1NHOA

Structural and functional characterization of a thioredoxin-like protein from methanobacterium thermoautotrophicum
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
85
structure length
85
Chain Sequence
MVVNIEVFTSPTCPYCPMAIEVVDEAKKEFGDKIDVEKIDIMVDREKAIEYGLMAVPAIAINGVVRFVGAPSREELFEAINDEME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Probable Thioredoxin
publication title Structural and Functional Characterization of a Thioredoxin-like Protein (Mt0807) from Methanobacterium thermoautotrophicum
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 13
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2002-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1nhoA00
5HR1A 5C00A 3U6VA 3HJMA 1X5CA 1A2LA 4ZILA 4L0UA 3BCIA 3PH9A 1HYUA 1K0NA 4N0ZA 1B4PA 5EY6A 2RLIA 2PMTA 3RPNA 1GL8A 1GULA 1GLPA 1DSBA 1MEKA 3FR6A 5DCHA 5E4WA 4CDOA 1WRYA 3ED3A 3WGDA 2EIRA 5FHIA 1UN2A 2JZTA 2FWFA 2LRCA 4IJIA 2FWHA 1BJXA 2H75A 1SYXA 2KP2A 3APSA 3KCMA 3EC3A 3LSZA 1SK0A 5IO0A 1MTCA 5AISA 5DQYA 2F8AA 2HT9A 1PD21 3CXGA 3D0ZA 4F9ZA 1GUMA 1X5EA 2FGXA 3ZITA 4TR3A 4KX4A 4FH8A 2VCWA 3LXZA 3CRUA 4TKYA 1YEPA 2I3YA 2REMA 1GSFA 2GSQA 2QGVA 1PN9A 3HD5A 3APQA 2FWGA 5H5QA 2KHPA 4TXOB 1ABAA 2RUEA 4G2EA 4HQSA 4L5LA 3S9FA 2L6CA 1O8WA 2GT5A 2JL4A 3C71A 4ZBAA 2QSIA 2GSTA 5FT3A 4HS1A 2F8FA 3G7YA 3PINA 3TCOA 4WBRD 3K8NA 5C04A 1T4YA 2B3SA 1R7HA 4CW9A 1XWKA 1Q4JA 3DGQA 2PPTA 4ISDA 4LMVA 4ZBDA 4Q5QA 5IPHA 2A4VA 2F9SA 5ID2B 2MMAA 4IW9A 3VWVA 4MH2A 1VF1A 4I2TA 3IOSA 1R26A 2FCHA 2B7KA 5CREA 3QAWA 1HNCA 2C3NA 3L4NA 3G9BA 2H6XA 4WF4A 2DMLA 4IGJA 3EMPA 2H0GA 6GSWA 4GQFA 4TOPA 5LNKe 5IO2A 3CSIA 1EWXA 12GSA 4PQHA 1K0AA 1K3OA 4Q5NA 5GZZB 3IAS2 3EE2A 1EEMA 3RDWA 1V58A 4KDUA 3D4TA 2XBQA 2GZYA 3GMFA 1TRUA 3UBLA 1ZGNA 5F05A 2C3TA 2CVKA 3BBYA 5ECNB 2E2GA 4ECIA 6GSUA 1G7EA 1M9BA 5ECQB 2P31A 3GTUA 2CZ2A 4MP4A 4YAPA 3ZVJD 1KNGA 1W89A 1EP7A 3LEFA 