1TRWA

The high-resolution three-dimensional solution structures of the oxidized and reduced states of human thioredoxin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
105
structure length
105
Chain Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDAQDVASEAEVKATPTFQFFKKGQKVGEFSGANKEKLEATINELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords THIOREDOXIN
publication title The high-resolution three-dimensional solution structures of the oxidized and reduced states of human thioredoxin.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1994-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1trwA00
4TXVA 1WMJA 3IV4A 1TKDB 5DALA 3P2AA 3C73A 5D9VA 1T1VA 2JSYA 5B6MA 1K0CA 1SK0A 1DSBA 1DUGA 1ZYEA 3E0UA 4LL4B 3FYGA 5F07A 3LORA 7GSSA 4E8EA 1R4WA 5D96A 5ECOB 2CVKA 4GRFA 4MK3A 3TJBA 3GIXA 3LGCA 4NHZA 4CHSA 4PX1A 3ZZXA 2WS2A 1WP0A 4TW5A 1OVNA 3RAZA 1VF3A 5IOXA 14GSA 2JACA 2M46A 1ILOA 2LKUA 5LD0A 1OYJA 1JZDA 3HVVA 5J5NA 1RW1A 4GQCA 4ZILA 4K0GA 4ML6A 4WKWA 2YWIA 2CVBA 4K7IA 1FG4A 2LQOA 3QCPA 2M80A 4KAEA 3CRUA 1HNBA 1GNEA 2FNOA 1GSQA 4RQXA 4HDEA 5IO2A 3N5OA 4KDUA 3K8NA 4KSMA 2VLUA 2DBCA 2G2QA 4K1FA 1SJ6A 4ECJA 1O8WA 1B8XA 2IIYA 1ZGNA 1T7PB 4GSSA 2YANA 3QR6A 4F82A 2YOIA 1SK2A 4L5OA 3L9VA 2M72A 5IMZA 6GSYA 2H75A 4LLRA 2CQ9A 4DSSA 3IRAA 5COHA 4I8BA 3UARA 1UN2A 2DMLA 3HCZA 5B7CA 4ECIA 1SKSB 4ZBBA 4DSSB 3EVIA 2GLRA 1V98A 2L4QA 5KEJA 1QQ2A 3GTUB 1B48A 4GSNA 3WGDA 2R2JA 4IQAA 2YPMA 2IJYA 4K7OA 5H5QA 5ECSA 3D22A 2CAIA 5J41A 2VL2A 3WT1A 2JSZA 4KA0A 3BCIA 1YEPA 3F6FA 2YWNA 1TXXA 2GGTA 5G31A 4AJ7A 3MWHA 1JHBA 3UOMA 2H74A 3F63A 4K8MA 1S3AA 5D93A 4N0ZA 5HR1A 5DQYA 1YF0A 3LSZA 1CQGA 1VF1A 4HQSA 1S3CA 1FW1A 3GRXA 3HJOA 4K7NA 5HQPA 2NTOA 2H19A 2TRCP 1O85A 1GWCA 2TIRA 3TGZA 1Z7RA 1SJIA 1HNAA 2HZEB 4MJAA 4G10A 1TRWA 2JZSA 2H1DA 4IN0A 3WGXA 1NSWA 2H6ZA 5LCZA 4JZQA 5EL8A 1LU4A 1W89A 4ZB9A 4KSOA 3LFLA 1GTUA 1AC1A 2R5GA 3EC3A 1SJZA 4OCFA 4EVMA 2ZUPA 4OWYA 4KUNA 6GSSA 2NBSA 4X1UA 3D4MA 3BJ5A 4V2MA 2KHPA 1X5DA 1M2DA 2F3MA 2K9FA 2OJLA 1G6YA 2LRCA 1HD2A 1Y25A 4YAVA 2EIQA 1NHOA 2VCZA 2L5LA 2GDRA 4HQZA 5A4UA 3H93A 1E6BA 3D6IA 3ZVJA 3HHVA 3O3TA 4WF5A 1OE7A 3RPNA 3HD5A 1FAAA 3CTGA 4HEA2 2OACA 2XBQA 2ZCTA 5FHIA 2XPDA 1T4YA 2H0GA 4G19A 3VFIA 5D73A 3NZNA 3ED3A 5JWOB 1U87A 1K0MA 5AIVA 5IOWA 1V40A 1R5AA 3FKFA 3TKSC 3VPQA 1YDKA 5JWQB 3M9KA 6GSWA 2E2MA 3MAKA 3UJ1A 1M9BA 4PNFA 2LNTA 2H70A 1QK8A 3GN3A 4MPFA 2CV4A 2J23A 2NPBA 2H0IA 4WF4A 1GSYA 5ECNB 2IN3A 2JADA 4GWRA 4E8HA 12GSA 1K3LA 4ZBDA 3A2VA 2YWOA 2IMDA 4ECCA 2F9SA 3DVWA 4BA7A 2CZ3A 3GUSA 3GA4A 4HJ2A 3WGEA 9GSSA 1Q98A 3LXTA 2IL3A 1PA3A 4NAXA 1YEXA 3GMFA 2N5FA 2VM1A 4K6XA 2FA8A 3F4RA 4IJIA 1VF4A 3QPMA 5J9BA 1R7HA 2VM2A 1ABAA 1A2JA 3F4TA 1GUHA 1OC8A 1ZYQB 3F4SA 5IMVA 3J7Yk 5CAXA 4ZIJA 3HZ8A 4J56E 2GZYA 2MBTA 1GTAA 2GT6A 2DJJA 4EE0A 4F9ZA 1MDJA 3LJRA 2HXKA 2V6OA 5IMDA 1EZKA 1YZXA 4WXTA 1K3OA 2JZTA 4RUVA 2GS3A 3TRPA 2PBJA 4V2LA 2H66A 3GFKA 2O87A 1SL1B 3FY7A 3QD9A 2LSTA 2B5EA 1I5GA 4BWSA 2LUSA 1BEDA 2DMMA 1F2EA 1EWXA 1KBNA 4KDYA 3DEXA 3VK9A 1GH2A 4NXIA 1SENA 3ME8A 4OMVA 2VAFA 2C80A 5GSTA 2R3XA 2MYGA 2RIIA 3ERWA 3H8QA 3CMIA 2GQLA 3GKXA 5EPFA 4EC0A 1K0NA 1SKRB 3J7Yb 3GKNA 5IPGA 1PL2A 1SYXA 2FWEA 2L6DA 4GQFA 2QSIA 1EOGA 4NPBA 1IYIA 3BD2A 1QXHA 5DJLA 4DSRA 4PQ1A 2R37A 1V58A 3V1WA 4PQIA 4MLYA 5E4WA 4J57E 2VL9A 1EP8A 1JFUA 1THOA 4IW9A 1B4QA 1TDIA 3UIWA 3ZFBA 1U3AA 2ES7A 3IHQA 1FB6A 4WETA 2PUKC 4QL9A 4EXJA 5LNKe 2FGXA 3LG6A 3LYKA 4F03A 3WT2A 2GSTA 3GHAA 2N5BA 2H1AA 2C1YA 3C1RA 4TR0A 3KD0A 4FYBA 4HOJA 1XCCA 4IP6A 2DJ1A 2TRXA 5A4VA 2HZFA 2WB9A 1EEMA 5KN3A 5CRDA 4X0XA 2OA7A 5EY6A 2WCIA 2H01A 3CSJA 4HS1A 5IMAA 1QGVA 2MMOA 2WRTA 5C00A 2OE1A 1OC9A 2YCDA 1ZCPA 1XOBA 2XHFA 4EDZA 1XW6A 4LL1B 2F8AA 1GSFA 4PNGA 2IPAA 1OC9B 3PGTA 3GX0A 2K8VA 5G2ZA 1XWKA 3ZREA 1G7OA 17GSA 3Q18A 5F8BA 1B9YC 4IVFA 4PURA 3D4TA 4CDOA 5CREA 1O81A 1M2BA 3ZFLA 1YKAA 1XWAA 2GQMA 2MMNA 4ZL7A 1PKZA 1DE1A 2MBSA 5A4WA 3VI7A 3KTBA 1TU7A 4KDXA 1H4OA 3NIVA 5HFKA 1X9MB 5DALB 1JLVA 1T8EB 4EL1A 2B6MA 2H8LA 3QAWA 4ACSA 5AGYA 4FIWA 3VLNA 3U5RE 2HRNA 4XRDA 2VCVA 2CX3A 2LJKA 3TCOA 4D73A 2KLXA 2H30A 4V1Ag 4V1Ap 1G7EA 3KP8A 5CYYA 1CQHA 3EURA 2GZZA 5ELAA 4L5LA 1M9AA 1ZMAA 4MZBA 1BAYA 4NHWA 5J9CA 1TU8A 3P90A 3CXGA 3P8WA 2GT5A 1DBYA 4GSTA 2IMKA 1KEBA 4RI6A 3ZIJA 3FW2A 4ML1A 2HLSA 1GUKA 1BX9A 1EV9A 1FVKA 4EO3A 3FK8A 1ZZYA 3IK9A 1FOVA 2KOKA 2LRTA 2QKEA 5D8IA 3M8NA 5AISA 2LJRA 2N5AA 2VOCA 3E3EA 1GSUA 4TVEA 2FHEA 1X9WB 2QC7A 4HU9A 3F3QA 5JCUA 5H5RA 1WE0A 1V9WA 1A23A 2BJXA 3APQA 4MF5A 3M1GA 4J2FA 1TRSA 1OKTA 5D9WA 4EUYA 3ISOA 3L4NA 2CT6A 1XWBA 3I69A 1O7UA 2L4CA 1ON4A 2GVPA 3N9JA 1TRVA 4DSQA 2DIZA 3FR3A 5AIXA 3BOAA 1EGRA 2O7KA 4I5QA 1PQNA 2P5QA 4ZB8A 3HVXA 3DXBA 1Z6NA 4JEDA 4HJMA 4XS6A 2L5OA 5C04A 3IR4A 4I2UA 1Z3EA 3C8EA 1AUCA 1SL2B 2DLXA 4XS1A 5DAKA 1XZOA 2HSHA 2CVDA 2G0FA 5CRWA 2FY6A 3IDVA 3QFAC 4FH8A 5DAKB 4TR1A 1GSEA 1PKWA 3GURA 2PGTA 4POKA 1TTZA 4IJ3A 1R26A 2MZCA 1X5CA 1MD4A 4LA1A 4POBA 4TR1B 2YV9A 3FZ9A 4YQMA 3KMOA 1TOFA 1PX6A 5CP1A 4DEJA 4IBPA 1MD3A 4YQUA 2E7PA 2CA8A 4IGJA 2OE3A 1QFNA 2H72A 5F06A 6GSXA 2C3QA 2AV4A 4L0WA 2LS5A 4IP1A 1A0RP 5INYA 4OD7A 4HI7A 2X64A 4BVYA 2MMAA 1N2AA 2CX4A 2DSAA 3UMAA 1Y6EA 5L71A 2C3TA 1GL8A 4K9ZA 1LBKA 1XVWA 2B7KA 1F3BA 2K18A 4TRXA 3EU3A 3CRTA 1PL1A 2BMXA 3L9UA 2RLIA 2XPEA 4ZL8A 2WJUA 2OBKA 1SYRA 3TKPA 5HR3A 4EKZA 3KH7A 1G6WA 3IXRA 2LTKA 3KJYA 4L0UA 2O85A 4NV2A 2HSYA 4PUAA 3ZVJD 2OADA 3UAPA 5ECRB 3VWVA 3KH9A 2V6KA 2LJAA 2YP6A 1SL0B 5GAND 4Z7XA 3QDNA 3DIEA 3GKKA 2FLSA 3D0ZA 3ZYWA 3Q6OA 1X5EA 4Q5RA 4KX4A 3TKSA 1ML6A 1W4VA 3UL3A 2DJ0A 1XBSA 4QL7A 4P3YB 4AF2A 1KTEA 2AB6A 4NV5A 3G7YA 2EIOA 4HU7A 2VCQA 1JZOA 3GV1A 3HVSA 4XTSA 4MMMA 1YJ6A 3TB2A 2VCWA 5DCGA 8GSSA 1M7TA 1ERWA 2ALBA 4TOPA 1A0FA 3EE2A 4NWYA 2FA4A 1XWCA 2V2GA 4XIHA 1NHYA 4FYUA 4MJCA 3VPTA 2PPTA 1HNCA 4TXOA 3DD3A 1A2MA 1GTIA 4MF6A 3CYNA 3VWXA 2OKAA 2X8GA 2IWTA 1GNWA 2P5RA 5J4UA 4TXOB 3VI5A 3TKQA 2FCHA 4POMA 3RDWA 1AXDA 3KCMA 4ILFA 2LQQA 1I9DA 1JLWA 2AHEA 5IQYA 1Z6MA 2YJHA 1DE2A 2P31A 3M9JA 4JU5A 4I6XA 2B7JA 3IC4A 3KMNA 2A2SA 5J3RA 4IQ1A 2FD3A 2F8FA 1TK0B 5EVOA 3IE3A 3FHKA 1XW5A 1JZWA 3IOSA 2YZHA 3W8JA 5ECQB 2H6XA 3ERGA 3PR8A 3GYKA 1K0BA 3TOTA 4N30A 3S9FA 4EF0A 1J0FA 1EV4A 1UVZA 3KM6A 1WIKA 3WD6A 2VO4A 3UBLA 5ECMB 1ERTA 2H73A 1F3AA 2O8VB 3I9V2 2VD1A 4RI7A 4XS4A 2V41A 4BPYA 3GSSA 1ACVA 2CAQA 1FHEA 3Q74A 3H79A 2DJ3A 2IMFA 1XXUA 2ZNMA 2PU9C 2E2GA 3EMXA 4XS4B 4AGSA 4GTUA 1Z7PA 4G9HA 2HRFA 1WPIA 5DBQA 1FB0A 2A2RA 4F2IA 3O6TA 3GL5A 2OE0A 4K2DA 3F6DA 1V57A 5CRGA 2REMA 3H4KA 3HJMA 2X99A 1TRUA 3RBTA 4GLTA 2R6KA 2FUG2 1X9SB 1TW9A 5KN1A 2JL4A 3KTLA 5B6NA 5HFGA 3FZ4A 5D9TA 4O32A 2RUEA 3QMXA 1BG5A 4AJ8A 2K6VA 1PGTA 11GSA 4IHUA 1QUWA 5G1KA 5ECLB 1M99A 4JRRA 1GUMA 1XFLA 2I4AA 3GNJA 2NVLA 4LMVA 5ELGA 1BJXA 3VWUA 3EU4A 2V1MA 1AIUA 1THXA 4PUFC 1K0OA 3C71A 3HY2A 1Q4JA 3OR5A 3EMPA 2B5YA 4ZXGA 1HQOA 5D9XA 3D5JA 3HJPA 1WOUA 4POLA 1U6TA 5F0GA 3HXSA 3DYRA 2DC5A 1R5PA 2MMZA 2VD0A 3SBCA 3A2WA 1MTCA 3L9SA 3M0FA 2IFQA 5E59A 1GLPA 3H1NA 3UEMA 3KEBA 4RQRA 3M3MA 2IFQB 2I3YA 1UA5A 4EDYA 3JCML 22GSA 1C72A 1O73A 5DJMA 3HYPA 2VCXA 3L78A 1GSSA 2GZPA 5DCHA 1O8XA 3W8SA 1X0RA 2WZ9A 4AJ6A 4BWQA 4K0NA 4OO4A 1A2LA 2X8CA 4D73B 3KGKA 2HE3A 4MABA 4TR3A 2YNXA 3DMLA 3NOFA 2NDOA 1USBA 2AAWA 1T00A 5ABRA 2LNSA 3MSZA 4H86A 3HZ4A 4FO5A 3ZRDA 4PQHA 4ZBAA 1F9MA 4MF7A 4JR6A 5IM9A 3GH6A 2WGRA 3FRCA 1XW9A 4KCAA 4JBBA 3QOUA 1MDIA 1OKDA 4GCIA 2E0QA 4ISDA 4TKYA 3KXOA 2C8UA 3BBYA 3CTFA 1PRXA 5FT3A 2I1UA 2PWJA 3IBHA 2BTOT 1AQVA 2DIYA 3DRNA 3IK7A 3MNGA 2PMTA 2R4VA 4O7HA 2VIMA 1SK1A 3IPZA 2B3SA 4Q5QA 2I81A 1YQ1A 4PGTA 1FVJA 4JR4A 3GTUA 2H6YA 3CBUA 4PXOA 3AY8A 5IMCA 5DQSA 2O89A 2VL2C 3F3RA 5ID2A 3G7JA 6GSVA 3O76A 2LEGA 3IAM2 4IKHA 4HZ2A 3CSIA 5FWGA 4V2NA 1H75A 3GSTA 1Z9HA 1EEJA 5ID2B 16GSA 2H76A 2B1LA 2WULA 4MCUA 3ZITA 3TJJA 1A8YA 2VUPA 4ULXA 4HUAA 4WR4A 3TUEA 1SD8A 1EOHA 2YN1A 4OFNA 2KP1A 2RM6A 3LQ7A 5IO0A 1O6JA 5JCWA 3IAS2 1AQWA 2HZEA 4KCEA 2AJQB 3EYTA 3I43A 4MPGA 2H0HA 2X8HA 4KH7A 1LJRA 3G7IA 4YQVA 4WEYA 4ECBA 4I97A 3FR9A 5IIZA 1GP1A 4BVXA 2FWFA 3KP9A 1B9XC 3FZ5A 2V32A 2HFDA 1VF2A 2AUVA 2JZRA 2L6CA 4MH3A 5IMFA 4CW9A 1GRXA 5AN1A 1MEKA 3RHCA 1XPVA 1UC7A 5ECPB 4G2EA 1VRSD 2RUFA 3F8UA 4OCEA 2HT9A 1AQXA 4MH2A 5KN0A 5DVBA 2ON5A 4QQ7A 4TN8A 5HFIA 3D21A 3TKSE 18GSA 1QMVA 2VLTA 4NMUA 4F0BA 6GSUA 3FZAA 1RK4A 5CRHA 2YZUA 3DWVA 1A8LA 4Q5NA 4MJEA 4HZ4A 1TI3A 1XVQA 4O5RA 1KNGA 2PVQA 1T3BA 2KUCA 1M2AA 3MDKA 3HA9A 2DJKA 1K3YA 1E2YA 2HYXA 3PINA 3TDGA 3GKMA 3VURA 2YV7A 3ZLPA 3GL3A 2XC2A 5G30A 2B5XA 4JE1A 6GSTA 1PMTA 3FEUA 1XIYA 4OFTA 3LXZA 4IELA 1NM3A 1WWJA 1HYUA 4ZL9A 3W6GA 4N10A 2L57A 2RM5A 4MDCA 3IA1A 2JU5A 1XWGA 3G9BA 5G5FA 1WJKA 3VWWA 1TJDA 1PX7A 3US3A 2LV3A 2VLVA 3APSA 1JZRA 3HDCA 3EWLA 3FR6A 2IMEA 5H5SA 4XHMA 3A3TA 1K0DA 2IMIA 4IS0A 2C4JA 3TRXA 2DJ2A 4X43A 2GSSA 5DDLA 3ZMKA 1SD9A 1NW2A 4Q5FA 1OE8A 1MDKA 3UVTA 1AAZA 4OO5A 5HR2A 4WBRD 1FO5A 1PN9A 2EC4A 2EIRA 2B1KA 3U6VA 1ERUA 5JCGA 3Q19A 1PSQA 3E9JB 4N0VA 4TR4A 1BYEA 4FYCA 2C3NA 3DVXA 2WDUA 3WYWA 4KW6A 3TRQA 4I2TA 3RPPA 1BQ7A 13GSA 1PD21 4WR5A 1GTBA 4MJBA 2PERA 3ZL5A 5CNWA 4MP4A 2QGVA 3C1SA 2VL3A 3QAGA 2YWMA 3DGQA 2GTUA 2C0GA 3DKSA 2YJ7A 10GSA 3EINA 3GH9A 4ZB6A 3BCKA 5G1LA 1GSDA 4XCSA 3TKRA 3TJGA 2K8SA 3C7MA 4OFMA 2D2ZA 2FWHA 5IPHA 3TJKA 2OBIA 5HR0A 1U88A 1TI1A 5ECKB 1V2AA 2HNLA 1AW9A 2LRNA 2A4VA 4O92A 3ERFA 4KE3A 4L8EA 2H1BA 2J9HA 1XOAA 2CZ2A 3UBKA 1URMA 3ZMLA 1WRYA 2XBIA 1YF1A 2AYTA 1SU9A 3LWAA 5ECHB 3LYPA 4N11A 3HKRA 5JWRB 2I9HA 1TK5B 1EP7A 3ME7A 4ID0A 1VGLA 3ZIVA 3TOUA 3A2XA 1J9BA 1OC3A 1M0UA 1S3DA 1GULA 1ST9A 3I6AA 1Z5YE 3P7XA 1ZL9A 3TJFA 1RQMA 5F05A 5B8BA 1B4PA 3A5WA 5GAPD 1ERVA 1U3IA 4WBJA 3SWLA 3RHBA 1TK8B 3APOA 2L59A 3F9UA 1IYHA 1K0AA 1SKWB 2Z9SA 4YH2A 1YKCA 1EGOA 2KP2A 4YAPA 1F37A 19GSA 2ON7A 4XRAA 3PH9A 4KB3A 2C0FA 5A5KA 5G5EA 2GSQA 1J08A 3QFBC 1F6MC 4KNDA 1T4ZA 2GQKA 4MZCA 1OAZA 5GSSA 3KZQA 4DVCA 3R2QA 4MA9A 5CO3A 2H71A 2F51A 2HI7A 4BL7A 5B8AA 2C0EA 1ZOFA 2P0GA 2C0DA 2WFCA 2PN8A 3ZTLA 1N8JA 2FWGA 2GSRA 1G0TA 4LMWA 5ENUA 4GF0A 1YY7A 3L0HA 20GSA 4GXZA 3CSHA 4F0CA 1A24A 3GX8A 5ECIB 5GZZB 3LEFA 4KGIA 4MZWA 5KN2A 3UVHA 3KIJA 2VCTA 1TP9A 3QAVA 1GLQA 2H1GA 2PVOC 3F0IA
