZA 2R6KA 4F0CA 4WR5A 1HNBA 3FR3A 3JCML 2K8VA 3RHBA 3FK8A 5ECLB 2YPMA 1GH2A 3IBHA 3CTGA 2Z9SA 2VL9A 2GQKA 1PSQA 2DJ3A 1Z6MA 3DMLA 4PUAA 3ME7A 4FYCA 3D4TA 2OBKA 1M9AA 3WD6A 4N0ZA 1T4YA 3DEXA 2RLIA 1A23A 1T7PB 3IK9A 4ZB8A 1OE7A 5LNKe 3LWAA 2K6VA 2YANA 3DGQA 4BA7A 3CBUA 3F4TA 1WWJA 3C7MA 1Z9HA 1WE0A 5COHA 3VURA 1OVNA 3VK9A 1OAZA 1OYJA 4MJAA 3WT1A 2PVQA 1YKCA 2H71A 2C3TA 1NW2A 4MMMA 4TRXA 3I43A 4XS6A 3A2VA 4K0NA 1TKDB 3ISOA 4NV2A 4IN0A 2C0GA 2V6OA 1M99A 3KXOA 4HZ2A 2H6XA 1KEBA 3CRTA 1YZXA 2AB6A 4F82A 1WP0A 1F6MC 2MZCA 4ZIJA 3GH9A 2GS3A 3MWHA 1K0OA 2VCVA 4DVCA 1FW1A 3F4SA 2MYGA 3M1GA 4EF0A 5CP1A 4KCAA 1TW9A 4KDXA 1B8XA 2IPAA 3O3TA 2RUFA 4BWQA 3TJKA 2GZYA 4FO5A 5DAKA 1I5GA 3GA4A 2DMMA 3EC3A 2WZ9A 2WULA 1C72A 1EEMA 1ZYEA 1AAZA 4V2LA 1A0FA 2DBCA 2OBIA 1THOA 5G2ZA 4IELA 5JWQB 4XS4A 2VCQA 4IW9A 1SKSB 4IKHA 3IE3A 4IVFA 2OE1A 4V2MA 3DIEA 1JZOA 3C8EA 3W8SA 3GX8A 5ABRA 2VM1A 2R5GA 2H0IA 3G7YA 4K8MA 3GTUB 2O8VB 1XWKA 3CYNA 4FH8A 2CX3A 1A24A 1G7EA 1X0RA 1K0NA 3GHAA 4K7OA 4MA9A 2VD0A 1Q4JA 1FHEA 5A4WA 3IRAA 5F8BA 3FR6A 3UAPA 5B6NA 2IMKA 5ECNB 2XPEA 3TRPA 16GSA 2FCHA 4YAVA 2PN8A 1Z7PA 2G0FA 2J23A 5ELAA 1EOGA 1GSFA 3K8NA 3DWVA 3UARA 3QCPA 1Z6NA 2FA8A 1VF1A 3CSJA 2PMTA 3LJRA 2HZFA 1IYIA 5KEJA 3H4KA 1A0RP 3LYKA 1GSSA 4BL7A 3APOA 2H75A 5INYA 4GSNA 1UVZA 3F4RA 4MZWA 1OC9B 2EIOA 3TCOA 3KIJA 1B4PA 3QMXA 2XBQA 4XIHA 3L0HA 2H01A 4G2EA 1SENA 3G7IA 2HYXA 4BPYA 3P90A 4LA1A 1PQNA 4PUFC 3PR8A 1DE1A 2GSSA 1B48A 2GQLA 5ECSA 4GQCA 2CAIA 2O87A 3HD5A 1MD4A 2L6DA 3ERWA 2YWIA 4K6XA 4MJEA 3ZLPA 1WOUA 2K18A 4D73A 4GWRA 5ELGA 3F3QA 4DEJA 4G10A 3MNGA 2H6YA 4OMVA 3MDKA 3FY7A 2XHFA 3FKFA 5HFIA 3A2XA 5LD0A 1YDKA 5LCZA 3QAWA 1U87A 2O89A 3RAZA 4MF7A 1GNEA 2IFQA 4HQSA 4K7IA 3DVWA 3RPPA 5B8BA 2WS2A 3KTLA 3ZREA 1NM3A 1RW1A 4AJ7A 3WYWA 4MP4A 2C0EA 4TOPA 1K3LA 1VGLA 1SJ6A 5GZZB 4OFMA 3VPQA 3E0UA 2L5LA 4MJBA 1QK8A 4PNGA 2B5EA 4EXJA 3GUSA 3GKXA 4EL1A 2GSTA 1O85A 1GL8A 5G1KA 4QL9A 4RI7A 3C71A 3DYRA 1VF2A 1U3IA 1K0MA 2F8FA 2DIZA 2LJKA 1PKZA 2MMOA 3O6TA 4PQ1A 3KH7A 1JZDA 2CVDA 2HLSA 2AJQB 3BD2A 3C73A 1WPIA 3HJPA 4TXVA 1FG4A 1RK4A 4Q5NA 3SWLA 5IMAA 3BJ5A 5D9TA 4EC0A 3ZITA 1BEDA 4AF2A 4YQMA 3UEMA 3KM6A 2YNXA 2E7PA 3IAM2 5D9VA 3DXBA 18GSA 4BVYA 2AAWA 4TXOB 5IPGA 1GSYA 3UIWA 1K0AA 5IMVA 3TRQA 1MD3A 3C1RA 2B7JA 2B5YA 2LEGA 5IMCA 2L6CA 2DJJA 4J56E 2H0GA 3W8JA 4L8EA 3VWXA 1F3AA 2FGXA 4IBPA 4KCEA 1B9XC 1GLPA 2BJXA 4WKWA 2C3QA 5AN1A 5CYYA 4OFNA 3IXRA 1TU8A 2DJ1A 2CX4A 2IMFA 3M9KA 1CQGA 2I4AA 4MZBA 5GAND 1F9MA 1NSWA 2H8LA 1PX7A 5HR3A 3GIXA 2IMEA 5E4WA 13GSA 3LQ7A 6GSVA 4O7HA 5J3RA 2H6ZA 4E8EA 3GV1A 3DVXA 2I3YA 3GH6A 1LU4A 4GQFA 2E0QA 4MPGA 2C8UA 5DALA 4JEDA 3Q6OA 2IL3A 2GSQA 1WIKA 4E8HA 4PQIA 2GQMA 1PD21 3MSZA 1O7UA 3VWUA 4KE3A 1ZOFA 3D21A 3TJGA 2H1DA 1OKTA 2HRFA 1XWGA 4IQAA 5AIXA 3SBCA 1ML6A 3M8NA 5ECPB 2H74A 1NHYA 1DE2A 4ZILA 3HJOA 1EV4A 2H30A 2NVLA 2F3MA 2VCXA 1TK0B 1YF0A 2MMZA 4HJ2A 2N5BA 5DDLA 1G7OA 2PVOC 4ML1A 4L5LA 3QDNA 4HS1A 3IDVA 6GSUA 5EVOA 1A2LA 3GYKA 1KBNA 5A4UA 5F05A 4TKYA 2GT5A 1Y6EA 4KH7A 5ECKB 4F9ZA 2L59A 3TJFA 4ZL9A 8GSSA 2VOCA 1KTEA 4WF5A 1FVJA 1V9WA 1M7TA 3MAKA 2GZPA 1ZZYA 3BBYA 2WJUA 4KW6A 4ILFA 3P7XA 1X9WB 1EGOA 5IMDA 3L78A 1FB6A 4F0BA 3HCZA 2TIRA 2B3SA 3PGTA 4ML6A 2B1KA 2REMA 1PGTA 3KJYA 4IJ3A 3CSHA 2EIRA 2LJAA 1QMVA 5D73A 3HDCA 4ZBAA 1TK5B 4XS1A 4PQHA 1EZKA 5KN0A 1KNGA 2GTUA 1XFLA 4FIWA 4KA0A 2A2RA 2PBJA 12GSA 1SK2A 2VCWA 1X9MB 5IQYA 4MCUA 4L5OA 3KTBA 2YJ7A 2ON7A 3D6IA 2HSHA 5J9CA 2LV3A 2XBIA 1AXDA 3NIVA 4WR4A 3GNJA 2WRTA 5ECOB 3GTUA 3F8UA 4FYBA 5D96A 1Z5YE 3TKSE 1XPVA 2V1MA 2HXKA 1PKWA 2YJHA 2JSZA 2L5OA 1JFUA 2CVKA 1NHOA 3HXSA 2R4VA 5E59A 2NBSA 4NPBA 3U5RE 1GTBA 1V2AA 3O76A 2L4CA 3UVTA 2JL4A 1TXXA 2HSYA 1WMJA 3WGDA 2LJRA
chains in the Genus database with same CATH superfamily
2VM2A 1O6JA 1EOHA 2D2ZA 4HU7A 4QQ7A 2OKAA 4HEA2 14GSA 5KN1A 3A3TA 3HVXA 2VCTA 1OC9A 5DQYA 1GUKA 2YP6A 1X5DA 3EMPA 5D8IA 1AIUA 1U88A 3L9UA 4YKFA 2ALBA 1V40A 2M46A 4CW9A 1Y25A 2R0PA 4ZXGA 4K5SA 3VFIA 1QGVA 2IIYA 3UBLA 1GTAA 4GF0A 3ZFBA 2NTOA 3WGEA 1RQMA 4POMA 2E2MA 3DD3A 1LJRA 3ZMKA 2TRCP 5FHIA 1EEJA 1W89A 1EP7A 1AC1A 3IOSA 4IHUA 3D0ZA 4KF9A 2V2GA 1XIYA 5IMFA 1SJIA 1MEKA 4WEYA 4IQ1A 1X5EA 4OO5A 2MMNA 1S3DA 2MMAA 2V41A 17GSA 4G19A 1IYHA 4MF6A 3TKSA 3TKRA 20GSA 4FYUA 3FW2A 2QKEA 3GL5A 3S9FA 2ZUPA 1LBKA 1PRXA 1SYXA 1TRUA 2ZCTA 6GSXA 1XOAA 1XVQA 2CVBA 2YZHA 2AUVA 2WDUA 4ULXA 3UJ1A 2VLUA 4XHMA 1T00A 3EMXA 2HT9A 2LUSA 4LMWA 2VD1A 1BAYA 2B5XA 4IS0A 4LL4B 5GAPD 2QGVA 4OO4A 1R5AA 1ZGNA 1XWBA 2IMDA 2B7KA 1TK8B 4KNDA 2IMIA 2YV7A 2OE3A 1TI1A 4HSCX 1A8YA 4I6XA 3V1WA 1GUHA 2X4AA 3NOFA 5ID2B 1XG8A 2C0FA 6GSSA 1M2AA 5DVBA 3Q19A 1WRYA 1TI3A 3RHCA 3U6VA 3N9JA 1HNAA 3FYGA 3HJMA 2OADA 5G5FA 2LTKA 1ABAA 5KOXA 5F07A 4DSSB 1MTCA 1BJXA 3KD0A 4TXOA 3EWLA 2QSIA 4ID0A 2GVPA 2X99A 3F9UA 2C80A 3LXTA 1ERTA 4RI6A 1ERWA 2H0HA 2JSYA 4XRAA 4N30A 5GSTA 3F63A 3LW9A 1T3BA 5H5SA 2R0CA 1QXHA 3C1SA 1ERUA 1MDIA 2YZUA 4PURA 2F9SA 3A2WA 2PPTA 4GTUA 5EPFA 5A5KA 3ERGA 3H79A 4NAXA 19GSA 3ED3A 2OJLA 2CA8A 4N10A 1SD9A 4TR0A 2VL2C 1ACVA 1ZCPA 2FNOA 1QFNA 4J57E 4GRFA 3M0FA 1EP8A 3G9BA 5F0GA 1K0CA 1V58A 3E3EA 5DQSA 1BQ7A 4AJ6A 2GT6A 2JZRA 3H1NA 4K7NA 2ZNMA 5G1LA 5KN3A 1AUCA 3GKMA 5AIVA 2HZEB 5HFKA 2LQQA 2RM6A 4NHWA 2OA7A 1TU7A 3FEUA 1PL1A 5JWOB 4QL7A 4I2UA 1JZWA 1EWXA 2PWJA 4HUAA 1O81A 1XWCA 5JCUA 3L9VA 5CRGA 3FZ4A 4IP1A 4A5PA 2B1LA 3ZFLA 2AV4A 2CZ3A 3VI5A 5IOXA 1OC8A 2FLSA 2YCDA 1ZYQB 1M3JA 1JHBA 5HQPA 4O92A 4Z2TA 5FT3A 2JZSA 1VF3A 1V98A 2M72A 2HE3A 2H1AA 2F8AA 3GN3A 3IHGA 4PNFA 2RM5A 1HYUA 4TR4A 3GKKA 3QFAC 5JCWA 1OE8A 1R26A 3FHKA 3ZVJD 5F06A 2O85A 4BVXA 3HHVA 2YOIA 3FR9A 1O8XA 2EC4A 1SK1A 5HR2A 2R0GA 3I69A 3CTFA 2WFCA 4V1Ap 3IV4A 1F3BA 1ZYPA 5IIZA 4CHSA 1WJKA 1E2YA 2N5AA 1M2DA 4EIQA 2VAFA 4YQUA 1H4OA 4AJ8A 3QFBC 3TUEA 2RUEA 2GLRA 4BIKA 2AHEA 3QD9A 1N2AA 4MF5A 4MK3A 1HQOA 4K1FA 5EL8A 4G9HA 3FZ5A 5ECHB 1GTUA 4X4JA 2FWHA 5J5NA 3IA1A 1XW6A 4XRDA 1YKAA 2O7KA 1UC7A 1EGRA 4HI7A 3CRUA 1YEXA 2MBSA 2KLXA 3AY8A 4ECBA 1VRSD 2PUKC 3H8QA 3KP9A 2FWGA 3WGXA 2P0GA 4GLTA 2QA1A 1G0TA 3QAVA 3KP8A 3L9SA 4KDYA 4JBBA 2TRXA 3M9JA 10GSA 3F6DA 4ZL8A 2H76A 4K0GA 1U3AA 1ON4A 3FZ9A 1FOVA 4EVMA 3US3A 3ZIVA 2X8HA 1R4WA 3CSIA 4WXTA 3D4MA 9GSSA 2GZZA 3GSSA 3CMIA 3LYPA 3BCIA 1DBYA 2N5FA 3HKRA 2OACA 2JZTA 3HVSA 1ZMAA 4GSTA 4LLRA 2LQOA 2X49A 3ZYWA 2V6KA 4NV5A 2XC2A 4L0WA 1XBSA 3KZQA 2LRTA 1HNCA 2DKIA 4O32A 3F6FA 5KN2A 4ZB6A 5C04A 3FRCA 4ZB9A 1Z3EA 3OR5A 1GSEA 5B8AA 2YWOA 2E2GA 2C0DA 3TB2A 2CZ2A 4LMVA 1GSDA 2OE0A 4RUVA 4GXZA 22GSA 4GCIA 3F0IA 1YEPA 1V57A 1EV9A 3QAGA 3IR4A 3IK7A 3TKPA 2DJ2A 1M0UA 2ON5A 3HY2A 1TP9A 4X0XA 4JR6A 3GFKA 3KCMA 5J9BA 3QOUA 1S3CA 4HQZA 4TR1B 5J4UA 3F3RA 4KX4A 2DMLA 3GKNA 3FZAA 4DSRA 2P5RA 2JU5A 1SD8A 1XOBA 3VLNA 1SL1B 3ZVJA 3DKSA 5JCGA 2ES7A 3NZNA 4KAEA 2HRNA 4TVEA 3DRNA 4IJIA 5ECQB 2WGRA 2L4QA 1FVKA 3LG6A 4EE0A 3HYPA 3APQA 5CAXA 4KDUA 4G0LA 1ZYNA 1N8JA 4I2TA 4L0UA 5HR1A 3FMWA 1GSQA 2LSTA 1TDIA 1TRSA 2CV4A 1AQXA 3UBKA 3EVIA 2F51A 4K2DA 1ST9A 1XW5A 3GX0A 3APSA 4H86A 2LJRA 1MDKA 3M3MA 3LXZA 1GRXA 2VIMA 4V1Ag 5ID2A 2FWFA 5L71A 3J7Yk 4WETA 1SKRB 1J9BA 1JLVA 4GSSA 2FWEA 2QA2A 1O73A 4ECIA 5CRHA 5HFGA 2PERA 1Q98A 4DSSA 1K3OA 1GULA 4NXIA 4N0VA 4EDZA 3KMOA 4O5RA 3TRXA 2P31A 4MPFA 4JU5A 2LRNA 2H19A 5CNWA 1GNWA 3HVVA 4X1UA 1B9YC 3RDWA 3VWWA 3VWVA 3QR6A 2NDOA 3CXGA 3TOTA 2KP2A 2NPBA 3Q74A 4Z7XA 3TOUA 2H73A 2QC7A 2HRKA 3EU4A 2R37A 2V32A 4WF4A 1TRWA 3P8WA 5IO2A 5CO3A 3ZTLA 3BOAA 2K8SA 4HU9A 3P2AA 2X8CA 3KEBA 2YN1A 1XVWA 5DCGA 1JZRA 5G30A 2R2JA 1AW9A 2FHEA 2UZ8A 1XWAA 11GSA 2C4JA 1K0DA 1TJDA 1R5PA 4ZBBA 1GTIA 5HR0A 5FWGA 2YV9A 4OD7A 1SK0A 3LSZA 4ICYA 3ME8A 2AYTA 4TR3A 2PGTA 2DJKA 3EPTA 4Q5FA 4POBA 1BX9A 3Q18A 7GSSA 1DSBA 2MBTA 1AQVA 5BRTA 3N5OA 2R3XA 5C00A 2PU9C 4EUYA 3IPZA 2HZEA 1PFOA 4TW5A 2C3NA 3R2QA 2DC5A 3ZL5A 3EU3A 3TDGA 1A2JA 2FY6A 4HOJA 4XTSA 3LORA 3GURA 5DAKB 3PPUA 2GSRA 2YWMA 1X9SB 4OWYA 1ERVA 4I5QA 5B7CA 1S3RA 4XS4B 1K3YA 1PL2A 4MLYA 1OKDA 2RIIA 1A2MA 3KGKA 5H5RA 1SL0B 1VF4A 2EIQA 3TJJA 4YH2A 5IPHA 4MH3A 1ILOA 3WT2A 4KGIA 3ZRDA 4HDEA 4RQXA 1M3IA 1THXA 4JZQA 4MABA 5BMUA 2KOKA 2IJYA 5AGYA 1J08A 3EINA 1OC3A 2CQ9A 1SYRA 5ENUA 4AGSA 4XCSA 2C1YA 1I9DA 5ECIB 4MJCA 4F03A 1XCCA 1PX6A 3IC4A 1PMTA 3TGZA 4MH2A 4HJMA 5JWRB 1F2EA 4ISDA 4ZL7A 4JE1A 2LS5A 3TJBA 4EKZA 2VCZA 3UVHA 3RPNA 2H66A 4PXOA 4P3YB 3GMFA 3KH9A 3EE2A 3HZ4A 1J0FA 1CQHA 4JRRA 1JLWA 1UA5A 3LGCA 2B6MA 1H75A 3UOMA 5AISA 1X5CA 5ECMB 3UMAA 5EY6A 5G5EA 4BWSA 4WBRD 1BG5A 4KSMA 3J7Yb 2BTOT 2CT6A 2LKUA 1O8WA 1F37A 1G6WA 