1NHOA

Structural and functional characterization of a thioredoxin-like protein from methanobacterium thermoautotrophicum
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
85
structure length
85
Chain Sequence
MVVNIEVFTSPTCPYCPMAIEVVDEAKKEFGDKIDVEKIDIMVDREKAIEYGLMAVPAIAINGVVRFVGAPSREELFEAINDEME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable Thioredoxin
publication title Structural and Functional Characterization of a Thioredoxin-like Protein (Mt0807) from Methanobacterium thermoautotrophicum
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Oxidoreductase
total genus 13
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2002-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1nhoA00
1A2MA 3WGDA 1KEBA 2DMMA 3FZ4A 2VCZA 1J9BA 4OCFA 1TU7A 1ZL9A 4MJEA 5A4VA 2IMIA 5E4WA 3LFLA 1SKWB 3IAS2 4HU7A 1WMJA 2WJUA 1FHEA 5J41A 1H75A 4GCIA 1V9WA 3HHVA 1O7UA 1K3YA 1GSQA 1BQ7A 5HR0A 3IBHA 4BA7A 1XBSA 5HR1A 4ACSA 2TRXA 1ZCPA 1T7PB 5DBQA 1MEKA 1OYJA 2C8UA 3EMXA 4WXTA 3D0ZA 4J2FA 4PGTA 4BL7A 4CDOA 4POLA 3TRQA 2AJQB 1ABAA 4XS6A 1JZOA 2VCTA 1QK8A 1F37A 4V2NA 3ME8A 2VM1A 4ZL7A 5GSTA 1YJ6A 4MJBA 2EIRA 2VIMA 5H5SA 1MDJA 1TRUA 3SBCA 3QOUA 1S3AA 1EEJA 5ECMB 1Q98A 4YQVA 3L4NA 4MJCA 5ID2B 2HZEB 2L4CA 4LMVA 1RW1A 3ZFLA 1HNAA 1K3OA 5IMCA 2R2JA 1A0FA 4I2TA 3FR3A 1AQXA 3KP8A 3KMOA 1PD21 2C3TA 2DLXA 2DSAA 3O3TA 5DQSA 3L0HA 4KCEA 3K8NA 2A2SA 3TB2A 2A4VA 4PNGA 5H5RA 1VGLA 5DAKB 3UOMA 5DJMA 3H8QA 2IMEA 1FVJA 2P5RA 1PX7A 1ZMAA 2WULA 4RQXA 1V2AA 3IHQA 4LA1A 1SKSB 3P8WA 1PQNA 3TJGA 4GLTA 4POMA 4D73A 4FYBA 2CA8A 2F3MA 5D9TA 1NHYA 1K0CA 4WBJA 3APOA 1YF1A 1TW9A 2VL2C 3QD9A 2O7KA 4ML1A 5ECPB 1Y25A 3QDNA 3QAVA 3TGZA 1TTZA 2F8AA 2DJJA 4ZB9A 4WKWA 4NAXA 2EIOA 3G7IA 3ZIVA 1R5AA 1B4QA 4CW9A 3CSJA 1I9DA 1ZGNA 4O92A 3FKFA 1WPIA 2X8HA 4EC0A 4K1FA 2M72A 3H1NA 3M0FA 4HQZA 4EO3A 3GKXA 1FG4A 3ZMLA 1V58A 4KB3A 5ECKB 2B3SA 1MD3A 1SD8A 4MPGA 3W6GA 1S3CA 3HZ4A 2L59A 4LLRA 4N10A 3F9UA 2B1KA 4TR0A 1OE7A 1XWKA 3GSSA 2XPDA 2HSHA 3HDCA 5JWQB 4XS4A 4OFNA 2CVDA 2ON5A 2VLUA 3CTGA 1TK5B 4YH2A 4YAVA 3KGKA 3GX8A 1A24A 17GSA 2WB9A 4IJ3A 1BG5A 4FIWA 5HFGA 3MWHA 1GULA 5IOWA 3GL3A 3O76A 5JCGA 1SK2A 3IR4A 3ZL5A 3ERWA 1KNGA 2WS2A 1Z7RA 3TDGA 3DVXA 3IDVA 1HNBA 3UEMA 4TR1A 3I69A 2YZHA 2L57A 1Z5YE 3SWLA 3ZIJA 1F3BA 2KP1A 1PRXA 1XVQA 1XPVA 2ES7A 4F0CA 3GKNA 4F03A 3R2QA 2YWIA 1MTCA 3N9JA 4V1Ap 4WR4A 3LYKA 3Q18A 4ISDA 1ZYQB 4MK3A 1V98A 3F3QA 1GNEA 4TR4A 1EOGA 2VAFA 4QQ7A 2PVOC 3GMFA 4KDUA 3W8JA 1GTAA 1XWAA 2LRCA 9GSSA 4NPBA 1URMA 2ALBA 1XW5A 2LKUA 5F06A 2G0FA 4ZL8A 3GV1A 3F4RA 3G9BA 3VLNA 2H30A 2P0GA 1EV4A 3GHAA 3L78A 3GFKA 1GL8A 1OVNA 4MF7A 2D2ZA 3HJPA 2YV7A 5DCHA 2TIRA 2JL4A 3CYNA 2GGTA 4OFMA 1LU4A 2YP6A 1O81A 4ZILA 2H76A 4GSNA 2LSTA 2HXKA 1BAYA 4AJ6A 2YWMA 3VK9A 4KA0A 4EVMA 2RLIA 3WT2A 4G10A 1M9BA 2K18A 1OC9B 1BX9A 3TJBA 1ST9A 2R5GA 2H01A 4X0XA 2VOCA 4I2UA 3NIVA 4IP1A 5JCWA 2MBSA 1Z6MA 3ERGA 2H73A 1WRYA 1GUHA 1NM3A 5ECOB 3EWLA 4NXIA 1V40A 2GQKA 2L5OA 2J23A 2B7KA 1OE8A 3GX0A 2LNTA 1UA5A 3C73A 3US3A 3W8SA 2LTKA 2K8VA 3TOUA 4BWSA 1M2BA 4ZL9A 1X9MB 1HYUA 3C7MA 1THOA 1R26A 3QAWA 4KDXA 4EDYA 2OE3A 5AIXA 4CHSA 5G2ZA 2HZFA 4AJ7A 4GTUA 2PPTA 4ZIJA 5JWOB 1RQMA 1GNWA 5CNWA 2O89A 2J9HA 1T1VA 4L8EA 2O85A 2WGRA 1O8XA 1AQVA 3M9JA 2L4QA 2VCVA 4MZWA 4EUYA 2QGVA 5DJLA 3PR8A 2E2MA 2B5YA 4TR3A 2FLSA 5C00A 4IGJA 1WOUA 1S3DA 4POBA 1ON4A 3EMPA 4K0NA 1NSWA 3E0UA 1DUGA 1EGRA 3EC3A 1TK0B 3UAPA 3Q19A 6GSUA 3TRPA 3Q6OA 2RIIA 3TKRA 2AUVA 1Y6EA 3WGXA 4V2LA 3IC4A 4KX4A 3I43A 3OR5A 2CZ3A 5COHA 3GTUB 3BBYA 4WF5A 1SKRB 4KGIA 1R5PA 5DAKA 1R4WA 4NV2A 5D73A 1PSQA 3UJ1A 1SJIA 5B6NA 2AHEA 2N5BA 3GUSA 2DIZA 2VCQA 1XW9A 2MYGA 1OKDA 4MLYA 1A23A 4F2IA 4TXOB 4P3YB 4GF0A 4JBBA 1O8WA 3PGTA 4L0WA 3LYPA 2C3QA 1T8EB 1M99A 4J57E 4TOPA 2GSQA 4I6XA 3C8EA 1X5CA 5IMZA 3RBTA 2OE0A 5D96A 4AGSA 4DSRA 1TP9A 5B8AA 2IMDA 5ELAA 3CRUA 3EE2A 2KOKA 4NV5A 4YAPA 4X1UA 4XS1A 1GUKA 3RAZA 4IQ1A 1JZRA 4JR4A 3A2XA 1CQGA 2F8FA 4ZBDA 2H0IA 1QQ2A 2PMTA 1SYRA 3GA4A 3QFBC 3FY7A 5ECQB 2H0GA 2ON7A 1DE2A 1PKWA 4NHZA 1X5EA 3TJJA 1NW2A 3IK9A 1YDKA 2C0DA 1SYXA 4IQAA 8GSSA 4IELA 4DSSB 2PGTA 4GSTA 3ZMKA 2YV9A 4GRFA 3NOFA 2MMNA 4XHMA 2H6XA 1X9WB 1ZOFA 1O6JA 2HFDA 1SK1A 4KDYA 2FWHA 5D9WA 1GWCA 1GSUA 3D21A 5A4UA 1YEXA 2L6CA 3H79A 3AY8A 4I97A 5ECIB 3DMLA 5ECSA 5EY6A 2TRCP 4I8BA 4EDZA 4EF0A 1XVWA 1O85A 5CP1A 3KM6A 1AIUA 5LCZA 1AC1A 2V6OA 5JWRB 1FW1A 3QCPA 1TU8A 2KUCA 2FWFA 2FY6A 2FWGA 4X43A 3TKSC 3GSTA 3CRTA 4HDEA 2MMOA 2VLTA 5IQYA 2G2QA 1GLPA 2N5AA 3FZ5A 4MABA 5IMFA 4OFTA 3EVIA 1J0FA 2WFCA 3QR6A 1GSFA 4FYUA 4K8MA 4IP6A 3RPPA 4ECCA 1SJ6A 4TN8A 1O73A 3DKSA 1JLVA 5B7CA 3FR6A 5IO2A 3GH6A 1EP7A 4LL1B 1Z3EA 1B9XC 3GNJA 1R7HA 2R37A 3JCML 1WE0A 2B6MA 1K0MA 2NBSA 3FEUA 1CQHA 1GSSA 4OCEA 5EL8A 4Q5RA 2C1YA 2FCHA 5IIZA 2H75A 3APQA 3V1WA 1KBNA 5C04A 1B48A 5EPFA 2JACA 4LL4B 2VL3A 3KZQA 2JZSA 3M9KA 2LRNA 3EURA 2AV4A 4G2EA 1G7EA 1SENA 1ZZYA 3A2VA 4MCUA 3WD6A 3UL3A 1ERUA 3BCKA 4K7OA 5J9BA 2V2GA 4WEYA 1T4YA 5CRHA 4XCSA 4RI7A 3WYWA 3IAM2 6GSYA 1TJDA 3CTFA 4MMMA 1A2LA 1QFNA 1G6YA 3RHCA 1XIYA 2GSRA 1T4ZA 2NDOA 1M7TA 1OC9A 2MMAA 2HI7A 5F0GA 4HEA2 4E8EA 2YCDA 3IV4A 5ECHB 1PGTA 4JRRA 3F4SA 1GTBA 3DRNA 4JE1A 2QC7A 4V2MA 5G5EA 3HKRA 3F6FA 1XCCA 1T00A 2RM5A 3HA9A 1EWXA 4MA9A 1GP1A 1F6MC 3PH9A 2AAWA 4MZCA 2QKEA 3FK8A 1WJKA 1U6TA 3KH7A 3APSA 2YANA 2HNLA 1WP0A 2WDUA 3BOAA 2FA8A 1LJRA 2CT6A 3VURA 2DJ2A 2H19A 1W4VA 4DEJA 1QUWA 4L5LA 4XRDA 4OO5A 3H4KA 4E8HA 1YEPA 1F2EA 1VRSD 3WT1A 1FB0A 3IOSA 5G31A 4PURA 4QL9A 5KN0A 2R4VA 4HU9A 3ZITA 1DSBA 2L5LA 2JSZA 2HSYA 2B7JA 5HR3A 3MDKA 1SU9A 2K6VA 4YQMA 4RUVA 2I3YA 4ECBA 3DEXA 5INYA 3J7Yb 3C1RA 1M0UA 3IE3A 4HJ2A 4ILFA 1AXDA 5LNKe 2GSTA 3CSHA 2H1DA 5CRWA 2LEGA 1GUMA 5B8BA 4KE3A 3O6TA 1OKTA 4PQIA 2EC4A 1QXHA 1EEMA 1DE1A 2YWOA 1OC8A 4FH8A 2QSIA 2I4AA 2LQQA 3E3EA 2CAQA 4YQUA 3VWXA 4WETA 1N8JA 3KD0A 3FW2A 1K0OA 4IHUA 2X64A 1PN9A 1M9AA 6GSVA 5ABRA 2H6ZA 2X99A 2OE1A 2FNOA 4TW5A 2EIQA 4PQHA 3P2AA 4WBRD 1W89A 2GTUA 3D6IA 5F05A 5ENUA 3VPTA 4D73B 3GRXA 4HS1A 3S9FA 2AB6A 2HRNA 2BTOT 4F9ZA 2MBTA 4IKHA 1AAZA 5IPHA 5CO3A 5FT3A 5DALA 1K0AA 1MDIA 3QMXA 1SJZA 3D22A 1FAAA 3KH9A 2I81A 2H66A 3HXSA 4IBPA 2IFQA 3LXZA 2X8CA 4TXVA 3P90A 5HFIA 4WF4A 5CAXA 3KEBA 3ME7A 2LUSA 3DXBA 3DYRA 2PBJA 5GAND 2F51A 5CREA 4KAEA 1GSEA 1PMTA 3ED3A 3UIWA 3TUEA 2YZUA 2LV3A 1XOAA 4EXJA 4XTSA 4GQCA 3VI5A 3UVTA 4POKA 3HYPA 3ZTLA 2PU9C 2I1UA 2KLXA 2PWJA 5KN2A 1I5GA 3LEFA 4BVYA 2C4JA 5GZZB 4K2DA 2GT6A 4XS4B 2VL9A 2DJKA 3UMAA 1PKZA 3ZFBA 4EKZA 4KH7A 3TJKA 1E2YA 4OMVA 3LORA 2B5XA 2VCXA 4ZBAA 2OKAA 1A2JA 4BWQA 1MDKA 3TKSE 3VPQA 6GSTA 3DD3A 1BEDA 5J4UA 1T3BA 1EZKA 5AGYA 3I9V2 5AN1A 14GSA 1V57A 4EL1A 3BD2A 1B4PA 1FO5A 3GYKA 2XHFA 2Z9SA 1NHOA 5KN3A 3KTLA 2FHEA 4AF2A 1ZYEA 2CV4A 4V1Ag 2FUG2 4IJIA 4FYCA 3GIXA 3DWVA 4K7NA 3F6DA 1K0NA 2H1GA 2H72A 2GVPA 5ID2A 2HZEA 3LGCA 2HRFA 5CYYA 5DQYA 4ZXGA 3G7YA 2CAIA 5ECRB 20GSA 1LBKA 1PL1A 1VF1A 2IMKA 3EU4A 5HQPA 3F3RA 2YWNA 1HNCA 2LS5A 1QGVA 1U87A 4KW6A 1EGOA 2LJAA 1M2AA 1XXUA 4G19A 1K0DA 2K9FA 2CX4A 1SL0B 1FB6A 5ECLB 3GL5A 3ZLPA 3A2WA 4I5QA 19GSA 4PXOA 4HOJA 2BJXA 2YOIA 2BMXA 2DJ0A 2OBKA 4IS0A 1TK8B 1JFUA 3A5WA 1USBA 1TXXA 1TDIA 2FWEA 2NPBA 4PNFA 1YQ1A 3DIEA 2H74A 3D4TA 1TRSA 2ZUPA 2ZCTA 2VM2A 5LD0A 5DCGA 2ZNMA 1Z6NA 3KIJA 4KUNA 1U88A 4TRXA 4OO4A 4LMWA 2R6KA 1AW9A 5J5NA 5F07A 4KNDA 3QFAC 1XZOA 2IMFA 3I6AA 3CBUA 6GSXA 3CXGA 4MZBA 3WGEA 2GZPA 2IL3A 1PX6A 3TKSA 1XOBA 2HT9A 2JZRA 4ID0A 3KP9A 12GSA 2B5EA 3FZAA 1E6BA 1OC3A 2P31A 4ZB6A 1MD4A 3CMIA 2JSYA 5KEJA 3QPMA 2E2GA 2V41A 5J3RA 3FYGA 2CVBA 2HLSA 1K0BA 1VF2A 1B8XA 4Z7XA 4JU5A 4K7IA 5D9VA 1A8LA 4IW9A 2GS3A 2AYTA 4NHWA 3E9JB 1KTEA 4GSSA 3PINA 1UN2A 1AUCA 3LWAA 1TRWA 6GSSA 2M46A 5A4WA 4MPFA 3VFIA 1N2AA 2JZTA 2JU5A 1ILOA 1JZDA 1GTIA 2DJ3A 3UARA 1XWBA 4AJ8A 2PVQA 5A5KA 2H70A 4HI7A 3L9SA 2VL2A 5CRDA 4ZBBA 3D4MA 1GRXA 2VLVA 2DMLA 1PA3A 2VUPA 3M3MA 3TJFA 3ZYWA 5KN1A 3F8UA 2HYXA 4J56E 2H8LA 4BPYA 1TKDB 2GSSA 2IPAA 1SK0A 3UBKA 1AQWA 2OJLA 3IXRA 3U6VA 1DBYA 1UC7A 3UVHA 4XRAA 2DC5A 3GH9A 1TRVA 1A8YA 4HQSA 1Q4JA 3MSZA 4Q5FA 4GQFA 3GURA 4O5RA 5GAPD 2IIYA 2PERA 5ECNB 2GDRA 2C3NA 1U3IA 1YF0A 2YJ7A 4MDCA 4WR5A 5B6MA 1XWCA 5D8IA 1H4OA 1VF3A 1GLQA 3MAKA 4NWYA 1EP8A 1GSYA 5IPGA 3F63A 3F4TA 3TOTA 2R3XA 4H86A 1HQOA 3HY2A 3LQ7A 1IYHA 1EV9A 2OACA 3KMNA 2CZ2A 4HZ2A 5H5QA 2MZCA 3L9VA 3Q74A 1F9MA 3EU3A 4N30A 4N0ZA 3QAGA 2LJRA 3TKQA 5FHIA 4TKYA 1EOHA 3C1SA 2XPEA 3N5OA 5EVOA 4KSMA 1BJXA 1FOVA 3VWVA 4N0VA 3LXTA 2VO4A 5IMAA 3FZ9A 3DVWA 5L71A 5HR2A 3HZ8A 18GSA 1RK4A 4TVEA 2CQ9A 3ZZXA 1YKCA 4K6XA 4MF6A 4L5OA 5AISA 1FVKA 2OADA 1HD2A 2C0GA 1J08A 3ZRDA 5IOXA 2M80A 3EINA 3HJOA 3DGQA 2XBIA 3FRCA 3VI7A 1JZWA 4MH2A 2FA4A 3CSIA 1ERWA 4F0BA 3GKKA 4OWYA 2OBIA 4FO5A 4O7HA 2IJYA 2PN8A 2XC2A 3F0IA 3KCMA 1SL1B 3LG6A 3C71A 1K3LA 5IO0A 1JHBA 1WIKA 3BJ5A 3P7XA 3IK7A 3GTUA 2V6KA 2H1BA 1YZXA 4PUFC 4NMUA 2F9SA 3HCZA 3UBLA 1ML6A 1B9YC 1F3AA 1WWJA 1SD9A 5G30A 3RHBA 3EYTA 2X8GA 4JZQA 1IYIA 2YJHA 4TXOA 3KTBA 4K0GA 3NZNA 3FHKA 4ECJA 5J9CA 11GSA 4DSQA 2LRTA 22GSA 3VWUA 5ELGA 2FGXA 1X0RA 2KP2A 4GWRA 3IA1A 3TCOA 2FD3A 2NTOA 4IVFA 2H0HA 13GSA 3KJYA 3M1GA 2O87A 3GKMA 4DVCA 4EE0A 4MP4A 1G6WA 5GSSA 3LJRA 2H1AA 2WZ9A 3H93A 4JEDA 4G9HA 2H71A 5G1KA 3BCIA 3HVXA 4PUAA 4ZB8A 5G5FA 1OAZA 5IM9A 2E7PA 2MMZA 3RDWA 2DIYA 4IN0A 1SL2B 3J7Yk 1A0RP 3HJMA 4DSSA 3ZREA 1TOFA 2C80A 5AIVA 2CX3A 10GSA 2VCWA 4HZ4A 7GSSA 4O32A 2PUKC 2YNXA 2GZYA 4MH3A 1XWGA 4HUAA 1X5DA 2DBCA 5IMDA 4OD7A 1G0TA 4ECIA 1BYEA 1UVZA 1GTUA 4MF5A 2DJ1A 2JADA 3TKPA 2REMA 2VD1A 2LNSA 4ML6A 5IMVA 2HE3A 4ULXA 3GN3A 3IRAA 2OA7A 1THXA 2GLRA 4TR1B 2A2RA 5G1LA 4K9ZA 2RUEA 3ISOA 4QL7A 1X9SB 2NVLA 2H6YA 2LJKA 2RUFA 4XIHA 1Z7PA 2V32A 3MNGA 2B1LA 1ERTA 2YN1A 2YPMA 2WRTA 1XW6A 1ACVA 2P5QA 3L9UA 4RQRA 4GXZA 4HJMA 4F82A 1G7OA 3RPNA 5DVBA 3A3TA 3ZVJD 5DDLA 2CVKA 6GSWA 1QMVA 1M2DA 2V1MA 5FWGA 5F8BA 3HD5A 4RI6A 2KHPA 3ERFA 2GQLA 1YKAA 2XBQA 2E0QA 5E59A 4MJAA 4Q5NA 2IN3A 3G7JA 5HFKA 2C0EA 3IPZA 1PL2A 1ERVA 5D93A 2O8VB 5JCUA 1TI1A 2N5FA 3VWWA 4N11A 1U3AA 1YY7A 2C0FA 2GZZA 5D9XA 2RM6A 2GT5A 5CRGA 4KSOA 2GQMA 1Z9HA 3D5JA 3U5RE 16GSA 3TRXA 2LQOA 2IWTA 1VF4A 3HVVA 5DALB 1TI3A 2L6DA 1GSDA 4L0UA 3KXOA 2WCIA 4Q5QA 2I9HA 2IFQB 3FR9A 4BVXA 4KCAA 1JLWA 3ZVJA 1C72A 1XFLA 3HVSA 4PX1A 2K8SA 1GH2A 3LSZA 4JR6A 2VD0A 4PQ1A 3M8NA
