1ZOFA

Crystal structure of alkyl hydroperoxide-reductase (ahpc) from helicobacter pylori
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
170
structure length
170
Chain Sequence
MVVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGVILFFWPKDFTFVCPTEIIAFDKRVKDFHEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVSFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords alkyl hydroperoxide-reductase
publication title Crystal structure of alkyl hydroperoxide-reductase (AhpC) from Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 50
structure length 170
sequence length 170
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2005-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1zofA00
5JWQB 1R5AA 2YWOA 4D73B 3LJRA 1DSBA 3UARA 4FH8A 2VUPA 4JRRA 4IBPA 5D9XA 4WF4A 1FB6A 2DJ1A 4RQRA 1SJ6A 2V2GA 3N5OA 4KDUA 1M0UA 1R26A 2MBSA 4K7OA 3EMXA 4DSQA 3GA4A 4X1UA 4KAEA 2P31A 2V32A 1ACVA 4TN8A 3TJBA 2LJAA 2H75A 1HYUA 2OBIA 3FZ5A 4KA0A 1GTIA 1PMTA 3CXGA 3I9V2 1EP8A 3ZYWA 4GXZA 1ERWA 2CVKA 2X8CA 3M9KA 2ON5A 1G7OA 4DSSA 3MDKA 3GKNA 2LJKA 2B7KA 4HDEA 1Z9HA 4EE0A 1G6YA 1GL8A 5IMAA 3PH9A 4TR0A 1TI3A 1GRXA 4ID0A 4O5RA 3H93A 4K8MA 3TCOA 3OR5A 3AY8A 2LRNA 5C00A 1T00A 5F0GA 2MBTA 1Z6MA 4I97A 3C1SA 5CO3A 4L0UA 3FZ4A 2KUCA 4BWQA 3GIXA 4EC0A 4G2EA 2C0GA 4HEA2 5ECOB 3G7IA 3NOFA 1BAYA 1TRSA 3GTUA 1JZRA 5IQYA 2H01A 1CQGA 4TKYA 4AJ7A 1Z6NA 1Q98A 1XW9A 2E7PA 4POMA 3IXRA 1RK4A 4ZB6A 1XOBA 1JHBA 2X99A 1WP0A 4RQXA 1C72A 1BQ7A 3CTGA 2KLXA 3DKSA 3NIVA 2VL2C 2H0HA 1EEJA 4NWYA 4TRXA 4HQSA 4CDOA 3UBKA 1ERTA 4F2IA 1OAZA 1GTAA 1SENA 4GWRA 2AUVA 5IMFA 3MWHA 13GSA 2FWEA 3QFAC 1W89A 2CAIA 1ZGNA 3F8UA 3GKMA 4GQFA 3LFLA 3CTFA 3ZZXA 1M2BA 2PUKC 4V1Ap 1IYIA 2LQOA 4KUNA 1SYXA 2N5AA 2ZCTA 1XIYA 1H4OA 4AJ6A 2IIYA 5B8BA 2L4CA 2HNLA 4L5OA 4FYBA 3VI7A 4MF7A 5HFIA 1XCCA 8GSSA 3GSTA 2FNOA 5ECQB 2OA7A 3PINA 3FR3A 1GSEA 1OKDA 3D4TA 1TRWA 2XHFA 2DJKA 4ECJA 2EC4A 2FUG2 2OE0A 2GTUA 5HR0A 1MEKA 4QL7A 5IOXA 3LYPA 1SYRA 5ECLB 4PXOA 4Q5NA 1XVQA 1HQOA 2L5LA 1X5EA 3TB2A 5D96A 2CV4A 1K0OA 1MTCA 2I1UA 3D5JA 3CSJA 3EURA 3GHAA 4E8EA 3C8EA 5F8BA 3EWLA 4I8BA 2YJ7A 2H6XA 2HXKA 2MZCA 3FRCA 4KSOA 2LUSA 4KDYA 3L9UA 3EU4A 5G5EA 1QFNA 2N5FA 1VF3A 4L8EA 1YEPA 3ZIVA 5ID2B 4GF0A 2H74A 3GL5A 4HU9A 1ERUA 4ZBBA 2GVPA 1N8JA 2PVOC 2IL3A 3APQA 3MNGA 3GV1A 1YKAA 4K1FA 1QQ2A 3HJOA 2I3YA 4WBRD 2VL9A 4OO4A 3A3TA 2V1MA 1XWGA 3CSIA 1GLQA 2B7JA 3LSZA 4WR4A 2TRXA 4NAXA 1XBSA 2JL4A 3GX8A 1NM3A 2O89A 4XS4B 1PKZA 2A4VA 1XWBA 4MDCA 1OYJA 4K9ZA 2PMTA 5B7CA 1N2AA 2L57A 2WJUA 2L5OA 5ENUA 2IMEA 1YJ6A 2K8VA 2K8SA 1Z3EA 3NZNA 5LD0A 4XCSA 4I6XA 1KEBA 1QUWA 3KXOA 2GQMA 3BOAA 1SK0A 3HY2A 5G30A 4NXIA 3D22A 4IKHA 1AAZA 2VLUA 4FIWA 3G7YA 4MCUA 4LMWA 5GAND 5HR1A 1SK2A 1ST9A 4LA1A 3HDCA 3HD5A 1YEXA 3TUEA 4H86A 3ED3A 3WGXA 2F51A 2RIIA 3LXTA 1S3CA 2ALBA 4F03A 3L0HA 7GSSA 4KCAA 2B3SA 1FVJA 2H71A 4V2NA 1UC7A 1U88A 2DMMA 2C3QA 4O7HA 1WRYA 5JWOB 4J56E 4K0NA 2DIYA 3QMXA 4K7IA 5IO0A 3P90A 2B5YA 4TXVA 6GSUA 1VF1A 1GSSA 2VCWA 4HQZA 5KN0A 4LMVA 2A2RA 3RPNA 1EV9A 4ISDA 3TKSE 5DQSA 1OC9A 3LWAA 1T4YA 4JZQA 3EINA 4PQHA 2VLTA 3LEFA 3FYGA 4EF0A 1XOAA 4K2DA 2FGXA 5FT3A 2HFDA 1YKCA 4JEDA 1MDJA 2VL3A 5IMVA 1W4VA 3KIJA 4K0GA 4GCIA 1B4PA 5GZZB 4HJMA 1B8XA 2A2SA 1YF0A 1I5GA 2GZZA 2VCTA 3US3A 1MDIA 4K6XA 2C3TA 3ZLPA 3W8JA 5DVBA 3W8SA 1U87A 5B6NA 4N10A 3DVWA 2H0GA 3I69A 3ZTLA 1Z7RA 5L71A 5E59A 4EL1A 2C4JA 2FA8A 4P3YB 2G2QA 5D73A 1SL0B 1WOUA 3I6AA 2FWHA 3QCPA 2KHPA 1A0RP 4I5QA 1FVKA 4LL4B 3UMAA 2F8FA 1LU4A 2KP1A 5G1LA 1WMJA 4AJ8A 3LGCA 3ME7A 4IS0A 5G31A 3DWVA 1V57A 4IW9A 1F9MA 4RI7A 5B8AA 4PURA 2VM1A 2IWTA 3O6TA 1X5CA 2KOKA 2R6KA 3H79A 3KH9A 5ID2A 3APSA 5JCUA 3F63A 4QL9A 2QGVA 4TR1A 2P5RA 5CRDA 4IN0A 2RUFA 4WR5A 3IBHA 2DIZA 2N5BA 4O32A 2CQ9A 1KTEA 6GSXA 2R2JA 1JZDA 2IPAA 1O73A 2YWIA 4WF5A 3IAM2 2YNXA 1SD9A 5F05A 3HXSA 1M99A 4OO5A 3DD3A 2CX3A 1YDKA 4TR3A 4XS4A 1ZYQB 1E6BA 2HT9A 3L4NA 2AV4A 2ZUPA 2YJHA 1F3AA 5CAXA 1JLVA 1F3BA 2VD0A 2BMXA 1K0CA 5EY6A 4ZB9A 4G9HA 4MPGA 4ML6A 1FOVA 3FW2A 2XBIA 5ELGA 5F06A 3GH9A 1S3DA 1GUMA 2RM5A 2I9HA 4CW9A 4NPBA 3DYRA 1DBYA 3UJ1A 4IJIA 3GFKA 4YAVA 1Z7PA 3A2WA 2YPMA 4GLTA 5JCWA 3L9VA 1ZL9A 2VL2A 4MZWA 1AW9A 5D9VA 5D8IA 1OC3A 3KP8A 1KNGA 4TXOB 1YQ1A 3KJYA 4JR6A 2VD1A 17GSA 5ELAA 5IPHA 4KCEA 1GNWA 4ZIJA 5DDLA 2FCHA 5CNWA 4BWSA 4HU7A 3QAVA 4OFNA 2IN3A 1DUGA 2YV9A 1USBA 1ABAA 5HFKA 3GUSA 3KCMA 2GQKA 2R3XA 3GL3A 4XHMA 3LXZA 1TU7A 2PVQA 3VWWA 3WYWA 5DJLA 4GQCA 2ES7A 2LNSA 2H6ZA 2XBQA 4Q5RA 1ON4A 4IJ3A 2X64A 5HR3A 1JZWA 3TRQA 1K3LA 5FHIA 3MSZA 2AB6A 5J9CA 2OJLA 3ZFLA 2HZEB 3TKRA 4WBJA 2DJJA 4MJCA 4BL7A 3TJKA 2PERA 4WXTA 2J9HA 3VWUA 4GRFA 3TRXA 1GUHA 1RW1A 2FWGA 1NW2A 3EE2A 1TTZA 3K8NA 4MH2A 2VOCA 3QAWA 3GYKA 1K0MA 2IMKA 2M80A 4TW5A 3HZ8A 2H8LA 4ECCA 2FA4A 3DGQA 3QD9A 5AGYA 4J57E 6GSYA 4MPFA 1GSFA 1SKRB 1O6JA 1UN2A 1XFLA 1K3OA 4KW6A 1O81A 3KGKA 3KMOA 1HNCA 2C0DA 3ME8A 5CRWA 2GZYA 2DJ2A 5G5FA 3TJFA 3FKFA 2CT6A 2GS3A 2OE1A 2O87A 4N11A 1AQXA 5H5SA 4FO5A 2MMOA 4IP6A 4K7NA 5DJMA 3J7Yb 3FR9A 1G7EA 1OC9B 5J5NA 3KP9A 1JFUA 3I43A 2HRFA 1M7TA 3DVXA 3CMIA 5IMDA 1O85A 4NMUA 2H1DA 2HRNA 2F9SA 1BX9A 4WETA 2QC7A 3S9FA 2KP2A 3APOA 1K3YA 3VPTA 4G10A 2H30A 1A8YA 5FWGA 2JSZA 2RLIA 2H1GA 4MH3A 3KMNA 2YOIA 3EC3A 3U5RE 4ECIA 2LRCA 4DSRA 4EO3A 2R5GA 1DE2A 3LQ7A 3VI5A 2C3NA 1BYEA 2QKEA 1MD3A 4X43A 3IAS2 2LQQA 2VCZA 3VWVA 4JBBA 3GKXA 4V1Ag 4F0CA 3HHVA 4L0WA 2Z9SA 1EZKA 3Q74A 4ZBDA 16GSA 1NHYA 2WDUA 5EVOA 1AUCA 3IK9A 5CYYA 4OWYA 3BCKA 2GZPA 1WWJA 1OVNA 4TR1B 5GSSA 2H73A 5EL8A 3P2AA 1T8EB 1SKWB 4ZB8A 5F07A 2GSSA 2BTOT 2RUEA 4TXOA 3P8WA 4Q5FA 1EV4A 3DEXA 3GRXA 1FB0A 3L78A 2NPBA 2CX4A 1SJZA 4N0ZA 4WEYA 2MMNA 2PGTA 4POLA 3IA1A 4EDYA 1Y25A 1HNBA 2YWMA 4ACSA 1K0DA 2RM6A 2K6VA 5INYA 1U3IA 3A5WA 4HS1A 4AF2A 2B1LA 2LJRA 3UAPA 1S3AA 2IFQB 1GSQA 2C0FA 3M3MA 4HUAA 5A4UA 3G7JA 1YY7A 2HZEA 1PX6A 2LEGA 3GMFA 2WS2A 1LBKA 2DJ3A 2VIMA 3C71A 4I2TA 4L5LA 3HVSA 3UIWA 3UOMA 3RHCA 3FY7A 3IRAA 1EWXA 1TOFA 1TP9A 3FZ9A 1J9BA 5ECHB 1GSDA 4ZBAA 1WE0A 4HI7A 1V40A 2R4VA 3TDGA 3VK9A 3JCML 4AGSA 1EOGA 2JACA 1R5PA 4MMMA 3TKQA 2PU9C 5EPFA 1PN9A 3KTBA 4ECBA 1PD21 4IELA 3UL3A 5ECRB 3RPPA 2LV3A 4NHZA 4YQMA 3PGTA 2C0EA 3ERFA 5DCGA 1PX7A 3KD0A 2O8VB 3HKRA 3IK7A 3N9JA 3QFBC 3TKPA 2B1KA 1J0FA 2DJ0A 3CBUA 3ERWA 2IMFA 2JZTA 2HZFA 3GN3A 20GSA 3RHBA 4G19A 2MMZA 3KEBA 3WGDA 2PN8A 1GH2A 1GP1A 4NV5A 4WKWA 3F6DA 3GX0A 1XZOA 3QDNA 2GT6A 1GUKA 2H19A 3UBLA 1TK0B 1FW1A 2FY6A 4JE1A 2WB9A 3H4KA 2VO4A 1T1VA 2HSHA 3A2VA 2B6MA 1X0RA 2H1AA 3FHKA 6GSTA 2LTKA 3M0FA 2OE3A 1MD4A 4LLRA 1TRVA 1FAAA 1VF4A 4OCEA 3V1WA 2H1BA 1A23A 5JCGA 3EMPA 3HZ4A 1SJIA 1OE7A 1EEMA 1ZMAA 1KBNA 3GNJA 2AHEA 1VGLA 1XPVA 1X9SB 3IR4A 1V9WA 4BVXA 2FWFA 2YN1A 1GNEA 2QSIA 3EYTA 2L4QA 3LYKA 2V6KA 4IVFA 1X9WB 1FO5A 3TOTA 1OKTA 1U6TA 5IPGA 2CZ3A 3D21A 4NV2A 1OC8A 3R2QA 2OKAA 4EXJA 4KX4A 4NHWA 1E2YA 4MZCA 5HR2A 5C04A 1ZZYA 4XS1A 1A2JA 4MA9A 1AC1A 3UEMA 3E9JB 3VURA 4RI6A 4IQAA 1K0BA 5D93A 4EVMA 2YWNA 5CRHA 5IO2A 3IHQA 3HJMA 2IFQA 4ZILA 5HFGA 6GSVA 2F8AA 2GSQA 4PUFC 3KZQA 2JZRA 3F4SA 5IM9A 1YF1A 4ML1A 12GSA 3IE3A 3ZITA 3M1GA 2V41A 5E4WA 2NTOA 2GSRA 2CZ2A 4RUVA 3CYNA 5ECPB 1V58A 2VCVA 5JWRB 3UVTA 1TI1A 4OFMA 4F82A 3VFIA 1B9YC 4MF5A 2BJXA 4OCFA 4TR4A 3BCIA 4FYCA 1Z5YE 2EIQA 3P7XA 19GSA 5AIVA 2WULA 3HVXA 1PL2A 1AQVA 1TJDA 3E0UA 1U3AA 5AISA 4MLYA 5IOWA 4JU5A 3W6GA 1G6WA 3BBYA 4OD7A 22GSA 2HYXA 1WJKA 4PX1A 3BD2A 3WT1A 2R37A 5ECMB 3QOUA 4KNDA 2B5EA 5KN1A 2F3MA 5CREA 4PGTA 3VWXA 3H1NA 2CVBA 3LG6A 3A2XA 1BG5A 18GSA 10GSA 3CRTA 4XS6A 2M72A 5IMCA 4PQ1A 3ZRDA 2VM2A 4EUYA 3TKSC 4IQ1A 1A8LA 1SL2B 2AJQB 4O92A 5A4WA 1BJXA 2C80A 2WGRA 2IMIA 4OMVA 5IIZA 1SD8A 2OACA 3RDWA 2NBSA 1A0FA 2FHEA 2HSYA 2REMA 1DE1A 1O8XA 1M9BA 1A2MA 5COHA 2XPEA 3WGEA 4YAPA 2L6DA 4TOPA 3VPQA 4HZ4A 5DALB 4IP1A 3WT2A 2WCIA 5A5KA 5AIXA 1A2LA 3FK8A 1PA3A 4BVYA 3Q19A 3EU3A 4ZL7A 5A4VA 1HD2A 2FLSA 1M2DA 1WPIA 1FG4A 1B48A 1XW6A 1EP7A 1THXA 4YQVA 1THOA 5ABRA 1XW5A 4X0XA 1B9XC 3C1RA 1J08A 2I81A 3GSSA 4CHSA 5HQPA 4DVCA 1ZYEA 2X8HA 2GT5A 3TGZA 4IGJA 4MJAA 5IMZA 5H5RA 4KSMA 2E0QA 4BA7A 5ECNB 4BPYA 1GTBA 4MF6A 5G1KA 4KDXA 3FR6A 1GLPA 4YQUA 3KTLA 3ZVJD 1ML6A 2O7KA 3D6IA 2LNTA 5DAKA 4I2UA 2LSTA 4PNFA 5CP1A 4HOJA 3J7Yk 3U6VA 2WFCA 2L59A 1AXDA 1PRXA 2MYGA 1JZOA 3RBTA 3ZMKA 4GSTA 3ZFBA 2H6YA 1M2AA 3M8NA 2C8UA 4OFTA 3FEUA 2YZUA 4ILFA 5G2ZA 3ZMLA 1K0NA 2HI7A 3HJPA 4Q5QA 1O7UA 2DBCA 3SWLA 1NSWA 2YP6A 2VCQA 2PWJA 5J9BA 3RAZA 2FD3A 1T3BA 1V98A 2DSAA 3ISOA 4PUAA 1GSYA 4D73A 3PR8A 1V2AA 3EVIA 2DC5A 2C1YA 2YANA 3G9BA 5DBQA 4IHUA 1BEDA 1SK1A 3IDVA 1XWCA 1PQNA 2K18A 3BJ5A 2E2MA 4LL1B 4E8HA 1FHEA 1GTUA 4KH7A 5KEJA 4MJEA 2HE3A 4XTSA 3ZIJA 3Q6OA 1TRUA 4YH2A 5J41A 3ZREA 1ERVA 3FZAA 2CA8A 2JU5A 1K0AA 2DLXA 2P0GA 4ZL8A 4KB3A 4Z7XA 4XRAA 3DIEA 4DEJA 3ZVJA 1LJRA 2TIRA 3DRNA 14GSA 3KM6A 1AIUA 2L6CA 2ZNMA 3Q18A 2AYTA 2LRTA 1PL1A 4GSNA 5CRGA 1SU9A 2OBKA 5GSTA 2P5QA 3D4MA 2GQLA 2H70A 2VLVA 4PNGA 2GLRA 2JSYA 2OADA 3HYPA 1JLWA 1TXXA 5DQYA 1PKWA 1XVWA 1GSUA 1OE8A 2WRTA 1Q4JA 4HJ2A 4ZXGA 1WIKA 3F0IA 4MJBA 2YZHA 3IC4A 2YV7A 1MDKA 1T7PB 4MK3A 5J3RA 5J4UA 5B6MA 1ZOFA 1R4WA 5KN2A 5H5QA 3GKKA 2JADA 2O85A 3F9UA 3C7MA 3F4TA 3KH7A 5DALA 5LNKe 4HZ2A 1ZCPA 2CVDA 1O8WA 2PPTA 2EIOA 3MAKA 3L9SA 2V6OA 3QR6A 4DSSB 2JZSA 3IV4A 1XXUA 2GDRA 1Y6EA 5D9WA 1G0TA 2X8GA 2HLSA 1AQWA 3CRUA 2VAFA 4KGIA 2GGTA 3F3RA 1TDIA 3CSHA 1H75A 3C73A 3QPMA 1A24A 1CQHA 1SKSB 3TJGA 4N30A 4EKZA 1URMA 5DCHA 1PSQA 9GSSA 3DMLA 4MABA 3IOSA 5ECKB 2WZ9A 1PGTA 2E2GA 4F9ZA 4EDZA 4J2FA 4KE3A 2B5XA 2H0IA 3GTUB 3WD6A 1UVZA 1QK8A 4V2LA 4F0BA 4POKA 3TRPA 1ILOA 3O76A 1HNAA 2TRCP 5LCZA 2LKUA 4QQ7A 3QAGA 3LORA 2H66A 1F37A 4MZBA 3O3TA 1GWCA 2H72A 3GURA 1F6MC 1F2EA 5ECSA 1SL1B 2IJYA 5D9TA 3UVHA 2EIRA 4POBA 4PQIA 5AN1A 2I4AA 1QMVA 3TJJA 2XC2A 3HVVA 4XRDA 4FYUA 2NDOA 1QGVA 2XPDA 5ECIB 1XWAA 3GH6A 1EGRA 3VLNA 1TKDB 2IMDA 1X5DA 1UA5A 4GSSA 1VF2A 3DXBA 2PBJA 1GULA 1R7HA 4ULXA 2YCDA 2H76A 2ON7A 3F3QA 2DMLA 1VRSD 1EOHA 2LS5A 2K9FA 2J23A 4GTUA 4JR4A 6GSSA 3ERGA 2G0FA 1RQMA 1IYHA 6GSWA 4XIHA 5DAKB 1I9DA 3E3EA 1NHOA 3SBCA 2M46A 2AAWA 1T4ZA 3M9JA 3HCZA 11GSA 1X9MB 2GSTA 3TOUA 1XWKA 1M9AA 3IPZA 3ZL5A 4MP4A 1EGOA 3D0ZA 3F4RA 1TK8B 2MMAA 4N0VA 3H8QA 2CAQA 1B4QA 1TW9A 5GAPD 5KN3A 1TU8A 4TVEA 4V2MA 2NVLA 3HA9A 1YZXA 3TKSA 1TK5B 4ZL9A 2VCXA 3F6FA 1QXHA 2D2ZA