4O5UA 3ZIJA 4IGJA 3ZZXA 1SKWB 2GDRA 4POKA 1QUWA 4N11A 5DBQA 4ECJA 4D73B 1S3AA 2LNTA 2I9HA 5IM9A 3LFLA 1R7HA 3HVNA 2GGTA 4KB3A 1A8LA 4ECCA 2M80A 2IWTA 1K0BA 4DSQA 2H72A 3ERFA 2VLVA 2FUG2 1GP1A 1T8EB 5D93A 2IFQB 2X64A 3E9JB 5CREA 2HI7A 3QPMA 1G6YA 3I6AA 1QQ2A 2JADA 4TN8A 5DJMA 2HNLA 2H1BA 4CDOA 3BCKA 4NMUA 1FB0A 3PH9A 1T4ZA 1PA3A 3L4NA 4OFTA 1M9BA 4PGTA 2KHPA 1GSUA 5A4VA 4YQVA 1FAAA 5CRDA 4RQRA 4MDCA 4KUNA 1BYEA 4NWYA 2BMXA 2FA4A 2H1GA 5DJLA 4J2FA 2I1UA 4ACSA 5ECRB 3GSTA 2J9HA 5IMZA 2CAQA 3TKQA 2X8GA 1XW9A 1PN9A 1TOFA 2G2QA 2A2SA 1YF1A 2VO4A 2L57A 2I81A 1YJ6A 4X43A 2YWNA 1W4VA 6GSTA 5IOWA 3LEFA 5B6MA 3H93A 3MIXA 2VL3A 4WBJA 4EO3A 2XPDA 1TTZA 2VL2A 2DSAA 1ZL9A 1USBA 4BVYB 4TR1A 3HA9A 3GRXA 4NHZA 5G31A 3VPTA 1URMA 1UN2A 2HFDA 3UL3A 2VLTA 1TRVA 1DUGA 1GUMA 4K9ZA 1SU9A 3I9V2 4POLA 4I8BA 1XZOA 1GLQA 2VUPA 3VI7A 2WB9A 2A4VA 3IC8A 1FO5A 2DLXA 5CRWA 1YQ1A 2P5QA 3D5JA 4G0IA 3GL3A 4ZBDA 2KUCA 6GSYA 2FD3A 1U6TA 4Z2UA 3HZ8A 5IO0A 1M2BA 5DCHA 4Q5RA 1SL2B 3G7JA 2K9FA 4F2IA 5D9XA 4Q5QA 4YAPA 3D22A 4PX1A 4JR4A 2IN3A 1YY7A 1B4QA 4MZCA 2H70A 3EURA 2DIYA 2LRCA 1HD2A 3IHQA 3RBTA 4LL1B 3A5WA 3TKSC 5H5QA 2JACA 4I97A 1E6BA 3IAS2 3PINA 4OCEA 4V2NA 5GSSA 1AQWA 4IP6A 3W6GA 1T1VA 1MDJA 3EYTA 1GWCA 1Z7RA 2WCIA 3ZMLA 3KMNA 5D9WA 2DJ0A 4HZ4A 1XXUA 4OCFA 2KP1A 5J41A 2LNSA 4KSOA 4EDYA 6GSWA 2DKHA 5DALB 1SJZA 2R6KA 4F0CA 4WR5A 1HNBA 3FR3A 3CQFA 3JCML 2K8VA 3RHBA 3FK8A 2HSMA 5ECLB 3MYDA 2YPMA 1GH2A 3IBHA 3CTGA 2Z9SA 2VL9A 2GQKA 1PSQA 2DJ3A 1Z6MA 3DMLA 4PUAA 3ME7A 4FYCA 3D4TA 2OBKA 1M9AA 3WD6A 4N0ZA 1T4YA 3DEXA 2RLIA 1A23A 1T7PB 3IK9A 4ZB8A 1OE7A 5LNKe 4O5QA 3LWAA 2K6VA 2YANA 3DGQA 4BA7A 3CBUA 3F4TA 1WWJA 3C7MA 1Z9HA 1WE0A 5COHA 3VURA 1OVNA 3VK9A 1OAZA 1OYJA 4MJAA 3WT1A 2PVQA 1YKCA 2H71A 2C3TA 1NW2A 4MMMA 4TRXA 3I43A 4XS6A 2HRAA 3A2VA 4K0NA 1TKDB 3ISOA 1FOHA 4NV2A 4IN0A 2C0GA 2V6OA 1M99A 3KXOA 4HZ2A 2H6XA 1KEBA 3CRTA 4CY8A 1YZXA 2AB6A 4F82A 1WP0A 1F6MC 2MZCA 4ZIJA 3GH9A 2GS3A 3MWHA 1K0OA 2VCVA 4DVCA 1FW1A 3F4SA 2MYGA 3M1GA 4EF0A 5CP1A 4KCAA 1TW9A 4G0KA 4KDXA 1B8XA 2IPAA 3O3TA 2RUFA 4BWQA 3TJKA 2GZYA 4FO5A 5DAKA 1I5GA 3GA4A 2DMMA 3EC3A 2WZ9A 2WULA 1C72A 1EEMA 1ZYEA 1AAZA 4V2LA 1A0FA 2DBCA 2OBIA 1THOA 5G2ZA 4IELA 5JWQB 4XS4A 2VCQA 4IW9A 1SKSB 4IKHA 3IE3A 4IVFA 2OE1A 4V2MA 3DIEA 1JZOA 3C8EA 3W8SA 3GX8A 5ABRA 2VM1A 2R5GA 2H0IA 3G7YA 4K8MA 3GTUB 2O8VB 1XWKA 3CYNA 4FH8A 2CX3A 1A24A 1G7EA 1X0RA 1K0NA 3GHAA 4K7OA 4MA9A 2VD0A 1Q4JA 1FHEA 5A4WA 3IRAA 5F8BA 3FR6A 3UAPA 5B6NA 2IMKA 5ECNB 2XPEA 3TRPA 16GSA 2FCHA 4YAVA 2PN8A 1Z7PA 2G0FA 2J23A 5ELAA 1EOGA 1GSFA 3K8NA 3DWVA 3UARA 3QCPA 1Z6NA 2FA8A 1VF1A 3CSJA 2PMTA 3LJRA 2HZFA 1IYIA 5KEJA 3H4KA 1A0RP 3LYKA 1GSSA 4BL7A 3APOA 2H75A 5INYA 4GSNA 1UVZA 3F4RA 4MZWA 1OC9B 2EIOA 3TCOA 3KIJA 1B4PA 3QMXA 2XBQA 4XIHA 3L0HA 2H01A 4G2EA 1SENA 3G7IA 2HYXA 4BPYA 3P90A 4LA1A 1PQNA 4PUFC 3PR8A 1DE1A 2GSSA 1B48A 2GQLA 5ECSA 4GQCA 2CAIA 2O87A 4K5RA 3HD5A 1MD4A 4USSA 2L6DA 3ERWA 2YWIA 4K6XA 4MJEA 2A4HA 3ZLPA 1WOUA 2K18A 4D73A 4GWRA 5ELGA 3F3QA 4DEJA 4G10A 3MNGA 2H6YA 4OMVA 3MDKA 3FY7A 2XHFA 3FKFA 5HFIA 3A2XA 5LD0A 1YDKA 5LCZA 3QAWA 4Z2RA 1U87A 2O89A 3RAZA 4MF7A 4EIPA 1GNEA 2IFQA 4HQSA 4K7IA 3DVWA 3R3EA 3RPPA 5B8BA 2WS2A 3KTLA 3ZREA 1NM3A 1RW1A 4AJ7A 3WYWA 4MP4A 2C0EA 4TOPA 1K3LA 1VGLA 1SJ6A 5GZZB 4OFMA 3VPQA 3E0UA 2L5LA 4MJBA 1QK8A 4PNGA 2B5EA 4EXJA 3GUSA 4BL7B 3GKXA 4EL1A 2GSTA 1O85A 1GL8A 5G1KA 4QL9A 4RI7A 3C71A 3DYRA 1VF2A 1U3IA 1K0MA 2F8FA 2DIZA 2LJKA 1PKZA 2MMOA 3O6TA 4PQ1A 3KH7A 1JZDA 2CVDA 2HLSA 2AJQB 3BD2A 3C73A 1WPIA 3HJPA 4TXVA 1FG4A 1RK4A 4Q5NA 3SWLA 5IMAA 3BJ5A 5D9TA 4EC0A 3ZITA 1BEDA 4AF2A 4YQMA 3UEMA 3KM6A 4FQUA 2YNXA 2E7PA 3IAM2 5D9VA 3DXBA 18GSA 4BVYA 2AAWA 4TXOB 5IPGA 1GSYA 3UIWA 1K0AA 5IMVA 4PTSA 3TRQA 1MD3A 3C1RA 2B7JA 2B5YA 2LEGA 5IMCA 2L6CA 2DJJA 4J56E 2H0GA 3W8JA 4L8EA 3VWXA 1F3AA 2FGXA 4IBPA 4KCEA 1B9XC 1GLPA 2BJXA 4WKWA 2C3QA 5AN1A 5CYYA 4OFNA 3IXRA 1TU8A 2DJ1A 2CX4A 2IMFA 3M9KA 1CQGA 2I4AA 4MZBA 5GAND 1F9MA 1NSWA 2H8LA 1PX7A 5HR3A 3GIXA 4YKGA 2IMEA 5E4WA 13GSA 3LQ7A 6GSVA 4O7HA 5J3RA 2H6ZA 4E8EA 3GV1A 2A2PA 3DVXA 2I3YA 3GH6A 1LU4A 4GQFA 2E0QA 4MPGA 2C8UA 5DALA 4JEDA 3Q6OA 2IL3A 2GSQA 1WIKA 4E8HA 4PQIA 2GQMA 1PD21 3MSZA 1O7UA 3VWUA 4KE3A 1ZOFA 4MNNA 3D21A 3TJGA 2H1DA 1OKTA 2HRFA 1XWGA 4IQAA 5AIXA 3SBCA 1ML6A 3M8NA 4CY6A 5ECPB 2H74A 1NHYA 1DE2A 4ZILA 3HJOA 1EV4A 2H30A 2NVLA 2F3MA 2VCXA 1TK0B 1YF0A 2MMZA 4HJ2A 2N5BA 5DDLA 1G7OA 2PVOC 4ML1A 4L5LA 3QDNA 4HS1A 3IDVA 6GSUA 5EVOA 1A2LA 3GYKA 1KBNA 5A4UA 5F05A 4TKYA 2GT5A 1Y6EA 4KH7A 5ECKB 4F9ZA 2L59A 3TJFA 4ZL9A 8GSSA 2VOCA 1KTEA 4BVXB 4WF5A 1FVJA 1V9WA 1M7TA 3MAKA 2GZPA 1ZZYA 3BBYA 2WJUA 4KW6A 4ILFA 4K2XA 3P7XA 1X9WB 1EGOA 5IMDA 3L78A 1FB6A 5KOWA 4F0BA 3HCZA 2TIRA 2B3SA 3PGTA 4ML6A 2B1KA 2REMA 1PGTA 3KJYA 4IJ3A 3CSHA 2EIRA 2LJAA 1QMVA 5D73A 3HDCA 4ZBAA 1TK5B 4XS1A 4PQHA 1EZKA 5KN0A 1KNGA 2GTUA 1XFLA 4FIWA 4KA0A 2A2RA 2PBJA 12GSA 1SK2A 2VCWA 1X9MB 5IQYA 4MCUA 4L5OA 3KTBA 2YJ7A 2ON7A 3D6IA 2HSHA 5J9CA 2LV3A 2XBIA 1AXDA 3NIVA 4WR4A 3GNJA 2WRTA 3GTUA 5ECOB 1PN0A 3F8UA 4FYBA 5D96A 1Z5YE 3TKSE 1XPVA 2V1MA 2HXKA 1PKWA 2YJHA 2JSZA 2L5OA 1JFUA 2CVKA 1NHOA 3HXSA 2R4VA 5E59A 2NBSA 4NPBA 3U5RE 1GTBA 1V2AA 3O76A 2L4CA 3UVTA 2JL4A 1TXXA 2HSYA 1WMJA 3WGDA 3A5IA
chains in the Genus database with same CATH topology
2VM2A 1O6JA 1EOHA 2D2ZA 4HU7A 4QQ7A 2OKAA 4HEA2 14GSA 5KN1A 3A3TA 3HVXA 2VCTA 1OC9A 5DQYA 1GUKA 2YP6A 1X5DA 3EMPA 5D8IA 1AIUA 1U88A 3L9UA 4YKFA 2ALBA 1V40A 2M46A 4CW9A 1Y25A 2R0PA 4ZXGA 4K5SA 3VFIA 1QGVA 2IIYA 3UBLA 1GTAA 4GF0A 3ZFBA 2NTOA 3WGEA 1RQMA 4POMA 2E2MA 3DD3A 1LJRA 3ZMKA 2TRCP 5FHIA 1EEJA 1W89A 1EP7A 1AC1A 3IOSA 4IHUA 3D0ZA 4KF9A 2V2GA 1XIYA 5IMFA 1SJIA 1MEKA 4WEYA 4IQ1A 1X5EA 4OO5A 2MMNA 1S3DA 2MMAA 2V41A 17GSA 4G19A 1IYHA 4MF6A 3TKSA 3TKRA 20GSA 4FYUA 3FW2A 2QKEA 3GL5A 3S9FA 2ZUPA 1LBKA 1PRXA 1SYXA 1TRUA 2ZCTA 6GSXA 1XOAA 1XVQA 2CVBA 2YZHA 2AUVA 2WDUA 4ULXA 3UJ1A 2VLUA 4XHMA 1T00A 3EMXA 2HT9A 2LUSA 4LMWA 2VD1A 1BAYA 2B5XA 4IS0A 4LL4B 5GAPD 2QGVA 4OO4A 1R5AA 1ZGNA 1XWBA 2IMDA 2B7KA 1TK8B 4KNDA 2IMIA 2YV7A 2OE3A 1TI1A 1A8YA 4I6XA 3V1WA 1GUHA 2X4AA 3NOFA 5ID2B 2C0FA 6GSSA 1M2AA 5DVBA 3Q19A 1WRYA 1TI3A 3RHCA 3U6VA 3N9JA 1HNAA 3FYGA 3HJMA 2OADA 5G5FA 2LTKA 1ABAA 5KOXA 5F07A 4DSSB 1MTCA 1BJXA 3KD0A 4TXOA 3EWLA 2QSIA 4ID0A 2GVPA 2X99A 3F9UA 2C80A 3LXTA 1ERTA 4RI6A 1ERWA 2H0HA 2JSYA 4XRAA 4N30A 5GSTA 3F63A 3LW9A 1T3BA 5H5SA 2R0CA 1QXHA 3C1SA 1ERUA 1MDIA 2YZUA 4PURA 2F9SA 3A2WA 2PPTA 4GTUA 5EPFA 5A5KA 3ERGA 3H79A 4NAXA 19GSA 3ED3A 2OJLA 2CA8A 4N10A 1SD9A 4TR0A 2VL2C 1ACVA 1ZCPA 2FNOA 1QFNA 4J57E 4GRFA 3M0FA 1EP8A 3G9BA 5F0GA 1K0CA 1V58A 3E3EA 5DQSA 1BQ7A 4AJ6A 2GT6A 2JZRA 3H1NA 4K7NA 2ZNMA 5G1LA 5KN3A 1AUCA 3GKMA 5AIVA 2HZEB 5HFKA 2LQQA 2RM6A 4NHWA 2OA7A 1TU7A 3FEUA 1PL1A 5JWOB 4QL7A 4I2UA 1JZWA 1EWXA 2PWJA 4HUAA 1O81A 1XWCA 5JCUA 3L9VA 5CRGA 3FZ4A 4IP1A 4A5PA 2B1LA 3ZFLA 2AV4A 2CZ3A 3VI5A 5IOXA 1OC8A 2FLSA 2YCDA 1ZYQB 1JHBA 5HQPA 4O92A 4Z2TA 5FT3A 2JZSA 1VF3A 1V98A 2M72A 2HE3A 2H1AA 2F8AA 3GN3A 3IHGA 4PNFA 2RM5A 1HYUA 4TR4A 3GKKA 3QFAC 5JCWA 1OE8A 1R26A 3FHKA 3ZVJD 5F06A 2O85A 4BVXA 3HHVA 2YOIA 3FR9A 1O8XA 2EC4A 1SK1A 5HR2A 2R0GA 3I69A 3CTFA 2WFCA 4V1Ap 3IV4A 1F3BA 1ZYPA 5IIZA 4CHSA 1WJKA 1E2YA 2N5AA 1M2DA 4EIQA 2VAFA 4YQUA 1H4OA 4AJ8A 3QFBC 3TUEA 2RUEA 2GLRA 2AHEA 3QD9A 1N2AA 4MF5A 4MK3A 1HQOA 4K1FA 5EL8A 4G9HA 3FZ5A 5ECHB 1GTUA 4X4JA 2FWHA 5J5NA 3IA1A 1XW6A 4XRDA 1YKAA 2O7KA 1UC7A 1EGRA 4HI7A 3CRUA 1YEXA 2MBSA 2KLXA 3AY8A 4ECBA 1VRSD 2PUKC 3H8QA 3KP9A 2FWGA 3WGXA 2P0GA 4GLTA 2QA1A 1G0TA 3QAVA 3KP8A 3L9SA 4KDYA 4JBBA 2TRXA 3M9JA 10GSA 3F6DA 4ZL8A 2H76A 4K0GA 1U3AA 1ON4A 3FZ9A 1FOVA 4EVMA 3US3A 3ZIVA 2X8HA 1R4WA 3CSIA 4WXTA 3D4MA 9GSSA 2GZZA 3GSSA 3CMIA 3LYPA 3BCIA 1DBYA 2N5FA 3HKRA 2OACA 2JZTA 3HVSA 1ZMAA 4GSTA 4LLRA 2LQOA 2X49A 3ZYWA 2V6KA 4NV5A 2XC2A 4L0WA 1XBSA 3KZQA 2LRTA 1HNCA 2DKIA 4O32A 3F6FA 5KN2A 4ZB6A 5C04A 3FRCA 4ZB9A 1Z3EA 3OR5A 1GSEA 5B8AA 2YWOA 2E2GA 2C0DA 3TB2A 2CZ2A 4LMVA 1GSDA 2OE0A 4RUVA 4GXZA 22GSA 4GCIA 3F0IA 1YEPA 1V57A 1EV9A 3QAGA 3IR4A 3IK7A 3TKPA 2DJ2A 1M0UA 2ON5A 3HY2A 1TP9A 4X0XA 4JR6A 3GFKA 3KCMA 5J9BA 3QOUA 1S3CA 4HQZA 4TR1B 5J4UA 3F3RA 4KX4A 2DMLA 3GKNA 3FZAA 4DSRA 2P5RA 2JU5A 1SD8A 1XOBA 3VLNA 1SL1B 3ZVJA 3DKSA 5JCGA 2ES7A 3NZNA 4KAEA 2HRNA 4TVEA 3DRNA 4IJIA 5ECQB 2WGRA 2L4QA 1FVKA 3LG6A 4EE0A 3HYPA 3APQA 5CAXA 4KDUA 4G0LA 1ZYNA 1N8JA 4I2TA 4L0UA 5HR1A 3FMWA 1GSQA 2LSTA 1TDIA 1TRSA 2CV4A 1AQXA 3UBKA 3EVIA 2F51A 4K2DA 1ST9A 1XW5A 3GX0A 3APSA 4H86A 2LJRA 