chains in the Genus database with same CATH superfamily
1A2MA 3WGDA 1KEBA 2HRKA 2DMMA 3FZ4A 2VCZA 1J9BA 4OCFA 1TU7A 1ZL9A 4MJEA 5A4VA 2IMIA 5E4WA 3LFLA 1SKWB 4A5PA 3IAS2 4HU7A 4BVYB 1WMJA 2R0GA 2WJUA 1FHEA 5J41A 1H75A 4GCIA 1V9WA 3HHVA 1O7UA 1K3YA 1GSQA 1BQ7A 5HR0A 3IBHA 4BA7A 1XBSA 5HR1A 4ACSA 2TRXA 1ZCPA 1T7PB 5DBQA 1MEKA 1OYJA 2C8UA 3EMXA 4WXTA 3D0ZA 4J2FA 4PGTA 4BL7A 4CDOA 4POLA 3TRQA 2AJQB 1ABAA 4XS6A 1JZOA 2VCTA 1QK8A 1F37A 4V2NA 3ME8A 2VM1A 4ZL7A 5GSTA 1YJ6A 4MJBA 2EIRA 2VIMA 5H5SA 1MDJA 1TRUA 3SBCA 3QOUA 1S3AA 1EEJA 5ECMB 1Q98A 4YQVA 3L4NA 4MJCA 5ID2B 2HZEB 5KOXA 2L4CA 4LMVA 1RW1A 3ZFLA 1HNAA 1K3OA 5IMCA 2R2JA 1A0FA 4I2TA 3FR3A 1AQXA 3KP8A 3KMOA 1PD21 2C3TA 2DLXA 2DSAA 3O3TA 5DQSA 3L0HA 4KCEA 3K8NA 2A2SA 3TB2A 2A4VA 4PNGA 4K5RA 5H5RA 1VGLA 5DAKB 1ZYNA 3UOMA 5DJMA 3H8QA 2IMEA 1FVJA 2P5RA 1PX7A 1ZMAA 2WULA 4RQXA 1V2AA 3IHQA 3IC8A 4LA1A 1SKSB 3P8WA 1PQNA 3TJGA 4GLTA 4POMA 4D73A 4FYBA 2CA8A 2F3MA 5D9TA 1NHYA 1K0CA 4WBJA 3APOA 1YF1A 1TW9A 2VL2C 3QD9A 2O7KA 4K2XA 4ML1A 5ECPB 1Y25A 3QDNA 3QAVA 3TGZA 1TTZA 2F8AA 2DJJA 4ZB9A 4WKWA 4NAXA 2EIOA 3G7IA 3ZIVA 1R5AA 1B4QA 4CW9A 3CSJA 1I9DA 1ZGNA 4O92A 3FKFA 1WPIA 2X8HA 4EC0A 4K1FA 2M72A 1M3IA 3H1NA 3M0FA 4HQZA 4EO3A 3GKXA 1FG4A 3ZMLA 1V58A 4KB3A 5ECKB 2B3SA 1MD3A 1SD8A 4MPGA 3W6GA 1S3CA 3HZ4A 2L59A 4LLRA 4N10A 3F9UA 2B1KA 4TR0A 4G0LA 1OE7A 1XWKA 3GSSA 2XPDA 2HSHA 3HDCA 5JWQB 4XS4A 4OFNA 2CVDA 2ON5A 2VLUA 3CTGA 1TK5B 4YH2A 4YAVA 3KGKA 3GX8A 1A24A 17GSA 2WB9A 3PPUA 4X4JA 4IJ3A 1BG5A 4FIWA 5HFGA 3MWHA 1GULA 5IOWA 3GL3A 3O76A 5JCGA 1SK2A 3IR4A 3ZL5A 3ERWA 1KNGA 2WS2A 1Z7RA 3TDGA 3DVXA 3IDVA 1HNBA 3UEMA 4TR1A 3I69A 2YZHA 2L57A 1Z5YE 3SWLA 3ZIJA 1F3BA 2KP1A 1PRXA 1XVQA 1XPVA 2ES7A 4F0CA 3GKNA 4F03A 3R2QA 2YWIA 1MTCA 3N9JA 4V1Ap 4WR4A 3LYKA 3Q18A 4CY6A 4ISDA 1ZYQB 4MK3A 1V98A 3F3QA 1GNEA 4TR4A 1EOGA 2VAFA 4QQ7A 2PVOC 3GMFA 4KDUA 3W8JA 1GTAA 1XWAA 2LRCA 9GSSA 4NPBA 1URMA 2ALBA 1XW5A 2LKUA 5F06A 2G0FA 4ZL8A 3GV1A 3F4RA 3G9BA 3VLNA 2H30A 2P0GA 1EV4A 3GHAA 3L78A 3GFKA 1GL8A 1OVNA 4MF7A 2D2ZA 3HJPA 2YV7A 5DCHA 2TIRA 2JL4A 3CYNA 2GGTA 4OFMA 1LU4A 2YP6A 1O81A 4ZILA 4YKGA 2H76A 4GSNA 2LSTA 2HXKA 1BAYA 4AJ6A 2YWMA 3VK9A 4KA0A 4EVMA 2RLIA 3WT2A 4G10A 1M9BA 2K18A 1OC9B 1BX9A 3TJBA 1ST9A 2R5GA 2H01A 4X0XA 2VOCA 4I2UA 3NIVA 4IP1A 5JCWA 2MBSA 1Z6MA 3ERGA 2H73A 1WRYA 1GUHA 1NM3A 5ECOB 3EWLA 4NXIA 1V40A 2GQKA 2L5OA 2J23A 2B7KA 1OE8A 3GX0A 4CY8A 2LNTA 1UA5A 3C73A 3US3A 3W8SA 2LTKA 2K8VA 3TOUA 4BWSA 1M2BA 4ZL9A 1X9MB 1HYUA 3C7MA 1THOA 1R26A 3QAWA 4KDXA 4EDYA 2OE3A 5AIXA 4CHSA 5BMUA 5G2ZA 2HZFA 4AJ7A 4GTUA 2PPTA 4ZIJA 5JWOB 1RQMA 1GNWA 5CNWA 2O89A 2J9HA 1T1VA 4L8EA 2O85A 2WGRA 1O8XA 1AQVA 3M9JA 2L4QA 2VCVA 4MZWA 4EUYA 2QGVA 5DJLA 3PR8A 2E2MA 2B5YA 4TR3A 2FLSA 5C00A 1PFOA 2HSMA 4IGJA 1WOUA 1S3DA 4POBA 1ON4A 1ZYPA 3EMPA 4K0NA 1NSWA 3E0UA 1DUGA 1EGRA 3EC3A 1TK0B 3UAPA 3Q19A 6GSUA 3TRPA 3Q6OA 2RIIA 3TKRA 2AUVA 1Y6EA 3WGXA 4V2LA 3IC4A 4KX4A 3I43A 3OR5A 2CZ3A 5COHA 3GTUB 3BBYA 4WF5A 1SKRB 4KGIA 1R5PA 5DAKA 1R4WA 4NV2A 5D73A 1PSQA 3UJ1A 1SJIA 5B6NA 2AHEA 4G0KA 2N5BA 3GUSA 2DIZA 2VCQA 1XW9A 2MYGA 1OKDA 4MLYA 1A23A 4F2IA 4TXOB 4P3YB 4GF0A 4JBBA 1O8WA 3PGTA 4L0WA 3LYPA 2C3QA 1T8EB 1M99A 4J57E 4TOPA 2GSQA 4I6XA 3C8EA 1X5CA 4HSCX 5IMZA 3RBTA 2OE0A 5D96A 4AGSA 4DSRA 1TP9A 5B8AA 2IMDA 5ELAA 3CRUA 3EE2A 4KF9A 2KOKA 4NV5A 4YAPA 4X1UA 4XS1A 1GUKA 3RAZA 4IQ1A 1JZRA 4JR4A 3A2XA 1CQGA 2F8FA 4ZBDA 2H0IA 1QQ2A 2PMTA 1SYRA 3GA4A 3QFBC 3FY7A 5ECQB 2H0GA 2ON7A 1DE2A 1PKWA 4NHZA 1X5EA 3TJJA 1NW2A 3IK9A 1YDKA 2C0DA 1SYXA 4IQAA 8GSSA 4IELA 4DSSB 2PGTA 4GSTA 3ZMKA 2YV9A 4GRFA 3NOFA 2MMNA 4XHMA 2H6XA 1X9WB 1ZOFA 1O6JA 2HFDA 1SK1A 2DKIA 4KDYA 2FWHA 5D9WA 1GWCA 1GSUA 3D21A 5A4UA 4Z2TA 1YEXA 2L6CA 3H79A 3AY8A 4I97A 5ECIB 3DMLA 5ECSA 5EY6A 2TRCP 4I8BA 4EDZA 4EF0A 1XVWA 1O85A 5CP1A 3KM6A 1AIUA 5LCZA 1AC1A 4Z2UA 2V6OA 5JWRB 1FW1A 3QCPA 1TU8A 2KUCA 2FWFA 2FY6A 2FWGA 4X43A 3TKSC 3GSTA 3CRTA 4HDEA 2MMOA 2VLTA 5IQYA 2G2QA 1GLPA 2N5AA 3FZ5A 4MABA 5IMFA 4OFTA 3EVIA 1J0FA 2WFCA 3QR6A 1GSFA 4FYUA 4K8MA 4IP6A 3RPPA 4ECCA 1SJ6A 4TN8A 1O73A 3DKSA 1JLVA 5B7CA 3FR6A 5IO2A 3GH6A 1EP7A 4LL1B 1Z3EA 1B9XC 3GNJA 1R7HA 2R37A 3JCML 1WE0A 2B6MA 1K0MA 3FMWA 2NBSA 3FEUA 1CQHA 1GSSA 4OCEA 5EL8A 4Q5RA 2C1YA 2FCHA 5IIZA 2H75A 3APQA 3V1WA 1KBNA 5C04A 1B48A 5EPFA 2JACA 4LL4B 2VL3A 3KZQA 2JZSA 3M9KA 2LRNA 3EURA 2AV4A 4G2EA 1G7EA 1SENA 1ZZYA 3A2VA 4MCUA 3WD6A 3UL3A 1ERUA 3BCKA 2R0CA 4K7OA 5J9BA 2V2GA 4WEYA 1T4YA 5CRHA 4XCSA 4RI7A 4FQUA 3WYWA 3IAM2 4BVXB 6GSYA 1TJDA 3CTFA 4MMMA 1A2LA 1QFNA 1G6YA 3RHCA 1XIYA 2GSRA 1T4ZA 2NDOA 1M7TA 1OC9A 2MMAA 2HI7A 3IHGA 5F0GA 4HEA2 4E8EA 2YCDA 2A4HA 3IV4A 5ECHB 1PGTA 4JRRA 3F4SA 1GTBA 3DRNA 4JE1A 2QC7A 4V2MA 5G5EA 3HKRA 3F6FA 1XCCA 1T00A 2RM5A 3HA9A 1EWXA 4MA9A 1GP1A 1F6MC 3PH9A 2AAWA 4MZCA 2QKEA 3FK8A 4ICYA 1WJKA 1U6TA 3KH7A 3APSA 2YANA 2HNLA 1WP0A 2WDUA 3BOAA 2FA8A 1LJRA 2CT6A 3VURA 2DJ2A 2H19A 1W4VA 4DEJA 1QUWA 4L5LA 1PN0A 4OO5A 4XRDA 3H4KA 4E8HA 1YEPA 1F2EA 1VRSD 3WT1A 1FB0A 3IOSA 5G31A 4BL7B 4PURA 4QL9A 5KN0A 2R4VA 2QA1A 4HU9A 3ZITA 1DSBA 4Z2RA 2L5LA 2JSZA 2HSYA 2B7JA 5HR3A 3MDKA 1SU9A 2K6VA 4RUVA 4YQMA 2I3YA 4ECBA 3DEXA 5INYA 3J7Yb 3C1RA 1M0UA 3IE3A 4HJ2A 4ILFA 1AXDA 5LNKe 2GSTA 3CSHA 2H1DA 5CRWA 2LEGA 1GUMA 5B8BA 4KE3A 3O6TA 1OKTA 4PQIA 2EC4A 1QXHA 1EEMA 1DE1A 2YWOA 1OC8A 4FH8A 2QSIA 1XG8A 2I4AA 2LQQA 3E3EA 2CAQA 4YQUA 3VWXA 4WETA 1N8JA 3KD0A 3FW2A 1K0OA 4IHUA 2X64A 1PN9A 1M9AA 6GSVA 5ABRA 2H6ZA 2X99A 2OE1A 2FNOA 4TW5A 2EIQA 4PQHA 3P2AA 4WBRD 1W89A 2GTUA 3D6IA 5F05A 5ENUA 3VPTA 4D73B 3GRXA 4HS1A 3S9FA 2AB6A 2HRNA 2BTOT 4F9ZA 2MBTA 4IKHA 1AAZA 5IPHA 5CO3A 5FT3A 5DALA 1K0AA 1MDIA 3QMXA 1SJZA 3D22A 1FAAA 3KH9A 2I81A 2H66A 3HXSA 4YKFA 4IBPA 2IFQA 3LXZA 2X8CA 4TXVA 3P90A 5HFIA 4WF4A 5CAXA 4USSA 3KEBA 3ME7A 2LUSA 3DXBA 3DYRA 2PBJA 5GAND 2F51A 5CREA 4KAEA 1GSEA 1PMTA 3ED3A 3UIWA 3TUEA 2YZUA 2LV3A 1XOAA 4EXJA 4XTSA 4GQCA 3VI5A 3UVTA 4POKA 3HYPA 3ZTLA 2PU9C 2I1UA 2KLXA 2PWJA 5KN2A 1I5GA 3LEFA 4BVYA 2C4JA 5GZZB 4K2DA 2GT6A 4XS4B 2VL9A 2DJKA 3UMAA 1PKZA 3ZFBA 4EKZA 4KH7A 3TJKA 1E2YA 4OMVA 4EIPA 3LORA 2B5XA 2VCXA 4ZBAA 2OKAA 1A2JA 4BWQA 1MDKA 3TKSE 3VPQA 6GSTA 3DD3A 1BEDA 5J4UA 1T3BA 1EZKA 5AGYA 3I9V2 5AN1A 14GSA 1V57A 4EL1A 3BD2A 1B4PA 1FO5A 3GYKA 2XHFA 2Z9SA 1NHOA 5KN3A 3KTLA 2FHEA 4AF2A 1ZYEA 2CV4A 4V1Ag 2FUG2 4IJIA 4FYCA 3GIXA 3DWVA 4K7NA 3F6DA 1K0NA 2H1GA 2H72A 2GVPA 5ID2A 2HZEA 3LGCA 2HRFA 5CYYA 5DQYA 4ZXGA 5KOWA 3G7YA 2CAIA 5ECRB 20GSA 1LBKA 1PL1A 1VF1A 2IMKA 3EU4A 5HQPA 3F3RA 2YWNA 1HNCA 2LS5A 4MNNA 1QGVA 1U87A 4KW6A 1EGOA 2LJAA 1M2AA 1XXUA 4G19A 1K0DA 2K9FA 2CX4A 1SL0B 1FB6A 5ECLB 3GL5A 3ZLPA 3A2WA 3MYDA 4I5QA 19GSA 4PXOA 4HOJA 2BJXA 2YOIA 2BMXA 2DJ0A 2OBKA 2X49A 4IS0A 1TK8B 1JFUA 3A5WA 1USBA 1TXXA 1TDIA 2FWEA 2NPBA 4PNFA 1YQ1A 3DIEA 2H74A 3EPTA 3D4TA 1TRSA 2ZUPA 2ZCTA 2VM2A 5LD0A 5DCGA 2ZNMA 3MIXA 1Z6NA 3KIJA 4KUNA 1U88A 4TRXA 4OO4A 4LMWA 2R6KA 1AW9A 5J5NA 5F07A 4KNDA 3QFAC 1XZOA 2IMFA 3I6AA 3CBUA 6GSXA 3CXGA 4MZBA 5BRTA 1S3RA 2GZPA 2IL3A 1PX6A 3TKSA 3WGEA 1XOBA 2HT9A 2JZRA 4ID0A 3KP9A 12GSA 2B5EA 1M3JA 3FZAA 1E6BA 1OC3A 2P31A 4ZB6A 1MD4A 3CMIA 2JSYA 5KEJA 3QPMA 1FOHA 2E2GA 2V41A 5J3RA 3FYGA 2CVBA 2HLSA 1K0BA 1VF2A 1B8XA 4Z7XA 4JU5A 4K7IA 5D9VA 1A8LA 4IW9A 2GS3A 2AYTA 4NHWA 3E9JB 1KTEA 4GSSA 3PINA 1UN2A 1AUCA 3LWAA 1TRWA 6GSSA 2M46A 5A4WA 4MPFA 3VFIA 1N2AA 2JZTA 2JU5A 1ILOA 1JZDA 1GTIA 2DJ3A 3UARA 1XWBA 4AJ8A 2PVQA 5A5KA 2H70A 4HI7A 3L9SA 2VL2A 5CRDA 4ZBBA 3D4MA 1GRXA 2VLVA 2DMLA 1PA3A 2VUPA 3M3MA 3TJFA 3ZYWA 5KN1A 3F8UA 2HYXA 4J56E 2H8LA 4BPYA 1TKDB 2GSSA 2IPAA 1SK0A 3UBKA 1AQWA 2OJLA 3IXRA 3U6VA 1DBYA 1UC7A 3UVHA 4XRAA 2DC5A 3GH9A 1TRVA 1A8YA 4HQSA 1Q4JA 3MSZA 4Q5FA 4GQFA 3GURA 4O5RA 4PTSA 5GAPD 2IIYA 2PERA 5ECNB 2GDRA 2C3NA 1U3IA 1YF0A 2YJ7A 4MDCA 4WR5A 5B6MA 1XWCA 5D8IA 1H4OA 1VF3A 1GLQA 2DKHA 3MAKA 4NWYA 1EP8A 1GSYA 5IPGA 3F63A 3F4TA 3TOTA 2R3XA 4H86A 1HQOA 3HY2A 3LQ7A 1IYHA 1EV9A 2OACA 3KMNA 2CZ2A 4HZ2A 5H5QA 2MZCA 3L9VA 3CQFA 3Q74A 1F9MA 3EU3A 4N30A 4N0ZA 3QAGA 2LJRA 3TKQA 2HRAA 5FHIA 4TKYA 1EOHA 3C1SA 2XPEA 3N5OA 5EVOA 4KSMA 1BJXA 1FOVA 3VWVA 4N0VA 3LXTA 2VO4A 5IMAA 3FZ9A 3DVWA 5L71A 5HR2A 3HZ8A 18GSA 1RK4A 4TVEA 2CQ9A 3ZZXA 1YKCA 4K6XA 4MF6A 4L5OA 5AISA 1FVKA 2OADA 1HD2A 2C0GA 1J08A 3ZRDA 5IOXA 2M80A 3EINA 3HJOA 3DGQA 2XBIA 3FRCA 3VI7A 1JZWA 4MH2A 2FA4A 3CSIA 1ERWA 4F0BA 3GKKA 4OWYA 2OBIA 4FO5A 4O7HA 