chains in the Genus database with same CATH superfamily
5JWQB 1R5AA 2YWOA 3CQFA 4D73B 3LJRA 1DSBA 3UARA 4FH8A 2VUPA 4JRRA 4IBPA 5D9XA 4WF4A 1FB6A 2DJ1A 4RQRA 1SJ6A 2V2GA 3N5OA 4KDUA 1M0UA 1R26A 2MBSA 4K7OA 3EMXA 4DSQA 3GA4A 4X1UA 4KAEA 2P31A 2V32A 1ACVA 4TN8A 3TJBA 2LJAA 2H75A 1HYUA 2OBIA 3FZ5A 4KA0A 1GTIA 1PMTA 3CXGA 3I9V2 1EP8A 3ZYWA 4EIPA 4GXZA 1ERWA 2CVKA 2X8CA 3M9KA 2ON5A 1G7OA 4DSSA 3MDKA 3GKNA 2LJKA 2B7KA 4HDEA 1Z9HA 4EE0A 1G6YA 1GL8A 5IMAA 3PH9A 4TR0A 1TI3A 1GRXA 4ID0A 4O5RA 3H93A 4K8MA 3TCOA 3OR5A 3AY8A 2LRNA 5C00A 1T00A 5F0GA 2R0CA 2MBTA 1Z6MA 4I97A 3C1SA 5CO3A 4L0UA 3FZ4A 2KUCA 4BWQA 3GIXA 4EC0A 4G2EA 2C0GA 4HEA2 5ECOB 3G7IA 3NOFA 1BAYA 1TRSA 3GTUA 1JZRA 5IQYA 2H01A 1CQGA 2R0GA 4TKYA 4AJ7A 1Z6NA 1Q98A 1XW9A 2E7PA 4POMA 3IXRA 1RK4A 4ZB6A 1XOBA 1JHBA 4EIQA 2X99A 1WP0A 4RQXA 1C72A 1BQ7A 3CTGA 2KLXA 3DKSA 3NIVA 2VL2C 2H0HA 1EEJA 4NWYA 4TRXA 4HQSA 4CDOA 3UBKA 1ERTA 4F2IA 1OAZA 1GTAA 1SENA 4GWRA 2AUVA 5IMFA 3MWHA 13GSA 2FWEA 3QFAC 1W89A 2CAIA 1ZGNA 3F8UA 3GKMA 4GQFA 3LFLA 3CTFA 3ZZXA 1M2BA 2PUKC 4V1Ap 1IYIA 2LQOA 4KUNA 1SYXA 2N5AA 2ZCTA 1XIYA 1H4OA 4AJ6A 2IIYA 5B8BA 2L4CA 2HNLA 4L5OA 4FYBA 3VI7A 4MF7A 5HFIA 1XCCA 4CY8A 8GSSA 3GSTA 2FNOA 5ECQB 2OA7A 3PINA 3FR3A 1GSEA 1OKDA 3D4TA 1TRWA 2XHFA 2DJKA 4ECJA 2EC4A 2FUG2 2OE0A 2GTUA 5HR0A 1MEKA 4QL7A 5IOXA 3LYPA 1SYRA 5ECLB 4PXOA 4Q5NA 1XVQA 1HQOA 2L5LA 1X5EA 3TB2A 5D96A 2CV4A 1K0OA 1MTCA 2I1UA 3D5JA 3CSJA 3EURA 3GHAA 4E8EA 3C8EA 5F8BA 3EWLA 4I8BA 2YJ7A 2H6XA 2HXKA 2MZCA 3FRCA 4KSOA 2LUSA 4KDYA 3L9UA 3EU4A 5G5EA 1QFNA 2N5FA 1VF3A 4L8EA 1YEPA 3ZIVA 5ID2B 4GF0A 2H74A 3GL5A 4HU9A 1ERUA 4ZBBA 2GVPA 1N8JA 2PVOC 2IL3A 3APQA 3MNGA 3GV1A 1YKAA 4K1FA 1QQ2A 3HJOA 2I3YA 4WBRD 2VL9A 4OO4A 3A3TA 2V1MA 1XWGA 3CSIA 1GLQA 2B7JA 3LSZA 4WR4A 2TRXA 4NAXA 1XBSA 2JL4A 3GX8A 1NM3A 2O89A 4K5RA 4XS4B 1PKZA 2A4VA 1XWBA 4MDCA 1OYJA 4K9ZA 2PMTA 5B7CA 1N2AA 2L57A 2WJUA 2L5OA 5ENUA 2IMEA 1YJ6A 2K8VA 2K8SA 1Z3EA 3NZNA 5LD0A 4XCSA 4I6XA 1KEBA 1QUWA 3KXOA 2GQMA 3BOAA 1SK0A 3HY2A 5G30A 4NXIA 3D22A 4IKHA 1AAZA 1PN0A 2VLUA 4FIWA 3IC8A 3G7YA 4MCUA 4LMWA 5GAND 5HR1A 4ICYA 1SK2A 1ST9A 4LA1A 3HDCA 3HD5A 1YEXA 3TUEA 4H86A 3ED3A 3WGXA 2F51A 2RIIA 3LXTA 1S3CA 5KOXA 2ALBA 4F03A 3L0HA 7GSSA 4KCAA 2B3SA 1FVJA 2H71A 4V2NA 1UC7A 1U88A 2DMMA 2C3QA 4O7HA 1WRYA 5JWOB 4J56E 4K0NA 2DIYA 3QMXA 4K7IA 5IO0A 3P90A 2B5YA 4TXVA 6GSUA 1VF1A 1GSSA 2VCWA 4HQZA 5KN0A 4LMVA 2A2RA 3RPNA 1EV9A 4ISDA 3TKSE 5DQSA 1OC9A 3LWAA 1T4YA 4JZQA 3EINA 4BL7B 5BRTA 4PQHA 2VLTA 3LEFA 1S3RA 3FYGA 4EF0A 1XOAA 4K2DA 2FGXA 5FT3A 2HFDA 2HRAA 1YKCA 4JEDA 1MDJA 2VL3A 5IMVA 1W4VA 3KIJA 4K0GA 4GCIA 1B4PA 5GZZB 4G0KA 4HJMA 1B8XA 2A2SA 1YF0A 1I5GA 2GZZA 2VCTA 3US3A 1MDIA 4K6XA 2C3TA 3ZLPA 3W8JA 5DVBA 3W8SA 1U87A 5B6NA 4N10A 3DVWA 2H0GA 3I69A 3ZTLA 1Z7RA 5L71A 5E59A 4EL1A 2C4JA 2FA8A 4P3YB 2G2QA 5D73A 1SL0B 1WOUA 3I6AA 1M3JA 2FWHA 3QCPA 2KHPA 1A0RP 4I5QA 1FVKA 4LL4B 3UMAA 2F8FA 1LU4A 2KP1A 5G1LA 1WMJA 4AJ8A 3LGCA 3ME7A 4IS0A 5G31A 3DWVA 1V57A 4IW9A 1F9MA 4RI7A 5B8AA 4PURA 2VM1A 2IWTA 3O6TA 1X5CA 2KOKA 2R6KA 3H79A 3KH9A 5ID2A 3APSA 5JCUA 3F63A 4QL9A 2QGVA 4TR1A 2P5RA 5CRDA 4IN0A 2RUFA 2X4AA 4WR5A 3IBHA 2DIZA 2N5BA 4O32A 2CQ9A 1KTEA 6GSXA 2R2JA 1JZDA 2IPAA 2A4HA 4K5SA 1O73A 2YWIA 4WF5A 3IAM2 2YNXA 1SD9A 5F05A 3HXSA 1M99A 4OO5A 3DD3A 2CX3A 1YDKA 4TR3A 4XS4A 1ZYQB 1E6BA 2HT9A 3L4NA 2AV4A 2ZUPA 2YJHA 1F3AA 5CAXA 1JLVA 1F3BA 2VD0A 2BMXA 1K0CA 5EY6A 4ZB9A 4G9HA 4MPGA 4ML6A 1FOVA 3FW2A 2XBIA 5ELGA 5F06A 3GH9A 1S3DA 1GUMA 2RM5A 2I9HA 4CW9A 4NPBA 3DYRA 1DBYA 3UJ1A 4IJIA 3GFKA 4YAVA 1Z7PA 3A2WA 2YPMA 4GLTA 2DKIA 5JCWA 3L9VA 1ZL9A 2VL2A 4MZWA 1AW9A 5D9VA 5D8IA 1OC3A 3KP8A 1KNGA 4TXOB 1YQ1A 3KJYA 4JR6A 2VD1A 17GSA 5ELAA 5IPHA 4KCEA 1GNWA 4ZIJA 5DDLA 2FCHA 5CNWA 4BWSA 4HU7A 3QAVA 4OFNA 2IN3A 1DUGA 2YV9A 1USBA 1ABAA 5HFKA 4K2XA 3MYDA 3GUSA 3KCMA 2GQKA 2R3XA 3GL3A 4XHMA 3LXZA 1TU7A 2PVQA 3VWWA 3WYWA 5DJLA 4GQCA 2ES7A 2LNSA 2H6ZA 2XBQA 4Q5RA 1ON4A 4IJ3A 2X64A 5HR3A 1JZWA 3TRQA 1K3LA 5FHIA 3MSZA 2AB6A 5J9CA 2OJLA 3ZFLA 2HZEB 3TKRA 4WBJA 2DJJA 4MJCA 4BL7A 3TJKA 4Z2UA 2PERA 4WXTA 2J9HA 3VWUA 4GRFA 3TRXA 1GUHA 1RW1A 2FWGA 1NW2A 3EE2A 1TTZA 3K8NA 4MH2A 2VOCA 3QAWA 3GYKA 1K0MA 2IMKA 2M80A 2A2PA 4TW5A 3HZ8A 2H8LA 4ECCA 2FA4A 3DGQA 3QD9A 5AGYA 4J57E 6GSYA 4MPFA 1GSFA 1SKRB 1O6JA 1UN2A 1XFLA 2UZ8A 1K3OA 4KW6A 1O81A 3KGKA 3KMOA 1HNCA 2C0DA 3ME8A 5CRWA 2GZYA 2DJ2A 5G5FA 3TJFA 3FKFA 2CT6A 2GS3A 2OE1A 2O87A 4N11A 1AQXA 5H5SA 4FO5A 2MMOA 4IP6A 4K7NA 5DJMA 3J7Yb 3FR9A 1G7EA 1OC9B 5J5NA 3KP9A 1JFUA 3I43A 2HRFA 1M7TA 3DVXA 3CMIA 5IMDA 1O85A 4NMUA 2H1DA 2HRNA 2F9SA 1BX9A 4WETA 2QC7A 3S9FA 2KP2A 3APOA 1K3YA 3VPTA 4G10A 2H30A 1A8YA 5FWGA 2JSZA 2RLIA 2H1GA 4MH3A 3KMNA 2YOIA 3EC3A 3U5RE 2DKHA 4ECIA 2LRCA 4DSRA 4EO3A 2R5GA 1DE2A 3LQ7A 3VI5A 2C3NA 1BYEA 2QKEA 1MD3A 4X43A 3IAS2 2LQQA 2VCZA 3VWVA 4JBBA 3GKXA 4Z2TA 4V1Ag 4YKFA 4F0CA 3HHVA 4CY6A 4L0WA 2Z9SA 1EZKA 3Q74A 4ZBDA 16GSA 1NHYA 2WDUA 5EVOA 1AUCA 3IK9A 5CYYA 4OWYA 3BCKA 2GZPA 1WWJA 1OVNA 4TR1B 5GSSA 2H73A 5EL8A 3P2AA 1T8EB 1SKWB 4ZB8A 5F07A 2GSSA 2BTOT 2RUEA 4TXOA 3P8WA 4Q5FA 1EV4A 3DEXA 3GRXA 1FB0A 3L78A 2NPBA 2CX4A 5BMUA 1SJZA 4N0ZA 4WEYA 4YKGA 2MMNA 2PGTA 4POLA 3IA1A 4EDYA 1Y25A 1HNBA 2YWMA 4ACSA 1K0DA 2RM6A 2K6VA 5INYA 1U3IA 3A5WA 4HS1A 4AF2A 2B1LA 2LJRA 3UAPA 1S3AA 2IFQB 1GSQA 2C0FA 3M3MA 4HUAA 5A4UA 3G7JA 1YY7A 2HZEA 1PX6A 2LEGA 3GMFA 2WS2A 1LBKA 2DJ3A 2VIMA 3C71A 4X4JA 4I2TA 4L5LA 3HVSA 3UIWA 3UOMA 3RHCA 3FY7A 3IRAA 1EWXA 1TOFA 1TP9A 1ZYNA 3FZ9A 1J9BA 5ECHB 1GSDA 4ZBAA 1WE0A 4HI7A 1V40A 4Z2RA 2R4VA 3TDGA 3VK9A 3JCML 4AGSA 1EOGA 2JACA 1R5PA 4MMMA 3TKQA 2PU9C 5EPFA 1PN9A 3KTBA 4ECBA 1PD21 4IELA 3UL3A 5ECRB 4PTSA 2LV3A 4NHZA 3RPPA 4YQMA 3PGTA 2C0EA 3ERFA 1PFOA 1XG8A 5DCGA 1PX7A 3KD0A 2O8VB 3HKRA 3IK7A 3N9JA 3QFBC 3TKPA 2B1KA 1J0FA 2DJ0A 3CBUA 3ERWA 2IMFA 2JZTA 2HZFA 3GN3A 20GSA 3RHBA 4G19A 2MMZA 3KEBA 3WGDA 2PN8A 4A5PA 1GH2A 1GP1A 4NV5A 4WKWA 3F6DA 3GX0A 1XZOA 3QDNA 2GT6A 1GUKA 2H19A 3UBLA 1TK0B 1FW1A 2FY6A 4JE1A 2WB9A 3H4KA 4KF9A 2VO4A 1T1VA 2HSHA 3A2VA 2B6MA 1X0RA 2H1AA 3FHKA 6GSTA 2LTKA 3M0FA 2OE3A 1MD4A 4LLRA 1TRVA 1FAAA 1VF4A 4OCEA 3V1WA 2H1BA 1A23A 5JCGA 3EMPA 3HZ4A 1SJIA 1OE7A 1EEMA 1ZMAA 1KBNA 3GNJA 2AHEA 1VGLA 4BVYB 1XPVA 1X9SB 3IR4A 1V9WA 4BVXA 2FWFA 2YN1A 1GNEA 2QSIA 3EYTA 2L4QA 3LYKA 4G0IA 2V6KA 4IVFA 1X9WB 1FO5A 3TOTA 1OKTA 1U6TA 5IPGA 2CZ3A 3D21A 4NV2A 1OC8A 3R2QA 2OKAA 4EXJA 4KX4A 1ZYPA 4NHWA 1E2YA 4MZCA 5HR2A 5C04A 1ZZYA 4XS1A 1A2JA 4MA9A 1AC1A 3UEMA 3E9JB 3VURA 4RI6A 4IQAA 1K0BA 5D93A 4EVMA 2YWNA 5CRHA 5IO2A 3IHQA 3HJMA 2IFQA 4ZILA 5HFGA 6GSVA 2F8AA 2GSQA 4PUFC 3KZQA 2JZRA 4O5UA 3F4SA 5IM9A 1YF1A 4ML1A 12GSA 3IE3A 3ZITA 3M1GA 2V41A 5E4WA 2NTOA 2GSRA 2CZ2A 4RUVA 3CYNA 5ECPB 1V58A 2VCVA 5JWRB 3UVTA 1TI1A 5KOWA 4OFMA 4F82A 3VFIA 1B9YC 3LW9A 4MF5A 2BJXA 4MNNA 4OCFA 4TR4A 3BCIA 4FYCA 1Z5YE 2EIQA 3P7XA 19GSA 5AIVA 2WULA 3HVXA 1PL2A 1AQVA 1TJDA 3E0UA 1U3AA 5AISA 4MLYA 5IOWA 4JU5A 3W6GA 1G6WA 3BBYA 4OD7A 22GSA 2HYXA 1WJKA 4PX1A 3BD2A 3WT1A 2R37A 5ECMB 3QOUA 4KNDA 2B5EA 5KN1A 2F3MA 5CREA 4PGTA 3VWXA 3H1NA 2CVBA 3LG6A 3A2XA 1BG5A 18GSA 10GSA 3HVNA 3CRTA 4XS6A 2M72A 5IMCA 4PQ1A 3ZRDA 2VM2A 4EUYA 3TKSC 4IQ1A 1A8LA 1SL2B 2AJQB 4O92A 5A4WA 1BJXA 2C80A 2WGRA 2IMIA 4OMVA 5IIZA 1SD8A 2OACA 3RDWA 2NBSA 1A0FA 2FHEA 2HSYA 2REMA 1DE1A 1O8XA 1M9BA 1A2MA 5COHA 2XPEA 3WGEA 4YAPA 2L6DA 4TOPA 3VPQA 4HZ4A 5DALB 4IP1A 3WT2A 2WCIA 5A5KA 5AIXA 1A2LA 3FK8A 1PA3A 4BVYA 3Q19A 3EU3A 4ZL7A 5A4VA 1HD2A 2FLSA 1M2DA 1WPIA 1FG4A 1B48A 1XW6A 1EP7A 1THXA 4YQVA 1THOA 5ABRA 1XW5A 4X0XA 1B9XC 3IHGA 3C1RA 1J08A 2I81A 3GSSA 4CHSA 5HQPA 4DVCA 1ZYEA 2X8HA 2GT5A 3TGZA 3A5IA 4IGJA 4MJAA 5IMZA 5H5RA 4FQUA 4KSMA 2E0QA 4BA7A 5ECNB 4BPYA 1GTBA 4MF6A 5G1KA 4KDXA 3FR6A 1GLPA 4YQUA 3KTLA 3ZVJD 1ML6A 2O7KA 3D6IA 2LNTA 5DAKA 4I2UA 2LSTA 4PNFA 5CP1A 4HOJA 3J7Yk 3U6VA 2WFCA 2L59A 1AXDA 1PRXA 2MYGA 1JZOA 3RBTA 3ZMKA 4GSTA 3ZFBA 2H6YA 1M2AA 3M8NA 2C8UA 4OFTA 3FEUA 2YZUA 4ILFA 5G2ZA 3ZMLA 1K0NA 2HI7A 3HJPA 4Q5QA 1O7UA 2DBCA 3SWLA 4BVXB 1NSWA 2YP6A 2VCQA 2PWJA 5J9BA 3RAZA 2FD3A 2R0PA 1T3BA 1V98A 2DSAA 3MIXA 3ISOA 4PUAA 1GSYA 4D73A 3PR8A 1V2AA 3EVIA 2DC5A 2C1YA 2YANA 3G9BA 5DBQA 4IHUA 1BEDA 1SK1A 3IDVA 1XWCA 1PQNA 2K18A 3BJ5A 2E2MA 4LL1B 4E8HA 1FHEA 1GTUA 4KH7A 5KEJA 4MJEA 2HE3A 4XTSA 3ZIJA 3Q6OA 1TRUA 4YH2A 5J41A 3ZREA 1ERVA 3FZAA 2CA8A 2JU5A 1K0AA 4HSCX 2DLXA 2P0GA 4ZL8A 