2XBIA 5ECLB 3G7IA 4IP6A 4OO5A 3LJRA 1AAZA 5F07A 3ZVJA 5LD0A 2IMDA 4EE0A 4V2LA 1NW2A 5AN1A 1YKCA 1GTAA 1GTIA 1HQOA 3BJ5A 2GSSA 1OE7A 2ON5A 3NZNA 4ECBA 3FKFA 3TRXA 5HQPA 4MH3A 4F2IA 4N11A 5J5NA 4GRFA 2FY6A 1PKZA 1Z3EA 1TDIA 1FG4A 2GZZA 1R5PA 5ECOB 2GSRA 4QL9A 2GZPA 3TJJA 3HY2A 1SENA 4KGIA 3LYPA 1V40A 1RQMA 1M2BA 3A3TA 3CBUA 3H1NA 5H5RA 4I97A 2K18A 2R37A 5B6NA 1ZOFA 1BYEA 1OC9A 4HJ2A 1F3BA 2LUSA 2R4VA 3LGCA 1ML6A 5CRGA 3P90A 1K0BA 1NM3A 2LEGA 4ID0A 3GKKA 16GSA 2YJHA 2HXKA 4OFNA 4O5RA 1Y25A 4K7NA 1YZXA 3P2AA 3TJFA 2IN3A 2MMNA 3ERFA 10GSA 4NV5A 3QDNA 3EMXA 4JZQA 4H86A 2PWJA 3GRXA 2DIZA 3OR5A 4F0BA 2WCIA 5ABRA 1QGVA 1Z6NA 4MZBA 1N2AA 1O7UA 5CRDA 2VL2C 1ZCPA 3VFIA 4OCFA 1XIYA 2OKAA 2C0GA 4ULXA 4P3YB 2A2SA 17GSA 3D22A 3M9JA 5ENUA 1XW6A 2IPAA 1GSDA 3APOA 2FD3A 2X8HA 2YNXA 4HUAA 1OYJA 3P7XA 2XPEA 1QK8A 1SD8A 1UVZA 4AGSA 3GH6A 3QPMA 5D93A 4F03A 2VCTA 3EYTA 5KN0A 6GSYA 5IQYA 2C80A 2FA4A 3HVSA 1KBNA 5CRWA 1M9AA 1PA3A 2CVBA 3JCML 1TK5B 1JLWA 5JCWA 2H72A 2M46A 2IMFA 3RHBA 3VURA 5LCZA 1X9MB 1X0RA 5IMAA 22GSA 5GAPD 1FVJA 1JZOA 2I9HA 2HFDA 2YJ7A 4PURA 3F0IA 1K0DA 4GF0A 2DJKA 5F06A 2CX4A 3IDVA 4LL4B 4MABA 1XCCA 3FZ4A 5ELGA 1IYIA 2HRNA 3GURA 1YDKA 3VWWA 4IQAA 2L5OA 4MJBA 1SL1B 1BG5A 2OJLA 2DJJA 2Z9SA 3EU4A 4JE1A 1ZL9A 5HR2A 1U3AA 1PGTA 2K6VA 1BAYA 5DBQA 2C1YA 1A24A 2MMOA 3GX0A 1OKTA 1F9MA 3TOUA 2LSTA 1THOA 4BVYA 2E7PA 5IM9A 3ZREA 1GTBA 5G30A 5J4UA 2FWEA 4HOJA 1GWCA 5G1KA 4KDYA 4NAXA 2FLSA 2L6DA 5D73A 5DJLA 5G5FA 4Q5FA 1JLVA 3VWXA 4ZXGA 4N10A 3WT2A 1OC8A 2PGTA 4PX1A 2H30A 3UVHA 2LKUA 4IS0A 1O8XA 2V41A 1EEJA 1ERTA 1Z5YE 1TU7A 4Z7XA 4KA0A 3F9UA 3UIWA 3GN3A 1B48A 1AUCA 9GSSA 3HJOA 4LA1A 2C4JA 2AJQB 1TI1A 2PBJA 5IMCA 4TXOA 5A5KA 1B8XA 2VL2A 1NHOA 5GSSA 5CNWA 4L8EA 3HZ8A 3HVXA 2F3MA 1NHYA 2VAFA 3ZMKA 1WWJA 2VD1A 2M80A 4FYUA 4AJ6A 4K6XA 1TOFA 4ZB8A 1WIKA 3KJYA 3HZ4A 4GSNA 3LYKA 4DSQA 4HQZA 3DMLA 3ZZXA 1PL1A 3L78A 4LMWA 2YOIA 