3C73A

Structure of cehc variant resa
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
136
structure length
136
Chain Sequence
b'SDAPNFVLEDTNGKRIELSDLKGKGVFLNFWGTWCEHCKKEFPYMANQYKHFKSQGVEIVAVNVGESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLINPEGKVVKVVTGTMTESMIHDYMNLIKPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol-disulfide oxidoreductase resA
publication title Effects of substitutions in the CXXC active-site motif of the extracytoplasmic thioredoxin ResA.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 42
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3c73A00
4KA0A 4WR5A 1QMVA 4X1UA 2AYTA 2N5FA 3TOUA 3CMIA 2EIQA 3TKRA 4HQSA 1THOA 3ZL5A 3KEBA 1WPIA 2CA8A 5CRGA 3GFKA 4BPYA 1KBNA 2IJYA 4MABA 4GRFA 1JZRA 2O7KA 2CZ2A 2JU5A 4FH8A 1FW1A 2LNTA 3E3EA 2DIZA 1K0CA 1UC7A 4BVXA 3QR6A 2X99A 3CSIA 3M9JA 1ZL9A 1EOGA 2DIYA 2MZCA 1MDJA 3UOMA 4EKZA 3O3TA 4KDYA 1AQWA 1O73A 1AIUA 4J2FA 3P8WA 2FD3A 1EV4A 1NSWA 3FZ4A 1USBA 1Y6EA 2HT9A 1G6WA 2VL3A 4Z7XA 1BEDA 2C0EA 1HQOA 4OWYA 2VL2A 2K8VA 2FLSA 2C1YA 3C1SA 4EF0A 1PMTA 5HR2A 2H71A 3L9SA 2WCIA 4TRXA 4XTSA 2B5XA 2P31A 1J9BA 3VFIA 3ED3A 4PNFA 2L6CA 4G9HA 1GTBA 4KCAA 4F03A 3A2XA 1KTEA 3RPPA 4HU9A 1QUWA 5EL8A 5B6NA 1EGRA 3I69A 4RI7A 4V2LA 1DE1A 2YV7A 4ML6A 1V57A 1FB6A 1O8WA 1K0AA 1TRUA 4ILFA 4J56E 3P2AA 1SJIA 1M7TA 1TI3A 3HY2A 5D8IA 1S3AA 5B8AA 20GSA 2GLRA 1DSBA 4JRRA 3DGQA 4JZQA 3HZ8A 3HZ4A 1GSDA 4N10A 1SKSB 18GSA 5KN3A 2RUFA 2OA7A 4K0NA 2AHEA 1JZOA 3A5WA 1JLWA 3ZMLA 2IPAA 2C0GA 2VM1A 3IK7A 3GA4A 5D96A 5HR0A 4NMUA 3UVTA 5KEJA 4ECIA 3ZFBA 4EC0A 1GSSA 7GSSA 4OO4A 3US3A 3FZ5A 3I9V2 3P90A 1AAZA 4WEYA 4F2IA 1XZOA 5D9TA 3G9BA 2F51A 3KCMA 1TRWA 1K3YA 2CX4A 4OFTA 1ST9A 1E6BA 2GZZA 2IL3A 3UL3A 4HI7A 1ZYEA 4MPFA 1AW9A 3ZITA 5ECIB 4DSRA 1EZKA 1PGTA 1OAZA 1SENA 2IMKA 3E9JB 4ZB6A 4CDOA 3UAPA 2L5LA 5IM9A 1UA5A 2PBJA 3FR3A 2C3QA 5CRDA 3KM6A 4PGTA 3GUSA 5CNWA 5ECPB 3ERGA 1X9WB 5IO0A 3HJMA 2QKEA 3W8SA 3ZZXA 1WWJA 2JZSA 3GURA 2HXKA 4KNDA 2WB9A 4PNGA 2I9HA 1GULA 1NHYA 3IRAA 3TRPA 1B9YC 3LJRA 3EU4A 2YWOA 5LCZA 1RW1A 5CP1A 2NVLA 1T1VA 2I81A 2CVKA 4KGIA 9GSSA 5J5NA 4MF7A 3PR8A 5F0GA 4O32A 5DJMA 4L0WA 2KP1A 2MMAA 2N5AA 4GSNA 5D73A 4MF5A 2M46A 2MMOA 2R5GA 5CYYA 2X8GA 5C04A 3HDCA 4V1Ap 3VI5A 4IBPA 4F0BA 2HE3A 3CXGA 3MAKA 6GSTA 3BJ5A 2OE0A 1TU7A 4HEA2 5AISA 2B5YA 5DQSA 5GAPD 2IIYA 2RLIA 2GSTA 3HYPA 3MNGA 2YNXA 5AN1A 2H6YA 2PVQA 3QPMA 4IS0A 4NV2A 1WRYA 3GN3A 5JWRB 2DMLA 4WBRD 3VWUA 1JZDA 1X5EA 4YQVA 2P0GA 5F07A 1XWKA 1B4QA 2PN8A 1IYHA 1EEMA 3FR6A 5ECKB 5CO3A 2WDUA 3EC3A 5E4WA 3ZVJA 5KN2A 3HA9A 3ZTLA 1XFLA 3G7YA 5IMDA 1KNGA 4IVFA 3RPNA 2LTKA 3APSA 1XW6A 6GSWA 4G19A 1GUKA 1FAAA 1PQNA 4PURA 4H86A 5ECNB 1BAYA 5IMCA 3QAWA 1M0UA 2B7JA 2GSRA 1WP0A 3FRCA 4OFNA 1IYIA 1ERWA 1S3CA 2YANA 4DSSB 1URMA 3QOUA 4JBBA 4GTUA 3DVXA 3U5RE 1V40A 4BWSA 22GSA 2GGTA 3DMLA 4LA1A 1ERTA 1YZXA 4WF5A 3WGDA 1TU8A 3HXSA 1VF2A 5CRWA 4LL1B 2HFDA 3CSJA 4ISDA 5GSTA 1XW9A 3RAZA 3HVSA 1FO5A 4F0CA 2CAIA 2HRNA 3VWVA 2H1DA 4ECCA 2GT5A 5F8BA 3TB2A 2DMMA 2XPDA 4ZIJA 2KOKA 1M2BA 2LUSA 4DEJA 2BJXA 4HS1A 1PN9A 2HI7A 4K7NA 3N9JA 2H8LA 1AC1A 1EP8A 1VGLA 2Z9SA 2FCHA 3FW2A 6GSXA 3S9FA 1A0RP 1YQ1A 4BL7A 3DVWA 1T00A 1TTZA 4LLRA 5HFKA 2RUEA 1A2JA 2P5QA 2OE3A 4MZWA 4HDEA 3CYNA 4FYCA 3H79A 3D22A 1A0FA 3TJFA 1O6JA 2R6KA 3CBUA 3DXBA 3KTLA 5G5EA 1HNBA 2I1UA 1TJDA 4V2NA 4IQ1A 3A2WA 2JADA 4E8HA 5IQYA 3C8EA 4IJIA 1SK1A 1BYEA 2IMDA 3H4KA 1K0BA 3NZNA 3RBTA 3GTUA 3LWAA 4GXZA 3WGXA 1XOBA 1T7PB 2VD1A 3LQ7A 4GCIA 3TCOA 2FWEA 4WXTA 1B9XC 3FHKA 3FYGA 4GWRA 4RQRA 1NW2A 5DAKA 5A4UA 4D73B 2VM2A 2AV4A 4GLTA 1FG4A 4ZB9A 2C3TA 5IPHA 4OFMA 2VLVA 3KZQA 4TOPA 3GKXA 5HFGA 3VPQA 5IMFA 2GQLA 4TXOA 4ZL9A 3BBYA 3LYKA 1QGVA 3LXZA 1V98A 3IDVA 4IP6A 3C71A 3ERFA 2GDRA 2L59A 2R4VA 1GTUA 1YDKA 1OC9A 4IKHA 2H19A 3F6DA 3MWHA 1GUMA 3F8UA 2JZTA 1Z5YE 5IOWA 5DCGA 2H73A 1OE8A 1PL1A 3R2QA 3DWVA 1AQVA 2H72A 1RK4A 1XIYA 4HUAA 16GSA 4KDUA 2F3MA 3GKMA 1SKWB 4N30A 2J9HA 2A4VA 2RM6A 5AGYA 2CVDA 3GSSA 4PUFC 2AAWA 1ABAA 4YQMA 5B6MA 1A2LA 4KAEA 2AUVA 2FY6A 2V6OA 5B8BA 5J3RA 4ID0A 3MSZA 2QGVA 4MJBA 4KUNA 2ZUPA 4PX1A 1Z7RA 1AUCA 1MTCA 1R26A 4IJ3A 2O87A 4BVYA 1XPVA 3GL3A 2V2GA 3WD6A 1K0DA 1BG5A 5G2ZA 4L5OA 1ZYQB 4K6XA 2ES7A 3GTUB 3C1RA 1GSUA 4LMWA 6GSYA 1GTIA 1T4YA 2F8AA 4PQIA 1ZMAA 4N0VA 3F63A 4OD7A 5DAKB 3RHCA 4XS6A 3BOAA 3CTGA 4PUAA 2LV3A 2X8HA 5ECRB 1R7HA 2DC5A 1TKDB 1PKZA 2VLTA 5ENUA 1I9DA 4FO5A 3UJ1A 4MZCA 2HZFA 2PMTA 1W4VA 3U6VA 1BJXA 1NM3A 3QD9A 5EY6A 3FY7A 4TXOB 3H8QA 5DQYA 4ACSA 2CZ3A 2REMA 3APQA 3G7IA 3TGZA 3CTFA 1U88A 4OMVA 1WOUA 4FYBA 4F9ZA 4MCUA 3KP8A 2L4CA 4IQAA 5ABRA 4V2MA 3M3MA 2BMXA 4DSQA 3IOSA 2CAQA 2GQMA 5A4WA 1EV9A 2JSZA 1U87A 2VD0A 3QAGA 1H4OA 3F9UA 3D4TA 2R2JA 5ID2A 2DSAA 1GWCA 3UBLA 2V41A 1GRXA 2HLSA 5JCWA 5D93A 2GTUA 1OYJA 2R37A 2H1GA 4K0GA 3N5OA 1X9SB 3O76A 3ME8A 3KMOA 2MYGA 4G2EA 2FGXA 5L71A 4XS4A 3TRXA 2HNLA 1GH2A 4ZBDA 1F37A 2EC4A 3QFAC 3WT1A 3GV1A 3WYWA 4CHSA 4EDYA 1F2EA 2NPBA 3HJPA 1GNWA 1THXA 2MMZA 1V2AA 3M9KA 4ZL8A 3EMXA 3FEUA 4DVCA 4ZBBA 4O7HA 2X64A 4MJEA 5AIXA 5C00A 5A4VA 3L9UA 2FWHA 1GLPA 1RQMA 2LRTA 3ZRDA 1B48A 4XRDA 2OE1A 3VLNA 1YY7A 2VL2C 5J4UA 1XXUA 3KH9A 1HNAA 2JSYA 4LMVA 3HD5A 1Y25A 4EO3A 1JFUA 1WJKA 3G7JA 1Z6NA 1U3IA 1EP7A 3IV4A 2MBSA 6GSUA 1N2AA 5AIVA 2FWGA 2DJ3A 3HJOA 2FA4A 2HSHA 4JE1A 2IFQA 3J7Yk 1OE7A 3F4RA 2O85A 1ZOFA 2D2ZA 2IMFA 1HNCA 4NWYA 3I6AA 1J08A 2QC7A 1Q4JA 3KP9A 4QL7A 2B6MA 2B3SA 3SBCA 1T8EB 4HJMA 4ZBAA 4IP1A 2XBQA 3GNJA 3LGCA 2WRTA 5HFIA 4HU7A 2LQOA 4I97A 4Q5QA 5D9WA 4HOJA 2H1AA 1MD4A 5HQPA 2PUKC 4KSMA 3TDGA 5H5QA 2H0GA 3LSZA 1SYXA 3KD0A 3GL5A 2H75A 1YEXA 4POKA 2A2RA 2HSYA 2I4AA 2K6VA 4MJAA 4YAVA 2PVOC 1XWAA 1K3OA 3M8NA 5LNKe 2HYXA 2H6XA 1QQ2A 4MA9A 1YJ6A 2ON5A 2YZUA 1H75A 2H74A 3DRNA 1XWCA 3F4SA 2H70A 4HQZA 3F3RA 3L0HA 4ZILA 1X5DA 4KDXA 2CV4A 1O8XA 4YQUA 5IO2A 2LRNA 5IOXA 1TP9A 1JHBA 3FKFA 4NAXA 1XWGA 10GSA 1TOFA 2IN3A 3RDWA 2KHPA 4V1Ag 4I6XA 2LKUA 3NIVA 1ZCPA 4IELA 3VI7A 1EEJA 2VLUA 5DALA 1GSYA 1N8JA 1XVQA 2TRCP 4IW9A 1TI1A 2TRXA 1GLQA 3MDKA 4I8BA 2TIRA 4L8EA 4EVMA 1TXXA 4GSTA 1PA3A 4EE0A 3IPZA 1MD3A 5FT3A 5ELAA 2LJRA 3LG6A 4O5RA 1ZZYA 2NDOA 5DVBA 1M99A 4TR1A 1T3BA 5CREA 2VIMA 2V6KA 4K8MA 4MDCA 1FB0A 2C80A 1LBKA 4EUYA 3F4TA 2LS5A 3KJYA 3LFLA 2ZCTA 3ZREA 4TKYA 2G0FA 4GQCA 1XWBA 4ZB8A 5GZZB 2OJLA 1SYRA 2B1KA 1V9WA 1VF4A 1DUGA 2YJHA 2MBTA 3ERWA 2JZRA 1XW5A 2VOCA 3LEFA 1GUHA 4NXIA 2N5BA 13GSA 1PL2A 4O92A 4RUVA 2L57A 3WT2A 4MZBA 3UBKA 4KB3A 2YWIA 3KTBA 1YF1A 4FYUA 1GL8A 2PU9C 2OACA 4KCEA 4TR3A 3HCZA 2IMIA 2EIRA 2DJ0A 3IK9A 3LORA 2GSQA 1NHOA 3TJBA 3M1GA 3W6GA 6GSVA 2YWMA 4MK3A 3TOTA 2G2QA 3GX8A 2L6DA 2XPEA 2GVPA 4MPGA 3KMNA 1SL2B 1KEBA 2VCZA 4ULXA 4NPBA 3C7MA 3WGEA 4IN0A 1JZWA 4KH7A 1CQGA 3QAVA 1Q98A 2H01A 2DBCA 4MH2A 5KN0A 3BCKA 4RQXA 4RI6A 1QFNA 3TKQA 1F9MA 4IHUA 2P5RA 5GSSA 3D5JA 1GP1A 1V58A 3VURA 5LD0A 4GSSA 4TW5A 1ERVA 1G6YA 2OBKA 2H1BA 2K9FA 17GSA 1SL0B 2O8VB 4WF4A 12GSA 5FWGA 4ECJA 3TJGA 1DE2A 1SK2A 1Z9HA 1R4WA 3H93A 3Q18A 1XCCA 4PQHA 2F9SA 3ISOA 3ZMKA 2GZYA 3Q74A 3GH6A 3H1NA 4NV5A 3V1WA 2A2SA 4OCFA 2YP6A 3F0IA 3FR9A 4OCEA 2YN1A 3HHVA 1PD21 5JWOB 3FZAA 2CVBA 4CW9A 1LU4A 4KE3A 1F3BA 3BCIA 3NOFA 1OKTA 4TR4A 1M9AA 3KH7A 4GF0A 3GKNA 2LSTA 3APOA 1GNEA 1YF0A 4NHWA 1BX9A 4XHMA 2PERA 4YH2A 5KN1A 4WR4A 1QK8A 2H0HA 3AY8A 1GTAA 1K0OA 3GMFA 1PX6A 3DEXA 2VCQA 2GT6A 8GSSA 2IMEA 1TDIA 1M2DA 2WULA 2DJ1A 2O89A 4XIHA 1BQ7A 2FWFA 3FZ9A 3L4NA 1EGOA 2PPTA 1FOVA 5G30A 5B7CA 6GSSA 1E2YA 1WE0A 2YWNA 5JWQB 2VO4A 3VK9A 1X0RA 3DKSA 1O81A 1SD8A 3IAS2 3GRXA 3IHQA 4PQ1A 2CQ9A 2VCWA 2I3YA 1M9BA 4QQ7A 4X43A 2AB6A 4AF2A 4XS1A 1OC9B 3I43A 3EE2A 4TR0A 1A24A 3ZIVA 1MDKA 3ZIJA 2FNOA 1ML6A 2OKAA 3LXTA 5H5SA 3D6IA 5DCHA 4AJ6A 1TK0B 1SJZA 3CRUA 1SU9A 2YCDA 3SWLA 2R3XA 4ZL7A 5HR1A 4PXOA 4JR4A 4EL1A 3QFBC 2XBIA 1A8YA 3IBHA 1TRSA 1TK8B 1GSQA 2GS3A 4MJCA 3JCML 1U6TA 1ON4A 1TW9A 4GQFA 1SKRB 4ECBA 1U3AA 5JCGA 1VRSD 2VCXA 4XRAA 4TVEA 2B1LA 2B7KA 1EWXA 3ME7A 3EVIA 2B5EA 2M72A 5COHA 5G1KA 1FHEA 2HRFA 3IC4A 5IPGA 3KGKA 1DBYA 1FVKA 2YPMA 2OADA 3Q19A 2FHEA 4POLA 1ZGNA 5J9BA 2IWTA 1OC8A 1MEKA 5J9CA 3PINA 1G7EA 2ALBA 2H6ZA 2DJJA 3A2VA 1S3DA 4K9ZA 4IGJA 3L78A 3O6TA 2H30A 3HVXA 2E7PA 3A3TA 4X0XA 3IE3A 5D9VA 14GSA 1PRXA 5IMAA 4Q5RA 4WKWA 3EWLA 2OBIA 4HZ2A 2K8SA 1AXDA 1OKDA 3IAM2 1OVNA 3E0UA 1WMJA 1QXHA 2E2GA 5D9XA 4J57E 3VWXA 1M2AA 2ON7A 2VCVA 1XBSA 3C73A 1SL1B 1VF1A 5ECQB 3KXOA 1HD2A 5A5KA 2XC2A 5FHIA 2ZNMA 1J0FA 2WFCA 1F3AA 3GHAA 1A23A 5IMVA 2LQQA 1ACVA 3OR5A 1XVWA 4KX4A 2C0FA 4MF6A 5EVOA 1SJ6A 5ID2B 3PGTA 3P7XA 2H76A 4MMMA 4DSSA 1I5GA 4XCSA 4P3YB 2WJUA 4JU5A 2FUG2 3TKSA 4TN8A 3CSHA 1EOHA 2F8FA 2YZHA 3GX0A 2DJ2A 1LJRA 5ECOB 5G1LA 3ZFLA 2C8UA 3F3QA 2L4QA 2LEGA 2M80A 4XS4B 4TXVA 1A8LA 3D21A 4AJ8A 5G5FA 5DBQA 3QDNA 2JACA 3UMAA 4N11A 5F06A 1TRVA 1B4PA 2FA8A 2V1MA 4ZXGA 4MLYA 3TJKA 2KP2A 2H66A 2BTOT 5ECMB 4FIWA 2XHFA 2PWJA 5G31A 3GKKA 4BA7A 1UVZA 2PGTA 4BWQA 1F6MC 3EURA 4JR6A 1SD9A 1K0NA 2VAFA 3RHBA 1K3LA 2NTOA 1PX7A 2C0DA 2VL9A 5JCUA 1VF3A 4POMA 5CRHA 2NBSA 5CAXA 1UN2A 2C4JA 1AQXA 2CX3A 2LJAA 4I5QA 2C3NA 2GQKA 2DLXA 5INYA 3TKPA 1X9MB 3QCPA 2RIIA 3QMXA 4MH3A 4HJ2A 3UIWA 3VPTA 3TJJA 2YJ7A 3ZLPA 2KLXA 2IFQB 5ELGA 3D4MA 5EPFA 3TRQA 3UVHA 4G10A 3BD2A 1Z6MA 2GSSA 3UEMA 1YKAA 19GSA 2H0IA 1GSFA 3K8NA 5H5RA 1OC3A 2MMNA 3Q6OA 4ML1A 4HZ4A 3UARA 3DIEA 1G7OA 3DYRA 1A2MA 4KW6A 1ERUA 1CQHA 2HZEA 1W89A 2VCTA 4QL9A 3CRTA 4L0UA 4D73A 4WETA 5ECSA 4OO5A 3DD3A 2WZ9A 1R5PA 3D0ZA 5IIZA 1XOAA 1WIKA 2EIOA 1R5AA 3GYKA 3FK8A 1K0MA 5E59A 2QSIA 1YKCA 3TKSC 5F05A 3ZVJD 3IA1A 4EDZA 3EINA 1X5CA 4POBA 3W8JA 3J7Yb 1JLVA 5GAND 4K7OA 5ECLB 4K7IA 4YAPA 2RM5A 3IR4A 4Q5FA 2LNSA 2VUPA 3M0FA 1B8XA 4AGSA 2JL4A 4EXJA 2E2MA 11GSA 1Z7PA 2WGRA 3GIXA 4N0ZA 3LYPA 2K18A 4NHZA 4K2DA 3HKRA 5DJLA 1T4ZA 3IXRA 4L5LA 3EU3A 4AJ7A 1HYUA 4E8EA 3TKSE 1O85A 2J23A 3GH9A 5DALB 1PSQA 3TUEA 1SK0A 2LJKA 2AJQB 3PH9A 1ILOA 1PKWA 1GSEA 1YEPA 2WS2A 2E0QA 3EMPA 1C72A 1FVJA 2YOIA 3L9VA 2LRCA 2DJKA 4LL4B 5ECHB 3EYTA 2HZEB 5HR3A 4F82A 4WBJA 2GZPA 5IMZA 3F6FA 4I2UA 3VWWA 3HVVA 4KSOA 2KUCA 4K1FA 4MP4A 2YV9A 4TR1B 2V32A 2L5OA 4JEDA 1Z3EA 1O7UA 1TK5B 3ZYWA 1MDIA 4Q5NA 3GSTA 3KIJA 5J41A 5DDLA 2CT6A 1G0TA 2X8CA 4I2TA