2IJYA 2PN8A 2XC2A 3F0IA 3KCMA 1SL1B 3LG6A 3C71A 1K3LA 5IO0A 1JHBA 1WIKA 3BJ5A 3P7XA 3IK7A 3GTUA 2V6KA 4EIQA 2H1BA 1YZXA 4PUFC 4NMUA 2F9SA 3HCZA 3UBLA 1ML6A 1B9YC 1F3AA 1WWJA 1SD9A 5G30A 3RHBA 3EYTA 2X8GA 4JZQA 1IYIA 2YJHA 4TXOA 3KTBA 4K0GA 3NZNA 3FHKA 4ECJA 5J9CA 11GSA 4DSQA 2LRTA 22GSA 3VWUA 5ELGA 2X4AA 2FGXA 1X0RA 2KP2A 4GWRA 3IA1A 3TCOA 2FD3A 2NTOA 4IVFA 2H0HA 13GSA 3KJYA 3M1GA 2O87A 3GKMA 4DVCA 4EE0A 4MP4A 1G6WA 5GSSA 3LJRA 2H1AA 2WZ9A 3H93A 4JEDA 4G9HA 2H71A 5G1KA 3BCIA 3HVXA 4PUAA 4ZB8A 5G5FA 1OAZA 5IM9A 3R3EA 2E7PA 2MMZA 3RDWA 2DIYA 4IN0A 1SL2B 3J7Yk 1A0RP 4O5UA 3HJMA 4DSSA 3ZREA 1TOFA 2C80A 5AIVA 2CX3A 10GSA 2VCWA 4HZ4A 7GSSA 4O32A 2PUKC 2YNXA 2GZYA 4MH3A 1XWGA 4HUAA 1X5DA 2DBCA 4K5SA 5IMDA 4OD7A 1G0TA 4ECIA 1BYEA 1UVZA 1GTUA 3A5IA 4MF5A 2DJ1A 2JADA 2QA2A 2R0PA 3TKPA 2REMA 2VD1A 2LNSA 4ML6A 5IMVA 2HE3A 4ULXA 3GN3A 3IRAA 2OA7A 1THXA 2GLRA 4TR1B 2A2RA 2A2PA 5G1LA 4K9ZA 2RUEA 3ISOA 4QL7A 1X9SB 2NVLA 2H6YA 2LJKA 2RUFA 4XIHA 4BIKA 1Z7PA 2V32A 3MNGA 2B1LA 1ERTA 2YN1A 2YPMA 2WRTA 1XW6A 1ACVA 2P5QA 3LW9A 3L9UA 4RQRA 4GXZA 4HJMA 4F82A 1G7OA 3RPNA 4G0IA 5DVBA 3A3TA 3ZVJD 5DDLA 2CVKA 6GSWA 1QMVA 1M2DA 2V1MA 5FWGA 5F8BA 3HD5A 4RI6A 2KHPA 3ERFA 2GQLA 1YKAA 2XBQA 2E0QA 5E59A 2UZ8A 4MJAA 4Q5NA 2IN3A 3G7JA 5HFKA 2C0EA 3IPZA 1PL2A 1ERVA 5D93A 2O8VB 5JCUA 1TI1A 2N5FA 3VWWA 4N11A 1U3AA 1YY7A 2C0FA 2GZZA 5D9XA 2RM6A 2GT5A 5CRGA 4KSOA 2GQMA 1Z9HA 3D5JA 3U5RE 16GSA 3TRXA 2LQOA 2IWTA 1VF4A 3HVVA 5DALB 1TI3A 2L6DA 1GSDA 4L0UA 3KXOA 2WCIA 4Q5QA 2I9HA 2IFQB 3FR9A 4BVXA 4KCAA 1JLWA 3ZVJA 1C72A 1XFLA 3HVSA 4PX1A 2K8SA 4O5QA 1GH2A 3LSZA 4JR6A 2VD0A 4PQ1A 3M8NA 3HVNA
chains in the Genus database with same CATH topology
1A2MA 3WGDA 1KEBA 2HRKA 2DMMA 3FZ4A 2VCZA 1J9BA 4OCFA 1TU7A 1ZL9A 4MJEA 5A4VA 2IMIA 5E4WA 3LFLA 1SKWB 4A5PA 3IAS2 4HU7A 4BVYB 1WMJA 2R0GA 2WJUA 1FHEA 5J41A 1H75A 4GCIA 1V9WA 3HHVA 1O7UA 1K3YA 1GSQA 1BQ7A 5HR0A 3IBHA 4BA7A 1XBSA 5HR1A 4ACSA 2TRXA 1ZCPA 1T7PB 5DBQA 1MEKA 1OYJA 2C8UA 3EMXA 4WXTA 3D0ZA 4J2FA 4PGTA 4BL7A 4CDOA 4POLA 3TRQA 2AJQB 1ABAA 4XS6A 1JZOA 2VCTA 1QK8A 1F37A 4V2NA 3ME8A 2VM1A 4ZL7A 5GSTA 1YJ6A 4MJBA 2EIRA 2VIMA 5H5SA 1MDJA 1TRUA 3SBCA 3QOUA 1S3AA 1EEJA 5ECMB 1Q98A 4YQVA 3L4NA 4MJCA 5ID2B 2HZEB 5KOXA 2L4CA 4LMVA 1RW1A 3ZFLA 1HNAA 1K3OA 5IMCA 2R2JA 1A0FA 4I2TA 3FR3A 1AQXA 3KP8A 3KMOA 1PD21 2C3TA 2DLXA 2DSAA 3O3TA 5DQSA 3L0HA 4KCEA 3K8NA 2A2SA 3TB2A 2A4VA 4PNGA 4K5RA 5H5RA 1VGLA 5DAKB 1ZYNA 3UOMA 5DJMA 3H8QA 2IMEA 1FVJA 2P5RA 1PX7A 1ZMAA 2WULA 4RQXA 1V2AA 3IHQA 3IC8A 4LA1A 1SKSB 3P8WA 1PQNA 3TJGA 4GLTA 4POMA 4D73A 4FYBA 2CA8A 2F3MA 5D9TA 1NHYA 1K0CA 4WBJA 3APOA 1YF1A 1TW9A 2VL2C 3QD9A 2O7KA 4K2XA 4ML1A 5ECPB 1Y25A 3QDNA 3QAVA 3TGZA 1TTZA 2F8AA 2DJJA 4ZB9A 4WKWA 4NAXA 2EIOA 3G7IA 3ZIVA 1R5AA 1B4QA 4CW9A 3CSJA 1I9DA 1ZGNA 4O92A 3FKFA 1WPIA 2X8HA 4EC0A 4K1FA 2M72A 3H1NA 3M0FA 4HQZA 4EO3A 3GKXA 1FG4A 3ZMLA 1V58A 4KB3A 5ECKB 2B3SA 1MD3A 1SD8A 4MPGA 3W6GA 1S3CA 3HZ4A 2L59A 4LLRA 4N10A 3F9UA 2B1KA 4TR0A 4G0LA 1OE7A 1XWKA 3GSSA 2XPDA 2HSHA 3HDCA 5JWQB 4XS4A 4OFNA 2CVDA 2ON5A 2VLUA 3CTGA 1TK5B 4YH2A 4YAVA 3KGKA 3GX8A 1A24A 17GSA 2WB9A 3PPUA 4X4JA 4IJ3A 1BG5A 4FIWA 5HFGA 3MWHA 1GULA 5IOWA 3GL3A 3O76A 5JCGA 1SK2A 3IR4A 3ZL5A 3ERWA 1KNGA 2WS2A 1Z7RA 3TDGA 3DVXA 3IDVA 1HNBA 3UEMA 4TR1A 3I69A 2YZHA 2L57A 1Z5YE 3SWLA 3ZIJA 1F3BA 2KP1A 1PRXA 1XVQA 1XPVA 2ES7A 4F0CA 3GKNA 4F03A 3R2QA 2YWIA 1MTCA 3N9JA 4V1Ap 4WR4A 3LYKA 3Q18A 4CY6A 4ISDA 1ZYQB 4MK3A 1V98A 3F3QA 1GNEA 4TR4A 1EOGA 2VAFA 4QQ7A 2PVOC 3GMFA 4KDUA 3W8JA 1GTAA 1XWAA 2LRCA 9GSSA 4NPBA 1URMA 2ALBA 1XW5A 2LKUA 5F06A 2G0FA 4ZL8A 3GV1A 3F4RA 3G9BA 3VLNA 2H30A 2P0GA 1EV4A 3GHAA 3L78A 3GFKA 1GL8A 1OVNA 4MF7A 2D2ZA 3HJPA 2YV7A 5DCHA 2TIRA 2JL4A 3CYNA 2GGTA 4OFMA 1LU4A 2YP6A 1O81A 4ZILA 4YKGA 2H76A 4GSNA 2LSTA 2HXKA 1BAYA 4AJ6A 2YWMA 3VK9A 4KA0A 4EVMA 2RLIA 3WT2A 4G10A 1M9BA 2K18A 1OC9B 1BX9A 3TJBA 1ST9A 2R5GA 2H01A 4X0XA 2VOCA 4I2UA 3NIVA 4IP1A 5JCWA 2MBSA 1Z6MA 3ERGA 2H73A 1WRYA 1GUHA 1NM3A 5ECOB 3EWLA 4NXIA 1V40A 2GQKA 2L5OA 2J23A 2B7KA 1OE8A 3GX0A 4CY8A 2LNTA 1UA5A 3C73A 3US3A 3W8SA 2LTKA 2K8VA 3TOUA 4BWSA 1M2BA 4ZL9A 1X9MB 1HYUA 3C7MA 1THOA 1R26A 3QAWA 4KDXA 4EDYA 2OE3A 5AIXA 4CHSA 5BMUA 5G2ZA 2HZFA 4AJ7A 4GTUA 2PPTA 4ZIJA 5JWOB 1RQMA 1GNWA 5CNWA 2O89A 2J9HA 1T1VA 4L8EA 2O85A 2WGRA 1O8XA 1AQVA 3M9JA 2L4QA 2VCVA 4MZWA 4EUYA 2QGVA 5DJLA 3PR8A 2E2MA 2B5YA 4TR3A 2FLSA 5C00A 2HSMA 4IGJA 1WOUA 1S3DA 4POBA 1ON4A 1ZYPA 3EMPA 4K0NA 1NSWA 3E0UA 1DUGA 1EGRA 3EC3A 1TK0B 3UAPA 3Q19A 6GSUA 3TRPA 3Q6OA 2RIIA 3TKRA 2AUVA 1Y6EA 3WGXA 4V2LA 3IC4A 4KX4A 3I43A 3OR5A 2CZ3A 5COHA 3GTUB 3BBYA 4WF5A 1SKRB 4KGIA 1R5PA 5DAKA 1R4WA 4NV2A 5D73A 1PSQA 3UJ1A 1SJIA 5B6NA 2AHEA 4G0KA 2N5BA 3GUSA 2DIZA 2VCQA 1XW9A 2MYGA 1OKDA 4MLYA 1A23A 4F2IA 4TXOB 4P3YB 4GF0A 4JBBA 1O8WA 3PGTA 4L0WA 3LYPA 2C3QA 1T8EB 1M99A 4J57E 4TOPA 2GSQA 4I6XA 3C8EA 1X5CA 5IMZA 3RBTA 2OE0A 5D96A 4AGSA 4DSRA 1TP9A 5B8AA 2IMDA 5ELAA 3CRUA 3EE2A 4KF9A 2KOKA 4NV5A 4YAPA 4X1UA 4XS1A 1GUKA 3RAZA 4IQ1A 1JZRA 4JR4A 3A2XA 1CQGA 2F8FA 4ZBDA 2H0IA 1QQ2A 2PMTA 1SYRA 3GA4A 3QFBC 3FY7A 5ECQB 2H0GA 2ON7A 1DE2A 1PKWA 4NHZA 1X5EA 3TJJA 1NW2A 3IK9A 1YDKA 2C0DA 1SYXA 4IQAA 8GSSA 4IELA 4DSSB 2PGTA 4GSTA 3ZMKA 2YV9A 4GRFA 3NOFA 2MMNA 4XHMA 2H6XA 1X9WB 1ZOFA 1O6JA 2HFDA 1SK1A 2DKIA 4KDYA 2FWHA 5D9WA 1GWCA 1GSUA 3D21A 5A4UA 4Z2TA 1YEXA 2L6CA 3H79A 3AY8A 4I97A 5ECIB 3DMLA 5ECSA 5EY6A 2TRCP 4I8BA 4EDZA 4EF0A 1XVWA 1O85A 5CP1A 3KM6A 1AIUA 5LCZA 1AC1A 4Z2UA 2V6OA 5JWRB 1FW1A 3QCPA 1TU8A 2KUCA 2FWFA 2FY6A 2FWGA 4X43A 3TKSC 3GSTA 3CRTA 4HDEA 2MMOA 2VLTA 5IQYA 2G2QA 1GLPA 2N5AA 3FZ5A 4MABA 5IMFA 4OFTA 3EVIA 1J0FA 2WFCA 3QR6A 1GSFA 4FYUA 4K8MA 4IP6A 3RPPA 4ECCA 1SJ6A 4TN8A 1O73A 3DKSA 1JLVA 5B7CA 3FR6A 5IO2A 3GH6A 1EP7A 4LL1B 1Z3EA 1B9XC 3GNJA 1R7HA 2R37A 3JCML 1WE0A 2B6MA 1K0MA 3FMWA 2NBSA 3FEUA 1CQHA 1GSSA 4OCEA 5EL8A 4Q5RA 2C1YA 2FCHA 5IIZA 2H75A 3APQA 3V1WA 1KBNA 5C04A 1B48A 5EPFA 2JACA 4LL4B 2VL3A 3KZQA 2JZSA 3M9KA 2LRNA 3EURA 2AV4A 4G2EA 1G7EA 1SENA 1ZZYA 3A2VA 4MCUA 3WD6A 3UL3A 1ERUA 3BCKA 2R0CA 4K7OA 5J9BA 2V2GA 4WEYA 1T4YA 5CRHA 4XCSA 4RI7A 4FQUA 3WYWA 3IAM2 4BVXB 6GSYA 1TJDA 3CTFA 4MMMA 1A2LA 1QFNA 1G6YA 3RHCA 1XIYA 2GSRA 1T4ZA 2NDOA 1M7TA 1OC9A 2MMAA 2HI7A 3IHGA 5F0GA 4HEA2 4E8EA 2YCDA 2A4HA 3IV4A 5ECHB 1PGTA 4JRRA 3F4SA 1GTBA 3DRNA 4JE1A 2QC7A 4V2MA 5G5EA 3HKRA 3F6FA 1XCCA 1T00A 2RM5A 3HA9A 1EWXA 4MA9A 1GP1A 1F6MC 3PH9A 2AAWA 4MZCA 2QKEA 3FK8A 4ICYA 1WJKA 1U6TA 3KH7A 3APSA 2YANA 2HNLA 1WP0A 2WDUA 3BOAA 2FA8A 1LJRA 2CT6A 3VURA 2DJ2A 2H19A 1W4VA 4DEJA 1QUWA 4L5LA 1PN0A 4OO5A 4XRDA 3H4KA 4E8HA 1YEPA 1F2EA 1VRSD 3WT1A 1FB0A 3IOSA 5G31A 4BL7B 4PURA 4QL9A 5KN0A 2R4VA 2QA1A 4HU9A 3ZITA 1DSBA 4Z2RA 2L5LA 2JSZA 2HSYA 2B7JA 5HR3A 3MDKA 1SU9A 2K6VA 4YQMA 4RUVA 2I3YA 4ECBA 3DEXA 5INYA 3J7Yb 3C1RA 1M0UA 3IE3A 4HJ2A 4ILFA 1AXDA 5LNKe 2GSTA 3CSHA 2H1DA 5CRWA 2LEGA 1GUMA 5B8BA 4KE3A 3O6TA 1OKTA 4PQIA 2EC4A 1QXHA 1EEMA 1DE1A 2YWOA 1OC8A 4FH8A 2QSIA 2I4AA 2LQQA 3E3EA 2CAQA 4YQUA 3VWXA 4WETA 1N8JA 3KD0A 3FW2A 1K0OA 4IHUA 2X64A 1PN9A 1M9AA 6GSVA 5ABRA 2H6ZA 2X99A 2OE1A 2FNOA 4TW5A 2EIQA 4PQHA 3P2AA 4WBRD 1W89A 2GTUA 3D6IA 5F05A 5ENUA 3VPTA 4D73B 3GRXA 4HS1A 3S9FA 2AB6A 2HRNA 2BTOT 4F9ZA 2MBTA 4IKHA 1AAZA 5IPHA 5CO3A 5FT3A 5DALA 1K0AA 1MDIA 3QMXA 1SJZA 3D22A 1FAAA 3KH9A 2I81A 2H66A 3HXSA 4YKFA 4IBPA 2IFQA 3LXZA 2X8CA 4TXVA 3P90A 5HFIA 4WF4A 5CAXA 4USSA 3KEBA 3ME7A 2LUSA 3DXBA 3DYRA 2PBJA 5GAND 2F51A 5CREA 4KAEA 1GSEA 1PMTA 3ED3A 3UIWA 3TUEA 2YZUA 2LV3A 1XOAA 4EXJA 4XTSA 4GQCA 3VI5A 3UVTA 4POKA 3HYPA 3ZTLA 2PU9C 2I1UA 2KLXA 2PWJA 5KN2A 1I5GA 3LEFA 4BVYA 2C4JA 5GZZB 4K2DA 2GT6A 4XS4B 2VL9A 2DJKA 3UMAA 1PKZA 3ZFBA 4EKZA 4KH7A 3TJKA 1E2YA 4OMVA 4EIPA 3LORA 2B5XA 2VCXA 4ZBAA 2OKAA 1A2JA 4BWQA 1MDKA 3TKSE 3VPQA 6GSTA 3DD3A 1BEDA 5J4UA 1T3BA 1EZKA 5AGYA 3I9V2 5AN1A 14GSA 1V57A 4EL1A 3BD2A 1B4PA 1FO5A 3GYKA 2XHFA 2Z9SA 1NHOA 5KN3A 3KTLA 2FHEA 4AF2A 1ZYEA 2CV4A 4V1Ag 2FUG2 4IJIA 4FYCA 3GIXA 3DWVA 4K7NA 3F6DA 1K0NA 2H1GA 2H72A 2GVPA 5ID2A 2HZEA 3LGCA 2HRFA 5CYYA 5DQYA 4ZXGA 5KOWA 3G7YA 2CAIA 5ECRB 20GSA 1LBKA 1PL1A 1VF1A 2IMKA 3EU4A 5HQPA 3F3RA 2YWNA 1HNCA 2LS5A 4MNNA 1QGVA 1U87A 4KW6A 1EGOA 2LJAA 1M2AA 1XXUA 4G19A 1K0DA 2K9FA 2CX4A 1SL0B 1FB6A 5ECLB 3GL5A 3ZLPA 3A2WA 3MYDA 4I5QA 19GSA 4PXOA 4HOJA 2BJXA 2YOIA 2BMXA 2DJ0A 2OBKA 2X49A 4IS0A 1TK8B 1JFUA 3A5WA 1USBA 1TXXA 1TDIA 2FWEA 2NPBA 4PNFA 1YQ1A 3DIEA 2H74A 3EPTA 3D4TA 1TRSA 2ZUPA 2ZCTA 2VM2A 5LD0A 5DCGA 2ZNMA 3MIXA 1Z6NA 3KIJA 4KUNA 1U88A 4TRXA 4OO4A 4LMWA 2R6KA 1AW9A 5J5NA 5F07A 4KNDA 3QFAC 1XZOA 2IMFA 3I6AA 3CBUA 6GSXA 3CXGA 4MZBA 5BRTA 3WGEA 2GZPA 2IL3A 1PX6A 3TKSA 1XOBA 2HT9A 2JZRA 4ID0A 3KP9A 12GSA 2B5EA 3FZAA 1E6BA 1OC3A 2P31A 4ZB6A 1MD4A 3CMIA 2JSYA 5KEJA 3QPMA 1FOHA 2E2GA 2V41A 5J3RA 3FYGA 2CVBA 2HLSA 1K0BA 1VF2A 1B8XA 4Z7XA 4JU5A 4K7IA 5D9VA 1A8LA 4IW9A 2GS3A 2AYTA 4NHWA 3E9JB 1KTEA 4GSSA 3PINA 1UN2A 1AUCA 3LWAA 1TRWA 6GSSA 2M46A 5A4WA 4MPFA 3VFIA 1N2AA 2JZTA 2JU5A 1ILOA 1JZDA 1GTIA 2DJ3A 3UARA 1XWBA 4AJ8A 2PVQA 5A5KA 2H70A 4HI7A 3L9SA 2VL2A 5CRDA 4ZBBA 3D4MA 1GRXA 2VLVA 2DMLA 1PA3A 2VUPA 3M3MA 3TJFA 3ZYWA 5KN1A 3F8UA 2HYXA 4J56E 2H8LA 4BPYA 1TKDB 2GSSA 2IPAA 1SK0A 3UBKA 1AQWA 2OJLA 3IXRA 3U6VA 1DBYA 1UC7A 3UVHA 4XRAA 2DC5A 3GH9A 1TRVA 1A8YA 4HQSA 1Q4JA 3MSZA 4Q5FA 4GQFA 3GURA 4O5RA 4PTSA 