2A2RA 2WRTA 1TTZA 4ECJA 2GVPA 3IR4A 4RQRA 3H93A 5KN3A 4WBJA 2GS3A 5JCGA 5CP1A 3GL3A 5ID2A 3TKSC 18GSA 3TOTA 1XZOA 4HDEA 3LQ7A 3KP9A 2OBIA 2H1AA 3IRAA 4I6XA 4AF2A 4MCUA 1GUKA 1S3AA 3D4MA 1VF3A 1YEXA 4NHZA 1V57A 2G0FA 4RI7A 4LLRA 4PNFA 1O81A 3M3MA 2IJYA 4MPFA 7GSSA 4G9HA 1QXHA 1TK8B 3L9VA 2VCVA 1GTUA 4DVCA 4RI6A 1VGLA 3LFLA 2YANA 3IC4A 4OCEA 1X9SB 5HR3A 4ML6A 3M0FA 4RQXA 1THXA 3MAKA 1BQ7A 2OADA 4OD7A 1XFLA 3ERWA 19GSA 5KEJA 5A4WA 1AC1A 3HCZA 2B1KA 3ZTLA 5B7CA 3VWUA 2H0IA 4EKZA 1ON4A 1FB0A 4YQVA 3HKRA 4ZL9A 3EVIA 3MDKA 3IV4A 1O85A 1ILOA 2I1UA 3VPQA 2V6KA 2K9FA 3GSSA 2WZ9A 2I4AA 2KOKA 4FYCA 2H6ZA 1K3YA 2PVQA 3TKRA 5D8IA 1DE1A 3HYPA 2CA8A 4JU5A 2WB9A 1XXUA 1O73A 3PR8A 2VCQA 1WPIA 1B9XC 4WEYA 1SJZA 2P0GA 4HJMA 3SBCA 1M2AA 3FHKA 1FHEA 5CAXA 5DAKA 2PERA 3N9JA 2H6YA 2LJKA 2MMZA 4MJCA 1F6MC 1EGOA 2HZEB 3O6TA 3GNJA 1V98A 2H8LA 5GSTA 3KD0A 4XRDA 3GL5A 5B8AA 3TKPA 3DYRA 1HD2A 2YZUA 4X0XA 2CVDA 3F4TA 3FK8A 3L0HA 1EGRA 1OAZA 2X8GA 2LRNA 4IBPA 1GSYA 4MJAA 5ECIB 3A2VA 1T00A 4HU9A 3UMAA 1SK1A 1LU4A 4WR5A 2H76A 3DEXA 2FHEA 3TKSA 4D73B 3F3RA 2DSAA 2N5FA 1U6TA 2HYXA 2AB6A 3D5JA 4E8HA 1IYHA 3Q19A 1JHBA 1SK2A 2PN8A 1XWAA 3UL3A 3F3QA 1XWCA 8GSSA 2DLXA 2MBSA 3DXBA 1PQNA 2HSHA 1U88A 4V2NA 4WXTA 2H19A 5E59A 5KN2A 4BWQA 1TRWA 2ALBA 2R5GA 4TR4A 3W8JA 2JU5A 1H4OA 3O3TA 4TRXA 3NOFA 4IELA 2VL3A 4YH2A 1AQWA 2YCDA 2OACA 4K9ZA 1T8EB 5JCUA 3NIVA 5J3RA 4EDYA 1YY7A 4QL7A 5F0GA 1B9YC 5EL8A 1USBA 5J9BA 2O87A 1XWBA 2C0DA 3KGKA 1XOBA 1G0TA 3CYNA 1TI3A 4I8BA 3DRNA 2IMIA 5DAKB 4ECCA 2X8CA 3FEUA 2RM6A 3GKXA 3Q18A 4IP1A 3IXRA 5IPGA 4FIWA 5D9VA 3FZ9A 3VI7A 4PXOA 2YPMA 1UA5A 4IKHA 4J57E 4TN8A 3ZYWA 4I2UA 3IA1A 5B8BA 4PUAA 4L0WA 2YV7A 2PUKC 3F6DA 5CYYA 4MZWA 2XPDA 2H0HA 3QD9A 4KW6A 4GWRA 2CAIA 3KMOA 1GP1A 3A2WA 1WJKA 5DALB 1Z7RA 1GNEA 3ZFBA 5IMZA 2HSYA 1YF1A 1DUGA 1EOGA 1XBSA 4MPGA 1OC3A 5IOXA 4KSOA 6GSSA 2ZUPA 5KN1A 3I43A 4MMMA 4IHUA 2HZFA 