chains in the Genus database with same CATH superfamily
4KA0A 4WR5A 1QMVA 4X1UA 2AYTA 2N5FA 3TOUA 3CMIA 2EIQA 3TKRA 4HQSA 1THOA 3ZL5A 3LW9A 3KEBA 1WPIA 2CA8A 5CRGA 3GFKA 4BPYA 1KBNA 2IJYA 4MABA 4GRFA 1JZRA 2O7KA 2CZ2A 2JU5A 4FH8A 1FW1A 2LNTA 3E3EA 2DIZA 1K0CA 1UC7A 4BVXA 4X4JA 3QR6A 2X99A 3CSIA 3M9JA 1ZL9A 1EOGA 2DIYA 2MZCA 1MDJA 3UOMA 4EKZA 3O3TA 4KDYA 1AQWA 1O73A 1AIUA 4J2FA 3P8WA 2FD3A 1EV4A 1NSWA 3FZ4A 1USBA 1Y6EA 2HT9A 1G6WA 2R0CA 2VL3A 4Z7XA 1BEDA 2C0EA 1HQOA 4OWYA 2VL2A 2K8VA 2FLSA 2C1YA 3C1SA 4EF0A 1PMTA 5HR2A 2H71A 3L9SA 2WCIA 4TRXA 4XTSA 2B5XA 2P31A 1J9BA 3VFIA 3ED3A 4PNFA 2L6CA 4G9HA 1GTBA 4O5QA 4KCAA 4F03A 3A2XA 1KTEA 3RPPA 4HU9A 1QUWA 5EL8A 5B6NA 1EGRA 3I69A 4RI7A 4V2LA 1DE1A 2YV7A 4ML6A 1V57A 1FB6A 1O8WA 1K0AA 1TRUA 4ILFA 4J56E 3P2AA 1SJIA 1M7TA 1TI3A 3HY2A 5D8IA 1S3AA 5B8AA 1ZYNA 20GSA 2GLRA 1DSBA 4JRRA 3DGQA 4JZQA 3HZ8A 3HZ4A 1GSDA 4N10A 1SKSB 18GSA 5KN3A 2RUFA 2OA7A 4K0NA 2AHEA 1JZOA 3A5WA 1JLWA 4K2XA 3ZMLA 2IPAA 2C0GA 2VM1A 3IK7A 3GA4A 5D96A 5HR0A 4NMUA 3UVTA 5KEJA 4ECIA 3FMWA 3ZFBA 4EC0A 1GSSA 7GSSA 4OO4A 2R0GA 3US3A 3FZ5A 3I9V2 3P90A 1AAZA 4WEYA 4F2IA 1XZOA 5D9TA 3G9BA 2F51A 3KCMA 1TRWA 1K3YA 2CX4A 4OFTA 1ST9A 1E6BA 2GZZA 2IL3A 3UL3A 4K5RA 4HI7A 1ZYEA 4MPFA 4O5UA 1AW9A 3ZITA 5ECIB 4DSRA 1EZKA 1PGTA 1OAZA 1SENA 2IMKA 3E9JB 4ZB6A 4CDOA 3UAPA 2L5LA 5IM9A 1UA5A 2PBJA 2HRKA 3FR3A 2C3QA 5CRDA 3KM6A 4PGTA 3GUSA 5CNWA 5ECPB 3ERGA 1X9WB 5IO0A 3HJMA 2QKEA 3W8SA 3ZZXA 1WWJA 2JZSA 3GURA 2HXKA 4KNDA 2WB9A 4PNGA 2I9HA 1GULA 1NHYA 3IRAA 3TRPA 1B9YC 3LJRA 3EU4A 2YWOA 5LCZA 1RW1A 5CP1A 2NVLA 1T1VA 2I81A 2CVKA 3PPUA 4KGIA 9GSSA 5J5NA 4MF7A 3PR8A 4ICYA 5F0GA 4O32A 5DJMA 4L0WA 2KP1A 2MMAA 4HSCX 2N5AA 4GSNA 5D73A 4MF5A 2M46A 2MMOA 2R5GA 5CYYA 2X8GA 5C04A 3HDCA 4V1Ap 3VI5A 4IBPA 4F0BA 2HE3A 3CXGA 3MAKA 6GSTA 3BJ5A 2OE0A 3IHGA 1TU7A 4HEA2 5AISA 2B5YA 5DQSA 5GAPD 2IIYA 2RLIA 2GSTA 3HYPA 3MNGA 2YNXA 5AN1A 2H6YA 2PVQA 3QPMA 4IS0A 4NV2A 1WRYA 3GN3A 5JWRB 2DMLA 4WBRD 3VWUA 1JZDA 1X5EA 4YQVA 2P0GA 5F07A 1XWKA 4MNNA 1B4QA 2PN8A 1IYHA 1EEMA 3FR6A 5ECKB 5CO3A 2WDUA 3EC3A 5E4WA 3ZVJA 5KN2A 3HA9A 3ZTLA 1XFLA 3G7YA 5IMDA 1KNGA 4IVFA 3RPNA 2LTKA 3APSA 1XW6A 6GSWA 4G19A 1GUKA 1FAAA 1PQNA 4PURA 4H86A 5ECNB 1BAYA 5IMCA 3QAWA 1M0UA 2B7JA 2GSRA 1WP0A 2A2PA 3FRCA 4Z2UA 4OFNA 1IYIA 1ERWA 1S3CA 2YANA 5BMUA 4DSSB 1URMA 3QOUA 4JBBA 4GTUA 3DVXA 3U5RE 1V40A 4BWSA 22GSA 2GGTA 3DMLA 4LA1A 1ERTA 1YZXA 4WF5A 4YKGA 3WGDA 1TU8A 3HXSA 1VF2A 5CRWA 4LL1B 2HFDA 3CSJA 4ISDA 5GSTA 1XW9A 3RAZA 3HVSA 1FO5A 4I2TA 2CAIA 4F0CA 2HRNA 3VWVA 2H1DA 4ECCA 2GT5A 1M3JA 5F8BA 3TB2A 2DMMA 2XPDA 4ZIJA 2KOKA 1M2BA 2LUSA 4DEJA 2BJXA 4HS1A 1PN9A 2HI7A 4K7NA 3N9JA 2H8LA 1AC1A 1EP8A 1VGLA 3MIXA 2DKHA 2Z9SA 4KF9A 2FCHA 3FW2A 6GSXA 3S9FA 1A0RP 1YQ1A 4BL7A 3DVWA 5KOXA 1T00A 1TTZA 4LLRA 5HFKA 2RUEA 1A2JA 2P5QA 2OE3A 4MZWA 4HDEA 3CYNA 4FYCA 3H79A 3D22A 1A0FA 4EIPA 4EIQA 3TJFA 1O6JA 2R6KA 3CBUA 3DXBA 3IC8A 3KTLA 5G5EA 5BRTA 1HNBA 2I1UA 1TJDA 4V2NA 4IQ1A 3A2WA 2JADA 4E8HA 5IQYA 3C8EA 4IJIA 1SK1A 1BYEA 2IMDA 3H4KA 1K0BA 3NZNA 3RBTA 3GTUA 3LWAA 4GXZA 3WGXA 1XOBA 1T7PB 3LQ7A 4GCIA 3HVNA 3TCOA 2FWEA 4WXTA 1B9XC 3FHKA 3FYGA 4GWRA 4RQRA 1NW2A 5DAKA 5A4UA 4D73B 2VM2A 2AV4A 4GLTA 1FG4A 4ZB9A 2C3TA 5IPHA 3EPTA 2VLVA 4OFMA 3KZQA 4TOPA 3GKXA 5HFGA 3VPQA 5IMFA 2GQLA 4TXOA 4ZL9A 3BBYA 3LYKA 2HRAA 1QGVA 3LXZA 1V98A 3IDVA 4IP6A 3C71A 3ERFA 2GDRA 2L59A 2R4VA 2UZ8A 1GTUA 1YDKA 1OC9A 4IKHA 2H19A 3F6DA 3MWHA 1GUMA 3F8UA 2JZTA 2X49A 1Z5YE 5IOWA 5DCGA 2H73A 1OE8A 1PL1A 3R2QA 3DWVA 1AQVA 2H72A 4BL7B 1RK4A 1XIYA 4HUAA 16GSA 4KDUA 2F3MA 3GKMA 1SKWB 4N30A 2J9HA 2A4VA 2RM6A 5AGYA 2CVDA 3GSSA 4PUFC 2AAWA 1ABAA 4YQMA 5B6MA 1A2LA 4KAEA 2AUVA 2FY6A 2V6OA 5B8BA 5J3RA 4ID0A 3MSZA 2QGVA 4MJBA 4KUNA 2ZUPA 4PX1A 1Z7RA 1AUCA 1MTCA 1R26A 4IJ3A 2O87A 4BVYA 1XPVA 3GL3A 2V2GA 3WD6A 1K0DA 1BG5A 5G2ZA 4L5OA 1ZYQB 4BIKA 4K6XA 2ES7A 3GTUB 3C1RA 1GSUA 4LMWA 6GSYA 1GTIA 1T4YA 2F8AA 4PQIA 1ZMAA 4N0VA 3F63A 4OD7A 5DAKB 3RHCA 4XS6A 3BOAA 3CTGA 4PUAA 2LV3A 2X8HA 5ECRB 1R7HA 5KOWA 2DC5A 1TKDB 1PKZA 4Z2RA 2VLTA 5ENUA 1I9DA 4FO5A 3UJ1A 4MZCA 2HZFA 2PMTA 1W4VA 3U6VA 1BJXA 1NM3A 3QD9A 5EY6A 3FY7A 4TXOB 3H8QA 5DQYA 4ACSA 2CZ3A 2REMA 3APQA 2QA2A 3G7IA 3TGZA 3CTFA 1U88A 4OMVA 1WOUA 4FYBA 4F9ZA 4MCUA 3KP8A 2L4CA 4IQAA 5ABRA 4V2MA 3M3MA 2BMXA 4DSQA 3IOSA 2CAQA 2GQMA 5A4WA 1EV9A 2JSZA 1U87A 2VD0A 3QAGA 1H4OA 3F9UA 3D4TA 4BVXB 2R2JA 5ID2A 2DSAA 1GWCA 3UBLA 2A4HA 2V41A 1GRXA 2HLSA 5JCWA 5D93A 2GTUA 1OYJA 2R37A 2H1GA 4K0GA 3N5OA 1X9SB 3O76A 3ME8A 3KMOA 2MYGA 4G2EA 2FGXA 5L71A 4XS4A 4BVYB 3TRXA 2HNLA 1GH2A 4ZBDA 1F37A 2EC4A 3QFAC 3WT1A 3GV1A 3WYWA 4CHSA 4EDYA 1F2EA 2NPBA 3HJPA 1GNWA 1THXA 2MMZA 1V2AA 3M9KA 4ZL8A 3EMXA 3FEUA 4DVCA 4ZBBA 4O7HA 2X64A 4MJEA 2DKIA 5AIXA 5C00A 5A4VA 3L9UA 2FWHA 3A5IA 3MYDA 1GLPA 1RQMA 2LRTA 3ZRDA 1B48A 4XRDA 2OE1A 3VLNA 1YY7A 2VL2C 5J4UA 1XXUA 3KH9A 1HNAA 2JSYA 4LMVA 3HD5A 1Y25A 4EO3A 1JFUA 1WJKA 3G7JA 1Z6NA 1U3IA 1EP7A 3IV4A 2HSMA 2MBSA 6GSUA 1N2AA 5AIVA 2FWGA 2DJ3A 3HJOA 2FA4A 2HSHA 4JE1A 2IFQA 3J7Yk 1OE7A 3F4RA 2O85A 1ZOFA 2D2ZA 2IMFA 1HNCA 4NWYA 3I6AA 1J08A 2QC7A 1Q4JA 3R3EA 3KP9A 4QL7A 2B6MA 2B3SA 3SBCA 1T8EB 4HJMA 4ZBAA 4IP1A 2XBQA 3GNJA 3LGCA 2WRTA 5HFIA 4HU7A 2LQOA 4I97A 4Q5QA 5D9WA 4HOJA 2H1AA 1MD4A 5HQPA 2PUKC 4KSMA 3TDGA 5H5QA 2H0GA 3LSZA 1SYXA 3KD0A 3GL5A 2H75A 1YEXA 4POKA 2A2RA 2HSYA 2I4AA 2K6VA 4MJAA 4YAVA 2PVOC 1XWAA 1K3OA 3M8NA 5LNKe 2HYXA 4FQUA 2H6XA 1QQ2A 4MA9A 1YJ6A 2ON5A 2YZUA 1H75A 2H74A 3DRNA 1XWCA 3F4SA 2H70A 4HQZA 3F3RA 3L0HA 4ZILA 1X5DA 4KDXA 2CV4A 1O8XA 4YQUA 5IO2A 2LRNA 5IOXA 1TP9A 1JHBA 3FKFA 4NAXA 1XWGA 10GSA 1TOFA 2IN3A 3RDWA 2KHPA 4V1Ag 4I6XA 2LKUA 3NIVA 1ZCPA 4IELA 3VI7A 1EEJA 2VLUA 5DALA 1GSYA 1N8JA 4USSA 1XVQA 2TRCP 4IW9A 1TI1A 2TRXA 1GLQA 3MDKA 4I8BA 2TIRA 4G0KA 4L8EA 4EVMA 1TXXA 4GSTA 1PA3A 4EE0A 3IPZA 1MD3A 5FT3A 5ELAA 2LJRA 3LG6A 4O5RA 1ZZYA 2NDOA 5DVBA 1M99A 4TR1A 1T3BA 5CREA 2VIMA 2V6KA 4K8MA 4MDCA 1FB0A 2C80A 1LBKA 4EUYA 3F4TA 2LS5A 3KJYA 3LFLA 2ZCTA 3ZREA 4TKYA 2G0FA 4GQCA 1XWBA 4ZB8A 5GZZB 2OJLA 1SYRA 2B1KA 1V9WA 1VF4A 1DUGA 2YJHA 2MBTA 3ERWA 2JZRA 1XW5A 1PN0A 2VOCA 3LEFA 1GUHA 4NXIA 2N5BA 13GSA 1PL2A 4O92A 4RUVA 2L57A 3WT2A 4MZBA 3UBKA 4KB3A 2YWIA 3KTBA 1YF1A 4FYUA 1GL8A 2PU9C 3CQFA 2OACA 4KCEA 4TR3A 3HCZA 2IMIA 2EIRA 2DJ0A 3IK9A 3LORA 2GSQA 1NHOA 3TJBA 3M1GA 3W6GA 6GSVA 2YWMA 4MK3A 3TOTA 2G2QA 3GX8A 2L6DA 2XPEA 2GVPA 4MPGA 3KMNA 1SL2B 1KEBA 2VCZA 4ULXA 4NPBA 3C7MA 3WGEA 4IN0A 1JZWA 4KH7A 4CY8A 1CQGA 3QAVA 1Q98A 2H01A 2DBCA 4MH2A 5KN0A 3BCKA 4RQXA 4RI6A 1QFNA 3TKQA 1F9MA 4IHUA 2P5RA 5GSSA 3D5JA 1GP1A 1V58A 3VURA 5LD0A 4GSSA 4TW5A 1ERVA 1G6YA 2OBKA 2H1BA 2K9FA 17GSA 1SL0B 2O8VB 4WF4A 12GSA 5FWGA 4ECJA 3TJGA 1DE2A 1SK2A 1Z9HA 1R4WA 3H93A 3Q18A 1XCCA 4PQHA 2F9SA 3ISOA 4G0IA 3ZMKA 2GZYA 3Q74A 3GH6A 3H1NA 4NV5A 3V1WA 2A2SA 4OCFA 2YP6A 3F0IA 3FR9A 4OCEA 2YN1A 3HHVA 1PD21 5JWOB 3FZAA 2CVBA 4CW9A 1LU4A 4KE3A 1F3BA 3BCIA 3NOFA 1OKTA 4TR4A 1M9AA 3KH7A 4GF0A 3GKNA 2LSTA 3APOA 1GNEA 1YF0A 4NHWA 1BX9A 4XHMA 2PERA 4YH2A 5KN1A 4WR4A 1QK8A 2H0HA 3AY8A 1GTAA 1K0OA 3GMFA 1PX6A 3DEXA 2VCQA 2GT6A 8GSSA 2IMEA 1TDIA 1M2DA 2WULA 2DJ1A 2O89A 4XIHA 1BQ7A 2FWFA 3FZ9A 3L4NA 1EGOA 2PPTA 1FOVA 5G30A 5B7CA 6GSSA 1E2YA 1WE0A 2YWNA 5JWQB 2VO4A 3VK9A 4A5PA 1X0RA 3DKSA 1O81A 1SD8A 3IAS2 3GRXA 3IHQA 4PQ1A 2CQ9A 2VCWA 2I3YA 1M9BA 4QQ7A 4X43A 2AB6A 4AF2A 4XS1A 1OC9B 3I43A 3EE2A 4TR0A 1A24A 3ZIVA 1MDKA 3ZIJA 2FNOA 1ML6A 2OKAA 3LXTA 5H5SA 3D6IA 2R0PA 5DCHA 4AJ6A 1TK0B 1SJZA 3CRUA 1SU9A 2YCDA 3SWLA 2R3XA 4ZL7A 5HR1A 4PXOA 4JR4A 4EL1A 3QFBC 2XBIA 1A8YA 3IBHA 1TRSA 1TK8B 1GSQA 2GS3A 4MJCA 3JCML 1U6TA 1ON4A 1TW9A 4GQFA 1SKRB 4ECBA 1U3AA 5JCGA 1VRSD 2VCXA 4XRAA 4TVEA 1M3IA 2B1LA 2B7KA 1EWXA 3ME7A 3EVIA 2B5EA 2M72A 5COHA 5G1KA 1FHEA 2QA1A 2HRFA 3IC4A 5IPGA 3KGKA 1DBYA 1FVKA 2YPMA 2OADA 3Q19A 2FHEA 4POLA 1ZGNA 5J9BA 2IWTA 1OC8A 1MEKA 5J9CA 3PINA 1G7EA 2ALBA 2H6ZA 2DJJA 3A2VA 1S3DA 4K9ZA 4IGJA 3L78A 3O6TA 2H30A 3HVXA 2E7PA 3A3TA 4X0XA 3IE3A 5D9VA 14GSA 1FOHA 1PRXA 5IMAA 4Q5RA 4WKWA 3EWLA 2OBIA 4HZ2A 2K8SA 4G0LA 1AXDA 1OKDA 3IAM2 1OVNA 3E0UA 1WMJA 1QXHA 2E2GA 5D9XA 4J57E 3VWXA 1M2AA 2ON7A 2VCVA 1XBSA 3C73A 1SL1B 1VF1A 5ECQB 3KXOA 1HD2A 5A5KA 2XC2A 5FHIA 2ZNMA 1J0FA 2WFCA 1F3AA 3GHAA 1A23A 5IMVA 2LQQA 1ACVA 3OR5A 1XVWA 4KX4A 2C0FA 4MF6A 5EVOA 1SJ6A 5ID2B 3PGTA 3P7XA 2H76A 4MMMA 4DSSA 1I5GA 4XCSA 4P3YB 2WJUA 4JU5A 2FUG2 3TKSA 4TN8A 3CSHA 1EOHA 2F8FA 1ZYPA 2YZHA 3GX0A 2DJ2A 1LJRA 5ECOB 5G1LA 