5GAPD 2IIYA 2PERA 5ECNB 2GDRA 2C3NA 1U3IA 1YF0A 2YJ7A 4MDCA 4WR5A 5B6MA 1XWCA 5D8IA 1H4OA 1VF3A 1GLQA 2DKHA 3MAKA 4NWYA 1EP8A 1GSYA 5IPGA 3F63A 3F4TA 3TOTA 2R3XA 4H86A 1HQOA 3HY2A 3LQ7A 1IYHA 1EV9A 2OACA 3KMNA 2CZ2A 4HZ2A 5H5QA 2MZCA 3L9VA 3Q74A 1F9MA 3EU3A 4N30A 4N0ZA 3QAGA 2LJRA 3TKQA 2HRAA 5FHIA 4TKYA 1EOHA 3C1SA 2XPEA 3N5OA 5EVOA 4KSMA 1BJXA 1FOVA 3VWVA 4N0VA 3LXTA 2VO4A 5IMAA 3FZ9A 3DVWA 5L71A 5HR2A 3HZ8A 18GSA 1RK4A 4TVEA 2CQ9A 3ZZXA 1YKCA 4K6XA 4MF6A 4L5OA 5AISA 1FVKA 2OADA 1HD2A 2C0GA 1J08A 3ZRDA 5IOXA 2M80A 3EINA 3HJOA 3DGQA 2XBIA 3FRCA 3VI7A 1JZWA 4MH2A 2FA4A 3CSIA 1ERWA 4F0BA 3GKKA 4OWYA 2OBIA 4FO5A 4O7HA 2IJYA 2PN8A 2XC2A 3F0IA 3KCMA 1SL1B 3LG6A 3C71A 1K3LA 5IO0A 1JHBA 1WIKA 3BJ5A 3P7XA 3IK7A 3GTUA 2V6KA 4EIQA 2H1BA 1YZXA 4PUFC 4NMUA 2F9SA 3HCZA 3UBLA 1ML6A 1B9YC 1F3AA 1WWJA 1SD9A 5G30A 3RHBA 3EYTA 2X8GA 4JZQA 1IYIA 2YJHA 4TXOA 3KTBA 4K0GA 3NZNA 3FHKA 4ECJA 5J9CA 11GSA 4DSQA 2LRTA 22GSA 3VWUA 5ELGA 2X4AA 2FGXA 1X0RA 2KP2A 4GWRA 3IA1A 3TCOA 2FD3A 2NTOA 4IVFA 2H0HA 13GSA 3KJYA 3M1GA 2O87A 3GKMA 4DVCA 4EE0A 4MP4A 1G6WA 5GSSA 3LJRA 2H1AA 2WZ9A 3H93A 4JEDA 4G9HA 2H71A 5G1KA 3BCIA 3HVXA 4PUAA 4ZB8A 5G5FA 1OAZA 5IM9A 3R3EA 2E7PA 2MMZA 3RDWA 2DIYA 4IN0A 1SL2B 3J7Yk 1A0RP 4O5UA 3HJMA 4DSSA 3ZREA 1TOFA 2C80A 5AIVA 2CX3A 10GSA 2VCWA 4HZ4A 7GSSA 4O32A 2PUKC 2YNXA 2GZYA 4MH3A 1XWGA 4HUAA 1X5DA 2DBCA 4K5SA 5IMDA 4OD7A 1G0TA 4ECIA 1BYEA 1UVZA 1GTUA 3A5IA 4MF5A 2DJ1A 2JADA 2QA2A 2R0PA 3TKPA 2REMA 2VD1A 2LNSA 4ML6A 5IMVA 2HE3A 4ULXA 3GN3A 3IRAA 2OA7A 1THXA 2GLRA 4TR1B 2A2RA 2A2PA 5G1LA 4K9ZA 2RUEA 3ISOA 4QL7A 1X9SB 2NVLA 2H6YA 2LJKA 2RUFA 4XIHA 1Z7PA 2V32A 3MNGA 2B1LA 1ERTA 2YN1A 2YPMA 2WRTA 1XW6A 1ACVA 2P5QA 3LW9A 3L9UA 4RQRA 4GXZA 4HJMA 4F82A 1G7OA 3RPNA 4G0IA 5DVBA 3A3TA 3ZVJD 5DDLA 2CVKA 6GSWA 1QMVA 1M2DA 2V1MA 5FWGA 5F8BA 3HD5A 4RI6A 2KHPA 3ERFA 2GQLA 1YKAA 2XBQA 2E0QA 5E59A 2UZ8A 4MJAA 4Q5NA 2IN3A 3G7JA 5HFKA 2C0EA 3IPZA 1PL2A 1ERVA 5D93A 2O8VB 5JCUA 1TI1A 2N5FA 3VWWA 4N11A 1U3AA 1YY7A 2C0FA 2GZZA 5D9XA 2RM6A 2GT5A 5CRGA 4KSOA 2GQMA 1Z9HA 3D5JA 3U5RE 16GSA 3TRXA 2LQOA 2IWTA 1VF4A 3HVVA 5DALB 1TI3A 2L6DA 1GSDA 4L0UA 3KXOA 2WCIA 4Q5QA 2I9HA 2IFQB 3FR9A 4BVXA 4KCAA 1JLWA 3ZVJA 1C72A 1XFLA 3HVSA 4PX1A 2K8SA 4O5QA 1GH2A 3LSZA 4JR6A 2VD0A 4PQ1A 3M8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A2M A;  3WGD A;  1KEB A;  2DMM A;  3FZ4 A;  2VCZ A;  1J9B A;  4OCF A;  1TU7 A;  1ZL9 A;  4MJE A;  5A4V A;  2IMI A;  5E4W A;  3LFL A;  1SKW B;  3IAS 2;  4HU7 A;  1WMJ A;  2WJU A;  1FHE A;  5J41 A;  1H75 A;  4GCI A;  1V9W A;  3HHV A;  1O7U A;  1K3Y A;  1GSQ A;  1BQ7 A;  5HR0 A;  3IBH A;  4BA7 A;  1XBS A;  5HR1 A;  4ACS A;  2TRX A;  1ZCP A;  1T7P B;  5DBQ A;  1MEK A;  1OYJ A;  2C8U A;  3EMX A;  4WXT A;  3D0Z A;  4J2F A;  4PGT A;  4BL7 A;  4CDO A;  4POL A;  3TRQ A;  2AJQ B;  1ABA A;  4XS6 A;  1JZO A;  2VCT A;  1QK8 A;  1F37 A;  4V2N A;  3ME8 A;  2VM1 A;  4ZL7 A;  5GST A;  1YJ6 A;  4MJB A;  2EIR A;  2VIM A;  5H5S A;  1MDJ A;  1TRU A;  3SBC A;  3QOU A;  1S3A A;  1EEJ A;  5ECM B;  1Q98 A;  4YQV A;  3L4N A;  4MJC A;  5ID2 B;  2HZE B;  2L4C A;  4LMV A;  1RW1 A;  3ZFL A;  1HNA A;  1K3O A;  5IMC A;  2R2J A;  1A0F A;  4I2T A;  3FR3 A;  1AQX A;  3KP8 A;  3KMO A;  1PD2 1;  2C3T A;  2DLX A;  2DSA A;  3O3T A;  5DQS A;  3L0H A;  4KCE A;  3K8N A;  2A2S A;  3TB2 A;  2A4V A;  4PNG A;  5H5R A;  1VGL A;  5DAK B;  3UOM A;  5DJM A;  3H8Q A;  2IME A;  1FVJ A;  2P5R A;  1PX7 A;  1ZMA A;  2WUL A;  4RQX A;  1V2A A;  3IHQ A;  4LA1 A;  1SKS B;  3P8W A;  1PQN A;  3TJG A;  4GLT A;  4POM A;  4D73 A;  4FYB A;  2CA8 A;  2F3M A;  5D9T A;  1NHY A;  1K0C A;  4WBJ A;  3APO A;  1YF1 A;  1TW9 A;  2VL2 C;  3QD9 A;  2O7K A;  4ML1 A;  5ECP B;  1Y25 A;  3QDN A;  3QAV A;  3TGZ A;  1TTZ A;  2F8A A;  2DJJ A;  4ZB9 A;  4WKW A;  4NAX A;  2EIO A;  3G7I A;  3ZIV A;  1R5A A;  1B4Q A;  4CW9 A;  3CSJ A;  1I9D A;  1ZGN A;  4O92 A;  3FKF A;  1WPI A;  2X8H A;  4EC0 A;  4K1F A;  2M72 A;  3H1N A;  3M0F A;  4HQZ A;  4EO3 A;  3GKX A;  1FG4 A;  3ZML A;  1V58 A;  4KB3 A;  5ECK B;  2B3S A;  1MD3 A;  1SD8 A;  4MPG A;  3W6G A;  1S3C A;  3HZ4 A;  2L59 A;  4LLR A;  4N10 A;  3F9U A;  2B1K A;  4TR0 A;  1OE7 A;  1XWK A;  3GSS A;  2XPD A;  2HSH A;  3HDC A;  5JWQ B;  4XS4 A;  4OFN A;  2CVD A;  2ON5 A;  2VLU A;  3CTG A;  1TK5 B;  4YH2 A;  4YAV A;  3KGK A;  3GX8 A;  1A24 A;  17GS A;  2WB9 A;  4IJ3 A;  1BG5 A;  4FIW A;  5HFG A;  3MWH A;  1GUL A;  5IOW A;  3GL3 A;  3O76 A;  5JCG A;  1SK2 A;  3IR4 A;  3ZL5 A;  3ERW A;  1KNG A;  2WS2 A;  1Z7R A;  3TDG A;  3DVX A;  3IDV A;  1HNB A;  3UEM A;  4TR1 A;  3I69 A;  2YZH A;  2L57 A;  1Z5Y E;  3SWL A;  3ZIJ A;  1F3B A;  2KP1 A;  1PRX A;  1XVQ A;  1XPV A;  2ES7 A;  4F0C A;  3GKN A;  4F03 A;  3R2Q A;  2YWI A;  1MTC A;  3N9J A;  4V1A p;  4WR4 A;  3LYK A;  3Q18 A;  4ISD A;  1ZYQ B;  4MK3 A;  1V98 A;  3F3Q A;  1GNE A;  4TR4 A;  1EOG A;  2VAF A;  4QQ7 A;  2PVO C;  3GMF A;  4KDU A;  3W8J A;  1GTA A;  1XWA A;  2LRC A;  9GSS A;  4NPB A;  1URM A;  2ALB A;  1XW5 A;  2LKU A;  5F06 A;  2G0F A;  4ZL8 A;  3GV1 A;  3F4R A;  3G9B A;  3VLN A;  2H30 A;  2P0G A;  1EV4 A;  3GHA A;  3L78 A;  3GFK A;  1GL8 A;  1OVN A;  4MF7 A;  2D2Z A;  3HJP A;  2YV7 A;  5DCH A;  2TIR A;  2JL4 A;  3CYN A;  2GGT A;  4OFM A;  1LU4 A;  2YP6 A;  1O81 A;  4ZIL A;  2H76 A;  4GSN A;  2LST A;  2HXK A;  1BAY A;  4AJ6 A;  2YWM A;  3VK9 A;  4KA0 A;  4EVM A;  2RLI A;  3WT2 A;  4G10 A;  1M9B A;  2K18 A;  1OC9 B;  1BX9 A;  3TJB A;  1ST9 A;  2R5G A;  2H01 A;  4X0X A;  2VOC A;  4I2U A;  3NIV A;  4IP1 A;  5JCW A;  2MBS A;  1Z6M A;  3ERG A;  2H73 A;  1WRY A;  1GUH A;  1NM3 A;  5ECO B;  3EWL A;  4NXI A;  1V40 A;  2GQK A;  2L5O A;  2J23 A;  2B7K A;  1OE8 A;  3GX0 A;  2LNT A;  1UA5 A;  3C73 A;  3US3 A;  3W8S A;  2LTK A;  2K8V A;  3TOU A;  4BWS A;  1M2B A;  4ZL9 A;  1X9M B;  1HYU A;  3C7M A;  1THO A;  1R26 A;  3QAW A;  4KDX A;  4EDY A;  2OE3 A;  5AIX A;  4CHS A;  5G2Z A;  2HZF A;  4AJ7 A;  4GTU A;  2PPT A;  4ZIJ A;  5JWO B;  1RQM A;  1GNW A;  5CNW A;  2O89 A;  2J9H A;  1T1V A;  4L8E A;  2O85 A;  2WGR A;  1O8X A;  1AQV A;  3M9J A;  2L4Q A;  2VCV A;  4MZW A;  4EUY A;  2QGV A;  5DJL A;  3PR8 A;  2E2M A;  2B5Y A;  4TR3 A;  2FLS A;  5C00 A;  4IGJ A;  1WOU A;  1S3D A;  4POB A;  1ON4 A;  3EMP A;  4K0N A;  1NSW A;  3E0U A;  1DUG A;  1EGR A;  3EC3 A;  1TK0 B;  3UAP A;  3Q19 A;  6GSU A;  3TRP A;  3Q6O A;  2RII A;  3TKR A;  2AUV A;  1Y6E A;  3WGX A;  4V2L A;  3IC4 A;  4KX4 A;  3I43 A;  3OR5 A;  2CZ3 A;  5COH A;  3GTU B;  3BBY A;  4WF5 A;  1SKR B;  4KGI A;  1R5P A;  5DAK A;  1R4W A;  4NV2 A;  5D73 A;  1PSQ A;  3UJ1 A;  1SJI A;  5B6N A;  2AHE A;  2N5B A;  3GUS A;  2DIZ A;  2VCQ A;  1XW9 A;  2MYG A;  1OKD A;  4MLY A;  1A23 A;  4F2I A;  4TXO B;  4P3Y B;  4GF0 A;  4JBB A;  1O8W A;  3PGT A;  4L0W A;  3LYP A;  2C3Q A;  1T8E B;  1M99 A;  4J57 E;  4TOP A;  2GSQ A;  4I6X A;  3C8E A;  1X5C A;  5IMZ A;  3RBT A;  2OE0 A;  5D96 A;  4AGS A;  4DSR A;  1TP9 A;  5B8A A;  2IMD A;  5ELA A;  3CRU A;  3EE2 A;  2KOK A;  4NV5 A;  4YAP A;  4X1U A;  4XS1 A;  1GUK A;  3RAZ A;  4IQ1 A;  1JZR A;  4JR4 A;  3A2X A;  1CQG A;  2F8F A;  4ZBD A;  2H0I A;  1QQ2 A;  2PMT A;  1SYR A;  3GA4 A;  3QFB C;  3FY7 A;  5ECQ B;  2H0G A;  2ON7 A;  1DE2 A;  1PKW A;  4NHZ A;  1X5E A;  3TJJ A;  1NW2 A;  3IK9 A;  1YDK A;  2C0D A;  1SYX A;  4IQA A;  8GSS A;  4IEL A;  4DSS B;  2PGT A;  4GST A;  3ZMK A;  2YV9 A;  4GRF A;  3NOF A;  2MMN A;  4XHM A;  2H6X A;  1X9W B;  1ZOF A;  1O6J A;  2HFD A;  1SK1 A;  4KDY A;  2FWH A;  5D9W A;  1GWC A;  1GSU A;  3D21 A;  5A4U A;  1YEX A;  2L6C A;  3H79 A;  3AY8 A;  4I97 A;  5ECI B;  3DML A;  5ECS A;  5EY6 A;  2TRC P;  4I8B A;  4EDZ A;  4EF0 A;  1XVW A;  1O85 A;  5CP1 A;  3KM6 A;  1AIU A;  5LCZ A;  1AC1 A;  2V6O A;  5JWR B;  1FW1 A;  3QCP A;  1TU8 A;  2KUC A;  2FWF A;  2FY6 A;  2FWG A;  4X43 A;  3TKS C;  3GST A;  3CRT A;  4HDE A;  2MMO A;  2VLT A;  5IQY A;  2G2Q A;  1GLP A;  2N5A A;  3FZ5 A;  4MAB A;  5IMF A;  4OFT A;  3EVI A;  1J0F A;  2WFC A;  3QR6 A;  1GSF A;  4FYU A;  4K8M A;  4IP6 A;  3RPP A;  4ECC A;  1SJ6 A;  4TN8 A;  1O73 A;  3DKS A;  1JLV A;  5B7C A;  3FR6 A;  5IO2 A;  3GH6 A;  1EP7 A;  4LL1 B;  1Z3E A;  1B9X C;  3GNJ A;  1R7H A;  2R37 A;  3JCM L;  1WE0 A;  2B6M A;  1K0M A;  2NBS A;  3FEU A;  1CQH A;  1GSS A;  4OCE A;  5EL8 A;  4Q5R A;  2C1Y A;  2FCH A;  5IIZ A;  2H75 A;  3APQ A;  3V1W A;  1KBN A;  5C04 A;  1B48 A;  5EPF A;  2JAC A;  4LL4 B;  2VL3 A;  3KZQ A;  2JZS A;  3M9K A;  2LRN A;  3EUR A;  2AV4 A;  4G2E A;  1G7E A;  1SEN A;  1ZZY A;  3A2V A;  4MCU A;  3WD6 A;  3UL3 A;  1ERU A;  3BCK A;  4K7O A;  5J9B A;  2V2G A;  4WEY A;  1T4Y A;  5CRH A;  4XCS A;  4RI7 A;  3WYW A;  3IAM 2;  6GSY A;  1TJD A;  3CTF A;  4MMM A;  1A2L A;  1QFN A;  1G6Y A;  3RHC A;  1XIY A;  2GSR A;  1T4Z A;  2NDO A;  1M7T A;  1OC9 A;  2MMA A;  2HI7 A;  5F0G A;  4HEA 2;  4E8E A;  2YCD A;  3IV4 A;  5ECH B;  1PGT A;  4JRR A;  3F4S A;  1GTB A;  3DRN A;  4JE1 A;  2QC7 A;  4V2M A;  5G5E A;  3HKR A;  3F6F A;  1XCC A;  1T00 A;  2RM5 A;  3HA9 A;  1EWX A;  4MA9 A;  1GP1 A;  1F6M C;  3PH9 A;  2AAW A;  4MZC A;  2QKE A;  3FK8 A;  1WJK A;  1U6T A;  3KH7 A;  3APS A;  2YAN A;  2HNL A;  1WP0 A;  2WDU A;  3BOA A;  2FA8 A;  1LJR A;  2CT6 A;  3VUR A;  2DJ2 A;  2H19 A;  1W4V