4KB3A 4Z7XA 4XRAA 3DIEA 4DEJA 3ZVJA 1LJRA 2TIRA 3DRNA 14GSA 3KM6A 1AIUA 2L6CA 2ZNMA 3Q18A 4O5QA 2AYTA 2LRTA 1PL1A 4GSNA 5CRGA 1SU9A 2OBKA 5GSTA 2P5QA 3D4MA 2GQLA 2H70A 2VLVA 4PNGA 2GLRA 2JSYA 2OADA 3R3EA 3HYPA 1JLWA 1TXXA 5DQYA 1PKWA 1XVWA 1GSUA 1OE8A 2WRTA 1Q4JA 4HJ2A 4ZXGA 1WIKA 3F0IA 4MJBA 2YZHA 3IC4A 2YV7A 3EPTA 1MDKA 1T7PB 4MK3A 5J3RA 5J4UA 5B6MA 1ZOFA 1R4WA 5KN2A 5H5QA 3GKKA 2JADA 2O85A 3F9UA 3C7MA 3F4TA 3KH7A 5DALA 5LNKe 4HZ2A 1ZCPA 2CVDA 1O8WA 2PPTA 2EIOA 3MAKA 3L9SA 2V6OA 3QR6A 4DSSB 2JZSA 3IV4A 1XXUA 2GDRA 1Y6EA 5D9WA 1G0TA 2X8GA 2HLSA 1AQWA 3CRUA 2VAFA 4KGIA 2GGTA 3F3RA 1TDIA 3CSHA 1H75A 3C73A 3QPMA 1A24A 1CQHA 1SKSB 3TJGA 3PPUA 4N30A 4EKZA 1URMA 2QA2A 5DCHA 1PSQA 9GSSA 3DMLA 4MABA 3IOSA 5ECKB 2WZ9A 1PGTA 2E2GA 4F9ZA 4EDZA 4J2FA 4KE3A 2B5XA 2H0IA 3GTUB 3WD6A 1UVZA 1QK8A 4USSA 4V2LA 4F0BA 4POKA 3TRPA 1ILOA 3O76A 1HNAA 2TRCP 5LCZA 2LKUA 4QQ7A 3QAGA 3LORA 2H66A 1F37A 4MZBA 3O3TA 1GWCA 3FMWA 2H72A 4BIKA 3GURA 1F6MC 1F2EA 5ECSA 1SL1B 2IJYA 5D9TA 3UVHA 2EIRA 4POBA 4PQIA 5AN1A 2I4AA 1QMVA 1FOHA 3TJJA 2XC2A 3HVVA 4XRDA 4FYUA 2NDOA 1QGVA 2XPDA 5ECIB 1XWAA 3GH6A 1EGRA 3VLNA 1TKDB 2IMDA 1X5DA 1UA5A 4GSSA 1VF2A 3DXBA 2PBJA 1GULA 1R7HA 4ULXA 2YCDA 2H76A 2ON7A 3F3QA 4G0LA 2DMLA 1VRSD 1EOHA 2LS5A 2K9FA 2J23A 4GTUA 4JR4A 6GSSA 2X49A 3ERGA 2G0FA 1RQMA 2HRKA 1IYHA 6GSWA 4XIHA 5DAKB 1I9DA 3E3EA 1NHOA 2QA1A 3SBCA 2M46A 2AAWA 1T4ZA 3M9JA 3HCZA 11GSA 1X9MB 2GSTA 3TOUA 1XWKA 1M9AA 3IPZA 3ZL5A 4MP4A 1EGOA 3D0ZA 3F4RA 1TK8B 2MMAA 4N0VA 3H8QA 2CAQA 1B4QA 1TW9A 5GAPD 5KN3A 2HSMA 1TU8A 4TVEA 4V2MA 2NVLA 3HA9A 1YZXA 3TKSA 1TK5B 1M3IA 4ZL9A 2VCXA 3F6FA 1QXHA 2D2ZA
chains in the Genus database with same CATH topology
5JWQB 1R5AA 2YWOA 4D73B 3LJRA 1DSBA 3UARA 4FH8A 2VUPA 4JRRA 4IBPA 5D9XA 4WF4A 1FB6A 2DJ1A 4RQRA 1SJ6A 2V2GA 3N5OA 4KDUA 1M0UA 1R26A 2MBSA 4K7OA 3EMXA 4DSQA 3GA4A 4X1UA 4KAEA 2P31A 2V32A 1ACVA 4TN8A 3TJBA 2LJAA 2H75A 1HYUA 2OBIA 3FZ5A 4KA0A 1GTIA 1PMTA 3CXGA 3I9V2 1EP8A 3ZYWA 4EIPA 4GXZA 1ERWA 2CVKA 2X8CA 3M9KA 2ON5A 1G7OA 4DSSA 3MDKA 3GKNA 2LJKA 2B7KA 4HDEA 1Z9HA 4EE0A 1G6YA 1GL8A 5IMAA 3PH9A 4TR0A 1TI3A 1GRXA 4ID0A 4O5RA 3H93A 4K8MA 3TCOA 3OR5A 3AY8A 2LRNA 5C00A 1T00A 5F0GA 2R0CA 2MBTA 1Z6MA 4I97A 3C1SA 5CO3A 4L0UA 3FZ4A 2KUCA 4BWQA 3GIXA 4EC0A 4G2EA 2C0GA 4HEA2 5ECOB 3G7IA 3NOFA 1BAYA 1TRSA 3GTUA 1JZRA 5IQYA 2H01A 1CQGA 2R0GA 4TKYA 4AJ7A 1Z6NA 1Q98A 1XW9A 2E7PA 4POMA 3IXRA 1RK4A 4ZB6A 1XOBA 1JHBA 4EIQA 2X99A 1WP0A 4RQXA 1C72A 1BQ7A 3CTGA 2KLXA 3DKSA 3NIVA 2VL2C 2H0HA 1EEJA 4NWYA 4TRXA 4HQSA 4CDOA 3UBKA 1ERTA 4F2IA 1OAZA 1GTAA 1SENA 4GWRA 2AUVA 5IMFA 3MWHA 13GSA 2FWEA 3QFAC 1W89A 2CAIA 1ZGNA 3F8UA 3GKMA 4GQFA 3LFLA 3CTFA 3ZZXA 1M2BA 2PUKC 4V1Ap 1IYIA 2LQOA 4KUNA 1SYXA 2N5AA 2ZCTA 1XIYA 1H4OA 4AJ6A 2IIYA 5B8BA 2L4CA 2HNLA 4L5OA 4FYBA 3VI7A 4MF7A 5HFIA 1XCCA 4CY8A 8GSSA 3GSTA 2FNOA 5ECQB 2OA7A 3PINA 3FR3A 1GSEA 1OKDA 3D4TA 1TRWA 2XHFA 2DJKA 4ECJA 2EC4A 2FUG2 2OE0A 2GTUA 5HR0A 1MEKA 4QL7A 5IOXA 3LYPA 1SYRA 5ECLB 4PXOA 4Q5NA 1XVQA 1HQOA 2L5LA 1X5EA 3TB2A 5D96A 2CV4A 1K0OA 1MTCA 2I1UA 3D5JA 3CSJA 3EURA 3GHAA 4E8EA 3C8EA 5F8BA 3EWLA 4I8BA 2YJ7A 2H6XA 2HXKA 2MZCA 3FRCA 4KSOA 2LUSA 4KDYA 3L9UA 3EU4A 5G5EA 1QFNA 2N5FA 1VF3A 4L8EA 1YEPA 3ZIVA 5ID2B 4GF0A 2H74A 3GL5A 4HU9A 1ERUA 4ZBBA 2GVPA 1N8JA 2PVOC 2IL3A 3APQA 3MNGA 3GV1A 1YKAA 4K1FA 1QQ2A 3HJOA 2I3YA 4WBRD 2VL9A 4OO4A 3A3TA 2V1MA 1XWGA 3CSIA 1GLQA 2B7JA 3LSZA 4WR4A 2TRXA 4NAXA 1XBSA 2JL4A 3GX8A 1NM3A 2O89A 4K5RA 4XS4B 1PKZA 2A4VA 1XWBA 4MDCA 1OYJA 4K9ZA 2PMTA 5B7CA 1N2AA 2L57A 2WJUA 2L5OA 5ENUA 2IMEA 1YJ6A 2K8VA 2K8SA 1Z3EA 3NZNA 5LD0A 4XCSA 4I6XA 1KEBA 1QUWA 3KXOA 2GQMA 3BOAA 1SK0A 3HY2A 5G30A 4NXIA 3D22A 4IKHA 1AAZA 1PN0A 2VLUA 4FIWA 3IC8A 3G7YA 4MCUA 4LMWA 5GAND 5HR1A 4ICYA 1SK2A 1ST9A 4LA1A 3HDCA 3HD5A 1YEXA 3TUEA 4H86A 3ED3A 3WGXA 2F51A 2RIIA 3LXTA 1S3CA 5KOXA 2ALBA 4F03A 3L0HA 7GSSA 4KCAA 2B3SA 1FVJA 2H71A 4V2NA 1UC7A 1U88A 2DMMA 2C3QA 4O7HA 1WRYA 5JWOB 4J56E 4K0NA 2DIYA 3QMXA 4K7IA 5IO0A 3P90A 2B5YA 4TXVA 6GSUA 1VF1A 1GSSA 2VCWA 4HQZA 5KN0A 4LMVA 2A2RA 3RPNA 1EV9A 4ISDA 3TKSE 5DQSA 1OC9A 3LWAA 1T4YA 4JZQA 3EINA 4BL7B 5BRTA 4PQHA 2VLTA 3LEFA 3FYGA 4EF0A 1XOAA 4K2DA 2FGXA 5FT3A 2HFDA 2HRAA 1YKCA 4JEDA 1MDJA 2VL3A 5IMVA 1W4VA 3KIJA 4K0GA 4GCIA 1B4PA 5GZZB 4G0KA 4HJMA 1B8XA 2A2SA 1YF0A 1I5GA 2GZZA 2VCTA 3US3A 1MDIA 4K6XA 2C3TA 3ZLPA 3W8JA 5DVBA 3W8SA 1U87A 5B6NA 4N10A 3DVWA 2H0GA 3I69A 3ZTLA 1Z7RA 5L71A 5E59A 4EL1A 2C4JA 2FA8A 4P3YB 2G2QA 5D73A 1SL0B 1WOUA 3I6AA 2FWHA 3QCPA 2KHPA 1A0RP 4I5QA 1FVKA 4LL4B 3UMAA 2F8FA 1LU4A 2KP1A 5G1LA 1WMJA 4AJ8A 3LGCA 3ME7A 4IS0A 5G31A 3DWVA 1V57A 4IW9A 1F9MA 4RI7A 5B8AA 4PURA 2VM1A 2IWTA 3O6TA 1X5CA 2KOKA 2R6KA 3H79A 3KH9A 5ID2A 3APSA 5JCUA 3F63A 4QL9A 2QGVA 4TR1A 2P5RA 5CRDA 4IN0A 2RUFA 2X4AA 4WR5A 3IBHA 2DIZA 2N5BA 4O32A 2CQ9A 1KTEA 6GSXA 2R2JA 1JZDA 2IPAA 2A4HA 4K5SA 1O73A 2YWIA 4WF5A 3IAM2 2YNXA 1SD9A 5F05A 3HXSA 1M99A 4OO5A 3DD3A 2CX3A 1YDKA 4TR3A 4XS4A 1ZYQB 1E6BA 2HT9A 3L4NA 2AV4A 2ZUPA 2YJHA 1F3AA 5CAXA 1JLVA 1F3BA 2VD0A 2BMXA 1K0CA 5EY6A 4ZB9A 4G9HA 4MPGA 4ML6A 1FOVA 3FW2A 2XBIA 5ELGA 5F06A 3GH9A 1S3DA 1GUMA 2RM5A 2I9HA 4CW9A 4NPBA 3DYRA 1DBYA 3UJ1A 4IJIA 3GFKA 4YAVA 1Z7PA 3A2WA 2YPMA 4GLTA 2DKIA 5JCWA 3L9VA 1ZL9A 2VL2A 4MZWA 1AW9A 5D9VA 5D8IA 1OC3A 3KP8A 1KNGA 4TXOB 1YQ1A 3KJYA 4JR6A 2VD1A 17GSA 5ELAA 5IPHA 4KCEA 1GNWA 4ZIJA 5DDLA 2FCHA 5CNWA 4BWSA 4HU7A 3QAVA 4OFNA 2IN3A 1DUGA 2YV9A 1USBA 1ABAA 5HFKA 4K2XA 3MYDA 3GUSA 3KCMA 2GQKA 2R3XA 3GL3A 4XHMA 3LXZA 1TU7A 2PVQA 3VWWA 3WYWA 5DJLA 4GQCA 2ES7A 2LNSA 2H6ZA 2XBQA 4Q5RA 1ON4A 4IJ3A 2X64A 5HR3A 1JZWA 3TRQA 1K3LA 5FHIA 3MSZA 2AB6A 5J9CA 2OJLA 3ZFLA 2HZEB 3TKRA 4WBJA 2DJJA 4MJCA 4BL7A 3TJKA 4Z2UA 2PERA 4WXTA 2J9HA 3VWUA 4GRFA 3TRXA 1GUHA 1RW1A 2FWGA 1NW2A 3EE2A 1TTZA 3K8NA 4MH2A 2VOCA 3QAWA 3GYKA 1K0MA 2IMKA 2M80A 2A2PA 4TW5A 3HZ8A 2H8LA 4ECCA 2FA4A 3DGQA 3QD9A 5AGYA 4J57E 6GSYA 4MPFA 1GSFA 1SKRB 1O6JA 1UN2A 1XFLA 2UZ8A 1K3OA 4KW6A 1O81A 3KGKA 3KMOA 1HNCA 2C0DA 3ME8A 5CRWA 2GZYA 2DJ2A 5G5FA 3TJFA 3FKFA 2CT6A 2GS3A 2OE1A 2O87A 4N11A 1AQXA 5H5SA 4FO5A 2MMOA 4IP6A 4K7NA 5DJMA 3J7Yb 3FR9A 1G7EA 1OC9B 5J5NA 3KP9A 1JFUA 3I43A 2HRFA 1M7TA 3DVXA 3CMIA 5IMDA 1O85A 4NMUA 2H1DA 2HRNA 2F9SA 1BX9A 4WETA 2QC7A 3S9FA 2KP2A 3APOA 1K3YA 3VPTA 4G10A 2H30A 1A8YA 5FWGA 2JSZA 2RLIA 2H1GA 4MH3A 3KMNA 2YOIA 3EC3A 3U5RE 2DKHA 4ECIA 2LRCA 4DSRA 4EO3A 2R5GA 1DE2A 3LQ7A 3VI5A 2C3NA 1BYEA 2QKEA 1MD3A 4X43A 3IAS2 2LQQA 2VCZA 3VWVA 4JBBA 3GKXA 4Z2TA 4V1Ag 4YKFA 4F0CA 3HHVA 4CY6A 4L0WA 2Z9SA 1EZKA 3Q74A 4ZBDA 16GSA 1NHYA 2WDUA 5EVOA 1AUCA 3IK9A 5CYYA 4OWYA 3BCKA 2GZPA 1WWJA 1OVNA 4TR1B 5GSSA 2H73A 5EL8A 3P2AA 1T8EB 1SKWB 4ZB8A 5F07A 2GSSA 2BTOT 2RUEA 4TXOA 3P8WA 4Q5FA 1EV4A 3DEXA 3GRXA 1FB0A 3L78A 2NPBA 2CX4A 5BMUA 1SJZA 4N0ZA 4WEYA 4YKGA 2MMNA 2PGTA 4POLA 3IA1A 4EDYA 1Y25A 1HNBA 2YWMA 4ACSA 1K0DA 2RM6A 2K6VA 5INYA 1U3IA 3A5WA 4HS1A 4AF2A 2B1LA 2LJRA 3UAPA 1S3AA 2IFQB 1GSQA 2C0FA 3M3MA 4HUAA 5A4UA 3G7JA 1YY7A 2HZEA 1PX6A 2LEGA 3GMFA 2WS2A 1LBKA 2DJ3A 2VIMA 3C71A 4X4JA 4I2TA 4L5LA 3HVSA 3UIWA 3UOMA 3RHCA 3FY7A 3IRAA 1EWXA 1TOFA 1TP9A 1ZYNA 3FZ9A 1J9BA 5ECHB 1GSDA 4ZBAA 1WE0A 4HI7A 1V40A 4Z2RA 2R4VA 3TDGA 3VK9A 3JCML 4AGSA 1EOGA 2JACA 1R5PA 4MMMA 3TKQA 2PU9C 5EPFA 1PN9A 3KTBA 4ECBA 1PD21 4IELA 3UL3A 5ECRB 4PTSA 2LV3A 4NHZA 3RPPA 4YQMA 3PGTA 2C0EA 3ERFA 5DCGA 1PX7A 3KD0A 2O8VB 3HKRA 3IK7A 3N9JA 3QFBC 3TKPA 2B1KA 1J0FA 2DJ0A 3CBUA 3ERWA 2IMFA 2JZTA 2HZFA 3GN3A 20GSA 3RHBA 4G19A 2MMZA 3KEBA 3WGDA 2PN8A 4A5PA 1GH2A 1GP1A 4NV5A 4WKWA 3F6DA 3GX0A 1XZOA 3QDNA 2GT6A 1GUKA 2H19A 3UBLA 1TK0B 1FW1A 2FY6A 4JE1A 2WB9A 3H4KA 4KF9A 2VO4A 1T1VA 2HSHA 3A2VA 2B6MA 1X0RA 2H1AA 3FHKA 6GSTA 2LTKA 3M0FA 2OE3A 1MD4A 4LLRA 1TRVA 1FAAA 1VF4A 4OCEA 3V1WA 2H1BA 1A23A 5JCGA 3EMPA 3HZ4A 1SJIA 1OE7A 1EEMA 1ZMAA 1KBNA 3GNJA 2AHEA 1VGLA 4BVYB 1XPVA 1X9SB 3IR4A 1V9WA 4BVXA 2FWFA 2YN1A 1GNEA 2QSIA 3EYTA 2L4QA 3LYKA 4G0IA 2V6KA 4IVFA 1X9WB 1FO5A 3TOTA 1OKTA 1U6TA 5IPGA 2CZ3A 3D21A 4NV2A 1OC8A 3R2QA 2OKAA 4EXJA 4KX4A 1ZYPA 4NHWA 1E2YA 4MZCA 5HR2A 5C04A 1ZZYA 4XS1A 1A2JA 4MA9A 1AC1A 3UEMA 3E9JB 3VURA 4RI6A 4IQAA 1K0BA 5D93A 4EVMA 2YWNA 5CRHA 5IO2A 3IHQA 3HJMA 2IFQA 4ZILA 5HFGA 6GSVA 2F8AA 2GSQA 4PUFC 3KZQA 2JZRA 4O5UA 3F4SA 5IM9A 1YF1A 4ML1A 12GSA 3IE3A 3ZITA 3M1GA 2V41A 5E4WA 2NTOA 2GSRA 2CZ2A 4RUVA 3CYNA 5ECPB 1V58A 2VCVA 5JWRB 3UVTA 1TI1A 5KOWA 4OFMA 4F82A 3VFIA 1B9YC 3LW9A 4MF5A 2BJXA 4MNNA 4OCFA 4TR4A 3BCIA 4FYCA 1Z5YE 2EIQA 3P7XA 19GSA 5AIVA 2WULA 3HVXA 1PL2A 1AQVA 1TJDA 3E0UA 1U3AA 5AISA 4MLYA 5IOWA 4JU5A 3W6GA 1G6WA 3BBYA 4OD7A 22GSA 2HYXA 1WJKA 4PX1A 3BD2A 3WT1A 2R37A 5ECMB 3QOUA 4KNDA 2B5EA 5KN1A 2F3MA 5CREA 4PGTA 3VWXA 3H1NA 2CVBA 3LG6A 3A2XA 1BG5A 18GSA 10GSA 3CRTA 4XS6A 2M72A 5IMCA 4PQ1A 3ZRDA 2VM2A 4EUYA 3TKSC 4IQ1A 1A8LA 1SL2B 2AJQB 4O92A 5A4WA 1BJXA 2C80A 2WGRA 2IMIA 4OMVA 5IIZA 1SD8A 2OACA 3RDWA 2NBSA 1A0FA 2FHEA 2HSYA 2REMA 1DE1A 1O8XA 1M9BA 1A2MA 5COHA 2XPEA 3WGEA 4YAPA 2L6DA 4TOPA 3VPQA 4HZ4A 5DALB 4IP1A 3WT2A 2WCIA 5A5KA 5AIXA 1A2LA 3FK8A 1PA3A 4BVYA 3Q19A 3EU3A 4ZL7A 5A4VA 1HD2A 2FLSA 1M2DA 1WPIA 1FG4A 1B48A 1XW6A 1EP7A 1THXA 4YQVA 1THOA 5ABRA 1XW5A 4X0XA 1B9XC 3IHGA 3C1RA 1J08A 2I81A 3GSSA 4CHSA 5HQPA 4DVCA 1ZYEA 2X8HA 2GT5A 3TGZA 3A5IA 4IGJA 4MJAA 5IMZA 5H5RA 4FQUA 4KSMA 2E0QA 4BA7A 5ECNB 4BPYA 1GTBA 4MF6A 