1FO5A 13GSA 4HI7A 2VM1A 3C1RA 3TRQA 3C73A 3WT1A 2LJRA 2E2MA 2GT6A 4ZB9A 1A8YA 1TU8A 4O7HA 4YAVA 2C3QA 1FVKA 3VPTA 2LJAA 6GSVA 3WYWA 2YP6A 5AIVA 4POKA 2FA8A 1DE2A 1YJ6A 2FNOA 5DVBA 3GIXA 1JFUA 2L5LA 1WE0A 2VD0A 3FR9A 1JZRA 2GQLA 2IFQB 4DSRA 2YN1A 2L4QA 2H1BA 5EVOA 4GSTA 3KH9A 1ERUA 3ZRDA 4NHWA 1RW1A 2DJ3A 4ZIJA 3TRPA 4XS4B 1ACVA 4G19A 5DJMA 1Q98A 3GUSA 1R4WA 4GTUA 1WMJA 2R2JA 5ECRB 4J56E 2B5YA 4KE3A 4POMA 5GAND 3HDCA 4EDZA 4FO5A 1PSQA 4PQ1A 3DD3A 4KAEA 1ZZYA 3FY7A 4OFTA 1U87A 3KTLA 3TJBA 4PQIA 1EV4A 1Z6MA 4IN0A 5COHA 1M2DA 3LG6A 5CO3A 3QR6A 2IWTA 2KP1A 3RBTA 2G2QA 4ZBBA 1WOUA 1KEBA 4PUFC 3UAPA 3F8UA 4OMVA 3LORA 3WGXA 5G2ZA 1X5DA 4GXZA 3N5OA 5ELAA 4KCEA 2DC5A 4OO4A 5ECMB 4BVXA 1URMA 2HE3A 2ZCTA 4ZL7A 1K0CA 4GLTA 3KTBA 2CV4A 3VK9A 1MDJA 2L4CA 1PX7A 5IMVA 2E0QA 4XCSA 2JACA 1TW9A 5ECSA 5IMFA 1GSUA 1A0FA 4POLA 3D6IA 2BTOT 5H5SA 3EU3A 3I9V2 2L59A 2OA7A 4XS6A 4V1Ag 14GSA 3RAZA 3ISOA 2WGRA 4ZB6A 2ON7A 3Q74A 3TB2A 1TP9A 3TJGA 5HFGA 2RIIA 3TUEA 1WP0A 2N5AA 3QFAC 3UBKA 3J7Yb 4KB3A 1YQ1A 2VCXA 4YQMA 4ACSA 3CRTA 1TRSA 2B5XA 1BEDA 3GKNA 3MSZA 1TJDA 1TRVA 3CTFA 1EV9A 1K0MA 1XVQA 4CHSA 4E8EA 3BOAA 1M0UA 5G5EA 3L9UA 4V2MA 5HFIA 3HA9A 4K8MA 1HNBA 5JWQB 2YWIA 1GSQA 3E9JB 1KTEA 5J9CA 3KZQA 2H70A 5J41A 5B6MA 2VIMA 2VLTA 5HFKA 4WR4A 2LQQA 6GSXA 2NTOA 2VM2A 4MF7A 2P5RA 3TKQA 2JADA 3FZAA 1OE8A 2OBKA 1SL0B 2AV4A 2HZEA 11GSA 4BA7A 4L5OA 3GV1A 3US3A 1BX9A 4TVEA 3TJKA 4MF6A 2B1LA 2IIYA 3QAGA 2GLRA 1K3LA 1ERVA 2NPBA 3F6FA 1JZWA 4GQCA 3R2QA 2VL9A 3M8NA 1SU9A 4F0CA 2PVOC 1T7PB 2C8UA 2OE0A 3CSJA 3F4RA 5L71A 2WFCA 4N0VA 1TK0B 1MD3A 3LWAA 3KIJA 2CZ3A 3HXSA 4D73A 4J2FA 2K8VA 1YKAA 4JRRA 3FYGA 3IK9A 2J9HA 4AJ7A 1S3CA 3GHAA 5JWOB 1E2YA 2NVLA 2K8SA 1I9DA 1R5AA 5DDLA 1XWGA 5AGYA 4DEJA 2TIRA 4NV2A 2LRTA 2NBSA 3W8SA 4EVMA 1ERWA 2AHEA 3HJPA 4XIHA 1MDKA 5JWRB 3CSHA 1XVWA 1VF4A 1PL2A 1GH2A 2DJ0A 2GQKA 3EURA 2LV3A 1A23A 4FYBA 4LL1B 5INYA 