chains in the Genus database with same CATH superfamily
4TXVA 1WMJA 5KOXA 3IV4A 1TKDB 5DALA 3P2AA 3C73A 5D9VA 1T1VA 2JSYA 5B6MA 1K0CA 4PTSA 1SK0A 1DSBA 1DUGA 1ZYEA 3E0UA 4LL4B 3FYGA 5F07A 3LORA 7GSSA 4E8EA 1R4WA 5D96A 5ECOB 2CVKA 4GRFA 4MK3A 3TJBA 3GIXA 3LGCA 4NHZA 4CHSA 4PX1A 3ZZXA 2WS2A 1WP0A 4TW5A 1OVNA 3RAZA 1VF3A 5IOXA 14GSA 2JACA 2M46A 1ILOA 2LKUA 5LD0A 1OYJA 1JZDA 3HVVA 5J5NA 1RW1A 4GQCA 4ZILA 4K0GA 4ML6A 4WKWA 2YWIA 2CVBA 4K7IA 1FG4A 2LQOA 3QCPA 2M80A 4KAEA 3CRUA 1HNBA 1GNEA 2FNOA 1GSQA 4RQXA 4HDEA 5IO2A 3N5OA 4Z2TA 4KDUA 3K8NA 4KSMA 2VLUA 4K5RA 2DBCA 2G2QA 4K1FA 1SJ6A 4ECJA 1O8WA 1B8XA 2IIYA 1ZGNA 4EIQA 1T7PB 4GSSA 2YANA 3QR6A 4F82A 2YOIA 4CY6A 1SK2A 4L5OA 3L9VA 2M72A 5IMZA 6GSYA 2H75A 4LLRA 2CQ9A 4DSSA 3IRAA 5COHA 4I8BA 2HRAA 3UARA 1UN2A 2DMLA 3HCZA 5B7CA 4ECIA 1SKSB 4ZBBA 4DSSB 3EVIA 2GLRA 1V98A 2L4QA 5KEJA 1QQ2A 3GTUB 1B48A 4GSNA 3WGDA 2R2JA 4IQAA 5KOWA 2YPMA 2IJYA 4K7OA 5H5QA 5ECSA 3D22A 2CAIA 5J41A 2VL2A 3WT1A 2JSZA 4KA0A 3BCIA 1YEPA 1FOHA 3F6FA 2YWNA 1TXXA 2GGTA 5G31A 4AJ7A 3MWHA 1JHBA 3UOMA 2H74A 3F63A 3IHGA 1S3AA 4K8MA 5D93A 4N0ZA 5HR1A 5DQYA 4Z2UA 1YF0A 3LSZA 1CQGA 1VF1A 4HQSA 1S3CA 1FW1A 3GRXA 3HJOA 4K7NA 5HQPA 2NTOA 2DKIA 2H19A 2TRCP 1O85A 1GWCA 2TIRA 3TGZA 1Z7RA 1SJIA 1HNAA 2HZEB 4MJAA 4G10A 1TRWA 2JZSA 2H1DA 4IN0A 3WGXA 1NSWA 2H6ZA 5LCZA 4JZQA 5EL8A 1LU4A 1W89A 4ZB9A 4KSOA 3LFLA 1GTUA 1AC1A 2R5GA 3EC3A 1SJZA 4OCFA 4EVMA 2ZUPA 4OWYA 4KUNA 6GSSA 2NBSA 4X1UA 5BMUA 3D4MA 3BJ5A 4V2MA 2KHPA 1X5DA 1M2DA 2F3MA 2K9FA 2OJLA 1G6YA 2LRCA 1HD2A 1Y25A 4YAVA 2EIQA 1NHOA 2VCZA 2L5LA 2GDRA 4HQZA 5A4UA 3H93A 1E6BA 3D6IA 3ZVJA 3O3TA 3HHVA 2R0PA 4WF5A 1OE7A 3RPNA 3HD5A 1FAAA 3CTGA 4HEA2 2OACA 2XBQA 2ZCTA 5FHIA 2XPDA 1T4YA 2H0GA 4G19A 3VFIA 5D73A 3NZNA 3ED3A 5JWOB 1PN0A 1U87A 1K0MA 5AIVA 5IOWA 1V40A 1R5AA 3FKFA 3TKSC 3VPQA 1YDKA 5JWQB 3M9KA 6GSWA 2E2MA 3MAKA 3UJ1A 1M9BA 4PNFA 2LNTA 2H70A 1QK8A 3FMWA 3GN3A 4MPFA 2CV4A 2J23A 2NPBA 4FQUA 2H0IA 4WF4A 1GSYA 5ECNB 2IN3A 2JADA 4GWRA 4E8HA 12GSA 1K3LA 4ZBDA 3A2VA 4G0KA 2YWOA 2IMDA 4ECCA 2F9SA 3DVWA 4BA7A 2CZ3A 3GUSA 3GA4A 4HJ2A 3WGEA 9GSSA 1Q98A 3LXTA 2IL3A 1PA3A 4NAXA 1YEXA 3GMFA 2N5FA 2VM1A 4K6XA 2FA8A 3F4RA 4IJIA 1VF4A 3QPMA 5J9BA 1R7HA 2VM2A 1ABAA 2UZ8A 1A2JA 1S3RA 3F4TA 1GUHA 1OC8A 1ZYQB 3F4SA 5IMVA 3J7Yk 5CAXA 4ZIJA 3HZ8A 4J56E 2GZYA 2MBTA 1GTAA 4O5UA 2GT6A 2DJJA 4EE0A 4F9ZA 1MDJA 3LJRA 2HXKA 2V6OA 5IMDA 1EZKA 1YZXA 4WXTA 1K3OA 2JZTA 4RUVA 3A5IA 2GS3A 3TRPA 2PBJA 4V2LA 2H66A 3GFKA 2O87A 1SL1B 3FY7A 3QD9A 2LSTA 2B5EA 1I5GA 4BWSA 2LUSA 1BEDA 2DMMA 1F2EA 1EWXA 1KBNA 4KDYA 3DEXA 3VK9A 1GH2A 4NXIA 1SENA 3ME8A 4OMVA 2VAFA 2C80A 5GSTA 2R3XA 2MYGA 2RIIA 3ERWA 3H8QA 3CMIA 2GQLA 3GKXA 5EPFA 4EC0A 1K0NA 1SKRB 4EIPA 3GKNA 5IPGA 3J7Yb 1PL2A 1SYXA 2FWEA 2L6DA 4GQFA 2QSIA 1EOGA 4NPBA 1IYIA 3BD2A 1QXHA 5DJLA 4DSRA 4PQ1A 2R37A 1V58A 3V1WA 4PQIA 4MLYA 5E4WA 4J57E 1ZYNA 2VL9A 1EP8A 1JFUA 1THOA 4IW9A 1B4QA 1TDIA 3UIWA 3ZFBA 1U3AA 2ES7A 3IHQA 1FB6A 4WETA 2PUKC 4QL9A 4EXJA 5LNKe 2X49A 2FGXA 4K5SA 3LG6A 3LYKA 4F03A 3WT2A 2GSTA 3GHAA 2N5BA 2H1AA 2C1YA 3C1RA 4TR0A 3KD0A 4FYBA 4HOJA 1XCCA 4IP6A 2DJ1A 2TRXA 5A4VA 2HZFA 2WB9A 1EEMA 5KN3A 5CRDA 4X0XA 2OA7A 4K2XA 5EY6A 2WCIA 2H01A 3CSJA 4HS1A 5IMAA 1QGVA 2MMOA 2WRTA 5C00A 2OE1A 1OC9A 2YCDA 1ZCPA 1XOBA 2XHFA 4EDZA 1XW6A 4LL1B 2F8AA 1GSFA 4PNGA 2IPAA 1OC9B 3PGTA 3GX0A 2K8VA 5G2ZA 1XWKA 3ZREA 1G7OA 17GSA 3Q18A 5F8BA 2X4AA 1B9YC 4IVFA 4PURA 3D4TA 4CDOA 5CREA 1O81A 1M2BA 3ZFLA 1YKAA 1XWAA 2GQMA 2MMNA 4ZL7A 1PKZA 3LW9A 1DE1A 2MBSA 5A4WA 3VI7A 3KTBA 1TU7A 4KDXA 1H4OA 3NIVA 5HFKA 1X9MB 5DALB 1JLVA 1T8EB 4EL1A 2B6MA 2H8LA 3QAWA 4ACSA 5AGYA 4FIWA 3VLNA 3U5RE 2HRNA 4XRDA 2VCVA 2CX3A 2LJKA 3TCOA 4D73A 2KLXA 2H30A 2HSMA 4V1Ag 4V1Ap 1G7EA 3KP8A 4HSCX 5CYYA 1CQHA 3EURA 2GZZA 5ELAA 4L5LA 1M9AA 1ZMAA 4MZBA 1BAYA 4NHWA 4MNNA 5J9CA 1TU8A 3P90A 3CXGA 3P8WA 2GT5A 3IC8A 1DBYA 4GSTA 2IMKA 4USSA 1KEBA 4RI6A 3ZIJA 3FW2A 4ML1A 2HLSA 1GUKA 1BX9A 4X4JA 1EV9A 1FVKA 4Z2RA 4EO3A 3FK8A 1ZZYA 3IK9A 1FOVA 2KOKA 2LRTA 2QKEA 5D8IA 3M8NA 2QA1A 5AISA 2LJRA 2N5AA 2VOCA 3E3EA 1GSUA 4TVEA 2FHEA 1X9WB 2QC7A 4HU9A 3F3QA 5JCUA 5H5RA 1WE0A 1V9WA 1A23A 2BJXA 3APQA 4MF5A 3M1GA 4J2FA 1TRSA 1OKTA 5D9WA 4EUYA 3ISOA 3L4NA 2CT6A 1XWBA 3I69A 1O7UA 2L4CA 1ON4A 2GVPA 3N9JA 1TRVA 4DSQA 2DIZA 3FR3A 5AIXA 3BOAA 1EGRA 2O7KA 4I5QA 1PQNA 2P5QA 4ZB8A 3HVXA 3DXBA 1Z6NA 4JEDA 4HJMA 4XS6A 2L5OA 5C04A 3IR4A 4I2UA 1Z3EA 3C8EA 1AUCA 1SL2B 2DLXA 4XS1A 5DAKA 1XZOA 2HSHA 2CVDA 2G0FA 5CRWA 2FY6A 3IDVA 3QFAC 4FH8A 5DAKB 4TR1A 1GSEA 1PKWA 3GURA 2PGTA 4POKA 1TTZA 4IJ3A 1R26A 2MZCA 1X5CA 1MD4A 4LA1A 4POBA 4TR1B 2YV9A 3FZ9A 4YQMA 3KMOA 1TOFA 1PX6A 5CP1A 4DEJA 4IBPA 1MD3A 4YQUA 2E7PA 2CA8A 4IGJA 2OE3A 1QFNA 2H72A 5F06A 6GSXA 2C3QA 2AV4A 4L0WA 2LS5A 4IP1A 1A0RP 5INYA 4OD7A 4HI7A 2X64A 4BVYA 2MMAA 1N2AA 2CX4A 2DSAA 3UMAA 1Y6EA 5L71A 2C3TA 1GL8A 4K9ZA 1LBKA 1XVWA 2B7KA 1F3BA 2K18A 4TRXA 3EU3A 3CRTA 1PL1A 2BMXA 3L9UA 2RLIA 2XPEA 4ZL8A 2WJUA 2OBKA 1SYRA 3TKPA 5HR3A 4EKZA 3KH7A 1G6WA 3IXRA 1M3IA 2LTKA 3KJYA 4L0UA 2O85A 4NV2A 2HSYA 4PUAA 3ZVJD 2OADA 3UAPA 5ECRB 3VWVA 3KH9A 2V6KA 2LJAA 2YP6A 1SL0B 5GAND 4Z7XA 3QDNA 3DIEA 3GKKA 2FLSA 3D0ZA 3ZYWA 3Q6OA 1X5EA 4Q5RA 4KX4A 3TKSA 1ML6A 1W4VA 3UL3A 2DJ0A 1XBSA 4QL7A 4P3YB 4AF2A 1KTEA 2AB6A 4NV5A 3G7YA 2EIOA 4HU7A 2VCQA 1JZOA 3GV1A 3HVSA 4XTSA 4MMMA 1YJ6A 3TB2A 2VCWA 5DCGA 8GSSA 1M7TA 1ERWA 2ALBA 4KF9A 4TOPA 1A0FA 3EE2A 4NWYA 2FA4A 1XWCA 2V2GA 4XIHA 1NHYA 4FYUA 4MJCA 3VPTA 2PPTA 1HNCA 4TXOA 3DD3A 1A2MA 1GTIA 4YKFA 4MF6A 3CYNA 3VWXA 2OKAA 2X8GA 2IWTA 1GNWA 2P5RA 5J4UA 4TXOB 3VI5A 3TKQA 2FCHA 4POMA 3RDWA 1AXDA 3KCMA 4ILFA 2LQQA 1I9DA 1JLWA 2AHEA 5IQYA 1Z6MA 2YJHA 1DE2A 2P31A 3M9JA 4JU5A 4I6XA 2B7JA 3IC4A 3KMNA 2A2SA 5J3RA 4IQ1A 2FD3A 2F8FA 1TK0B 5EVOA 3IE3A 3FHKA 1XW5A 1JZWA 3IOSA 2YZHA 3W8JA 5ECQB 2H6XA 3ERGA 3PR8A 3GYKA 1K0BA 3TOTA 4N30A 4A5PA 3S9FA 4EF0A 1J0FA 1EV4A 1UVZA 3KM6A 1WIKA 3WD6A 2VO4A 3UBLA 3PPUA 5ECMB 2DKHA 1ERTA 4G0LA 2H73A 1F3AA 2O8VB 3I9V2 2VD1A 4RI7A 4XS4A 2V41A 4BPYA 3GSSA 1ACVA 2CAQA 1FHEA 3Q74A 3H79A 2DJ3A 2IMFA 1XXUA 2ZNMA 2PU9C 2E2GA 3EMXA 4XS4B 4AGSA 4GTUA 1Z7PA 4G9HA 2HRFA 1WPIA 5DBQA 1FB0A 2A2RA 4F2IA 3O6TA 3GL5A 2OE0A 4K2DA 3F6DA 4BIKA 1V57A 5CRGA 2REMA 3H4KA 3HJMA 2X99A 1TRUA 3RBTA 4GLTA 2R6KA 2FUG2 1X9SB 1TW9A 5KN1A 2JL4A 3KTLA 5B6NA 5HFGA 3FZ4A 5D9TA 4O32A 2RUEA 3QMXA 1BG5A 4AJ8A 2K6VA 1PGTA 11GSA 4IHUA 1QUWA 5G1KA 5ECLB 1M99A 4JRRA 1GUMA 1XFLA 2I4AA 3GNJA 2NVLA 4LMVA 5ELGA 1BJXA 3VWUA 3EU4A 2V1MA 1AIUA 1THXA 4PUFC 1K0OA 3C71A 3HY2A 1Q4JA 3OR5A 3EMPA 2B5YA 4ZXGA 1HQOA 5D9XA 3D5JA 3HJPA 1WOUA 4POLA 2A4HA 1U6TA 5F0GA 3HXSA 3DYRA 2DC5A 1R5PA 2MMZA 2VD0A 3SBCA 3A2WA 1MTCA 3L9SA 3M0FA 2IFQA 5E59A 1XG8A 1GLPA 3H1NA 3UEMA 3KEBA 4RQRA 3M3MA 2IFQB 2I3YA 1UA5A 4EDYA 3JCML 22GSA 1C72A 1O73A 5DJMA 3CQFA 3HYPA 2VCXA 3L78A 1GSSA 2GZPA 5DCHA 1O8XA 3W8SA 1X0RA 2WZ9A 4AJ6A 4BWQA 4K0NA 4OO4A 2A2PA 1A2LA 2X8CA 4D73B 3KGKA 2HE3A 4MABA 4TR3A 2YNXA 3DMLA 3NOFA 2NDOA 1USBA 2AAWA 1T00A 5ABRA 2LNSA 3MSZA 4H86A 3HZ4A 4FO5A 3ZRDA 4PQHA 4ZBAA 1F9MA 4MF7A 4JR6A 5IM9A 3GH6A 2WGRA 3FRCA 1XW9A 4KCAA 4JBBA 3QOUA 1MDIA 1OKDA 4GCIA 2E0QA 4ISDA 4TKYA 3KXOA 2C8UA 3BBYA 3CTFA 1PRXA 4CY8A 5FT3A 3MYDA 2I1UA 2PWJA 3IBHA 2BTOT 1AQVA 2DIYA 3DRNA 3IK7A 3MNGA 2PMTA 2R4VA 4O7HA 2VIMA 1SK1A 3IPZA 2B3SA 4Q5QA 2I81A 1YQ1A 4PGTA 1FVJA 4JR4A 3GTUA 2H6YA 3CBUA 4PXOA 3AY8A 5IMCA 5DQSA 2O89A 2VL2C 3F3RA 5ID2A 3G7JA 6GSVA 3O76A 2LEGA 3IAM2 4IKHA 4HZ2A 3CSIA 5FWGA 4V2NA 1H75A 3GSTA 1M3JA 1Z9HA 1EEJA 5ID2B 16GSA 2H76A 2B1LA 2WULA 4MCUA 3ZITA 5BRTA 3TJJA 1A8YA 2VUPA 4ULXA 4HUAA 4WR4A 3TUEA 1SD8A 1EOHA 2YN1A 4OFNA 2KP1A 2RM6A 3LQ7A 5IO0A 1O6JA 5JCWA 3IAS2 1AQWA 2HZEA 4KCEA 2AJQB 3EYTA 3I43A 4MPGA 2H0HA 2X8HA 4KH7A 1LJRA 3G7IA 4YQVA 4WEYA 4ECBA 1PFOA 4I97A 3FR9A 5IIZA 1GP1A 4BVXA 2FWFA 3KP9A 1B9XC 3FZ5A 2V32A 2HFDA 1VF2A 2AUVA 2JZRA 2L6CA 4MH3A 4BVXB 5IMFA 4CW9A 1GRXA 5AN1A 1MEKA 3RHCA 1XPVA 1UC7A 5ECPB 4G2EA 1VRSD 4BVYB 2RUFA 3F8UA 4OCEA 2HT9A 1AQXA 4MH2A 5KN0A 5DVBA 2ON5A 4QQ7A 4TN8A 5HFIA 3D21A 3TKSE 18GSA 1QMVA 2VLTA 3HVNA 4NMUA 4F0BA 6GSUA 3FZAA 1RK4A 5CRHA 2YZUA 3DWVA 1A8LA 4Q5NA 4MJEA 4HZ4A 1TI3A 1XVQA 4O5RA 1KNGA 2PVQA 1T3BA 2R0GA 2KUCA 1M2AA 3MDKA 3HA9A 2DJKA 1K3YA 1E2YA 2HYXA 3PINA 3TDGA 3R3EA 3GKMA 3VURA 2YV7A 3ZLPA 3GL3A 2XC2A 4YKGA 5G30A 2B5XA 4JE1A 6GSTA 1PMTA 3FEUA 1XIYA 4OFTA 3LXZA 4IELA 1NM3A 1WWJA 1HYUA 4ZL9A 3W6GA 4N10A 2L57A 2RM5A 4MDCA 3IA1A 2JU5A 1XWGA 