5G1KA 4KDXA 3FR6A 1GLPA 4YQUA 3KTLA 3ZVJD 1ML6A 2O7KA 3D6IA 2LNTA 5DAKA 4I2UA 2LSTA 4PNFA 5CP1A 4HOJA 3J7Yk 3U6VA 2WFCA 2L59A 1AXDA 1PRXA 2MYGA 1JZOA 3RBTA 3ZMKA 4GSTA 3ZFBA 2H6YA 1M2AA 3M8NA 2C8UA 4OFTA 3FEUA 2YZUA 4ILFA 5G2ZA 3ZMLA 1K0NA 2HI7A 3HJPA 4Q5QA 1O7UA 2DBCA 3SWLA 4BVXB 1NSWA 2YP6A 2VCQA 2PWJA 5J9BA 3RAZA 2FD3A 2R0PA 1T3BA 1V98A 2DSAA 3MIXA 3ISOA 4PUAA 1GSYA 4D73A 3PR8A 1V2AA 3EVIA 2DC5A 2C1YA 2YANA 3G9BA 5DBQA 4IHUA 1BEDA 1SK1A 3IDVA 1XWCA 1PQNA 2K18A 3BJ5A 2E2MA 4LL1B 4E8HA 1FHEA 1GTUA 4KH7A 5KEJA 4MJEA 2HE3A 4XTSA 3ZIJA 3Q6OA 1TRUA 4YH2A 5J41A 3ZREA 1ERVA 3FZAA 2CA8A 2JU5A 1K0AA 2DLXA 2P0GA 4ZL8A 4KB3A 4Z7XA 4XRAA 3DIEA 4DEJA 3ZVJA 1LJRA 2TIRA 3DRNA 14GSA 3KM6A 1AIUA 2L6CA 2ZNMA 3Q18A 4O5QA 2AYTA 2LRTA 1PL1A 4GSNA 5CRGA 1SU9A 2OBKA 5GSTA 2P5QA 3D4MA 2GQLA 2H70A 2VLVA 4PNGA 2GLRA 2JSYA 2OADA 3R3EA 3HYPA 1JLWA 1TXXA 5DQYA 1PKWA 1XVWA 1GSUA 1OE8A 2WRTA 1Q4JA 4HJ2A 4ZXGA 1WIKA 3F0IA 4MJBA 2YZHA 3IC4A 2YV7A 3EPTA 1MDKA 1T7PB 4MK3A 5J3RA 5J4UA 5B6MA 1ZOFA 1R4WA 5KN2A 5H5QA 3GKKA 2JADA 2O85A 3F9UA 3C7MA 3F4TA 3KH7A 5DALA 5LNKe 4HZ2A 1ZCPA 2CVDA 1O8WA 2PPTA 2EIOA 3MAKA 3L9SA 2V6OA 3QR6A 4DSSB 2JZSA 3IV4A 1XXUA 2GDRA 1Y6EA 5D9WA 1G0TA 2X8GA 2HLSA 1AQWA 3CRUA 2VAFA 4KGIA 2GGTA 3F3RA 1TDIA 3CSHA 1H75A 3C73A 3QPMA 1A24A 1CQHA 1SKSB 3TJGA 3PPUA 4N30A 4EKZA 1URMA 2QA2A 5DCHA 1PSQA 9GSSA 3DMLA 4MABA 3IOSA 5ECKB 2WZ9A 1PGTA 2E2GA 4F9ZA 4EDZA 4J2FA 4KE3A 2B5XA 2H0IA 3GTUB 3WD6A 1UVZA 1QK8A 4USSA 4V2LA 4F0BA 4POKA 3TRPA 1ILOA 3O76A 1HNAA 2TRCP 5LCZA 2LKUA 4QQ7A 3QAGA 3LORA 2H66A 1F37A 4MZBA 3O3TA 1GWCA 3FMWA 2H72A 3GURA 1F6MC 1F2EA 5ECSA 1SL1B 2IJYA 5D9TA 3UVHA 2EIRA 4POBA 4PQIA 5AN1A 2I4AA 1QMVA 1FOHA 3TJJA 2XC2A 3HVVA 4XRDA 4FYUA 2NDOA 1QGVA 2XPDA 5ECIB 1XWAA 3GH6A 1EGRA 3VLNA 1TKDB 2IMDA 1X5DA 1UA5A 4GSSA 1VF2A 3DXBA 2PBJA 1GULA 1R7HA 4ULXA 2YCDA 2H76A 2ON7A 3F3QA 4G0LA 2DMLA 1VRSD 1EOHA 2LS5A 2K9FA 2J23A 4GTUA 4JR4A 6GSSA 2X49A 3ERGA 2G0FA 1RQMA 2HRKA 1IYHA 6GSWA 4XIHA 5DAKB 1I9DA 3E3EA 1NHOA 2QA1A 3SBCA 2M46A 2AAWA 1T4ZA 3M9JA 3HCZA 11GSA 1X9MB 2GSTA 3TOUA 1XWKA 1M9AA 3IPZA 3ZL5A 4MP4A 1EGOA 3D0ZA 3F4RA 1TK8B 2MMAA 4N0VA 3H8QA 2CAQA 1B4QA 1TW9A 5GAPD 5KN3A 2HSMA 1TU8A 4TVEA 4V2MA 2NVLA 3HA9A 1YZXA 3TKSA 1TK5B 4ZL9A 2VCXA 3F6FA 1QXHA 2D2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JWQ B;  1R5A A;  2YWO A;  4D73 B;  3LJR A;  1DSB A;  3UAR A;  4FH8 A;  2VUP A;  4JRR A;  4IBP A;  5D9X A;  4WF4 A;  1FB6 A;  2DJ1 A;  4RQR A;  1SJ6 A;  2V2G A;  3N5O A;  4KDU A;  1M0U A;  1R26 A;  2MBS A;  4K7O A;  3EMX A;  4DSQ A;  3GA4 A;  4X1U A;  4KAE A;  2P31 A;  2V32 A;  1ACV A;  4TN8 A;  3TJB A;  2LJA A;  2H75 A;  1HYU A;  2OBI A;  3FZ5 A;  4KA0 A;  1GTI A;  1PMT A;  3CXG A;  3I9V 2;  1EP8 A;  3ZYW A;  4GXZ A;  1ERW A;  2CVK A;  2X8C A;  3M9K A;  2ON5 A;  1G7O A;  4DSS A;  3MDK A;  3GKN A;  2LJK A;  2B7K A;  4HDE A;  1Z9H A;  4EE0 A;  1G6Y A;  1GL8 A;  5IMA A;  3PH9 A;  4TR0 A;  1TI3 A;  1GRX A;  4ID0 A;  4O5R A;  3H93 A;  4K8M A;  3TCO A;  3OR5 A;  3AY8 A;  2LRN A;  5C00 A;  1T00 A;  5F0G A;  2MBT A;  1Z6M A;  4I97 A;  3C1S A;  5CO3 A;  4L0U A;  3FZ4 A;  2KUC A;  4BWQ A;  3GIX A;  4EC0 A;  4G2E A;  2C0G A;  4HEA 2;  5ECO B;  3G7I A;  3NOF A;  1BAY A;  1TRS A;  3GTU A;  1JZR A;  5IQY A;  2H01 A;  1CQG A;  4TKY A;  4AJ7 A;  1Z6N A;  1Q98 A;  1XW9 A;  2E7P A;  4POM A;  3IXR A;  1RK4 A;  4ZB6 A;  1XOB A;  1JHB A;  2X99 A;  1WP0 A;  4RQX A;  1C72 A;  1BQ7 A;  3CTG A;  2KLX A;  3DKS A;  3NIV A;  2VL2 C;  2H0H A;  1EEJ A;  4NWY A;  4TRX A;  4HQS A;  4CDO A;  3UBK A;  1ERT A;  4F2I A;  1OAZ A;  1GTA A;  1SEN A;  4GWR A;  2AUV A;  5IMF A;  3MWH A;  13GS A;  2FWE A;  3QFA C;  1W89 A;  2CAI A;  1ZGN A;  3F8U A;  3GKM A;  4GQF A;  3LFL A;  3CTF A;  3ZZX A;  1M2B A;  2PUK C;  4V1A p;  1IYI A;  2LQO A;  4KUN A;  1SYX A;  2N5A A;  2ZCT A;  1XIY A;  1H4O A;  4AJ6 A;  2IIY A;  5B8B A;  2L4C A;  2HNL A;  4L5O A;  4FYB A;  3VI7 A;  4MF7 A;  5HFI A;  1XCC A;  8GSS A;  3GST A;  2FNO A;  5ECQ B;  2OA7 A;  3PIN A;  3FR3 A;  1GSE A;  1OKD A;  3D4T A;  1TRW A;  2XHF A;  2DJK A;  4ECJ A;  2EC4 A;  2FUG 2;  2OE0 A;  2GTU A;  5HR0 A;  1MEK A;  4QL7 A;  5IOX A;  3LYP A;  1SYR A;  5ECL B;  4PXO A;  4Q5N A;  1XVQ A;  1HQO A;  2L5L A;  1X5E A;  3TB2 A;  5D96 A;  2CV4 A;  1K0O A;  1MTC A;  2I1U A;  3D5J A;  3CSJ A;  3EUR A;  3GHA A;  4E8E A;  3C8E A;  5F8B A;  3EWL A;  4I8B A;  2YJ7 A;  2H6X A;  2HXK A;  2MZC A;  3FRC A;  4KSO A;  2LUS A;  4KDY A;  3L9U A;  3EU4 A;  5G5E A;  1QFN A;  2N5F A;  1VF3 A;  4L8E A;  1YEP A;  3ZIV A;  5ID2 B;  4GF0 A;  2H74 A;  3GL5 A;  4HU9 A;  1ERU A;  4ZBB A;  2GVP A;  1N8J A;  2PVO C;  2IL3 A;  3APQ A;  3MNG A;  3GV1 A;  1YKA A;  4K1F A;  1QQ2 A;  3HJO A;  2I3Y A;  4WBR D;  2VL9 A;  4OO4 A;  3A3T A;  2V1M A;  1XWG A;  3CSI A;  1GLQ A;  2B7J A;  3LSZ A;  4WR4 A;  2TRX A;  4NAX A;  1XBS A;  2JL4 A;  3GX8 A;  1NM3 A;  2O89 A;  4XS4 B;  1PKZ A;  2A4V A;  1XWB A;  4MDC A;  1OYJ A;  4K9Z A;  2PMT A;  5B7C A;  1N2A A;  2L57 A;  2WJU A;  2L5O A;  5ENU A;  2IME A;  1YJ6 A;  2K8V A;  2K8S A;  1Z3E A;  3NZN A;  5LD0 A;  4XCS A;  4I6X A;  1KEB A;  1QUW A;  3KXO A;  2GQM A;  3BOA A;  1SK0 A;  3HY2 A;  5G30 A;  4NXI A;  3D22 A;  4IKH A;  1AAZ A;  2VLU A;  4FIW A;  3G7Y A;  4MCU A;  4LMW A;  5GAN D;  5HR1 A;  1SK2 A;  1ST9 A;  4LA1 A;  3HDC A;  3HD5 A;  1YEX A;  3TUE A;  4H86 A;  3ED3 A;  3WGX A;  2F51 A;  2RII A;  3LXT A;  1S3C A;  2ALB A;  4F03 A;  3L0H A;  7GSS A;  4KCA A;  2B3S A;  1FVJ A;  2H71 A;  4V2N A;  1UC7 A;  1U88 A;  2DMM A;  2C3Q A;  4O7H A;  1WRY A;  5JWO B;  4J56 E;  4K0N A;  2DIY A;  3QMX A;  4K7I A;  5IO0 A;  3P90 A;  2B5Y A;  4TXV A;  6GSU A;  1VF1 A;  1GSS A;  2VCW A;  4HQZ A;  5KN0 A;  4LMV A;  2A2R A;  3RPN A;  1EV9 A;  4ISD A;  3TKS E;  5DQS A;  1OC9 A;  3LWA A;  1T4Y A;  4JZQ A;  3EIN A;  4PQH A;  2VLT A;  3LEF A;  3FYG A;  4EF0 A;  1XOA A;  4K2D A;  2FGX A;  5FT3 A;  2HFD A;  1YKC A;  4JED A;  1MDJ A;  2VL3 A;  5IMV A;  1W4V A;  3KIJ A;  4K0G A;  4GCI A;  1B4P A;  5GZZ B;  4HJM A;  1B8X A;  2A2S A;  1YF0 A;  1I5G A;  2GZZ A;  2VCT A;  3US3 A;  1MDI A;  4K6X A;  2C3T A;  3ZLP A;  3W8J A;  5DVB A;  3W8S A;  1U87 A;  5B6N A;  4N10 A;  3DVW A;  2H0G A;  3I69 A;  3ZTL A;  1Z7R A;  5L71 A;  5E59 A;  4EL1 A;  2C4J A;  2FA8 A;  4P3Y B;  2G2Q A;  5D73 A;  1SL0 B;  1WOU A;  3I6A A;  2FWH A;  3QCP A;  2KHP A;  1A0R P;  4I5Q A;  1FVK A;  4LL4 B;  3UMA A;  2F8F A;  1LU4 A;  2KP1 A;  5G1L A;  1WMJ A;  4AJ8 A;  3LGC A;  3ME7 A;  4IS0 A;  5G31 A;  3DWV A;  1V57 A;  4IW9 A;  1F9M A;  4RI7 A;  5B8A A;  4PUR A;  2VM1 A;  2IWT A;  3O6T A;  1X5C A;  2KOK A;  2R6K A;  3H79 A;  3KH9 A;  5ID2 A;  3APS A;  5JCU A;  3F63 A;  4QL9 A;  2QGV A;  4TR1 A;  2P5R A;  5CRD A;  4IN0 A;  2RUF A;  4WR5 A;  3IBH A;  2DIZ A;  2N5B A;  4O32 A;  2CQ9 A;  1KTE A;  6GSX A;  2R2J A;  1JZD A;  2IPA A;  1O73 A;  2YWI A;  4WF5 A;  3IAM 2;  2YNX A;  1SD9 A;  5F05 A;  3HXS A;  1M99 A;  4OO5 A;  3DD3 A;  2CX3 A;  1YDK A;  4TR3 A;  4XS4 A;  1ZYQ B;  1E6B A;  2HT9 A;  3L4N A;  2AV4 A;  2ZUP A;  2YJH A;  1F3A A;  5CAX A;  1JLV A;  1F3B A;  2VD0 A;  2BMX A;  1K0C A;  5EY6 A;  4ZB9 A;  4G9H A;  4MPG A;  4ML6 A;  1FOV A;  3FW2 A;  2XBI A;  5ELG A;  5F06 A;  3GH9 A;  1S3D A;  1GUM A;  2RM5 A;  2I9H A;  4CW9 A;  4NPB A;  3DYR A;  1DBY A;  3UJ1 A;  4IJI A;  3GFK A;  4YAV A;  1Z7P A;  3A2W A;  2YPM A;  4GLT A;  5JCW A;  3L9V A;  1ZL9 A;  2VL2 A;  4MZW A;  1AW9 A;  5D9V A;  5D8I A;  1OC3 A;  3KP8 A;  1KNG A;  4TXO B;  1YQ1 A;  3KJY A;  4JR6 A;  2VD1 A;  17GS A;  5ELA A;  5IPH A;  4KCE A;  1GNW A;  4ZIJ A;  5DDL A;  2FCH A;  5CNW A;  4BWS A;  4HU7 A;  3QAV A;  4OFN A;  2IN3 A;  1DUG A;  2YV9 A;  1USB A;  1ABA A;  5HFK A;  3GUS A;  3KCM A;  2GQK A;  2R3X A;  3GL3 A;  4XHM A;  3LXZ A;  1TU7 A;  2PVQ A;  3VWW A;  3WYW A;  5DJL A;  4GQC A;  2ES7 A;  2LNS A;  2H6Z A;  2XBQ A;  4Q5R A;  1ON4 A;  4IJ3 A;  2X64 A;  5HR3 A;  1JZW A;  3TRQ A;  1K3L A;  5FHI A;  3MSZ A;  2AB6 A;  5J9C A;  2OJL A;  3ZFL A;  2HZE B;  3TKR A;  4WBJ A;  2DJJ A;  4MJC A;  4BL7 A;  3TJK A;  2PER A;  4WXT A;  2J9H A;  3VWU A;  4GRF A;  3TRX A;  1GUH A;  1RW1 A;  2FWG A;  1NW2 A;  3EE2 A;  1TTZ A;  3K8N A;  4MH2 A;  2VOC A;  3QAW A;  3GYK A;  1K0M A;  2IMK A;  2M80 A;  4TW5 A;  3HZ8 A;  2H8L A;  4ECC A;  2FA4 A;  3DGQ A;  3QD9 A;  5AGY A;  4J57 E;  6GSY A;  4MPF A;  1GSF A;  1SKR B;  1O6J A;  1UN2 A;  1XFL A;  1K3O A;  4KW6 A;  1O81 A;  3KGK A;  3KMO A;  1HNC A;  2C0D A;  3ME8 A;  5CRW A;  2GZY A;  2DJ2 A;  5G5F A;  3TJF A;  3FKF A;  2CT6 A;  2GS3 A;  2OE1 A;  2O87 A;  4N11 A;  1AQX A;  5H5S A;  4FO5 A;  2MMO A;  4IP6 A;  4K7N A;  5DJM A;  3J7Y b;  3FR9 A;  1G7E A;  1OC9 B;  5J5N A;  3KP9 A;  1JFU A;  3I43 A;  2HRF A;  1M7T A;  3DVX A;  3CMI A;  5IMD A;  1O85 A;  4NMU A;  2H1D A;  2HRN A;  2F9S A;  1BX9 A;  4WET A;  2QC7 A;  3S9F A;  2KP2 A;  3APO A;  1K3Y A;  3VPT A;  4G10 A;  2H30 A;  1A8Y A;  5FWG A;  2JSZ A;  2RLI A;  2H1G A;  4MH3 A;  3KMN A;  2YOI A;  3EC3 A;  3U5R E;  4ECI A;  2LRC A;  4DSR A;  4EO3 A;  2R5G A;  1DE2 A;  3LQ7 A;  3VI5 A;  2C3N A;  1BYE A;  2QKE A;  1MD3 A;  4X43 A;  3IAS 2;  2LQQ A;  2VCZ A;  3VWV A;  4JBB A;  3GKX A;  4V1A g;  4F0C A;  3HHV A;  4L0W A;  2Z9S