3ZFLA 2C8UA 3F3QA 2L4QA 2LEGA 1S3RA 2M80A 4XS4B 4TXVA 1A8LA 3D21A 4AJ8A 5G5FA 5DBQA 3QDNA 2JACA 3UMAA 4N11A 5F06A 1TRVA 1B4PA 2FA8A 2V1MA 4ZXGA 4MLYA 3TJKA 2KP2A 2H66A 2BTOT 5ECMB 4FIWA 2XHFA 2PWJA 5G31A 3GKKA 4BA7A 1UVZA 2PGTA 4BWQA 1F6MC 3EURA 4JR6A 1SD9A 1K0NA 2VAFA 3RHBA 1K3LA 2NTOA 1PX7A 2C0DA 2VL9A 5JCUA 1VF3A 4POMA 5CRHA 2NBSA 4CY6A 5CAXA 1UN2A 2C4JA 1AQXA 2CX3A 2LJAA 4I5QA 2C3NA 2GQKA 2DLXA 5INYA 3TKPA 1X9MB 3QCPA 2RIIA 4Z2TA 4PTSA 1PFOA 3QMXA 4MH3A 4HJ2A 3UIWA 3VPTA 3TJJA 2YJ7A 2X4AA 3ZLPA 2KLXA 2IFQB 5ELGA 3D4MA 5EPFA 3TRQA 3UVHA 4G10A 3BD2A 1Z6MA 2GSSA 3UEMA 1YKAA 19GSA 2H0IA 1GSFA 3K8NA 5H5RA 1OC3A 2MMNA 3Q6OA 4ML1A 4HZ4A 3UARA 3DIEA 1G7OA 3DYRA 1A2MA 4KW6A 1ERUA 1CQHA 2HZEA 1W89A 2VCTA 4QL9A 3CRTA 4L0UA 1XG8A 4D73A 4WETA 5ECSA 4OO5A 3DD3A 2WZ9A 1R5PA 3D0ZA 5IIZA 1XOAA 1WIKA 2EIOA 1R5AA 3GYKA 3FK8A 1K0MA 5E59A 2QSIA 1YKCA 3TKSC 5F05A 3ZVJD 3IA1A 4EDZA 3EINA 1X5CA 4POBA 3W8JA 3J7Yb 1JLVA 5GAND 4K7OA 5ECLB 4K7IA 4YAPA 2RM5A 3IR4A 4Q5FA 2LNSA 2VUPA 3M0FA 1B8XA 4AGSA 2JL4A 4EXJA 2E2MA 11GSA 1Z7PA 2WGRA 3GIXA 4N0ZA 3LYPA 2K18A 4NHZA 4K2DA 3HKRA 5DJLA 1T4ZA 3IXRA 4L5LA 3EU3A 4AJ7A 1HYUA 4E8EA 3TKSE 1O85A 2J23A 3GH9A 5DALB 1PSQA 3TUEA 1SK0A 2LJKA 2AJQB 3PH9A 1ILOA 1PKWA 1GSEA 1YEPA 2WS2A 2E0QA 3EMPA 1C72A 1FVJA 2YOIA 3L9VA 2LRCA 2DJKA 4LL4B 5ECHB 3EYTA 2HZEB 5HR3A 4F82A 4WBJA 2GZPA 5IMZA 3F6FA 4I2UA 3VWWA 3HVVA 4KSOA 2KUCA 4K1FA 4MP4A 2YV9A 4TR1B 4YKFA 2V32A 2L5OA 4JEDA 1Z3EA 1O7UA 1TK5B 3ZYWA 4K5SA 1MDIA 4Q5NA 3GSTA 3KIJA 5J41A 5DDLA 2CT6A 1G0TA 2X8CA 2VD1A
chains in the Genus database with same CATH topology
4KA0A 4WR5A 1QMVA 4X1UA 2AYTA 2N5FA 3TOUA 3CMIA 2EIQA 3TKRA 4HQSA 1THOA 3ZL5A 3LW9A 3KEBA 1WPIA 2CA8A 5CRGA 3GFKA 4BPYA 1KBNA 2IJYA 4MABA 4GRFA 1JZRA 2O7KA 2CZ2A 2JU5A 4FH8A 1FW1A 2LNTA 3E3EA 2DIZA 1K0CA 1UC7A 4BVXA 4X4JA 3QR6A 2X99A 3CSIA 3M9JA 1ZL9A 1EOGA 2DIYA 2MZCA 1MDJA 3UOMA 4EKZA 3O3TA 4KDYA 1AQWA 1O73A 1AIUA 4J2FA 3P8WA 2FD3A 1EV4A 1NSWA 3FZ4A 1USBA 1Y6EA 2HT9A 1G6WA 2R0CA 2VL3A 4Z7XA 1BEDA 2C0EA 1HQOA 4OWYA 2VL2A 2K8VA 2FLSA 2C1YA 3C1SA 4EF0A 1PMTA 5HR2A 2H71A 3L9SA 2WCIA 4TRXA 4XTSA 2B5XA 2P31A 1J9BA 3VFIA 3ED3A 4PNFA 2L6CA 4G9HA 1GTBA 4O5QA 4KCAA 4F03A 3A2XA 1KTEA 3RPPA 4HU9A 1QUWA 5EL8A 5B6NA 1EGRA 3I69A 4RI7A 4V2LA 1DE1A 2YV7A 4ML6A 1V57A 1FB6A 1O8WA 1K0AA 1TRUA 4ILFA 4J56E 3P2AA 1SJIA 1M7TA 1TI3A 3HY2A 5D8IA 1S3AA 5B8AA 1ZYNA 20GSA 2GLRA 1DSBA 4JRRA 3DGQA 4JZQA 3HZ8A 3HZ4A 1GSDA 4N10A 1SKSB 18GSA 5KN3A 2RUFA 2OA7A 4K0NA 2AHEA 1JZOA 3A5WA 1JLWA 4K2XA 3ZMLA 2IPAA 2C0GA 2VM1A 3IK7A 3GA4A 5D96A 5HR0A 4NMUA 3UVTA 5KEJA 4ECIA 3FMWA 3ZFBA 4EC0A 1GSSA 7GSSA 4OO4A 2R0GA 3US3A 3FZ5A 3I9V2 3P90A 1AAZA 4WEYA 4F2IA 1XZOA 5D9TA 3G9BA 2F51A 3KCMA 1TRWA 1K3YA 2CX4A 4OFTA 1ST9A 1E6BA 2GZZA 2IL3A 3UL3A 4K5RA 4HI7A 1ZYEA 4MPFA 4O5UA 1AW9A 3ZITA 5ECIB 4DSRA 1EZKA 1PGTA 1OAZA 1SENA 2IMKA 3E9JB 4ZB6A 4CDOA 3UAPA 2L5LA 5IM9A 1UA5A 2PBJA 2HRKA 3FR3A 2C3QA 5CRDA 3KM6A 4PGTA 3GUSA 5CNWA 5ECPB 3ERGA 1X9WB 5IO0A 3HJMA 2QKEA 3W8SA 3ZZXA 1WWJA 2JZSA 3GURA 2HXKA 4KNDA 2WB9A 4PNGA 2I9HA 1GULA 1NHYA 3IRAA 3TRPA 1B9YC 3LJRA 3EU4A 2YWOA 5LCZA 1RW1A 5CP1A 2NVLA 1T1VA 2I81A 2CVKA 3PPUA 4KGIA 9GSSA 5J5NA 4MF7A 3PR8A 4ICYA 5F0GA 4O32A 5DJMA 4L0WA 2KP1A 2MMAA 2N5AA 4GSNA 5D73A 4MF5A 2M46A 2MMOA 2R5GA 5CYYA 2X8GA 5C04A 3HDCA 4V1Ap 3VI5A 4IBPA 4F0BA 2HE3A 3CXGA 3MAKA 6GSTA 3BJ5A 2OE0A 3IHGA 1TU7A 4HEA2 5AISA 2B5YA 5DQSA 5GAPD 2IIYA 2RLIA 2GSTA 3HYPA 3MNGA 2YNXA 5AN1A 2H6YA 2PVQA 3QPMA 4IS0A 4NV2A 1WRYA 3GN3A 5JWRB 2DMLA 4WBRD 3VWUA 1JZDA 1X5EA 4YQVA 2P0GA 5F07A 1XWKA 4MNNA 1B4QA 2PN8A 1IYHA 1EEMA 3FR6A 5ECKB 5CO3A 2WDUA 3EC3A 5E4WA 3ZVJA 5KN2A 3HA9A 3ZTLA 1XFLA 3G7YA 5IMDA 1KNGA 4IVFA 3RPNA 2LTKA 3APSA 1XW6A 6GSWA 4G19A 1GUKA 1FAAA 1PQNA 4PURA 4H86A 5ECNB 1BAYA 5IMCA 3QAWA 1M0UA 2B7JA 2GSRA 1WP0A 2A2PA 3FRCA 4Z2UA 4OFNA 1IYIA 1ERWA 1S3CA 2YANA 5BMUA 4DSSB 1URMA 3QOUA 4JBBA 4GTUA 3DVXA 3U5RE 1V40A 4BWSA 22GSA 2GGTA 3DMLA 4LA1A 1ERTA 1YZXA 4WF5A 4YKGA 3WGDA 1TU8A 3HXSA 1VF2A 5CRWA 4LL1B 2HFDA 3CSJA 4ISDA 5GSTA 1XW9A 3RAZA 3HVSA 1FO5A 4I2TA 2CAIA 4F0CA 2HRNA 3VWVA 2H1DA 4ECCA 2GT5A 5F8BA 3TB2A 2DMMA 2XPDA 4ZIJA 2KOKA 1M2BA 2LUSA 4DEJA 2BJXA 4HS1A 1PN9A 2HI7A 4K7NA 3N9JA 2H8LA 1AC1A 1EP8A 1VGLA 3MIXA 2DKHA 2Z9SA 4KF9A 2FCHA 3FW2A 6GSXA 3S9FA 1A0RP 1YQ1A 4BL7A 3DVWA 5KOXA 1T00A 1TTZA 4LLRA 5HFKA 2RUEA 1A2JA 2P5QA 2OE3A 4MZWA 4HDEA 3CYNA 4FYCA 3H79A 3D22A 1A0FA 4EIPA 4EIQA 3TJFA 1O6JA 2R6KA 3CBUA 3DXBA 3IC8A 3KTLA 5G5EA 5BRTA 1HNBA 2I1UA 1TJDA 4V2NA 4IQ1A 3A2WA 2JADA 4E8HA 5IQYA 3C8EA 4IJIA 1SK1A 1BYEA 2IMDA 3H4KA 1K0BA 3NZNA 3RBTA 3GTUA 3LWAA 4GXZA 3WGXA 1XOBA 1T7PB 3LQ7A 4GCIA 3TCOA 2FWEA 4WXTA 1B9XC 3FHKA 3FYGA 4GWRA 4RQRA 1NW2A 5DAKA 5A4UA 4D73B 2VM2A 2AV4A 4GLTA 1FG4A 4ZB9A 2C3TA 5IPHA 3EPTA 2VLVA 4OFMA 3KZQA 4TOPA 3GKXA 5HFGA 3VPQA 5IMFA 2GQLA 4TXOA 4ZL9A 3BBYA 3LYKA 2HRAA 1QGVA 3LXZA 1V98A 3IDVA 4IP6A 3C71A 3ERFA 2GDRA 2L59A 2R4VA 2UZ8A 1GTUA 1YDKA 1OC9A 4IKHA 2H19A 3F6DA 3MWHA 1GUMA 3F8UA 2JZTA 2X49A 1Z5YE 5IOWA 5DCGA 2H73A 1OE8A 1PL1A 3R2QA 3DWVA 1AQVA 2H72A 4BL7B 1RK4A 1XIYA 4HUAA 16GSA 4KDUA 2F3MA 3GKMA 1SKWB 4N30A 2J9HA 2A4VA 2RM6A 5AGYA 2CVDA 3GSSA 4PUFC 2AAWA 1ABAA 4YQMA 5B6MA 1A2LA 4KAEA 2AUVA 2FY6A 2V6OA 5B8BA 5J3RA 4ID0A 3MSZA 2QGVA 4MJBA 4KUNA 2ZUPA 4PX1A 1Z7RA 1AUCA 1MTCA 1R26A 4IJ3A 2O87A 4BVYA 1XPVA 3GL3A 2V2GA 3WD6A 1K0DA 1BG5A 5G2ZA 4L5OA 1ZYQB 4K6XA 2ES7A 3GTUB 3C1RA 1GSUA 4LMWA 6GSYA 1GTIA 1T4YA 2F8AA 4PQIA 1ZMAA 4N0VA 3F63A 4OD7A 5DAKB 3RHCA 4XS6A 3BOAA 3CTGA 4PUAA 2LV3A 2X8HA 5ECRB 1R7HA 5KOWA 2DC5A 1TKDB 1PKZA 4Z2RA 2VLTA 5ENUA 1I9DA 4FO5A 3UJ1A 4MZCA 2HZFA 2PMTA 1W4VA 3U6VA 1BJXA 1NM3A 3QD9A 5EY6A 3FY7A 4TXOB 3H8QA 5DQYA 4ACSA 2CZ3A 2REMA 3APQA 2QA2A 3G7IA 3TGZA 3CTFA 1U88A 4OMVA 1WOUA 4FYBA 4F9ZA 4MCUA 3KP8A 2L4CA 4IQAA 5ABRA 4V2MA 3M3MA 2BMXA 4DSQA 3IOSA 2CAQA 2GQMA 5A4WA 1EV9A 2JSZA 1U87A 2VD0A 3QAGA 1H4OA 3F9UA 3D4TA 4BVXB 2R2JA 5ID2A 2DSAA 1GWCA 3UBLA 2A4HA 2V41A 1GRXA 2HLSA 5JCWA 5D93A 2GTUA 1OYJA 2R37A 2H1GA 4K0GA 3N5OA 1X9SB 3O76A 3ME8A 3KMOA 2MYGA 4G2EA 2FGXA 5L71A 4XS4A 4BVYB 3TRXA 2HNLA 1GH2A 4ZBDA 1F37A 2EC4A 3QFAC 3WT1A 3GV1A 3WYWA 4CHSA 4EDYA 1F2EA 2NPBA 3HJPA 1GNWA 1THXA 2MMZA 1V2AA 3M9KA 4ZL8A 3EMXA 3FEUA 4DVCA 4ZBBA 4O7HA 2X64A 4MJEA 2DKIA 5AIXA 5C00A 5A4VA 3L9UA 2FWHA 3A5IA 3MYDA 1GLPA 1RQMA 2LRTA 3ZRDA 1B48A 4XRDA 2OE1A 3VLNA 1YY7A 2VL2C 5J4UA 1XXUA 3KH9A 1HNAA 2JSYA 4LMVA 3HD5A 1Y25A 4EO3A 1JFUA 1WJKA 3G7JA 1Z6NA 1U3IA 1EP7A 3IV4A 2HSMA 2MBSA 6GSUA 1N2AA 5AIVA 2FWGA 2DJ3A 3HJOA 2FA4A 2HSHA 4JE1A 2IFQA 3J7Yk 1OE7A 3F4RA 2O85A 1ZOFA 2D2ZA 2IMFA 1HNCA 4NWYA 3I6AA 1J08A 2QC7A 1Q4JA 3R3EA 3KP9A 4QL7A 2B6MA 2B3SA 3SBCA 1T8EB 4HJMA 4ZBAA 4IP1A 2XBQA 3GNJA 3LGCA 2WRTA 5HFIA 4HU7A 2LQOA 4I97A 4Q5QA 5D9WA 4HOJA 2H1AA 1MD4A 5HQPA 2PUKC 4KSMA 3TDGA 5H5QA 2H0GA 3LSZA 1SYXA 3KD0A 3GL5A 2H75A 1YEXA 4POKA 2A2RA 2HSYA 2I4AA 2K6VA 4MJAA 4YAVA 2PVOC 1XWAA 1K3OA 3M8NA 5LNKe 2HYXA 4FQUA 2H6XA 1QQ2A 4MA9A 1YJ6A 2ON5A 2YZUA 1H75A 2H74A 3DRNA 1XWCA 3F4SA 2H70A 4HQZA 3F3RA 3L0HA 4ZILA 1X5DA 4KDXA 2CV4A 1O8XA 4YQUA 5IO2A 2LRNA 5IOXA 1TP9A 1JHBA 3FKFA 4NAXA 1XWGA 10GSA 1TOFA 2IN3A 3RDWA 2KHPA 4V1Ag 4I6XA 2LKUA 3NIVA 1ZCPA 4IELA 3VI7A 1EEJA 2VLUA 5DALA 1GSYA 1N8JA 4USSA 1XVQA 2TRCP 4IW9A 1TI1A 2TRXA 1GLQA 3MDKA 4I8BA 2TIRA 4G0KA 4L8EA 4EVMA 1TXXA 4GSTA 1PA3A 4EE0A 3IPZA 1MD3A 5FT3A 5ELAA 2LJRA 3LG6A 4O5RA 1ZZYA 2NDOA 5DVBA 1M99A 4TR1A 1T3BA 5CREA 2VIMA 2V6KA 4K8MA 4MDCA 1FB0A 2C80A 1LBKA 4EUYA 3F4TA 2LS5A 3KJYA 3LFLA 2ZCTA 3ZREA 4TKYA 2G0FA 4GQCA 1XWBA 4ZB8A 5GZZB 2OJLA 1SYRA 2B1KA 1V9WA 1VF4A 1DUGA 2YJHA 2MBTA 3ERWA 2JZRA 1XW5A 1PN0A 2VOCA 3LEFA 1GUHA 4NXIA 2N5BA 13GSA 1PL2A 4O92A 4RUVA 2L57A 3WT2A 4MZBA 3UBKA 4KB3A 2YWIA 3KTBA 1YF1A 4FYUA 1GL8A 2PU9C 2OACA 4KCEA 4TR3A 3HCZA 2IMIA 2EIRA 2DJ0A 3IK9A 3LORA 2GSQA 1NHOA 3TJBA 3M1GA 3W6GA 6GSVA 2YWMA 4MK3A 3TOTA 2G2QA 3GX8A 2L6DA 2XPEA 2GVPA 4MPGA 3KMNA 1SL2B 1KEBA 2VCZA 4ULXA 4NPBA 3C7MA 3WGEA 4IN0A 1JZWA 4KH7A 4CY8A 1CQGA 3QAVA 1Q98A 2H01A 2DBCA 4MH2A 5KN0A 3BCKA 4RQXA 4RI6A 1QFNA 3TKQA 1F9MA 4IHUA 2P5RA 5GSSA 3D5JA 1GP1A 1V58A 3VURA 5LD0A 4GSSA 4TW5A 1ERVA 1G6YA 2OBKA 2H1BA 2K9FA 17GSA 1SL0B 2O8VB 4WF4A 12GSA 5FWGA 4ECJA 3TJGA 1DE2A 1SK2A 1Z9HA 1R4WA 3H93A 3Q18A 1XCCA 4PQHA 2F9SA 3ISOA 4G0IA 3ZMKA 2GZYA 3Q74A 3GH6A 3H1NA 4NV5A 3V1WA 2A2SA 4OCFA 2YP6A 3F0IA 3FR9A 4OCEA 2YN1A 3HHVA 1PD21 5JWOB 3FZAA 2CVBA 4CW9A 1LU4A 4KE3A 1F3BA 3BCIA 3NOFA 1OKTA 4TR4A 1M9AA 3KH7A 4GF0A 3GKNA 2LSTA 3APOA 1GNEA 1YF0A 4NHWA 1BX9A 4XHMA 2PERA 4YH2A 5KN1A 4WR4A 1QK8A 2H0HA 3AY8A 1GTAA 1K0OA 3GMFA 1PX6A 3DEXA 2VCQA 2GT6A 8GSSA 2IMEA 1TDIA 1M2DA 2WULA 2DJ1A 2O89A 4XIHA 1BQ7A 2FWFA 3FZ9A 3L4NA 1EGOA 2PPTA 1FOVA 5G30A 5B7CA 6GSSA 1E2YA 1WE0A 2YWNA 5JWQB 2VO4A 3VK9A 4A5PA 1X0RA 3DKSA 1O81A 1SD8A 3IAS2 3GRXA 3IHQA 4PQ1A 2CQ9A 2VCWA 2I3YA 1M9BA 4QQ7A 4X43A 2AB6A 4AF2A 4XS1A 1OC9B 3I43A 3EE2A 4TR0A 1A24A 3ZIVA 1MDKA 3ZIJA 2FNOA 1ML6A 2OKAA 3LXTA 5H5SA 3D6IA 2R0PA 5DCHA 4AJ6A 1TK0B 1SJZA 3CRUA 1SU9A 2YCDA 3SWLA 2R3XA 4ZL7A 5HR1A 4PXOA 4JR4A 4EL1A 3QFBC 2XBIA 1A8YA 3IBHA 1TRSA 1TK8B 1GSQA 2GS3A 4MJCA 3JCML 1U6TA 1ON4A 1TW9A 4GQFA 1SKRB 4ECBA 1U3AA 5JCGA 1VRSD 2VCXA 4XRAA 4TVEA 2B1LA 2B7KA 1EWXA 3ME7A 3EVIA 2B5EA 2M72A 5COHA 5G1KA 1FHEA 2QA1A 2HRFA 3IC4A 5IPGA 