1MDKA 3M3MA 3LXZA 1GRXA 2VIMA 4V1Ag 5ID2A 2FWFA 5L71A 3J7Yk 4WETA 1SKRB 1J9BA 1JLVA 4GSSA 2FWEA 2QA2A 1O73A 4ECIA 5CRHA 5HFGA 2PERA 1Q98A 4DSSA 1K3OA 1GULA 4NXIA 4N0VA 4EDZA 3KMOA 4O5RA 3TRXA 2P31A 4MPFA 4JU5A 2LRNA 2H19A 5CNWA 1GNWA 3HVVA 4X1UA 1B9YC 3RDWA 3VWWA 3VWVA 3QR6A 2NDOA 3CXGA 3TOTA 2KP2A 2NPBA 3Q74A 4Z7XA 3TOUA 2H73A 2QC7A 2HRKA 3EU4A 2R37A 2V32A 4WF4A 1TRWA 3P8WA 5IO2A 5CO3A 3ZTLA 3BOAA 2K8SA 4HU9A 3P2AA 2X8CA 3KEBA 2YN1A 1XVWA 5DCGA 1JZRA 5G30A 2R2JA 1AW9A 2FHEA 2UZ8A 1XWAA 11GSA 2C4JA 1K0DA 1TJDA 1R5PA 4ZBBA 1GTIA 5HR0A 5FWGA 2YV9A 4OD7A 1SK0A 3LSZA 4ICYA 3ME8A 2AYTA 4TR3A 2PGTA 2DJKA 3EPTA 4Q5FA 4POBA 1BX9A 3Q18A 7GSSA 1DSBA 2MBTA 1AQVA 5BRTA 3N5OA 2R3XA 5C00A 2PU9C 4EUYA 3IPZA 2HZEA 4TW5A 2C3NA 3R2QA 2DC5A 3ZL5A 3EU3A 3TDGA 1A2JA 2FY6A 4HOJA 4XTSA 3LORA 3GURA 5DAKB 3PPUA 2GSRA 2YWMA 1X9SB 4OWYA 1ERVA 4I5QA 5B7CA 4XS4B 1K3YA 1PL2A 4MLYA 1OKDA 2RIIA 1A2MA 3KGKA 5H5RA 1SL0B 1VF4A 2EIQA 3TJJA 4YH2A 5IPHA 4MH3A 1ILOA 3WT2A 4KGIA 3ZRDA 4HDEA 4RQXA 1THXA 4JZQA 4MABA 5BMUA 2KOKA 2IJYA 5AGYA 1J08A 3EINA 1OC3A 2CQ9A 1SYRA 5ENUA 4AGSA 4XCSA 2C1YA 1I9DA 5ECIB 4MJCA 4F03A 1XCCA 1PX6A 3IC4A 1PMTA 3TGZA 4MH2A 4HJMA 5JWRB 1F2EA 4ISDA 4ZL7A 4JE1A 2LS5A 3TJBA 4EKZA 2VCZA 3UVHA 3RPNA 2H66A 4PXOA 4P3YB 3GMFA 3KH9A 3EE2A 3HZ4A 1J0FA 1CQHA 4JRRA 1JLWA 1UA5A 3LGCA 2B6MA 1H75A 3UOMA 5AISA 1X5CA 5ECMB 3UMAA 5EY6A 5G5EA 4BWSA 4WBRD 1BG5A 4KSMA 3J7Yb 2BTOT 2CT6A 2LKUA 1O8WA 1F37A 1G6WA 4O5UA 3ZIJA 4IGJA 3ZZXA 1SKWB 2GDRA 4POKA 1QUWA 4N11A 5DBQA 4ECJA 4D73B 1S3AA 2LNTA 2I9HA 5IM9A 3LFLA 1R7HA 2GGTA 4KB3A 1A8LA 4ECCA 2M80A 2IWTA 1K0BA 4DSQA 2H72A 3ERFA 2VLVA 2FUG2 1GP1A 1T8EB 5D93A 2IFQB 2X64A 3E9JB 5CREA 2HI7A 3QPMA 1G6YA 3I6AA 1QQ2A 2JADA 4TN8A 5DJMA 2HNLA 2H1BA 4CDOA 3BCKA 4NMUA 1FB0A 3PH9A 1T4ZA 1PA3A 3L4NA 4OFTA 1M9BA 4PGTA 2KHPA 1GSUA 5A4VA 4YQVA 1FAAA 5CRDA 4RQRA 4MDCA 4KUNA 1BYEA 4NWYA 2BMXA 2FA4A 2H1GA 5DJLA 4J2FA 2I1UA 4ACSA 5ECRB 3GSTA 2J9HA 5IMZA 2CAQA 3TKQA 2X8GA 1XW9A 1PN9A 1TOFA 2G2QA 2A2SA 1YF1A 2VO4A 2L57A 2I81A 1YJ6A 4X43A 2YWNA 1W4VA 6GSTA 5IOWA 3LEFA 5B6MA 3H93A 3MIXA 2VL3A 4WBJA 4EO3A 2XPDA 1TTZA 2VL2A 2DSAA 1ZL9A 1USBA 4BVYB 4TR1A 3HA9A 3GRXA 4NHZA 5G31A 3VPTA 1URMA 1UN2A 2HFDA 3UL3A 2VLTA 1TRVA 1DUGA 1GUMA 4K9ZA 1SU9A 3I9V2 4POLA 4I8BA 1XZOA 1GLQA 2VUPA 3VI7A 2WB9A 2A4VA 3IC8A 1FO5A 2DLXA 5CRWA 1YQ1A 2P5QA 3D5JA 4G0IA 3GL3A 4ZBDA 2KUCA 6GSYA 2FD3A 1U6TA 4Z2UA 3HZ8A 5IO0A 1M2BA 5DCHA 4Q5RA 1SL2B 3G7JA 2K9FA 4F2IA 5D9XA 4Q5QA 4YAPA 3D22A 4PX1A 4JR4A 2IN3A 1YY7A 1B4QA 4MZCA 2H70A 3EURA 2DIYA 2LRCA 1HD2A 3IHQA 3RBTA 4LL1B 3A5WA 3TKSC 5H5QA 2JACA 4I97A 1E6BA 3IAS2 3PINA 4OCEA 4V2NA 5GSSA 1AQWA 4IP6A 3W6GA 1T1VA 1MDJA 3EYTA 1GWCA 1Z7RA 2WCIA 3ZMLA 3KMNA 5D9WA 2DJ0A 4HZ4A 1XXUA 4OCFA 2KP1A 5J41A 2LNSA 4KSOA 4EDYA 6GSWA 2DKHA 5DALB 1SJZA 2R6KA 4F0CA 4WR5A 1HNBA 3FR3A 3JCML 2K8VA 3RHBA 3FK8A 2HSMA 5ECLB 3MYDA 2YPMA 1GH2A 3IBHA 3CTGA 2Z9SA 2VL9A 2GQKA 1PSQA 2DJ3A 1Z6MA 3DMLA 4PUAA 3ME7A 4FYCA 3D4TA 2OBKA 1M9AA 3WD6A 4N0ZA 1T4YA 3DEXA 2RLIA 1A23A 1T7PB 3IK9A 4ZB8A 1OE7A 5LNKe 4O5QA 3LWAA 2K6VA 2YANA 3DGQA 4BA7A 3CBUA 3F4TA 1WWJA 3C7MA 1Z9HA 1WE0A 5COHA 3VURA 1OVNA 3VK9A 1OAZA 1OYJA 4MJAA 3WT1A 2PVQA 1YKCA 2H71A 2C3TA 1NW2A 4MMMA 4TRXA 3I43A 4XS6A 2HRAA 3A2VA 4K0NA 1TKDB 3ISOA 1FOHA 4NV2A 4IN0A 2C0GA 2V6OA 1M99A 3KXOA 4HZ2A 2H6XA 1KEBA 3CRTA 4CY8A 1YZXA 2AB6A 4F82A 1WP0A 1F6MC 2MZCA 4ZIJA 3GH9A 2GS3A 3MWHA 1K0OA 2VCVA 4DVCA 1FW1A 3F4SA 2MYGA 3M1GA 4EF0A 5CP1A 4KCAA 1TW9A 4G0KA 4KDXA 1B8XA 2IPAA 3O3TA 2RUFA 4BWQA 3TJKA 2GZYA 4FO5A 5DAKA 1I5GA 3GA4A 2DMMA 3EC3A 2WZ9A 2WULA 1C72A 1EEMA 1ZYEA 1AAZA 4V2LA 1A0FA 2DBCA 2OBIA 1THOA 5G2ZA 4IELA 5JWQB 4XS4A 2VCQA 4IW9A 1SKSB 4IKHA 3IE3A 4IVFA 2OE1A 4V2MA 3DIEA 1JZOA 3C8EA 3W8SA 3GX8A 5ABRA 2VM1A 2R5GA 2H0IA 3G7YA 4K8MA 3GTUB 2O8VB 1XWKA 3CYNA 4FH8A 2CX3A 1A24A 1G7EA 1X0RA 1K0NA 3GHAA 4K7OA 4MA9A 2VD0A 1Q4JA 1FHEA 5A4WA 3IRAA 5F8BA 3FR6A 3UAPA 5B6NA 2IMKA 5ECNB 2XPEA 3TRPA 16GSA 2FCHA 4YAVA 2PN8A 1Z7PA 2G0FA 2J23A 5ELAA 1EOGA 1GSFA 3K8NA 3DWVA 3UARA 3QCPA 1Z6NA 2FA8A 1VF1A 3CSJA 2PMTA 3LJRA 2HZFA 1IYIA 5KEJA 3H4KA 1A0RP 3LYKA 1GSSA 4BL7A 3APOA 2H75A 5INYA 4GSNA 1UVZA 3F4RA 4MZWA 1OC9B 2EIOA 3TCOA 3KIJA 1B4PA 3QMXA 2XBQA 4XIHA 3L0HA 2H01A 4G2EA 1SENA 3G7IA 2HYXA 4BPYA 3P90A 4LA1A 1PQNA 4PUFC 3PR8A 1DE1A 2GSSA 1B48A 2GQLA 5ECSA 4GQCA 2CAIA 2O87A 4K5RA 3HD5A 1MD4A 4USSA 2L6DA 3ERWA 2YWIA 4K6XA 4MJEA 2A4HA 3ZLPA 1WOUA 2K18A 4D73A 4GWRA 5ELGA 3F3QA 4DEJA 4G10A 3MNGA 2H6YA 4OMVA 3MDKA 3FY7A 2XHFA 3FKFA 5HFIA 3A2XA 5LD0A 1YDKA 5LCZA 3QAWA 4Z2RA 1U87A 2O89A 3RAZA 4MF7A 4EIPA 1GNEA 2IFQA 4HQSA 4K7IA 3DVWA 3R3EA 3RPPA 5B8BA 2WS2A 3KTLA 3ZREA 1NM3A 1RW1A 4AJ7A 3WYWA 4MP4A 2C0EA 4TOPA 1K3LA 1VGLA 1SJ6A 5GZZB 4OFMA 3VPQA 3E0UA 2L5LA 4MJBA 1QK8A 4PNGA 2B5EA 4EXJA 3GUSA 4BL7B 3GKXA 4EL1A 2GSTA 1O85A 1GL8A 5G1KA 4QL9A 4RI7A 3C71A 3DYRA 1VF2A 1U3IA 1K0MA 2F8FA 2DIZA 2LJKA 1PKZA 2MMOA 3O6TA 4PQ1A 3KH7A 1JZDA 2CVDA 2HLSA 2AJQB 3BD2A 3C73A 1WPIA 3HJPA 4TXVA 1FG4A 1RK4A 4Q5NA 3SWLA 5IMAA 3BJ5A 5D9TA 4EC0A 3ZITA 1BEDA 4AF2A 4YQMA 3UEMA 3KM6A 4FQUA 2YNXA 2E7PA 3IAM2 5D9VA 3DXBA 18GSA 4BVYA 2AAWA 4TXOB 5IPGA 1GSYA 3UIWA 1K0AA 5IMVA 4PTSA 3TRQA 1MD3A 3C1RA 2B7JA 2B5YA 2LEGA 5IMCA 2L6CA 2DJJA 4J56E 2H0GA 3W8JA 4L8EA 3VWXA 1F3AA 2FGXA 4IBPA 4KCEA 1B9XC 1GLPA 2BJXA 4WKWA 2C3QA 5AN1A 5CYYA 4OFNA 3IXRA 1TU8A 2DJ1A 2CX4A 2IMFA 3M9KA 1CQGA 2I4AA 4MZBA 5GAND 1F9MA 1NSWA 2H8LA 1PX7A 5HR3A 3GIXA 4YKGA 2IMEA 5E4WA 13GSA 3LQ7A 6GSVA 4O7HA 5J3RA 2H6ZA 4E8EA 3GV1A 2A2PA 3DVXA 2I3YA 3GH6A 1LU4A 4GQFA 2E0QA 4MPGA 2C8UA 5DALA 4JEDA 3Q6OA 2IL3A 2GSQA 1WIKA 4E8HA 4PQIA 2GQMA 1PD21 3MSZA 1O7UA 3VWUA 4KE3A 1ZOFA 4MNNA 3D21A 3TJGA 2H1DA 1OKTA 2HRFA 1XWGA 4IQAA 5AIXA 3SBCA 1ML6A 3M8NA 4CY6A 5ECPB 2H74A 1NHYA 1DE2A 4ZILA 3HJOA 1EV4A 2H30A 2NVLA 2F3MA 2VCXA 1TK0B 1YF0A 2MMZA 4HJ2A 2N5BA 5DDLA 1G7OA 2PVOC 4ML1A 4L5LA 3QDNA 4HS1A 3IDVA 6GSUA 5EVOA 1A2LA 3GYKA 1KBNA 5A4UA 5F05A 4TKYA 2GT5A 1Y6EA 4KH7A 5ECKB 4F9ZA 2L59A 3TJFA 4ZL9A 8GSSA 2VOCA 1KTEA 4BVXB 4WF5A 1FVJA 1V9WA 1M7TA 3MAKA 2GZPA 1ZZYA 3BBYA 2WJUA 4KW6A 4ILFA 4K2XA 3P7XA 1X9WB 1EGOA 5IMDA 3L78A 1FB6A 5KOWA 4F0BA 3HCZA 2TIRA 2B3SA 3PGTA 4ML6A 2B1KA 2REMA 1PGTA 3KJYA 4IJ3A 3CSHA 2EIRA 2LJAA 1QMVA 5D73A 3HDCA 4ZBAA 1TK5B 4XS1A 4PQHA 1EZKA 5KN0A 1KNGA 2GTUA 1XFLA 4FIWA 4KA0A 2A2RA 2PBJA 12GSA 1SK2A 2VCWA 1X9MB 5IQYA 4MCUA 4L5OA 3KTBA 2YJ7A 2ON7A 3D6IA 2HSHA 5J9CA 2LV3A 2XBIA 1AXDA 3NIVA 4WR4A 3GNJA 2WRTA 3GTUA 5ECOB 1PN0A 3F8UA 4FYBA 5D96A 1Z5YE 3TKSE 1XPVA 2V1MA 2HXKA 1PKWA 2YJHA 2JSZA 2L5OA 1JFUA 2CVKA 1NHOA 3HXSA 2R4VA 5E59A 2NBSA 4NPBA 3U5RE 1GTBA 1V2AA 3O76A 2L4CA 3UVTA 2JL4A 1TXXA 2HSYA 1WMJA 3WGDA 3A5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VM2 A;  1O6J A;  1EOH A;  2D2Z A;  4HU7 A;  4QQ7 A;  2OKA A;  4HEA 2;  14GS A;  5KN1 A;  3A3T A;  3HVX A;  2VCT A;  1OC9 A;  5DQY A;  1GUK A;  2YP6 A;  1X5D A;  3EMP A;  5D8I A;  1AIU A;  1U88 A;  3L9U A;  2ALB A;  1V40 A;  2M46 A;  4CW9 A;  1Y25 A;  4ZXG A;  3VFI A;  1QGV A;  2IIY A;  3UBL A;  1GTA A;  4GF0 A;  3ZFB A;  2NTO A;  3WGE A;  1RQM A;  4POM A;  2E2M A;  3DD3 A;  1LJR A;  3ZMK A;  2TRC P;  5FHI A;  1EEJ A;  1W89 A;  1EP7 A;  1AC1 A;  3IOS A;  4IHU A;  3D0Z A;  2V2G A;  1XIY A;  5IMF A;  1SJI A;  1MEK A;  4WEY A;  4IQ1 A;  1X5E A;  4OO5 A;  2MMN A;  1S3D A;  2MMA A;  2V41 A;  17GS A;  4G19 A;  1IYH A;  4MF6 A;  3TKS A;  3TKR A;  20GS A;  4FYU A;  3FW2 A;  2QKE A;  3GL5 A;  3S9F A;  2ZUP A;  1LBK A;  1PRX A;  1SYX A;  1TRU A;  2ZCT A;  6GSX A;  1XOA A;  1XVQ A;  2CVB A;  2YZH A;  2AUV A;  2WDU A;  4ULX A;  3UJ1 A;  2VLU A;  4XHM A;  1T00 A;  3EMX A;  2HT9 A;  2LUS A;  4LMW A;  2VD1 A;  1BAY A;  2B5X A;  4IS0 A;  4LL4 B;  5GAP D;  2QGV A;  4OO4 A;  1R5A A;  1ZGN A;  1XWB A;  2IMD A;  2B7K A;  1TK8 B;  4KND A;  2IMI A;  2YV7 A;  2OE3 A;  1TI1 A;  1A8Y A;  4I6X A;  3V1W A;  1GUH A;  3NOF A;  5ID2 B;  2C0F A;  6GSS A;  1M2A A;  5DVB A;  3Q19 A;  1WRY A;  1TI3 A;  3RHC A;  3U6V A;  3N9J A;  1HNA A;  3FYG A;  3HJM A;  2OAD A;  5G5F A;  2LTK A;  1ABA A;  5F07 A;  4DSS B;  1MTC A;  1BJX A;  3KD0 A;  4TXO A;  3EWL A;  2QSI A;  4ID0 A;  2GVP A;  2X99 A;  3F9U A;  2C80 A;  3LXT A;  1ERT A;  4RI6 A;  1ERW A;  2H0H A;  2JSY A;  4XRA A;  4N30 A;  5GST A;  3F63 A;  1T3B A;  5H5S A;  1QXH A;  3C1S A;  1ERU A;  1MDI A;  2YZU A;  4PUR A;  2F9S A;  3A2W A;  2PPT A;  4GTU A;  5EPF A;  5A5K A;  3ERG A;  3H79 A;  4NAX A;  19GS A;  3ED3 A;  