2HRFA 2R6KA 2V1MA 1TKDB 5FWGA 1TXXA 4XHMA 3MWHA 3KP8A 4TR1B 3UARA 2VCZA 1ST9A 4JR4A 4DSSB 1EZKA 2YWOA 1F2EA 1EOHA 2HI7A 2O7KA 3E3EA 3KH7A 5G31A 5ECPB 4KNDA 2WULA 3KXOA 2XC2A 1OKDA 2L57A 5A4UA 3C8EA 20GSA 1PRXA 1A2JA 2WJUA 4HZ4A 2B6MA 4OFMA 2LS5A 4KSMA 5DQSA 1T3BA 2VO4A 5DALA 1T1VA 3SWLA 2EC4A 1MDIA 1EP8A 3D21A 1H75A 3KEBA 3UJ1A 3CMIA 5IMDA 2D2ZA 1JZDA 4YQUA 4K2DA 1Z9HA 2V32A 3A2XA 2HNLA 4KH7A 3IE3A 3AY8A 1V9WA 2M72A 1FW1A 1GLQA 1AIUA 1T4ZA 1GNWA 5G1LA 4HU7A 3IHQA 2H1DA 5ECHB 2WDUA 3ZLPA 4F82A 2DBCA 3HHVA 4ZL8A 2X64A 3ZIJA 2AAWA 4KCAA 3FW2A 4OWYA 2H74A 2MYGA 2P5QA 3QCPA 1SJIA 2RUFA 3RHCA 1LBKA 2OE1A 1SL2B 2IMKA 2EIQA 1NSWA 2PU9C 3TDGA 3VLNA 3H79A 1G7OA 3BD2A 1HNAA 3J7Yk 2IFQA 2JSYA 2H66A 3FZ5A 4I5QA 4QQ7A 2JSZA 1GRXA 2JZSA 4XS4A 4GSSA 3M1GA 4NWYA 2DJ2A 4BPYA 4EXJA 3FR3A 1AXDA 3FRCA 4N30A 4O32A 5CRHA 3WGEA 1SJ6A 2FUG2 2C0EA 2X99A 3HVVA 3UVTA 1RK4A 3U5RE 4HZ2A 2WS2A 5EPFA 2VLVA 1ZYEA 4EO3A 3V1WA 2BJXA 3CTGA 3M9KA 1GSEA 2YV9A 3WD6A 1SD9A 3H8QA 4MLYA 1FOVA 3KMNA 4BWSA 2TRXA 2OE3A 4NXIA 4EF0A 3I6AA 2VLUA 3UEMA 4TR0A 3IPZA 2CT6A 1PX6A 2LTKA 4X43A 3TKSE 4MZCA 3IK7A 1AW9A 2CX3A 4IQ1A 3EINA 3LXTA 4XS1A 3I69A 4IJ3A 3ZL5A 2O8VB 2B5EA 2IMEA 3A5WA 2GGTA 1O6JA 1G6WA 1SKRB 2MZCA 2RM5A 4ILFA 1DBYA 1AQVA 5D96A 1V2AA 3QFBC 3E0UA 2VUPA 2B7JA 4WF5A 2ZNMA 3GFKA 2CQ9A 2KLXA 4K7IA 4GCIA 5D9TA 4EUYA 2I81A 3QAVA 3GTUB 4JR6A 3IAM2 3GA4A 3VI5A 3QMXA 4JEDA 2H73A 3P8WA 4TW5A 6GSTA 3GX8A 2V6OA 1OVNA 3GH9A 2XHFA 3ERGA 3DWVA 1B4QA 1QFNA 2V2GA 4MDCA 1XOAA 4RUVA 3C7MA 2LNTA 2YZHA 1ZMAA 1C72A 4XRAA 5A4VA 2LNSA 1X9WB 2O85A 1Y6EA 3Q6OA 3IBHA 2LQOA 2QC7A 4XTSA 2BMXA 3ZMLA 2ES7A 1XPVA 2MBTA 1F3AA 2GDRA 4MK3A 3F4SA 1GUHA 1PMTA 2QKEA 4MJEA 1XW5A 4NMUA 3ZFLA 1GSSA 4BL7A 4K7OA 1PKWA 2O89A 3ME8A 2C0FA 4K1FA 1YF0A 1SYRA 4MF5A 1LJRA 5IIZA 4K0GA 3F63A 1OC9B 3DVWA 2KUCA 3ME7A 4ML1A 3H4KA 3DVXA 1S3DA 3W6GA 1SKSB 2HLSA 4Q5RA 1J0FA 2H1GA 2VOCA 4V1Ap 