3KGKA 1DBYA 1FVKA 2YPMA 2OADA 3Q19A 2FHEA 4POLA 1ZGNA 5J9BA 2IWTA 1OC8A 1MEKA 5J9CA 3PINA 1G7EA 2ALBA 2H6ZA 2DJJA 3A2VA 1S3DA 4K9ZA 4IGJA 3L78A 3O6TA 2H30A 3HVXA 2E7PA 3A3TA 4X0XA 3IE3A 5D9VA 14GSA 1FOHA 1PRXA 5IMAA 4Q5RA 4WKWA 3EWLA 2OBIA 4HZ2A 2K8SA 4G0LA 1AXDA 1OKDA 3IAM2 1OVNA 3E0UA 1WMJA 1QXHA 2E2GA 5D9XA 4J57E 3VWXA 1M2AA 2ON7A 2VCVA 1XBSA 3C73A 1SL1B 1VF1A 5ECQB 3KXOA 1HD2A 5A5KA 2XC2A 5FHIA 2ZNMA 1J0FA 2WFCA 1F3AA 3GHAA 1A23A 5IMVA 2LQQA 1ACVA 3OR5A 1XVWA 4KX4A 2C0FA 4MF6A 5EVOA 1SJ6A 5ID2B 3PGTA 3P7XA 2H76A 4MMMA 4DSSA 1I5GA 4XCSA 4P3YB 2WJUA 4JU5A 2FUG2 3TKSA 4TN8A 3CSHA 1EOHA 2F8FA 1ZYPA 2YZHA 3GX0A 2DJ2A 1LJRA 5ECOB 5G1LA 3ZFLA 2C8UA 3F3QA 2L4QA 2LEGA 2M80A 4XS4B 4TXVA 1A8LA 3D21A 4AJ8A 5G5FA 5DBQA 3QDNA 2JACA 3UMAA 4N11A 5F06A 1TRVA 1B4PA 2FA8A 2V1MA 4ZXGA 4MLYA 3TJKA 2KP2A 2H66A 2BTOT 5ECMB 4FIWA 2XHFA 2PWJA 5G31A 3GKKA 4BA7A 1UVZA 2PGTA 4BWQA 1F6MC 3EURA 4JR6A 1SD9A 1K0NA 2VAFA 3RHBA 1K3LA 2NTOA 1PX7A 2C0DA 2VL9A 5JCUA 1VF3A 4POMA 5CRHA 2NBSA 4CY6A 5CAXA 1UN2A 2C4JA 1AQXA 2CX3A 2LJAA 4I5QA 2C3NA 2GQKA 2DLXA 5INYA 3TKPA 1X9MB 3QCPA 2RIIA 4Z2TA 4PTSA 3QMXA 4MH3A 4HJ2A 3UIWA 3VPTA 3TJJA 2YJ7A 2X4AA 3ZLPA 2KLXA 2IFQB 5ELGA 3D4MA 5EPFA 3TRQA 3UVHA 4G10A 3BD2A 1Z6MA 2GSSA 3UEMA 1YKAA 19GSA 2H0IA 1GSFA 3K8NA 5H5RA 1OC3A 2MMNA 3Q6OA 4ML1A 4HZ4A 3UARA 3DIEA 1G7OA 3DYRA 1A2MA 4KW6A 1ERUA 1CQHA 2HZEA 1W89A 2VCTA 4QL9A 3CRTA 4L0UA 4D73A 4WETA 5ECSA 4OO5A 3DD3A 2WZ9A 1R5PA 3D0ZA 5IIZA 1XOAA 1WIKA 2EIOA 1R5AA 3GYKA 3FK8A 1K0MA 5E59A 2QSIA 1YKCA 3TKSC 5F05A 3ZVJD 3IA1A 4EDZA 3EINA 1X5CA 4POBA 3W8JA 3J7Yb 1JLVA 5GAND 4K7OA 5ECLB 4K7IA 4YAPA 2RM5A 3IR4A 4Q5FA 2LNSA 2VUPA 3M0FA 1B8XA 4AGSA 2JL4A 4EXJA 2E2MA 11GSA 1Z7PA 2WGRA 3GIXA 4N0ZA 3LYPA 2K18A 4NHZA 4K2DA 3HKRA 5DJLA 1T4ZA 3IXRA 4L5LA 3EU3A 4AJ7A 1HYUA 4E8EA 3TKSE 1O85A 2J23A 3GH9A 5DALB 1PSQA 3TUEA 1SK0A 2LJKA 2AJQB 3PH9A 1ILOA 1PKWA 1GSEA 1YEPA 2WS2A 2E0QA 3EMPA 1C72A 1FVJA 2YOIA 3L9VA 2LRCA 2DJKA 4LL4B 5ECHB 3EYTA 2HZEB 5HR3A 4F82A 4WBJA 2GZPA 5IMZA 3F6FA 4I2UA 3VWWA 3HVVA 4KSOA 2KUCA 4K1FA 4MP4A 2YV9A 4TR1B 4YKFA 2V32A 2L5OA 4JEDA 1Z3EA 1O7UA 1TK5B 3ZYWA 4K5SA 1MDIA 4Q5NA 3GSTA 3KIJA 5J41A 5DDLA 2CT6A 1G0TA 2X8CA 2VD1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KA0 A;  4WR5 A;  1QMV A;  4X1U A;  2AYT A;  2N5F A;  3TOU A;  3CMI A;  2EIQ A;  3TKR A;  4HQS A;  1THO A;  3ZL5 A;  3KEB A;  1WPI A;  2CA8 A;  5CRG A;  3GFK A;  4BPY A;  1KBN A;  2IJY A;  4MAB A;  4GRF A;  1JZR A;  2O7K A;  2CZ2 A;  2JU5 A;  4FH8 A;  1FW1 A;  2LNT A;  3E3E A;  2DIZ A;  1K0C A;  1UC7 A;  4BVX A;  3QR6 A;  2X99 A;  3CSI A;  3M9J A;  1ZL9 A;  1EOG A;  2DIY A;  2MZC A;  1MDJ A;  3UOM A;  4EKZ A;  3O3T A;  4KDY A;  1AQW A;  1O73 A;  1AIU A;  4J2F A;  3P8W A;  2FD3 A;  1EV4 A;  1NSW A;  3FZ4 A;  1USB A;  1Y6E A;  2HT9 A;  1G6W A;  2VL3 A;  4Z7X A;  1BED A;  2C0E A;  1HQO A;  4OWY A;  2VL2 A;  2K8V A;  2FLS A;  2C1Y A;  3C1S A;  4EF0 A;  1PMT A;  5HR2 A;  2H71 A;  3L9S A;  2WCI A;  4TRX A;  4XTS A;  2B5X A;  2P31 A;  1J9B A;  3VFI A;  3ED3 A;  4PNF A;  2L6C A;  4G9H A;  1GTB A;  4KCA A;  4F03 A;  3A2X A;  1KTE A;  3RPP A;  4HU9 A;  1QUW A;  5EL8 A;  5B6N A;  1EGR A;  3I69 A;  4RI7 A;  4V2L A;  1DE1 A;  2YV7 A;  4ML6 A;  1V57 A;  1FB6 A;  1O8W A;  1K0A A;  1TRU A;  4ILF A;  4J56 E;  3P2A A;  1SJI A;  1M7T A;  1TI3 A;  3HY2 A;  5D8I A;  1S3A A;  5B8A A;  20GS A;  2GLR A;  1DSB A;  4JRR A;  3DGQ A;  4JZQ A;  3HZ8 A;  3HZ4 A;  1GSD A;  4N10 A;  1SKS B;  18GS A;  5KN3 A;  2RUF A;  2OA7 A;  4K0N A;  2AHE A;  1JZO A;  3A5W A;  1JLW A;  3ZML A;  2IPA A;  2C0G A;  2VM1 A;  3IK7 A;  3GA4 A;  5D96 A;  5HR0 A;  4NMU A;  3UVT A;  5KEJ A;  4ECI A;  3ZFB A;  4EC0 A;  1GSS A;  7GSS A;  4OO4 A;  3US3 A;  3FZ5 A;  3I9V 2;  3P90 A;  1AAZ A;  4WEY A;  4F2I A;  1XZO A;  5D9T A;  3G9B A;  2F51 A;  3KCM A;  1TRW A;  1K3Y A;  2CX4 A;  4OFT A;  1ST9 A;  1E6B A;  2GZZ A;  2IL3 A;  3UL3 A;  4HI7 A;  1ZYE A;  4MPF A;  1AW9 A;  3ZIT A;  5ECI B;  4DSR A;  1EZK A;  1PGT A;  1OAZ A;  1SEN A;  2IMK A;  3E9J B;  4ZB6 A;  4CDO A;  3UAP A;  2L5L A;  5IM9 A;  1UA5 A;  2PBJ A;  3FR3 A;  2C3Q A;  5CRD A;  3KM6 A;  4PGT A;  3GUS A;  5CNW A;  5ECP B;  3ERG A;  1X9W B;  5IO0 A;  3HJM A;  2QKE A;  3W8S A;  3ZZX A;  1WWJ A;  2JZS A;  3GUR A;  2HXK A;  4KND A;  2WB9 A;  4PNG A;  2I9H A;  1GUL A;  1NHY A;  3IRA A;  3TRP A;  1B9Y C;  3LJR A;  3EU4 A;  2YWO A;  5LCZ A;  1RW1 A;  5CP1 A;  2NVL A;  1T1V A;  2I81 A;  2CVK A;  4KGI A;  9GSS A;  5J5N A;  4MF7 A;  3PR8 A;  5F0G A;  4O32 A;  5DJM A;  4L0W A;  2KP1 A;  2MMA A;  2N5A A;  4GSN A;  5D73 A;  4MF5 A;  2M46 A;  2MMO A;  2R5G A;  5CYY A;  2X8G A;  5C04 A;  3HDC A;  4V1A p;  3VI5 A;  4IBP A;  4F0B A;  2HE3 A;  3CXG A;  3MAK A;  6GST A;  3BJ5 A;  2OE0 A;  1TU7 A;  4HEA 2;  5AIS A;  2B5Y A;  5DQS A;  5GAP D;  2IIY A;  2RLI A;  2GST A;  3HYP A;  3MNG A;  2YNX A;  5AN1 A;  2H6Y A;  2PVQ A;  3QPM A;  4IS0 A;  4NV2 A;  1WRY A;  3GN3 A;  5JWR B;  2DML A;  4WBR D;  3VWU A;  1JZD A;  1X5E A;  4YQV A;  2P0G A;  5F07 A;  1XWK A;  1B4Q A;  2PN8 A;  1IYH A;  1EEM A;  3FR6 A;  5ECK B;  5CO3 A;  2WDU A;  3EC3 A;  5E4W A;  3ZVJ A;  5KN2 A;  3HA9 A;  3ZTL A;  1XFL A;  3G7Y A;  5IMD A;  1KNG A;  4IVF A;  3RPN A;  2LTK A;  3APS A;  1XW6 A;  6GSW A;  4G19 A;  1GUK A;  1FAA A;  1PQN A;  4PUR A;  4H86 A;  5ECN B;  1BAY A;  5IMC A;  3QAW A;  1M0U A;  2B7J A;  2GSR A;  1WP0 A;  3FRC A;  4OFN A;  1IYI A;  1ERW A;  1S3C A;  2YAN A;  4DSS B;  1URM A;  3QOU A;  4JBB A;  4GTU A;  3DVX A;  3U5R E;  1V40 A;  4BWS A;  22GS A;  2GGT A;  3DML A;  4LA1 A;  1ERT A;  1YZX A;  4WF5 A;  3WGD A;  1TU8 A;  3HXS A;  1VF2 A;  5CRW A;  4LL1 B;  2HFD A;  3CSJ A;  4ISD A;  5GST A;  1XW9 A;  3RAZ A;  3HVS A;  1FO5 A;  4F0C A;  2CAI A;  2HRN A;  3VWV A;  2H1D A;  4ECC A;  2GT5 A;  5F8B A;  3TB2 A;  2DMM A;  2XPD A;  4ZIJ A;  2KOK A;  1M2B A;  2LUS A;  4DEJ A;  2BJX A;  4HS1 A;  1PN9 A;  2HI7 A;  4K7N A;  3N9J A;  2H8L A;  1AC1 A;  1EP8 A;  1VGL A;  2Z9S A;  2FCH A;  3FW2 A;  6GSX A;  3S9F A;  1A0R P;  1YQ1 A;  4BL7 A;  3DVW A;  1T00 A;  1TTZ A;  4LLR A;  5HFK A;  2RUE A;  1A2J A;  2P5Q A;  2OE3 A;  4MZW A;  4HDE A;  3CYN A;  4FYC A;  3H79 A;  3D22 A;  1A0F A;  3TJF A;  1O6J A;  2R6K A;  3CBU A;  3DXB A;  3KTL A;  5G5E A;  1HNB A;  2I1U A;  1TJD A;  4V2N A;  4IQ1 A;  3A2W A;  2JAD A;  4E8H A;  5IQY A;  3C8E A;  4IJI A;  1SK1 A;  1BYE A;  2IMD A;  3H4K A;  1K0B A;  3NZN A;  3RBT A;  3GTU A;  3LWA A;  4GXZ A;  3WGX A;  1XOB A;  1T7P B;  2VD1 A;  3LQ7 A;  4GCI A;  3TCO A;  2FWE A;  4WXT A;  1B9X C;  3FHK A;  3FYG A;  4GWR A;  4RQR A;  1NW2 A;  5DAK A;  5A4U A;  4D73 B;  2VM2 A;  2AV4 A;  4GLT A;  1FG4 A;  4ZB9 A;  2C3T A;  5IPH A;  4OFM A;  2VLV A;  3KZQ A;  4TOP A;  3GKX A;  5HFG A;  3VPQ A;  5IMF A;  2GQL A;  4TXO A;  4ZL9 A;  3BBY A;  3LYK A;  1QGV A;  3LXZ A;  1V98 A;  3IDV A;  4IP6 A;  3C71 A;  3ERF A;  2GDR A;  2L59 A;  2R4V A;  1GTU A;  1YDK A;  1OC9 A;  4IKH A;  2H19 A;  3F6D A;  3MWH A;  1GUM A;  3F8U A;  2JZT A;  1Z5Y E;  5IOW A;  5DCG A;  2H73 A;  1OE8 A;  1PL1 A;  3R2Q A;  3DWV A;  1AQV A;  2H72 A;  1RK4 A;  1XIY A;  4HUA A;  16GS A;  4KDU A;  2F3M A;  3GKM A;  1SKW B;  4N30 A;  2J9H A;  2A4V A;  2RM6 A;  5AGY A;  2CVD A;  3GSS A;  4PUF C;  2AAW A;  1ABA A;  4YQM A;  5B6M A;  1A2L A;  4KAE A;  2AUV A;  2FY6 A;  2V6O A;  5B8B A;  5J3R A;  4ID0 A;  3MSZ A;  2QGV A;  4MJB A;  4KUN A;  2ZUP A;  4PX1 A;  1Z7R A;  1AUC A;  1MTC A;  1R26 A;  4IJ3 A;  2O87 A;  4BVY A;  1XPV A;  3GL3 A;  2V2G A;  3WD6 A;  1K0D A;  1BG5 A;  5G2Z A;  4L5O A;  1ZYQ B;  4K6X A;  2ES7 A;  3GTU B;  3C1R A;  1GSU A;  4LMW A;  6GSY A;  1GTI A;  1T4Y A;  2F8A A;  4PQI A;  1ZMA A;  4N0V A;  3F63 A;  4OD7 A;  5DAK B;  3RHC A;  4XS6 A;  3BOA A;  3CTG A;  4PUA A;  2LV3 A;  2X8H A;  5ECR B;  1R7H A;  2DC5 A;  1TKD B;  1PKZ A;  2VLT A;  5ENU A;  1I9D A;  4FO5 A;  3UJ1 A;  4MZC A;  2HZF A;  2PMT A;  1W4V A;  3U6V A;  1BJX A;  1NM3 A;  3QD9 A;  5EY6 A;  3FY7 A;  4TXO B;  3H8Q A;  5DQY A;  4ACS A;  2CZ3 A;  2REM A;  3APQ A;  3G7I A;  3TGZ A;  3CTF A;  1U88 A;  4OMV A;  1WOU A;  4FYB A;  4F9Z A;  4MCU A;  3KP8 A;  2L4C A;  4IQA A;  5ABR A;  4V2M A;  3M3M A;  2BMX A;  4DSQ A;  3IOS A;  2CAQ A;  2GQM A;  5A4W A;  1EV9 A;  2JSZ A;  1U87 A;  2VD0 A;  3QAG A;  1H4O A;  3F9U A;  3D4T A;  2R2J A;  5ID2 A;  2DSA A;  1GWC A;  3UBL A;  2V41 A;  1GRX A;  2HLS A;  5JCW A;  5D93 A;  2GTU A;  1OYJ A;  2R37 A;  2H1G A;  4K0G A;  3N5O A;  1X9S B;  3O76 A;  3ME8 A;  3KMO A;  2MYG A;  4G2E A;  2FGX A;  5L71 A;  4XS4 A;  3TRX A;  2HNL A;  1GH2 A;  4ZBD A;  1F37 A;  2EC4 A;  3QFA C;  3WT1 A;  3GV1 A;  3WYW A;  4CHS A;  4EDY A;  1F2E A;  2NPB A;  3HJP A;  1GNW A;  1THX A;  2MMZ A;  1V2A A;  3M9K A;  4ZL8 A;  3EMX A;  3FEU A;  4DVC A;  4ZBB A;  4O7H A;  2X64 A;  4MJE A;  5AIX A;  5C00 A;  5A4V A;  3L9U A;  2FWH A;  1GLP A;  1RQM A;  2LRT A;  3ZRD A;  1B48 A;  4XRD A;  2OE1 A;  3VLN A;  1YY7 A;  2VL2 C;  5J4U A;  1XXU A;  3KH9 A;  1HNA A;  2JSY A;  4LMV A;  3HD5 A;  1Y25 A;  4EO3 A;  1JFU A;  1WJK A;  3G7J A;  1Z6N A;  1U3I A;  1EP7 A;  3IV4 A;  2MBS A;  6GSU A;  1N2A A;  5AIV A;  2FWG A;  2DJ3 A;  3HJO A;  2FA4 A;  2HSH A;  4JE1 A;  2IFQ A;  3J7Y