A;  4DEJ A;  1QUW A;  4L5L A;  4XRD A;  4OO5 A;  3H4K A;  4E8H A;  1YEP A;  1F2E A;  1VRS D;  3WT1 A;  1FB0 A;  3IOS A;  5G31 A;  4PUR A;  4QL9 A;  5KN0 A;  2R4V A;  4HU9 A;  3ZIT A;  1DSB A;  2L5L A;  2JSZ A;  2HSY A;  2B7J A;  5HR3 A;  3MDK A;  1SU9 A;  2K6V A;  4YQM A;  4RUV A;  2I3Y A;  4ECB A;  3DEX A;  5INY A;  3J7Y b;  3C1R A;  1M0U A;  3IE3 A;  4HJ2 A;  4ILF A;  1AXD A;  5LNK e;  2GST A;  3CSH A;  2H1D A;  5CRW A;  2LEG A;  1GUM A;  5B8B A;  4KE3 A;  3O6T A;  1OKT A;  4PQI A;  2EC4 A;  1QXH A;  1EEM A;  1DE1 A;  2YWO A;  1OC8 A;  4FH8 A;  2QSI A;  2I4A A;  2LQQ A;  3E3E A;  2CAQ A;  4YQU A;  3VWX A;  4WET A;  1N8J A;  3KD0 A;  3FW2 A;  1K0O A;  4IHU A;  2X64 A;  1PN9 A;  1M9A A;  6GSV A;  5ABR A;  2H6Z A;  2X99 A;  2OE1 A;  2FNO A;  4TW5 A;  2EIQ A;  4PQH A;  3P2A A;  4WBR D;  1W89 A;  2GTU A;  3D6I A;  5F05 A;  5ENU A;  3VPT A;  4D73 B;  3GRX A;  4HS1 A;  3S9F A;  2AB6 A;  2HRN A;  2BTO T;  4F9Z A;  2MBT A;  4IKH A;  1AAZ A;  5IPH A;  5CO3 A;  5FT3 A;  5DAL A;  1K0A A;  1MDI A;  3QMX A;  1SJZ A;  3D22 A;  1FAA A;  3KH9 A;  2I81 A;  2H66 A;  3HXS A;  4IBP A;  2IFQ A;  3LXZ A;  2X8C A;  4TXV A;  3P90 A;  5HFI A;  4WF4 A;  5CAX A;  3KEB A;  3ME7 A;  2LUS A;  3DXB A;  3DYR A;  2PBJ A;  5GAN D;  2F51 A;  5CRE A;  4KAE A;  1GSE A;  1PMT A;  3ED3 A;  3UIW A;  3TUE A;  2YZU A;  2LV3 A;  1XOA A;  4EXJ A;  4XTS A;  4GQC A;  3VI5 A;  3UVT A;  4POK A;  3HYP A;  3ZTL A;  2PU9 C;  2I1U A;  2KLX A;  2PWJ A;  5KN2 A;  1I5G A;  3LEF A;  4BVY A;  2C4J A;  5GZZ B;  4K2D A;  2GT6 A;  4XS4 B;  2VL9 A;  2DJK A;  3UMA A;  1PKZ A;  3ZFB A;  4EKZ A;  4KH7 A;  3TJK A;  1E2Y A;  4OMV A;  3LOR A;  2B5X A;  2VCX A;  4ZBA A;  2OKA A;  1A2J A;  4BWQ A;  1MDK A;  3TKS E;  3VPQ A;  6GST A;  3DD3 A;  1BED A;  5J4U A;  1T3B A;  1EZK A;  5AGY A;  3I9V 2;  5AN1 A;  14GS A;  1V57 A;  4EL1 A;  3BD2 A;  1B4P A;  1FO5 A;  3GYK A;  2XHF A;  2Z9S A;  1NHO A;  5KN3 A;  3KTL A;  2FHE A;  4AF2 A;  1ZYE A;  2CV4 A;  4V1A g;  2FUG 2;  4IJI A;  4FYC A;  3GIX A;  3DWV A;  4K7N A;  3F6D A;  1K0N A;  2H1G A;  2H72 A;  2GVP A;  5ID2 A;  2HZE A;  3LGC A;  2HRF A;  5CYY A;  5DQY A;  4ZXG A;  3G7Y A;  2CAI A;  5ECR B;  20GS A;  1LBK A;  1PL1 A;  1VF1 A;  2IMK A;  3EU4 A;  5HQP A;  3F3R A;  2YWN A;  1HNC A;  2LS5 A;  1QGV A;  1U87 A;  4KW6 A;  1EGO A;  2LJA A;  1M2A A;  1XXU A;  4G19 A;  1K0D A;  2K9F A;  2CX4 A;  1SL0 B;  1FB6 A;  5ECL B;  3GL5 A;  3ZLP A;  3A2W A;  4I5Q A;  19GS A;  4PXO A;  4HOJ A;  2BJX A;  2YOI A;  2BMX A;  2DJ0 A;  2OBK A;  4IS0 A;  1TK8 B;  1JFU A;  3A5W A;  1USB A;  1TXX A;  1TDI A;  2FWE A;  2NPB A;  4PNF A;  1YQ1 A;  3DIE A;  2H74 A;  3D4T A;  1TRS A;  2ZUP A;  2ZCT A;  2VM2 A;  5LD0 A;  5DCG A;  2ZNM A;  1Z6N A;  3KIJ A;  4KUN A;  1U88 A;  4TRX A;  4OO4 A;  4LMW A;  2R6K A;  1AW9 A;  5J5N A;  5F07 A;  4KND A;  3QFA C;  1XZO A;  2IMF A;  3I6A A;  3CBU A;  6GSX A;  3CXG A;  4MZB A;  3WGE A;  2GZP A;  2IL3 A;  1PX6 A;  3TKS A;  1XOB A;  2HT9 A;  2JZR A;  4ID0 A;  3KP9 A;  12GS A;  2B5E A;  3FZA A;  1E6B A;  1OC3 A;  2P31 A;  4ZB6 A;  1MD4 A;  3CMI A;  2JSY A;  5KEJ A;  3QPM A;  2E2G A;  2V41 A;  5J3R A;  3FYG A;  2CVB A;  2HLS A;  1K0B A;  1VF2 A;  1B8X A;  4Z7X A;  4JU5 A;  4K7I A;  5D9V A;  1A8L A;  4IW9 A;  2GS3 A;  2AYT A;  4NHW A;  3E9J B;  1KTE A;  4GSS A;  3PIN A;  1UN2 A;  1AUC A;  3LWA A;  1TRW A;  6GSS A;  2M46 A;  5A4W A;  4MPF A;  3VFI A;  1N2A A;  2JZT A;  2JU5 A;  1ILO A;  1JZD A;  1GTI A;  2DJ3 A;  3UAR A;  1XWB A;  4AJ8 A;  2PVQ A;  5A5K A;  2H70 A;  4HI7 A;  3L9S A;  2VL2 A;  5CRD A;  4ZBB A;  3D4M A;  1GRX A;  2VLV A;  2DML A;  1PA3 A;  2VUP A;  3M3M A;  3TJF A;  3ZYW A;  5KN1 A;  3F8U A;  2HYX A;  4J56 E;  2H8L A;  4BPY A;  1TKD B;  2GSS A;  2IPA A;  1SK0 A;  3UBK A;  1AQW A;  2OJL A;  3IXR A;  3U6V A;  1DBY A;  1UC7 A;  3UVH A;  4XRA A;  2DC5 A;  3GH9 A;  1TRV A;  1A8Y A;  4HQS A;  1Q4J A;  3MSZ A;  4Q5F A;  4GQF A;  3GUR A;  4O5R A;  5GAP D;  2IIY A;  2PER A;  5ECN B;  2GDR A;  2C3N A;  1U3I A;  1YF0 A;  2YJ7 A;  4MDC A;  4WR5 A;  5B6M A;  1XWC A;  5D8I A;  1H4O A;  1VF3 A;  1GLQ A;  3MAK A;  4NWY A;  1EP8 A;  1GSY A;  5IPG A;  3F63 A;  3F4T A;  3TOT A;  2R3X A;  4H86 A;  1HQO A;  3HY2 A;  3LQ7 A;  1IYH A;  1EV9 A;  2OAC A;  3KMN A;  2CZ2 A;  4HZ2 A;  5H5Q A;  2MZC A;  3L9V A;  3Q74 A;  1F9M A;  3EU3 A;  4N30 A;  4N0Z A;  3QAG A;  2LJR A;  3TKQ A;  5FHI A;  4TKY A;  1EOH A;  3C1S A;  2XPE A;  3N5O A;  5EVO A;  4KSM A;  1BJX A;  1FOV A;  3VWV A;  4N0V A;  3LXT A;  2VO4 A;  5IMA A;  3FZ9 A;  3DVW A;  5L71 A;  5HR2 A;  3HZ8 A;  18GS A;  1RK4 A;  4TVE A;  2CQ9 A;  3ZZX A;  1YKC A;  4K6X A;  4MF6 A;  4L5O A;  5AIS A;  1FVK A;  2OAD A;  1HD2 A;  2C0G A;  1J08 A;  3ZRD A;  5IOX A;  2M80 A;  3EIN A;  3HJO A;  3DGQ A;  2XBI A;  3FRC A;  3VI7 A;  1JZW A;  4MH2 A;  2FA4 A;  3CSI A;  1ERW A;  4F0B A;  3GKK A;  4OWY A;  2OBI A;  4FO5 A;  4O7H A;  2IJY A;  2PN8 A;  2XC2 A;  3F0I A;  3KCM A;  1SL1 B;  3LG6 A;  3C71 A;  1K3L A;  5IO0 A;  1JHB A;  1WIK A;  3BJ5 A;  3P7X A;  3IK7 A;  3GTU A;  2V6K A;  2H1B A;  1YZX A;  4PUF C;  4NMU A;  2F9S A;  3HCZ A;  3UBL A;  1ML6 A;  1B9Y C;  1F3A A;  1WWJ A;  1SD9 A;  5G30 A;  3RHB A;  3EYT A;  2X8G A;  4JZQ A;  1IYI A;  2YJH A;  4TXO A;  3KTB A;  4K0G A;  3NZN A;  3FHK A;  4ECJ A;  5J9C A;  11GS A;  4DSQ A;  2LRT A;  22GS A;  3VWU A;  5ELG A;  2FGX A;  1X0R A;  2KP2 A;  4GWR A;  3IA1 A;  3TCO A;  2FD3 A;  2NTO A;  4IVF A;  2H0H A;  13GS A;  3KJY A;  3M1G A;  2O87 A;  3GKM A;  4DVC A;  4EE0 A;  4MP4 A;  1G6W A;  5GSS A;  3LJR A;  2H1A A;  2WZ9 A;  3H93 A;  4JED A;  4G9H A;  2H71 A;  5G1K A;  3BCI A;  3HVX A;  4PUA A;  4ZB8 A;  5G5F A;  1OAZ A;  5IM9 A;  2E7P A;  2MMZ A;  3RDW A;  2DIY A;  4IN0 A;  1SL2 B;  3J7Y k;  1A0R P;  3HJM A;  4DSS A;  3ZRE A;  1TOF A;  2C80 A;  5AIV A;  2CX3 A;  10GS A;  2VCW A;  4HZ4 A;  7GSS A;  4O32 A;  2PUK C;  2YNX A;  2GZY A;  4MH3 A;  1XWG A;  4HUA A;  1X5D A;  2DBC A;  5IMD A;  4OD7 A;  1G0T A;  4ECI A;  1BYE A;  1UVZ A;  1GTU A;  4MF5 A;  2DJ1 A;  2JAD A;  3TKP A;  2REM A;  2VD1 A;  2LNS A;  4ML6 A;  5IMV A;  2HE3 A;  4ULX A;  3GN3 A;  3IRA A;  2OA7 A;  1THX A;  2GLR A;  4TR1 B;  2A2R A;  5G1L A;  4K9Z A;  2RUE A;  3ISO A;  4QL7 A;  1X9S B;  2NVL A;  2H6Y A;  2LJK A;  2RUF A;  4XIH A;  1Z7P A;  2V32 A;  3MNG A;  2B1L A;  1ERT A;  2YN1 A;  2YPM A;  2WRT A;  1XW6 A;  1ACV A;  2P5Q A;  3L9U A;  4RQR A;  4GXZ A;  4HJM A;  4F82 A;  1G7O A;  3RPN A;  5DVB A;  3A3T A;  3ZVJ D;  5DDL A;  2CVK A;  6GSW A;  1QMV A;  1M2D A;  2V1M A;  5FWG A;  5F8B A;  3HD5 A;  4RI6 A;  2KHP A;  3ERF A;  2GQL A;  1YKA A;  2XBQ A;  2E0Q A;  5E59 A;  4MJA A;  4Q5N A;  2IN3 A;  3G7J A;  5HFK A;  2C0E A;  3IPZ A;  1PL2 A;  1ERV A;  5D93 A;  2O8V B;  5JCU A;  1TI1 A;  2N5F A;  3VWW A;  4N11 A;  1U3A A;  1YY7 A;  2C0F A;  2GZZ A;  5D9X A;  2RM6 A;  2GT5 A;  5CRG A;  4KSO A;  2GQM A;  1Z9H A;  3D5J A;  3U5R E;  16GS A;  3TRX A;  2LQO A;  2IWT A;  1VF4 A;  3HVV A;  5DAL B;  1TI3 A;  2L6D A;  1GSD A;  4L0U A;  3KXO A;  2WCI A;  4Q5Q A;  2I9H A;  2IFQ B;  3FR9 A;  4BVX A;  4KCA A;  1JLW A;  3ZVJ A;  1C72 A;  1XFL A;  3HVS A;  4PX1 A;  2K8S A;  1GH2 A;  3LSZ A;  4JR6 A;  2VD0 A;  4PQ1 A;  3M8N A; 
#chains in the Genus database with same CATH topology
 1A2M A;  3WGD A;  1KEB A;  2HRK A;  2DMM A;  3FZ4 A;  2VCZ A;  1J9B A;  4OCF A;  1TU7 A;  1ZL9 A;  4MJE A;  5A4V A;  2IMI A;  5E4W A;  3LFL A;  1SKW B;  4A5P A;  3IAS 2;  4HU7 A;  4BVY B;  1WMJ A;  2R0G A;  2WJU A;  1FHE A;  5J41 A;  1H75 A;  4GCI A;  1V9W A;  3HHV A;  1O7U A;  1K3Y A;  1GSQ A;  1BQ7 A;  5HR0 A;  3IBH A;  4BA7 A;  1XBS A;  5HR1 A;  4ACS A;  2TRX A;  1ZCP A;  1T7P B;  5DBQ A;  1MEK A;  1OYJ A;  2C8U A;  3EMX A;  4WXT A;  3D0Z A;  4J2F A;  4PGT A;  4BL7 A;  4CDO A;  4POL A;  3TRQ A;  2AJQ B;  1ABA A;  4XS6 A;  1JZO A;  2VCT A;  1QK8 A;  1F37 A;  4V2N A;  3ME8 A;  2VM1 A;  4ZL7 A;  5GST A;  1YJ6 A;  4MJB A;  2EIR A;  2VIM A;  5H5S A;  1MDJ A;  1TRU A;  3SBC A;  3QOU A;  1S3A A;  1EEJ A;  5ECM B;  1Q98 A;  4YQV A;  3L4N A;  4MJC A;  5ID2 B;  2HZE B;  5KOX A;  2L4C A;  4LMV A;  1RW1 A;  3ZFL A;  1HNA A;  1K3O A;  5IMC A;  2R2J A;  1A0F A;  4I2T A;  3FR3 A;  1AQX A;  3KP8 A;  3KMO A;  1PD2 1;  2C3T A;  2DLX A;  2DSA A;  3O3T A;  5DQS A;  3L0H A;  4KCE A;  3K8N A;  2A2S A;  3TB2 A;  2A4V A;  4PNG A;  4K5R A;  5H5R A;  1VGL A;  5DAK B;  1ZYN A;  3UOM A;  5DJM A;  3H8Q A;  2IME A;  1FVJ A;  2P5R A;  1PX7 A;  1ZMA A;  2WUL A;  4RQX A;  1V2A A;  3IHQ A;  3IC8 A;  4LA1 A;  1SKS B;  3P8W A;  1PQN A;  3TJG A;  4GLT A;  4POM A;  4D73 A;  4FYB A;  2CA8 A;  2F3M A;  5D9T A;  1NHY A;  1K0C A;  4WBJ A;  3APO A;  1YF1 A;  1TW9 A;  2VL2 C;  3QD9 A;  2O7K A;  4K2X A;  4ML1 A;  5ECP B;  1Y25 A;  3QDN A;  3QAV A;  3TGZ A;  1TTZ A;  2F8A A;  2DJJ A;  4ZB9 A;  4WKW A;  4NAX A;  2EIO A;  3G7I A;  3ZIV A;  1R5A A;  1B4Q A;  4CW9 A;  3CSJ A;  1I9D A;  1ZGN A;  4O92 A;  3FKF A;  1WPI A;  2X8H A;  4EC0 A;  4K1F A;  2M72 A;  1M3I A;  3H1N A;  3M0F A;  4HQZ A;  4EO3 A;  3GKX A;  1FG4 A;  3ZML A;  1V58 A;  4KB3 A;  5ECK B;  2B3S A;  1MD3 A;  1SD8 A;  4MPG A;  3W6G A;  1S3C A;  3HZ4 A;  2L59 A;  4LLR A;  4N10 A;  3F9U A;  2B1K A;  4TR0 A;  4G0L