2OJL A;  2CA8 A;  4N10 A;  1SD9 A;  4TR0 A;  2VL2 C;  1ACV A;  1ZCP A;  2FNO A;  1QFN A;  4J57 E;  4GRF A;  3M0F A;  1EP8 A;  3G9B A;  5F0G A;  1K0C A;  1V58 A;  3E3E A;  5DQS A;  1BQ7 A;  4AJ6 A;  2GT6 A;  2JZR A;  3H1N A;  4K7N A;  2ZNM A;  5G1L A;  5KN3 A;  1AUC A;  3GKM A;  5AIV A;  2HZE B;  5HFK A;  2LQQ A;  2RM6 A;  4NHW A;  2OA7 A;  1TU7 A;  3FEU A;  1PL1 A;  5JWO B;  4QL7 A;  4I2U A;  1JZW A;  1EWX A;  2PWJ A;  4HUA A;  1O81 A;  1XWC A;  5JCU A;  3L9V A;  5CRG A;  3FZ4 A;  4IP1 A;  2B1L A;  3ZFL A;  2AV4 A;  2CZ3 A;  3VI5 A;  5IOX A;  1OC8 A;  2FLS A;  2YCD A;  1ZYQ B;  1JHB A;  5HQP A;  4O92 A;  5FT3 A;  2JZS A;  1VF3 A;  1V98 A;  2M72 A;  2HE3 A;  2H1A A;  2F8A A;  3GN3 A;  4PNF A;  2RM5 A;  1HYU A;  4TR4 A;  3GKK A;  3QFA C;  5JCW A;  1OE8 A;  1R26 A;  3FHK A;  3ZVJ D;  5F06 A;  2O85 A;  4BVX A;  3HHV A;  2YOI A;  3FR9 A;  1O8X A;  2EC4 A;  1SK1 A;  5HR2 A;  3I69 A;  3CTF A;  2WFC A;  4V1A p;  3IV4 A;  1F3B A;  5IIZ A;  4CHS A;  1WJK A;  1E2Y A;  2N5A A;  1M2D A;  2VAF A;  4YQU A;  1H4O A;  4AJ8 A;  3QFB C;  3TUE A;  2RUE A;  2GLR A;  2AHE A;  3QD9 A;  1N2A A;  4MF5 A;  4MK3 A;  1HQO A;  4K1F A;  5EL8 A;  4G9H A;  3FZ5 A;  5ECH B;  1GTU A;  2FWH A;  5J5N A;  3IA1 A;  1XW6 A;  4XRD A;  1YKA A;  2O7K A;  1UC7 A;  1EGR A;  4HI7 A;  3CRU A;  1YEX A;  2MBS A;  2KLX A;  3AY8 A;  4ECB A;  1VRS D;  2PUK C;  3H8Q A;  3KP9 A;  2FWG A;  3WGX A;  2P0G A;  4GLT A;  1G0T A;  3QAV A;  3KP8 A;  3L9S A;  4KDY A;  4JBB A;  2TRX A;  3M9J A;  10GS A;  3F6D A;  4ZL8 A;  2H76 A;  4K0G A;  1U3A A;  1ON4 A;  3FZ9 A;  1FOV A;  4EVM A;  3US3 A;  3ZIV A;  2X8H A;  1R4W A;  3CSI A;  4WXT A;  3D4M A;  9GSS A;  2GZZ A;  3GSS A;  3CMI A;  3LYP A;  3BCI A;  1DBY A;  2N5F A;  3HKR A;  2OAC A;  2JZT A;  3HVS A;  1ZMA A;  4GST A;  4LLR A;  2LQO A;  3ZYW A;  2V6K A;  4NV5 A;  2XC2 A;  4L0W A;  1XBS A;  3KZQ A;  2LRT A;  1HNC A;  4O32 A;  3F6F A;  5KN2 A;  4ZB6 A;  5C04 A;  3FRC A;  4ZB9 A;  1Z3E A;  3OR5 A;  1GSE A;  5B8A A;  2YWO A;  2E2G A;  2C0D A;  3TB2 A;  2CZ2 A;  4LMV A;  1GSD A;  2OE0 A;  4RUV A;  4GXZ A;  22GS A;  4GCI A;  3F0I A;  1YEP A;  1V57 A;  1EV9 A;  3QAG A;  3IR4 A;  3IK7 A;  3TKP A;  2DJ2 A;  1M0U A;  2ON5 A;  3HY2 A;  1TP9 A;  4X0X A;  4JR6 A;  3GFK A;  3KCM A;  5J9B A;  3QOU A;  1S3C A;  4HQZ A;  4TR1 B;  5J4U A;  3F3R A;  4KX4 A;  2DML A;  3GKN A;  3FZA A;  4DSR A;  2P5R A;  2JU5 A;  1SD8 A;  1XOB A;  3VLN A;  1SL1 B;  3ZVJ A;  3DKS A;  5JCG A;  2ES7 A;  3NZN A;  4KAE A;  2HRN A;  4TVE A;  3DRN A;  4IJI A;  5ECQ B;  2WGR A;  2L4Q A;  1FVK A;  3LG6 A;  4EE0 A;  3HYP A;  3APQ A;  5CAX A;  4KDU A;  1N8J A;  4I2T A;  4L0U A;  5HR1 A;  1GSQ A;  2LST A;  1TDI A;  1TRS A;  2CV4 A;  1AQX A;  3UBK A;  3EVI A;  2F51 A;  4K2D A;  1ST9 A;  1XW5 A;  3GX0 A;  3APS A;  4H86 A;  1MDK A;  3M3M A;  3LXZ A;  1GRX A;  2VIM A;  4V1A g;  5ID2 A;  2FWF A;  5L71 A;  3J7Y k;  4WET A;  1SKR B;  1J9B A;  1JLV A;  4GSS A;  2FWE A;  1O73 A;  4ECI A;  5CRH A;  5HFG A;  2PER A;  1Q98 A;  4DSS A;  1K3O A;  1GUL A;  4NXI A;  4N0V A;  4EDZ A;  3KMO A;  4O5R A;  3TRX A;  2P31 A;  4MPF A;  4JU5 A;  2LRN A;  2H19 A;  5CNW A;  1GNW A;  3HVV A;  4X1U A;  1B9Y C;  3RDW A;  3VWW A;  3VWV A;  3QR6 A;  2NDO A;  3CXG A;  3TOT A;  2KP2 A;  2NPB A;  3Q74 A;  4Z7X A;  3TOU A;  2H73 A;  2QC7 A;  3EU4 A;  2R37 A;  2V32 A;  4WF4 A;  1TRW A;  3P8W A;  5IO2 A;  5CO3 A;  3ZTL A;  3BOA A;  2K8S A;  4HU9 A;  3P2A A;  2X8C A;  3KEB A;  2YN1 A;  1XVW A;  5DCG A;  1JZR A;  5G30 A;  2R2J A;  1AW9 A;  2FHE A;  1XWA A;  11GS A;  2C4J A;  1K0D A;  1TJD A;  1R5P A;  4ZBB A;  1GTI A;  5HR0 A;  5FWG A;  2YV9 A;  4OD7 A;  1SK0 A;  3LSZ A;  3ME8 A;  2AYT A;  4TR3 A;  2PGT A;  2DJK A;  4Q5F A;  4POB A;  1BX9 A;  3Q18 A;  7GSS A;  1DSB A;  2MBT A;  1AQV A;  3N5O A;  2R3X A;  5C00 A;  2PU9 C;  4EUY A;  3IPZ A;  2HZE A;  4TW5 A;  2C3N A;  3R2Q A;  2DC5 A;  3ZL5 A;  3EU3 A;  3TDG A;  1A2J A;  2FY6 A;  4HOJ A;  4XTS A;  3LOR A;  3GUR A;  5DAK B;  2GSR A;  2YWM A;  1X9S B;  4OWY A;  1ERV A;  4I5Q A;  5B7C A;  4XS4 B;  1K3Y A;  1PL2 A;  4MLY A;  1OKD A;  2RII A;  1A2M A;  3KGK A;  5H5R A;  1SL0 B;  1VF4 A;  2EIQ A;  3TJJ A;  4YH2 A;  5IPH A;  4MH3 A;  1ILO A;  3WT2 A;  4KGI A;  3ZRD A;  4HDE A;  4RQX A;  1THX A;  4JZQ A;  4MAB A;  2KOK A;  2IJY A;  5AGY A;  1J08 A;  3EIN A;  1OC3 A;  2CQ9 A;  1SYR A;  5ENU A;  4AGS A;  4XCS A;  2C1Y A;  1I9D A;  5ECI B;  4MJC A;  4F03 A;  1XCC A;  1PX6 A;  3IC4 A;  1PMT A;  3TGZ A;  4MH2 A;  4HJM A;  5JWR B;  1F2E A;  4ISD A;  4ZL7 A;  4JE1 A;  2LS5 A;  3TJB A;  4EKZ A;  2VCZ A;  3UVH A;  3RPN A;  2H66 A;  4PXO A;  4P3Y B;  3GMF A;  3KH9 A;  3EE2 A;  3HZ4 A;  1J0F A;  1CQH A;  4JRR A;  1JLW A;  1UA5 A;  3LGC A;  2B6M A;  1H75 A;  3UOM A;  5AIS A;  1X5C A;  5ECM B;  3UMA A;  5EY6 A;  5G5E A;  4BWS A;  4WBR D;  1BG5 A;  4KSM A;  3J7Y b;  2BTO T;  2CT6 A;  2LKU A;  1O8W A;  1F37 A;  1G6W A;  3ZIJ A;  4IGJ A;  3ZZX A;  1SKW B;  2GDR A;  4POK A;  1QUW A;  4N11 A;  5DBQ A;  4ECJ A;  4D73 B;  1S3A A;  2LNT A;  2I9H A;  5IM9 A;  3LFL A;  1R7H A;  2GGT A;  4KB3 A;  1A8L A;  4ECC A;  2M80 A;  2IWT A;  1K0B A;  4DSQ A;  2H72 A;  3ERF A;  2VLV A;  2FUG 2;  1GP1 A;  1T8E B;  5D93 A;  2IFQ B;  2X64 A;  3E9J B;  5CRE A;  2HI7 A;  3QPM A;  1G6Y A;  3I6A A;  1QQ2 A;  2JAD A;  4TN8 A;  5DJM A;  2HNL A;  2H1B A;  4CDO A;  3BCK A;  4NMU A;  1FB0 A;  3PH9 A;  1T4Z A;  1PA3 A;  3L4N A;  4OFT A;  1M9B A;  4PGT A;  2KHP A;  1GSU A;  5A4V A;  4YQV A;  1FAA A;  5CRD A;  4RQR A;  4MDC A;  4KUN A;  1BYE A;  4NWY A;  2BMX A;  2FA4 A;  2H1G A;  5DJL A;  4J2F A;  2I1U A;  4ACS A;  5ECR B;  3GST A;  2J9H A;  5IMZ A;  2CAQ A;  3TKQ A;  2X8G A;  1XW9 A;  1PN9 A;  1TOF A;  2G2Q A;  2A2S A;  1YF1 A;  2VO4 A;  2L57 A;  2I81 A;  1YJ6 A;  4X43 A;  2YWN A;  1W4V A;  6GST A;  5IOW A;  3LEF A;  5B6M A;  3H93 A;  2VL3 A;  4WBJ A;  4EO3 A;  2XPD A;  1TTZ A;  2VL2 A;  2DSA A;  1ZL9 A;  1USB A;  4TR1 A;  3HA9 A;  3GRX A;  4NHZ A;  5G31 A;  3VPT A;  1URM A;  1UN2 A;  2HFD A;  3UL3 A;  2VLT A;  1TRV A;  1DUG A;  1GUM A;  4K9Z A;  1SU9 A;  3I9V 2;  4POL A;  4I8B A;  1XZO A;  1GLQ A;  2VUP A;  3VI7 A;  2WB9 A;  2A4V A;  1FO5 A;  2DLX A;  5CRW A;  1YQ1 A;  2P5Q A;  3D5J A;  3GL3 A;  4ZBD A;  2KUC A;  6GSY A;  2FD3 A;  1U6T A;  3HZ8 A;  5IO0 A;  1M2B A;  5DCH A;  4Q5R A;  1SL2 B;  3G7J A;  2K9F A;  4F2I A;  5D9X A;  4Q5Q A;  4YAP A;  3D22 A;  4PX1 A;  4JR4 A;  2IN3 A;  1YY7 A;  1B4Q A;  4MZC A;  2H70 A;  3EUR A;  2DIY A;  2LRC A;  1HD2 A;  3IHQ A;  3RBT A;  4LL1 B;  3A5W A;  3TKS C;  5H5Q A;  2JAC A;  4I97 A;  1E6B A;  3IAS 2;  3PIN A;  4OCE A;  4V2N A;  5GSS A;  1AQW A;  4IP6 A;  3W6G A;  1T1V A;  1MDJ A;  3EYT A;  1GWC A;  1Z7R A;  2WCI A;  3ZML A;  3KMN A;  5D9W A;  2DJ0 A;  4HZ4 A;  1XXU A;  4OCF A;  2KP1 A;  5J41 A;  2LNS A;  4KSO A;  4EDY A;  6GSW A;  5DAL B;  1SJZ A;  2R6K A;  4F0C A;  4WR5 A;  1HNB A;  3FR3 A;  3JCM L;  2K8V A;  3RHB A;  3FK8 A;  5ECL B;  2YPM A;  1GH2 A;  3IBH A;  3CTG A;  2Z9S A;  2VL9 A;  2GQK A;  1PSQ A;  2DJ3 A;  1Z6M A;  3DML A;  4PUA A;  3ME7 A;  4FYC A;  3D4T A;  2OBK A;  1M9A A;  3WD6 A;  4N0Z A;  1T4Y A;  3DEX A;  2RLI A;  1A23 A;  1T7P B;  3IK9 A;  4ZB8 A;  1OE7 A;  5LNK e;  3LWA A;  2K6V A;  2YAN A;  3DGQ A;  4BA7 A;  3CBU A;  3F4T A;  1WWJ A;  3C7M A;  1Z9H A;  1WE0 A;  5COH A;  3VUR A;  1OVN A;  3VK9 A;  1OAZ A;  1OYJ A;  4MJA A;  3WT1 A;  2PVQ A;  1YKC A;  2H71 A;  2C3T A;  1NW2 A;  4MMM A;  4TRX A;  3I43 A;  4XS6 A;  3A2V A;  4K0N A;  1TKD B;  3ISO A;  4NV2 A;  4IN0 A;  2C0G A;  2V6O A;  1M99 A;  3KXO A;  4HZ2 A;  2H6X A;  1KEB A;  3CRT A;  1YZX A;  2AB6 A;  4F82 A;  1WP0 A;  1F6M C;  2MZC A;  4ZIJ A;  3GH9 A;  2GS3 A;  3MWH A;  1K0O A;  2VCV A;  4DVC A;  1FW1 A;  3F4S A;  2MYG A;  3M1G A;  4EF0 A;  5CP1 A;  4KCA A;  1TW9 A;  4KDX A;  1B8X A;  2IPA A;  3O3T A;  2RUF A;  4BWQ A;  3TJK A;  2GZY A;  4FO5 A;  5DAK A;  1I5G A;  3GA4 A;  2DMM A;  3EC3 A;  2WZ9 A;  2WUL A;  1C72 A;  1EEM A;  1ZYE A;  1AAZ A;  4V2L A;  1A0F A;  2DBC A;  2OBI A;  1THO A;  5G2Z A;  4IEL A;  5JWQ B;  4XS4 A;  2VCQ A;  4IW9 A;  1SKS B;  4IKH A;  3IE3 A;  4IVF A;  2OE1 A;  4V2M A;  3DIE A;  1JZO A;  3C8E A;  3W8S A;  3GX8 A;  5ABR A;  2VM1 A;  2R5G A;  2H0I A;  3G7Y A;  4K8M A;  3GTU B;  2O8V B;  1XWK A;  3CYN A;  4FH8 A;  2CX3 A;  1A24 A;  1G7E A;  1X0R A;  1K0N A;  3GHA A;  4K7O A;  4MA9 A;  2VD0 A;  1Q4J