k;  1OE7 A;  3F4R A;  2O85 A;  1ZOF A;  2D2Z A;  2IMF A;  1HNC A;  4NWY A;  3I6A A;  1J08 A;  2QC7 A;  1Q4J A;  3KP9 A;  4QL7 A;  2B6M A;  2B3S A;  3SBC A;  1T8E B;  4HJM A;  4ZBA A;  4IP1 A;  2XBQ A;  3GNJ A;  3LGC A;  2WRT A;  5HFI A;  4HU7 A;  2LQO A;  4I97 A;  4Q5Q A;  5D9W A;  4HOJ A;  2H1A A;  1MD4 A;  5HQP A;  2PUK C;  4KSM A;  3TDG A;  5H5Q A;  2H0G A;  3LSZ A;  1SYX A;  3KD0 A;  3GL5 A;  2H75 A;  1YEX A;  4POK A;  2A2R A;  2HSY A;  2I4A A;  2K6V A;  4MJA A;  4YAV A;  2PVO C;  1XWA A;  1K3O A;  3M8N A;  5LNK e;  2HYX A;  2H6X A;  1QQ2 A;  4MA9 A;  1YJ6 A;  2ON5 A;  2YZU A;  1H75 A;  2H74 A;  3DRN A;  1XWC A;  3F4S A;  2H70 A;  4HQZ A;  3F3R A;  3L0H A;  4ZIL A;  1X5D A;  4KDX A;  2CV4 A;  1O8X A;  4YQU A;  5IO2 A;  2LRN A;  5IOX A;  1TP9 A;  1JHB A;  3FKF A;  4NAX A;  1XWG A;  10GS A;  1TOF A;  2IN3 A;  3RDW A;  2KHP A;  4V1A g;  4I6X A;  2LKU A;  3NIV A;  1ZCP A;  4IEL A;  3VI7 A;  1EEJ A;  2VLU A;  5DAL A;  1GSY A;  1N8J A;  1XVQ A;  2TRC P;  4IW9 A;  1TI1 A;  2TRX A;  1GLQ A;  3MDK A;  4I8B A;  2TIR A;  4L8E A;  4EVM A;  1TXX A;  4GST A;  1PA3 A;  4EE0 A;  3IPZ A;  1MD3 A;  5FT3 A;  5ELA A;  2LJR A;  3LG6 A;  4O5R A;  1ZZY A;  2NDO A;  5DVB A;  1M99 A;  4TR1 A;  1T3B A;  5CRE A;  2VIM A;  2V6K A;  4K8M A;  4MDC A;  1FB0 A;  2C80 A;  1LBK A;  4EUY A;  3F4T A;  2LS5 A;  3KJY A;  3LFL A;  2ZCT A;  3ZRE A;  4TKY A;  2G0F A;  4GQC A;  1XWB A;  4ZB8 A;  5GZZ B;  2OJL A;  1SYR A;  2B1K A;  1V9W A;  1VF4 A;  1DUG A;  2YJH A;  2MBT A;  3ERW A;  2JZR A;  1XW5 A;  2VOC A;  3LEF A;  1GUH A;  4NXI A;  2N5B A;  13GS A;  1PL2 A;  4O92 A;  4RUV A;  2L57 A;  3WT2 A;  4MZB A;  3UBK A;  4KB3 A;  2YWI A;  3KTB A;  1YF1 A;  4FYU A;  1GL8 A;  2PU9 C;  2OAC A;  4KCE A;  4TR3 A;  3HCZ A;  2IMI A;  2EIR A;  2DJ0 A;  3IK9 A;  3LOR A;  2GSQ A;  1NHO A;  3TJB A;  3M1G A;  3W6G A;  6GSV A;  2YWM A;  4MK3 A;  3TOT A;  2G2Q A;  3GX8 A;  2L6D A;  2XPE A;  2GVP A;  4MPG A;  3KMN A;  1SL2 B;  1KEB A;  2VCZ A;  4ULX A;  4NPB A;  3C7M A;  3WGE A;  4IN0 A;  1JZW A;  4KH7 A;  1CQG A;  3QAV A;  1Q98 A;  2H01 A;  2DBC A;  4MH2 A;  5KN0 A;  3BCK A;  4RQX A;  4RI6 A;  1QFN A;  3TKQ A;  1F9M A;  4IHU A;  2P5R A;  5GSS A;  3D5J A;  1GP1 A;  1V58 A;  3VUR A;  5LD0 A;  4GSS A;  4TW5 A;  1ERV A;  1G6Y A;  2OBK A;  2H1B A;  2K9F A;  17GS A;  1SL0 B;  2O8V B;  4WF4 A;  12GS A;  5FWG A;  4ECJ A;  3TJG A;  1DE2 A;  1SK2 A;  1Z9H A;  1R4W A;  3H93 A;  3Q18 A;  1XCC A;  4PQH A;  2F9S A;  3ISO A;  3ZMK A;  2GZY A;  3Q74 A;  3GH6 A;  3H1N A;  4NV5 A;  3V1W A;  2A2S A;  4OCF A;  2YP6 A;  3F0I A;  3FR9 A;  4OCE A;  2YN1 A;  3HHV A;  1PD2 1;  5JWO B;  3FZA A;  2CVB A;  4CW9 A;  1LU4 A;  4KE3 A;  1F3B A;  3BCI A;  3NOF A;  1OKT A;  4TR4 A;  1M9A A;  3KH7 A;  4GF0 A;  3GKN A;  2LST A;  3APO A;  1GNE A;  1YF0 A;  4NHW A;  1BX9 A;  4XHM A;  2PER A;  4YH2 A;  5KN1 A;  4WR4 A;  1QK8 A;  2H0H A;  3AY8 A;  1GTA A;  1K0O A;  3GMF A;  1PX6 A;  3DEX A;  2VCQ A;  2GT6 A;  8GSS A;  2IME A;  1TDI A;  1M2D A;  2WUL A;  2DJ1 A;  2O89 A;  4XIH A;  1BQ7 A;  2FWF A;  3FZ9 A;  3L4N A;  1EGO A;  2PPT A;  1FOV A;  5G30 A;  5B7C A;  6GSS A;  1E2Y A;  1WE0 A;  2YWN A;  5JWQ B;  2VO4 A;  3VK9 A;  1X0R A;  3DKS A;  1O81 A;  1SD8 A;  3IAS 2;  3GRX A;  3IHQ A;  4PQ1 A;  2CQ9 A;  2VCW A;  2I3Y A;  1M9B A;  4QQ7 A;  4X43 A;  2AB6 A;  4AF2 A;  4XS1 A;  1OC9 B;  3I43 A;  3EE2 A;  4TR0 A;  1A24 A;  3ZIV A;  1MDK A;  3ZIJ A;  2FNO A;  1ML6 A;  2OKA A;  3LXT A;  5H5S A;  3D6I A;  5DCH A;  4AJ6 A;  1TK0 B;  1SJZ A;  3CRU A;  1SU9 A;  2YCD A;  3SWL A;  2R3X A;  4ZL7 A;  5HR1 A;  4PXO A;  4JR4 A;  4EL1 A;  3QFB C;  2XBI A;  1A8Y A;  3IBH A;  1TRS A;  1TK8 B;  1GSQ A;  2GS3 A;  4MJC A;  3JCM L;  1U6T A;  1ON4 A;  1TW9 A;  4GQF A;  1SKR B;  4ECB A;  1U3A A;  5JCG A;  1VRS D;  2VCX A;  4XRA A;  4TVE A;  2B1L A;  2B7K A;  1EWX A;  3ME7 A;  3EVI A;  2B5E A;  2M72 A;  5COH A;  5G1K A;  1FHE A;  2HRF A;  3IC4 A;  5IPG A;  3KGK A;  1DBY A;  1FVK A;  2YPM A;  2OAD A;  3Q19 A;  2FHE A;  4POL A;  1ZGN A;  5J9B A;  2IWT A;  1OC8 A;  1MEK A;  5J9C A;  3PIN A;  1G7E A;  2ALB A;  2H6Z A;  2DJJ A;  3A2V A;  1S3D A;  4K9Z A;  4IGJ A;  3L78 A;  3O6T A;  2H30 A;  3HVX A;  2E7P A;  3A3T A;  4X0X A;  3IE3 A;  5D9V A;  14GS A;  1PRX A;  5IMA A;  4Q5R A;  4WKW A;  3EWL A;  2OBI A;  4HZ2 A;  2K8S A;  1AXD A;  1OKD A;  3IAM 2;  1OVN A;  3E0U A;  1WMJ A;  1QXH A;  2E2G A;  5D9X A;  4J57 E;  3VWX A;  1M2A A;  2ON7 A;  2VCV A;  1XBS A;  3C73 A;  1SL1 B;  1VF1 A;  5ECQ B;  3KXO A;  1HD2 A;  5A5K A;  2XC2 A;  5FHI A;  2ZNM A;  1J0F A;  2WFC A;  1F3A A;  3GHA A;  1A23 A;  5IMV A;  2LQQ A;  1ACV A;  3OR5 A;  1XVW A;  4KX4 A;  2C0F A;  4MF6 A;  5EVO A;  1SJ6 A;  5ID2 B;  3PGT A;  3P7X A;  2H76 A;  4MMM A;  4DSS A;  1I5G A;  4XCS A;  4P3Y B;  2WJU A;  4JU5 A;  2FUG 2;  3TKS A;  4TN8 A;  3CSH A;  1EOH A;  2F8F A;  2YZH A;  3GX0 A;  2DJ2 A;  1LJR A;  5ECO B;  5G1L A;  3ZFL A;  2C8U A;  3F3Q A;  2L4Q A;  2LEG A;  2M80 A;  4XS4 B;  4TXV A;  1A8L A;  3D21 A;  4AJ8 A;  5G5F A;  5DBQ A;  3QDN A;  2JAC A;  3UMA A;  4N11 A;  5F06 A;  1TRV A;  1B4P A;  2FA8 A;  2V1M A;  4ZXG A;  4MLY A;  3TJK A;  2KP2 A;  2H66 A;  2BTO T;  5ECM B;  4FIW A;  2XHF A;  2PWJ A;  5G31 A;  3GKK A;  4BA7 A;  1UVZ A;  2PGT A;  4BWQ A;  1F6M C;  3EUR A;  4JR6 A;  1SD9 A;  1K0N A;  2VAF A;  3RHB A;  1K3L A;  2NTO A;  1PX7 A;  2C0D A;  2VL9 A;  5JCU A;  1VF3 A;  4POM A;  5CRH A;  2NBS A;  5CAX A;  1UN2 A;  2C4J A;  1AQX A;  2CX3 A;  2LJA A;  4I5Q A;  2C3N A;  2GQK A;  2DLX A;  5INY A;  3TKP A;  1X9M B;  3QCP A;  2RII A;  3QMX A;  4MH3 A;  4HJ2 A;  3UIW A;  3VPT A;  3TJJ A;  2YJ7 A;  3ZLP A;  2KLX A;  2IFQ B;  5ELG A;  3D4M A;  5EPF A;  3TRQ A;  3UVH A;  4G10 A;  3BD2 A;  1Z6M A;  2GSS A;  3UEM A;  1YKA A;  19GS A;  2H0I A;  1GSF A;  3K8N A;  5H5R A;  1OC3 A;  2MMN A;  3Q6O A;  4ML1 A;  4HZ4 A;  3UAR A;  3DIE A;  1G7O A;  3DYR A;  1A2M A;  4KW6 A;  1ERU A;  1CQH A;  2HZE A;  1W89 A;  2VCT A;  4QL9 A;  3CRT A;  4L0U A;  4D73 A;  4WET A;  5ECS A;  4OO5 A;  3DD3 A;  2WZ9 A;  1R5P A;  3D0Z A;  5IIZ A;  1XOA A;  1WIK A;  2EIO A;  1R5A A;  3GYK A;  3FK8 A;  1K0M A;  5E59 A;  2QSI A;  1YKC A;  3TKS C;  5F05 A;  3ZVJ D;  3IA1 A;  4EDZ A;  3EIN A;  1X5C A;  4POB A;  3W8J A;  3J7Y b;  1JLV A;  5GAN D;  4K7O A;  5ECL B;  4K7I A;  4YAP A;  2RM5 A;  3IR4 A;  4Q5F A;  2LNS A;  2VUP A;  3M0F A;  1B8X A;  4AGS A;  2JL4 A;  4EXJ A;  2E2M A;  11GS A;  1Z7P A;  2WGR A;  3GIX A;  4N0Z A;  3LYP A;  2K18 A;  4NHZ A;  4K2D A;  3HKR A;  5DJL A;  1T4Z A;  3IXR A;  4L5L A;  3EU3 A;  4AJ7 A;  1HYU A;  4E8E A;  3TKS E;  1O85 A;  2J23 A;  3GH9 A;  5DAL B;  1PSQ A;  3TUE A;  1SK0 A;  2LJK A;  2AJQ B;  3PH9 A;  1ILO A;  1PKW A;  1GSE A;  1YEP A;  2WS2 A;  2E0Q A;  3EMP A;  1C72 A;  1FVJ A;  2YOI A;  3L9V A;  2LRC A;  2DJK A;  4LL4 B;  5ECH B;  3EYT A;  2HZE B;  5HR3 A;  4F82 A;  4WBJ A;  2GZP A;  5IMZ A;  3F6F A;  4I2U A;  3VWW A;  3HVV A;  4KSO A;  2KUC A;  4K1F A;  4MP4 A;  2YV9 A;  4TR1 B;  2V32 A;  2L5O A;  4JED A;  1Z3E A;  1O7U A;  1TK5 B;  3ZYW A;  1MDI A;  4Q5N A;  3GST A;  3KIJ A;  5J41 A;  5DDL A;  2CT6 A;  1G0T A;  2X8C A;  4I2T A; 
#chains in the Genus database with same CATH topology
 4KA0 A;  4WR5 A;  1QMV A;  4X1U A;  2AYT A;  2N5F A;  3TOU A;  3CMI A;  2EIQ A;  3TKR A;  4HQS A;  1THO A;  3ZL5 A;  3LW9 A;  3KEB A;  1WPI A;  2CA8 A;  5CRG A;  3GFK A;  4BPY A;  1KBN A;  2IJY A;  4MAB A;  4GRF A;  1JZR A;  2O7K A;  2CZ2 A;  2JU5 A;  4FH8 A;  1FW1 A;  2LNT A;  3E3E A;  2DIZ A;  1K0C A;  1UC7 A;  4BVX A;  4X4J A;  3QR6 A;  2X99 A;  3CSI A;  3M9J A;  1ZL9 A;  1EOG A;  2DIY A;  2MZC A;  1MDJ A;  3UOM A;  4EKZ A;  3O3T A;  4KDY A;  1AQW A;  1O73 A;  1AIU A;  4J2F A;  3P8W A;  2FD3 A;  1EV4 A;  1NSW A;  3FZ4 A;  1USB A;  1Y6E A;  2HT9 A;  1G6W A;  2R0C A;  2VL3 A;  4Z7X A;  1BED A;  2C0E A;  1HQO A;  4OWY A;  2VL2 A;  2K8V A;  2FLS A;  2C1Y A;  3C1S A;  4EF0 A;  1PMT A;  5HR2 A;  2H71 A;  3L9S A;  2WCI A;  4TRX A;  4XTS A;  2B5X A;  2P31 A;  1J9B A;  3VFI A;  3ED3 A;  4PNF A;  2L6C A;  4G9H A;  1GTB A;  4O5Q A;  4KCA A;  4F03 A;  3A2X A;  1KTE A;  3RPP A;  4HU9 A;  1QUW A;  5EL8 A;  5B6N A;  1EGR A;  3I69 A;  4RI7 A;  4V2L A;  1DE1 A;  2YV7 A;  4ML6 A;  1V57 A;  1FB6 A;  1O8W A;  1K0A A;  1TRU A;  4ILF A;  4J56 E;  3P2A A;  1SJI A;  1M7T A;  1TI3 A;  3HY2 A;  5D8I A;  1S3A A;  5B8A A;  1ZYN A;  20GS A;  2GLR A;  1DSB A;  4JRR A;  3DGQ A;  4JZQ A;  3HZ8 A;  3HZ4 A;  1GSD A;  4N10 A;  1SKS B;  18GS A;  5KN3 A;  2RUF A;  2OA7 A;  4K0N A;  2AHE A;  1JZO A;  3A5W A;  1JLW A;  4K2X A;  3ZML A;  2IPA A;  2C0G A;  2VM1 A;  3IK7 A;  3GA4 A;  5D96 A;  5HR0 A;  4NMU A;  3UVT A;  5KEJ A;  4ECI A;  3FMW A;  3ZFB A;  4EC0 A;  1GSS A;  7GSS A;  4OO4 A;  2R0G A;  3US3 A;  3FZ5 A;  3I9V 2;  3P90 A;  1AAZ A;  4WEY A;  4F2I A;  1XZO A;  5D9T A;  3G9B A;  2F51 A;  3KCM A;  1TRW A;  1K3Y A;  2CX4 A;  4OFT A;  1ST9 A;  1E6B A;  2GZZ A;  2IL3 A;  3UL3 A;  4K5R A;  4HI7 A;  1ZYE A;  4MPF A;  4O5U A;  1AW9 A;  3ZIT A;  5ECI B;  4DSR A;  1EZK A;  1PGT A;  1OAZ A;  1SEN A;  2IMK A;  3E9J B;  4ZB6 A;  4CDO A;  3UAP A;  2L5L A;  5IM9 A;  1UA5 A;  2PBJ A;  2HRK A;  3FR3 A;  2C3Q A;  