A;  1OE7 A;  1XWK A;  3GSS A;  2XPD A;  2HSH A;  3HDC A;  5JWQ B;  4XS4 A;  4OFN A;  2CVD A;  2ON5 A;  2VLU A;  3CTG A;  1TK5 B;  4YH2 A;  4YAV A;  3KGK A;  3GX8 A;  1A24 A;  17GS A;  2WB9 A;  3PPU A;  4X4J A;  4IJ3 A;  1BG5 A;  4FIW A;  5HFG A;  3MWH A;  1GUL A;  5IOW A;  3GL3 A;  3O76 A;  5JCG A;  1SK2 A;  3IR4 A;  3ZL5 A;  3ERW A;  1KNG A;  2WS2 A;  1Z7R A;  3TDG A;  3DVX A;  3IDV A;  1HNB A;  3UEM A;  4TR1 A;  3I69 A;  2YZH A;  2L57 A;  1Z5Y E;  3SWL A;  3ZIJ A;  1F3B A;  2KP1 A;  1PRX A;  1XVQ A;  1XPV A;  2ES7 A;  4F0C A;  3GKN A;  4F03 A;  3R2Q A;  2YWI A;  1MTC A;  3N9J A;  4V1A p;  4WR4 A;  3LYK A;  3Q18 A;  4CY6 A;  4ISD A;  1ZYQ B;  4MK3 A;  1V98 A;  3F3Q A;  1GNE A;  4TR4 A;  1EOG A;  2VAF A;  4QQ7 A;  2PVO C;  3GMF A;  4KDU A;  3W8J A;  1GTA A;  1XWA A;  2LRC A;  9GSS A;  4NPB A;  1URM A;  2ALB A;  1XW5 A;  2LKU A;  5F06 A;  2G0F A;  4ZL8 A;  3GV1 A;  3F4R A;  3G9B A;  3VLN A;  2H30 A;  2P0G A;  1EV4 A;  3GHA A;  3L78 A;  3GFK A;  1GL8 A;  1OVN A;  4MF7 A;  2D2Z A;  3HJP A;  2YV7 A;  5DCH A;  2TIR A;  2JL4 A;  3CYN A;  2GGT A;  4OFM A;  1LU4 A;  2YP6 A;  1O81 A;  4ZIL A;  4YKG A;  2H76 A;  4GSN A;  2LST A;  2HXK A;  1BAY A;  4AJ6 A;  2YWM A;  3VK9 A;  4KA0 A;  4EVM A;  2RLI A;  3WT2 A;  4G10 A;  1M9B A;  2K18 A;  1OC9 B;  1BX9 A;  3TJB A;  1ST9 A;  2R5G A;  2H01 A;  4X0X A;  2VOC A;  4I2U A;  3NIV A;  4IP1 A;  5JCW A;  2MBS A;  1Z6M A;  3ERG A;  2H73 A;  1WRY A;  1GUH A;  1NM3 A;  5ECO B;  3EWL A;  4NXI A;  1V40 A;  2GQK A;  2L5O A;  2J23 A;  2B7K A;  1OE8 A;  3GX0 A;  4CY8 A;  2LNT A;  1UA5 A;  3C73 A;  3US3 A;  3W8S A;  2LTK A;  2K8V A;  3TOU A;  4BWS A;  1M2B A;  4ZL9 A;  1X9M B;  1HYU A;  3C7M A;  1THO A;  1R26 A;  3QAW A;  4KDX A;  4EDY A;  2OE3 A;  5AIX A;  4CHS A;  5BMU A;  5G2Z A;  2HZF A;  4AJ7 A;  4GTU A;  2PPT A;  4ZIJ A;  5JWO B;  1RQM A;  1GNW A;  5CNW A;  2O89 A;  2J9H A;  1T1V A;  4L8E A;  2O85 A;  2WGR A;  1O8X A;  1AQV A;  3M9J A;  2L4Q A;  2VCV A;  4MZW A;  4EUY A;  2QGV A;  5DJL A;  3PR8 A;  2E2M A;  2B5Y A;  4TR3 A;  2FLS A;  5C00 A;  1PFO A;  2HSM A;  4IGJ A;  1WOU A;  1S3D A;  4POB A;  1ON4 A;  1ZYP A;  3EMP A;  4K0N A;  1NSW A;  3E0U A;  1DUG A;  1EGR A;  3EC3 A;  1TK0 B;  3UAP A;  3Q19 A;  6GSU A;  3TRP A;  3Q6O A;  2RII A;  3TKR A;  2AUV A;  1Y6E A;  3WGX A;  4V2L A;  3IC4 A;  4KX4 A;  3I43 A;  3OR5 A;  2CZ3 A;  5COH A;  3GTU B;  3BBY A;  4WF5 A;  1SKR B;  4KGI A;  1R5P A;  5DAK A;  1R4W A;  4NV2 A;  5D73 A;  1PSQ A;  3UJ1 A;  1SJI A;  5B6N A;  2AHE A;  4G0K A;  2N5B A;  3GUS A;  2DIZ A;  2VCQ A;  1XW9 A;  2MYG A;  1OKD A;  4MLY A;  1A23 A;  4F2I A;  4TXO B;  4P3Y B;  4GF0 A;  4JBB A;  1O8W A;  3PGT A;  4L0W A;  3LYP A;  2C3Q A;  1T8E B;  1M99 A;  4J57 E;  4TOP A;  2GSQ A;  4I6X A;  3C8E A;  1X5C A;  4HSC X;  5IMZ A;  3RBT A;  2OE0 A;  5D96 A;  4AGS A;  4DSR A;  1TP9 A;  5B8A A;  2IMD A;  5ELA A;  3CRU A;  3EE2 A;  4KF9 A;  2KOK A;  4NV5 A;  4YAP A;  4X1U A;  4XS1 A;  1GUK A;  3RAZ A;  4IQ1 A;  1JZR A;  4JR4 A;  3A2X A;  1CQG A;  2F8F A;  4ZBD A;  2H0I A;  1QQ2 A;  2PMT A;  1SYR A;  3GA4 A;  3QFB C;  3FY7 A;  5ECQ B;  2H0G A;  2ON7 A;  1DE2 A;  1PKW A;  4NHZ A;  1X5E A;  3TJJ A;  1NW2 A;  3IK9 A;  1YDK A;  2C0D A;  1SYX A;  4IQA A;  8GSS A;  4IEL A;  4DSS B;  2PGT A;  4GST A;  3ZMK A;  2YV9 A;  4GRF A;  3NOF A;  2MMN A;  4XHM A;  2H6X A;  1X9W B;  1ZOF A;  1O6J A;  2HFD A;  1SK1 A;  2DKI A;  4KDY A;  2FWH A;  5D9W A;  1GWC A;  1GSU A;  3D21 A;  5A4U A;  4Z2T A;  1YEX A;  2L6C A;  3H79 A;  3AY8 A;  4I97 A;  5ECI B;  3DML A;  5ECS A;  5EY6 A;  2TRC P;  4I8B A;  4EDZ A;  4EF0 A;  1XVW A;  1O85 A;  5CP1 A;  3KM6 A;  1AIU A;  5LCZ A;  1AC1 A;  4Z2U A;  2V6O A;  5JWR B;  1FW1 A;  3QCP A;  1TU8 A;  2KUC A;  2FWF A;  2FY6 A;  2FWG A;  4X43 A;  3TKS C;  3GST A;  3CRT A;  4HDE A;  2MMO A;  2VLT A;  5IQY A;  2G2Q A;  1GLP A;  2N5A A;  3FZ5 A;  4MAB A;  5IMF A;  4OFT A;  3EVI A;  1J0F A;  2WFC A;  3QR6 A;  1GSF A;  4FYU A;  4K8M A;  4IP6 A;  3RPP A;  4ECC A;  1SJ6 A;  4TN8 A;  1O73 A;  3DKS A;  1JLV A;  5B7C A;  3FR6 A;  5IO2 A;  3GH6 A;  1EP7 A;  4LL1 B;  1Z3E A;  1B9X C;  3GNJ A;  1R7H A;  2R37 A;  3JCM L;  1WE0 A;  2B6M A;  1K0M A;  3FMW A;  2NBS A;  3FEU A;  1CQH A;  1GSS A;  4OCE A;  5EL8 A;  4Q5R A;  2C1Y A;  2FCH A;  5IIZ A;  2H75 A;  3APQ A;  3V1W A;  1KBN A;  5C04 A;  1B48 A;  5EPF A;  2JAC A;  4LL4 B;  2VL3 A;  3KZQ A;  2JZS A;  3M9K A;  2LRN A;  3EUR A;  2AV4 A;  4G2E A;  1G7E A;  1SEN A;  1ZZY A;  3A2V A;  4MCU A;  3WD6 A;  3UL3 A;  1ERU A;  3BCK A;  2R0C A;  4K7O A;  5J9B A;  2V2G A;  4WEY A;  1T4Y A;  5CRH A;  4XCS A;  4RI7 A;  4FQU A;  3WYW A;  3IAM 2;  4BVX B;  6GSY A;  1TJD A;  3CTF A;  4MMM A;  1A2L A;  1QFN A;  1G6Y A;  3RHC A;  1XIY A;  2GSR A;  1T4Z A;  2NDO A;  1M7T A;  1OC9 A;  2MMA A;  2HI7 A;  3IHG A;  5F0G A;  4HEA 2;  4E8E A;  2YCD A;  2A4H A;  3IV4 A;  5ECH B;  1PGT A;  4JRR A;  3F4S A;  1GTB A;  3DRN A;  4JE1 A;  2QC7 A;  4V2M A;  5G5E A;  3HKR A;  3F6F A;  1XCC A;  1T00 A;  2RM5 A;  3HA9 A;  1EWX A;  4MA9 A;  1GP1 A;  1F6M C;  3PH9 A;  2AAW A;  4MZC A;  2QKE A;  3FK8 A;  4ICY A;  1WJK A;  1U6T A;  3KH7 A;  3APS A;  2YAN A;  2HNL A;  1WP0 A;  2WDU A;  3BOA A;  2FA8 A;  1LJR A;  2CT6 A;  3VUR A;  2DJ2 A;  2H19 A;  1W4V A;  4DEJ A;  1QUW A;  4L5L A;  1PN0 A;  4OO5 A;  4XRD A;  3H4K A;  4E8H A;  1YEP A;  1F2E A;  1VRS D;  3WT1 A;  1FB0 A;  3IOS A;  5G31 A;  4BL7 B;  4PUR A;  4QL9 A;  5KN0 A;  2R4V A;  2QA1 A;  4HU9 A;  3ZIT A;  1DSB A;  4Z2R A;  2L5L A;  2JSZ A;  2HSY A;  2B7J A;  5HR3 A;  3MDK A;  1SU9 A;  2K6V A;  4RUV A;  4YQM A;  2I3Y A;  4ECB A;  3DEX A;  5INY A;  3J7Y b;  3C1R A;  1M0U A;  3IE3 A;  4HJ2 A;  4ILF A;  1AXD A;  5LNK e;  2GST A;  3CSH A;  2H1D A;  5CRW A;  2LEG A;  1GUM A;  5B8B A;  4KE3 A;  3O6T A;  1OKT A;  4PQI A;  2EC4 A;  1QXH A;  1EEM A;  1DE1 A;  2YWO A;  1OC8 A;  4FH8 A;  2QSI A;  1XG8 A;  2I4A A;  2LQQ A;  3E3E A;  2CAQ A;  4YQU A;  3VWX A;  4WET A;  1N8J A;  3KD0 A;  3FW2 A;  1K0O A;  4IHU A;  2X64 A;  1PN9 A;  1M9A A;  6GSV A;  5ABR A;  2H6Z A;  2X99 A;  2OE1 A;  2FNO A;  4TW5 A;  2EIQ A;  4PQH A;  3P2A A;  4WBR D;  1W89 A;  2GTU A;  3D6I A;  5F05 A;  5ENU A;  3VPT A;  4D73 B;  3GRX A;  4HS1 A;  3S9F A;  2AB6 A;  2HRN A;  2BTO T;  4F9Z A;  2MBT A;  4IKH A;  1AAZ A;  5IPH A;  5CO3 A;  5FT3 A;  5DAL A;  1K0A A;  1MDI A;  3QMX A;  1SJZ A;  3D22 A;  1FAA A;  3KH9 A;  2I81 A;  2H66 A;  3HXS A;  4YKF A;  4IBP A;  2IFQ A;  3LXZ A;  2X8C A;  4TXV A;  3P90 A;  5HFI A;  4WF4 A;  5CAX A;  4USS A;  3KEB A;  3ME7 A;  2LUS A;  3DXB A;  3DYR A;  2PBJ A;  5GAN D;  2F51 A;  5CRE A;  4KAE A;  1GSE A;  1PMT A;  3ED3 A;  3UIW A;  3TUE A;  2YZU A;  2LV3 A;  1XOA A;  4EXJ A;  4XTS A;  4GQC A;  3VI5 A;  3UVT A;  4POK A;  3HYP A;  3ZTL A;  2PU9 C;  2I1U A;  2KLX A;  2PWJ A;  5KN2 A;  1I5G A;  3LEF A;  4BVY A;  2C4J A;  5GZZ B;  4K2D A;  2GT6 A;  4XS4 B;  2VL9 A;  2DJK A;  3UMA A;  1PKZ A;  3ZFB A;  4EKZ A;  4KH7 A;  3TJK A;  1E2Y A;  4OMV A;  4EIP A;  3LOR A;  2B5X A;  2VCX A;  4ZBA A;  2OKA A;  1A2J A;  4BWQ A;  1MDK A;  3TKS E;  3VPQ A;  6GST A;  3DD3 A;  1BED A;  5J4U A;  1T3B A;  1EZK A;  5AGY A;  3I9V 2;  5AN1 A;  14GS A;  1V57 A;  4EL1 A;  3BD2 A;  1B4P A;  1FO5 A;  3GYK A;  2XHF A;  2Z9S A;  1NHO A;  5KN3 A;  3KTL A;  2FHE A;  4AF2 A;  1ZYE A;  2CV4 A;  4V1A g;  2FUG 2;  4IJI A;  4FYC A;  3GIX A;  3DWV A;  4K7N A;  3F6D A;  1K0N A;  2H1G A;  2H72 A;  2GVP A;  5ID2 A;  2HZE A;  3LGC A;  2HRF A;  5CYY A;  5DQY A;  4ZXG A;  5KOW A;  3G7Y A;  2CAI A;  5ECR B;  20GS A;  1LBK A;  1PL1 A;  1VF1 A;  2IMK A;  3EU4 A;  5HQP A;  3F3R A;  2YWN A;  1HNC A;  2LS5 A;  4MNN A;  1QGV A;  1U87 A;  4KW6 A;  1EGO A;  2LJA A;  1M2A A;  1XXU A;  4G19 A;  1K0D A;  2K9F A;  2CX4 A;  1SL0 B;  1FB6 A;  5ECL B;  3GL5 A;  3ZLP A;  3A2W A;  3MYD A;  4I5Q A;  19GS A;  4PXO A;  4HOJ A;  2BJX A;  2YOI A;  2BMX A;  2DJ0 A;  2OBK A;  2X49 A;  4IS0 A;  1TK8 B;  1JFU A;  3A5W A;  1USB A;  1TXX A;  1TDI A;  2FWE A;  2NPB A;  4PNF A;  1YQ1 A;  3DIE A;  2H74 A;  3EPT A;  3D4T A;  1TRS A;  2ZUP A;  2ZCT A;  2VM2 A;  5LD0 A;  5DCG A;  2ZNM A;  3MIX A;  1Z6N A;  3KIJ A;  4KUN A;  1U88 A;  4TRX A;  4OO4 A;  4LMW A;  2R6K A;  1AW9 A;  5J5N A;  5F07 A;  4KND A;  3QFA C;  1XZO A;  2IMF A;  3I6A A;  3CBU A;  6GSX A;  3CXG A;  4MZB A;  5BRT A;  1S3R A;  2GZP A;  2IL3 A;  1PX6 A;  3TKS A;  3WGE A;  1XOB A;  2HT9 A;  2JZR A;  4ID0 A;  3KP9 A;  12GS A;  2B5E A;  1M3J A;  3FZA A;  1E6B A;  1OC3 A;  2P31 A;  4ZB6 A;  1MD4 A;  3CMI A;  2JSY A;  5KEJ A;  3QPM A;  1FOH A;  2E2G A;  2V41 A;  5J3R A;  3FYG A;  2CVB A;  2HLS A;  1K0B A;  1VF2 A;  1B8X A;  4Z7X A;  4JU5 A;  4K7I A;  5D9V A;  1A8L A;  4IW9 A;  2GS3 A;  2AYT A;  4NHW A;  3E9J B;  1KTE A;  4GSS A;  3PIN A;  1UN2 A;  1AUC A;  3LWA A;  1TRW A;  6GSS A;  2M46 A;  5A4W A;  4MPF A;  3VFI A;  1N2A A;  2JZT A;  2JU5 A;  1ILO A;  1JZD A;  1GTI A;  2DJ3 A;  3UAR A;  1XWB A;  4AJ8 A;  2PVQ A;  5A5K A;  2H70 A;  4HI7 A;  3L9S A;  2VL2 A;  5CRD A;  4ZBB A;  3D4M A;  1GRX A;  2VLV A;  2DML A;  1PA3 A;  2VUP A;  3M3M A;  3TJF A;  3ZYW A;  5KN1 A;  3F8U A;  2HYX A;  4J56 E;  2H8L A;  4BPY A;  1TKD B;  2GSS A;  2IPA A;  1SK0 A;  3UBK