A;  1EZK A;  3Q74 A;  4ZBD A;  16GS A;  1NHY A;  2WDU A;  5EVO A;  1AUC A;  3IK9 A;  5CYY A;  4OWY A;  3BCK A;  2GZP A;  1WWJ A;  1OVN A;  4TR1 B;  5GSS A;  2H73 A;  5EL8 A;  3P2A A;  1T8E B;  1SKW B;  4ZB8 A;  5F07 A;  2GSS A;  2BTO T;  2RUE A;  4TXO A;  3P8W A;  4Q5F A;  1EV4 A;  3DEX A;  3GRX A;  1FB0 A;  3L78 A;  2NPB A;  2CX4 A;  1SJZ A;  4N0Z A;  4WEY A;  2MMN A;  2PGT A;  4POL A;  3IA1 A;  4EDY A;  1Y25 A;  1HNB A;  2YWM A;  4ACS A;  1K0D A;  2RM6 A;  2K6V A;  5INY A;  1U3I A;  3A5W A;  4HS1 A;  4AF2 A;  2B1L A;  2LJR A;  3UAP A;  1S3A A;  2IFQ B;  1GSQ A;  2C0F A;  3M3M A;  4HUA A;  5A4U A;  3G7J A;  1YY7 A;  2HZE A;  1PX6 A;  2LEG A;  3GMF A;  2WS2 A;  1LBK A;  2DJ3 A;  2VIM A;  3C71 A;  4I2T A;  4L5L A;  3HVS A;  3UIW A;  3UOM A;  3RHC A;  3FY7 A;  3IRA A;  1EWX A;  1TOF A;  1TP9 A;  3FZ9 A;  1J9B A;  5ECH B;  1GSD A;  4ZBA A;  1WE0 A;  4HI7 A;  1V40 A;  2R4V A;  3TDG A;  3VK9 A;  3JCM L;  4AGS A;  1EOG A;  2JAC A;  1R5P A;  4MMM A;  3TKQ A;  2PU9 C;  5EPF A;  1PN9 A;  3KTB A;  4ECB A;  1PD2 1;  4IEL A;  3UL3 A;  5ECR B;  3RPP A;  2LV3 A;  4NHZ A;  4YQM A;  3PGT A;  2C0E A;  3ERF A;  5DCG A;  1PX7 A;  3KD0 A;  2O8V B;  3HKR A;  3IK7 A;  3N9J A;  3QFB C;  3TKP A;  2B1K A;  1J0F A;  2DJ0 A;  3CBU A;  3ERW A;  2IMF A;  2JZT A;  2HZF A;  3GN3 A;  20GS A;  3RHB A;  4G19 A;  2MMZ A;  3KEB A;  3WGD A;  2PN8 A;  1GH2 A;  1GP1 A;  4NV5 A;  4WKW A;  3F6D A;  3GX0 A;  1XZO A;  3QDN A;  2GT6 A;  1GUK A;  2H19 A;  3UBL A;  1TK0 B;  1FW1 A;  2FY6 A;  4JE1 A;  2WB9 A;  3H4K A;  2VO4 A;  1T1V A;  2HSH A;  3A2V A;  2B6M A;  1X0R A;  2H1A A;  3FHK A;  6GST A;  2LTK A;  3M0F A;  2OE3 A;  1MD4 A;  4LLR A;  1TRV A;  1FAA A;  1VF4 A;  4OCE A;  3V1W A;  2H1B A;  1A23 A;  5JCG A;  3EMP A;  3HZ4 A;  1SJI A;  1OE7 A;  1EEM A;  1ZMA A;  1KBN A;  3GNJ A;  2AHE A;  1VGL A;  1XPV A;  1X9S B;  3IR4 A;  1V9W A;  4BVX A;  2FWF A;  2YN1 A;  1GNE A;  2QSI A;  3EYT A;  2L4Q A;  3LYK A;  2V6K A;  4IVF A;  1X9W B;  1FO5 A;  3TOT A;  1OKT A;  1U6T A;  5IPG A;  2CZ3 A;  3D21 A;  4NV2 A;  1OC8 A;  3R2Q A;  2OKA A;  4EXJ A;  4KX4 A;  4NHW A;  1E2Y A;  4MZC A;  5HR2 A;  5C04 A;  1ZZY A;  4XS1 A;  1A2J A;  4MA9 A;  1AC1 A;  3UEM A;  3E9J B;  3VUR A;  4RI6 A;  4IQA A;  1K0B A;  5D93 A;  4EVM A;  2YWN A;  5CRH A;  5IO2 A;  3IHQ A;  3HJM A;  2IFQ A;  4ZIL A;  5HFG A;  6GSV A;  2F8A A;  2GSQ A;  4PUF C;  3KZQ A;  2JZR A;  3F4S A;  5IM9 A;  1YF1 A;  4ML1 A;  12GS A;  3IE3 A;  3ZIT A;  3M1G A;  2V41 A;  5E4W A;  2NTO A;  2GSR A;  2CZ2 A;  4RUV A;  3CYN A;  5ECP B;  1V58 A;  2VCV A;  5JWR B;  3UVT A;  1TI1 A;  4OFM A;  4F82 A;  3VFI A;  1B9Y C;  4MF5 A;  2BJX A;  4OCF A;  4TR4 A;  3BCI A;  4FYC A;  1Z5Y E;  2EIQ A;  3P7X A;  19GS A;  5AIV A;  2WUL A;  3HVX A;  1PL2 A;  1AQV A;  1TJD A;  3E0U A;  1U3A A;  5AIS A;  4MLY A;  5IOW A;  4JU5 A;  3W6G A;  1G6W A;  3BBY A;  4OD7 A;  22GS A;  2HYX A;  1WJK A;  4PX1 A;  3BD2 A;  3WT1 A;  2R37 A;  5ECM B;  3QOU A;  4KND A;  2B5E A;  5KN1 A;  2F3M A;  5CRE A;  4PGT A;  3VWX A;  3H1N A;  2CVB A;  3LG6 A;  3A2X A;  1BG5 A;  18GS A;  10GS A;  3CRT A;  4XS6 A;  2M72 A;  5IMC A;  4PQ1 A;  3ZRD A;  2VM2 A;  4EUY A;  3TKS C;  4IQ1 A;  1A8L A;  1SL2 B;  2AJQ B;  4O92 A;  5A4W A;  1BJX A;  2C80 A;  2WGR A;  2IMI A;  4OMV A;  5IIZ A;  1SD8 A;  2OAC A;  3RDW A;  2NBS A;  1A0F A;  2FHE A;  2HSY A;  2REM A;  1DE1 A;  1O8X A;  1M9B A;  1A2M A;  5COH A;  2XPE A;  3WGE A;  4YAP A;  2L6D A;  4TOP A;  3VPQ A;  4HZ4 A;  5DAL B;  4IP1 A;  3WT2 A;  2WCI A;  5A5K A;  5AIX A;  1A2L A;  3FK8 A;  1PA3 A;  4BVY A;  3Q19 A;  3EU3 A;  4ZL7 A;  5A4V A;  1HD2 A;  2FLS A;  1M2D A;  1WPI A;  1FG4 A;  1B48 A;  1XW6 A;  1EP7 A;  1THX A;  4YQV A;  1THO A;  5ABR A;  1XW5 A;  4X0X A;  1B9X C;  3C1R A;  1J08 A;  2I81 A;  3GSS A;  4CHS A;  5HQP A;  4DVC A;  1ZYE A;  2X8H A;  2GT5 A;  3TGZ A;  4IGJ A;  4MJA A;  5IMZ A;  5H5R A;  4KSM A;  2E0Q A;  4BA7 A;  5ECN B;  4BPY A;  1GTB A;  4MF6 A;  5G1K A;  4KDX A;  3FR6 A;  1GLP A;  4YQU A;  3KTL A;  3ZVJ D;  1ML6 A;  2O7K A;  3D6I A;  2LNT A;  5DAK A;  4I2U A;  2LST A;  4PNF A;  5CP1 A;  4HOJ A;  3J7Y k;  3U6V A;  2WFC A;  2L59 A;  1AXD A;  1PRX A;  2MYG A;  1JZO A;  3RBT A;  3ZMK A;  4GST A;  3ZFB A;  2H6Y A;  1M2A A;  3M8N A;  2C8U A;  4OFT A;  3FEU A;  2YZU A;  4ILF A;  5G2Z A;  3ZML A;  1K0N A;  2HI7 A;  3HJP A;  4Q5Q A;  1O7U A;  2DBC A;  3SWL A;  1NSW A;  2YP6 A;  2VCQ A;  2PWJ A;  5J9B A;  3RAZ A;  2FD3 A;  1T3B A;  1V98 A;  2DSA A;  3ISO A;  4PUA A;  1GSY A;  4D73 A;  3PR8 A;  1V2A A;  3EVI A;  2DC5 A;  2C1Y A;  2YAN A;  3G9B A;  5DBQ A;  4IHU A;  1BED A;  1SK1 A;  3IDV A;  1XWC A;  1PQN A;  2K18 A;  3BJ5 A;  2E2M A;  4LL1 B;  4E8H A;  1FHE A;  1GTU A;  4KH7 A;  5KEJ A;  4MJE A;  2HE3 A;  4XTS A;  3ZIJ A;  3Q6O A;  1TRU A;  4YH2 A;  5J41 A;  3ZRE A;  1ERV A;  3FZA A;  2CA8 A;  2JU5 A;  1K0A A;  2DLX A;  2P0G A;  4ZL8 A;  4KB3 A;  4Z7X A;  4XRA A;  3DIE A;  4DEJ A;  3ZVJ A;  1LJR A;  2TIR A;  3DRN A;  14GS A;  3KM6 A;  1AIU A;  2L6C A;  2ZNM A;  3Q18 A;  2AYT A;  2LRT A;  1PL1 A;  4GSN A;  5CRG A;  1SU9 A;  2OBK A;  5GST A;  2P5Q A;  3D4M A;  2GQL A;  2H70 A;  2VLV A;  4PNG A;  2GLR A;  2JSY A;  2OAD A;  3HYP A;  1JLW A;  1TXX A;  5DQY A;  1PKW A;  1XVW A;  1GSU A;  1OE8 A;  2WRT A;  1Q4J A;  4HJ2 A;  4ZXG A;  1WIK A;  3F0I A;  4MJB A;  2YZH A;  3IC4 A;  2YV7 A;  1MDK A;  1T7P B;  4MK3 A;  5J3R A;  5J4U A;  5B6M A;  1ZOF A;  1R4W A;  5KN2 A;  5H5Q A;  3GKK A;  2JAD A;  2O85 A;  3F9U A;  3C7M A;  3F4T A;  3KH7 A;  5DAL A;  5LNK e;  4HZ2 A;  1ZCP A;  2CVD A;  1O8W A;  2PPT A;  2EIO A;  3MAK A;  3L9S A;  2V6O A;  3QR6 A;  4DSS B;  2JZS A;  3IV4 A;  1XXU A;  2GDR A;  1Y6E A;  5D9W A;  1G0T A;  2X8G A;  2HLS A;  1AQW A;  3CRU A;  2VAF A;  4KGI A;  2GGT A;  3F3R A;  1TDI A;  3CSH A;  1H75 A;  3C73 A;  3QPM A;  1A24 A;  1CQH A;  1SKS B;  3TJG A;  4N30 A;  4EKZ A;  1URM A;  5DCH A;  1PSQ A;  9GSS A;  3DML A;  4MAB A;  3IOS A;  5ECK B;  2WZ9 A;  1PGT A;  2E2G A;  4F9Z A;  4EDZ A;  4J2F A;  4KE3 A;  2B5X A;  2H0I A;  3GTU B;  3WD6 A;  1UVZ A;  1QK8 A;  4V2L A;  4F0B A;  4POK A;  3TRP A;  1ILO A;  3O76 A;  1HNA A;  2TRC P;  5LCZ A;  2LKU A;  4QQ7 A;  3QAG A;  3LOR A;  2H66 A;  1F37 A;  4MZB A;  3O3T A;  1GWC A;  2H72 A;  3GUR A;  1F6M C;  1F2E A;  5ECS A;  1SL1 B;  2IJY A;  5D9T A;  3UVH A;  2EIR A;  4POB A;  4PQI A;  5AN1 A;  2I4A A;  1QMV A;  3TJJ A;  2XC2 A;  3HVV A;  4XRD A;  4FYU A;  2NDO A;  1QGV A;  2XPD A;  5ECI B;  1XWA A;  3GH6 A;  1EGR A;  3VLN A;  1TKD B;  2IMD A;  1X5D A;  1UA5 A;  4GSS A;  1VF2 A;  3DXB A;  2PBJ A;  1GUL A;  1R7H A;  4ULX A;  2YCD A;  2H76 A;  2ON7 A;  3F3Q A;  2DML A;  1VRS D;  1EOH A;  2LS5 A;  2K9F A;  2J23 A;  4GTU A;  4JR4 A;  6GSS A;  3ERG A;  2G0F A;  1RQM A;  1IYH A;  6GSW A;  4XIH A;  5DAK B;  1I9D A;  3E3E A;  1NHO A;  3SBC A;  2M46 A;  2AAW A;  1T4Z A;  3M9J A;  3HCZ A;  11GS A;  1X9M B;  2GST A;  3TOU A;  1XWK A;  1M9A A;  3IPZ A;  3ZL5 A;  4MP4 A;  1EGO A;  3D0Z A;  3F4R A;  1TK8 B;  2MMA A;  4N0V A;  3H8Q A;  2CAQ A;  1B4Q A;  1TW9 A;  5GAP D;  5KN3 A;  1TU8 A;  4TVE A;  4V2M A;  2NVL A;  3HA9 A;  1YZX A;  3TKS A;  1TK5 B;  4ZL9 A;  2VCX A;  3F6F A;  1QXH A;  2D2Z A; 
#chains in the Genus database with same CATH topology
 5JWQ B;  1R5A A;  2YWO A;  3CQF A;  4D73 B;  3LJR A;  1DSB A;  3UAR A;  4FH8 A;  2VUP A;  4JRR A;  4IBP A;  5D9X A;  4WF4 A;  1FB6 A;  2DJ1 A;  4RQR A;  1SJ6 A;  2V2G A;  3N5O A;  4KDU A;  1M0U A;  1R26 A;  2MBS A;  4K7O A;  3EMX A;  4DSQ A;  3GA4 A;  4X1U A;  4KAE A;  2P31 A;  2V32 A;  1ACV A;  4TN8 A;  3TJB A;  2LJA A;  2H75 A;  1HYU A;  2OBI A;  3FZ5 A;  4KA0 A;  1GTI A;  1PMT A;  3CXG A;  3I9V 2;  1EP8 A;  3ZYW A;  4EIP A;  4GXZ A;  1ERW A;  2CVK A;  2X8C A;  3M9K A;  2ON5 A;  1G7O A;  4DSS A;  3MDK A;  3GKN A;  2LJK A;  2B7K A;  4HDE A;  1Z9H A;  4EE0 A;  1G6Y A;  1GL8 A;  5IMA A;  3PH9 A;  4TR0 A;  1TI3 A;  1GRX A;  4ID0 A;  4O5R A;  3H93 A;  4K8M A;  3TCO A;  3OR5 A;  3AY8 A;  2LRN A;  5C00 A;  1T00 A;  5F0G A;  2R0C A;  2MBT A;  1Z6M A;  4I97 A;  3C1S A;  5CO3 A;  4L0U A;  3FZ4 A;  2KUC A;  4BWQ A;  3GIX A;  4EC0 A;  4G2E A;  2C0G A;  4HEA 2;  5ECO B;  3G7I A;  3NOF A;  1BAY A;  1TRS A;  3GTU A;  1JZR A;  5IQY A;  2H01 A;  1CQG A;  2R0G A;  4TKY A;  4AJ7 A;  1Z6N A;  1Q98 A;  1XW9 A;  2E7P A;  4POM A;  3IXR A;  1RK4 A;  4ZB6 A;  1XOB A;  1JHB A;  4EIQ A;  2X99 A;  1WP0 A;  4RQX A;  1C72 A;  1BQ7 A;  3CTG A;  2KLX A;  3DKS A;  3NIV A;  2VL2 C;  2H0H A;  1EEJ A;  4NWY A;  4TRX A;  4HQS A;  4CDO A;  3UBK A;  1ERT A;  4F2I A;  1OAZ A;  1GTA A;  1SEN A;  4GWR A;  2AUV A;  5IMF A;  3MWH A;  13GS A;  2FWE A;  3QFA C;  1W89 A;  2CAI A;  1ZGN A;  3F8U A;  3GKM A;  4GQF A;  3LFL A;  3CTF A;  3ZZX A;  1M2B A;  2PUK C;  4V1A p;  1IYI A;  2LQO A;  4KUN A;  1SYX A;  2N5A A;  2ZCT A;  1XIY A;  1H4O A;  4AJ6 A;  2IIY A;  5B8B A;  2L4C A;  2HNL A;  4L5O A;  4FYB A;  3VI7 A;  4MF7 A;  5HFI A;  1XCC A;  4CY8 A;  8GSS A;  3GST A;  2FNO A;  5ECQ B;  2OA7 A;  3PIN A;  3FR3 A;  1GSE A;  1OKD A;  3D4T A;  1TRW A;  2XHF A;  2DJK A;  4ECJ A;  2EC4 A;  2FUG 2;  2OE0 A;  2GTU A;  5HR0 A;  1MEK A;  4QL7 A;  5IOX A;  3LYP A;  1SYR A;  5ECL B;  4PXO