5CRD A;  3KM6 A;  4PGT A;  3GUS A;  5CNW A;  5ECP B;  3ERG A;  1X9W B;  5IO0 A;  3HJM A;  2QKE A;  3W8S A;  3ZZX A;  1WWJ A;  2JZS A;  3GUR A;  2HXK A;  4KND A;  2WB9 A;  4PNG A;  2I9H A;  1GUL A;  1NHY A;  3IRA A;  3TRP A;  1B9Y C;  3LJR A;  3EU4 A;  2YWO A;  5LCZ A;  1RW1 A;  5CP1 A;  2NVL A;  1T1V A;  2I81 A;  2CVK A;  3PPU A;  4KGI A;  9GSS A;  5J5N A;  4MF7 A;  3PR8 A;  4ICY A;  5F0G A;  4O32 A;  5DJM A;  4L0W A;  2KP1 A;  2MMA A;  4HSC X;  2N5A A;  4GSN A;  5D73 A;  4MF5 A;  2M46 A;  2MMO A;  2R5G A;  5CYY A;  2X8G A;  5C04 A;  3HDC A;  4V1A p;  3VI5 A;  4IBP A;  4F0B A;  2HE3 A;  3CXG A;  3MAK A;  6GST A;  3BJ5 A;  2OE0 A;  3IHG A;  1TU7 A;  4HEA 2;  5AIS A;  2B5Y A;  5DQS A;  5GAP D;  2IIY A;  2RLI A;  2GST A;  3HYP A;  3MNG A;  2YNX A;  5AN1 A;  2H6Y A;  2PVQ A;  3QPM A;  4IS0 A;  4NV2 A;  1WRY A;  3GN3 A;  5JWR B;  2DML A;  4WBR D;  3VWU A;  1JZD A;  1X5E A;  4YQV A;  2P0G A;  5F07 A;  1XWK A;  4MNN A;  1B4Q A;  2PN8 A;  1IYH A;  1EEM A;  3FR6 A;  5ECK B;  5CO3 A;  2WDU A;  3EC3 A;  5E4W A;  3ZVJ A;  5KN2 A;  3HA9 A;  3ZTL A;  1XFL A;  3G7Y A;  5IMD A;  1KNG A;  4IVF A;  3RPN A;  2LTK A;  3APS A;  1XW6 A;  6GSW A;  4G19 A;  1GUK A;  1FAA A;  1PQN A;  4PUR A;  4H86 A;  5ECN B;  1BAY A;  5IMC A;  3QAW A;  1M0U A;  2B7J A;  2GSR A;  1WP0 A;  2A2P A;  3FRC A;  4Z2U A;  4OFN A;  1IYI A;  1ERW A;  1S3C A;  2YAN A;  5BMU A;  4DSS B;  1URM A;  3QOU A;  4JBB A;  4GTU A;  3DVX A;  3U5R E;  1V40 A;  4BWS A;  22GS A;  2GGT A;  3DML A;  4LA1 A;  1ERT A;  1YZX A;  4WF5 A;  4YKG A;  3WGD A;  1TU8 A;  3HXS A;  1VF2 A;  5CRW A;  4LL1 B;  2HFD A;  3CSJ A;  4ISD A;  5GST A;  1XW9 A;  3RAZ A;  3HVS A;  1FO5 A;  4I2T A;  2CAI A;  4F0C A;  2HRN A;  3VWV A;  2H1D A;  4ECC A;  2GT5 A;  1M3J A;  5F8B A;  3TB2 A;  2DMM A;  2XPD A;  4ZIJ A;  2KOK A;  1M2B A;  2LUS A;  4DEJ A;  2BJX A;  4HS1 A;  1PN9 A;  2HI7 A;  4K7N A;  3N9J A;  2H8L A;  1AC1 A;  1EP8 A;  1VGL A;  3MIX A;  2DKH A;  2Z9S A;  4KF9 A;  2FCH A;  3FW2 A;  6GSX A;  3S9F A;  1A0R P;  1YQ1 A;  4BL7 A;  3DVW A;  5KOX A;  1T00 A;  1TTZ A;  4LLR A;  5HFK A;  2RUE A;  1A2J A;  2P5Q A;  2OE3 A;  4MZW A;  4HDE A;  3CYN A;  4FYC A;  3H79 A;  3D22 A;  1A0F A;  4EIP A;  4EIQ A;  3TJF A;  1O6J A;  2R6K A;  3CBU A;  3DXB A;  3IC8 A;  3KTL A;  5G5E A;  5BRT A;  1HNB A;  2I1U A;  1TJD A;  4V2N A;  4IQ1 A;  3A2W A;  2JAD A;  4E8H A;  5IQY A;  3C8E A;  4IJI A;  1SK1 A;  1BYE A;  2IMD A;  3H4K A;  1K0B A;  3NZN A;  3RBT A;  3GTU A;  3LWA A;  4GXZ A;  3WGX A;  1XOB A;  1T7P B;  3LQ7 A;  4GCI A;  3HVN A;  3TCO A;  2FWE A;  4WXT A;  1B9X C;  3FHK A;  3FYG A;  4GWR A;  4RQR A;  1NW2 A;  5DAK A;  5A4U A;  4D73 B;  2VM2 A;  2AV4 A;  4GLT A;  1FG4 A;  4ZB9 A;  2C3T A;  5IPH A;  3EPT A;  2VLV A;  4OFM A;  3KZQ A;  4TOP A;  3GKX A;  5HFG A;  3VPQ A;  5IMF A;  2GQL A;  4TXO A;  4ZL9 A;  3BBY A;  3LYK A;  2HRA A;  1QGV A;  3LXZ A;  1V98 A;  3IDV A;  4IP6 A;  3C71 A;  3ERF A;  2GDR A;  2L59 A;  2R4V A;  2UZ8 A;  1GTU A;  1YDK A;  1OC9 A;  4IKH A;  2H19 A;  3F6D A;  3MWH A;  1GUM A;  3F8U A;  2JZT A;  2X49 A;  1Z5Y E;  5IOW A;  5DCG A;  2H73 A;  1OE8 A;  1PL1 A;  3R2Q A;  3DWV A;  1AQV A;  2H72 A;  4BL7 B;  1RK4 A;  1XIY A;  4HUA A;  16GS A;  4KDU A;  2F3M A;  3GKM A;  1SKW B;  4N30 A;  2J9H A;  2A4V A;  2RM6 A;  5AGY A;  2CVD A;  3GSS A;  4PUF C;  2AAW A;  1ABA A;  4YQM A;  5B6M A;  1A2L A;  4KAE A;  2AUV A;  2FY6 A;  2V6O A;  5B8B A;  5J3R A;  4ID0 A;  3MSZ A;  2QGV A;  4MJB A;  4KUN A;  2ZUP A;  4PX1 A;  1Z7R A;  1AUC A;  1MTC A;  1R26 A;  4IJ3 A;  2O87 A;  4BVY A;  1XPV A;  3GL3 A;  2V2G A;  3WD6 A;  1K0D A;  1BG5 A;  5G2Z A;  4L5O A;  1ZYQ B;  4BIK A;  4K6X A;  2ES7 A;  3GTU B;  3C1R A;  1GSU A;  4LMW A;  6GSY A;  1GTI A;  1T4Y A;  2F8A A;  4PQI A;  1ZMA A;  4N0V A;  3F63 A;  4OD7 A;  5DAK B;  3RHC A;  4XS6 A;  3BOA A;  3CTG A;  4PUA A;  2LV3 A;  2X8H A;  5ECR B;  1R7H A;  5KOW A;  2DC5 A;  1TKD B;  1PKZ A;  4Z2R A;  2VLT A;  5ENU A;  1I9D A;  4FO5 A;  3UJ1 A;  4MZC A;  2HZF A;  2PMT A;  1W4V A;  3U6V A;  1BJX A;  1NM3 A;  3QD9 A;  5EY6 A;  3FY7 A;  4TXO B;  3H8Q A;  5DQY A;  4ACS A;  2CZ3 A;  2REM A;  3APQ A;  2QA2 A;  3G7I A;  3TGZ A;  3CTF A;  1U88 A;  4OMV A;  1WOU A;  4FYB A;  4F9Z A;  4MCU A;  3KP8 A;  2L4C A;  4IQA A;  5ABR A;  4V2M A;  3M3M A;  2BMX A;  4DSQ A;  3IOS A;  2CAQ A;  2GQM A;  5A4W A;  1EV9 A;  2JSZ A;  1U87 A;  2VD0 A;  3QAG A;  1H4O A;  3F9U A;  3D4T A;  4BVX B;  2R2J A;  5ID2 A;  2DSA A;  1GWC A;  3UBL A;  2A4H A;  2V41 A;  1GRX A;  2HLS A;  5JCW A;  5D93 A;  2GTU A;  1OYJ A;  2R37 A;  2H1G A;  4K0G A;  3N5O A;  1X9S B;  3O76 A;  3ME8 A;  3KMO A;  2MYG A;  4G2E A;  2FGX A;  5L71 A;  4XS4 A;  4BVY B;  3TRX A;  2HNL A;  1GH2 A;  4ZBD A;  1F37 A;  2EC4 A;  3QFA C;  3WT1 A;  3GV1 A;  3WYW A;  4CHS A;  4EDY A;  1F2E A;  2NPB A;  3HJP A;  1GNW A;  1THX A;  2MMZ A;  1V2A A;  3M9K A;  4ZL8 A;  3EMX A;  3FEU A;  4DVC A;  4ZBB A;  4O7H A;  2X64 A;  4MJE A;  2DKI A;  5AIX A;  5C00 A;  5A4V A;  3L9U A;  2FWH A;  3A5I A;  3MYD A;  1GLP A;  1RQM A;  2LRT A;  3ZRD A;  1B48 A;  4XRD A;  2OE1 A;  3VLN A;  1YY7 A;  2VL2 C;  5J4U A;  1XXU A;  3KH9 A;  1HNA A;  2JSY A;  4LMV A;  3HD5 A;  1Y25 A;  4EO3 A;  1JFU A;  1WJK A;  3G7J A;  1Z6N A;  1U3I A;  1EP7 A;  3IV4 A;  2HSM A;  2MBS A;  6GSU A;  1N2A A;  5AIV A;  2FWG A;  2DJ3 A;  3HJO A;  2FA4 A;  2HSH A;  4JE1 A;  2IFQ A;  3J7Y k;  1OE7 A;  3F4R A;  2O85 A;  1ZOF A;  2D2Z A;  2IMF A;  1HNC A;  4NWY A;  3I6A A;  1J08 A;  2QC7 A;  1Q4J A;  3R3E A;  3KP9 A;  4QL7 A;  2B6M A;  2B3S A;  3SBC A;  1T8E B;  4HJM A;  4ZBA A;  4IP1 A;  2XBQ A;  3GNJ A;  3LGC A;  2WRT A;  5HFI A;  4HU7 A;  2LQO A;  4I97 A;  4Q5Q A;  5D9W A;  4HOJ A;  2H1A A;  1MD4 A;  5HQP A;  2PUK C;  4KSM A;  3TDG A;  5H5Q A;  2H0G A;  3LSZ A;  1SYX A;  3KD0 A;  3GL5 A;  2H75 A;  1YEX A;  4POK A;  2A2R A;  2HSY A;  2I4A A;  2K6V A;  4MJA A;  4YAV A;  2PVO C;  1XWA A;  1K3O A;  3M8N A;  5LNK e;  2HYX A;  4FQU A;  2H6X A;  1QQ2 A;  4MA9 A;  1YJ6 A;  2ON5 A;  2YZU A;  1H75 A;  2H74 A;  3DRN A;  1XWC A;  3F4S A;  2H70 A;  4HQZ A;  3F3R A;  3L0H A;  4ZIL A;  1X5D A;  4KDX A;  2CV4 A;  1O8X A;  4YQU A;  5IO2 A;  2LRN A;  5IOX A;  1TP9 A;  1JHB A;  3FKF A;  4NAX A;  1XWG A;  10GS A;  1TOF A;  2IN3 A;  3RDW A;  2KHP A;  4V1A g;  4I6X A;  2LKU A;  3NIV A;  1ZCP A;  4IEL A;  3VI7 A;  1EEJ A;  2VLU A;  5DAL A;  1GSY A;  1N8J A;  4USS A;  1XVQ A;  2TRC P;  4IW9 A;  1TI1 A;  2TRX A;  1GLQ A;  3MDK A;  4I8B A;  2TIR A;  4G0K A;  4L8E A;  4EVM A;  1TXX A;  4GST A;  1PA3 A;  4EE0 A;  3IPZ A;  1MD3 A;  5FT3 A;  5ELA A;  2LJR A;  3LG6 A;  4O5R A;  1ZZY A;  2NDO A;  5DVB A;  1M99 A;  4TR1 A;  1T3B A;  5CRE A;  2VIM A;  2V6K A;  4K8M A;  4MDC A;  1FB0 A;  2C80 A;  1LBK A;  4EUY A;  3F4T A;  2LS5 A;  3KJY A;  3LFL A;  2ZCT A;  3ZRE A;  4TKY A;  2G0F A;  4GQC A;  1XWB A;  4ZB8 A;  5GZZ B;  2OJL A;  1SYR A;  2B1K A;  1V9W A;  1VF4 A;  1DUG A;  2YJH A;  2MBT A;  3ERW A;  2JZR A;  1XW5 A;  1PN0 A;  2VOC A;  3LEF A;  1GUH A;  4NXI A;  2N5B A;  13GS A;  1PL2 A;  4O92 A;  4RUV A;  2L57 A;  3WT2 A;  4MZB A;  3UBK A;  4KB3 A;  2YWI A;  3KTB A;  1YF1 A;  4FYU A;  1GL8 A;  2PU9 C;  3CQF A;  2OAC A;  4KCE A;  4TR3 A;  3HCZ A;  2IMI A;  2EIR A;  2DJ0 A;  3IK9 A;  3LOR A;  2GSQ A;  1NHO A;  3TJB A;  3M1G A;  3W6G A;  6GSV A;  2YWM A;  4MK3 A;  3TOT A;  2G2Q A;  3GX8 A;  2L6D A;  2XPE A;  2GVP A;  4MPG A;  3KMN A;  1SL2 B;  1KEB A;  2VCZ A;  4ULX A;  4NPB A;  3C7M A;  3WGE A;  4IN0 A;  1JZW A;  4KH7 A;  4CY8 A;  1CQG A;  3QAV A;  1Q98 A;  2H01 A;  2DBC A;  4MH2 A;  5KN0 A;  3BCK A;  4RQX A;  4RI6 A;  1QFN A;  3TKQ A;  1F9M A;  4IHU A;  2P5R A;  5GSS A;  3D5J A;  1GP1 A;  1V58 A;  3VUR A;  5LD0 A;  4GSS A;  4TW5 A;  1ERV A;  1G6Y A;  2OBK A;  2H1B A;  2K9F A;  17GS A;  1SL0 B;  2O8V B;  4WF4 A;  12GS A;  5FWG A;  4ECJ A;  3TJG A;  1DE2 A;  1SK2 A;  1Z9H A;  1R4W A;  3H93 A;  3Q18 A;  1XCC A;  4PQH A;  2F9S A;  3ISO A;  4G0I A;  3ZMK A;  2GZY A;  3Q74 A;  3GH6 A;  3H1N A;  4NV5 A;  3V1W A;  2A2S A;  4OCF A;  2YP6 A;  3F0I A;  3FR9 A;  4OCE A;  2YN1 A;  3HHV A;  1PD2 1;  5JWO B;  3FZA A;  2CVB A;  4CW9 A;  1LU4 A;  4KE3 A;  1F3B A;  3BCI A;  3NOF A;  1OKT A;  4TR4 A;  1M9A A;  3KH7 A;  4GF0 A;  3GKN A;  2LST A;  3APO A;  1GNE A;  1YF0 A;  4NHW A;  1BX9 A;  4XHM A;  2PER A;  4YH2 A;  5KN1 A;  4WR4 A;  1QK8 A;  2H0H A;  3AY8 A;  1GTA A;  1K0O A;  3GMF A;  1PX6 A;  3DEX A;  2VCQ A;  2GT6 A;  8GSS A;  2IME A;  1TDI A;  1M2D A;  2WUL A;  2DJ1 A;  2O89 A;  4XIH A;  1BQ7 A;  2FWF A;  3FZ9 A;  3L4N A;  1EGO A;  2PPT A;  1FOV A;  5G30 A;  5B7C A;  6GSS A;  1E2Y A;  1WE0 A;  2YWN A;  5JWQ B;  2VO4 A;  3VK9 A;  4A5P A;  1X0R A;  3DKS A;  1O81 A;  1SD8 A;  3IAS 2;  3GRX A;  3IHQ A;  4PQ1 A;  2CQ9 A;  2VCW A;  2I3Y A;  1M9B A;  4QQ7 A;  4X43 A;  2AB6 A;  4AF2 A;  4XS1 A;  1OC9 B;  3I43 A;  3EE2 A;  4TR0 A;  1A24 A;  3ZIV A;  1MDK A;  3ZIJ A;  2FNO A;  1ML6 A;  2OKA A;  3LXT A;  5H5S A;  3D6I A;  2R0P A;  5DCH A;  4AJ6 A;  1TK0 B;  1SJZ A;  3CRU A;  1SU9 A;  2YCD A;  3SWL A;  2R3X A;  4ZL7 A;  5HR1 A;  4PXO A;  4JR4 A;  4EL1 A;  3QFB C;  2XBI A;  1A8Y A;  3IBH A;  1TRS A;  1TK8 B;  1GSQ A;  2GS3 