4AJ8A 2TRCP 5AIXA 5HR0A 5D9XA 4HEA2 1QMVA 3KM6A 1M99A 4MA9A 1XW9A 1W4VA 5DCGA 2JZRA 2AYTA 5F8BA 1CQGA 4KDXA 4POBA 3RPPA 1FB6A 4KUNA 2GQMA 1M7TA 4K0NA 1ZYQB 3GSTA 1MD4A 2CAQA 4EL1A 1G6YA 5ECKB 3EWLA 1FAAA 3UOMA 2DIYA 1N8JA 3TGZA 4WETA 1A2MA 1I5GA 2R3XA 2EIOA 1A0RP 2N5BA 1A8LA 2YWMA 1E6BA 3QOUA 1K0OA 4X1UA 1QUWA 2H71A 3C1SA 3L9SA 2F51A 4IVFA 5IOWA 4O92A 4NPBA 2J23A 3DKSA 3ZIVA 2GTUA 1U3IA 3MNGA 2DJ1A 1VF2A 4JBBA 3GYKA 1J9BA 1QQ2A 2YWNA 2DMMA 4PNGA 4PGTA 2AUVA 1UC7A 4TR1A 4TXVA 3GKMA 4EC0A 3PGTA 1VRSD 3G7JA 1AQXA 1Z7PA 3O76A 1CQHA 4DSSA 3DIEA 1J08A 2H01A 4WKWA 1SKWB 5D9WA 2NDOA 2IL3A 3BCKA 4G10A 1F37A
chains in the Genus database with same CATH superfamily
5HR1A 5C00A 3U6VA 3HJMA 1X5CA 1A2LA 4ZILA 4L0UA 3BCIA 3PH9A 1HYUA 1K0NA 4N0ZA 1B4PA 5EY6A 2RLIA 2PMTA 3RPNA 1GL8A 1GULA 1GLPA 1DSBA 1MEKA 4USSA 3FR6A 5DCHA 5E4WA 4CDOA 1WRYA 3EPTA 4BVYB 3ED3A 3WGDA 2EIRA 5FHIA 1UN2A 2JZTA 2FWFA 2LRCA 4IJIA 2FWHA 1BJXA 2H75A 1SYXA 2KP2A 3APSA 3KCMA 3EC3A 3LSZA 1SK0A 5IO0A 1MTCA 5AISA 5DQYA 2F8AA 2HT9A 1PD21 3CXGA 3D0ZA 4F9ZA 1GUMA 1X5EA 2FGXA 3ZITA 4TR3A 4KX4A 4YKFA 4FH8A 2VCWA 3LXZA 3CRUA 4TKYA 1YEPA 2I3YA 2REMA 1GSFA 2GSQA 2QGVA 1PN9A 3HD5A 3APQA 2FWGA 5H5QA 2KHPA 4TXOB 4K5RA 1ABAA 2RUEA 4G2EA 4HQSA 4L5LA 3S9FA 2L6CA 1O8WA 4CY8A 2GT5A 2JL4A 4Z2UA 3C71A 4ZBAA 2QSIA 2GSTA 5FT3A 4HS1A 2F8FA 3G7YA 3PINA 3TCOA 4WBRD 3K8NA 5C04A 1T4YA 2B3SA 1R7HA 4CW9A 1XWKA 1Q4JA 3DGQA 2PPTA 4ISDA 4LMVA 4ZBDA 4Q5QA 5IPHA 2A4VA 2F9SA 5ID2B 2MMAA 4IW9A 4YKGA 3VWVA 4MH2A 1VF1A 4I2TA 3IOSA 1R26A 2FCHA 2B7KA 5CREA 3QAWA 3FMWA 1HNCA 2C3NA 3L4NA 3G9BA 2H6XA 4WF4A 2DMLA 4IGJA 3EMPA 2H0GA 6GSWA 4GQFA 4TOPA 5LNKe 5IO2A 3CSIA 4EIQA 1EWXA 12GSA 4PQHA 1K0AA 1K3OA 4Q5NA 5GZZB 3IAS2 3EE2A 1EEMA 3RDWA 1V58A 4KDUA 3D4TA 2XBQA 2GZYA 3GMFA 1TRUA 3UBLA 1ZGNA 5F05A 2C3TA 2CVKA 3BBYA 5ECNB 2E2GA 4ECIA 6GSUA 1G7EA 1M9BA 5ECQB 2P31A 4K2XA 3GTUA 2CZ2A 4MP4A 