A;  1FHE A;  5A4W A;  3IRA A;  5F8B A;  3FR6 A;  3UAP A;  5B6N A;  2IMK A;  5ECN B;  2XPE A;  3TRP A;  16GS A;  2FCH A;  4YAV A;  2PN8 A;  1Z7P A;  2G0F A;  2J23 A;  5ELA A;  1EOG A;  1GSF A;  3K8N A;  3DWV A;  3UAR A;  3QCP A;  1Z6N A;  2FA8 A;  1VF1 A;  3CSJ A;  2PMT A;  3LJR A;  2HZF A;  1IYI A;  5KEJ A;  3H4K A;  1A0R P;  3LYK A;  1GSS A;  4BL7 A;  3APO A;  2H75 A;  5INY A;  4GSN A;  1UVZ A;  3F4R A;  4MZW A;  1OC9 B;  2EIO A;  3TCO A;  3KIJ A;  1B4P A;  3QMX A;  2XBQ A;  4XIH A;  3L0H A;  2H01 A;  4G2E A;  1SEN A;  3G7I A;  2HYX A;  4BPY A;  3P90 A;  4LA1 A;  1PQN A;  4PUF C;  3PR8 A;  1DE1 A;  2GSS A;  1B48 A;  2GQL A;  5ECS A;  4GQC A;  2CAI A;  2O87 A;  3HD5 A;  1MD4 A;  2L6D A;  3ERW A;  2YWI A;  4K6X A;  4MJE A;  3ZLP A;  1WOU A;  2K18 A;  4D73 A;  4GWR A;  5ELG A;  3F3Q A;  4DEJ A;  4G10 A;  3MNG A;  2H6Y A;  4OMV A;  3MDK A;  3FY7 A;  2XHF A;  3FKF A;  5HFI A;  3A2X A;  5LD0 A;  1YDK A;  5LCZ A;  3QAW A;  1U87 A;  2O89 A;  3RAZ A;  4MF7 A;  1GNE A;  2IFQ A;  4HQS A;  4K7I A;  3DVW A;  3RPP A;  5B8B A;  2WS2 A;  3KTL A;  3ZRE A;  1NM3 A;  1RW1 A;  4AJ7 A;  3WYW A;  4MP4 A;  2C0E A;  4TOP A;  1K3L A;  1VGL A;  1SJ6 A;  5GZZ B;  4OFM A;  3VPQ A;  3E0U A;  2L5L A;  4MJB A;  1QK8 A;  4PNG A;  2B5E A;  4EXJ A;  3GUS A;  3GKX A;  4EL1 A;  2GST A;  1O85 A;  1GL8 A;  5G1K A;  4QL9 A;  4RI7 A;  3C71 A;  3DYR A;  1VF2 A;  1U3I A;  1K0M A;  2F8F A;  2DIZ A;  2LJK A;  1PKZ A;  2MMO A;  3O6T A;  4PQ1 A;  3KH7 A;  1JZD A;  2CVD A;  2HLS A;  2AJQ B;  3BD2 A;  3C73 A;  1WPI A;  3HJP A;  4TXV A;  1FG4 A;  1RK4 A;  4Q5N A;  3SWL A;  5IMA A;  3BJ5 A;  5D9T A;  4EC0 A;  3ZIT A;  1BED A;  4AF2 A;  4YQM A;  3UEM A;  3KM6 A;  2YNX A;  2E7P A;  3IAM 2;  5D9V A;  3DXB A;  18GS A;  4BVY A;  2AAW A;  4TXO B;  5IPG A;  1GSY A;  3UIW A;  1K0A A;  5IMV A;  3TRQ A;  1MD3 A;  3C1R A;  2B7J A;  2B5Y A;  2LEG A;  5IMC A;  2L6C A;  2DJJ A;  4J56 E;  2H0G A;  3W8J A;  4L8E A;  3VWX A;  1F3A A;  2FGX A;  4IBP A;  4KCE A;  1B9X C;  1GLP A;  2BJX A;  4WKW A;  2C3Q A;  5AN1 A;  5CYY A;  4OFN A;  3IXR A;  1TU8 A;  2DJ1 A;  2CX4 A;  2IMF A;  3M9K A;  1CQG A;  2I4A A;  4MZB A;  5GAN D;  1F9M A;  1NSW A;  2H8L A;  1PX7 A;  5HR3 A;  3GIX A;  2IME A;  5E4W A;  13GS A;  3LQ7 A;  6GSV A;  4O7H A;  5J3R A;  2H6Z A;  4E8E A;  3GV1 A;  3DVX A;  2I3Y A;  3GH6 A;  1LU4 A;  4GQF A;  2E0Q A;  4MPG A;  2C8U A;  5DAL A;  4JED A;  3Q6O A;  2IL3 A;  2GSQ A;  1WIK A;  4E8H A;  4PQI A;  2GQM A;  1PD2 1;  3MSZ A;  1O7U A;  3VWU A;  4KE3 A;  1ZOF A;  3D21 A;  3TJG A;  2H1D A;  1OKT A;  2HRF A;  1XWG A;  4IQA A;  5AIX A;  3SBC A;  1ML6 A;  3M8N A;  5ECP B;  2H74 A;  1NHY A;  1DE2 A;  4ZIL A;  3HJO A;  1EV4 A;  2H30 A;  2NVL A;  2F3M A;  2VCX A;  1TK0 B;  1YF0 A;  2MMZ A;  4HJ2 A;  2N5B A;  5DDL A;  1G7O A;  2PVO C;  4ML1 A;  4L5L A;  3QDN A;  4HS1 A;  3IDV A;  6GSU A;  5EVO A;  1A2L A;  3GYK A;  1KBN A;  5A4U A;  5F05 A;  4TKY A;  2GT5 A;  1Y6E A;  4KH7 A;  5ECK B;  4F9Z A;  2L59 A;  3TJF A;  4ZL9 A;  8GSS A;  2VOC A;  1KTE A;  4WF5 A;  1FVJ A;  1V9W A;  1M7T A;  3MAK A;  2GZP A;  1ZZY A;  3BBY A;  2WJU A;  4KW6 A;  4ILF A;  3P7X A;  1X9W B;  1EGO A;  5IMD A;  3L78 A;  1FB6 A;  4F0B A;  3HCZ A;  2TIR A;  2B3S A;  3PGT A;  4ML6 A;  2B1K A;  2REM A;  1PGT A;  3KJY A;  4IJ3 A;  3CSH A;  2EIR A;  2LJA A;  1QMV A;  5D73 A;  3HDC A;  4ZBA A;  1TK5 B;  4XS1 A;  4PQH A;  1EZK A;  5KN0 A;  1KNG A;  2GTU A;  1XFL A;  4FIW A;  4KA0 A;  2A2R A;  2PBJ A;  12GS A;  1SK2 A;  2VCW A;  1X9M B;  5IQY A;  4MCU A;  4L5O A;  3KTB A;  2YJ7 A;  2ON7 A;  3D6I A;  2HSH A;  5J9C A;  2LV3 A;  2XBI A;  1AXD A;  3NIV A;  4WR4 A;  3GNJ A;  2WRT A;  5ECO B;  3GTU A;  3F8U A;  4FYB A;  5D96 A;  1Z5Y E;  3TKS E;  1XPV A;  2V1M A;  2HXK A;  1PKW A;  2YJH A;  2JSZ A;  2L5O A;  1JFU A;  2CVK A;  1NHO A;  3HXS A;  2R4V A;  5E59 A;  2NBS A;  4NPB A;  3U5R E;  1GTB A;  1V2A A;  3O76 A;  2L4C A;  3UVT A;  2JL4 A;  1TXX A;  2HSY A;  1WMJ A;  3WGD A;  2LJR A; 
#chains in the Genus database with same CATH topology
 2VM2 A;  1O6J A;  1EOH A;  2D2Z A;  4HU7 A;  4QQ7 A;  2OKA A;  4HEA 2;  14GS A;  5KN1 A;  3A3T A;  3HVX A;  2VCT A;  1OC9 A;  5DQY A;  1GUK A;  2YP6 A;  1X5D A;  3EMP A;  5D8I A;  1AIU A;  1U88 A;  3L9U A;  4YKF A;  2ALB A;  1V40 A;  2M46 A;  4CW9 A;  1Y25 A;  2R0P A;  4ZXG A;  4K5S A;  3VFI A;  1QGV A;  2IIY A;  3UBL A;  1GTA A;  4GF0 A;  3ZFB A;  2NTO A;  3WGE A;  1RQM A;  4POM A;  2E2M A;  3DD3 A;  1LJR A;  3ZMK A;  2TRC P;  5FHI A;  1EEJ A;  1W89 A;  1EP7 A;  1AC1 A;  3IOS A;  4IHU A;  3D0Z A;  4KF9 A;  2V2G A;  1XIY A;  5IMF A;  1SJI A;  1MEK A;  4WEY A;  4IQ1 A;  1X5E A;  4OO5 A;  2MMN A;  1S3D A;  2MMA A;  2V41 A;  17GS A;  4G19 A;  1IYH A;  4MF6 A;  3TKS A;  3TKR A;  20GS A;  4FYU A;  3FW2 A;  2QKE A;  3GL5 A;  3S9F A;  2ZUP A;  1LBK A;  1PRX A;  1SYX A;  1TRU A;  2ZCT A;  6GSX A;  1XOA A;  1XVQ A;  2CVB A;  2YZH A;  2AUV A;  2WDU A;  4ULX A;  3UJ1 A;  2VLU A;  4XHM A;  1T00 A;  3EMX A;  2HT9 A;  2LUS A;  4LMW A;  2VD1 A;  1BAY A;  2B5X A;  4IS0 A;  4LL4 B;  5GAP D;  2QGV A;  4OO4 A;  1R5A A;  1ZGN A;  1XWB A;  2IMD A;  2B7K A;  1TK8 B;  4KND A;  2IMI A;  2YV7 A;  2OE3 A;  1TI1 A;  4HSC X;  1A8Y A;  4I6X A;  3V1W A;  1GUH A;  2X4A A;  3NOF A;  5ID2 B;  1XG8 A;  2C0F A;  6GSS A;  1M2A A;  5DVB A;  3Q19 A;  1WRY A;  1TI3 A;  3RHC A;  3U6V A;  3N9J A;  1HNA A;  3FYG A;  3HJM A;  2OAD A;  5G5F A;  2LTK A;  1ABA A;  5KOX A;  5F07 A;  4DSS B;  1MTC A;  1BJX A;  3KD0 A;  4TXO A;  3EWL A;  2QSI A;  4ID0 A;  2GVP A;  2X99 A;  3F9U A;  2C80 A;  3LXT A;  1ERT A;  4RI6 A;  1ERW A;  2H0H A;  2JSY A;  4XRA A;  4N30 A;  5GST A;  3F63 A;  3LW9 A;  1T3B A;  5H5S A;  2R0C A;  1QXH A;  3C1S A;  1ERU A;  1MDI A;  2YZU A;  4PUR A;  2F9S A;  3A2W A;  2PPT A;  4GTU A;  5EPF A;  5A5K A;  3ERG A;  3H79 A;  4NAX A;  19GS A;  3ED3 A;  2OJL A;  2CA8 A;  4N10 A;  1SD9 A;  4TR0 A;  2VL2 C;  1ACV A;  1ZCP A;  2FNO A;  1QFN A;  4J57 E;  4GRF A;  3M0F A;  1EP8 A;  3G9B A;  5F0G A;  1K0C A;  1V58 A;  3E3E A;  5DQS A;  1BQ7 A;  4AJ6 A;  2GT6 A;  2JZR A;  3H1N A;  4K7N A;  2ZNM A;  5G1L A;  5KN3 A;  1AUC A;  3GKM A;  5AIV A;  2HZE B;  5HFK A;  2LQQ A;  2RM6 A;  4NHW A;  2OA7 A;  1TU7 A;  3FEU A;  1PL1 A;  5JWO B;  4QL7 A;  4I2U A;  1JZW A;  1EWX A;  2PWJ A;  4HUA A;  1O81 A;  1XWC A;  5JCU A;  3L9V A;  5CRG A;  3FZ4 A;  4IP1 A;  4A5P A;  2B1L A;  3ZFL A;  2AV4 A;  2CZ3 A;  3VI5 A;  5IOX A;  1OC8 A;  2FLS A;  2YCD A;  1ZYQ B;  1M3J A;  1JHB A;  5HQP A;  4O92 A;  4Z2T A;  5FT3 A;  2JZS A;  1VF3 A;  1V98 A;  2M72 A;  2HE3 A;  2H1A A;  2F8A A;  3GN3 A;  3IHG A;  4PNF A;  2RM5 A;  1HYU A;  4TR4 A;  3GKK A;  3QFA C;  5JCW A;  1OE8 A;  1R26 A;  3FHK A;  3ZVJ D;  5F06 A;  2O85 A;  4BVX A;  3HHV A;  2YOI A;  3FR9 A;  1O8X A;  2EC4 A;  1SK1 A;  5HR2 A;  2R0G A;  3I69 A;  3CTF A;  2WFC A;  4V1A p;  3IV4 A;  1F3B A;  1ZYP A;  5IIZ A;  4CHS A;  1WJK A;  1E2Y A;  2N5A A;  1M2D A;  4EIQ A;  2VAF A;  4YQU A;  1H4O A;  4AJ8 A;  3QFB C;  3TUE A;  2RUE A;  2GLR A;  4BIK A;  2AHE A;  3QD9 A;  1N2A A;  4MF5 A;  4MK3 A;  1HQO A;  4K1F A;  5EL8 A;  4G9H A;  3FZ5 A;  5ECH B;  1GTU A;  4X4J A;  2FWH A;  5J5N A;  3IA1 A;  1XW6 A;  4XRD A;  1YKA A;  2O7K A;  1UC7 A;  1EGR A;  4HI7 A;  3CRU A;  1YEX A;  2MBS A;  2KLX A;  3AY8 A;  4ECB A;  1VRS D;  2PUK C;  3H8Q A;  3KP9 A;  2FWG A;  3WGX A;  2P0G A;  4GLT A;  2QA1 A;  1G0T A;  3QAV A;  3KP8 A;  3L9S A;  4KDY A;  4JBB A;  2TRX A;  3M9J A;  10GS A;  3F6D A;  4ZL8 A;  2H76 A;  4K0G A;  1U3A A;  1ON4 A;  3FZ9 A;  1FOV A;  4EVM A;  3US3 A;  3ZIV A;  2X8H A;  1R4W A;  3CSI A;  4WXT A;  3D4M A;  9GSS A;  2GZZ A;  3GSS A;  3CMI A;  3LYP A;  3BCI A;  1DBY A;  2N5F A;  3HKR A;  2OAC A;  2JZT A;  3HVS A;  1ZMA A;  4GST A;  4LLR A;  2LQO A;  2X49 A;  3ZYW A;  2V6K A;  4NV5 A;  2XC2 A;  4L0W A;  1XBS A;  3KZQ A;  2LRT A;  1HNC A;  2DKI A;  4O32 A;  3F6F A;  5KN2 A;  4ZB6 A;  5C04 A;  3FRC A;  4ZB9 A;  1Z3E A;  3OR5 A;  1GSE A;  5B8A A;  2YWO A;  2E2G A;  2C0D A;  3TB2 A;  2CZ2 A;  4LMV A;  1GSD A;  2OE0 A;  4RUV A;  4GXZ A;  22GS A;  4GCI A;  3F0I A;  1YEP A;  1V57 A;  1EV9 A;  3QAG A;  3IR4 A;  3IK7 A;  3TKP A;  2DJ2 A;  1M0U A;  2ON5 A;  3HY2 A;  1TP9 A;  4X0X A;  4JR6 A;  3GFK A;  3KCM A;  5J9B A;  3QOU A;  1S3C A;  4HQZ A;  4TR1 B;  5J4U A;  3F3R A;  4KX4 A;  2DML A;  3GKN A;  3FZA A;  4DSR A;  2P5R A;  2JU5 A;  1SD8 A;  1XOB