3G9BA 5G5FA 1WJKA 3VWWA 1TJDA 3MIXA 1PX7A 3US3A 2LV3A 2VLVA 3APSA 1JZRA 1ZYPA 3HDCA 3EWLA 3FR6A 2IMEA 5H5SA 4XHMA 3A3TA 1K0DA 2IMIA 4IS0A 2C4JA 3TRXA 2DJ2A 4X43A 2GSSA 5DDLA 3ZMKA 1SD9A 1NW2A 4Q5FA 1OE8A 1MDKA 4G0IA 3UVTA 2R0CA 1AAZA 4OO5A 5HR2A 4WBRD 1FO5A 1PN9A 2EC4A 2EIRA 2B1KA 3U6VA 1ERUA 5JCGA 3Q19A 1PSQA 3E9JB 4N0VA 4TR4A 1BYEA 4FYCA 2C3NA 3DVXA 2WDUA 3WYWA 4KW6A 3TRQA 4I2TA 3RPPA 1BQ7A 13GSA 1PD21 4WR5A 1GTBA 4ICYA 4MJBA 2PERA 3ZL5A 5CNWA 4MP4A 2QGVA 2HRKA 3C1SA 2VL3A 3QAGA 2YWMA 3DGQA 2GTUA 2C0GA 3DKSA 2YJ7A 10GSA 3EINA 3GH9A 4ZB6A 3BCKA 5G1LA 1GSDA 4XCSA 3TKRA 3TJGA 2K8SA 3C7MA 4OFMA 2D2ZA 2FWHA 5IPHA 3TJKA 2OBIA 5HR0A 1U88A 1TI1A 5ECKB 1V2AA 2HNLA 1AW9A 2LRNA 2A4VA 4O92A 3ERFA 4KE3A 4L8EA 2H1BA 2J9HA 1XOAA 2CZ2A 3UBKA 1URMA 3ZMLA 1WRYA 2XBIA 2QA2A 1YF1A 2AYTA 1SU9A 3LWAA 5ECHB 3LYPA 4N11A 3HKRA 5JWRB 2I9HA 1TK5B 1EP7A 3ME7A 4ID0A 1VGLA 3ZIVA 3TOUA 3A2XA 1J9BA 1OC3A 1M0UA 1S3DA 1GULA 1ST9A 3I6AA 1Z5YE 3P7XA 1ZL9A 3TJFA 1RQMA 5F05A 5B8BA 1B4PA 3EPTA 3A5WA 5GAPD 1ERVA 1U3IA 4WBJA 4O5QA 3SWLA 3RHBA 1TK8B 3APOA 2L59A 3F9UA 1IYHA 1K0AA 1SKWB 2Z9SA 4YH2A 1YKCA 1EGOA 2KP2A 4YAPA 1F37A 19GSA 2ON7A 4XRAA 3PH9A 4KB3A 2C0FA 5A5KA 5G5EA 2GSQA 1J08A 3QFBC 1F6MC 4KNDA 1T4ZA 2GQKA 4MZCA 1OAZA 5GSSA 3KZQA 4DVCA 3R2QA 4MA9A 5CO3A 2H71A 2F51A 2HI7A 4BL7A 5B8AA 2C0EA 1ZOFA 2P0GA 2C0DA 2WFCA 2PN8A 3ZTLA 1N8JA 2FWGA 4BL7B 2GSRA 1G0TA 4LMWA 5ENUA 4GF0A 1YY7A 3L0HA 20GSA 4GXZA 3CSHA 4F0CA 1A24A 3GX8A 5ECIB 5GZZB 3LEFA 4KGIA 4MZWA 5KN2A 3UVHA 3KIJA 2VCTA 1TP9A 3QAVA 1GLQA 2H1GA 2PVOC 3F0IA
chains in the Genus database with same CATH topology
4TXVA 1WMJA 5KOXA 3IV4A 1TKDB 5DALA 3P2AA 3C73A 5D9VA 1T1VA 2JSYA 5B6MA 1K0CA 4PTSA 1SK0A 1DSBA 1DUGA 1ZYEA 3E0UA 4LL4B 3FYGA 5F07A 3LORA 7GSSA 4E8EA 1R4WA 5D96A 5ECOB 2CVKA 4GRFA 4MK3A 3TJBA 3GIXA 3LGCA 4NHZA 4CHSA 4PX1A 3ZZXA 2WS2A 1WP0A 4TW5A 1OVNA 3RAZA 1VF3A 5IOXA 14GSA 2JACA 2M46A 1ILOA 2LKUA 5LD0A 1OYJA 1JZDA 3HVVA 5J5NA 1RW1A 4GQCA 4ZILA 4K0GA 4ML6A 4WKWA 2YWIA 2CVBA 4K7IA 1FG4A 2LQOA 3QCPA 2M80A 4KAEA 3CRUA 1HNBA 1GNEA 2FNOA 1GSQA 4RQXA 4HDEA 5IO2A 3N5OA 4Z2TA 4KDUA 3K8NA 4KSMA 2VLUA 4K5RA 2DBCA 2G2QA 4K1FA 1SJ6A 4ECJA 1O8WA 1B8XA 2IIYA 1ZGNA 4EIQA 1T7PB 4GSSA 2YANA 3QR6A 4F82A 2YOIA 4CY6A 1SK2A 4L5OA 3L9VA 2M72A 5IMZA 6GSYA 2H75A 4LLRA 2CQ9A 4DSSA 3IRAA 5COHA 4I8BA 2HRAA 3UARA 1UN2A 2DMLA 3HCZA 5B7CA 4ECIA 1SKSB 4ZBBA 4DSSB 3EVIA 2GLRA 1V98A 2L4QA 5KEJA 1QQ2A 3GTUB 1B48A 4GSNA 3WGDA 2R2JA 4IQAA 5KOWA 2YPMA 2IJYA 4K7OA 5H5QA 5ECSA 3D22A 2CAIA 5J41A 2VL2A 3WT1A 2JSZA 4KA0A 3BCIA 1YEPA 1FOHA 3F6FA 2YWNA 1TXXA 2GGTA 5G31A 4AJ7A 3MWHA 1JHBA 3UOMA 2H74A 3F63A 3IHGA 1S3AA 4K8MA 5D93A 4N0ZA 5HR1A 5DQYA 4Z2UA 1YF0A 3LSZA 1CQGA 1VF1A 4HQSA 1S3CA 1FW1A 3GRXA 3HJOA 4K7NA 5HQPA 2NTOA 2DKIA 2H19A 2TRCP 1O85A 1GWCA 2TIRA 3TGZA 1Z7RA 1SJIA 1HNAA 2HZEB 4MJAA 4G10A 1TRWA 2JZSA 2H1DA 4IN0A 3WGXA 1NSWA 2H6ZA 5LCZA 4JZQA 5EL8A 1LU4A 1W89A 4ZB9A 4KSOA 3LFLA 1GTUA 1AC1A 2R5GA 3EC3A 1SJZA 4OCFA 4EVMA 2ZUPA 4OWYA 4KUNA 6GSSA 2NBSA 4X1UA 5BMUA 3D4MA 3BJ5A 4V2MA 2KHPA 1X5DA 1M2DA 2F3MA 2K9FA 2OJLA 1G6YA 2LRCA 1HD2A 1Y25A 4YAVA 2EIQA 1NHOA 2VCZA 2L5LA 2GDRA 4HQZA 5A4UA 3H93A 1E6BA 3D6IA 3ZVJA 3O3TA 3HHVA 2R0PA 4WF5A 1OE7A 3RPNA 3HD5A 1FAAA 3CTGA 4HEA2 2OACA 2XBQA 2ZCTA 5FHIA 2XPDA 1T4YA 2H0GA 4G19A 3VFIA 5D73A 3NZNA 3ED3A 5JWOB 1PN0A 1U87A 1K0MA 5AIVA 5IOWA 1V40A 1R5AA 3FKFA 3TKSC 3VPQA 1YDKA 5JWQB 3M9KA 6GSWA 2E2MA 3MAKA 3UJ1A 1M9BA 4PNFA 2LNTA 2H70A 1QK8A 3FMWA 3GN3A 4MPFA 2CV4A 2J23A 2NPBA 4FQUA 2H0IA 4WF4A 1GSYA 5ECNB 2IN3A 2JADA 4GWRA 4E8HA 12GSA 1K3LA 4ZBDA 3A2VA 4G0KA 2YWOA 2IMDA 4ECCA 2F9SA 3DVWA 4BA7A 2CZ3A 3GUSA 3GA4A 4HJ2A 3WGEA 9GSSA 1Q98A 3LXTA 2IL3A 1PA3A 4NAXA 1YEXA 3GMFA 2N5FA 2VM1A 4K6XA 2FA8A 3F4RA 4IJIA 1VF4A 3QPMA 5J9BA 1R7HA 2VM2A 1ABAA 2UZ8A 1A2JA 3F4TA 1GUHA 1OC8A 1ZYQB 3F4SA 5IMVA 3J7Yk 5CAXA 4ZIJA 3HZ8A 4J56E 2GZYA 2MBTA 1GTAA 4O5UA 2GT6A 2DJJA 4EE0A 4F9ZA 1MDJA 3LJRA 2HXKA 2V6OA 5IMDA 1EZKA 1YZXA 4WXTA 1K3OA 2JZTA 4RUVA 3A5IA 2GS3A 3TRPA 2PBJA 4V2LA 2H66A 3GFKA 2O87A 1SL1B 3FY7A 3QD9A 2LSTA 2B5EA 1I5GA 4BWSA 2LUSA 1BEDA 2DMMA 1F2EA 1EWXA 1KBNA 4KDYA 3DEXA 3VK9A 1GH2A 4NXIA 1SENA 3ME8A 4OMVA 2VAFA 2C80A 5GSTA 2R3XA 2MYGA 2RIIA 3ERWA 3H8QA 3CMIA 2GQLA 3GKXA 5EPFA 4EC0A 1K0NA 1SKRB 4EIPA 3GKNA 5IPGA 3J7Yb 1PL2A 1SYXA 2FWEA 2L6DA 4GQFA 2QSIA 1EOGA 4NPBA 1IYIA 3BD2A 1QXHA 5DJLA 4DSRA 4PQ1A 2R37A 1V58A 3V1WA 4PQIA 4MLYA 5E4WA 4J57E 1ZYNA 2VL9A 1EP8A 1JFUA 1THOA 4IW9A 1B4QA 1TDIA 3UIWA 3ZFBA 1U3AA 2ES7A 3IHQA 1FB6A 4WETA 2PUKC 4QL9A 4EXJA 5LNKe 2X49A 2FGXA 4K5SA 3LG6A 3LYKA 4F03A 3WT2A 2GSTA 3GHAA 2N5BA 2H1AA 2C1YA 3C1RA 4TR0A 3KD0A 4FYBA 4HOJA 1XCCA 4IP6A 2DJ1A 2TRXA 5A4VA 2HZFA 2WB9A 1EEMA 5KN3A 5CRDA 4X0XA 2OA7A 4K2XA 5EY6A 2WCIA 2H01A 3CSJA 4HS1A 5IMAA 1QGVA 2MMOA 2WRTA 5C00A 2OE1A 1OC9A 2YCDA 1ZCPA 1XOBA 2XHFA 4EDZA 1XW6A 4LL1B 2F8AA 1GSFA 4PNGA 2IPAA 1OC9B 3PGTA 3GX0A 2K8VA 5G2ZA 1XWKA 3ZREA 1G7OA 17GSA 3Q18A 5F8BA 2X4AA 1B9YC 4IVFA 4PURA 3D4TA 4CDOA 5CREA 1O81A 1M2BA 3ZFLA 1YKAA 1XWAA 2GQMA 2MMNA 4ZL7A 1PKZA 3LW9A 1DE1A 2MBSA 5A4WA 3VI7A 3KTBA 1TU7A 4KDXA 1H4OA 3NIVA 5HFKA 1X9MB 5DALB 1JLVA 1T8EB 4EL1A 2B6MA 2H8LA 3QAWA 4ACSA 5AGYA 4FIWA 3VLNA 3U5RE 2HRNA 4XRDA 2VCVA 2CX3A 2LJKA 3TCOA 4D73A 2KLXA 2H30A 2HSMA 4V1Ag 4V1Ap 1G7EA 3KP8A 5CYYA 1CQHA 3EURA 2GZZA 5ELAA 4L5LA 1M9AA 1ZMAA 4MZBA 1BAYA 4NHWA 4MNNA 5J9CA 1TU8A 3P90A 3CXGA 3P8WA 2GT5A 3IC8A 1DBYA 4GSTA 2IMKA 4USSA 1KEBA 4RI6A 3ZIJA 3FW2A 4ML1A 2HLSA 1GUKA 1BX9A 4X4JA 1EV9A 1FVKA 4Z2RA 4EO3A 3FK8A 1ZZYA 3IK9A 1FOVA 2KOKA 2LRTA 2QKEA 5D8IA 3M8NA 2QA1A 5AISA 2LJRA 2N5AA 2VOCA 3E3EA 1GSUA 4TVEA 2FHEA 1X9WB 2QC7A 4HU9A 3F3QA 5JCUA 5H5RA 1WE0A 1V9WA 1A23A 2BJXA 3APQA 4MF5A 3M1GA 4J2FA 1TRSA 1OKTA 5D9WA 4EUYA 3ISOA 3L4NA 2CT6A 1XWBA 3I69A 1O7UA 2L4CA 1ON4A 2GVPA 3N9JA 1TRVA 4DSQA 2DIZA 3FR3A 5AIXA 3BOAA 1EGRA 2O7KA 4I5QA 1PQNA 2P5QA 4ZB8A 3HVXA 3DXBA 1Z6NA 4JEDA 4HJMA 4XS6A 2L5OA 5C04A 3IR4A 4I2UA 1Z3EA 3C8EA 1AUCA 1SL2B 2DLXA 4XS1A 5DAKA 1XZOA 2HSHA 2CVDA 2G0FA 5CRWA 2FY6A 3IDVA 3QFAC 4FH8A 5DAKB 4TR1A 1GSEA 1PKWA 3GURA 2PGTA 4POKA 1TTZA 4IJ3A 1R26A 2MZCA 1X5CA 1MD4A 4LA1A 4POBA 4TR1B 2YV9A 3FZ9A 4YQMA 3KMOA 1TOFA 1PX6A 5CP1A 4DEJA 4IBPA 1MD3A 4YQUA 2E7PA 2CA8A 4IGJA 2OE3A 1QFNA 2H72A 5F06A 6GSXA 2C3QA 2AV4A 4L0WA 2LS5A 4IP1A 1A0RP 5INYA 4OD7A 4HI7A 2X64A 4BVYA 2MMAA 1N2AA 2CX4A 2DSAA 3UMAA 1Y6EA 5L71A 2C3TA 1GL8A 4K9ZA 1LBKA 1XVWA 2B7KA 1F3BA 2K18A 4TRXA 3EU3A 3CRTA 1PL1A 2BMXA 3L9UA 2RLIA 2XPEA 4ZL8A 2WJUA 2OBKA 1SYRA 3TKPA 5HR3A 4EKZA 3KH7A 1G6WA 3IXRA 2LTKA 3KJYA 4L0UA 2O85A 4NV2A 2HSYA 4PUAA 3ZVJD 2OADA 3UAPA 5ECRB 3VWVA 3KH9A 2V6KA 2LJAA 2YP6A 1SL0B 5GAND 4Z7XA 3QDNA 3DIEA 3GKKA 2FLSA 3D0ZA 3ZYWA 3Q6OA 1X5EA 4Q5RA 4KX4A 3TKSA 1ML6A 1W4VA 3UL3A 2DJ0A 1XBSA 4QL7A 4P3YB 4AF2A 1KTEA 2AB6A 4NV5A 3G7YA 2EIOA 4HU7A 2VCQA 1JZOA 3GV1A 3HVSA 4XTSA 4MMMA 1YJ6A 3TB2A 2VCWA 5DCGA 8GSSA 1M7TA 1ERWA 2ALBA 4KF9A 4TOPA 1A0FA 3EE2A 4NWYA 2FA4A 1XWCA 2V2GA 4XIHA 1NHYA 4FYUA 4MJCA 3VPTA 2PPTA 1HNCA 4TXOA 3DD3A 1A2MA 1GTIA 4YKFA 4MF6A 3CYNA 3VWXA 2OKAA 2X8GA 2IWTA 1GNWA 2P5RA 5J4UA 4TXOB 3VI5A 3TKQA 2FCHA 4POMA 3RDWA 1AXDA 3KCMA 4ILFA 2LQQA 1I9DA 1JLWA 2AHEA 5IQYA 1Z6MA 2YJHA 1DE2A 2P31A 3M9JA 4JU5A 4I6XA 2B7JA 3IC4A 3KMNA 2A2SA 5J3RA 4IQ1A 2FD3A 2F8FA 1TK0B 5EVOA 3IE3A 3FHKA 1XW5A 1JZWA 3IOSA 2YZHA 3W8JA 5ECQB 2H6XA 3ERGA 3PR8A 3GYKA 1K0BA 3TOTA 4N30A 4A5PA 3S9FA 4EF0A 1J0FA 1EV4A 1UVZA 3KM6A 1WIKA 3WD6A 2VO4A 3UBLA 3PPUA 5ECMB 2DKHA 1ERTA 4G0LA 2H73A 1F3AA 2O8VB 3I9V2 2VD1A 4RI7A 4XS4A 2V41A 4BPYA 3GSSA 1ACVA 2CAQA 1FHEA 3Q74A 3H79A 2DJ3A 2IMFA 1XXUA 2ZNMA 2PU9C 2E2GA 3EMXA 4XS4B 4AGSA 4GTUA 1Z7PA 4G9HA 2HRFA 1WPIA 5DBQA 1FB0A 2A2RA 4F2IA 3O6TA 3GL5A 2OE0A 4K2DA 3F6DA 1V57A 5CRGA 2REMA 3H4KA 3HJMA 2X99A 1TRUA 3RBTA 4GLTA 2R6KA 2FUG2 1X9SB 1TW9A 5KN1A 2JL4A 3KTLA 5B6NA 5HFGA 3FZ4A 5D9TA 4O32A 2RUEA 3QMXA 1BG5A 4AJ8A 2K6VA 1PGTA 11GSA 4IHUA 1QUWA 5G1KA 5ECLB 1M99A 4JRRA 1GUMA 1XFLA 2I4AA 3GNJA 2NVLA 4LMVA 5ELGA 1BJXA 3VWUA 3EU4A 2V1MA 1AIUA 1THXA 4PUFC 1K0OA 3C71A 3HY2A 1Q4JA 3OR5A 3EMPA 2B5YA 4ZXGA 1HQOA 5D9XA 3D5JA 3HJPA 1WOUA 4POLA 2A4HA 1U6TA 5F0GA 3HXSA 3DYRA 2DC5A 1R5PA 2MMZA 2VD0A 3SBCA 3A2WA 1MTCA 3L9SA 3M0FA 2IFQA 5E59A 1GLPA 3H1NA 3UEMA 3KEBA 4RQRA 3M3MA 2IFQB 2I3YA 1UA5A 4EDYA 3JCML 22GSA 1C72A 1O73A 5DJMA 3HYPA 2VCXA 3L78A 1GSSA 2GZPA 5DCHA 1O8XA 3W8SA 1X0RA 2WZ9A 4AJ6A 4BWQA 4K0NA 4OO4A 2A2PA 1A2LA 2X8CA 4D73B 3KGKA 2HE3A 4MABA 4TR3A 2YNXA 3DMLA 3NOFA 2NDOA 1USBA 2AAWA 1T00A 5ABRA 2LNSA 3MSZA 4H86A 3HZ4A 4FO5A 3ZRDA 4PQHA 4ZBAA 1F9MA 4MF7A 4JR6A 5IM9A 3GH6A 2WGRA 3FRCA 1XW9A 4KCAA 4JBBA 3QOUA 1MDIA 1OKDA 4GCIA 2E0QA 4ISDA 4TKYA 3KXOA 2C8UA 3BBYA 3CTFA 1PRXA 4CY8A 5FT3A 3MYDA 2I1UA 2PWJA 3IBHA 2BTOT 1AQVA 2DIYA 3DRNA 3IK7A 3MNGA 2PMTA 2R4VA 4O7HA 2VIMA 1SK1A 3IPZA 2B3SA 4Q5QA 2I81A 1YQ1A 4PGTA 1FVJA 4JR4A 3GTUA 2H6YA 3CBUA 4PXOA 3AY8A 5IMCA 5DQSA 2O89A 2VL2C 3F3RA 5ID2A 3G7JA 6GSVA 3O76A 2LEGA 3IAM2 4IKHA 4HZ2A 3CSIA 5FWGA 4V2NA 1H75A 3GSTA 1Z9HA 1EEJA 5ID2B 16GSA 2H76A 2B1LA 2WULA 4MCUA 3ZITA 5BRTA 3TJJA 1A8YA 2VUPA 4ULXA 4HUAA 4WR4A 3TUEA 1SD8A 1EOHA 2YN1A 4OFNA 2KP1A 2RM6A 3LQ7A 5IO0A 1O6JA 5JCWA 3IAS2 1AQWA 2HZEA 4KCEA 2AJQB 3EYTA 3I43A 4MPGA 2H0HA 2X8HA 4KH7A 1LJRA 3G7IA 4YQVA 4WEYA 4ECBA 4I97A 