A;  1AQW A;  2OJL A;  3IXR A;  3U6V A;  1DBY A;  1UC7 A;  3UVH A;  4XRA A;  2DC5 A;  3GH9 A;  1TRV A;  1A8Y A;  4HQS A;  1Q4J A;  3MSZ A;  4Q5F A;  4GQF A;  3GUR A;  4O5R A;  4PTS A;  5GAP D;  2IIY A;  2PER A;  5ECN B;  2GDR A;  2C3N A;  1U3I A;  1YF0 A;  2YJ7 A;  4MDC A;  4WR5 A;  5B6M A;  1XWC A;  5D8I A;  1H4O A;  1VF3 A;  1GLQ A;  2DKH A;  3MAK A;  4NWY A;  1EP8 A;  1GSY A;  5IPG A;  3F63 A;  3F4T A;  3TOT A;  2R3X A;  4H86 A;  1HQO A;  3HY2 A;  3LQ7 A;  1IYH A;  1EV9 A;  2OAC A;  3KMN A;  2CZ2 A;  4HZ2 A;  5H5Q A;  2MZC A;  3L9V A;  3CQF A;  3Q74 A;  1F9M A;  3EU3 A;  4N30 A;  4N0Z A;  3QAG A;  2LJR A;  3TKQ A;  2HRA A;  5FHI A;  4TKY A;  1EOH A;  3C1S A;  2XPE A;  3N5O A;  5EVO A;  4KSM A;  1BJX A;  1FOV A;  3VWV A;  4N0V A;  3LXT A;  2VO4 A;  5IMA A;  3FZ9 A;  3DVW A;  5L71 A;  5HR2 A;  3HZ8 A;  18GS A;  1RK4 A;  4TVE A;  2CQ9 A;  3ZZX A;  1YKC A;  4K6X A;  4MF6 A;  4L5O A;  5AIS A;  1FVK A;  2OAD A;  1HD2 A;  2C0G A;  1J08 A;  3ZRD A;  5IOX A;  2M80 A;  3EIN A;  3HJO A;  3DGQ A;  2XBI A;  3FRC A;  3VI7 A;  1JZW A;  4MH2 A;  2FA4 A;  3CSI A;  1ERW A;  4F0B A;  3GKK A;  4OWY A;  2OBI A;  4FO5 A;  4O7H A;  2IJY A;  2PN8 A;  2XC2 A;  3F0I A;  3KCM A;  1SL1 B;  3LG6 A;  3C71 A;  1K3L A;  5IO0 A;  1JHB A;  1WIK A;  3BJ5 A;  3P7X A;  3IK7 A;  3GTU A;  2V6K A;  4EIQ A;  2H1B A;  1YZX A;  4PUF C;  4NMU A;  2F9S A;  3HCZ A;  3UBL A;  1ML6 A;  1B9Y C;  1F3A A;  1WWJ A;  1SD9 A;  5G30 A;  3RHB A;  3EYT A;  2X8G A;  4JZQ A;  1IYI A;  2YJH A;  4TXO A;  3KTB A;  4K0G A;  3NZN A;  3FHK A;  4ECJ A;  5J9C A;  11GS A;  4DSQ A;  2LRT A;  22GS A;  3VWU A;  5ELG A;  2X4A A;  2FGX A;  1X0R A;  2KP2 A;  4GWR A;  3IA1 A;  3TCO A;  2FD3 A;  2NTO A;  4IVF A;  2H0H A;  13GS A;  3KJY A;  3M1G A;  2O87 A;  3GKM A;  4DVC A;  4EE0 A;  4MP4 A;  1G6W A;  5GSS A;  3LJR A;  2H1A A;  2WZ9 A;  3H93 A;  4JED A;  4G9H A;  2H71 A;  5G1K A;  3BCI A;  3HVX A;  4PUA A;  4ZB8 A;  5G5F A;  1OAZ A;  5IM9 A;  3R3E A;  2E7P A;  2MMZ A;  3RDW A;  2DIY A;  4IN0 A;  1SL2 B;  3J7Y k;  1A0R P;  4O5U A;  3HJM A;  4DSS A;  3ZRE A;  1TOF A;  2C80 A;  5AIV A;  2CX3 A;  10GS A;  2VCW A;  4HZ4 A;  7GSS A;  4O32 A;  2PUK C;  2YNX A;  2GZY A;  4MH3 A;  1XWG A;  4HUA A;  1X5D A;  2DBC A;  4K5S A;  5IMD A;  4OD7 A;  1G0T A;  4ECI A;  1BYE A;  1UVZ A;  1GTU A;  3A5I A;  4MF5 A;  2DJ1 A;  2JAD A;  2QA2 A;  2R0P A;  3TKP A;  2REM A;  2VD1 A;  2LNS A;  4ML6 A;  5IMV A;  2HE3 A;  4ULX A;  3GN3 A;  3IRA A;  2OA7 A;  1THX A;  2GLR A;  4TR1 B;  2A2R A;  2A2P A;  5G1L A;  4K9Z A;  2RUE A;  3ISO A;  4QL7 A;  1X9S B;  2NVL A;  2H6Y A;  2LJK A;  2RUF A;  4XIH A;  4BIK A;  1Z7P A;  2V32 A;  3MNG A;  2B1L A;  1ERT A;  2YN1 A;  2YPM A;  2WRT A;  1XW6 A;  1ACV A;  2P5Q A;  3LW9 A;  3L9U A;  4RQR A;  4GXZ A;  4HJM A;  4F82 A;  1G7O A;  3RPN A;  4G0I A;  5DVB A;  3A3T A;  3ZVJ D;  5DDL A;  2CVK A;  6GSW A;  1QMV A;  1M2D A;  2V1M A;  5FWG A;  5F8B A;  3HD5 A;  4RI6 A;  2KHP A;  3ERF A;  2GQL A;  1YKA A;  2XBQ A;  2E0Q A;  5E59 A;  2UZ8 A;  4MJA A;  4Q5N A;  2IN3 A;  3G7J A;  5HFK A;  2C0E A;  3IPZ A;  1PL2 A;  1ERV A;  5D93 A;  2O8V B;  5JCU A;  1TI1 A;  2N5F A;  3VWW A;  4N11 A;  1U3A A;  1YY7 A;  2C0F A;  2GZZ A;  5D9X A;  2RM6 A;  2GT5 A;  5CRG A;  4KSO A;  2GQM A;  1Z9H A;  3D5J A;  3U5R E;  16GS A;  3TRX A;  2LQO A;  2IWT A;  1VF4 A;  3HVV A;  5DAL B;  1TI3 A;  2L6D A;  1GSD A;  4L0U A;  3KXO A;  2WCI A;  4Q5Q A;  2I9H A;  2IFQ B;  3FR9 A;  4BVX A;  4KCA A;  1JLW A;  3ZVJ A;  1C72 A;  1XFL A;  3HVS A;  4PX1 A;  2K8S A;  4O5Q A;  1GH2 A;  3LSZ A;  4JR6 A;  2VD0 A;  4PQ1 A;  3M8N A;  3HVN A; 
#chains in the Genus database with same CATH homology
 1A2M A;  3WGD A;  1KEB A;  2HRK A;  2DMM A;  3FZ4 A;  2VCZ A;  1J9B A;  4OCF A;  1TU7 A;  1ZL9 A;  4MJE A;  5A4V A;  2IMI A;  5E4W A;  3LFL A;  1SKW B;  4A5P A;  3IAS 2;  4HU7 A;  4BVY B;  1WMJ A;  2R0G A;  2WJU A;  1FHE A;  5J41 A;  1H75 A;  4GCI A;  1V9W A;  3HHV A;  1O7U A;  1K3Y A;  1GSQ A;  1BQ7 A;  5HR0 A;  3IBH A;  4BA7 A;  1XBS A;  5HR1 A;  4ACS A;  2TRX A;  1ZCP A;  1T7P B;  5DBQ A;  1MEK A;  1OYJ A;  2C8U A;  3EMX A;  4WXT A;  3D0Z A;  4J2F A;  4PGT A;  4BL7 A;  4CDO A;  4POL A;  3TRQ A;  2AJQ B;  1ABA A;  4XS6 A;  1JZO A;  2VCT A;  1QK8 A;  1F37 A;  4V2N A;  3ME8 A;  2VM1 A;  4ZL7 A;  5GST A;  1YJ6 A;  4MJB A;  2EIR A;  2VIM A;  5H5S A;  1MDJ A;  1TRU A;  3SBC A;  3QOU A;  1S3A A;  1EEJ A;  5ECM B;  1Q98 A;  4YQV A;  3L4N A;  4MJC A;  5ID2 B;  2HZE B;  5KOX A;  2L4C A;  4LMV A;  1RW1 A;  3ZFL A;  1HNA A;  1K3O A;  5IMC A;  2R2J A;  1A0F A;  4I2T A;  3FR3 A;  1AQX A;  3KP8 A;  3KMO A;  1PD2 1;  2C3T A;  2DLX A;  2DSA A;  3O3T A;  5DQS A;  3L0H A;  4KCE A;  3K8N A;  2A2S A;  3TB2 A;  2A4V A;  4PNG A;  4K5R A;  5H5R A;  1VGL A;  5DAK B;  1ZYN A;  3UOM A;  5DJM A;  3H8Q A;  2IME A;  1FVJ A;  2P5R A;  1PX7 A;  1ZMA A;  2WUL A;  4RQX A;  1V2A A;  3IHQ A;  3IC8 A;  4LA1 A;  1SKS B;  3P8W A;  1PQN A;  3TJG A;  4GLT A;  4POM A;  4D73 A;  4FYB A;  2CA8 A;  2F3M A;  5D9T A;  1NHY A;  1K0C A;  4WBJ A;  3APO A;  1YF1 A;  1TW9 A;  2VL2 C;  3QD9 A;  2O7K A;  4K2X A;  4ML1 A;  5ECP B;  1Y25 A;  3QDN A;  3QAV A;  3TGZ A;  1TTZ A;  2F8A A;  2DJJ A;  4ZB9 A;  4WKW A;  4NAX A;  2EIO A;  3G7I A;  3ZIV A;  1R5A A;  1B4Q A;  4CW9 A;  3CSJ A;  1I9D A;  1ZGN A;  4O92 A;  3FKF A;  1WPI A;  2X8H A;  4EC0 A;  4K1F A;  2M72 A;  3H1N A;  3M0F A;  4HQZ A;  4EO3 A;  3GKX A;  1FG4 A;  3ZML A;  1V58 A;  4KB3 A;  5ECK B;  2B3S A;  1MD3 A;  1SD8 A;  4MPG A;  3W6G A;  1S3C A;  3HZ4 A;  2L59 A;  4LLR A;  4N10 A;  3F9U A;  2B1K A;  4TR0 A;  4G0L A;  1OE7 A;  1XWK A;  3GSS A;  2XPD A;  2HSH A;  3HDC A;  5JWQ B;  4XS4 A;  4OFN A;  2CVD A;  2ON5 A;  2VLU A;  3CTG A;  1TK5 B;  4YH2 A;  4YAV A;  3KGK A;  3GX8 A;  1A24 A;  17GS A;  2WB9 A;  3PPU A;  4X4J A;  4IJ3 A;  1BG5 A;  4FIW A;  5HFG A;  3MWH A;  1GUL A;  5IOW A;  3GL3 A;  3O76 A;  5JCG A;  1SK2 A;  3IR4 A;  3ZL5 A;  3ERW A;  1KNG A;  2WS2 A;  1Z7R A;  3TDG A;  3DVX A;  3IDV A;  1HNB A;  3UEM A;  4TR1 A;  3I69 A;  2YZH A;  2L57 A;  1Z5Y E;  3SWL A;  3ZIJ A;  1F3B A;  2KP1 A;  1PRX A;  1XVQ A;  1XPV A;  2ES7 A;  4F0C A;  3GKN A;  4F03 A;  3R2Q A;  2YWI A;  1MTC A;  3N9J A;  4V1A p;  4WR4 A;  3LYK A;  3Q18 A;  4CY6 A;  4ISD A;  1ZYQ B;  4MK3 A;  1V98 A;  3F3Q A;  1GNE A;  4TR4 A;  1EOG A;  2VAF A;  4QQ7 A;  2PVO C;  3GMF A;  4KDU A;  3W8J A;  1GTA A;  1XWA A;  2LRC A;  9GSS A;  4NPB A;  1URM A;  2ALB A;  1XW5 A;  2LKU A;  5F06 A;  2G0F A;  4ZL8 A;  3GV1 A;  3F4R A;  3G9B A;  3VLN A;  2H30 A;  2P0G A;  1EV4 A;  3GHA A;  3L78 A;  3GFK A;  1GL8 A;  1OVN A;  4MF7 A;  2D2Z A;  3HJP A;  2YV7 A;  5DCH A;  2TIR A;  2JL4 A;  3CYN A;  2GGT A;  4OFM A;  1LU4 A;  2YP6 A;  1O81 A;  4ZIL A;  4YKG A;  2H76 A;  4GSN A;  2LST A;  2HXK A;  1BAY A;  4AJ6 A;  2YWM A;  3VK9 A;  4KA0 A;  4EVM A;  2RLI A;  3WT2 A;  4G10 A;  1M9B A;  2K18 A;  1OC9 B;  1BX9 A;  3TJB A;  1ST9 A;  2R5G A;  2H01 A;  4X0X A;  2VOC A;  4I2U A;  3NIV A;  4IP1 A;  5JCW A;  2MBS A;  1Z6M A;  3ERG A;  2H73 A;  1WRY A;  1GUH A;  1NM3 A;  5ECO B;  3EWL A;  4NXI A;  1V40 A;  2GQK A;  2L5O A;  2J23 A;  2B7K A;  1OE8 A;  3GX0 A;  4CY8 A;  2LNT A;  1UA5 A;  3C73 A;  3US3 A;  3W8S A;  2LTK A;  2K8V A;  3TOU A;  4BWS A;  1M2B A;  4ZL9 A;  1X9M B;  1HYU A;  3C7M A;  1THO A;  1R26 A;  3QAW A;  4KDX A;  4EDY A;  2OE3 A;  5AIX A;  4CHS A;  5BMU A;  5G2Z A;  2HZF A;  4AJ7 A;  4GTU A;  2PPT A;  4ZIJ A;  5JWO B;  1RQM A;  1GNW A;  5CNW A;  2O89 A;  2J9H A;  1T1V A;  4L8E A;  2O85 A;  2WGR A;  1O8X A;  1AQV A;  3M9J A;  2L4Q A;  2VCV A;  4MZW A;  4EUY A;  2QGV A;  5DJL A;  3PR8 A;  2E2M A;  2B5Y A;  4TR3 A;  2FLS A;  5C00 A;  2HSM A;  4IGJ A;  1WOU A;  1S3D A;  4POB A;  1ON4 A;  1ZYP A;  3EMP A;  4K0N A;  1NSW A;  3E0U A;  1DUG A;  1EGR A;  3EC3 A;  1TK0 B;  3UAP A;  3Q19 A;  6GSU A;  3TRP A;  3Q6O A;  2RII A;  3TKR A;  2AUV A;  1Y6E A;  3WGX A;  4V2L A;  3IC4 A;  4KX4 A;  3I43 A;  3OR5 A;  2CZ3 A;  5COH A;  3GTU B;  3BBY A;  4WF5 A;  1SKR B;  4KGI A;  1R5P A;  5DAK A;  1R4W A;  4NV2 A;  5D73 A;  1PSQ A;  3UJ1 A;  1SJI A;  5B6N A;  2AHE A;  4G0K A;  2N5B A;  3GUS A;  2DIZ A;  2VCQ A;  1XW9 A;  2MYG A;  1OKD A;  4MLY A;  1A23 A;  4F2I A;  4TXO B;  4P3Y B;  4GF0 A;  4JBB A;  1O8W A;  3PGT A;  4L0W A;  3LYP A;  2C3Q A;  1T8E B;  1M99 A;  4J57 E;  4TOP A;  2GSQ A;  4I6X A;  3C8E A;  1X5C A;  5IMZ A;  3RBT A;  2OE0 A;  5D96 A;  4AGS A;  4DSR A;  1TP9 A;  5B8A A;  2IMD A;  5ELA A;  3CRU A;  3EE2 A;  4KF9 A;  2KOK A;  4NV5 A;  4YAP A;  4X1U A;  4XS1 A;  1GUK A;  3RAZ A;  4IQ1 A;  1JZR A;  4JR4 A;  3A2X A;  1CQG A;  2F8F A;  4ZBD A;  2H0I A;  1QQ2 A;  2PMT A;  1SYR A;  3GA4 A;  3QFB C;  3FY7 A;  5ECQ B;  2H0G A;  2ON7 A;  1DE2 A;  1PKW A;  4NHZ A;  1X5E A;  3TJJ A;  1NW2 A;  3IK9 A;  1YDK A;  2C0D A;  1SYX A;  4IQA A;  8GSS A;  4IEL A;  4DSS B;  2PGT A;  4GST A;  3ZMK A;  2YV9 A;  4GRF A;  3NOF A;  2MMN A;  4XHM A;  2H6X A;  1X9W B;  1ZOF A;  1O6J A;  2HFD A;  1SK1 A;  2DKI A;  4KDY A;  2FWH A;  5D9W A;  1GWC A;  1GSU A;  3D21 A;  5A4U A;  4Z2T A;  1YEX A;  2L6C A;  3H79 A;  3AY8 A;  4I97 A;  5ECI B;  3DML A;  5ECS A;  5EY6 A;  2TRC P;  4I8B A;  4EDZ A;  4EF0 A;  1XVW