A;  4Q5N A;  1XVQ A;  1HQO A;  2L5L A;  1X5E A;  3TB2 A;  5D96 A;  2CV4 A;  1K0O A;  1MTC A;  2I1U A;  3D5J A;  3CSJ A;  3EUR A;  3GHA A;  4E8E A;  3C8E A;  5F8B A;  3EWL A;  4I8B A;  2YJ7 A;  2H6X A;  2HXK A;  2MZC A;  3FRC A;  4KSO A;  2LUS A;  4KDY A;  3L9U A;  3EU4 A;  5G5E A;  1QFN A;  2N5F A;  1VF3 A;  4L8E A;  1YEP A;  3ZIV A;  5ID2 B;  4GF0 A;  2H74 A;  3GL5 A;  4HU9 A;  1ERU A;  4ZBB A;  2GVP A;  1N8J A;  2PVO C;  2IL3 A;  3APQ A;  3MNG A;  3GV1 A;  1YKA A;  4K1F A;  1QQ2 A;  3HJO A;  2I3Y A;  4WBR D;  2VL9 A;  4OO4 A;  3A3T A;  2V1M A;  1XWG A;  3CSI A;  1GLQ A;  2B7J A;  3LSZ A;  4WR4 A;  2TRX A;  4NAX A;  1XBS A;  2JL4 A;  3GX8 A;  1NM3 A;  2O89 A;  4K5R A;  4XS4 B;  1PKZ A;  2A4V A;  1XWB A;  4MDC A;  1OYJ A;  4K9Z A;  2PMT A;  5B7C A;  1N2A A;  2L57 A;  2WJU A;  2L5O A;  5ENU A;  2IME A;  1YJ6 A;  2K8V A;  2K8S A;  1Z3E A;  3NZN A;  5LD0 A;  4XCS A;  4I6X A;  1KEB A;  1QUW A;  3KXO A;  2GQM A;  3BOA A;  1SK0 A;  3HY2 A;  5G30 A;  4NXI A;  3D22 A;  4IKH A;  1AAZ A;  1PN0 A;  2VLU A;  4FIW A;  3IC8 A;  3G7Y A;  4MCU A;  4LMW A;  5GAN D;  5HR1 A;  4ICY A;  1SK2 A;  1ST9 A;  4LA1 A;  3HDC A;  3HD5 A;  1YEX A;  3TUE A;  4H86 A;  3ED3 A;  3WGX A;  2F51 A;  2RII A;  3LXT A;  1S3C A;  5KOX A;  2ALB A;  4F03 A;  3L0H A;  7GSS A;  4KCA A;  2B3S A;  1FVJ A;  2H71 A;  4V2N A;  1UC7 A;  1U88 A;  2DMM A;  2C3Q A;  4O7H A;  1WRY A;  5JWO B;  4J56 E;  4K0N A;  2DIY A;  3QMX A;  4K7I A;  5IO0 A;  3P90 A;  2B5Y A;  4TXV A;  6GSU A;  1VF1 A;  1GSS A;  2VCW A;  4HQZ A;  5KN0 A;  4LMV A;  2A2R A;  3RPN A;  1EV9 A;  4ISD A;  3TKS E;  5DQS A;  1OC9 A;  3LWA A;  1T4Y A;  4JZQ A;  3EIN A;  4BL7 B;  5BRT A;  4PQH A;  2VLT A;  3LEF A;  1S3R A;  3FYG A;  4EF0 A;  1XOA A;  4K2D A;  2FGX A;  5FT3 A;  2HFD A;  2HRA A;  1YKC A;  4JED A;  1MDJ A;  2VL3 A;  5IMV A;  1W4V A;  3KIJ A;  4K0G A;  4GCI A;  1B4P A;  5GZZ B;  4G0K A;  4HJM A;  1B8X A;  2A2S A;  1YF0 A;  1I5G A;  2GZZ A;  2VCT A;  3US3 A;  1MDI A;  4K6X A;  2C3T A;  3ZLP A;  3W8J A;  5DVB A;  3W8S A;  1U87 A;  5B6N A;  4N10 A;  3DVW A;  2H0G A;  3I69 A;  3ZTL A;  1Z7R A;  5L71 A;  5E59 A;  4EL1 A;  2C4J A;  2FA8 A;  4P3Y B;  2G2Q A;  5D73 A;  1SL0 B;  1WOU A;  3I6A A;  1M3J A;  2FWH A;  3QCP A;  2KHP A;  1A0R P;  4I5Q A;  1FVK A;  4LL4 B;  3UMA A;  2F8F A;  1LU4 A;  2KP1 A;  5G1L A;  1WMJ A;  4AJ8 A;  3LGC A;  3ME7 A;  4IS0 A;  5G31 A;  3DWV A;  1V57 A;  4IW9 A;  1F9M A;  4RI7 A;  5B8A A;  4PUR A;  2VM1 A;  2IWT A;  3O6T A;  1X5C A;  2KOK A;  2R6K A;  3H79 A;  3KH9 A;  5ID2 A;  3APS A;  5JCU A;  3F63 A;  4QL9 A;  2QGV A;  4TR1 A;  2P5R A;  5CRD A;  4IN0 A;  2RUF A;  2X4A A;  4WR5 A;  3IBH A;  2DIZ A;  2N5B A;  4O32 A;  2CQ9 A;  1KTE A;  6GSX A;  2R2J A;  1JZD A;  2IPA A;  2A4H A;  4K5S A;  1O73 A;  2YWI A;  4WF5 A;  3IAM 2;  2YNX A;  1SD9 A;  5F05 A;  3HXS A;  1M99 A;  4OO5 A;  3DD3 A;  2CX3 A;  1YDK A;  4TR3 A;  4XS4 A;  1ZYQ B;  1E6B A;  2HT9 A;  3L4N A;  2AV4 A;  2ZUP A;  2YJH A;  1F3A A;  5CAX A;  1JLV A;  1F3B A;  2VD0 A;  2BMX A;  1K0C A;  5EY6 A;  4ZB9 A;  4G9H A;  4MPG A;  4ML6 A;  1FOV A;  3FW2 A;  2XBI A;  5ELG A;  5F06 A;  3GH9 A;  1S3D A;  1GUM A;  2RM5 A;  2I9H A;  4CW9 A;  4NPB A;  3DYR A;  1DBY A;  3UJ1 A;  4IJI A;  3GFK A;  4YAV A;  1Z7P A;  3A2W A;  2YPM A;  4GLT A;  2DKI A;  5JCW A;  3L9V A;  1ZL9 A;  2VL2 A;  4MZW A;  1AW9 A;  5D9V A;  5D8I A;  1OC3 A;  3KP8 A;  1KNG A;  4TXO B;  1YQ1 A;  3KJY A;  4JR6 A;  2VD1 A;  17GS A;  5ELA A;  5IPH A;  4KCE A;  1GNW A;  4ZIJ A;  5DDL A;  2FCH A;  5CNW A;  4BWS A;  4HU7 A;  3QAV A;  4OFN A;  2IN3 A;  1DUG A;  2YV9 A;  1USB A;  1ABA A;  5HFK A;  4K2X A;  3MYD A;  3GUS A;  3KCM A;  2GQK A;  2R3X A;  3GL3 A;  4XHM A;  3LXZ A;  1TU7 A;  2PVQ A;  3VWW A;  3WYW A;  5DJL A;  4GQC A;  2ES7 A;  2LNS A;  2H6Z A;  2XBQ A;  4Q5R A;  1ON4 A;  4IJ3 A;  2X64 A;  5HR3 A;  1JZW A;  3TRQ A;  1K3L A;  5FHI A;  3MSZ A;  2AB6 A;  5J9C A;  2OJL A;  3ZFL A;  2HZE B;  3TKR A;  4WBJ A;  2DJJ A;  4MJC A;  4BL7 A;  3TJK A;  4Z2U A;  2PER A;  4WXT A;  2J9H A;  3VWU A;  4GRF A;  3TRX A;  1GUH A;  1RW1 A;  2FWG A;  1NW2 A;  3EE2 A;  1TTZ A;  3K8N A;  4MH2 A;  2VOC A;  3QAW A;  3GYK A;  1K0M A;  2IMK A;  2M80 A;  2A2P A;  4TW5 A;  3HZ8 A;  2H8L A;  4ECC A;  2FA4 A;  3DGQ A;  3QD9 A;  5AGY A;  4J57 E;  6GSY A;  4MPF A;  1GSF A;  1SKR B;  1O6J A;  1UN2 A;  1XFL A;  2UZ8 A;  1K3O A;  4KW6 A;  1O81 A;  3KGK A;  3KMO A;  1HNC A;  2C0D A;  3ME8 A;  5CRW A;  2GZY A;  2DJ2 A;  5G5F A;  3TJF A;  3FKF A;  2CT6 A;  2GS3 A;  2OE1 A;  2O87 A;  4N11 A;  1AQX A;  5H5S A;  4FO5 A;  2MMO A;  4IP6 A;  4K7N A;  5DJM A;  3J7Y b;  3FR9 A;  1G7E A;  1OC9 B;  5J5N A;  3KP9 A;  1JFU A;  3I43 A;  2HRF A;  1M7T A;  3DVX A;  3CMI A;  5IMD A;  1O85 A;  4NMU A;  2H1D A;  2HRN A;  2F9S A;  1BX9 A;  4WET A;  2QC7 A;  3S9F A;  2KP2 A;  3APO A;  1K3Y A;  3VPT A;  4G10 A;  2H30 A;  1A8Y A;  5FWG A;  2JSZ A;  2RLI A;  2H1G A;  4MH3 A;  3KMN A;  2YOI A;  3EC3 A;  3U5R E;  2DKH A;  4ECI A;  2LRC A;  4DSR A;  4EO3 A;  2R5G A;  1DE2 A;  3LQ7 A;  3VI5 A;  2C3N A;  1BYE A;  2QKE A;  1MD3 A;  4X43 A;  3IAS 2;  2LQQ A;  2VCZ A;  3VWV A;  4JBB A;  3GKX A;  4Z2T A;  4V1A g;  4YKF A;  4F0C A;  3HHV A;  4CY6 A;  4L0W A;  2Z9S A;  1EZK A;  3Q74 A;  4ZBD A;  16GS A;  1NHY A;  2WDU A;  5EVO A;  1AUC A;  3IK9 A;  5CYY A;  4OWY A;  3BCK A;  2GZP A;  1WWJ A;  1OVN A;  4TR1 B;  5GSS A;  2H73 A;  5EL8 A;  3P2A A;  1T8E B;  1SKW B;  4ZB8 A;  5F07 A;  2GSS A;  2BTO T;  2RUE A;  4TXO A;  3P8W A;  4Q5F A;  1EV4 A;  3DEX A;  3GRX A;  1FB0 A;  3L78 A;  2NPB A;  2CX4 A;  5BMU A;  1SJZ A;  4N0Z A;  4WEY A;  4YKG A;  2MMN A;  2PGT A;  4POL A;  3IA1 A;  4EDY A;  1Y25 A;  1HNB A;  2YWM A;  4ACS A;  1K0D A;  2RM6 A;  2K6V A;  5INY A;  1U3I A;  3A5W A;  4HS1 A;  4AF2 A;  2B1L A;  2LJR A;  3UAP A;  1S3A A;  2IFQ B;  1GSQ A;  2C0F A;  3M3M A;  4HUA A;  5A4U A;  3G7J A;  1YY7 A;  2HZE A;  1PX6 A;  2LEG A;  3GMF A;  2WS2 A;  1LBK A;  2DJ3 A;  2VIM A;  3C71 A;  4X4J A;  4I2T A;  4L5L A;  3HVS A;  3UIW A;  3UOM A;  3RHC A;  3FY7 A;  3IRA A;  1EWX A;  1TOF A;  1TP9 A;  1ZYN A;  3FZ9 A;  1J9B A;  5ECH B;  1GSD A;  4ZBA A;  1WE0 A;  4HI7 A;  1V40 A;  4Z2R A;  2R4V A;  3TDG A;  3VK9 A;  3JCM L;  4AGS A;  1EOG A;  2JAC A;  1R5P A;  4MMM A;  3TKQ A;  2PU9 C;  5EPF A;  1PN9 A;  3KTB A;  4ECB A;  1PD2 1;  4IEL A;  3UL3 A;  5ECR B;  4PTS A;  2LV3 A;  4NHZ A;  3RPP A;  4YQM A;  3PGT A;  2C0E A;  3ERF A;  1PFO A;  1XG8 A;  5DCG A;  1PX7 A;  3KD0 A;  2O8V B;  3HKR A;  3IK7 A;  3N9J A;  3QFB C;  3TKP A;  2B1K A;  1J0F A;  2DJ0 A;  3CBU A;  3ERW A;  2IMF A;  2JZT A;  2HZF A;  3GN3 A;  20GS A;  3RHB A;  4G19 A;  2MMZ A;  3KEB A;  3WGD A;  2PN8 A;  4A5P A;  1GH2 A;  1GP1 A;  4NV5 A;  4WKW A;  3F6D A;  3GX0 A;  1XZO A;  3QDN A;  2GT6 A;  1GUK A;  2H19 A;  3UBL A;  1TK0 B;  1FW1 A;  2FY6 A;  4JE1 A;  2WB9 A;  3H4K A;  4KF9 A;  2VO4 A;  1T1V A;  2HSH A;  3A2V A;  2B6M A;  1X0R A;  2H1A A;  3FHK A;  6GST A;  2LTK A;  3M0F A;  2OE3 A;  1MD4 A;  4LLR A;  1TRV A;  1FAA A;  1VF4 A;  4OCE A;  3V1W A;  2H1B A;  1A23 A;  5JCG A;  3EMP A;  3HZ4 A;  1SJI A;  1OE7 A;  1EEM A;  1ZMA A;  1KBN A;  3GNJ A;  2AHE A;  1VGL A;  4BVY B;  1XPV A;  1X9S B;  3IR4 A;  1V9W A;  4BVX A;  2FWF A;  2YN1 A;  1GNE A;  2QSI A;  3EYT A;  2L4Q A;  3LYK A;  4G0I A;  2V6K A;  4IVF A;  1X9W B;  1FO5 A;  3TOT A;  1OKT A;  1U6T A;  5IPG A;  2CZ3 A;  3D21 A;  4NV2 A;  1OC8 A;  3R2Q A;  2OKA A;  4EXJ A;  4KX4 A;  1ZYP A;  4NHW A;  1E2Y A;  4MZC A;  5HR2 A;  5C04 A;  1ZZY A;  4XS1 A;  1A2J A;  4MA9 A;  1AC1 A;  3UEM A;  3E9J B;  3VUR A;  4RI6 A;  4IQA A;  1K0B A;  5D93 A;  4EVM A;  2YWN A;  5CRH A;  5IO2 A;  3IHQ A;  3HJM A;  2IFQ A;  4ZIL A;  5HFG A;  6GSV A;  2F8A A;  2GSQ A;  4PUF C;  3KZQ A;  2JZR A;  4O5U A;  3F4S A;  5IM9 A;  1YF1 A;  4ML1 A;  12GS A;  3IE3 A;  3ZIT A;  3M1G A;  2V41 A;  5E4W A;  2NTO A;  2GSR A;  2CZ2 A;  4RUV A;  3CYN A;  5ECP B;  1V58 A;  2VCV A;  5JWR B;  3UVT A;  1TI1 A;  5KOW A;  4OFM A;  4F82 A;  3VFI A;  1B9Y C;  3LW9 A;  4MF5 A;  2BJX A;  4MNN A;  4OCF A;  4TR4 A;  3BCI A;  4FYC A;  1Z5Y E;  2EIQ A;  3P7X A;  19GS A;  5AIV A;  2WUL A;  3HVX A;  1PL2 A;  1AQV A;  1TJD A;  3E0U A;  1U3A A;  5AIS A;  4MLY A;  5IOW A;  4JU5 A;  3W6G A;  1G6W A;  3BBY A;  4OD7 A;  22GS A;  2HYX A;  1WJK A;  4PX1 A;  3BD2 A;  3WT1 A;  2R37 A;  5ECM B;  3QOU A;  4KND A;  2B5E A;  5KN1 A;  2F3M A;  5CRE A;  4PGT A;  3VWX A;  3H1N A;  2CVB A;  3LG6 A;  3A2X A;  1BG5 A;  18GS A;  10GS A;  3HVN A;  3CRT A;  4XS6 A;  2M72 A;  5IMC A;  4PQ1 A;  3ZRD A;  2VM2 A;  4EUY A;  3TKS C;  4IQ1 A;  1A8L A;  1SL2 B;  2AJQ B;  4O92 A;  5A4W A;  1BJX A;  2C80 A;  2WGR A;  2IMI A;  4OMV A;  5IIZ A;  1SD8 A;  2OAC A;  3RDW A;  2NBS A;  1A0F A;  2FHE A;  2HSY A;  2REM A;  1DE1 A;  1O8X A;  1M9B A;  1A2M A;  5COH A;  2XPE A;  3WGE A;  4YAP A;  2L6D A;  4TOP A;  3VPQ A;  4HZ4 A;  5DAL B;  4IP1 A;  3WT2 A;  2WCI A;  5A5K A;  5AIX A;  1A2L A;  3FK8 A;  1PA3 A;  4BVY A;  3Q19 A;  3EU3 A;  4ZL7 A;  5A4V A;  1HD2 A;  2FLS A;  1M2D A;  1WPI A;  1FG4 A;  1B48 A;  1XW6 A;  1EP7 A;  1THX A;  4YQV A;  1THO A;  5ABR A;  1XW5 A;  4X0X A;  1B9X C;  3IHG A;  3C1R A;  1J08 A;  2I81 