3FR9A 5IIZA 1GP1A 4BVXA 2FWFA 3KP9A 1B9XC 3FZ5A 2V32A 2HFDA 1VF2A 2AUVA 2JZRA 2L6CA 4MH3A 4BVXB 5IMFA 4CW9A 1GRXA 5AN1A 1MEKA 3RHCA 1XPVA 1UC7A 5ECPB 4G2EA 1VRSD 4BVYB 2RUFA 3F8UA 4OCEA 2HT9A 1AQXA 4MH2A 5KN0A 5DVBA 2ON5A 4QQ7A 4TN8A 5HFIA 3D21A 3TKSE 18GSA 1QMVA 2VLTA 4NMUA 4F0BA 6GSUA 3FZAA 1RK4A 5CRHA 2YZUA 3DWVA 1A8LA 4Q5NA 4MJEA 4HZ4A 1TI3A 1XVQA 4O5RA 1KNGA 2PVQA 1T3BA 2R0GA 2KUCA 1M2AA 3MDKA 3HA9A 2DJKA 1K3YA 1E2YA 2HYXA 3PINA 3TDGA 3R3EA 3GKMA 3VURA 2YV7A 3ZLPA 3GL3A 2XC2A 4YKGA 5G30A 2B5XA 4JE1A 6GSTA 1PMTA 3FEUA 1XIYA 4OFTA 3LXZA 4IELA 1NM3A 1WWJA 1HYUA 4ZL9A 3W6GA 4N10A 2L57A 2RM5A 4MDCA 3IA1A 2JU5A 1XWGA 3G9BA 5G5FA 1WJKA 3VWWA 1TJDA 3MIXA 1PX7A 3US3A 2LV3A 2VLVA 3APSA 1JZRA 1ZYPA 3HDCA 3EWLA 3FR6A 2IMEA 5H5SA 4XHMA 3A3TA 1K0DA 2IMIA 4IS0A 2C4JA 3TRXA 2DJ2A 4X43A 2GSSA 5DDLA 3ZMKA 1SD9A 1NW2A 4Q5FA 1OE8A 1MDKA 4G0IA 3UVTA 2R0CA 1AAZA 4OO5A 5HR2A 4WBRD 1FO5A 1PN9A 2EC4A 2EIRA 2B1KA 3U6VA 1ERUA 5JCGA 3Q19A 1PSQA 3E9JB 4N0VA 4TR4A 1BYEA 4FYCA 2C3NA 3DVXA 2WDUA 3WYWA 4KW6A 3TRQA 4I2TA 3RPPA 1BQ7A 13GSA 1PD21 4WR5A 1GTBA 4ICYA 4MJBA 2PERA 3ZL5A 5CNWA 4MP4A 2QGVA 2HRKA 3C1SA 2VL3A 3QAGA 2YWMA 3DGQA 2GTUA 2C0GA 3DKSA 2YJ7A 10GSA 3EINA 3GH9A 4ZB6A 3BCKA 5G1LA 1GSDA 4XCSA 3TKRA 3TJGA 2K8SA 3C7MA 4OFMA 2D2ZA 2FWHA 5IPHA 3TJKA 2OBIA 5HR0A 1U88A 1TI1A 5ECKB 1V2AA 2HNLA 1AW9A 2LRNA 2A4VA 4O92A 3ERFA 4KE3A 4L8EA 2H1BA 2J9HA 1XOAA 2CZ2A 3UBKA 1URMA 3ZMLA 1WRYA 2XBIA 2QA2A 1YF1A 2AYTA 1SU9A 3LWAA 5ECHB 3LYPA 4N11A 3HKRA 5JWRB 2I9HA 1TK5B 1EP7A 3ME7A 4ID0A 1VGLA 3ZIVA 3TOUA 3A2XA 1J9BA 1OC3A 1M0UA 1S3DA 1GULA 1ST9A 3I6AA 1Z5YE 3P7XA 1ZL9A 3TJFA 1RQMA 5F05A 5B8BA 1B4PA 3EPTA 3A5WA 5GAPD 1ERVA 1U3IA 4WBJA 4O5QA 3SWLA 3RHBA 1TK8B 3APOA 2L59A 3F9UA 1IYHA 1K0AA 1SKWB 2Z9SA 4YH2A 1YKCA 1EGOA 2KP2A 4YAPA 1F37A 19GSA 2ON7A 4XRAA 3PH9A 4KB3A 2C0FA 5A5KA 5G5EA 2GSQA 1J08A 3QFBC 1F6MC 4KNDA 1T4ZA 2GQKA 4MZCA 1OAZA 5GSSA 3KZQA 4DVCA 3R2QA 4MA9A 5CO3A 2H71A 2F51A 2HI7A 4BL7A 5B8AA 2C0EA 1ZOFA 2P0GA 2C0DA 2WFCA 2PN8A 3ZTLA 1N8JA 2FWGA 4BL7B 2GSRA 1G0TA 4LMWA 5ENUA 4GF0A 1YY7A 3L0HA 20GSA 4GXZA 3CSHA 4F0CA 1A24A 3GX8A 5ECIB 5GZZB 3LEFA 4KGIA 4MZWA 5KN2A 3UVHA 3KIJA 2VCTA 1TP9A 3QAVA 1GLQA 2H1GA 2PVOC 3F0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TXV A;  1WMJ A;  3IV4 A;  1TKD B;  5DAL A;  3P2A A;  3C73 A;  5D9V A;  1T1V A;  2JSY A;  5B6M A;  1K0C A;  1SK0 A;  1DSB A;  1DUG A;  1ZYE A;  3E0U A;  4LL4 B;  3FYG A;  5F07 A;  3LOR A;  7GSS A;  4E8E A;  1R4W A;  5D96 A;  5ECO B;  2CVK A;  4GRF A;  4MK3 A;  3TJB A;  3GIX A;  3LGC A;  4NHZ A;  4CHS A;  4PX1 A;  3ZZX A;  2WS2 A;  1WP0 A;  4TW5 A;  1OVN A;  3RAZ A;  1VF3 A;  5IOX A;  14GS A;  2JAC A;  2M46 A;  1ILO A;  2LKU A;  5LD0 A;  1OYJ A;  1JZD A;  3HVV A;  5J5N A;  1RW1 A;  4GQC A;  4ZIL A;  4K0G A;  4ML6 A;  4WKW A;  2YWI A;  2CVB A;  4K7I A;  1FG4 A;  2LQO A;  3QCP A;  2M80 A;  4KAE A;  3CRU A;  1HNB A;  1GNE A;  2FNO A;  1GSQ A;  4RQX A;  4HDE A;  5IO2 A;  3N5O A;  4KDU A;  3K8N A;  4KSM A;  2VLU A;  2DBC A;  2G2Q A;  4K1F A;  1SJ6 A;  4ECJ A;  1O8W A;  1B8X A;  2IIY A;  1ZGN A;  1T7P B;  4GSS A;  2YAN A;  3QR6 A;  4F82 A;  2YOI A;  1SK2 A;  4L5O A;  3L9V A;  2M72 A;  5IMZ A;  6GSY A;  2H75 A;  4LLR A;  2CQ9 A;  4DSS A;  3IRA A;  5COH A;  4I8B A;  3UAR A;  1UN2 A;  2DML A;  3HCZ A;  5B7C A;  4ECI A;  1SKS B;  4ZBB A;  4DSS B;  3EVI A;  2GLR A;  1V98 A;  2L4Q A;  5KEJ A;  1QQ2 A;  3GTU B;  1B48 A;  4GSN A;  3WGD A;  2R2J A;  4IQA A;  2YPM A;  2IJY A;  4K7O A;  5H5Q A;  5ECS A;  3D22 A;  2CAI A;  5J41 A;  2VL2 A;  3WT1 A;  2JSZ A;  4KA0 A;  3BCI A;  1YEP A;  3F6F A;  2YWN A;  1TXX A;  2GGT A;  5G31 A;  4AJ7 A;  3MWH A;  1JHB A;  3UOM A;  2H74 A;  3F63 A;  4K8M A;  1S3A A;  5D93 A;  4N0Z A;  5HR1 A;  5DQY A;  1YF0 A;  3LSZ A;  1CQG A;  1VF1 A;  4HQS A;  1S3C A;  1FW1 A;  3GRX A;  3HJO A;  4K7N A;  5HQP A;  2NTO A;  2H19 A;  2TRC P;  1O85 A;  1GWC A;  2TIR A;  3TGZ A;  1Z7R A;  1SJI A;  1HNA A;  2HZE B;  4MJA A;  4G10 A;  1TRW A;  2JZS A;  2H1D A;  4IN0 A;  3WGX A;  1NSW A;  2H6Z A;  5LCZ A;  4JZQ A;  5EL8 A;  1LU4 A;  1W89 A;  4ZB9 A;  4KSO A;  3LFL A;  1GTU A;  1AC1 A;  2R5G A;  3EC3 A;  1SJZ A;  4OCF A;  4EVM A;  2ZUP A;  4OWY A;  4KUN A;  6GSS A;  2NBS A;  4X1U A;  3D4M A;  3BJ5 A;  4V2M A;  2KHP A;  1X5D A;  1M2D A;  2F3M A;  2K9F A;  2OJL A;  1G6Y A;  2LRC A;  1HD2 A;  1Y25 A;  4YAV A;  2EIQ A;  1NHO A;  2VCZ A;  2L5L A;  2GDR A;  4HQZ A;  5A4U A;  3H93 A;  1E6B A;  3D6I A;  3ZVJ A;  3HHV A;  3O3T A;  4WF5 A;  1OE7 A;  3RPN A;  3HD5 A;  1FAA A;  3CTG A;  4HEA 2;  2OAC A;  2XBQ A;  2ZCT A;  5FHI A;  2XPD A;  1T4Y A;  2H0G A;  4G19 A;  3VFI A;  5D73 A;  3NZN A;  3ED3 A;  5JWO B;  1U87 A;  1K0M A;  5AIV A;  5IOW A;  1V40 A;  1R5A A;  3FKF A;  3TKS C;  3VPQ A;  1YDK A;  5JWQ B;  3M9K A;  6GSW A;  2E2M A;  3MAK A;  3UJ1 A;  1M9B A;  4PNF A;  2LNT A;  2H70 A;  1QK8 A;  3GN3 A;  4MPF A;  2CV4 A;  2J23 A;  2NPB A;  2H0I A;  4WF4 A;  1GSY A;  5ECN B;  2IN3 A;  2JAD A;  4GWR A;  4E8H A;  12GS A;  1K3L A;  4ZBD A;  3A2V A;  2YWO A;  2IMD A;  4ECC A;  2F9S A;  3DVW A;  4BA7 A;  2CZ3 A;  3GUS A;  3GA4 A;  4HJ2 A;  3WGE A;  9GSS A;  1Q98 A;  3LXT A;  2IL3 A;  1PA3 A;  4NAX A;  1YEX A;  3GMF A;  2N5F A;  2VM1 A;  4K6X A;  2FA8 A;  3F4R A;  4IJI A;  1VF4 A;  3QPM A;  5J9B A;  1R7H A;  2VM2 A;  1ABA A;  1A2J A;  3F4T A;  1GUH A;  1OC8 A;  1ZYQ B;  3F4S A;  5IMV A;  3J7Y k;  5CAX A;  4ZIJ A;  3HZ8 A;  4J56 E;  2GZY A;  2MBT A;  1GTA A;  2GT6 A;  2DJJ A;  4EE0 A;  4F9Z A;  1MDJ A;  3LJR A;  2HXK A;  2V6O A;  5IMD A;  1EZK A;  1YZX A;  4WXT A;  1K3O A;  2JZT A;  4RUV A;  2GS3 A;  3TRP A;  2PBJ A;  4V2L A;  2H66 A;  3GFK A;  2O87 A;  1SL1 B;  3FY7 A;  3QD9 A;  2LST A;  2B5E A;  1I5G A;  4BWS A;  2LUS A;  1BED A;  2DMM A;  1F2E A;  1EWX A;  1KBN A;  4KDY A;  3DEX A;  3VK9 A;  1GH2 A;  4NXI A;  1SEN A;  3ME8 A;  4OMV A;  2VAF A;  2C80 A;  5GST A;  2R3X A;  2MYG A;  2RII A;  3ERW A;  3H8Q A;  3CMI A;  2GQL A;  3GKX A;  5EPF A;  4EC0 A;  1K0N A;  1SKR B;  3J7Y b;  3GKN A;  5IPG A;  1PL2 A;  1SYX A;  2FWE A;  2L6D A;  4GQF A;  2QSI A;  1EOG A;  4NPB A;  1IYI A;  3BD2 A;  1QXH A;  5DJL A;  4DSR A;  4PQ1 A;  2R37 A;  1V58 A;  3V1W A;  4PQI A;  4MLY A;  5E4W A;  4J57 E;  2VL9 A;  1EP8 A;  1JFU A;  1THO A;  4IW9 A;  1B4Q A;  1TDI A;  3UIW A;  3ZFB A;  1U3A A;  2ES7 A;  3IHQ A;  1FB6 A;  4WET A;  2PUK C;  4QL9 A;  4EXJ A;  5LNK e;  2FGX A;  3LG6 A;  3LYK A;  4F03 A;  3WT2 A;  2GST A;  3GHA A;  2N5B A;  2H1A A;  2C1Y A;  3C1R A;  4TR0 A;  3KD0 A;  4FYB A;  4HOJ A;  1XCC A;  4IP6 A;  2DJ1 A;  2TRX A;  5A4V A;  2HZF A;  2WB9 A;  1EEM A;  5KN3 A;  5CRD A;  4X0X A;  2OA7 A;  5EY6 A;  2WCI A;  2H01 A;  3CSJ A;  4HS1 A;  5IMA A;  1QGV A;  2MMO A;  2WRT A;  5C00 A;  2OE1 A;  1OC9 A;  2YCD A;  1ZCP A;  1XOB A;  2XHF A;  4EDZ A;  1XW6 A;  4LL1 B;  2F8A A;  1GSF A;  4PNG A;  2IPA A;  1OC9 B;  3PGT A;  3GX0 A;  2K8V A;  5G2Z A;  1XWK A;  3ZRE A;  1G7O A;  17GS A;  3Q18 A;  5F8B A;  1B9Y C;  4IVF A;  4PUR A;  3D4T A;  4CDO A;  5CRE A;  1O81 A;  1M2B A;  3ZFL A;  1YKA A;  1XWA A;  2GQM A;  2MMN A;  4ZL7 A;  1PKZ A;  1DE1 A;  2MBS A;  5A4W A;  3VI7 A;  3KTB A;  1TU7 A;  4KDX A;  1H4O A;  3NIV A;  5HFK A;  1X9M B;  5DAL B;  1JLV A;  1T8E B;  4EL1 A;  2B6M A;  2H8L A;  3QAW A;  4ACS A;  5AGY A;  4FIW A;  3VLN A;  3U5R E;  2HRN A;  4XRD A;  2VCV A;  2CX3 A;  2LJK A;  3TCO A;  4D73 A;  2KLX A;  2H30 A;  4V1A g;  4V1A p;  1G7E A;  3KP8 A;  5CYY A;  1CQH A;  3EUR A;  2GZZ A;  5ELA A;  4L5L A;  1M9A A;  1ZMA A;  4MZB A;  1BAY A;  4NHW A;  5J9C A;  1TU8 A;  3P90 A;  3CXG A;  3P8W A;  2GT5 A;  1DBY A;  4GST A;  2IMK A;  1KEB A;  4RI6 A;  3ZIJ A;  3FW2 A;  4ML1 A;  2HLS A;  1GUK A;  1BX9 A;  1EV9 A;  1FVK A;  4EO3 A;  3FK8 A;  1ZZY A;  3IK9 A;  1FOV A;  2KOK A;  2LRT A;  2QKE A;  5D8I A;  3M8N A;  5AIS A;  2LJR A;  2N5A A;  2VOC A;  3E3E A;  1GSU A;  4TVE A;  2FHE A;  1X9W B;  2QC7 A;  4HU9 A;  3F3Q A;  5JCU A;  5H5R A;  1WE0 A;  1V9W A;  1A23 A;  2BJX A;  3APQ A;  4MF5 A;  3M1G A;  4J2F A;  1TRS A;  1OKT A;  5D9W A;  4EUY A;  3ISO A;  3L4N A;  2CT6 A;  1XWB A;  3I69 A;  1O7U A;  2L4C A;  1ON4 A;  2GVP A;  3N9J A;  1TRV A;  4DSQ A;  2DIZ A;  3FR3 A;  5AIX A;  3BOA A;  1EGR A;  2O7K A;  4I5Q A;  1PQN A;  2P5Q A;  4ZB8 A;  3HVX A;  3DXB A;  1Z6N A;  4JED A;  4HJM A;  4XS6 A;  2L5O A;  5C04 A;  3IR4 A;  4I2U A;  1Z3E A;  3C8E A;  1AUC A;  1SL2 B;  2DLX A;  4XS1 A;  5DAK A;  1XZO A;  2HSH A;  2CVD A;  2G0F A;  5CRW A;  2FY6 A;  3IDV A;  3QFA C;  4FH8 A;  5DAK B;  4TR1 A;  1GSE A;  1PKW A;  3GUR A;  2PGT A;  4POK A;  1TTZ A;  4IJ3 A;  1R26 A;  2MZC A;  1X5C A;  1MD4 A;  4LA1 A;  4POB A;  4TR1 B;  2YV9 A;  3FZ9 A;  4YQM A;  3KMO A;  1TOF A;  1PX6 A;  5CP1 A;  4DEJ A;  4IBP A;  1MD3 A;  4YQU A;  2E7P A;  2CA8 A;  4IGJ A;  2OE3 A;  1QFN A;  2H72 A;  5F06 A;  6GSX A;  2C3Q A;  2AV4 A;  4L0W A;  2LS5 A;  4IP1 A;  1A0R P;  5INY A;  4OD7 A;  4HI7 A;  2X64 A;  4BVY A;  2MMA A;  1N2A A;  2CX4 A;  2DSA A;  3UMA A;  1Y6E A;  5L71 A;  2C3T A;  1GL8 A;  4K9Z A;  1LBK A;  1XVW A;  2B7K A;  1F3B A;  2K18 A;  4TRX A;  3EU3 A;  3CRT A;  1PL1 A;  2BMX A;  3L9U A;  2RLI A;  2XPE A;  4ZL8 A;  2WJU A;  2OBK A;  1SYR