A;  1O85 A;  5CP1 A;  3KM6 A;  1AIU A;  5LCZ A;  1AC1 A;  4Z2U A;  2V6O A;  5JWR B;  1FW1 A;  3QCP A;  1TU8 A;  2KUC A;  2FWF A;  2FY6 A;  2FWG A;  4X43 A;  3TKS C;  3GST A;  3CRT A;  4HDE A;  2MMO A;  2VLT A;  5IQY A;  2G2Q A;  1GLP A;  2N5A A;  3FZ5 A;  4MAB A;  5IMF A;  4OFT A;  3EVI A;  1J0F A;  2WFC A;  3QR6 A;  1GSF A;  4FYU A;  4K8M A;  4IP6 A;  3RPP A;  4ECC A;  1SJ6 A;  4TN8 A;  1O73 A;  3DKS A;  1JLV A;  5B7C A;  3FR6 A;  5IO2 A;  3GH6 A;  1EP7 A;  4LL1 B;  1Z3E A;  1B9X C;  3GNJ A;  1R7H A;  2R37 A;  3JCM L;  1WE0 A;  2B6M A;  1K0M A;  3FMW A;  2NBS A;  3FEU A;  1CQH A;  1GSS A;  4OCE A;  5EL8 A;  4Q5R A;  2C1Y A;  2FCH A;  5IIZ A;  2H75 A;  3APQ A;  3V1W A;  1KBN A;  5C04 A;  1B48 A;  5EPF A;  2JAC A;  4LL4 B;  2VL3 A;  3KZQ A;  2JZS A;  3M9K A;  2LRN A;  3EUR A;  2AV4 A;  4G2E A;  1G7E A;  1SEN A;  1ZZY A;  3A2V A;  4MCU A;  3WD6 A;  3UL3 A;  1ERU A;  3BCK A;  2R0C A;  4K7O A;  5J9B A;  2V2G A;  4WEY A;  1T4Y A;  5CRH A;  4XCS A;  4RI7 A;  4FQU A;  3WYW A;  3IAM 2;  4BVX B;  6GSY A;  1TJD A;  3CTF A;  4MMM A;  1A2L A;  1QFN A;  1G6Y A;  3RHC A;  1XIY A;  2GSR A;  1T4Z A;  2NDO A;  1M7T A;  1OC9 A;  2MMA A;  2HI7 A;  3IHG A;  5F0G A;  4HEA 2;  4E8E A;  2YCD A;  2A4H A;  3IV4 A;  5ECH B;  1PGT A;  4JRR A;  3F4S A;  1GTB A;  3DRN A;  4JE1 A;  2QC7 A;  4V2M A;  5G5E A;  3HKR A;  3F6F A;  1XCC A;  1T00 A;  2RM5 A;  3HA9 A;  1EWX A;  4MA9 A;  1GP1 A;  1F6M C;  3PH9 A;  2AAW A;  4MZC A;  2QKE A;  3FK8 A;  4ICY A;  1WJK A;  1U6T A;  3KH7 A;  3APS A;  2YAN A;  2HNL A;  1WP0 A;  2WDU A;  3BOA A;  2FA8 A;  1LJR A;  2CT6 A;  3VUR A;  2DJ2 A;  2H19 A;  1W4V A;  4DEJ A;  1QUW A;  4L5L A;  1PN0 A;  4OO5 A;  4XRD A;  3H4K A;  4E8H A;  1YEP A;  1F2E A;  1VRS D;  3WT1 A;  1FB0 A;  3IOS A;  5G31 A;  4BL7 B;  4PUR A;  4QL9 A;  5KN0 A;  2R4V A;  2QA1 A;  4HU9 A;  3ZIT A;  1DSB A;  4Z2R A;  2L5L A;  2JSZ A;  2HSY A;  2B7J A;  5HR3 A;  3MDK A;  1SU9 A;  2K6V A;  4YQM A;  4RUV A;  2I3Y A;  4ECB A;  3DEX A;  5INY A;  3J7Y b;  3C1R A;  1M0U A;  3IE3 A;  4HJ2 A;  4ILF A;  1AXD A;  5LNK e;  2GST A;  3CSH A;  2H1D A;  5CRW A;  2LEG A;  1GUM A;  5B8B A;  4KE3 A;  3O6T A;  1OKT A;  4PQI A;  2EC4 A;  1QXH A;  1EEM A;  1DE1 A;  2YWO A;  1OC8 A;  4FH8 A;  2QSI A;  2I4A A;  2LQQ A;  3E3E A;  2CAQ A;  4YQU A;  3VWX A;  4WET A;  1N8J A;  3KD0 A;  3FW2 A;  1K0O A;  4IHU A;  2X64 A;  1PN9 A;  1M9A A;  6GSV A;  5ABR A;  2H6Z A;  2X99 A;  2OE1 A;  2FNO A;  4TW5 A;  2EIQ A;  4PQH A;  3P2A A;  4WBR D;  1W89 A;  2GTU A;  3D6I A;  5F05 A;  5ENU A;  3VPT A;  4D73 B;  3GRX A;  4HS1 A;  3S9F A;  2AB6 A;  2HRN A;  2BTO T;  4F9Z A;  2MBT A;  4IKH A;  1AAZ A;  5IPH A;  5CO3 A;  5FT3 A;  5DAL A;  1K0A A;  1MDI A;  3QMX A;  1SJZ A;  3D22 A;  1FAA A;  3KH9 A;  2I81 A;  2H66 A;  3HXS A;  4YKF A;  4IBP A;  2IFQ A;  3LXZ A;  2X8C A;  4TXV A;  3P90 A;  5HFI A;  4WF4 A;  5CAX A;  4USS A;  3KEB A;  3ME7 A;  2LUS A;  3DXB A;  3DYR A;  2PBJ A;  5GAN D;  2F51 A;  5CRE A;  4KAE A;  1GSE A;  1PMT A;  3ED3 A;  3UIW A;  3TUE A;  2YZU A;  2LV3 A;  1XOA A;  4EXJ A;  4XTS A;  4GQC A;  3VI5 A;  3UVT A;  4POK A;  3HYP A;  3ZTL A;  2PU9 C;  2I1U A;  2KLX A;  2PWJ A;  5KN2 A;  1I5G A;  3LEF A;  4BVY A;  2C4J A;  5GZZ B;  4K2D A;  2GT6 A;  4XS4 B;  2VL9 A;  2DJK A;  3UMA A;  1PKZ A;  3ZFB A;  4EKZ A;  4KH7 A;  3TJK A;  1E2Y A;  4OMV A;  4EIP A;  3LOR A;  2B5X A;  2VCX A;  4ZBA A;  2OKA A;  1A2J A;  4BWQ A;  1MDK A;  3TKS E;  3VPQ A;  6GST A;  3DD3 A;  1BED A;  5J4U A;  1T3B A;  1EZK A;  5AGY A;  3I9V 2;  5AN1 A;  14GS A;  1V57 A;  4EL1 A;  3BD2 A;  1B4P A;  1FO5 A;  3GYK A;  2XHF A;  2Z9S A;  1NHO A;  5KN3 A;  3KTL A;  2FHE A;  4AF2 A;  1ZYE A;  2CV4 A;  4V1A g;  2FUG 2;  4IJI A;  4FYC A;  3GIX A;  3DWV A;  4K7N A;  3F6D A;  1K0N A;  2H1G A;  2H72 A;  2GVP A;  5ID2 A;  2HZE A;  3LGC A;  2HRF A;  5CYY A;  5DQY A;  4ZXG A;  5KOW A;  3G7Y A;  2CAI A;  5ECR B;  20GS A;  1LBK A;  1PL1 A;  1VF1 A;  2IMK A;  3EU4 A;  5HQP A;  3F3R A;  2YWN A;  1HNC A;  2LS5 A;  4MNN A;  1QGV A;  1U87 A;  4KW6 A;  1EGO A;  2LJA A;  1M2A A;  1XXU A;  4G19 A;  1K0D A;  2K9F A;  2CX4 A;  1SL0 B;  1FB6 A;  5ECL B;  3GL5 A;  3ZLP A;  3A2W A;  3MYD A;  4I5Q A;  19GS A;  4PXO A;  4HOJ A;  2BJX A;  2YOI A;  2BMX A;  2DJ0 A;  2OBK A;  2X49 A;  4IS0 A;  1TK8 B;  1JFU A;  3A5W A;  1USB A;  1TXX A;  1TDI A;  2FWE A;  2NPB A;  4PNF A;  1YQ1 A;  3DIE A;  2H74 A;  3EPT A;  3D4T A;  1TRS A;  2ZUP A;  2ZCT A;  2VM2 A;  5LD0 A;  5DCG A;  2ZNM A;  3MIX A;  1Z6N A;  3KIJ A;  4KUN A;  1U88 A;  4TRX A;  4OO4 A;  4LMW A;  2R6K A;  1AW9 A;  5J5N A;  5F07 A;  4KND A;  3QFA C;  1XZO A;  2IMF A;  3I6A A;  3CBU A;  6GSX A;  3CXG A;  4MZB A;  5BRT A;  3WGE A;  2GZP A;  2IL3 A;  1PX6 A;  3TKS A;  1XOB A;  2HT9 A;  2JZR A;  4ID0 A;  3KP9 A;  12GS A;  2B5E A;  3FZA A;  1E6B A;  1OC3 A;  2P31 A;  4ZB6 A;  1MD4 A;  3CMI A;  2JSY A;  5KEJ A;  3QPM A;  1FOH A;  2E2G A;  2V41 A;  5J3R A;  3FYG A;  2CVB A;  2HLS A;  1K0B A;  1VF2 A;  1B8X A;  4Z7X A;  4JU5 A;  4K7I A;  5D9V A;  1A8L A;  4IW9 A;  2GS3 A;  2AYT A;  4NHW A;  3E9J B;  1KTE A;  4GSS A;  3PIN A;  1UN2 A;  1AUC A;  3LWA A;  1TRW A;  6GSS A;  2M46 A;  5A4W A;  4MPF A;  3VFI A;  1N2A A;  2JZT A;  2JU5 A;  1ILO A;  1JZD A;  1GTI A;  2DJ3 A;  3UAR A;  1XWB A;  4AJ8 A;  2PVQ A;  5A5K A;  2H70 A;  4HI7 A;  3L9S A;  2VL2 A;  5CRD A;  4ZBB A;  3D4M A;  1GRX A;  2VLV A;  2DML A;  1PA3 A;  2VUP A;  3M3M A;  3TJF A;  3ZYW A;  5KN1 A;  3F8U A;  2HYX A;  4J56 E;  2H8L A;  4BPY A;  1TKD B;  2GSS A;  2IPA A;  1SK0 A;  3UBK A;  1AQW A;  2OJL A;  3IXR A;  3U6V A;  1DBY A;  1UC7 A;  3UVH A;  4XRA A;  2DC5 A;  3GH9 A;  1TRV A;  1A8Y A;  4HQS A;  1Q4J A;  3MSZ A;  4Q5F A;  4GQF A;  3GUR A;  4O5R A;  4PTS A;  5GAP D;  2IIY A;  2PER A;  5ECN B;  2GDR A;  2C3N A;  1U3I A;  1YF0 A;  2YJ7 A;  4MDC A;  4WR5 A;  5B6M A;  1XWC A;  5D8I A;  1H4O A;  1VF3 A;  1GLQ A;  2DKH A;  3MAK A;  4NWY A;  1EP8 A;  1GSY A;  5IPG A;  3F63 A;  3F4T A;  3TOT A;  2R3X A;  4H86 A;  1HQO A;  3HY2 A;  3LQ7 A;  1IYH A;  1EV9 A;  2OAC A;  3KMN A;  2CZ2 A;  4HZ2 A;  5H5Q A;  2MZC A;  3L9V A;  3Q74 A;  1F9M A;  3EU3 A;  4N30 A;  4N0Z A;  3QAG A;  2LJR A;  3TKQ A;  2HRA A;  5FHI A;  4TKY A;  1EOH A;  3C1S A;  2XPE A;  3N5O A;  5EVO A;  4KSM A;  1BJX A;  1FOV A;  3VWV A;  4N0V A;  3LXT A;  2VO4 A;  5IMA A;  3FZ9 A;  3DVW A;  5L71 A;  5HR2 A;  3HZ8 A;  18GS A;  1RK4 A;  4TVE A;  2CQ9 A;  3ZZX A;  1YKC A;  4K6X A;  4MF6 A;  4L5O A;  5AIS A;  1FVK A;  2OAD A;  1HD2 A;  2C0G A;  1J08 A;  3ZRD A;  5IOX A;  2M80 A;  3EIN A;  3HJO A;  3DGQ A;  2XBI A;  3FRC A;  3VI7 A;  1JZW A;  4MH2 A;  2FA4 A;  3CSI A;  1ERW A;  4F0B A;  3GKK A;  4OWY A;  2OBI A;  4FO5 A;  4O7H A;  2IJY A;  2PN8 A;  2XC2 A;  3F0I A;  3KCM A;  1SL1 B;  3LG6 A;  3C71 A;  1K3L A;  5IO0 A;  1JHB A;  1WIK A;  3BJ5 A;  3P7X A;  3IK7 A;  3GTU A;  2V6K A;  4EIQ A;  2H1B A;  1YZX A;  4PUF C;  4NMU A;  2F9S A;  3HCZ A;  3UBL A;  1ML6 A;  1B9Y C;  1F3A A;  1WWJ A;  1SD9 A;  5G30 A;  3RHB A;  3EYT A;  2X8G A;  4JZQ A;  1IYI A;  2YJH A;  4TXO A;  3KTB A;  4K0G A;  3NZN A;  3FHK A;  4ECJ A;  5J9C A;  11GS A;  4DSQ A;  2LRT A;  22GS A;  3VWU A;  5ELG A;  2X4A A;  2FGX A;  1X0R A;  2KP2 A;  4GWR A;  3IA1 A;  3TCO A;  2FD3 A;  2NTO A;  4IVF A;  2H0H A;  13GS A;  3KJY A;  3M1G A;  2O87 A;  3GKM A;  4DVC A;  4EE0 A;  4MP4 A;  1G6W A;  5GSS A;  3LJR A;  2H1A A;  2WZ9 A;  3H93 A;  4JED A;  4G9H A;  2H71 A;  5G1K A;  3BCI A;  3HVX A;  4PUA A;  4ZB8 A;  5G5F A;  1OAZ A;  5IM9 A;  3R3E A;  2E7P A;  2MMZ A;  3RDW A;  2DIY A;  4IN0 A;  1SL2 B;  3J7Y k;  1A0R P;  4O5U A;  3HJM A;  4DSS A;  3ZRE A;  1TOF A;  2C80 A;  5AIV A;  2CX3 A;  10GS A;  2VCW A;  4HZ4 A;  7GSS A;  4O32 A;  2PUK C;  2YNX A;  2GZY A;  4MH3 A;  1XWG A;  4HUA A;  1X5D A;  2DBC A;  4K5S A;  5IMD A;  4OD7 A;  1G0T A;  4ECI A;  1BYE A;  1UVZ A;  1GTU A;  3A5I A;  4MF5 A;  2DJ1 A;  2JAD A;  2QA2 A;  2R0P A;  3TKP A;  2REM A;  2VD1 A;  2LNS A;  4ML6 A;  5IMV A;  2HE3 A;  4ULX A;  3GN3 A;  3IRA A;  2OA7 A;  1THX A;  2GLR A;  4TR1 B;  2A2R A;  2A2P A;  5G1L A;  4K9Z A;  2RUE A;  3ISO A;  4QL7 A;  1X9S B;  2NVL A;  2H6Y A;  2LJK A;  2RUF A;  4XIH A;  1Z7P A;  2V32 A;  3MNG A;  2B1L A;  1ERT A;  2YN1 A;  2YPM A;  2WRT A;  1XW6 A;  1ACV A;  2P5Q A;  3LW9 A;  3L9U A;  4RQR A;  4GXZ A;  4HJM A;  4F82 A;  1G7O A;  3RPN A;  4G0I A;  5DVB A;  3A3T A;  3ZVJ D;  5DDL A;  2CVK A;  6GSW A;  1QMV A;  1M2D A;  2V1M A;  5FWG A;  5F8B A;  3HD5 A;  4RI6 A;  2KHP A;  3ERF A;  2GQL A;  1YKA A;  2XBQ A;  2E0Q A;  5E59 A;  2UZ8 A;  4MJA A;  4Q5N A;  2IN3 A;  3G7J A;  5HFK A;  2C0E A;  3IPZ A;  1PL2 A;  1ERV A;  5D93 A;  2O8V B;  5JCU A;  1TI1 A;  2N5F A;  3VWW A;  4N11 A;  1U3A A;  1YY7 A;  2C0F A;  2GZZ A;  5D9X A;  2RM6 A;  2GT5 A;  5CRG A;  4KSO A;  2GQM A;  1Z9H A;  3D5J A;  3U5R E;  16GS A;  3TRX A;  2LQO A;  2IWT A;  1VF4 A;  3HVV A;  5DAL B;  1TI3 A;  2L6D A;  1GSD A;  4L0U A;  3KXO A;  2WCI A;  4Q5Q A;  2I9H A;  2IFQ B;  3FR9 A;  4BVX A;  4KCA A;  1JLW A;  3ZVJ A;  1C72 A;  1XFL A;  3HVS A;  4PX1 A;  2K8S A;  4O5Q A;  1GH2 A;  3LSZ A;  4JR6 A;  2VD0 A;  4PQ1 A;  3M8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...