A;  3VLN A;  1SL1 B;  3ZVJ A;  3DKS A;  5JCG A;  2ES7 A;  3NZN A;  4KAE A;  2HRN A;  4TVE A;  3DRN A;  4IJI A;  5ECQ B;  2WGR A;  2L4Q A;  1FVK A;  3LG6 A;  4EE0 A;  3HYP A;  3APQ A;  5CAX A;  4KDU A;  4G0L A;  1ZYN A;  1N8J A;  4I2T A;  4L0U A;  5HR1 A;  3FMW A;  1GSQ A;  2LST A;  1TDI A;  1TRS A;  2CV4 A;  1AQX A;  3UBK A;  3EVI A;  2F51 A;  4K2D A;  1ST9 A;  1XW5 A;  3GX0 A;  3APS A;  4H86 A;  2LJR A;  1MDK A;  3M3M A;  3LXZ A;  1GRX A;  2VIM A;  4V1A g;  5ID2 A;  2FWF A;  5L71 A;  3J7Y k;  4WET A;  1SKR B;  1J9B A;  1JLV A;  4GSS A;  2FWE A;  2QA2 A;  1O73 A;  4ECI A;  5CRH A;  5HFG A;  2PER A;  1Q98 A;  4DSS A;  1K3O A;  1GUL A;  4NXI A;  4N0V A;  4EDZ A;  3KMO A;  4O5R A;  3TRX A;  2P31 A;  4MPF A;  4JU5 A;  2LRN A;  2H19 A;  5CNW A;  1GNW A;  3HVV A;  4X1U A;  1B9Y C;  3RDW A;  3VWW A;  3VWV A;  3QR6 A;  2NDO A;  3CXG A;  3TOT A;  2KP2 A;  2NPB A;  3Q74 A;  4Z7X A;  3TOU A;  2H73 A;  2QC7 A;  2HRK A;  3EU4 A;  2R37 A;  2V32 A;  4WF4 A;  1TRW A;  3P8W A;  5IO2 A;  5CO3 A;  3ZTL A;  3BOA A;  2K8S A;  4HU9 A;  3P2A A;  2X8C A;  3KEB A;  2YN1 A;  1XVW A;  5DCG A;  1JZR A;  5G30 A;  2R2J A;  1AW9 A;  2FHE A;  2UZ8 A;  1XWA A;  11GS A;  2C4J A;  1K0D A;  1TJD A;  1R5P A;  4ZBB A;  1GTI A;  5HR0 A;  5FWG A;  2YV9 A;  4OD7 A;  1SK0 A;  3LSZ A;  4ICY A;  3ME8 A;  2AYT A;  4TR3 A;  2PGT A;  2DJK A;  3EPT A;  4Q5F A;  4POB A;  1BX9 A;  3Q18 A;  7GSS A;  1DSB A;  2MBT A;  1AQV A;  5BRT A;  3N5O A;  2R3X A;  5C00 A;  2PU9 C;  4EUY A;  3IPZ A;  2HZE A;  1PFO A;  4TW5 A;  2C3N A;  3R2Q A;  2DC5 A;  3ZL5 A;  3EU3 A;  3TDG A;  1A2J A;  2FY6 A;  4HOJ A;  4XTS A;  3LOR A;  3GUR A;  5DAK B;  3PPU A;  2GSR A;  2YWM A;  1X9S B;  4OWY A;  1ERV A;  4I5Q A;  5B7C A;  1S3R A;  4XS4 B;  1K3Y A;  1PL2 A;  4MLY A;  1OKD A;  2RII A;  1A2M A;  3KGK A;  5H5R A;  1SL0 B;  1VF4 A;  2EIQ A;  3TJJ A;  4YH2 A;  5IPH A;  4MH3 A;  1ILO A;  3WT2 A;  4KGI A;  3ZRD A;  4HDE A;  4RQX A;  1M3I A;  1THX A;  4JZQ A;  4MAB A;  5BMU A;  2KOK A;  2IJY A;  5AGY A;  1J08 A;  3EIN A;  1OC3 A;  2CQ9 A;  1SYR A;  5ENU A;  4AGS A;  4XCS A;  2C1Y A;  1I9D A;  5ECI B;  4MJC A;  4F03 A;  1XCC A;  1PX6 A;  3IC4 A;  1PMT A;  3TGZ A;  4MH2 A;  4HJM A;  5JWR B;  1F2E A;  4ISD A;  4ZL7 A;  4JE1 A;  2LS5 A;  3TJB A;  4EKZ A;  2VCZ A;  3UVH A;  3RPN A;  2H66 A;  4PXO A;  4P3Y B;  3GMF A;  3KH9 A;  3EE2 A;  3HZ4 A;  1J0F A;  1CQH A;  4JRR A;  1JLW A;  1UA5 A;  3LGC A;  2B6M A;  1H75 A;  3UOM A;  5AIS A;  1X5C A;  5ECM B;  3UMA A;  5EY6 A;  5G5E A;  4BWS A;  4WBR D;  1BG5 A;  4KSM A;  3J7Y b;  2BTO T;  2CT6 A;  2LKU A;  1O8W A;  1F37 A;  1G6W A;  4O5U A;  3ZIJ A;  4IGJ A;  3ZZX A;  1SKW B;  2GDR A;  4POK A;  1QUW A;  4N11 A;  5DBQ A;  4ECJ A;  4D73 B;  1S3A A;  2LNT A;  2I9H A;  5IM9 A;  3LFL A;  1R7H A;  3HVN A;  2GGT A;  4KB3 A;  1A8L A;  4ECC A;  2M80 A;  2IWT A;  1K0B A;  4DSQ A;  2H72 A;  3ERF A;  2VLV A;  2FUG 2;  1GP1 A;  1T8E B;  5D93 A;  2IFQ B;  2X64 A;  3E9J B;  5CRE A;  2HI7 A;  3QPM A;  1G6Y A;  3I6A A;  1QQ2 A;  2JAD A;  4TN8 A;  5DJM A;  2HNL A;  2H1B A;  4CDO A;  3BCK A;  4NMU A;  1FB0 A;  3PH9 A;  1T4Z A;  1PA3 A;  3L4N A;  4OFT A;  1M9B A;  4PGT A;  2KHP A;  1GSU A;  5A4V A;  4YQV A;  1FAA A;  5CRD A;  4RQR A;  4MDC A;  4KUN A;  1BYE A;  4NWY A;  2BMX A;  2FA4 A;  2H1G A;  5DJL A;  4J2F A;  2I1U A;  4ACS A;  5ECR B;  3GST A;  2J9H A;  5IMZ A;  2CAQ A;  3TKQ A;  2X8G A;  1XW9 A;  1PN9 A;  1TOF A;  2G2Q A;  2A2S A;  1YF1 A;  2VO4 A;  2L57 A;  2I81 A;  1YJ6 A;  4X43 A;  2YWN A;  1W4V A;  6GST A;  5IOW A;  3LEF A;  5B6M A;  3H93 A;  3MIX A;  2VL3 A;  4WBJ A;  4EO3 A;  2XPD A;  1TTZ A;  2VL2 A;  2DSA A;  1ZL9 A;  1USB A;  4BVY B;  4TR1 A;  3HA9 A;  3GRX A;  4NHZ A;  5G31 A;  3VPT A;  1URM A;  1UN2 A;  2HFD A;  3UL3 A;  2VLT A;  1TRV A;  1DUG A;  1GUM A;  4K9Z A;  1SU9 A;  3I9V 2;  4POL A;  4I8B A;  1XZO A;  1GLQ A;  2VUP A;  3VI7 A;  2WB9 A;  2A4V A;  3IC8 A;  1FO5 A;  2DLX A;  5CRW A;  1YQ1 A;  2P5Q A;  3D5J A;  4G0I A;  3GL3 A;  4ZBD A;  2KUC A;  6GSY A;  2FD3 A;  1U6T A;  4Z2U A;  3HZ8 A;  5IO0 A;  1M2B A;  5DCH A;  4Q5R A;  1SL2 B;  3G7J A;  2K9F A;  4F2I A;  5D9X A;  4Q5Q A;  4YAP A;  3D22 A;  4PX1 A;  4JR4 A;  2IN3 A;  1YY7 A;  1B4Q A;  4MZC A;  2H70 A;  3EUR A;  2DIY A;  2LRC A;  1HD2 A;  3IHQ A;  3RBT A;  4LL1 B;  3A5W A;  3TKS C;  5H5Q A;  2JAC A;  4I97 A;  1E6B A;  3IAS 2;  3PIN A;  4OCE A;  4V2N A;  5GSS A;  1AQW A;  4IP6 A;  3W6G A;  1T1V A;  1MDJ A;  3EYT A;  1GWC A;  1Z7R A;  2WCI A;  3ZML A;  3KMN A;  5D9W A;  2DJ0 A;  4HZ4 A;  1XXU A;  4OCF A;  2KP1 A;  5J41 A;  2LNS A;  4KSO A;  4EDY A;  6GSW A;  2DKH A;  5DAL B;  1SJZ A;  2R6K A;  4F0C A;  4WR5 A;  1HNB A;  3FR3 A;  3CQF A;  3JCM L;  2K8V A;  3RHB A;  3FK8 A;  2HSM A;  5ECL B;  3MYD A;  2YPM A;  1GH2 A;  3IBH A;  3CTG A;  2Z9S A;  2VL9 A;  2GQK A;  1PSQ A;  2DJ3 A;  1Z6M A;  3DML A;  4PUA A;  3ME7 A;  4FYC A;  3D4T A;  2OBK A;  1M9A A;  3WD6 A;  4N0Z A;  1T4Y A;  3DEX A;  2RLI A;  1A23 A;  1T7P B;  3IK9 A;  4ZB8 A;  1OE7 A;  5LNK e;  4O5Q A;  3LWA A;  2K6V A;  2YAN A;  3DGQ A;  4BA7 A;  3CBU A;  3F4T A;  1WWJ A;  3C7M A;  1Z9H A;  1WE0 A;  5COH A;  3VUR A;  1OVN A;  3VK9 A;  1OAZ A;  1OYJ A;  4MJA A;  3WT1 A;  2PVQ A;  1YKC A;  2H71 A;  2C3T A;  1NW2 A;  4MMM A;  4TRX A;  3I43 A;  4XS6 A;  2HRA A;  3A2V A;  4K0N A;  1TKD B;  3ISO A;  1FOH A;  4NV2 A;  4IN0 A;  2C0G A;  2V6O A;  1M99 A;  3KXO A;  4HZ2 A;  2H6X A;  1KEB A;  3CRT A;  4CY8 A;  1YZX A;  2AB6 A;  4F82 A;  1WP0 A;  1F6M C;  2MZC A;  4ZIJ A;  3GH9 A;  2GS3 A;  3MWH A;  1K0O A;  2VCV A;  4DVC A;  1FW1 A;  3F4S A;  2MYG A;  3M1G A;  4EF0 A;  5CP1 A;  4KCA A;  1TW9 A;  4G0K A;  4KDX A;  1B8X A;  2IPA A;  3O3T A;  2RUF A;  4BWQ A;  3TJK A;  2GZY A;  4FO5 A;  5DAK A;  1I5G A;  3GA4 A;  2DMM A;  3EC3 A;  2WZ9 A;  2WUL A;  1C72 A;  1EEM A;  1ZYE A;  1AAZ A;  4V2L A;  1A0F A;  2DBC A;  2OBI A;  1THO A;  5G2Z A;  4IEL A;  5JWQ B;  4XS4 A;  2VCQ A;  4IW9 A;  1SKS B;  4IKH A;  3IE3 A;  4IVF A;  2OE1 A;  4V2M A;  3DIE A;  1JZO A;  3C8E A;  3W8S A;  3GX8 A;  5ABR A;  2VM1 A;  2R5G A;  2H0I A;  3G7Y A;  4K8M A;  3GTU B;  2O8V B;  1XWK A;  3CYN A;  4FH8 A;  2CX3 A;  1A24 A;  1G7E A;  1X0R A;  1K0N A;  3GHA A;  4K7O A;  4MA9 A;  2VD0 A;  1Q4J A;  1FHE A;  5A4W A;  3IRA A;  5F8B A;  3FR6 A;  3UAP A;  5B6N A;  2IMK A;  5ECN B;  2XPE A;  3TRP A;  16GS A;  2FCH A;  4YAV A;  2PN8 A;  1Z7P A;  2G0F A;  2J23 A;  5ELA A;  1EOG A;  1GSF A;  3K8N A;  3DWV A;  3UAR A;  3QCP A;  1Z6N A;  2FA8 A;  1VF1 A;  3CSJ A;  2PMT A;  3LJR A;  2HZF A;  1IYI A;  5KEJ A;  3H4K A;  1A0R P;  3LYK A;  1GSS A;  4BL7 A;  3APO A;  2H75 A;  5INY A;  4GSN A;  1UVZ A;  3F4R A;  4MZW A;  1OC9 B;  2EIO A;  3TCO A;  3KIJ A;  1B4P A;  3QMX A;  2XBQ A;  4XIH A;  3L0H A;  2H01 A;  4G2E A;  1SEN A;  3G7I A;  2HYX A;  4BPY A;  3P90 A;  4LA1 A;  1PQN A;  4PUF C;  3PR8 A;  1DE1 A;  2GSS A;  1B48 A;  2GQL A;  5ECS A;  4GQC A;  2CAI A;  2O87 A;  4K5R A;  3HD5 A;  1MD4 A;  4USS A;  2L6D A;  3ERW A;  2YWI A;  4K6X A;  4MJE A;  2A4H A;  3ZLP A;  1WOU A;  2K18 A;  4D73 A;  4GWR A;  5ELG A;  3F3Q A;  4DEJ A;  4G10 A;  3MNG A;  2H6Y A;  4OMV A;  3MDK A;  3FY7 A;  2XHF A;  3FKF A;  5HFI A;  3A2X A;  5LD0 A;  1YDK A;  5LCZ A;  3QAW A;  4Z2R A;  1U87 A;  2O89 A;  3RAZ A;  4MF7 A;  4EIP A;  1GNE A;  2IFQ A;  4HQS A;  4K7I A;  3DVW A;  3R3E A;  3RPP A;  5B8B A;  2WS2 A;  3KTL A;  3ZRE A;  1NM3 A;  1RW1 A;  4AJ7 A;  3WYW A;  4MP4 A;  2C0E A;  4TOP A;  1K3L A;  1VGL A;  1SJ6 A;  5GZZ B;  4OFM A;  3VPQ A;  3E0U A;  2L5L A;  4MJB A;  1QK8 A;  4PNG A;  2B5E A;  4EXJ A;  3GUS A;  4BL7 B;  3GKX A;  4EL1 A;  2GST A;  1O85 A;  1GL8 A;  5G1K A;  4QL9 A;  4RI7 A;  3C71 A;  3DYR A;  1VF2 A;  1U3I A;  1K0M A;  2F8F A;  2DIZ A;  2LJK A;  1PKZ A;  2MMO A;  3O6T A;  4PQ1 A;  3KH7 A;  1JZD A;  2CVD A;  2HLS A;  2AJQ B;  3BD2 A;  3C73 A;  1WPI A;  3HJP A;  4TXV A;  1FG4 A;  1RK4 A;  4Q5N A;  3SWL A;  5IMA A;  3BJ5 A;  5D9T A;  4EC0 A;  3ZIT A;  1BED A;  4AF2 A;  4YQM A;  3UEM A;  3KM6 A;  4FQU A;  2YNX A;  2E7P A;  3IAM 2;  5D9V A;  3DXB A;  18GS A;  4BVY A;  2AAW A;  4TXO B;  5IPG A;  1GSY A;  3UIW A;  1K0A A;  5IMV A;  4PTS A;  3TRQ A;  1MD3 A;  3C1R A;  2B7J A;  2B5Y A;  2LEG A;  5IMC A;  2L6C A;  2DJJ A;  4J56 E;  2H0G A;  3W8J A;  4L8E A;  3VWX A;  1F3A A;  2FGX A;  4IBP A;  4KCE A;  1B9X C;  1GLP A;  2BJX A;  4WKW A;  2C3Q A;  