A;  3TKP A;  5HR3 A;  4EKZ A;  3KH7 A;  1G6W A;  3IXR A;  2LTK A;  3KJY A;  4L0U A;  2O85 A;  4NV2 A;  2HSY A;  4PUA A;  3ZVJ D;  2OAD A;  3UAP A;  5ECR B;  3VWV A;  3KH9 A;  2V6K A;  2LJA A;  2YP6 A;  1SL0 B;  5GAN D;  4Z7X A;  3QDN A;  3DIE A;  3GKK A;  2FLS A;  3D0Z A;  3ZYW A;  3Q6O A;  1X5E A;  4Q5R A;  4KX4 A;  3TKS A;  1ML6 A;  1W4V A;  3UL3 A;  2DJ0 A;  1XBS A;  4QL7 A;  4P3Y B;  4AF2 A;  1KTE A;  2AB6 A;  4NV5 A;  3G7Y A;  2EIO A;  4HU7 A;  2VCQ A;  1JZO A;  3GV1 A;  3HVS A;  4XTS A;  4MMM A;  1YJ6 A;  3TB2 A;  2VCW A;  5DCG A;  8GSS A;  1M7T A;  1ERW A;  2ALB A;  4TOP A;  1A0F A;  3EE2 A;  4NWY A;  2FA4 A;  1XWC A;  2V2G A;  4XIH A;  1NHY A;  4FYU A;  4MJC A;  3VPT A;  2PPT A;  1HNC A;  4TXO A;  3DD3 A;  1A2M A;  1GTI A;  4MF6 A;  3CYN A;  3VWX A;  2OKA A;  2X8G A;  2IWT A;  1GNW A;  2P5R A;  5J4U A;  4TXO B;  3VI5 A;  3TKQ A;  2FCH A;  4POM A;  3RDW A;  1AXD A;  3KCM A;  4ILF A;  2LQQ A;  1I9D A;  1JLW A;  2AHE A;  5IQY A;  1Z6M A;  2YJH A;  1DE2 A;  2P31 A;  3M9J A;  4JU5 A;  4I6X A;  2B7J A;  3IC4 A;  3KMN A;  2A2S A;  5J3R A;  4IQ1 A;  2FD3 A;  2F8F A;  1TK0 B;  5EVO A;  3IE3 A;  3FHK A;  1XW5 A;  1JZW A;  3IOS A;  2YZH A;  3W8J A;  5ECQ B;  2H6X A;  3ERG A;  3PR8 A;  3GYK A;  1K0B A;  3TOT A;  4N30 A;  3S9F A;  4EF0 A;  1J0F A;  1EV4 A;  1UVZ A;  3KM6 A;  1WIK A;  3WD6 A;  2VO4 A;  3UBL A;  5ECM B;  1ERT A;  2H73 A;  1F3A A;  2O8V B;  3I9V 2;  2VD1 A;  4RI7 A;  4XS4 A;  2V41 A;  4BPY A;  3GSS A;  1ACV A;  2CAQ A;  1FHE A;  3Q74 A;  3H79 A;  2DJ3 A;  2IMF A;  1XXU A;  2ZNM A;  2PU9 C;  2E2G A;  3EMX A;  4XS4 B;  4AGS A;  4GTU A;  1Z7P A;  4G9H A;  2HRF A;  1WPI A;  5DBQ A;  1FB0 A;  2A2R A;  4F2I A;  3O6T A;  3GL5 A;  2OE0 A;  4K2D A;  3F6D A;  1V57 A;  5CRG A;  2REM A;  3H4K A;  3HJM A;  2X99 A;  1TRU A;  3RBT A;  4GLT A;  2R6K A;  2FUG 2;  1X9S B;  1TW9 A;  5KN1 A;  2JL4 A;  3KTL A;  5B6N A;  5HFG A;  3FZ4 A;  5D9T A;  4O32 A;  2RUE A;  3QMX A;  1BG5 A;  4AJ8 A;  2K6V A;  1PGT A;  11GS A;  4IHU A;  1QUW A;  5G1K A;  5ECL B;  1M99 A;  4JRR A;  1GUM A;  1XFL A;  2I4A A;  3GNJ A;  2NVL A;  4LMV A;  5ELG A;  1BJX A;  3VWU A;  3EU4 A;  2V1M A;  1AIU A;  1THX A;  4PUF C;  1K0O A;  3C71 A;  3HY2 A;  1Q4J A;  3OR5 A;  3EMP A;  2B5Y A;  4ZXG A;  1HQO A;  5D9X A;  3D5J A;  3HJP A;  1WOU A;  4POL A;  1U6T A;  5F0G A;  3HXS A;  3DYR A;  2DC5 A;  1R5P A;  2MMZ A;  2VD0 A;  3SBC A;  3A2W A;  1MTC A;  3L9S A;  3M0F A;  2IFQ A;  5E59 A;  1GLP A;  3H1N A;  3UEM A;  3KEB A;  4RQR A;  3M3M A;  2IFQ B;  2I3Y A;  1UA5 A;  4EDY A;  3JCM L;  22GS A;  1C72 A;  1O73 A;  5DJM A;  3HYP A;  2VCX A;  3L78 A;  1GSS A;  2GZP A;  5DCH A;  1O8X A;  3W8S A;  1X0R A;  2WZ9 A;  4AJ6 A;  4BWQ A;  4K0N A;  4OO4 A;  1A2L A;  2X8C A;  4D73 B;  3KGK A;  2HE3 A;  4MAB A;  4TR3 A;  2YNX A;  3DML A;  3NOF A;  2NDO A;  1USB A;  2AAW A;  1T00 A;  5ABR A;  2LNS A;  3MSZ A;  4H86 A;  3HZ4 A;  4FO5 A;  3ZRD A;  4PQH A;  4ZBA A;  1F9M A;  4MF7 A;  4JR6 A;  5IM9 A;  3GH6 A;  2WGR A;  3FRC A;  1XW9 A;  4KCA A;  4JBB A;  3QOU A;  1MDI A;  1OKD A;  4GCI A;  2E0Q A;  4ISD A;  4TKY A;  3KXO A;  2C8U A;  3BBY A;  3CTF A;  1PRX A;  5FT3 A;  2I1U A;  2PWJ A;  3IBH A;  2BTO T;  1AQV A;  2DIY A;  3DRN A;  3IK7 A;  3MNG A;  2PMT A;  2R4V A;  4O7H A;  2VIM A;  1SK1 A;  3IPZ A;  2B3S A;  4Q5Q A;  2I81 A;  1YQ1 A;  4PGT A;  1FVJ A;  4JR4 A;  3GTU A;  2H6Y A;  3CBU A;  4PXO A;  3AY8 A;  5IMC A;  5DQS A;  2O89 A;  2VL2 C;  3F3R A;  5ID2 A;  3G7J A;  6GSV A;  3O76 A;  2LEG A;  3IAM 2;  4IKH A;  4HZ2 A;  3CSI A;  5FWG A;  4V2N A;  1H75 A;  3GST A;  1Z9H A;  1EEJ A;  5ID2 B;  16GS A;  2H76 A;  2B1L A;  2WUL A;  4MCU A;  3ZIT A;  3TJJ A;  1A8Y A;  2VUP A;  4ULX A;  4HUA A;  4WR4 A;  3TUE A;  1SD8 A;  1EOH A;  2YN1 A;  4OFN A;  2KP1 A;  2RM6 A;  3LQ7 A;  5IO0 A;  1O6J A;  5JCW A;  3IAS 2;  1AQW A;  2HZE A;  4KCE A;  2AJQ B;  3EYT A;  3I43 A;  4MPG A;  2H0H A;  2X8H A;  4KH7 A;  1LJR A;  3G7I A;  4YQV A;  4WEY A;  4ECB A;  4I97 A;  3FR9 A;  5IIZ A;  1GP1 A;  4BVX A;  2FWF A;  3KP9 A;  1B9X C;  3FZ5 A;  2V32 A;  2HFD A;  1VF2 A;  2AUV A;  2JZR A;  2L6C A;  4MH3 A;  5IMF A;  4CW9 A;  1GRX A;  5AN1 A;  1MEK A;  3RHC A;  1XPV A;  1UC7 A;  5ECP B;  4G2E A;  1VRS D;  2RUF A;  3F8U A;  4OCE A;  2HT9 A;  1AQX A;  4MH2 A;  5KN0 A;  5DVB A;  2ON5 A;  4QQ7 A;  4TN8 A;  5HFI A;  3D21 A;  3TKS E;  18GS A;  1QMV A;  2VLT A;  4NMU A;  4F0B A;  6GSU A;  3FZA A;  1RK4 A;  5CRH A;  2YZU A;  3DWV A;  1A8L A;  4Q5N A;  4MJE A;  4HZ4 A;  1TI3 A;  1XVQ A;  4O5R A;  1KNG A;  2PVQ A;  1T3B A;  2KUC A;  1M2A A;  3MDK A;  3HA9 A;  2DJK A;  1K3Y A;  1E2Y A;  2HYX A;  3PIN A;  3TDG A;  3GKM A;  3VUR A;  2YV7 A;  3ZLP A;  3GL3 A;  2XC2 A;  5G30 A;  2B5X A;  4JE1 A;  6GST A;  1PMT A;  3FEU A;  1XIY A;  4OFT A;  3LXZ A;  4IEL A;  1NM3 A;  1WWJ A;  1HYU A;  4ZL9 A;  3W6G A;  4N10 A;  2L57 A;  2RM5 A;  4MDC A;  3IA1 A;  2JU5 A;  1XWG A;  3G9B A;  5G5F A;  1WJK A;  3VWW A;  1TJD A;  1PX7 A;  3US3 A;  2LV3 A;  2VLV A;  3APS A;  1JZR A;  3HDC A;  3EWL A;  3FR6 A;  2IME A;  5H5S A;  4XHM A;  3A3T A;  1K0D A;  2IMI A;  4IS0 A;  2C4J A;  3TRX A;  2DJ2 A;  4X43 A;  2GSS A;  5DDL A;  3ZMK A;  1SD9 A;  1NW2 A;  4Q5F A;  1OE8 A;  1MDK A;  3UVT A;  1AAZ A;  4OO5 A;  5HR2 A;  4WBR D;  1FO5 A;  1PN9 A;  2EC4 A;  2EIR A;  2B1K A;  3U6V A;  1ERU A;  5JCG A;  3Q19 A;  1PSQ A;  3E9J B;  4N0V A;  4TR4 A;  1BYE A;  4FYC A;  2C3N A;  3DVX A;  2WDU A;  3WYW A;  4KW6 A;  3TRQ A;  4I2T A;  3RPP A;  1BQ7 A;  13GS A;  1PD2 1;  4WR5 A;  1GTB A;  4MJB A;  2PER A;  3ZL5 A;  5CNW A;  4MP4 A;  2QGV A;  3C1S A;  2VL3 A;  3QAG A;  2YWM A;  3DGQ A;  2GTU A;  2C0G A;  3DKS A;  2YJ7 A;  10GS A;  3EIN A;  3GH9 A;  4ZB6 A;  3BCK A;  5G1L A;  1GSD A;  4XCS A;  3TKR A;  3TJG A;  2K8S A;  3C7M A;  4OFM A;  2D2Z A;  2FWH A;  5IPH A;  3TJK A;  2OBI A;  5HR0 A;  1U88 A;  1TI1 A;  5ECK B;  1V2A A;  2HNL A;  1AW9 A;  2LRN A;  2A4V A;  4O92 A;  3ERF A;  4KE3 A;  4L8E A;  2H1B A;  2J9H A;  1XOA A;  2CZ2 A;  3UBK A;  1URM A;  3ZML A;  1WRY A;  2XBI A;  1YF1 A;  2AYT A;  1SU9 A;  3LWA A;  5ECH B;  3LYP A;  4N11 A;  3HKR A;  5JWR B;  2I9H A;  1TK5 B;  1EP7 A;  3ME7 A;  4ID0 A;  1VGL A;  3ZIV A;  3TOU A;  3A2X A;  1J9B A;  1OC3 A;  1M0U A;  1S3D A;  1GUL A;  1ST9 A;  3I6A A;  1Z5Y E;  3P7X A;  1ZL9 A;  3TJF A;  1RQM A;  5F05 A;  5B8B A;  1B4P A;  3A5W A;  5GAP D;  1ERV A;  1U3I A;  4WBJ A;  3SWL A;  3RHB A;  1TK8 B;  3APO A;  2L59 A;  3F9U A;  1IYH A;  1K0A A;  1SKW B;  2Z9S A;  4YH2 A;  1YKC A;  1EGO A;  2KP2 A;  4YAP A;  1F37 A;  19GS A;  2ON7 A;  4XRA A;  3PH9 A;  4KB3 A;  2C0F A;  5A5K A;  5G5E A;  2GSQ A;  1J08 A;  3QFB C;  1F6M C;  4KND A;  1T4Z A;  2GQK A;  4MZC A;  1OAZ A;  5GSS A;  3KZQ A;  4DVC A;  3R2Q A;  4MA9 A;  5CO3 A;  2H71 A;  2F51 A;  2HI7 A;  4BL7 A;  5B8A A;  2C0E A;  1ZOF A;  2P0G A;  2C0D A;  2WFC A;  2PN8 A;  3ZTL A;  1N8J A;  2FWG A;  2GSR A;  1G0T A;  4LMW A;  5ENU A;  4GF0 A;  1YY7 A;  3L0H A;  20GS A;  4GXZ A;  3CSH A;  4F0C A;  1A24 A;  3GX8 A;  5ECI B;  5GZZ B;  3LEF A;  4KGI A;  4MZW A;  5KN2 A;  3UVH A;  3KIJ A;  2VCT A;  1TP9 A;  3QAV A;  1GLQ A;  2H1G A;  2PVO C;  3F0I A; 
#chains in the Genus database with same CATH topology
 4TXV A;  1WMJ A;  5KOX A;  3IV4 A;  1TKD B;  5DAL A;  3P2A A;  3C73 A;  5D9V A;  1T1V A;  2JSY A;  5B6M A;  1K0C A;  4PTS A;  1SK0 A;  1DSB A;  1DUG A;  1ZYE A;  3E0U A;  4LL4 B;  3FYG A;  5F07 A;  3LOR A;  7GSS A;  4E8E A;  1R4W A;  5D96 A;  5ECO B;  2CVK A;  4GRF A;  4MK3 A;  3TJB A;  3GIX A;  3LGC A;  4NHZ A;  4CHS A;  4PX1 A;  3ZZX A;  2WS2 A;  1WP0 A;  4TW5 A;  1OVN A;  3RAZ A;  1VF3 A;  5IOX A;  14GS A;  2JAC A;  2M46 A;  1ILO A;  2LKU A;  5LD0 A;  1OYJ A;  1JZD A;  3HVV A;  5J5N A;  1RW1 A;  4GQC A;  4ZIL A;  4K0G A;  4ML6 A;  4WKW A;  2YWI A;  2CVB A;  4K7I A;  1FG4 A;  2LQO A;  3QCP A;  2M80 A;  4KAE A;  3CRU A;  1HNB A;  1GNE A;  2FNO A;  1GSQ A;  4RQX A;  4HDE A;  5IO2 A;  3N5O A;  4Z2T A;  4KDU A;  3K8N A;  4KSM A;  2VLU A;  4K5R A;  2DBC A;  2G2Q A;  4K1F A;  1SJ6 A;  4ECJ A;  1O8W A;  1B8X A;  2IIY A;  1ZGN A;  4EIQ A;  1T7P B;  4GSS A;  2YAN A;  3QR6 A;  4F82 A;  2YOI A;  4CY6 A;  1SK2 A;  4L5O A;  3L9V A;  2M72 A;  5IMZ A;  6GSY A;  2H75 A;  4LLR A;  2CQ9 A;  4DSS A;  3IRA A;  5COH A;  4I8B A;  2HRA A;  3UAR A;  1UN2 A;  2DML A;  3HCZ A;  5B7C A;  4ECI A;  1SKS B;  4ZBB A;  4DSS B;  3EVI A;  2GLR A;  1V98 A;  2L4Q A;  5KEJ A;  1QQ2 A;  3GTU B;  1B48 A;  4GSN A;  3WGD A;  2R2J A;  4IQA A;  5KOW A;  2YPM A;  2IJY A;  4K7O A;  5H5Q A;  5ECS A;  3D22 A;  2CAI A;  5J41 A;  2VL2 A;  3WT1 A;  2JSZ A;  4KA0 A;  3BCI A;  1YEP A;  1FOH A;  3F6F A;  2YWN A;  1TXX A;  2GGT A;  5G31 A;  4AJ7 A;  3MWH A;  1JHB A;  3UOM A;  2H74 A;  3F63 A;  3IHG A;  1S3A A;  4K8M A;  5D93 A;  4N0Z A;  5HR1 A;  5DQY A;  4Z2U A;  1YF0 A;  3LSZ A;  1CQG A;  1VF1 A;  4HQS A;  1S3C A;  1FW1 A;  3GRX A;  3HJO A;  4K7N A;  5HQP A;  2NTO A;  2DKI A;  2H19 A;  2TRC P;  1O85 A;  1GWC A;  2TIR A;  3TGZ A;  1Z7R A;  1SJI A;  1HNA A;  2HZE B;  4MJA A;  4G10 A;  1TRW A;  2JZS A;  2H1D A;  4IN0 A;  3WGX A;  1NSW A;  2H6Z A;  5LCZ A;  4JZQ A;  5EL8 A;  1LU4 A;  1W89 A;  4ZB9 A;  4KSO A;  