A;  3GSS A;  4CHS A;  5HQP A;  4DVC A;  1ZYE A;  2X8H A;  2GT5 A;  3TGZ A;  3A5I A;  4IGJ A;  4MJA A;  5IMZ A;  5H5R A;  4FQU A;  4KSM A;  2E0Q A;  4BA7 A;  5ECN B;  4BPY A;  1GTB A;  4MF6 A;  5G1K A;  4KDX A;  3FR6 A;  1GLP A;  4YQU A;  3KTL A;  3ZVJ D;  1ML6 A;  2O7K A;  3D6I A;  2LNT A;  5DAK A;  4I2U A;  2LST A;  4PNF A;  5CP1 A;  4HOJ A;  3J7Y k;  3U6V A;  2WFC A;  2L59 A;  1AXD A;  1PRX A;  2MYG A;  1JZO A;  3RBT A;  3ZMK A;  4GST A;  3ZFB A;  2H6Y A;  1M2A A;  3M8N A;  2C8U A;  4OFT A;  3FEU A;  2YZU A;  4ILF A;  5G2Z A;  3ZML A;  1K0N A;  2HI7 A;  3HJP A;  4Q5Q A;  1O7U A;  2DBC A;  3SWL A;  4BVX B;  1NSW A;  2YP6 A;  2VCQ A;  2PWJ A;  5J9B A;  3RAZ A;  2FD3 A;  2R0P A;  1T3B A;  1V98 A;  2DSA A;  3MIX A;  3ISO A;  4PUA A;  1GSY A;  4D73 A;  3PR8 A;  1V2A A;  3EVI A;  2DC5 A;  2C1Y A;  2YAN A;  3G9B A;  5DBQ A;  4IHU A;  1BED A;  1SK1 A;  3IDV A;  1XWC A;  1PQN A;  2K18 A;  3BJ5 A;  2E2M A;  4LL1 B;  4E8H A;  1FHE A;  1GTU A;  4KH7 A;  5KEJ A;  4MJE A;  2HE3 A;  4XTS A;  3ZIJ A;  3Q6O A;  1TRU A;  4YH2 A;  5J41 A;  3ZRE A;  1ERV A;  3FZA A;  2CA8 A;  2JU5 A;  1K0A A;  4HSC X;  2DLX A;  2P0G A;  4ZL8 A;  4KB3 A;  4Z7X A;  4XRA A;  3DIE A;  4DEJ A;  3ZVJ A;  1LJR A;  2TIR A;  3DRN A;  14GS A;  3KM6 A;  1AIU A;  2L6C A;  2ZNM A;  3Q18 A;  4O5Q A;  2AYT A;  2LRT A;  1PL1 A;  4GSN A;  5CRG A;  1SU9 A;  2OBK A;  5GST A;  2P5Q A;  3D4M A;  2GQL A;  2H70 A;  2VLV A;  4PNG A;  2GLR A;  2JSY A;  2OAD A;  3R3E A;  3HYP A;  1JLW A;  1TXX A;  5DQY A;  1PKW A;  1XVW A;  1GSU A;  1OE8 A;  2WRT A;  1Q4J A;  4HJ2 A;  4ZXG A;  1WIK A;  3F0I A;  4MJB A;  2YZH A;  3IC4 A;  2YV7 A;  3EPT A;  1MDK A;  1T7P B;  4MK3 A;  5J3R A;  5J4U A;  5B6M A;  1ZOF A;  1R4W A;  5KN2 A;  5H5Q A;  3GKK A;  2JAD A;  2O85 A;  3F9U A;  3C7M A;  3F4T A;  3KH7 A;  5DAL A;  5LNK e;  4HZ2 A;  1ZCP A;  2CVD A;  1O8W A;  2PPT A;  2EIO A;  3MAK A;  3L9S A;  2V6O A;  3QR6 A;  4DSS B;  2JZS A;  3IV4 A;  1XXU A;  2GDR A;  1Y6E A;  5D9W A;  1G0T A;  2X8G A;  2HLS A;  1AQW A;  3CRU A;  2VAF A;  4KGI A;  2GGT A;  3F3R A;  1TDI A;  3CSH A;  1H75 A;  3C73 A;  3QPM A;  1A24 A;  1CQH A;  1SKS B;  3TJG A;  3PPU A;  4N30 A;  4EKZ A;  1URM A;  2QA2 A;  5DCH A;  1PSQ A;  9GSS A;  3DML A;  4MAB A;  3IOS A;  5ECK B;  2WZ9 A;  1PGT A;  2E2G A;  4F9Z A;  4EDZ A;  4J2F A;  4KE3 A;  2B5X A;  2H0I A;  3GTU B;  3WD6 A;  1UVZ A;  1QK8 A;  4USS A;  4V2L A;  4F0B A;  4POK A;  3TRP A;  1ILO A;  3O76 A;  1HNA A;  2TRC P;  5LCZ A;  2LKU A;  4QQ7 A;  3QAG A;  3LOR A;  2H66 A;  1F37 A;  4MZB A;  3O3T A;  1GWC A;  3FMW A;  2H72 A;  4BIK A;  3GUR A;  1F6M C;  1F2E A;  5ECS A;  1SL1 B;  2IJY A;  5D9T A;  3UVH A;  2EIR A;  4POB A;  4PQI A;  5AN1 A;  2I4A A;  1QMV A;  1FOH A;  3TJJ A;  2XC2 A;  3HVV A;  4XRD A;  4FYU A;  2NDO A;  1QGV A;  2XPD A;  5ECI B;  1XWA A;  3GH6 A;  1EGR A;  3VLN A;  1TKD B;  2IMD A;  1X5D A;  1UA5 A;  4GSS A;  1VF2 A;  3DXB A;  2PBJ A;  1GUL A;  1R7H A;  4ULX A;  2YCD A;  2H76 A;  2ON7 A;  3F3Q A;  4G0L A;  2DML A;  1VRS D;  1EOH A;  2LS5 A;  2K9F A;  2J23 A;  4GTU A;  4JR4 A;  6GSS A;  2X49 A;  3ERG A;  2G0F A;  1RQM A;  2HRK A;  1IYH A;  6GSW A;  4XIH A;  5DAK B;  1I9D A;  3E3E A;  1NHO A;  2QA1 A;  3SBC A;  2M46 A;  2AAW A;  1T4Z A;  3M9J A;  3HCZ A;  11GS A;  1X9M B;  2GST A;  3TOU A;  1XWK A;  1M9A A;  3IPZ A;  3ZL5 A;  4MP4 A;  1EGO A;  3D0Z A;  3F4R A;  1TK8 B;  2MMA A;  4N0V A;  3H8Q A;  2CAQ A;  1B4Q A;  1TW9 A;  5GAP D;  5KN3 A;  2HSM A;  1TU8 A;  4TVE A;  4V2M A;  2NVL A;  3HA9 A;  1YZX A;  3TKS A;  1TK5 B;  1M3I A;  4ZL9 A;  2VCX A;  3F6F A;  1QXH A;  2D2Z A; 
#chains in the Genus database with same CATH homology
 5JWQ B;  1R5A A;  2YWO A;  4D73 B;  3LJR A;  1DSB A;  3UAR A;  4FH8 A;  2VUP A;  4JRR A;  4IBP A;  5D9X A;  4WF4 A;  1FB6 A;  2DJ1 A;  4RQR A;  1SJ6 A;  2V2G A;  3N5O A;  4KDU A;  1M0U A;  1R26 A;  2MBS A;  4K7O A;  3EMX A;  4DSQ A;  3GA4 A;  4X1U A;  4KAE A;  2P31 A;  2V32 A;  1ACV A;  4TN8 A;  3TJB A;  2LJA A;  2H75 A;  1HYU A;  2OBI A;  3FZ5 A;  4KA0 A;  1GTI A;  1PMT A;  3CXG A;  3I9V 2;  1EP8 A;  3ZYW A;  4EIP A;  4GXZ A;  1ERW A;  2CVK A;  2X8C A;  3M9K A;  2ON5 A;  1G7O A;  4DSS A;  3MDK A;  3GKN A;  2LJK A;  2B7K A;  4HDE A;  1Z9H A;  4EE0 A;  1G6Y A;  1GL8 A;  5IMA A;  3PH9 A;  4TR0 A;  1TI3 A;  1GRX A;  4ID0 A;  4O5R A;  3H93 A;  4K8M A;  3TCO A;  3OR5 A;  3AY8 A;  2LRN A;  5C00 A;  1T00 A;  5F0G A;  2R0C A;  2MBT A;  1Z6M A;  4I97 A;  3C1S A;  5CO3 A;  4L0U A;  3FZ4 A;  2KUC A;  4BWQ A;  3GIX A;  4EC0 A;  4G2E A;  2C0G A;  4HEA 2;  5ECO B;  3G7I A;  3NOF A;  1BAY A;  1TRS A;  3GTU A;  1JZR A;  5IQY A;  2H01 A;  1CQG A;  2R0G A;  4TKY A;  4AJ7 A;  1Z6N A;  1Q98 A;  1XW9 A;  2E7P A;  4POM A;  3IXR A;  1RK4 A;  4ZB6 A;  1XOB A;  1JHB A;  4EIQ A;  2X99 A;  1WP0 A;  4RQX A;  1C72 A;  1BQ7 A;  3CTG A;  2KLX A;  3DKS A;  3NIV A;  2VL2 C;  2H0H A;  1EEJ A;  4NWY A;  4TRX A;  4HQS A;  4CDO A;  3UBK A;  1ERT A;  4F2I A;  1OAZ A;  1GTA A;  1SEN A;  4GWR A;  2AUV A;  5IMF A;  3MWH A;  13GS A;  2FWE A;  3QFA C;  1W89 A;  2CAI A;  1ZGN A;  3F8U A;  3GKM A;  4GQF A;  3LFL A;  3CTF A;  3ZZX A;  1M2B A;  2PUK C;  4V1A p;  1IYI A;  2LQO A;  4KUN A;  1SYX A;  2N5A A;  2ZCT A;  1XIY A;  1H4O A;  4AJ6 A;  2IIY A;  5B8B A;  2L4C A;  2HNL A;  4L5O A;  4FYB A;  3VI7 A;  4MF7 A;  5HFI A;  1XCC A;  4CY8 A;  8GSS A;  3GST A;  2FNO A;  5ECQ B;  2OA7 A;  3PIN A;  3FR3 A;  1GSE A;  1OKD A;  3D4T A;  1TRW A;  2XHF A;  2DJK A;  4ECJ A;  2EC4 A;  2FUG 2;  2OE0 A;  2GTU A;  5HR0 A;  1MEK A;  4QL7 A;  5IOX A;  3LYP A;  1SYR A;  5ECL B;  4PXO A;  4Q5N A;  1XVQ A;  1HQO A;  2L5L A;  1X5E A;  3TB2 A;  5D96 A;  2CV4 A;  1K0O A;  1MTC A;  2I1U A;  3D5J A;  3CSJ A;  3EUR A;  3GHA A;  4E8E A;  3C8E A;  5F8B A;  3EWL A;  4I8B A;  2YJ7 A;  2H6X A;  2HXK A;  2MZC A;  3FRC A;  4KSO A;  2LUS A;  4KDY A;  3L9U A;  3EU4 A;  5G5E A;  1QFN A;  2N5F A;  1VF3 A;  4L8E A;  1YEP A;  3ZIV A;  5ID2 B;  4GF0 A;  2H74 A;  3GL5 A;  4HU9 A;  1ERU A;  4ZBB A;  2GVP A;  1N8J A;  2PVO C;  2IL3 A;  3APQ A;  3MNG A;  3GV1 A;  1YKA A;  4K1F A;  1QQ2 A;  3HJO A;  2I3Y A;  4WBR D;  2VL9 A;  4OO4 A;  3A3T A;  2V1M A;  1XWG A;  3CSI A;  1GLQ A;  2B7J A;  3LSZ A;  4WR4 A;  2TRX A;  4NAX A;  1XBS A;  2JL4 A;  3GX8 A;  1NM3 A;  2O89 A;  4K5R A;  4XS4 B;  1PKZ A;  2A4V A;  1XWB A;  4MDC A;  1OYJ A;  4K9Z A;  2PMT A;  5B7C A;  1N2A A;  2L57 A;  2WJU A;  2L5O A;  5ENU A;  2IME A;  1YJ6 A;  2K8V A;  2K8S A;  1Z3E A;  3NZN A;  5LD0 A;  4XCS A;  4I6X A;  1KEB A;  1QUW A;  3KXO A;  2GQM A;  3BOA A;  1SK0 A;  3HY2 A;  5G30 A;  4NXI A;  3D22 A;  4IKH A;  1AAZ A;  1PN0 A;  2VLU A;  4FIW A;  3IC8 A;  3G7Y A;  4MCU A;  4LMW A;  5GAN D;  5HR1 A;  4ICY A;  1SK2 A;  1ST9 A;  4LA1 A;  3HDC A;  3HD5 A;  1YEX A;  3TUE A;  4H86 A;  3ED3 A;  3WGX A;  2F51 A;  2RII A;  3LXT A;  1S3C A;  5KOX A;  2ALB A;  4F03 A;  3L0H A;  7GSS A;  4KCA A;  2B3S A;  1FVJ A;  2H71 A;  4V2N A;  1UC7 A;  1U88 A;  2DMM A;  2C3Q A;  4O7H A;  1WRY A;  5JWO B;  4J56 E;  4K0N A;  2DIY A;  3QMX A;  4K7I A;  5IO0 A;  3P90 A;  2B5Y A;  4TXV A;  6GSU A;  1VF1 A;  1GSS A;  2VCW A;  4HQZ A;  5KN0 A;  4LMV A;  2A2R A;  3RPN A;  1EV9 A;  4ISD A;  3TKS E;  5DQS A;  1OC9 A;  3LWA A;  1T4Y A;  4JZQ A;  3EIN A;  4BL7 B;  5BRT A;  4PQH A;  2VLT A;  3LEF A;  3FYG A;  4EF0 A;  1XOA A;  4K2D A;  2FGX A;  5FT3 A;  2HFD A;  2HRA A;  1YKC A;  4JED A;  1MDJ A;  2VL3 A;  5IMV A;  1W4V A;  3KIJ A;  4K0G A;  4GCI A;  1B4P A;  5GZZ B;  4G0K A;  4HJM A;  1B8X A;  2A2S A;  1YF0 A;  1I5G A;  2GZZ A;  2VCT A;  3US3 A;  1MDI A;  4K6X A;  2C3T A;  3ZLP A;  3W8J A;  5DVB A;  3W8S A;  1U87 A;  5B6N A;  4N10 A;  3DVW A;  2H0G A;  3I69 A;  3ZTL A;  1Z7R A;  5L71 A;  5E59 A;  4EL1 A;  2C4J A;  2FA8 A;  4P3Y B;  2G2Q A;  5D73 A;  1SL0 B;  1WOU A;  3I6A A;  2FWH A;  3QCP A;  2KHP A;  1A0R P;  4I5Q A;  1FVK A;  4LL4 B;  3UMA A;  2F8F A;  1LU4 A;  2KP1 A;  5G1L A;  1WMJ A;  4AJ8 A;  3LGC A;  3ME7 A;  4IS0 A;  5G31 A;  3DWV A;  1V57 A;  4IW9 A;  1F9M A;  4RI7 A;  5B8A A;  4PUR A;  2VM1 A;  2IWT A;  3O6T A;  1X5C A;  2KOK A;  2R6K A;  3H79 A;  3KH9 A;  5ID2 A;  3APS A;  5JCU A;  3F63 A;  4QL9 A;  2QGV A;  4TR1 A;  2P5R A;  5CRD A;  4IN0 A;  2RUF A;  2X4A A;  4WR5 A;  3IBH A;  2DIZ A;  2N5B A;  4O32 A;  2CQ9 A;  1KTE A;  6GSX A;  2R2J A;  1JZD A;  2IPA A;  2A4H A;  4K5S A;  1O73 A;  2YWI A;  4WF5 A;  3IAM 2;  2YNX A;  1SD9 A;  5F05 A;  3HXS A;  1M99 A;  4OO5 A;  3DD3 A;  2CX3 A;  1YDK A;  4TR3 A;  4XS4 A;  1ZYQ B;  1E6B A;  2HT9 A;  3L4N A;  2AV4 A;  2ZUP A;  2YJH A;  1F3A A;  5CAX A;  1JLV A;  1F3B A;  2VD0 A;  2BMX A;  1K0C A;  5EY6 A;  4ZB9 A;  4G9H A;  4MPG A;  4ML6 A;  1FOV A;  3FW2 A;  2XBI A;  5ELG A;  5F06 A;  3GH9 A;  1S3D A;  1GUM A;  2RM5 A;  2I9H A;  4CW9 A;  4NPB A;  3DYR A;  1DBY A;  3UJ1 A;  4IJI A;  3GFK A;  4YAV A;  1Z7P A;  3A2W A;  2YPM A;  4GLT A;  2DKI A;  5JCW A;  3L9V A;  1ZL9 A;  2VL2 A;  4MZW A;  1AW9 A;  5D9V A;  5D8I A;  1OC3 A;  3KP8 A;  1KNG A;  4TXO B;  1YQ1 A;  3KJY A;  4JR6 A;  2VD1 A;  17GS A;  5ELA A;  5IPH A;  4KCE A;  1GNW A;  4ZIJ A;  5DDL A;  2FCH A;  5CNW A;  4BWS A;  4HU7 A;  3QAV A;  4OFN A;  2IN3 A;  1DUG A;  2YV9 A;  1USB