4YAPA 3ZVJD 1KNGA 1W89A 1EP7A 3LEFA 2XBIA 5ECLB 3G7IA 4IP6A 4OO5A 3LJRA 1AAZA 5F07A 3ZVJA 5LD0A 2IMDA 4EE0A 4V2LA 1NW2A 5AN1A 1YKCA 1GTAA 1GTIA 1HQOA 3BJ5A 2GSSA 1OE7A 2ON5A 3NZNA 4ECBA 3FKFA 3TRXA 5HQPA 5BRTA 4MH3A 4F2IA 4N11A 5J5NA 4GRFA 2FY6A 1PKZA 1Z3EA 3MYDA 1TDIA 1FG4A 2GZZA 1R5PA 5ECOB 2GSRA 4QL9A 2GZPA 3TJJA 3HY2A 1SENA 4KGIA 3LYPA 1V40A 1RQMA 1M2BA 3A3TA 3CBUA 3H1NA 5H5RA 4I97A 2K18A 2R37A 5B6NA 1ZOFA 1BYEA 1OC9A 4HJ2A 1F3BA 2LUSA 2R4VA 3LGCA 1ML6A 5CRGA 3P90A 1K0BA 1NM3A 2LEGA 4ID0A 3GKKA 16GSA 2YJHA 2HXKA 4OFNA 4O5RA 1Y25A 4K7NA 1YZXA 3P2AA 3TJFA 2IN3A 2MMNA 3ERFA 10GSA 2UZ8A 4NV5A 3QDNA 3EMXA 4JZQA 4H86A 2PWJA 3GRXA 2DIZA 3OR5A 4F0BA 2WCIA 5ABRA 1QGVA 1Z6NA 4MZBA 1N2AA 1O7UA 5CRDA 2VL2C 1ZCPA 3VFIA 4OCFA 1XIYA 2OKAA 4A5PA 2C0GA 4ULXA 4P3YB 2A2SA 17GSA 3D22A 3M9JA 3IHGA 5ENUA 1XW6A 2IPAA 2DKHA 1GSDA 3APOA 2FD3A 2X8HA 2YNXA 4HUAA 1OYJA 3P7XA 2XPEA 1QK8A 1SD8A 1UVZA 4AGSA 3GH6A 3QPMA 5D93A 4F03A 2VCTA 3EYTA 5KN0A 2QA1A 6GSYA 5IQYA 2C80A 2FA4A 3HVSA 1KBNA 5CRWA 1M9AA 1PA3A 2CVBA 3JCML 1TK5B 1JLWA 4O5UA 5JCWA 2H72A 2M46A 2IMFA 3RHBA 3VURA 5LCZA 1X9MB 1X0RA 5IMAA 22GSA 5GAPD 1FVJA 1JZOA 2I9HA 2HFDA 2YJ7A 4PURA 3F0IA 1K0DA 4GF0A 2DJKA 5F06A 2CX4A 3IDVA 4LL4B 4MABA 1XCCA 3FZ4A 5ELGA 1IYIA 2HRNA 3GURA 1YDKA 3VWWA 4IQAA 2L5OA 4MJBA 1SL1B 1BG5A 2OJLA 2DJJA 2Z9SA 3EU4A 4JE1A 1ZL9A 5HR2A 1U3AA 1PGTA 2K6VA 1BAYA 5DBQA 2C1YA 1A24A 2MMOA 3GX0A 1OKTA 1F9MA 3TOUA 2LSTA 1THOA 2A2PA 4BVYA 2E7PA 5IM9A 3ZREA 1GTBA 5G30A 5J4UA 2FWEA 4HOJA 1GWCA 5G1KA 4KDYA 4NAXA 2FLSA 2L6DA 5D73A 5DJLA 5G5FA 4Q5FA 1JLVA 3VWXA 4ZXGA 4N10A 3WT2A 1OC8A 2PGTA 4PX1A 2H30A 3UVHA 2LKUA 4IS0A 1O8XA 2V41A 1EEJA 1ERTA 1Z5YE 1TU7A 4Z7XA 4KA0A 3F9UA 3UIWA 3GN3A 1B48A 1ZYPA 1AUCA 9GSSA 3HJOA 4LA1A 2C4JA 2AJQB 1TI1A 2PBJA 5IMCA 4TXOA 5A5KA 1B8XA 2VL2A 1NHOA 5GSSA 5CNWA 4L8EA 3HZ8A 3HVXA 2F3MA 1NHYA 2VAFA 3ZMKA 1WWJA 2VD1A 2M80A 4FYUA 