A;  4MJC A;  3JCM L;  1U6T A;  1ON4 A;  1TW9 A;  4GQF A;  1SKR B;  4ECB A;  1U3A A;  5JCG A;  1VRS D;  2VCX A;  4XRA A;  4TVE A;  1M3I A;  2B1L A;  2B7K A;  1EWX A;  3ME7 A;  3EVI A;  2B5E A;  2M72 A;  5COH A;  5G1K A;  1FHE A;  2QA1 A;  2HRF A;  3IC4 A;  5IPG A;  3KGK A;  1DBY A;  1FVK A;  2YPM A;  2OAD A;  3Q19 A;  2FHE A;  4POL A;  1ZGN A;  5J9B A;  2IWT A;  1OC8 A;  1MEK A;  5J9C A;  3PIN A;  1G7E A;  2ALB A;  2H6Z A;  2DJJ A;  3A2V A;  1S3D A;  4K9Z A;  4IGJ A;  3L78 A;  3O6T A;  2H30 A;  3HVX A;  2E7P A;  3A3T A;  4X0X A;  3IE3 A;  5D9V A;  14GS A;  1FOH A;  1PRX A;  5IMA A;  4Q5R A;  4WKW A;  3EWL A;  2OBI A;  4HZ2 A;  2K8S A;  4G0L A;  1AXD A;  1OKD A;  3IAM 2;  1OVN A;  3E0U A;  1WMJ A;  1QXH A;  2E2G A;  5D9X A;  4J57 E;  3VWX A;  1M2A A;  2ON7 A;  2VCV A;  1XBS A;  3C73 A;  1SL1 B;  1VF1 A;  5ECQ B;  3KXO A;  1HD2 A;  5A5K A;  2XC2 A;  5FHI A;  2ZNM A;  1J0F A;  2WFC A;  1F3A A;  3GHA A;  1A23 A;  5IMV A;  2LQQ A;  1ACV A;  3OR5 A;  1XVW A;  4KX4 A;  2C0F A;  4MF6 A;  5EVO A;  1SJ6 A;  5ID2 B;  3PGT A;  3P7X A;  2H76 A;  4MMM A;  4DSS A;  1I5G A;  4XCS A;  4P3Y B;  2WJU A;  4JU5 A;  2FUG 2;  3TKS A;  4TN8 A;  3CSH A;  1EOH A;  2F8F A;  1ZYP A;  2YZH A;  3GX0 A;  2DJ2 A;  1LJR A;  5ECO B;  5G1L A;  3ZFL A;  2C8U A;  3F3Q A;  2L4Q A;  2LEG A;  1S3R A;  2M80 A;  4XS4 B;  4TXV A;  1A8L A;  3D21 A;  4AJ8 A;  5G5F A;  5DBQ A;  3QDN A;  2JAC A;  3UMA A;  4N11 A;  5F06 A;  1TRV A;  1B4P A;  2FA8 A;  2V1M A;  4ZXG A;  4MLY A;  3TJK A;  2KP2 A;  2H66 A;  2BTO T;  5ECM B;  4FIW A;  2XHF A;  2PWJ A;  5G31 A;  3GKK A;  4BA7 A;  1UVZ A;  2PGT A;  4BWQ A;  1F6M C;  3EUR A;  4JR6 A;  1SD9 A;  1K0N A;  2VAF A;  3RHB A;  1K3L A;  2NTO A;  1PX7 A;  2C0D A;  2VL9 A;  5JCU A;  1VF3 A;  4POM A;  5CRH A;  2NBS A;  4CY6 A;  5CAX A;  1UN2 A;  2C4J A;  1AQX A;  2CX3 A;  2LJA A;  4I5Q A;  2C3N A;  2GQK A;  2DLX A;  5INY A;  3TKP A;  1X9M B;  3QCP A;  2RII A;  4Z2T A;  4PTS A;  1PFO A;  3QMX A;  4MH3 A;  4HJ2 A;  3UIW A;  3VPT A;  3TJJ A;  2YJ7 A;  2X4A A;  3ZLP A;  2KLX A;  2IFQ B;  5ELG A;  3D4M A;  5EPF A;  3TRQ A;  3UVH A;  4G10 A;  3BD2 A;  1Z6M A;  2GSS A;  3UEM A;  1YKA A;  19GS A;  2H0I A;  1GSF A;  3K8N A;  5H5R A;  1OC3 A;  2MMN A;  3Q6O A;  4ML1 A;  4HZ4 A;  3UAR A;  3DIE A;  1G7O A;  3DYR A;  1A2M A;  4KW6 A;  1ERU A;  1CQH A;  2HZE A;  1W89 A;  2VCT A;  4QL9 A;  3CRT A;  4L0U A;  1XG8 A;  4D73 A;  4WET A;  5ECS A;  4OO5 A;  3DD3 A;  2WZ9 A;  1R5P A;  3D0Z A;  5IIZ A;  1XOA A;  1WIK A;  2EIO A;  1R5A A;  3GYK A;  3FK8 A;  1K0M A;  5E59 A;  2QSI A;  1YKC A;  3TKS C;  5F05 A;  3ZVJ D;  3IA1 A;  4EDZ A;  3EIN A;  1X5C A;  4POB A;  3W8J A;  3J7Y b;  1JLV A;  5GAN D;  4K7O A;  5ECL B;  4K7I A;  4YAP A;  2RM5 A;  3IR4 A;  4Q5F A;  2LNS A;  2VUP A;  3M0F A;  1B8X A;  4AGS A;  2JL4 A;  4EXJ A;  2E2M A;  11GS A;  1Z7P A;  2WGR A;  3GIX A;  4N0Z A;  3LYP A;  2K18 A;  4NHZ A;  4K2D A;  3HKR A;  5DJL A;  1T4Z A;  3IXR A;  4L5L A;  3EU3 A;  4AJ7 A;  1HYU A;  4E8E A;  3TKS E;  1O85 A;  2J23 A;  3GH9 A;  5DAL B;  1PSQ A;  3TUE A;  1SK0 A;  2LJK A;  2AJQ B;  3PH9 A;  1ILO A;  1PKW A;  1GSE A;  1YEP A;  2WS2 A;  2E0Q A;  3EMP A;  1C72 A;  1FVJ A;  2YOI A;  3L9V A;  2LRC A;  2DJK A;  4LL4 B;  5ECH B;  3EYT A;  2HZE B;  5HR3 A;  4F82 A;  4WBJ A;  2GZP A;  5IMZ A;  3F6F A;  4I2U A;  3VWW A;  3HVV A;  4KSO A;  2KUC A;  4K1F A;  4MP4 A;  2YV9 A;  4TR1 B;  4YKF A;  2V32 A;  2L5O A;  4JED A;  1Z3E A;  1O7U A;  1TK5 B;  3ZYW A;  4K5S A;  1MDI A;  4Q5N A;  3GST A;  3KIJ A;  5J41 A;  5DDL A;  2CT6 A;  1G0T A;  2X8C A;  2VD1 A; 
#chains in the Genus database with same CATH homology
 4KA0 A;  4WR5 A;  1QMV A;  4X1U A;  2AYT A;  2N5F A;  3TOU A;  3CMI A;  2EIQ A;  3TKR A;  4HQS A;  1THO A;  3ZL5 A;  3LW9 A;  3KEB A;  1WPI A;  2CA8 A;  5CRG A;  3GFK A;  4BPY A;  1KBN A;  2IJY A;  4MAB A;  4GRF A;  1JZR A;  2O7K A;  2CZ2 A;  2JU5 A;  4FH8 A;  1FW1 A;  2LNT A;  3E3E A;  2DIZ A;  1K0C A;  1UC7 A;  4BVX A;  4X4J A;  3QR6 A;  2X99 A;  3CSI A;  3M9J A;  1ZL9 A;  1EOG A;  2DIY A;  2MZC A;  1MDJ A;  3UOM A;  4EKZ A;  3O3T A;  4KDY A;  1AQW A;  1O73 A;  1AIU A;  4J2F A;  3P8W A;  2FD3 A;  1EV4 A;  1NSW A;  3FZ4 A;  1USB A;  1Y6E A;  2HT9 A;  1G6W A;  2R0C A;  2VL3 A;  4Z7X A;  1BED A;  2C0E A;  1HQO A;  4OWY A;  2VL2 A;  2K8V A;  2FLS A;  2C1Y A;  3C1S A;  4EF0 A;  1PMT A;  5HR2 A;  2H71 A;  3L9S A;  2WCI A;  4TRX A;  4XTS A;  2B5X A;  2P31 A;  1J9B A;  3VFI A;  3ED3 A;  4PNF A;  2L6C A;  4G9H A;  1GTB A;  4O5Q A;  4KCA A;  4F03 A;  3A2X A;  1KTE A;  3RPP A;  4HU9 A;  1QUW A;  5EL8 A;  5B6N A;  1EGR A;  3I69 A;  4RI7 A;  4V2L A;  1DE1 A;  2YV7 A;  4ML6 A;  1V57 A;  1FB6 A;  1O8W A;  1K0A A;  1TRU A;  4ILF A;  4J56 E;  3P2A A;  1SJI A;  1M7T A;  1TI3 A;  3HY2 A;  5D8I A;  1S3A A;  5B8A A;  1ZYN A;  20GS A;  2GLR A;  1DSB A;  4JRR A;  3DGQ A;  4JZQ A;  3HZ8 A;  3HZ4 A;  1GSD A;  4N10 A;  1SKS B;  18GS A;  5KN3 A;  2RUF A;  2OA7 A;  4K0N A;  2AHE A;  1JZO A;  3A5W A;  1JLW A;  4K2X A;  3ZML A;  2IPA A;  2C0G A;  2VM1 A;  3IK7 A;  3GA4 A;  5D96 A;  5HR0 A;  4NMU A;  3UVT A;  5KEJ A;  4ECI A;  3FMW A;  3ZFB A;  4EC0 A;  1GSS A;  7GSS A;  4OO4 A;  2R0G A;  3US3 A;  3FZ5 A;  3I9V 2;  3P90 A;  1AAZ A;  4WEY A;  4F2I A;  1XZO A;  5D9T A;  3G9B A;  2F51 A;  3KCM A;  1TRW A;  1K3Y A;  2CX4 A;  4OFT A;  1ST9 A;  1E6B A;  2GZZ A;  2IL3 A;  3UL3 A;  4K5R A;  4HI7 A;  1ZYE A;  4MPF A;  4O5U A;  1AW9 A;  3ZIT A;  5ECI B;  4DSR A;  1EZK A;  1PGT A;  1OAZ A;  1SEN A;  2IMK A;  3E9J B;  4ZB6 A;  4CDO A;  3UAP A;  2L5L A;  5IM9 A;  1UA5 A;  2PBJ A;  2HRK A;  3FR3 A;  2C3Q A;  5CRD A;  3KM6 A;  4PGT A;  3GUS A;  5CNW A;  5ECP B;  3ERG A;  1X9W B;  5IO0 A;  3HJM A;  2QKE A;  3W8S A;  3ZZX A;  1WWJ A;  2JZS A;  3GUR A;  2HXK A;  4KND A;  2WB9 A;  4PNG A;  2I9H A;  1GUL A;  1NHY A;  3IRA A;  3TRP A;  1B9Y C;  3LJR A;  3EU4 A;  2YWO A;  5LCZ A;  1RW1 A;  5CP1 A;  2NVL A;  1T1V A;  2I81 A;  2CVK A;  3PPU A;  4KGI A;  9GSS A;  5J5N A;  4MF7 A;  3PR8 A;  4ICY A;  5F0G A;  4O32 A;  5DJM A;  4L0W A;  2KP1 A;  2MMA A;  2N5A A;  4GSN A;  5D73 A;  4MF5 A;  2M46 A;  2MMO A;  2R5G A;  5CYY A;  2X8G A;  5C04 A;  3HDC A;  4V1A p;  3VI5 A;  4IBP A;  4F0B A;  2HE3 A;  3CXG A;  3MAK A;  6GST A;  3BJ5 A;  2OE0 A;  3IHG A;  1TU7 A;  4HEA 2;  5AIS A;  2B5Y A;  5DQS A;  5GAP D;  2IIY A;  2RLI A;  2GST A;  3HYP A;  3MNG A;  2YNX A;  5AN1 A;  2H6Y A;  2PVQ A;  3QPM A;  4IS0 A;  4NV2 A;  1WRY A;  3GN3 A;  5JWR B;  2DML A;  4WBR D;  3VWU A;  1JZD A;  1X5E A;  4YQV A;  2P0G A;  5F07 A;  1XWK A;  4MNN A;  1B4Q A;  2PN8 A;  1IYH A;  1EEM A;  3FR6 A;  5ECK B;  5CO3 A;  2WDU A;  3EC3 A;  5E4W A;  3ZVJ A;  5KN2 A;  3HA9 A;  3ZTL A;  1XFL A;  3G7Y A;  5IMD A;  1KNG A;  4IVF A;  3RPN A;  2LTK A;  3APS A;  1XW6 A;  6GSW A;  4G19 A;  1GUK A;  1FAA A;  1PQN A;  4PUR A;  4H86 A;  5ECN B;  1BAY A;  5IMC A;  3QAW A;  1M0U A;  2B7J A;  2GSR A;  1WP0 A;  2A2P A;  3FRC A;  4Z2U A;  4OFN A;  1IYI A;  1ERW A;  1S3C A;  2YAN A;  5BMU A;  4DSS B;  1URM A;  3QOU A;  4JBB A;  4GTU A;  3DVX A;  3U5R E;  1V40 A;  4BWS A;  22GS A;  2GGT A;  3DML A;  4LA1 A;  1ERT A;  1YZX A;  4WF5 A;  4YKG A;  3WGD A;  1TU8 A;  3HXS A;  1VF2 A;  5CRW A;  4LL1 B;  2HFD A;  3CSJ A;  4ISD A;  5GST A;  1XW9 A;  3RAZ A;  3HVS A;  1FO5 A;  4I2T A;  2CAI A;  4F0C A;  2HRN A;  3VWV A;  2H1D A;  4ECC A;  2GT5 A;  5F8B A;  3TB2 A;  2DMM A;  2XPD A;  4ZIJ A;  2KOK A;  1M2B A;  2LUS A;  4DEJ A;  2BJX A;  4HS1 A;  1PN9 A;  2HI7 A;  4K7N A;  3N9J A;  2H8L A;  1AC1 A;  1EP8 A;  1VGL A;  3MIX A;  2DKH A;  2Z9S A;  4KF9 A;  2FCH A;  3FW2 A;  6GSX A;  3S9F A;  1A0R P;  1YQ1 A;  4BL7 A;  3DVW A;  5KOX A;  1T00 A;  1TTZ A;  4LLR A;  5HFK A;  2RUE A;  1A2J A;  2P5Q A;  2OE3 A;  4MZW A;  4HDE A;  3CYN A;  4FYC A;  3H79 A;  3D22 A;  1A0F A;  4EIP A;  4EIQ A;  3TJF A;  1O6J A;  2R6K A;  3CBU A;  3DXB A;  3IC8 A;  3KTL A;  5G5E A;  5BRT A;  1HNB A;  2I1U A;  1TJD A;  4V2N A;  4IQ1 A;  3A2W A;  2JAD A;  4E8H A;  5IQY A;  3C8E A;  4IJI A;  1SK1 A;  1BYE A;  2IMD A;  3H4K A;  1K0B A;  3NZN A;  3RBT A;  3GTU A;  3LWA A;  4GXZ A;  3WGX A;  1XOB A;  1T7P B;  3LQ7 A;  4GCI A;  3TCO A;  2FWE A;  4WXT A;  1B9X C;  3FHK A;  3FYG A;  4GWR A;  4RQR A;  1NW2 A;  5DAK A;  5A4U A;  4D73 B;  2VM2 A;  2AV4 A;  4GLT A;  1FG4 A;  4ZB9 A;  2C3T A;  5IPH A;  3EPT A;  2VLV A;  4OFM A;  3KZQ A;  4TOP A;  3GKX A;  5HFG A;  3VPQ A;  5IMF A;  2GQL A;  4TXO A;  4ZL9 A;  3BBY A;  3LYK A;  2HRA A;  1QGV A;  3LXZ A;  1V98 A;  3IDV A;  4IP6 A;  3C71 A;  3ERF A;  2GDR A;  2L59 A;  2R4V A;  2UZ8 A;  1GTU A;  1YDK A;  1OC9 A;  4IKH A;  2H19 A;  3F6D A;  3MWH A;  1GUM A;  3F8U A;  2JZT A;  2X49 A;  1Z5Y E;  5IOW A;  5DCG A;  2H73 A;  1OE8 A;  1PL1 A;  3R2Q A;  3DWV A;  1AQV A;  2H72 A;  4BL7 B;  1RK4 A;  1XIY A;  4HUA A;  16GS A;  4KDU A;  2F3M A;  3GKM A;  1SKW B;  4N30 A;  2J9H A;  2A4V A;  2RM6 A;  5AGY A;  2CVD A;  3GSS A;  4PUF C;  2AAW A;  1ABA A;  4YQM A;  5B6M A;  1A2L A;  4KAE A;  2AUV A;  2FY6 A;  2V6O A;  5B8B A;  5J3R A;  4ID0 A;  3MSZ A;  2QGV A;  4MJB A;  4KUN A;  2ZUP A;  4PX1 A;  1Z7R A;  1AUC A;  1MTC A;  1R26 A;  4IJ3 A;  2O87 A;  4BVY A;  1XPV A;  