3LFL A;  1GTU A;  1AC1 A;  2R5G A;  3EC3 A;  1SJZ A;  4OCF A;  4EVM A;  2ZUP A;  4OWY A;  4KUN A;  6GSS A;  2NBS A;  4X1U A;  5BMU A;  3D4M A;  3BJ5 A;  4V2M A;  2KHP A;  1X5D A;  1M2D A;  2F3M A;  2K9F A;  2OJL A;  1G6Y A;  2LRC A;  1HD2 A;  1Y25 A;  4YAV A;  2EIQ A;  1NHO A;  2VCZ A;  2L5L A;  2GDR A;  4HQZ A;  5A4U A;  3H93 A;  1E6B A;  3D6I A;  3ZVJ A;  3O3T A;  3HHV A;  2R0P A;  4WF5 A;  1OE7 A;  3RPN A;  3HD5 A;  1FAA A;  3CTG A;  4HEA 2;  2OAC A;  2XBQ A;  2ZCT A;  5FHI A;  2XPD A;  1T4Y A;  2H0G A;  4G19 A;  3VFI A;  5D73 A;  3NZN A;  3ED3 A;  5JWO B;  1PN0 A;  1U87 A;  1K0M A;  5AIV A;  5IOW A;  1V40 A;  1R5A A;  3FKF A;  3TKS C;  3VPQ A;  1YDK A;  5JWQ B;  3M9K A;  6GSW A;  2E2M A;  3MAK A;  3UJ1 A;  1M9B A;  4PNF A;  2LNT A;  2H70 A;  1QK8 A;  3FMW A;  3GN3 A;  4MPF A;  2CV4 A;  2J23 A;  2NPB A;  4FQU A;  2H0I A;  4WF4 A;  1GSY A;  5ECN B;  2IN3 A;  2JAD A;  4GWR A;  4E8H A;  12GS A;  1K3L A;  4ZBD A;  3A2V A;  4G0K A;  2YWO A;  2IMD A;  4ECC A;  2F9S A;  3DVW A;  4BA7 A;  2CZ3 A;  3GUS A;  3GA4 A;  4HJ2 A;  3WGE A;  9GSS A;  1Q98 A;  3LXT A;  2IL3 A;  1PA3 A;  4NAX A;  1YEX A;  3GMF A;  2N5F A;  2VM1 A;  4K6X A;  2FA8 A;  3F4R A;  4IJI A;  1VF4 A;  3QPM A;  5J9B A;  1R7H A;  2VM2 A;  1ABA A;  2UZ8 A;  1A2J A;  1S3R A;  3F4T A;  1GUH A;  1OC8 A;  1ZYQ B;  3F4S A;  5IMV A;  3J7Y k;  5CAX A;  4ZIJ A;  3HZ8 A;  4J56 E;  2GZY A;  2MBT A;  1GTA A;  4O5U A;  2GT6 A;  2DJJ A;  4EE0 A;  4F9Z A;  1MDJ A;  3LJR A;  2HXK A;  2V6O A;  5IMD A;  1EZK A;  1YZX A;  4WXT A;  1K3O A;  2JZT A;  4RUV A;  3A5I A;  2GS3 A;  3TRP A;  2PBJ A;  4V2L A;  2H66 A;  3GFK A;  2O87 A;  1SL1 B;  3FY7 A;  3QD9 A;  2LST A;  2B5E A;  1I5G A;  4BWS A;  2LUS A;  1BED A;  2DMM A;  1F2E A;  1EWX A;  1KBN A;  4KDY A;  3DEX A;  3VK9 A;  1GH2 A;  4NXI A;  1SEN A;  3ME8 A;  4OMV A;  2VAF A;  2C80 A;  5GST A;  2R3X A;  2MYG A;  2RII A;  3ERW A;  3H8Q A;  3CMI A;  2GQL A;  3GKX A;  5EPF A;  4EC0 A;  1K0N A;  1SKR B;  4EIP A;  3GKN A;  5IPG A;  3J7Y b;  1PL2 A;  1SYX A;  2FWE A;  2L6D A;  4GQF A;  2QSI A;  1EOG A;  4NPB A;  1IYI A;  3BD2 A;  1QXH A;  5DJL A;  4DSR A;  4PQ1 A;  2R37 A;  1V58 A;  3V1W A;  4PQI A;  4MLY A;  5E4W A;  4J57 E;  1ZYN A;  2VL9 A;  1EP8 A;  1JFU A;  1THO A;  4IW9 A;  1B4Q A;  1TDI A;  3UIW A;  3ZFB A;  1U3A A;  2ES7 A;  3IHQ A;  1FB6 A;  4WET A;  2PUK C;  4QL9 A;  4EXJ A;  5LNK e;  2X49 A;  2FGX A;  4K5S A;  3LG6 A;  3LYK A;  4F03 A;  3WT2 A;  2GST A;  3GHA A;  2N5B A;  2H1A A;  2C1Y A;  3C1R A;  4TR0 A;  3KD0 A;  4FYB A;  4HOJ A;  1XCC A;  4IP6 A;  2DJ1 A;  2TRX A;  5A4V A;  2HZF A;  2WB9 A;  1EEM A;  5KN3 A;  5CRD A;  4X0X A;  2OA7 A;  4K2X A;  5EY6 A;  2WCI A;  2H01 A;  3CSJ A;  4HS1 A;  5IMA A;  1QGV A;  2MMO A;  2WRT A;  5C00 A;  2OE1 A;  1OC9 A;  2YCD A;  1ZCP A;  1XOB A;  2XHF A;  4EDZ A;  1XW6 A;  4LL1 B;  2F8A A;  1GSF A;  4PNG A;  2IPA A;  1OC9 B;  3PGT A;  3GX0 A;  2K8V A;  5G2Z A;  1XWK A;  3ZRE A;  1G7O A;  17GS A;  3Q18 A;  5F8B A;  2X4A A;  1B9Y C;  4IVF A;  4PUR A;  3D4T A;  4CDO A;  5CRE A;  1O81 A;  1M2B A;  3ZFL A;  1YKA A;  1XWA A;  2GQM A;  2MMN A;  4ZL7 A;  1PKZ A;  3LW9 A;  1DE1 A;  2MBS A;  5A4W A;  3VI7 A;  3KTB A;  1TU7 A;  4KDX A;  1H4O A;  3NIV A;  5HFK A;  1X9M B;  5DAL B;  1JLV A;  1T8E B;  4EL1 A;  2B6M A;  2H8L A;  3QAW A;  4ACS A;  5AGY A;  4FIW A;  3VLN A;  3U5R E;  2HRN A;  4XRD A;  2VCV A;  2CX3 A;  2LJK A;  3TCO A;  4D73 A;  2KLX A;  2H30 A;  2HSM A;  4V1A g;  4V1A p;  1G7E A;  3KP8 A;  4HSC X;  5CYY A;  1CQH A;  3EUR A;  2GZZ A;  5ELA A;  4L5L A;  1M9A A;  1ZMA A;  4MZB A;  1BAY A;  4NHW A;  4MNN A;  5J9C A;  1TU8 A;  3P90 A;  3CXG A;  3P8W A;  2GT5 A;  3IC8 A;  1DBY A;  4GST A;  2IMK A;  4USS A;  1KEB A;  4RI6 A;  3ZIJ A;  3FW2 A;  4ML1 A;  2HLS A;  1GUK A;  1BX9 A;  4X4J A;  1EV9 A;  1FVK A;  4Z2R A;  4EO3 A;  3FK8 A;  1ZZY A;  3IK9 A;  1FOV A;  2KOK A;  2LRT A;  2QKE A;  5D8I A;  3M8N A;  2QA1 A;  5AIS A;  2LJR A;  2N5A A;  2VOC A;  3E3E A;  1GSU A;  4TVE A;  2FHE A;  1X9W B;  2QC7 A;  4HU9 A;  3F3Q A;  5JCU A;  5H5R A;  1WE0 A;  1V9W A;  1A23 A;  2BJX A;  3APQ A;  4MF5 A;  3M1G A;  4J2F A;  1TRS A;  1OKT A;  5D9W A;  4EUY A;  3ISO A;  3L4N A;  2CT6 A;  1XWB A;  3I69 A;  1O7U A;  2L4C A;  1ON4 A;  2GVP A;  3N9J A;  1TRV A;  4DSQ A;  2DIZ A;  3FR3 A;  5AIX A;  3BOA A;  1EGR A;  2O7K A;  4I5Q A;  1PQN A;  2P5Q A;  4ZB8 A;  3HVX A;  3DXB A;  1Z6N A;  4JED A;  4HJM A;  4XS6 A;  2L5O A;  5C04 A;  3IR4 A;  4I2U A;  1Z3E A;  3C8E A;  1AUC A;  1SL2 B;  2DLX A;  4XS1 A;  5DAK A;  1XZO A;  2HSH A;  2CVD A;  2G0F A;  5CRW A;  2FY6 A;  3IDV A;  3QFA C;  4FH8 A;  5DAK B;  4TR1 A;  1GSE A;  1PKW A;  3GUR A;  2PGT A;  4POK A;  1TTZ A;  4IJ3 A;  1R26 A;  2MZC A;  1X5C A;  1MD4 A;  4LA1 A;  4POB A;  4TR1 B;  2YV9 A;  3FZ9 A;  4YQM A;  3KMO A;  1TOF A;  1PX6 A;  5CP1 A;  4DEJ A;  4IBP A;  1MD3 A;  4YQU A;  2E7P A;  2CA8 A;  4IGJ A;  2OE3 A;  1QFN A;  2H72 A;  5F06 A;  6GSX A;  2C3Q A;  2AV4 A;  4L0W A;  2LS5 A;  4IP1 A;  1A0R P;  5INY A;  4OD7 A;  4HI7 A;  2X64 A;  4BVY A;  2MMA A;  1N2A A;  2CX4 A;  2DSA A;  3UMA A;  1Y6E A;  5L71 A;  2C3T A;  1GL8 A;  4K9Z A;  1LBK A;  1XVW A;  2B7K A;  1F3B A;  2K18 A;  4TRX A;  3EU3 A;  3CRT A;  1PL1 A;  2BMX A;  3L9U A;  2RLI A;  2XPE A;  4ZL8 A;  2WJU A;  2OBK A;  1SYR A;  3TKP A;  5HR3 A;  4EKZ A;  3KH7 A;  1G6W A;  3IXR A;  1M3I A;  2LTK A;  3KJY A;  4L0U A;  2O85 A;  4NV2 A;  2HSY A;  4PUA A;  3ZVJ D;  2OAD A;  3UAP A;  5ECR B;  3VWV A;  3KH9 A;  2V6K A;  2LJA A;  2YP6 A;  1SL0 B;  5GAN D;  4Z7X A;  3QDN A;  3DIE A;  3GKK A;  2FLS A;  3D0Z A;  3ZYW A;  3Q6O A;  1X5E A;  4Q5R A;  4KX4 A;  3TKS A;  1ML6 A;  1W4V A;  3UL3 A;  2DJ0 A;  1XBS A;  4QL7 A;  4P3Y B;  4AF2 A;  1KTE A;  2AB6 A;  4NV5 A;  3G7Y A;  2EIO A;  4HU7 A;  2VCQ A;  1JZO A;  3GV1 A;  3HVS A;  4XTS A;  4MMM A;  1YJ6 A;  3TB2 A;  2VCW A;  5DCG A;  8GSS A;  1M7T A;  1ERW A;  2ALB A;  4KF9 A;  4TOP A;  1A0F A;  3EE2 A;  4NWY A;  2FA4 A;  1XWC A;  2V2G A;  4XIH A;  1NHY A;  4FYU A;  4MJC A;  3VPT A;  2PPT A;  1HNC A;  4TXO A;  3DD3 A;  1A2M A;  1GTI A;  4YKF A;  4MF6 A;  3CYN A;  3VWX A;  2OKA A;  2X8G A;  2IWT A;  1GNW A;  2P5R A;  5J4U A;  4TXO B;  3VI5 A;  3TKQ A;  2FCH A;  4POM A;  3RDW A;  1AXD A;  3KCM A;  4ILF A;  2LQQ A;  1I9D A;  1JLW A;  2AHE A;  5IQY A;  1Z6M A;  2YJH A;  1DE2 A;  2P31 A;  3M9J A;  4JU5 A;  4I6X A;  2B7J A;  3IC4 A;  3KMN A;  2A2S A;  5J3R A;  4IQ1 A;  2FD3 A;  2F8F A;  1TK0 B;  5EVO A;  3IE3 A;  3FHK A;  1XW5 A;  1JZW A;  3IOS A;  2YZH A;  3W8J A;  5ECQ B;  2H6X A;  3ERG A;  3PR8 A;  3GYK A;  1K0B A;  3TOT A;  4N30 A;  4A5P A;  3S9F A;  4EF0 A;  1J0F A;  1EV4 A;  1UVZ A;  3KM6 A;  1WIK A;  3WD6 A;  2VO4 A;  3UBL A;  3PPU A;  5ECM B;  2DKH A;  1ERT A;  4G0L A;  2H73 A;  1F3A A;  2O8V B;  3I9V 2;  2VD1 A;  4RI7 A;  4XS4 A;  2V41 A;  4BPY A;  3GSS A;  1ACV A;  2CAQ A;  1FHE A;  3Q74 A;  3H79 A;  2DJ3 A;  2IMF A;  1XXU A;  2ZNM A;  2PU9 C;  2E2G A;  3EMX A;  4XS4 B;  4AGS A;  4GTU A;  1Z7P A;  4G9H A;  2HRF A;  1WPI A;  5DBQ A;  1FB0 A;  2A2R A;  4F2I A;  3O6T A;  3GL5 A;  2OE0 A;  4K2D A;  3F6D A;  4BIK A;  1V57 A;  5CRG A;  2REM A;  3H4K A;  3HJM A;  2X99 A;  1TRU A;  3RBT A;  4GLT A;  2R6K A;  2FUG 2;  1X9S B;  1TW9 A;  5KN1 A;  2JL4 A;  3KTL A;  5B6N A;  5HFG A;  3FZ4 A;  5D9T A;  4O32 A;  2RUE A;  3QMX A;  1BG5 A;  4AJ8 A;  2K6V A;  1PGT A;  11GS A;  4IHU A;  1QUW A;  5G1K A;  5ECL B;  1M99 A;  4JRR A;  1GUM A;  1XFL A;  2I4A A;  3GNJ A;  2NVL A;  4LMV A;  5ELG A;  1BJX A;  3VWU A;  3EU4 A;  2V1M A;  1AIU A;  1THX A;  4PUF C;  1K0O A;  3C71 A;  3HY2 A;  1Q4J A;  3OR5 A;  3EMP A;  2B5Y A;  4ZXG A;  1HQO A;  5D9X A;  3D5J A;  3HJP A;  1WOU A;  4POL A;  2A4H A;  1U6T A;  5F0G A;  3HXS A;  3DYR A;  2DC5 A;  1R5P A;  2MMZ A;  2VD0 A;  3SBC A;  3A2W A;  1MTC A;  3L9S A;  3M0F A;  2IFQ A;  5E59 A;  1XG8 A;  1GLP A;  3H1N A;  3UEM A;  3KEB A;  4RQR A;  3M3M A;  2IFQ B;  2I3Y A;  1UA5 A;  4EDY A;  3JCM L;  22GS A;  1C72 A;  1O73 A;  5DJM A;  3CQF A;  3HYP A;  2VCX A;  3L78 A;  1GSS A;  2GZP A;  5DCH A;  1O8X A;  3W8S A;  1X0R A;  2WZ9 A;  4AJ6 A;  4BWQ A;  4K0N A;  4OO4 A;  2A2P A;  1A2L A;  2X8C A;  4D73 B;  3KGK A;  2HE3 A;  4MAB A;  4TR3 A;  2YNX A;  3DML A;  3NOF A;  2NDO A;  1USB A;  2AAW A;  1T00 A;  5ABR A;  2LNS A;  3MSZ A;  4H86 A;  3HZ4 A;  4FO5 A;  3ZRD A;  4PQH A;  4ZBA A;  1F9M A;  4MF7 A;  4JR6 A;  5IM9 A;  3GH6 A;  2WGR A;  3FRC A;  1XW9 A;  4KCA A;  4JBB A;  3QOU A;  1MDI A;  1OKD A;  4GCI A;  2E0Q A;  4ISD A;  4TKY A;  3KXO A;  2C8U A;  3BBY A;  3CTF A;  1PRX A;  4CY8 A;  5FT3 A;  3MYD A;  2I1U A;  2PWJ A;  3IBH A;  2BTO T;  1AQV A;  2DIY A;  3DRN A;  3IK7 A;  3MNG A;  2PMT A;  2R4V A;  4O7H A;  2VIM A;  1SK1 A;  3IPZ A;  2B3S A;  4Q5Q A;  2I81 A;  1YQ1 A;  4PGT A;  1FVJ A;  4JR4 A;  3GTU A;  2H6Y A;  3CBU A;  4PXO A;  3AY8 A;  5IMC A;  5DQS A;  2O89 A;  2VL2 C;  3F3R A;  5ID2 A;  3G7J A;  6GSV A;  3O76 A;  2LEG A;  3IAM 2;  4IKH A;  4HZ2 A;  3CSI A;  5FWG A;  4V2N A;  1H75 A;  3GST A;  1M3J A;  1Z9H A;  1EEJ A;  5ID2 B;  16GS A;  2H76 A;  2B1L A;  2WUL A;  4MCU A;  3ZIT A;  5BRT A;  3TJJ A;  1A8Y A;  2VUP A;  4ULX A;  4HUA A;  