5AN1 A;  5CYY A;  4OFN A;  3IXR A;  1TU8 A;  2DJ1 A;  2CX4 A;  2IMF A;  3M9K A;  1CQG A;  2I4A A;  4MZB A;  5GAN D;  1F9M A;  1NSW A;  2H8L A;  1PX7 A;  5HR3 A;  3GIX A;  4YKG A;  2IME A;  5E4W A;  13GS A;  3LQ7 A;  6GSV A;  4O7H A;  5J3R A;  2H6Z A;  4E8E A;  3GV1 A;  2A2P A;  3DVX A;  2I3Y A;  3GH6 A;  1LU4 A;  4GQF A;  2E0Q A;  4MPG A;  2C8U A;  5DAL A;  4JED A;  3Q6O A;  2IL3 A;  2GSQ A;  1WIK A;  4E8H A;  4PQI A;  2GQM A;  1PD2 1;  3MSZ A;  1O7U A;  3VWU A;  4KE3 A;  1ZOF A;  4MNN A;  3D21 A;  3TJG A;  2H1D A;  1OKT A;  2HRF A;  1XWG A;  4IQA A;  5AIX A;  3SBC A;  1ML6 A;  3M8N A;  4CY6 A;  5ECP B;  2H74 A;  1NHY A;  1DE2 A;  4ZIL A;  3HJO A;  1EV4 A;  2H30 A;  2NVL A;  2F3M A;  2VCX A;  1TK0 B;  1YF0 A;  2MMZ A;  4HJ2 A;  2N5B A;  5DDL A;  1G7O A;  2PVO C;  4ML1 A;  4L5L A;  3QDN A;  4HS1 A;  3IDV A;  6GSU A;  5EVO A;  1A2L A;  3GYK A;  1KBN A;  5A4U A;  5F05 A;  4TKY A;  2GT5 A;  1Y6E A;  4KH7 A;  5ECK B;  4F9Z A;  2L59 A;  3TJF A;  4ZL9 A;  8GSS A;  2VOC A;  1KTE A;  4BVX B;  4WF5 A;  1FVJ A;  1V9W A;  1M7T A;  3MAK A;  2GZP A;  1ZZY A;  3BBY A;  2WJU A;  4KW6 A;  4ILF A;  4K2X A;  3P7X A;  1X9W B;  1EGO A;  5IMD A;  3L78 A;  1FB6 A;  5KOW A;  4F0B A;  3HCZ A;  2TIR A;  2B3S A;  3PGT A;  4ML6 A;  2B1K A;  2REM A;  1PGT A;  3KJY A;  4IJ3 A;  3CSH A;  2EIR A;  2LJA A;  1QMV A;  5D73 A;  3HDC A;  4ZBA A;  1TK5 B;  4XS1 A;  4PQH A;  1EZK A;  5KN0 A;  1KNG A;  2GTU A;  1XFL A;  4FIW A;  4KA0 A;  2A2R A;  2PBJ A;  12GS A;  1SK2 A;  2VCW A;  1X9M B;  5IQY A;  4MCU A;  4L5O A;  3KTB A;  2YJ7 A;  2ON7 A;  3D6I A;  2HSH A;  5J9C A;  2LV3 A;  2XBI A;  1AXD A;  3NIV A;  4WR4 A;  3GNJ A;  2WRT A;  3GTU A;  5ECO B;  1PN0 A;  3F8U A;  4FYB A;  5D96 A;  1Z5Y E;  3TKS E;  1XPV A;  2V1M A;  2HXK A;  1PKW A;  2YJH A;  2JSZ A;  2L5O A;  1JFU A;  2CVK A;  1NHO A;  3HXS A;  2R4V A;  5E59 A;  2NBS A;  4NPB A;  3U5R E;  1GTB A;  1V2A A;  3O76 A;  2L4C A;  3UVT A;  2JL4 A;  1TXX A;  2HSY A;  1WMJ A;  3WGD A;  3A5I A; 
#chains in the Genus database with same CATH homology
 2VM2 A;  1O6J A;  1EOH A;  2D2Z A;  4HU7 A;  4QQ7 A;  2OKA A;  4HEA 2;  14GS A;  5KN1 A;  3A3T A;  3HVX A;  2VCT A;  1OC9 A;  5DQY A;  1GUK A;  2YP6 A;  1X5D A;  3EMP A;  5D8I A;  1AIU A;  1U88 A;  3L9U A;  4YKF A;  2ALB A;  1V40 A;  2M46 A;  4CW9 A;  1Y25 A;  2R0P A;  4ZXG A;  4K5S A;  3VFI A;  1QGV A;  2IIY A;  3UBL A;  1GTA A;  4GF0 A;  3ZFB A;  2NTO A;  3WGE A;  1RQM A;  4POM A;  2E2M A;  3DD3 A;  1LJR A;  3ZMK A;  2TRC P;  5FHI A;  1EEJ A;  1W89 A;  1EP7 A;  1AC1 A;  3IOS A;  4IHU A;  3D0Z A;  4KF9 A;  2V2G A;  1XIY A;  5IMF A;  1SJI A;  1MEK A;  4WEY A;  4IQ1 A;  1X5E A;  4OO5 A;  2MMN A;  1S3D A;  2MMA A;  2V41 A;  17GS A;  4G19 A;  1IYH A;  4MF6 A;  3TKS A;  3TKR A;  20GS A;  4FYU A;  3FW2 A;  2QKE A;  3GL5 A;  3S9F A;  2ZUP A;  1LBK A;  1PRX A;  1SYX A;  1TRU A;  2ZCT A;  6GSX A;  1XOA A;  1XVQ A;  2CVB A;  2YZH A;  2AUV A;  2WDU A;  4ULX A;  3UJ1 A;  2VLU A;  4XHM A;  1T00 A;  3EMX A;  2HT9 A;  2LUS A;  4LMW A;  2VD1 A;  1BAY A;  2B5X A;  4IS0 A;  4LL4 B;  5GAP D;  2QGV A;  4OO4 A;  1R5A A;  1ZGN A;  1XWB A;  2IMD A;  2B7K A;  1TK8 B;  4KND A;  2IMI A;  2YV7 A;  2OE3 A;  1TI1 A;  1A8Y A;  4I6X A;  3V1W A;  1GUH A;  2X4A A;  3NOF A;  5ID2 B;  2C0F A;  6GSS A;  1M2A A;  5DVB A;  3Q19 A;  1WRY A;  1TI3 A;  3RHC A;  3U6V A;  3N9J A;  1HNA A;  3FYG A;  3HJM A;  2OAD A;  5G5F A;  2LTK A;  1ABA A;  5KOX A;  5F07 A;  4DSS B;  1MTC A;  1BJX A;  3KD0 A;  4TXO A;  3EWL A;  2QSI A;  4ID0 A;  2GVP A;  2X99 A;  3F9U A;  2C80 A;  3LXT A;  1ERT A;  4RI6 A;  1ERW A;  2H0H A;  2JSY A;  4XRA A;  4N30 A;  5GST A;  3F63 A;  3LW9 A;  1T3B A;  5H5S A;  2R0C A;  1QXH A;  3C1S A;  1ERU A;  1MDI A;  2YZU A;  4PUR A;  2F9S A;  3A2W A;  2PPT A;  4GTU A;  5EPF A;  5A5K A;  3ERG A;  3H79 A;  4NAX A;  19GS A;  3ED3 A;  2OJL A;  2CA8 A;  4N10 A;  1SD9 A;  4TR0 A;  2VL2 C;  1ACV A;  1ZCP A;  2FNO A;  1QFN A;  4J57 E;  4GRF A;  3M0F A;  1EP8 A;  3G9B A;  5F0G A;  1K0C A;  1V58 A;  3E3E A;  5DQS A;  1BQ7 A;  4AJ6 A;  2GT6 A;  2JZR A;  3H1N A;  4K7N A;  2ZNM A;  5G1L A;  5KN3 A;  1AUC A;  3GKM A;  5AIV A;  2HZE B;  5HFK A;  2LQQ A;  2RM6 A;  4NHW A;  2OA7 A;  1TU7 A;  3FEU A;  1PL1 A;  5JWO B;  4QL7 A;  4I2U A;  1JZW A;  1EWX A;  2PWJ A;  4HUA A;  1O81 A;  1XWC A;  5JCU A;  3L9V A;  5CRG A;  3FZ4 A;  4IP1 A;  4A5P A;  2B1L A;  3ZFL A;  2AV4 A;  2CZ3 A;  3VI5 A;  5IOX A;  1OC8 A;  2FLS A;  2YCD A;  1ZYQ B;  1JHB A;  5HQP A;  4O92 A;  4Z2T A;  5FT3 A;  2JZS A;  1VF3 A;  1V98 A;  2M72 A;  2HE3 A;  2H1A A;  2F8A A;  3GN3 A;  3IHG A;  4PNF A;  2RM5 A;  1HYU A;  4TR4 A;  3GKK A;  3QFA C;  5JCW A;  1OE8 A;  1R26 A;  3FHK A;  3ZVJ D;  5F06 A;  2O85 A;  4BVX A;  3HHV A;  2YOI A;  3FR9 A;  1O8X A;  2EC4 A;  1SK1 A;  5HR2 A;  2R0G A;  3I69 A;  3CTF A;  2WFC A;  4V1A p;  3IV4 A;  1F3B A;  1ZYP A;  5IIZ A;  4CHS A;  1WJK A;  1E2Y A;  2N5A A;  1M2D A;  4EIQ A;  2VAF A;  4YQU A;  1H4O A;  4AJ8 A;  3QFB C;  3TUE A;  2RUE A;  2GLR A;  2AHE A;  3QD9 A;  1N2A A;  4MF5 A;  4MK3 A;  1HQO A;  4K1F A;  5EL8 A;  4G9H A;  3FZ5 A;  5ECH B;  1GTU A;  4X4J A;  2FWH A;  5J5N A;  3IA1 A;  1XW6 A;  4XRD A;  1YKA A;  2O7K A;  1UC7 A;  1EGR A;  4HI7 A;  3CRU A;  1YEX A;  2MBS A;  2KLX A;  3AY8 A;  4ECB A;  1VRS D;  2PUK C;  3H8Q A;  3KP9 A;  2FWG A;  3WGX A;  2P0G A;  4GLT A;  2QA1 A;  1G0T A;  3QAV A;  3KP8 A;  3L9S A;  4KDY A;  4JBB A;  2TRX A;  3M9J A;  10GS A;  3F6D A;  4ZL8 A;  2H76 A;  4K0G A;  1U3A A;  1ON4 A;  3FZ9 A;  1FOV A;  4EVM A;  3US3 A;  3ZIV A;  2X8H A;  1R4W A;  3CSI A;  4WXT A;  3D4M A;  9GSS A;  2GZZ A;  3GSS A;  3CMI A;  3LYP A;  3BCI A;  1DBY A;  2N5F A;  3HKR A;  2OAC A;  2JZT A;  3HVS A;  1ZMA A;  4GST A;  4LLR A;  2LQO A;  2X49 A;  3ZYW A;  2V6K A;  4NV5 A;  2XC2 A;  4L0W A;  1XBS A;  3KZQ A;  2LRT A;  1HNC A;  2DKI A;  4O32 A;  3F6F A;  5KN2 A;  4ZB6 A;  5C04 A;  3FRC A;  4ZB9 A;  1Z3E A;  3OR5 A;  1GSE A;  5B8A A;  2YWO A;  2E2G A;  2C0D A;  3TB2 A;  2CZ2 A;  4LMV A;  1GSD A;  2OE0 A;  4RUV A;  4GXZ A;  22GS A;  4GCI A;  3F0I A;  1YEP A;  1V57 A;  1EV9 A;  3QAG A;  3IR4 A;  3IK7 A;  3TKP A;  2DJ2 A;  1M0U A;  2ON5 A;  3HY2 A;  1TP9 A;  4X0X A;  4JR6 A;  3GFK A;  3KCM A;  5J9B A;  3QOU A;  1S3C A;  4HQZ A;  4TR1 B;  5J4U A;  3F3R A;  4KX4 A;  2DML A;  3GKN A;  3FZA A;  4DSR A;  2P5R A;  2JU5 A;  1SD8 A;  1XOB A;  3VLN A;  1SL1 B;  3ZVJ A;  3DKS A;  5JCG A;  2ES7 A;  3NZN A;  4KAE A;  2HRN A;  4TVE A;  3DRN A;  4IJI A;  5ECQ B;  2WGR A;  2L4Q A;  1FVK A;  3LG6 A;  4EE0 A;  3HYP A;  3APQ A;  5CAX A;  4KDU A;  4G0L A;  1ZYN A;  1N8J A;  4I2T A;  4L0U A;  5HR1 A;  3FMW A;  1GSQ A;  2LST A;  1TDI A;  1TRS A;  2CV4 A;  1AQX A;  3UBK A;  3EVI A;  2F51 A;  4K2D A;  1ST9 A;  1XW5 A;  3GX0 A;  3APS A;  4H86 A;  2LJR A;  1MDK A;  3M3M A;  3LXZ A;  1GRX A;  2VIM A;  4V1A g;  5ID2 A;  2FWF A;  5L71 A;  3J7Y k;  4WET A;  1SKR B;  1J9B A;  1JLV A;  4GSS A;  2FWE A;  2QA2 A;  1O73 A;  4ECI A;  5CRH A;  5HFG A;  2PER A;  1Q98 A;  4DSS A;  1K3O A;  1GUL A;  4NXI A;  4N0V A;  4EDZ A;  3KMO A;  4O5R A;  3TRX A;  2P31 A;  4MPF A;  4JU5 A;  2LRN A;  2H19 A;  5CNW A;  1GNW A;  3HVV A;  4X1U A;  1B9Y C;  3RDW A;  3VWW A;  3VWV A;  3QR6 A;  2NDO A;  3CXG A;  3TOT A;  2KP2 A;  2NPB A;  3Q74 A;  4Z7X A;  3TOU A;  2H73 A;  2QC7 A;  2HRK A;  3EU4 A;  2R37 A;  2V32 A;  4WF4 A;  1TRW A;  3P8W A;  5IO2 A;  5CO3 A;  3ZTL A;  3BOA A;  2K8S A;  4HU9 A;  3P2A A;  2X8C A;  3KEB A;  2YN1 A;  1XVW A;  5DCG A;  1JZR A;  5G30 A;  2R2J A;  1AW9 A;  2FHE A;  2UZ8 A;  1XWA A;  11GS A;  2C4J A;  1K0D A;  1TJD A;  1R5P A;  4ZBB A;  1GTI A;  5HR0 A;  5FWG A;  2YV9 A;  4OD7 A;  1SK0 A;  3LSZ A;  4ICY A;  3ME8 A;  2AYT A;  4TR3 A;  2PGT A;  2DJK A;  3EPT A;  4Q5F A;  4POB A;  1BX9 A;  3Q18 A;  7GSS A;  1DSB A;  2MBT A;  1AQV A;  5BRT A;  3N5O A;  2R3X A;  5C00 A;  2PU9 C;  4EUY A;  3IPZ A;  2HZE A;  4TW5 A;  2C3N A;  3R2Q A;  2DC5 A;  3ZL5 A;  3EU3 A;  3TDG A;  1A2J A;  2FY6 A;  4HOJ A;  4XTS A;  3LOR A;  3GUR A;  5DAK B;  3PPU A;  2GSR A;  2YWM A;  1X9S B;  4OWY A;  1ERV A;  4I5Q A;  5B7C A;  4XS4 B;  1K3Y A;  1PL2 A;  4MLY A;  1OKD A;  2RII A;  1A2M A;  3KGK A;  5H5R A;  1SL0 B;  1VF4 A;  2EIQ A;  3TJJ A;  4YH2 A;  5IPH A;  4MH3 A;  1ILO A;  3WT2 A;  4KGI A;  3ZRD A;  4HDE A;  4RQX A;  1THX A;  4JZQ A;  4MAB A;  5BMU A;  2KOK A;  2IJY A;  5AGY A;  1J08 A;  