3GL3 A;  2V2G A;  3WD6 A;  1K0D A;  1BG5 A;  5G2Z A;  4L5O A;  1ZYQ B;  4K6X A;  2ES7 A;  3GTU B;  3C1R A;  1GSU A;  4LMW A;  6GSY A;  1GTI A;  1T4Y A;  2F8A A;  4PQI A;  1ZMA A;  4N0V A;  3F63 A;  4OD7 A;  5DAK B;  3RHC A;  4XS6 A;  3BOA A;  3CTG A;  4PUA A;  2LV3 A;  2X8H A;  5ECR B;  1R7H A;  5KOW A;  2DC5 A;  1TKD B;  1PKZ A;  4Z2R A;  2VLT A;  5ENU A;  1I9D A;  4FO5 A;  3UJ1 A;  4MZC A;  2HZF A;  2PMT A;  1W4V A;  3U6V A;  1BJX A;  1NM3 A;  3QD9 A;  5EY6 A;  3FY7 A;  4TXO B;  3H8Q A;  5DQY A;  4ACS A;  2CZ3 A;  2REM A;  3APQ A;  2QA2 A;  3G7I A;  3TGZ A;  3CTF A;  1U88 A;  4OMV A;  1WOU A;  4FYB A;  4F9Z A;  4MCU A;  3KP8 A;  2L4C A;  4IQA A;  5ABR A;  4V2M A;  3M3M A;  2BMX A;  4DSQ A;  3IOS A;  2CAQ A;  2GQM A;  5A4W A;  1EV9 A;  2JSZ A;  1U87 A;  2VD0 A;  3QAG A;  1H4O A;  3F9U A;  3D4T A;  4BVX B;  2R2J A;  5ID2 A;  2DSA A;  1GWC A;  3UBL A;  2A4H A;  2V41 A;  1GRX A;  2HLS A;  5JCW A;  5D93 A;  2GTU A;  1OYJ A;  2R37 A;  2H1G A;  4K0G A;  3N5O A;  1X9S B;  3O76 A;  3ME8 A;  3KMO A;  2MYG A;  4G2E A;  2FGX A;  5L71 A;  4XS4 A;  4BVY B;  3TRX A;  2HNL A;  1GH2 A;  4ZBD A;  1F37 A;  2EC4 A;  3QFA C;  3WT1 A;  3GV1 A;  3WYW A;  4CHS A;  4EDY A;  1F2E A;  2NPB A;  3HJP A;  1GNW A;  1THX A;  2MMZ A;  1V2A A;  3M9K A;  4ZL8 A;  3EMX A;  3FEU A;  4DVC A;  4ZBB A;  4O7H A;  2X64 A;  4MJE A;  2DKI A;  5AIX A;  5C00 A;  5A4V A;  3L9U A;  2FWH A;  3A5I A;  3MYD A;  1GLP A;  1RQM A;  2LRT A;  3ZRD A;  1B48 A;  4XRD A;  2OE1 A;  3VLN A;  1YY7 A;  2VL2 C;  5J4U A;  1XXU A;  3KH9 A;  1HNA A;  2JSY A;  4LMV A;  3HD5 A;  1Y25 A;  4EO3 A;  1JFU A;  1WJK A;  3G7J A;  1Z6N A;  1U3I A;  1EP7 A;  3IV4 A;  2HSM A;  2MBS A;  6GSU A;  1N2A A;  5AIV A;  2FWG A;  2DJ3 A;  3HJO A;  2FA4 A;  2HSH A;  4JE1 A;  2IFQ A;  3J7Y k;  1OE7 A;  3F4R A;  2O85 A;  1ZOF A;  2D2Z A;  2IMF A;  1HNC A;  4NWY A;  3I6A A;  1J08 A;  2QC7 A;  1Q4J A;  3R3E A;  3KP9 A;  4QL7 A;  2B6M A;  2B3S A;  3SBC A;  1T8E B;  4HJM A;  4ZBA A;  4IP1 A;  2XBQ A;  3GNJ A;  3LGC A;  2WRT A;  5HFI A;  4HU7 A;  2LQO A;  4I97 A;  4Q5Q A;  5D9W A;  4HOJ A;  2H1A A;  1MD4 A;  5HQP A;  2PUK C;  4KSM A;  3TDG A;  5H5Q A;  2H0G A;  3LSZ A;  1SYX A;  3KD0 A;  3GL5 A;  2H75 A;  1YEX A;  4POK A;  2A2R A;  2HSY A;  2I4A A;  2K6V A;  4MJA A;  4YAV A;  2PVO C;  1XWA A;  1K3O A;  3M8N A;  5LNK e;  2HYX A;  4FQU A;  2H6X A;  1QQ2 A;  4MA9 A;  1YJ6 A;  2ON5 A;  2YZU A;  1H75 A;  2H74 A;  3DRN A;  1XWC A;  3F4S A;  2H70 A;  4HQZ A;  3F3R A;  3L0H A;  4ZIL A;  1X5D A;  4KDX A;  2CV4 A;  1O8X A;  4YQU A;  5IO2 A;  2LRN A;  5IOX A;  1TP9 A;  1JHB A;  3FKF A;  4NAX A;  1XWG A;  10GS A;  1TOF A;  2IN3 A;  3RDW A;  2KHP A;  4V1A g;  4I6X A;  2LKU A;  3NIV A;  1ZCP A;  4IEL A;  3VI7 A;  1EEJ A;  2VLU A;  5DAL A;  1GSY A;  1N8J A;  4USS A;  1XVQ A;  2TRC P;  4IW9 A;  1TI1 A;  2TRX A;  1GLQ A;  3MDK A;  4I8B A;  2TIR A;  4G0K A;  4L8E A;  4EVM A;  1TXX A;  4GST A;  1PA3 A;  4EE0 A;  3IPZ A;  1MD3 A;  5FT3 A;  5ELA A;  2LJR A;  3LG6 A;  4O5R A;  1ZZY A;  2NDO A;  5DVB A;  1M99 A;  4TR1 A;  1T3B A;  5CRE A;  2VIM A;  2V6K A;  4K8M A;  4MDC A;  1FB0 A;  2C80 A;  1LBK A;  4EUY A;  3F4T A;  2LS5 A;  3KJY A;  3LFL A;  2ZCT A;  3ZRE A;  4TKY A;  2G0F A;  4GQC A;  1XWB A;  4ZB8 A;  5GZZ B;  2OJL A;  1SYR A;  2B1K A;  1V9W A;  1VF4 A;  1DUG A;  2YJH A;  2MBT A;  3ERW A;  2JZR A;  1XW5 A;  1PN0 A;  2VOC A;  3LEF A;  1GUH A;  4NXI A;  2N5B A;  13GS A;  1PL2 A;  4O92 A;  4RUV A;  2L57 A;  3WT2 A;  4MZB A;  3UBK A;  4KB3 A;  2YWI A;  3KTB A;  1YF1 A;  4FYU A;  1GL8 A;  2PU9 C;  2OAC A;  4KCE A;  4TR3 A;  3HCZ A;  2IMI A;  2EIR A;  2DJ0 A;  3IK9 A;  3LOR A;  2GSQ A;  1NHO A;  3TJB A;  3M1G A;  3W6G A;  6GSV A;  2YWM A;  4MK3 A;  3TOT A;  2G2Q A;  3GX8 A;  2L6D A;  2XPE A;  2GVP A;  4MPG A;  3KMN A;  1SL2 B;  1KEB A;  2VCZ A;  4ULX A;  4NPB A;  3C7M A;  3WGE A;  4IN0 A;  1JZW A;  4KH7 A;  4CY8 A;  1CQG A;  3QAV A;  1Q98 A;  2H01 A;  2DBC A;  4MH2 A;  5KN0 A;  3BCK A;  4RQX A;  4RI6 A;  1QFN A;  3TKQ A;  1F9M A;  4IHU A;  2P5R A;  5GSS A;  3D5J A;  1GP1 A;  1V58 A;  3VUR A;  5LD0 A;  4GSS A;  4TW5 A;  1ERV A;  1G6Y A;  2OBK A;  2H1B A;  2K9F A;  17GS A;  1SL0 B;  2O8V B;  4WF4 A;  12GS A;  5FWG A;  4ECJ A;  3TJG A;  1DE2 A;  1SK2 A;  1Z9H A;  1R4W A;  3H93 A;  3Q18 A;  1XCC A;  4PQH A;  2F9S A;  3ISO A;  4G0I A;  3ZMK A;  2GZY A;  3Q74 A;  3GH6 A;  3H1N A;  4NV5 A;  3V1W A;  2A2S A;  4OCF A;  2YP6 A;  3F0I A;  3FR9 A;  4OCE A;  2YN1 A;  3HHV A;  1PD2 1;  5JWO B;  3FZA A;  2CVB A;  4CW9 A;  1LU4 A;  4KE3 A;  1F3B A;  3BCI A;  3NOF A;  1OKT A;  4TR4 A;  1M9A A;  3KH7 A;  4GF0 A;  3GKN A;  2LST A;  3APO A;  1GNE A;  1YF0 A;  4NHW A;  1BX9 A;  4XHM A;  2PER A;  4YH2 A;  5KN1 A;  4WR4 A;  1QK8 A;  2H0H A;  3AY8 A;  1GTA A;  1K0O A;  3GMF A;  1PX6 A;  3DEX A;  2VCQ A;  2GT6 A;  8GSS A;  2IME A;  1TDI A;  1M2D A;  2WUL A;  2DJ1 A;  2O89 A;  4XIH A;  1BQ7 A;  2FWF A;  3FZ9 A;  3L4N A;  1EGO A;  2PPT A;  1FOV A;  5G30 A;  5B7C A;  6GSS A;  1E2Y A;  1WE0 A;  2YWN A;  5JWQ B;  2VO4 A;  3VK9 A;  4A5P A;  1X0R A;  3DKS A;  1O81 A;  1SD8 A;  3IAS 2;  3GRX A;  3IHQ A;  4PQ1 A;  2CQ9 A;  2VCW A;  2I3Y A;  1M9B A;  4QQ7 A;  4X43 A;  2AB6 A;  4AF2 A;  4XS1 A;  1OC9 B;  3I43 A;  3EE2 A;  4TR0 A;  1A24 A;  3ZIV A;  1MDK A;  3ZIJ A;  2FNO A;  1ML6 A;  2OKA A;  3LXT A;  5H5S A;  3D6I A;  2R0P A;  5DCH A;  4AJ6 A;  1TK0 B;  1SJZ A;  3CRU A;  1SU9 A;  2YCD A;  3SWL A;  2R3X A;  4ZL7 A;  5HR1 A;  4PXO A;  4JR4 A;  4EL1 A;  3QFB C;  2XBI A;  1A8Y A;  3IBH A;  1TRS A;  1TK8 B;  1GSQ A;  2GS3 A;  4MJC A;  3JCM L;  1U6T A;  1ON4 A;  1TW9 A;  4GQF A;  1SKR B;  4ECB A;  1U3A A;  5JCG A;  1VRS D;  2VCX A;  4XRA A;  4TVE A;  2B1L A;  2B7K A;  1EWX A;  3ME7 A;  3EVI A;  2B5E A;  2M72 A;  5COH A;  5G1K A;  1FHE A;  2QA1 A;  2HRF A;  3IC4 A;  5IPG A;  3KGK A;  1DBY A;  1FVK A;  2YPM A;  2OAD A;  3Q19 A;  2FHE A;  4POL A;  1ZGN A;  5J9B A;  2IWT A;  1OC8 A;  1MEK A;  5J9C A;  3PIN A;  1G7E A;  2ALB A;  2H6Z A;  2DJJ A;  3A2V A;  1S3D A;  4K9Z A;  4IGJ A;  3L78 A;  3O6T A;  2H30 A;  3HVX A;  2E7P A;  3A3T A;  4X0X A;  3IE3 A;  5D9V A;  14GS A;  1FOH A;  1PRX A;  5IMA A;  4Q5R A;  4WKW A;  3EWL A;  2OBI A;  4HZ2 A;  2K8S A;  4G0L A;  1AXD A;  1OKD A;  3IAM 2;  1OVN A;  3E0U A;  1WMJ A;  1QXH A;  2E2G A;  5D9X A;  4J57 E;  3VWX A;  1M2A A;  2ON7 A;  2VCV A;  1XBS A;  3C73 A;  1SL1 B;  1VF1 A;  5ECQ B;  3KXO A;  1HD2 A;  5A5K A;  2XC2 A;  5FHI A;  2ZNM A;  1J0F A;  2WFC A;  1F3A A;  3GHA A;  1A23 A;  5IMV A;  2LQQ A;  1ACV A;  3OR5 A;  1XVW A;  4KX4 A;  2C0F A;  4MF6 A;  5EVO A;  1SJ6 A;  5ID2 B;  3PGT A;  3P7X A;  2H76 A;  4MMM A;  4DSS A;  1I5G A;  4XCS A;  4P3Y B;  2WJU A;  4JU5 A;  2FUG 2;  3TKS A;  4TN8 A;  3CSH A;  1EOH A;  2F8F A;  1ZYP A;  2YZH A;  3GX0 A;  2DJ2 A;  1LJR A;  5ECO B;  5G1L A;  3ZFL A;  2C8U A;  3F3Q A;  2L4Q A;  2LEG A;  2M80 A;  4XS4 B;  4TXV A;  1A8L A;  3D21 A;  4AJ8 A;  5G5F A;  5DBQ A;  3QDN A;  2JAC A;  3UMA A;  4N11 A;  5F06 A;  1TRV A;  1B4P A;  2FA8 A;  2V1M A;  4ZXG A;  4MLY A;  3TJK A;  2KP2 A;  2H66 A;  2BTO T;  5ECM B;  4FIW A;  2XHF A;  2PWJ A;  5G31 A;  3GKK A;  4BA7 A;  1UVZ A;  2PGT A;  4BWQ A;  1F6M C;  3EUR A;  4JR6 A;  1SD9 A;  1K0N A;  2VAF A;  3RHB A;  1K3L A;  2NTO A;  1PX7 A;  2C0D A;  2VL9 A;  5JCU A;  1VF3 A;  4POM A;  5CRH A;  2NBS A;  4CY6 A;  5CAX A;  1UN2 A;  2C4J A;  1AQX A;  2CX3 A;  2LJA A;  4I5Q A;  2C3N A;  2GQK A;  2DLX A;  5INY A;  3TKP A;  1X9M B;  3QCP A;  2RII A;  4Z2T A;  4PTS A;  3QMX A;  4MH3 A;  4HJ2 A;  3UIW A;  3VPT A;  3TJJ A;  2YJ7 A;  2X4A A;  3ZLP A;  2KLX A;  2IFQ B;  5ELG A;  3D4M A;  5EPF A;  3TRQ A;  3UVH A;  4G10 A;  3BD2 A;  1Z6M A;  2GSS A;  3UEM A;  1YKA A;  19GS A;  2H0I A;  1GSF A;  3K8N A;  5H5R A;  1OC3 A;  2MMN A;  3Q6O A;  4ML1 A;  4HZ4 A;  3UAR A;  3DIE A;  1G7O A;  3DYR A;  1A2M A;  4KW6 A;  1ERU A;  1CQH A;  2HZE A;  1W89 A;  2VCT A;  4QL9 A;  3CRT A;  4L0U A;  4D73 A;  4WET A;  5ECS A;  4OO5 A;  3DD3 A;  2WZ9 A;  1R5P A;  3D0Z A;  5IIZ A;  1XOA A;  1WIK A;  2EIO A;  1R5A A;  3GYK A;  3FK8 A;  1K0M A;  5E59 A;  2QSI A;  1YKC A;  3TKS C;  5F05 A;  3ZVJ D;  3IA1 A;  4EDZ A;  3EIN A;  1X5C A;  4POB A;  3W8J A;  3J7Y b;  1JLV A;  5GAN D;  4K7O A;  5ECL B;  4K7I A;  4YAP A;  2RM5 A;  3IR4 A;  4Q5F A;  2LNS A;  2VUP A;  3M0F A;  1B8X A;  4AGS A;  2JL4 A;  4EXJ A;  2E2M A;  11GS A;  1Z7P A;  2WGR A;  3GIX A;  4N0Z A;  3LYP A;  2K18 A;  4NHZ A;  4K2D A;  3HKR A;  5DJL A;  1T4Z A;  3IXR A;  4L5L A;  3EU3 A;  4AJ7 A;  1HYU A;  4E8E A;  3TKS E;  1O85 A;  2J23 A;  3GH9 A;  5DAL B;  1PSQ A;  3TUE A;  1SK0 A;  2LJK A;  2AJQ B;  3PH9 A;  1ILO A;  1PKW A;  1GSE A;  1YEP A;  2WS2 A;  2E0Q A;  3EMP A;  1C72 A;  1FVJ A;  2YOI A;  3L9V A;  2LRC A;  2DJK A;  4LL4 B;  5ECH B;  3EYT A;  2HZE B;  5HR3 A;  4F82 A;  4WBJ A;  2GZP A;  5IMZ A;  3F6F A;  4I2U A;  3VWW A;  3HVV A;  4KSO A;  2KUC A;  4K1F A;  4MP4 A;  2YV9 A;  4TR1 B;  4YKF A;  2V32 A;  2L5O A;  4JED A;  1Z3E A;  1O7U A;  1TK5 B;  3ZYW A;  4K5S A;  1MDI A;  4Q5N A;  3GST A;  3KIJ A;  5J41 A;  5DDL A;  2CT6 A;  1G0T A;  2X8C A;  2VD1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...