4WR4 A;  3TUE A;  1SD8 A;  1EOH A;  2YN1 A;  4OFN A;  2KP1 A;  2RM6 A;  3LQ7 A;  5IO0 A;  1O6J A;  5JCW A;  3IAS 2;  1AQW A;  2HZE A;  4KCE A;  2AJQ B;  3EYT A;  3I43 A;  4MPG A;  2H0H A;  2X8H A;  4KH7 A;  1LJR A;  3G7I A;  4YQV A;  4WEY A;  4ECB A;  1PFO A;  4I97 A;  3FR9 A;  5IIZ A;  1GP1 A;  4BVX A;  2FWF A;  3KP9 A;  1B9X C;  3FZ5 A;  2V32 A;  2HFD A;  1VF2 A;  2AUV A;  2JZR A;  2L6C A;  4MH3 A;  4BVX B;  5IMF A;  4CW9 A;  1GRX A;  5AN1 A;  1MEK A;  3RHC A;  1XPV A;  1UC7 A;  5ECP B;  4G2E A;  1VRS D;  4BVY B;  2RUF A;  3F8U A;  4OCE A;  2HT9 A;  1AQX A;  4MH2 A;  5KN0 A;  5DVB A;  2ON5 A;  4QQ7 A;  4TN8 A;  5HFI A;  3D21 A;  3TKS E;  18GS A;  1QMV A;  2VLT A;  3HVN A;  4NMU A;  4F0B A;  6GSU A;  3FZA A;  1RK4 A;  5CRH A;  2YZU A;  3DWV A;  1A8L A;  4Q5N A;  4MJE A;  4HZ4 A;  1TI3 A;  1XVQ A;  4O5R A;  1KNG A;  2PVQ A;  1T3B A;  2R0G A;  2KUC A;  1M2A A;  3MDK A;  3HA9 A;  2DJK A;  1K3Y A;  1E2Y A;  2HYX A;  3PIN A;  3TDG A;  3R3E A;  3GKM A;  3VUR A;  2YV7 A;  3ZLP A;  3GL3 A;  2XC2 A;  4YKG A;  5G30 A;  2B5X A;  4JE1 A;  6GST A;  1PMT A;  3FEU A;  1XIY A;  4OFT A;  3LXZ A;  4IEL A;  1NM3 A;  1WWJ A;  1HYU A;  4ZL9 A;  3W6G A;  4N10 A;  2L57 A;  2RM5 A;  4MDC A;  3IA1 A;  2JU5 A;  1XWG A;  3G9B A;  5G5F A;  1WJK A;  3VWW A;  1TJD A;  3MIX A;  1PX7 A;  3US3 A;  2LV3 A;  2VLV A;  3APS A;  1JZR A;  1ZYP A;  3HDC A;  3EWL A;  3FR6 A;  2IME A;  5H5S A;  4XHM A;  3A3T A;  1K0D A;  2IMI A;  4IS0 A;  2C4J A;  3TRX A;  2DJ2 A;  4X43 A;  2GSS A;  5DDL A;  3ZMK A;  1SD9 A;  1NW2 A;  4Q5F A;  1OE8 A;  1MDK A;  4G0I A;  3UVT A;  2R0C A;  1AAZ A;  4OO5 A;  5HR2 A;  4WBR D;  1FO5 A;  1PN9 A;  2EC4 A;  2EIR A;  2B1K A;  3U6V A;  1ERU A;  5JCG A;  3Q19 A;  1PSQ A;  3E9J B;  4N0V A;  4TR4 A;  1BYE A;  4FYC A;  2C3N A;  3DVX A;  2WDU A;  3WYW A;  4KW6 A;  3TRQ A;  4I2T A;  3RPP A;  1BQ7 A;  13GS A;  1PD2 1;  4WR5 A;  1GTB A;  4ICY A;  4MJB A;  2PER A;  3ZL5 A;  5CNW A;  4MP4 A;  2QGV A;  2HRK A;  3C1S A;  2VL3 A;  3QAG A;  2YWM A;  3DGQ A;  2GTU A;  2C0G A;  3DKS A;  2YJ7 A;  10GS A;  3EIN A;  3GH9 A;  4ZB6 A;  3BCK A;  5G1L A;  1GSD A;  4XCS A;  3TKR A;  3TJG A;  2K8S A;  3C7M A;  4OFM A;  2D2Z A;  2FWH A;  5IPH A;  3TJK A;  2OBI A;  5HR0 A;  1U88 A;  1TI1 A;  5ECK B;  1V2A A;  2HNL A;  1AW9 A;  2LRN A;  2A4V A;  4O92 A;  3ERF A;  4KE3 A;  4L8E A;  2H1B A;  2J9H A;  1XOA A;  2CZ2 A;  3UBK A;  1URM A;  3ZML A;  1WRY A;  2XBI A;  2QA2 A;  1YF1 A;  2AYT A;  1SU9 A;  3LWA A;  5ECH B;  3LYP A;  4N11 A;  3HKR A;  5JWR B;  2I9H A;  1TK5 B;  1EP7 A;  3ME7 A;  4ID0 A;  1VGL A;  3ZIV A;  3TOU A;  3A2X A;  1J9B A;  1OC3 A;  1M0U A;  1S3D A;  1GUL A;  1ST9 A;  3I6A A;  1Z5Y E;  3P7X A;  1ZL9 A;  3TJF A;  1RQM A;  5F05 A;  5B8B A;  1B4P A;  3EPT A;  3A5W A;  5GAP D;  1ERV A;  1U3I A;  4WBJ A;  4O5Q A;  3SWL A;  3RHB A;  1TK8 B;  3APO A;  2L59 A;  3F9U A;  1IYH A;  1K0A A;  1SKW B;  2Z9S A;  4YH2 A;  1YKC A;  1EGO A;  2KP2 A;  4YAP A;  1F37 A;  19GS A;  2ON7 A;  4XRA A;  3PH9 A;  4KB3 A;  2C0F A;  5A5K A;  5G5E A;  2GSQ A;  1J08 A;  3QFB C;  1F6M C;  4KND A;  1T4Z A;  2GQK A;  4MZC A;  1OAZ A;  5GSS A;  3KZQ A;  4DVC A;  3R2Q A;  4MA9 A;  5CO3 A;  2H71 A;  2F51 A;  2HI7 A;  4BL7 A;  5B8A A;  2C0E A;  1ZOF A;  2P0G A;  2C0D A;  2WFC A;  2PN8 A;  3ZTL A;  1N8J A;  2FWG A;  4BL7 B;  2GSR A;  1G0T A;  4LMW A;  5ENU A;  4GF0 A;  1YY7 A;  3L0H A;  20GS A;  4GXZ A;  3CSH A;  4F0C A;  1A24 A;  3GX8 A;  5ECI B;  5GZZ B;  3LEF A;  4KGI A;  4MZW A;  5KN2 A;  3UVH A;  3KIJ A;  2VCT A;  1TP9 A;  3QAV A;  1GLQ A;  2H1G A;  2PVO C;  3F0I A; 
#chains in the Genus database with same CATH homology
 4TXV A;  1WMJ A;  5KOX A;  3IV4 A;  1TKD B;  5DAL A;  3P2A A;  3C73 A;  5D9V A;  1T1V A;  2JSY A;  5B6M A;  1K0C A;  4PTS A;  1SK0 A;  1DSB A;  1DUG A;  1ZYE A;  3E0U A;  4LL4 B;  3FYG A;  5F07 A;  3LOR A;  7GSS A;  4E8E A;  1R4W A;  5D96 A;  5ECO B;  2CVK A;  4GRF A;  4MK3 A;  3TJB A;  3GIX A;  3LGC A;  4NHZ A;  4CHS A;  4PX1 A;  3ZZX A;  2WS2 A;  1WP0 A;  4TW5 A;  1OVN A;  3RAZ A;  1VF3 A;  5IOX A;  14GS A;  2JAC A;  2M46 A;  1ILO A;  2LKU A;  5LD0 A;  1OYJ A;  1JZD A;  3HVV A;  5J5N A;  1RW1 A;  4GQC A;  4ZIL A;  4K0G A;  4ML6 A;  4WKW A;  2YWI A;  2CVB A;  4K7I A;  1FG4 A;  2LQO A;  3QCP A;  2M80 A;  4KAE A;  3CRU A;  1HNB A;  1GNE A;  2FNO A;  1GSQ A;  4RQX A;  4HDE A;  5IO2 A;  3N5O A;  4Z2T A;  4KDU A;  3K8N A;  4KSM A;  2VLU A;  4K5R A;  2DBC A;  2G2Q A;  4K1F A;  1SJ6 A;  4ECJ A;  1O8W A;  1B8X A;  2IIY A;  1ZGN A;  4EIQ A;  1T7P B;  4GSS A;  2YAN A;  3QR6 A;  4F82 A;  2YOI A;  4CY6 A;  1SK2 A;  4L5O A;  3L9V A;  2M72 A;  5IMZ A;  6GSY A;  2H75 A;  4LLR A;  2CQ9 A;  4DSS A;  3IRA A;  5COH A;  4I8B A;  2HRA A;  3UAR A;  1UN2 A;  2DML A;  3HCZ A;  5B7C A;  4ECI A;  1SKS B;  4ZBB A;  4DSS B;  3EVI A;  2GLR A;  1V98 A;  2L4Q A;  5KEJ A;  1QQ2 A;  3GTU B;  1B48 A;  4GSN A;  3WGD A;  2R2J A;  4IQA A;  5KOW A;  2YPM A;  2IJY A;  4K7O A;  5H5Q A;  5ECS A;  3D22 A;  2CAI A;  5J41 A;  2VL2 A;  3WT1 A;  2JSZ A;  4KA0 A;  3BCI A;  1YEP A;  1FOH A;  3F6F A;  2YWN A;  1TXX A;  2GGT A;  5G31 A;  4AJ7 A;  3MWH A;  1JHB A;  3UOM A;  2H74 A;  3F63 A;  3IHG A;  1S3A A;  4K8M A;  5D93 A;  4N0Z A;  5HR1 A;  5DQY A;  4Z2U A;  1YF0 A;  3LSZ A;  1CQG A;  1VF1 A;  4HQS A;  1S3C A;  1FW1 A;  3GRX A;  3HJO A;  4K7N A;  5HQP A;  2NTO A;  2DKI A;  2H19 A;  2TRC P;  1O85 A;  1GWC A;  2TIR A;  3TGZ A;  1Z7R A;  1SJI A;  1HNA A;  2HZE B;  4MJA A;  4G10 A;  1TRW A;  2JZS A;  2H1D A;  4IN0 A;  3WGX A;  1NSW A;  2H6Z A;  5LCZ A;  4JZQ A;  5EL8 A;  1LU4 A;  1W89 A;  4ZB9 A;  4KSO A;  3LFL A;  1GTU A;  1AC1 A;  2R5G A;  3EC3 A;  1SJZ A;  4OCF A;  4EVM A;  2ZUP A;  4OWY A;  4KUN A;  6GSS A;  2NBS A;  4X1U A;  5BMU A;  3D4M A;  3BJ5 A;  4V2M A;  2KHP A;  1X5D A;  1M2D A;  2F3M A;  2K9F A;  2OJL A;  1G6Y A;  2LRC A;  1HD2 A;  1Y25 A;  4YAV A;  2EIQ A;  1NHO A;  2VCZ A;  2L5L A;  2GDR A;  4HQZ A;  5A4U A;  3H93 A;  1E6B A;  3D6I A;  3ZVJ A;  3O3T A;  3HHV A;  2R0P A;  4WF5 A;  1OE7 A;  3RPN A;  3HD5 A;  1FAA A;  3CTG A;  4HEA 2;  2OAC A;  2XBQ A;  2ZCT A;  5FHI A;  2XPD A;  1T4Y A;  2H0G A;  4G19 A;  3VFI A;  5D73 A;  3NZN A;  3ED3 A;  5JWO B;  1PN0 A;  1U87 A;  1K0M A;  5AIV A;  5IOW A;  1V40 A;  1R5A A;  3FKF A;  3TKS C;  3VPQ A;  1YDK A;  5JWQ B;  3M9K A;  6GSW A;  2E2M A;  3MAK A;  3UJ1 A;  1M9B A;  4PNF A;  2LNT A;  2H70 A;  1QK8 A;  3FMW A;  3GN3 A;  4MPF A;  2CV4 A;  2J23 A;  2NPB A;  4FQU A;  2H0I A;  4WF4 A;  1GSY A;  5ECN B;  2IN3 A;  2JAD A;  4GWR A;  4E8H A;  12GS A;  1K3L A;  4ZBD A;  3A2V A;  4G0K A;  2YWO A;  2IMD A;  4ECC A;  2F9S A;  3DVW A;  4BA7 A;  2CZ3 A;  3GUS A;  3GA4 A;  4HJ2 A;  3WGE A;  9GSS A;  1Q98 A;  3LXT A;  2IL3 A;  1PA3 A;  4NAX A;  1YEX A;  3GMF A;  2N5F A;  2VM1 A;  4K6X A;  2FA8 A;  3F4R A;  4IJI A;  1VF4 A;  3QPM A;  5J9B A;  1R7H A;  2VM2 A;  1ABA A;  2UZ8 A;  1A2J A;  3F4T A;  1GUH A;  1OC8 A;  1ZYQ B;  3F4S A;  5IMV A;  3J7Y k;  5CAX A;  4ZIJ A;  3HZ8 A;  4J56 E;  2GZY A;  2MBT A;  1GTA A;  4O5U A;  2GT6 A;  2DJJ A;  4EE0 A;  4F9Z A;  1MDJ A;  3LJR A;  2HXK A;  2V6O A;  5IMD A;  1EZK A;  1YZX A;  4WXT A;  1K3O A;  2JZT A;  4RUV A;  3A5I A;  2GS3 A;  3TRP A;  2PBJ A;  4V2L A;  2H66 A;  3GFK A;  2O87 A;  1SL1 B;  3FY7 A;  3QD9 A;  2LST A;  2B5E A;  1I5G A;  4BWS A;  2LUS A;  1BED A;  2DMM A;  1F2E A;  1EWX A;  1KBN A;  4KDY A;  3DEX A;  3VK9 A;  1GH2 A;  4NXI A;  1SEN A;  3ME8 A;  4OMV A;  2VAF A;  2C80 A;  5GST A;  2R3X A;  2MYG A;  2RII A;  3ERW A;  3H8Q A;  3CMI A;  2GQL A;  3GKX A;  5EPF A;  4EC0 A;  1K0N A;  1SKR B;  4EIP A;  3GKN A;  5IPG A;  3J7Y b;  1PL2 A;  1SYX A;  2FWE A;  2L6D A;  4GQF A;  2QSI A;  1EOG A;  4NPB A;  1IYI A;  3BD2 A;  1QXH A;  5DJL A;  4DSR A;  4PQ1 A;  2R37 A;  1V58 A;  3V1W A;  4PQI A;  4MLY A;  5E4W A;  4J57 E;  1ZYN A;  2VL9 A;  1EP8 A;  1JFU A;  1THO A;  4IW9 A;  1B4Q A;  1TDI A;  3UIW A;  3ZFB A;  1U3A A;  2ES7 A;  3IHQ A;  1FB6 A;  4WET A;  2PUK C;  4QL9 A;  4EXJ A;  5LNK e;  2X49 A;  2FGX A;  4K5S A;  3LG6 A;  3LYK A;  4F03 A;  3WT2 A;  2GST A;  3GHA A;  2N5B A;  2H1A A;  2C1Y A;  3C1R A;  4TR0 A;  3KD0 A;  4FYB A;  4HOJ A;  1XCC A;  4IP6 A;  2DJ1 A;  2TRX A;  5A4V A;  2HZF A;  2WB9 A;  1EEM A;  5KN3 A;  5CRD A;  4X0X A;  2OA7 A;  4K2X A;  5EY6 A;  2WCI A;  2H01 A;  3CSJ A;  4HS1 A;  5IMA A;  1QGV A;  2MMO A;  2WRT A;  5C00 A;  2OE1 A;  1OC9 A;  2YCD A;  1ZCP A;  1XOB A;  2XHF A;  4EDZ A;  1XW6 A;  4LL1 B;  2F8A A;  1GSF A;  4PNG A;  2IPA A;  1OC9 B;  3PGT A;  3GX0 A;  2K8V A;  5G2Z A;  1XWK A;  3ZRE A;  1G7O A;  17GS A;  3Q18 A;  5F8B A;  2X4A A;  1B9Y C;  4IVF A;  4PUR A;  3D4T A;  4CDO A;  5CRE A;  1O81 A;  1M2B A;  3ZFL A;  1YKA A;  1XWA A;  2GQM A;  2MMN A;  4ZL7 A;  1PKZ A;  3LW9 A;  1DE1 A;  2MBS A;  5A4W A;  3VI7 A;  3KTB A;  1TU7 A;  4KDX A;  1H4O A;  3NIV A;  5HFK A;  1X9M B;  5DAL B;  1JLV A;  1T8E B;  4EL1 A;  2B6M A;  2H8L A;  3QAW A;  4ACS A;  5AGY A;  4FIW A;  3VLN A;  3U5R E;  2HRN A;  4XRD A;  2VCV A;  2CX3 A;  2LJK A;  3TCO A;  4D73 A;  2KLX A;  2H30 A;  2HSM A;  4V1A g;  4V1A p;  1G7E A;  3KP8 A;  5CYY A;  1CQH A;  3EUR A;  2GZZ A;  5ELA A;  4L5L A;  1M9A A;  1ZMA