3EIN A;  1OC3 A;  2CQ9 A;  1SYR A;  5ENU A;  4AGS A;  4XCS A;  2C1Y A;  1I9D A;  5ECI B;  4MJC A;  4F03 A;  1XCC A;  1PX6 A;  3IC4 A;  1PMT A;  3TGZ A;  4MH2 A;  4HJM A;  5JWR B;  1F2E A;  4ISD A;  4ZL7 A;  4JE1 A;  2LS5 A;  3TJB A;  4EKZ A;  2VCZ A;  3UVH A;  3RPN A;  2H66 A;  4PXO A;  4P3Y B;  3GMF A;  3KH9 A;  3EE2 A;  3HZ4 A;  1J0F A;  1CQH A;  4JRR A;  1JLW A;  1UA5 A;  3LGC A;  2B6M A;  1H75 A;  3UOM A;  5AIS A;  1X5C A;  5ECM B;  3UMA A;  5EY6 A;  5G5E A;  4BWS A;  4WBR D;  1BG5 A;  4KSM A;  3J7Y b;  2BTO T;  2CT6 A;  2LKU A;  1O8W A;  1F37 A;  1G6W A;  4O5U A;  3ZIJ A;  4IGJ A;  3ZZX A;  1SKW B;  2GDR A;  4POK A;  1QUW A;  4N11 A;  5DBQ A;  4ECJ A;  4D73 B;  1S3A A;  2LNT A;  2I9H A;  5IM9 A;  3LFL A;  1R7H A;  2GGT A;  4KB3 A;  1A8L A;  4ECC A;  2M80 A;  2IWT A;  1K0B A;  4DSQ A;  2H72 A;  3ERF A;  2VLV A;  2FUG 2;  1GP1 A;  1T8E B;  5D93 A;  2IFQ B;  2X64 A;  3E9J B;  5CRE A;  2HI7 A;  3QPM A;  1G6Y A;  3I6A A;  1QQ2 A;  2JAD A;  4TN8 A;  5DJM A;  2HNL A;  2H1B A;  4CDO A;  3BCK A;  4NMU A;  1FB0 A;  3PH9 A;  1T4Z A;  1PA3 A;  3L4N A;  4OFT A;  1M9B A;  4PGT A;  2KHP A;  1GSU A;  5A4V A;  4YQV A;  1FAA A;  5CRD A;  4RQR A;  4MDC A;  4KUN A;  1BYE A;  4NWY A;  2BMX A;  2FA4 A;  2H1G A;  5DJL A;  4J2F A;  2I1U A;  4ACS A;  5ECR B;  3GST A;  2J9H A;  5IMZ A;  2CAQ A;  3TKQ A;  2X8G A;  1XW9 A;  1PN9 A;  1TOF A;  2G2Q A;  2A2S A;  1YF1 A;  2VO4 A;  2L57 A;  2I81 A;  1YJ6 A;  4X43 A;  2YWN A;  1W4V A;  6GST A;  5IOW A;  3LEF A;  5B6M A;  3H93 A;  3MIX A;  2VL3 A;  4WBJ A;  4EO3 A;  2XPD A;  1TTZ A;  2VL2 A;  2DSA A;  1ZL9 A;  1USB A;  4BVY B;  4TR1 A;  3HA9 A;  3GRX A;  4NHZ A;  5G31 A;  3VPT A;  1URM A;  1UN2 A;  2HFD A;  3UL3 A;  2VLT A;  1TRV A;  1DUG A;  1GUM A;  4K9Z A;  1SU9 A;  3I9V 2;  4POL A;  4I8B A;  1XZO A;  1GLQ A;  2VUP A;  3VI7 A;  2WB9 A;  2A4V A;  3IC8 A;  1FO5 A;  2DLX A;  5CRW A;  1YQ1 A;  2P5Q A;  3D5J A;  4G0I A;  3GL3 A;  4ZBD A;  2KUC A;  6GSY A;  2FD3 A;  1U6T A;  4Z2U A;  3HZ8 A;  5IO0 A;  1M2B A;  5DCH A;  4Q5R A;  1SL2 B;  3G7J A;  2K9F A;  4F2I A;  5D9X A;  4Q5Q A;  4YAP A;  3D22 A;  4PX1 A;  4JR4 A;  2IN3 A;  1YY7 A;  1B4Q A;  4MZC A;  2H70 A;  3EUR A;  2DIY A;  2LRC A;  1HD2 A;  3IHQ A;  3RBT A;  4LL1 B;  3A5W A;  3TKS C;  5H5Q A;  2JAC A;  4I97 A;  1E6B A;  3IAS 2;  3PIN A;  4OCE A;  4V2N A;  5GSS A;  1AQW A;  4IP6 A;  3W6G A;  1T1V A;  1MDJ A;  3EYT A;  1GWC A;  1Z7R A;  2WCI A;  3ZML A;  3KMN A;  5D9W A;  2DJ0 A;  4HZ4 A;  1XXU A;  4OCF A;  2KP1 A;  5J41 A;  2LNS A;  4KSO A;  4EDY A;  6GSW A;  2DKH A;  5DAL B;  1SJZ A;  2R6K A;  4F0C A;  4WR5 A;  1HNB A;  3FR3 A;  3JCM L;  2K8V A;  3RHB A;  3FK8 A;  2HSM A;  5ECL B;  3MYD A;  2YPM A;  1GH2 A;  3IBH A;  3CTG A;  2Z9S A;  2VL9 A;  2GQK A;  1PSQ A;  2DJ3 A;  1Z6M A;  3DML A;  4PUA A;  3ME7 A;  4FYC A;  3D4T A;  2OBK A;  1M9A A;  3WD6 A;  4N0Z A;  1T4Y A;  3DEX A;  2RLI A;  1A23 A;  1T7P B;  3IK9 A;  4ZB8 A;  1OE7 A;  5LNK e;  4O5Q A;  3LWA A;  2K6V A;  2YAN A;  3DGQ A;  4BA7 A;  3CBU A;  3F4T A;  1WWJ A;  3C7M A;  1Z9H A;  1WE0 A;  5COH A;  3VUR A;  1OVN A;  3VK9 A;  1OAZ A;  1OYJ A;  4MJA A;  3WT1 A;  2PVQ A;  1YKC A;  2H71 A;  2C3T A;  1NW2 A;  4MMM A;  4TRX A;  3I43 A;  4XS6 A;  2HRA A;  3A2V A;  4K0N A;  1TKD B;  3ISO A;  1FOH A;  4NV2 A;  4IN0 A;  2C0G A;  2V6O A;  1M99 A;  3KXO A;  4HZ2 A;  2H6X A;  1KEB A;  3CRT A;  4CY8 A;  1YZX A;  2AB6 A;  4F82 A;  1WP0 A;  1F6M C;  2MZC A;  4ZIJ A;  3GH9 A;  2GS3 A;  3MWH A;  1K0O A;  2VCV A;  4DVC A;  1FW1 A;  3F4S A;  2MYG A;  3M1G A;  4EF0 A;  5CP1 A;  4KCA A;  1TW9 A;  4G0K A;  4KDX A;  1B8X A;  2IPA A;  3O3T A;  2RUF A;  4BWQ A;  3TJK A;  2GZY A;  4FO5 A;  5DAK A;  1I5G A;  3GA4 A;  2DMM A;  3EC3 A;  2WZ9 A;  2WUL A;  1C72 A;  1EEM A;  1ZYE A;  1AAZ A;  4V2L A;  1A0F A;  2DBC A;  2OBI A;  1THO A;  5G2Z A;  4IEL A;  5JWQ B;  4XS4 A;  2VCQ A;  4IW9 A;  1SKS B;  4IKH A;  3IE3 A;  4IVF A;  2OE1 A;  4V2M A;  3DIE A;  1JZO A;  3C8E A;  3W8S A;  3GX8 A;  5ABR A;  2VM1 A;  2R5G A;  2H0I A;  3G7Y A;  4K8M A;  3GTU B;  2O8V B;  1XWK A;  3CYN A;  4FH8 A;  2CX3 A;  1A24 A;  1G7E A;  1X0R A;  1K0N A;  3GHA A;  4K7O A;  4MA9 A;  2VD0 A;  1Q4J A;  1FHE A;  5A4W A;  3IRA A;  5F8B A;  3FR6 A;  3UAP A;  5B6N A;  2IMK A;  5ECN B;  2XPE A;  3TRP A;  16GS A;  2FCH A;  4YAV A;  2PN8 A;  1Z7P A;  2G0F A;  2J23 A;  5ELA A;  1EOG A;  1GSF A;  3K8N A;  3DWV A;  3UAR A;  3QCP A;  1Z6N A;  2FA8 A;  1VF1 A;  3CSJ A;  2PMT A;  3LJR A;  2HZF A;  1IYI A;  5KEJ A;  3H4K A;  1A0R P;  3LYK A;  1GSS A;  4BL7 A;  3APO A;  2H75 A;  5INY A;  4GSN A;  1UVZ A;  3F4R A;  4MZW A;  1OC9 B;  2EIO A;  3TCO A;  3KIJ A;  1B4P A;  3QMX A;  2XBQ A;  4XIH A;  3L0H A;  2H01 A;  4G2E A;  1SEN A;  3G7I A;  2HYX A;  4BPY A;  3P90 A;  4LA1 A;  1PQN A;  4PUF C;  3PR8 A;  1DE1 A;  2GSS A;  1B48 A;  2GQL A;  5ECS A;  4GQC A;  2CAI A;  2O87 A;  4K5R A;  3HD5 A;  1MD4 A;  4USS A;  2L6D A;  3ERW A;  2YWI A;  4K6X A;  4MJE A;  2A4H A;  3ZLP A;  1WOU A;  2K18 A;  4D73 A;  4GWR A;  5ELG A;  3F3Q A;  4DEJ A;  4G10 A;  3MNG A;  2H6Y A;  4OMV A;  3MDK A;  3FY7 A;  2XHF A;  3FKF A;  5HFI A;  3A2X A;  5LD0 A;  1YDK A;  5LCZ A;  3QAW A;  4Z2R A;  1U87 A;  2O89 A;  3RAZ A;  4MF7 A;  4EIP A;  1GNE A;  2IFQ A;  4HQS A;  4K7I A;  3DVW A;  3R3E A;  3RPP A;  5B8B A;  2WS2 A;  3KTL A;  3ZRE A;  1NM3 A;  1RW1 A;  4AJ7 A;  3WYW A;  4MP4 A;  2C0E A;  4TOP A;  1K3L A;  1VGL A;  1SJ6 A;  5GZZ B;  4OFM A;  3VPQ A;  3E0U A;  2L5L A;  4MJB A;  1QK8 A;  4PNG A;  2B5E A;  4EXJ A;  3GUS A;  4BL7 B;  3GKX A;  4EL1 A;  2GST A;  1O85 A;  1GL8 A;  5G1K A;  4QL9 A;  4RI7 A;  3C71 A;  3DYR A;  1VF2 A;  1U3I A;  1K0M A;  2F8F A;  2DIZ A;  2LJK A;  1PKZ A;  2MMO A;  3O6T A;  4PQ1 A;  3KH7 A;  1JZD A;  2CVD A;  2HLS A;  2AJQ B;  3BD2 A;  3C73 A;  1WPI A;  3HJP A;  4TXV A;  1FG4 A;  1RK4 A;  4Q5N A;  3SWL A;  5IMA A;  3BJ5 A;  5D9T A;  4EC0 A;  3ZIT A;  1BED A;  4AF2 A;  4YQM A;  3UEM A;  3KM6 A;  4FQU A;  2YNX A;  2E7P A;  3IAM 2;  5D9V A;  3DXB A;  18GS A;  4BVY A;  2AAW A;  4TXO B;  5IPG A;  1GSY A;  3UIW A;  1K0A A;  5IMV A;  4PTS A;  3TRQ A;  1MD3 A;  3C1R A;  2B7J A;  2B5Y A;  2LEG A;  5IMC A;  2L6C A;  2DJJ A;  4J56 E;  2H0G A;  3W8J A;  4L8E A;  3VWX A;  1F3A A;  2FGX A;  4IBP A;  4KCE A;  1B9X C;  1GLP A;  2BJX A;  4WKW A;  2C3Q A;  5AN1 A;  5CYY A;  4OFN A;  3IXR A;  1TU8 A;  2DJ1 A;  2CX4 A;  2IMF A;  3M9K A;  1CQG A;  2I4A A;  4MZB A;  5GAN D;  1F9M A;  1NSW A;  2H8L A;  1PX7 A;  5HR3 A;  3GIX A;  4YKG A;  2IME A;  5E4W A;  13GS A;  3LQ7 A;  6GSV A;  4O7H A;  5J3R A;  2H6Z A;  4E8E A;  3GV1 A;  2A2P A;  3DVX A;  2I3Y A;  3GH6 A;  1LU4 A;  4GQF A;  2E0Q A;  4MPG A;  2C8U A;  5DAL A;  4JED A;  3Q6O A;  2IL3 A;  2GSQ A;  1WIK A;  4E8H A;  4PQI A;  2GQM A;  1PD2 1;  3MSZ A;  1O7U A;  3VWU A;  4KE3 A;  1ZOF A;  4MNN A;  3D21 A;  3TJG A;  2H1D A;  1OKT A;  2HRF A;  1XWG A;  4IQA A;  5AIX A;  3SBC A;  1ML6 A;  3M8N A;  4CY6 A;  5ECP B;  2H74 A;  1NHY A;  1DE2 A;  4ZIL A;  3HJO A;  1EV4 A;  2H30 A;  2NVL A;  2F3M A;  2VCX A;  1TK0 B;  1YF0 A;  2MMZ A;  4HJ2 A;  2N5B A;  5DDL A;  1G7O A;  2PVO C;  4ML1 A;  4L5L A;  3QDN A;  4HS1 A;  3IDV A;  6GSU A;  5EVO A;  1A2L A;  3GYK A;  1KBN A;  5A4U A;  5F05 A;  4TKY A;  2GT5 A;  1Y6E A;  4KH7 A;  5ECK B;  4F9Z A;  2L59 A;  3TJF A;  4ZL9 A;  8GSS A;  2VOC A;  1KTE A;  4BVX B;  4WF5 A;  1FVJ A;  1V9W A;  1M7T A;  3MAK A;  2GZP A;  1ZZY A;  3BBY A;  2WJU A;  4KW6 A;  4ILF A;  4K2X A;  3P7X A;  1X9W B;  1EGO A;  5IMD A;  3L78 A;  1FB6 A;  5KOW A;  4F0B A;  3HCZ A;  2TIR A;  2B3S A;  3PGT A;  4ML6 A;  2B1K A;  2REM A;  1PGT A;  3KJY A;  4IJ3 A;  3CSH A;  2EIR A;  2LJA A;  1QMV A;  5D73 A;  3HDC A;  4ZBA A;  1TK5 B;  4XS1 A;  4PQH A;  1EZK A;  5KN0 A;  1KNG A;  2GTU A;  1XFL A;  4FIW A;  4KA0 A;  2A2R A;  2PBJ A;  12GS A;  1SK2 A;  2VCW A;  1X9M B;  5IQY A;  4MCU A;  4L5O A;  3KTB A;  2YJ7 A;  2ON7 A;  3D6I A;  2HSH A;  5J9C A;  2LV3 A;  2XBI A;  1AXD A;  3NIV A;  4WR4 A;  3GNJ A;  2WRT A;  3GTU A;  5ECO B;  1PN0 A;  3F8U A;  4FYB A;  5D96 A;  1Z5Y E;  3TKS E;  1XPV A;  2V1M A;  2HXK A;  1PKW A;  2YJH A;  2JSZ A;  2L5O A;  1JFU A;  2CVK A;  1NHO A;  3HXS A;  2R4V A;  5E59 A;  2NBS A;  4NPB A;  3U5R E;  1GTB A;  1V2A A;  3O76 A;  2L4C A;  3UVT A;  2JL4 A;  1TXX A;  2HSY A;  1WMJ A;  3WGD A;  3A5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...