A;  1ABA A;  5HFK A;  4K2X A;  3MYD A;  3GUS A;  3KCM A;  2GQK A;  2R3X A;  3GL3 A;  4XHM A;  3LXZ A;  1TU7 A;  2PVQ A;  3VWW A;  3WYW A;  5DJL A;  4GQC A;  2ES7 A;  2LNS A;  2H6Z A;  2XBQ A;  4Q5R A;  1ON4 A;  4IJ3 A;  2X64 A;  5HR3 A;  1JZW A;  3TRQ A;  1K3L A;  5FHI A;  3MSZ A;  2AB6 A;  5J9C A;  2OJL A;  3ZFL A;  2HZE B;  3TKR A;  4WBJ A;  2DJJ A;  4MJC A;  4BL7 A;  3TJK A;  4Z2U A;  2PER A;  4WXT A;  2J9H A;  3VWU A;  4GRF A;  3TRX A;  1GUH A;  1RW1 A;  2FWG A;  1NW2 A;  3EE2 A;  1TTZ A;  3K8N A;  4MH2 A;  2VOC A;  3QAW A;  3GYK A;  1K0M A;  2IMK A;  2M80 A;  2A2P A;  4TW5 A;  3HZ8 A;  2H8L A;  4ECC A;  2FA4 A;  3DGQ A;  3QD9 A;  5AGY A;  4J57 E;  6GSY A;  4MPF A;  1GSF A;  1SKR B;  1O6J A;  1UN2 A;  1XFL A;  2UZ8 A;  1K3O A;  4KW6 A;  1O81 A;  3KGK A;  3KMO A;  1HNC A;  2C0D A;  3ME8 A;  5CRW A;  2GZY A;  2DJ2 A;  5G5F A;  3TJF A;  3FKF A;  2CT6 A;  2GS3 A;  2OE1 A;  2O87 A;  4N11 A;  1AQX A;  5H5S A;  4FO5 A;  2MMO A;  4IP6 A;  4K7N A;  5DJM A;  3J7Y b;  3FR9 A;  1G7E A;  1OC9 B;  5J5N A;  3KP9 A;  1JFU A;  3I43 A;  2HRF A;  1M7T A;  3DVX A;  3CMI A;  5IMD A;  1O85 A;  4NMU A;  2H1D A;  2HRN A;  2F9S A;  1BX9 A;  4WET A;  2QC7 A;  3S9F A;  2KP2 A;  3APO A;  1K3Y A;  3VPT A;  4G10 A;  2H30 A;  1A8Y A;  5FWG A;  2JSZ A;  2RLI A;  2H1G A;  4MH3 A;  3KMN A;  2YOI A;  3EC3 A;  3U5R E;  2DKH A;  4ECI A;  2LRC A;  4DSR A;  4EO3 A;  2R5G A;  1DE2 A;  3LQ7 A;  3VI5 A;  2C3N A;  1BYE A;  2QKE A;  1MD3 A;  4X43 A;  3IAS 2;  2LQQ A;  2VCZ A;  3VWV A;  4JBB A;  3GKX A;  4Z2T A;  4V1A g;  4YKF A;  4F0C A;  3HHV A;  4CY6 A;  4L0W A;  2Z9S A;  1EZK A;  3Q74 A;  4ZBD A;  16GS A;  1NHY A;  2WDU A;  5EVO A;  1AUC A;  3IK9 A;  5CYY A;  4OWY A;  3BCK A;  2GZP A;  1WWJ A;  1OVN A;  4TR1 B;  5GSS A;  2H73 A;  5EL8 A;  3P2A A;  1T8E B;  1SKW B;  4ZB8 A;  5F07 A;  2GSS A;  2BTO T;  2RUE A;  4TXO A;  3P8W A;  4Q5F A;  1EV4 A;  3DEX A;  3GRX A;  1FB0 A;  3L78 A;  2NPB A;  2CX4 A;  5BMU A;  1SJZ A;  4N0Z A;  4WEY A;  4YKG A;  2MMN A;  2PGT A;  4POL A;  3IA1 A;  4EDY A;  1Y25 A;  1HNB A;  2YWM A;  4ACS A;  1K0D A;  2RM6 A;  2K6V A;  5INY A;  1U3I A;  3A5W A;  4HS1 A;  4AF2 A;  2B1L A;  2LJR A;  3UAP A;  1S3A A;  2IFQ B;  1GSQ A;  2C0F A;  3M3M A;  4HUA A;  5A4U A;  3G7J A;  1YY7 A;  2HZE A;  1PX6 A;  2LEG A;  3GMF A;  2WS2 A;  1LBK A;  2DJ3 A;  2VIM A;  3C71 A;  4X4J A;  4I2T A;  4L5L A;  3HVS A;  3UIW A;  3UOM A;  3RHC A;  3FY7 A;  3IRA A;  1EWX A;  1TOF A;  1TP9 A;  1ZYN A;  3FZ9 A;  1J9B A;  5ECH B;  1GSD A;  4ZBA A;  1WE0 A;  4HI7 A;  1V40 A;  4Z2R A;  2R4V A;  3TDG A;  3VK9 A;  3JCM L;  4AGS A;  1EOG A;  2JAC A;  1R5P A;  4MMM A;  3TKQ A;  2PU9 C;  5EPF A;  1PN9 A;  3KTB A;  4ECB A;  1PD2 1;  4IEL A;  3UL3 A;  5ECR B;  4PTS A;  2LV3 A;  4NHZ A;  3RPP A;  4YQM A;  3PGT A;  2C0E A;  3ERF A;  5DCG A;  1PX7 A;  3KD0 A;  2O8V B;  3HKR A;  3IK7 A;  3N9J A;  3QFB C;  3TKP A;  2B1K A;  1J0F A;  2DJ0 A;  3CBU A;  3ERW A;  2IMF A;  2JZT A;  2HZF A;  3GN3 A;  20GS A;  3RHB A;  4G19 A;  2MMZ A;  3KEB A;  3WGD A;  2PN8 A;  4A5P A;  1GH2 A;  1GP1 A;  4NV5 A;  4WKW A;  3F6D A;  3GX0 A;  1XZO A;  3QDN A;  2GT6 A;  1GUK A;  2H19 A;  3UBL A;  1TK0 B;  1FW1 A;  2FY6 A;  4JE1 A;  2WB9 A;  3H4K A;  4KF9 A;  2VO4 A;  1T1V A;  2HSH A;  3A2V A;  2B6M A;  1X0R A;  2H1A A;  3FHK A;  6GST A;  2LTK A;  3M0F A;  2OE3 A;  1MD4 A;  4LLR A;  1TRV A;  1FAA A;  1VF4 A;  4OCE A;  3V1W A;  2H1B A;  1A23 A;  5JCG A;  3EMP A;  3HZ4 A;  1SJI A;  1OE7 A;  1EEM A;  1ZMA A;  1KBN A;  3GNJ A;  2AHE A;  1VGL A;  4BVY B;  1XPV A;  1X9S B;  3IR4 A;  1V9W A;  4BVX A;  2FWF A;  2YN1 A;  1GNE A;  2QSI A;  3EYT A;  2L4Q A;  3LYK A;  4G0I A;  2V6K A;  4IVF A;  1X9W B;  1FO5 A;  3TOT A;  1OKT A;  1U6T A;  5IPG A;  2CZ3 A;  3D21 A;  4NV2 A;  1OC8 A;  3R2Q A;  2OKA A;  4EXJ A;  4KX4 A;  1ZYP A;  4NHW A;  1E2Y A;  4MZC A;  5HR2 A;  5C04 A;  1ZZY A;  4XS1 A;  1A2J A;  4MA9 A;  1AC1 A;  3UEM A;  3E9J B;  3VUR A;  4RI6 A;  4IQA A;  1K0B A;  5D93 A;  4EVM A;  2YWN A;  5CRH A;  5IO2 A;  3IHQ A;  3HJM A;  2IFQ A;  4ZIL A;  5HFG A;  6GSV A;  2F8A A;  2GSQ A;  4PUF C;  3KZQ A;  2JZR A;  4O5U A;  3F4S A;  5IM9 A;  1YF1 A;  4ML1 A;  12GS A;  3IE3 A;  3ZIT A;  3M1G A;  2V41 A;  5E4W A;  2NTO A;  2GSR A;  2CZ2 A;  4RUV A;  3CYN A;  5ECP B;  1V58 A;  2VCV A;  5JWR B;  3UVT A;  1TI1 A;  5KOW A;  4OFM A;  4F82 A;  3VFI A;  1B9Y C;  3LW9 A;  4MF5 A;  2BJX A;  4MNN A;  4OCF A;  4TR4 A;  3BCI A;  4FYC A;  1Z5Y E;  2EIQ A;  3P7X A;  19GS A;  5AIV A;  2WUL A;  3HVX A;  1PL2 A;  1AQV A;  1TJD A;  3E0U A;  1U3A A;  5AIS A;  4MLY A;  5IOW A;  4JU5 A;  3W6G A;  1G6W A;  3BBY A;  4OD7 A;  22GS A;  2HYX A;  1WJK A;  4PX1 A;  3BD2 A;  3WT1 A;  2R37 A;  5ECM B;  3QOU A;  4KND A;  2B5E A;  5KN1 A;  2F3M A;  5CRE A;  4PGT A;  3VWX A;  3H1N A;  2CVB A;  3LG6 A;  3A2X A;  1BG5 A;  18GS A;  10GS A;  3CRT A;  4XS6 A;  2M72 A;  5IMC A;  4PQ1 A;  3ZRD A;  2VM2 A;  4EUY A;  3TKS C;  4IQ1 A;  1A8L A;  1SL2 B;  2AJQ B;  4O92 A;  5A4W A;  1BJX A;  2C80 A;  2WGR A;  2IMI A;  4OMV A;  5IIZ A;  1SD8 A;  2OAC A;  3RDW A;  2NBS A;  1A0F A;  2FHE A;  2HSY A;  2REM A;  1DE1 A;  1O8X A;  1M9B A;  1A2M A;  5COH A;  2XPE A;  3WGE A;  4YAP A;  2L6D A;  4TOP A;  3VPQ A;  4HZ4 A;  5DAL B;  4IP1 A;  3WT2 A;  2WCI A;  5A5K A;  5AIX A;  1A2L A;  3FK8 A;  1PA3 A;  4BVY A;  3Q19 A;  3EU3 A;  4ZL7 A;  5A4V A;  1HD2 A;  2FLS A;  1M2D A;  1WPI A;  1FG4 A;  1B48 A;  1XW6 A;  1EP7 A;  1THX A;  4YQV A;  1THO A;  5ABR A;  1XW5 A;  4X0X A;  1B9X C;  3IHG A;  3C1R A;  1J08 A;  2I81 A;  3GSS A;  4CHS A;  5HQP A;  4DVC A;  1ZYE A;  2X8H A;  2GT5 A;  3TGZ A;  3A5I A;  4IGJ A;  4MJA A;  5IMZ A;  5H5R A;  4FQU A;  4KSM A;  2E0Q A;  4BA7 A;  5ECN B;  4BPY A;  1GTB A;  4MF6 A;  5G1K A;  4KDX A;  3FR6 A;  1GLP A;  4YQU A;  3KTL A;  3ZVJ D;  1ML6 A;  2O7K A;  3D6I A;  2LNT A;  5DAK A;  4I2U A;  2LST A;  4PNF A;  5CP1 A;  4HOJ A;  3J7Y k;  3U6V A;  2WFC A;  2L59 A;  1AXD A;  1PRX A;  2MYG A;  1JZO A;  3RBT A;  3ZMK A;  4GST A;  3ZFB A;  2H6Y A;  1M2A A;  3M8N A;  2C8U A;  4OFT A;  3FEU A;  2YZU A;  4ILF A;  5G2Z A;  3ZML A;  1K0N A;  2HI7 A;  3HJP A;  4Q5Q A;  1O7U A;  2DBC A;  3SWL A;  4BVX B;  1NSW A;  2YP6 A;  2VCQ A;  2PWJ A;  5J9B A;  3RAZ A;  2FD3 A;  2R0P A;  1T3B A;  1V98 A;  2DSA A;  3MIX A;  3ISO A;  4PUA A;  1GSY A;  4D73 A;  3PR8 A;  1V2A A;  3EVI A;  2DC5 A;  2C1Y A;  2YAN A;  3G9B A;  5DBQ A;  4IHU A;  1BED A;  1SK1 A;  3IDV A;  1XWC A;  1PQN A;  2K18 A;  3BJ5 A;  2E2M A;  4LL1 B;  4E8H A;  1FHE A;  1GTU A;  4KH7 A;  5KEJ A;  4MJE A;  2HE3 A;  4XTS A;  3ZIJ A;  3Q6O A;  1TRU A;  4YH2 A;  5J41 A;  3ZRE A;  1ERV A;  3FZA A;  2CA8 A;  2JU5 A;  1K0A A;  2DLX A;  2P0G A;  4ZL8 A;  4KB3 A;  4Z7X A;  4XRA A;  3DIE A;  4DEJ A;  3ZVJ A;  1LJR A;  2TIR A;  3DRN A;  14GS A;  3KM6 A;  1AIU A;  2L6C A;  2ZNM A;  3Q18 A;  4O5Q A;  2AYT A;  2LRT A;  1PL1 A;  4GSN A;  5CRG A;  1SU9 A;  2OBK A;  5GST A;  2P5Q A;  3D4M A;  2GQL A;  2H70 A;  2VLV A;  4PNG A;  2GLR A;  2JSY A;  2OAD A;  3R3E A;  3HYP A;  1JLW A;  1TXX A;  5DQY A;  1PKW A;  1XVW A;  1GSU A;  1OE8 A;  2WRT A;  1Q4J A;  4HJ2 A;  4ZXG A;  1WIK A;  3F0I A;  4MJB A;  2YZH A;  3IC4 A;  2YV7 A;  3EPT A;  1MDK A;  1T7P B;  4MK3 A;  5J3R A;  5J4U A;  5B6M A;  1ZOF A;  1R4W A;  5KN2 A;  5H5Q A;  3GKK A;  2JAD A;  2O85 A;  3F9U A;  3C7M A;  3F4T A;  3KH7 A;  5DAL A;  5LNK e;  4HZ2 A;  1ZCP A;  2CVD A;  1O8W A;  2PPT A;  2EIO A;  3MAK A;  3L9S A;  2V6O A;  3QR6 A;  4DSS B;  2JZS A;  3IV4 A;  1XXU A;  2GDR A;  1Y6E A;  5D9W A;  1G0T A;  2X8G A;  2HLS A;  1AQW A;  3CRU A;  2VAF A;  4KGI A;  2GGT A;  3F3R A;  1TDI A;  3CSH A;  1H75 A;  3C73 A;  3QPM A;  1A24 A;  1CQH A;  1SKS B;  3TJG A;  3PPU A;  4N30 A;  4EKZ A;  1URM A;  2QA2 A;  5DCH A;  1PSQ A;  9GSS A;  3DML A;  4MAB A;  3IOS A;  5ECK B;  2WZ9 A;  1PGT A;  2E2G A;  4F9Z A;  4EDZ A;  4J2F A;  4KE3 A;  2B5X A;  2H0I A;  3GTU B;  3WD6 A;  1UVZ A;  1QK8 A;  4USS A;  4V2L A;  4F0B A;  4POK A;  3TRP A;  1ILO A;  3O76 A;  1HNA A;  2TRC P;  5LCZ A;  2LKU A;  4QQ7 A;  3QAG A;  3LOR A;  2H66 A;  1F37 A;  4MZB A;  3O3T A;  1GWC A;  3FMW A;  2H72 A;  3GUR A;  1F6M C;  1F2E A;  5ECS A;  1SL1 B;  2IJY A;  5D9T A;  3UVH A;  2EIR A;  4POB A;  4PQI A;  5AN1 A;  2I4A A;  1QMV A;  1FOH A;  3TJJ A;  2XC2 A;  3HVV A;  4XRD A;  4FYU A;  2NDO A;  1QGV A;  2XPD A;  5ECI B;  1XWA A;  3GH6 A;  1EGR A;  3VLN A;  1TKD B;  2IMD A;  1X5D A;  1UA5 A;  4GSS A;  1VF2 A;  3DXB A;  2PBJ A;  1GUL A;  1R7H A;  4ULX A;  2YCD A;  2H76 A;  2ON7 A;  3F3Q A;  4G0L A;  2DML A;  1VRS D;  1EOH A;  2LS5 A;  2K9F A;  2J23 A;  4GTU A;  4JR4 A;  6GSS A;  2X49 A;  3ERG A;  2G0F A;  1RQM A;  2HRK A;  1IYH A;  6GSW A;  4XIH A;  5DAK B;  1I9D A;  3E3E A;  1NHO A;  2QA1 A;  3SBC A;  2M46 A;  2AAW A;  1T4Z A;  3M9J A;  3HCZ A;  11GS A;  1X9M B;  2GST A;  3TOU A;  1XWK A;  1M9A A;  3IPZ A;  3ZL5 A;  4MP4 A;  1EGO A;  3D0Z A;  3F4R A;  1TK8 B;  2MMA A;  4N0V A;  3H8Q A;  2CAQ A;  1B4Q A;  1TW9 A;  5GAP D;  5KN3 A;  2HSM A;  1TU8 A;  4TVE A;  4V2M A;  2NVL A;  3HA9 A;  1YZX A;  3TKS A;  1TK5 B;  4ZL9 A;  2VCX A;  3F6F A;  1QXH A;  2D2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...