A;  4MZB A;  1BAY A;  4NHW A;  4MNN A;  5J9C A;  1TU8 A;  3P90 A;  3CXG A;  3P8W A;  2GT5 A;  3IC8 A;  1DBY A;  4GST A;  2IMK A;  4USS A;  1KEB A;  4RI6 A;  3ZIJ A;  3FW2 A;  4ML1 A;  2HLS A;  1GUK A;  1BX9 A;  4X4J A;  1EV9 A;  1FVK A;  4Z2R A;  4EO3 A;  3FK8 A;  1ZZY A;  3IK9 A;  1FOV A;  2KOK A;  2LRT A;  2QKE A;  5D8I A;  3M8N A;  2QA1 A;  5AIS A;  2LJR A;  2N5A A;  2VOC A;  3E3E A;  1GSU A;  4TVE A;  2FHE A;  1X9W B;  2QC7 A;  4HU9 A;  3F3Q A;  5JCU A;  5H5R A;  1WE0 A;  1V9W A;  1A23 A;  2BJX A;  3APQ A;  4MF5 A;  3M1G A;  4J2F A;  1TRS A;  1OKT A;  5D9W A;  4EUY A;  3ISO A;  3L4N A;  2CT6 A;  1XWB A;  3I69 A;  1O7U A;  2L4C A;  1ON4 A;  2GVP A;  3N9J A;  1TRV A;  4DSQ A;  2DIZ A;  3FR3 A;  5AIX A;  3BOA A;  1EGR A;  2O7K A;  4I5Q A;  1PQN A;  2P5Q A;  4ZB8 A;  3HVX A;  3DXB A;  1Z6N A;  4JED A;  4HJM A;  4XS6 A;  2L5O A;  5C04 A;  3IR4 A;  4I2U A;  1Z3E A;  3C8E A;  1AUC A;  1SL2 B;  2DLX A;  4XS1 A;  5DAK A;  1XZO A;  2HSH A;  2CVD A;  2G0F A;  5CRW A;  2FY6 A;  3IDV A;  3QFA C;  4FH8 A;  5DAK B;  4TR1 A;  1GSE A;  1PKW A;  3GUR A;  2PGT A;  4POK A;  1TTZ A;  4IJ3 A;  1R26 A;  2MZC A;  1X5C A;  1MD4 A;  4LA1 A;  4POB A;  4TR1 B;  2YV9 A;  3FZ9 A;  4YQM A;  3KMO A;  1TOF A;  1PX6 A;  5CP1 A;  4DEJ A;  4IBP A;  1MD3 A;  4YQU A;  2E7P A;  2CA8 A;  4IGJ A;  2OE3 A;  1QFN A;  2H72 A;  5F06 A;  6GSX A;  2C3Q A;  2AV4 A;  4L0W A;  2LS5 A;  4IP1 A;  1A0R P;  5INY A;  4OD7 A;  4HI7 A;  2X64 A;  4BVY A;  2MMA A;  1N2A A;  2CX4 A;  2DSA A;  3UMA A;  1Y6E A;  5L71 A;  2C3T A;  1GL8 A;  4K9Z A;  1LBK A;  1XVW A;  2B7K A;  1F3B A;  2K18 A;  4TRX A;  3EU3 A;  3CRT A;  1PL1 A;  2BMX A;  3L9U A;  2RLI A;  2XPE A;  4ZL8 A;  2WJU A;  2OBK A;  1SYR A;  3TKP A;  5HR3 A;  4EKZ A;  3KH7 A;  1G6W A;  3IXR A;  2LTK A;  3KJY A;  4L0U A;  2O85 A;  4NV2 A;  2HSY A;  4PUA A;  3ZVJ D;  2OAD A;  3UAP A;  5ECR B;  3VWV A;  3KH9 A;  2V6K A;  2LJA A;  2YP6 A;  1SL0 B;  5GAN D;  4Z7X A;  3QDN A;  3DIE A;  3GKK A;  2FLS A;  3D0Z A;  3ZYW A;  3Q6O A;  1X5E A;  4Q5R A;  4KX4 A;  3TKS A;  1ML6 A;  1W4V A;  3UL3 A;  2DJ0 A;  1XBS A;  4QL7 A;  4P3Y B;  4AF2 A;  1KTE A;  2AB6 A;  4NV5 A;  3G7Y A;  2EIO A;  4HU7 A;  2VCQ A;  1JZO A;  3GV1 A;  3HVS A;  4XTS A;  4MMM A;  1YJ6 A;  3TB2 A;  2VCW A;  5DCG A;  8GSS A;  1M7T A;  1ERW A;  2ALB A;  4KF9 A;  4TOP A;  1A0F A;  3EE2 A;  4NWY A;  2FA4 A;  1XWC A;  2V2G A;  4XIH A;  1NHY A;  4FYU A;  4MJC A;  3VPT A;  2PPT A;  1HNC A;  4TXO A;  3DD3 A;  1A2M A;  1GTI A;  4YKF A;  4MF6 A;  3CYN A;  3VWX A;  2OKA A;  2X8G A;  2IWT A;  1GNW A;  2P5R A;  5J4U A;  4TXO B;  3VI5 A;  3TKQ A;  2FCH A;  4POM A;  3RDW A;  1AXD A;  3KCM A;  4ILF A;  2LQQ A;  1I9D A;  1JLW A;  2AHE A;  5IQY A;  1Z6M A;  2YJH A;  1DE2 A;  2P31 A;  3M9J A;  4JU5 A;  4I6X A;  2B7J A;  3IC4 A;  3KMN A;  2A2S A;  5J3R A;  4IQ1 A;  2FD3 A;  2F8F A;  1TK0 B;  5EVO A;  3IE3 A;  3FHK A;  1XW5 A;  1JZW A;  3IOS A;  2YZH A;  3W8J A;  5ECQ B;  2H6X A;  3ERG A;  3PR8 A;  3GYK A;  1K0B A;  3TOT A;  4N30 A;  4A5P A;  3S9F A;  4EF0 A;  1J0F A;  1EV4 A;  1UVZ A;  3KM6 A;  1WIK A;  3WD6 A;  2VO4 A;  3UBL A;  3PPU A;  5ECM B;  2DKH A;  1ERT A;  4G0L A;  2H73 A;  1F3A A;  2O8V B;  3I9V 2;  2VD1 A;  4RI7 A;  4XS4 A;  2V41 A;  4BPY A;  3GSS A;  1ACV A;  2CAQ A;  1FHE A;  3Q74 A;  3H79 A;  2DJ3 A;  2IMF A;  1XXU A;  2ZNM A;  2PU9 C;  2E2G A;  3EMX A;  4XS4 B;  4AGS A;  4GTU A;  1Z7P A;  4G9H A;  2HRF A;  1WPI A;  5DBQ A;  1FB0 A;  2A2R A;  4F2I A;  3O6T A;  3GL5 A;  2OE0 A;  4K2D A;  3F6D A;  1V57 A;  5CRG A;  2REM A;  3H4K A;  3HJM A;  2X99 A;  1TRU A;  3RBT A;  4GLT A;  2R6K A;  2FUG 2;  1X9S B;  1TW9 A;  5KN1 A;  2JL4 A;  3KTL A;  5B6N A;  5HFG A;  3FZ4 A;  5D9T A;  4O32 A;  2RUE A;  3QMX A;  1BG5 A;  4AJ8 A;  2K6V A;  1PGT A;  11GS A;  4IHU A;  1QUW A;  5G1K A;  5ECL B;  1M99 A;  4JRR A;  1GUM A;  1XFL A;  2I4A A;  3GNJ A;  2NVL A;  4LMV A;  5ELG A;  1BJX A;  3VWU A;  3EU4 A;  2V1M A;  1AIU A;  1THX A;  4PUF C;  1K0O A;  3C71 A;  3HY2 A;  1Q4J A;  3OR5 A;  3EMP A;  2B5Y A;  4ZXG A;  1HQO A;  5D9X A;  3D5J A;  3HJP A;  1WOU A;  4POL A;  2A4H A;  1U6T A;  5F0G A;  3HXS A;  3DYR A;  2DC5 A;  1R5P A;  2MMZ A;  2VD0 A;  3SBC A;  3A2W A;  1MTC A;  3L9S A;  3M0F A;  2IFQ A;  5E59 A;  1GLP A;  3H1N A;  3UEM A;  3KEB A;  4RQR A;  3M3M A;  2IFQ B;  2I3Y A;  1UA5 A;  4EDY A;  3JCM L;  22GS A;  1C72 A;  1O73 A;  5DJM A;  3HYP A;  2VCX A;  3L78 A;  1GSS A;  2GZP A;  5DCH A;  1O8X A;  3W8S A;  1X0R A;  2WZ9 A;  4AJ6 A;  4BWQ A;  4K0N A;  4OO4 A;  2A2P A;  1A2L A;  2X8C A;  4D73 B;  3KGK A;  2HE3 A;  4MAB A;  4TR3 A;  2YNX A;  3DML A;  3NOF A;  2NDO A;  1USB A;  2AAW A;  1T00 A;  5ABR A;  2LNS A;  3MSZ A;  4H86 A;  3HZ4 A;  4FO5 A;  3ZRD A;  4PQH A;  4ZBA A;  1F9M A;  4MF7 A;  4JR6 A;  5IM9 A;  3GH6 A;  2WGR A;  3FRC A;  1XW9 A;  4KCA A;  4JBB A;  3QOU A;  1MDI A;  1OKD A;  4GCI A;  2E0Q A;  4ISD A;  4TKY A;  3KXO A;  2C8U A;  3BBY A;  3CTF A;  1PRX A;  4CY8 A;  5FT3 A;  3MYD A;  2I1U A;  2PWJ A;  3IBH A;  2BTO T;  1AQV A;  2DIY A;  3DRN A;  3IK7 A;  3MNG A;  2PMT A;  2R4V A;  4O7H A;  2VIM A;  1SK1 A;  3IPZ A;  2B3S A;  4Q5Q A;  2I81 A;  1YQ1 A;  4PGT A;  1FVJ A;  4JR4 A;  3GTU A;  2H6Y A;  3CBU A;  4PXO A;  3AY8 A;  5IMC A;  5DQS A;  2O89 A;  2VL2 C;  3F3R A;  5ID2 A;  3G7J A;  6GSV A;  3O76 A;  2LEG A;  3IAM 2;  4IKH A;  4HZ2 A;  3CSI A;  5FWG A;  4V2N A;  1H75 A;  3GST A;  1Z9H A;  1EEJ A;  5ID2 B;  16GS A;  2H76 A;  2B1L A;  2WUL A;  4MCU A;  3ZIT A;  5BRT A;  3TJJ A;  1A8Y A;  2VUP A;  4ULX A;  4HUA A;  4WR4 A;  3TUE A;  1SD8 A;  1EOH A;  2YN1 A;  4OFN A;  2KP1 A;  2RM6 A;  3LQ7 A;  5IO0 A;  1O6J A;  5JCW A;  3IAS 2;  1AQW A;  2HZE A;  4KCE A;  2AJQ B;  3EYT A;  3I43 A;  4MPG A;  2H0H A;  2X8H A;  4KH7 A;  1LJR A;  3G7I A;  4YQV A;  4WEY A;  4ECB A;  4I97 A;  3FR9 A;  5IIZ A;  1GP1 A;  4BVX A;  2FWF A;  3KP9 A;  1B9X C;  3FZ5 A;  2V32 A;  2HFD A;  1VF2 A;  2AUV A;  2JZR A;  2L6C A;  4MH3 A;  4BVX B;  5IMF A;  4CW9 A;  1GRX A;  5AN1 A;  1MEK A;  3RHC A;  1XPV A;  1UC7 A;  5ECP B;  4G2E A;  1VRS D;  4BVY B;  2RUF A;  3F8U A;  4OCE A;  2HT9 A;  1AQX A;  4MH2 A;  5KN0 A;  5DVB A;  2ON5 A;  4QQ7 A;  4TN8 A;  5HFI A;  3D21 A;  3TKS E;  18GS A;  1QMV A;  2VLT A;  4NMU A;  4F0B A;  6GSU A;  3FZA A;  1RK4 A;  5CRH A;  2YZU A;  3DWV A;  1A8L A;  4Q5N A;  4MJE A;  4HZ4 A;  1TI3 A;  1XVQ A;  4O5R A;  1KNG A;  2PVQ A;  1T3B A;  2R0G A;  2KUC A;  1M2A A;  3MDK A;  3HA9 A;  2DJK A;  1K3Y A;  1E2Y A;  2HYX A;  3PIN A;  3TDG A;  3R3E A;  3GKM A;  3VUR A;  2YV7 A;  3ZLP A;  3GL3 A;  2XC2 A;  4YKG A;  5G30 A;  2B5X A;  4JE1 A;  6GST A;  1PMT A;  3FEU A;  1XIY A;  4OFT A;  3LXZ A;  4IEL A;  1NM3 A;  1WWJ A;  1HYU A;  4ZL9 A;  3W6G A;  4N10 A;  2L57 A;  2RM5 A;  4MDC A;  3IA1 A;  2JU5 A;  1XWG A;  3G9B A;  5G5F A;  1WJK A;  3VWW A;  1TJD A;  3MIX A;  1PX7 A;  3US3 A;  2LV3 A;  2VLV A;  3APS A;  1JZR A;  1ZYP A;  3HDC A;  3EWL A;  3FR6 A;  2IME A;  5H5S A;  4XHM A;  3A3T A;  1K0D A;  2IMI A;  4IS0 A;  2C4J A;  3TRX A;  2DJ2 A;  4X43 A;  2GSS A;  5DDL A;  3ZMK A;  1SD9 A;  1NW2 A;  4Q5F A;  1OE8 A;  1MDK A;  4G0I A;  3UVT A;  2R0C A;  1AAZ A;  4OO5 A;  5HR2 A;  4WBR D;  1FO5 A;  1PN9 A;  2EC4 A;  2EIR A;  2B1K A;  3U6V A;  1ERU A;  5JCG A;  3Q19 A;  1PSQ A;  3E9J B;  4N0V A;  4TR4 A;  1BYE A;  4FYC A;  2C3N A;  3DVX A;  2WDU A;  3WYW A;  4KW6 A;  3TRQ A;  4I2T A;  3RPP A;  1BQ7 A;  13GS A;  1PD2 1;  4WR5 A;  1GTB A;  4ICY A;  4MJB A;  2PER A;  3ZL5 A;  5CNW A;  4MP4 A;  2QGV A;  2HRK A;  3C1S A;  2VL3 A;  3QAG A;  2YWM A;  3DGQ A;  2GTU A;  2C0G A;  3DKS A;  2YJ7 A;  10GS A;  3EIN A;  3GH9 A;  4ZB6 A;  3BCK A;  5G1L A;  1GSD A;  4XCS A;  3TKR A;  3TJG A;  2K8S A;  3C7M A;  4OFM A;  2D2Z A;  2FWH A;  5IPH A;  3TJK A;  2OBI A;  5HR0 A;  1U88 A;  1TI1 A;  5ECK B;  1V2A A;  2HNL A;  1AW9 A;  2LRN A;  2A4V A;  4O92 A;  3ERF A;  4KE3 A;  4L8E A;  2H1B A;  2J9H A;  1XOA A;  2CZ2 A;  3UBK A;  1URM A;  3ZML A;  1WRY A;  2XBI A;  2QA2 A;  1YF1 A;  2AYT A;  1SU9 A;  3LWA A;  5ECH B;  3LYP A;  4N11 A;  3HKR A;  5JWR B;  2I9H A;  1TK5 B;  1EP7 A;  3ME7 A;  4ID0 A;  1VGL A;  3ZIV A;  3TOU A;  3A2X A;  1J9B A;  1OC3 A;  1M0U A;  1S3D A;  1GUL A;  1ST9 A;  3I6A A;  1Z5Y E;  3P7X A;  1ZL9 A;  3TJF A;  1RQM A;  5F05 A;  5B8B A;  1B4P A;  3EPT A;  3A5W A;  5GAP D;  1ERV A;  1U3I A;  4WBJ A;  4O5Q A;  3SWL A;  3RHB A;  1TK8 B;  3APO A;  2L59 A;  3F9U A;  1IYH A;  1K0A A;  1SKW B;  2Z9S A;  4YH2 A;  1YKC A;  1EGO A;  2KP2 A;  4YAP A;  1F37 A;  19GS A;  2ON7 A;  4XRA A;  3PH9 A;  4KB3 A;  2C0F A;  5A5K A;  5G5E A;  2GSQ A;  1J08 A;  3QFB C;  1F6M C;  4KND A;  1T4Z A;  2GQK A;  4MZC A;  1OAZ A;  5GSS A;  3KZQ A;  4DVC A;  3R2Q A;  4MA9 A;  5CO3 A;  2H71 A;  2F51 A;  2HI7 A;  4BL7 A;  5B8A A;  2C0E A;  1ZOF A;  2P0G A;  2C0D A;  2WFC A;  2PN8 A;  3ZTL A;  1N8J A;  2FWG A;  4BL7 B;  2GSR A;  1G0T A;  4LMW A;  5ENU A;  4GF0 A;  1YY7 A;  3L0H A;  20GS A;  4GXZ A;  3CSH A;  4F0C A;  1A24 A;  3GX8 A;  5ECI B;  5GZZ B;  3LEF A;  4KGI A;  4MZW A;  5KN2 A;  3UVH A;  3KIJ A;  2VCT A;  1TP9 A;  3QAV A;  1GLQ A;  2H1G A;  2PVO C;  3F0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...