4AJ6A 4K6XA 1TOFA 4ZB8A 1WIKA 3KJYA 3HZ4A 4GSNA 3LYKA 2R0GA 4DSQA 4HQZA 4X4JA 3DMLA 3ZZXA 1PL1A 3L78A 4LMWA 2YOIA 2A2RA 2WRTA 1TTZA 4ECJA 2GVPA 3IR4A 4RQRA 3H93A 5KN3A 4WBJA 2GS3A 5JCGA 5CP1A 3GL3A 5ID2A 3TKSC 18GSA 3TOTA 3CQFA 1XZOA 4HDEA 3LQ7A 3KP9A 2OBIA 2H1AA 3IRAA 4I6XA 4AF2A 4MCUA 1GUKA 1S3AA 3D4MA 1VF3A 1YEXA 4MNNA 4NHZA 1V57A 2G0FA 4RI7A 4BVXB 4LLRA 4PNFA 1O81A 3M3MA 2IJYA 4MPFA 7GSSA 4G9HA 1QXHA 1TK8B 3L9VA 2VCVA 1GTUA 4DVCA 4RI6A 1VGLA 3LFLA 2YANA 3IC4A 4OCEA 1X9SB 5HR3A 4ML6A 3M0FA 4RQXA 1THXA 3MAKA 1BQ7A 2OADA 4OD7A 1XFLA 3ERWA 19GSA 5KEJA 5A4WA 1AC1A 3HCZA 2B1KA 3ZTLA 5B7CA 3VWUA 2H0IA 4EKZA 1ON4A 1FB0A 4YQVA 3HKRA 4ZL9A 3LW9A 3EVIA 3MDKA 3IV4A 1O85A 1ILOA 2I1UA 3VPQA 2V6KA 2K9FA 2HRKA 3GSSA 2WZ9A 2I4AA 2KOKA 4FYCA 2H6ZA 1K3YA 2PVQA 3TKRA 5D8IA 1DE1A 3HYPA 2CA8A 4JU5A 2WB9A 1XXUA 1O73A 3PR8A 2VCQA 1WPIA 1B9XC 4WEYA 2X49A 1SJZA 2P0GA 4HJMA 3SBCA 1M2AA 3FHKA 5KOXA 2QA2A 1FHEA 5CAXA 5DAKA 2PERA 3N9JA 2H6YA 2LJKA 2MMZA 4MJCA 1F6MC 1EGOA 2HZEB 3O6TA 3GNJA 1V98A 2H8LA 5GSTA 3KD0A 4XRDA 3GL5A 5B8AA 3TKPA 3DYRA 1HD2A 2YZUA 4X0XA 2CVDA 3F4TA 3FK8A 3L0HA 1EGRA 1OAZA 2X8GA 2LRNA 4IBPA 1GSYA 4MJAA 5ECIB 4BIKA 3A2VA 1T00A 4HU9A 3UMAA 1SK1A 1LU4A 4WR5A 2H76A 3DEXA 2FHEA 3TKSA 4D73B 3F3RA 2DSAA 2N5FA 1U6TA 2HYXA 2AB6A 3D5JA 4E8HA 1IYHA 3Q19A 1JHBA 1SK2A 2PN8A 1XWAA 3UL3A 3F3QA 1XWCA 8GSSA 2DLXA 2MBSA 3DXBA 1PQNA 2HSHA 4O5QA 1U88A 4V2NA 4WXTA 2H19A 5E59A 5KN2A 4BWQA 1TRWA 2ALBA 2R5GA 4TR4A 3W8JA 2JU5A 1H4OA 3O3TA 4TRXA 3NOFA 4IELA 2VL3A 4YH2A 1AQWA 2YCDA 2OACA 4K9ZA 1T8EB 5JCUA 3NIVA 5J3RA 4EDYA 1YY7A 4QL7A 5F0GA 1B9YC 5EL8A 1USBA 5J9BA 2O87A 1XWBA 2C0DA 3KGKA 1XOBA 1G0TA 3CYNA 1TI3A 4I8BA 3DRNA 4PTSA 2IMIA 5DAKB 4ECCA 2X8CA 3FEUA 2RM6A 3GKXA 3Q18A 4IP1A 3IXRA 5IPGA 4FIWA 5D9VA 3FZ9A 3VI7A 4PXOA 2YPMA 1UA5A 4IKHA 4J57E 4TN8A 3ZYWA 4I2UA 3IA1A 5B8BA 4PUAA 4L0WA 2YV7A 2PUKC 3F6DA 5CYYA 4MZWA 2XPDA 2H0HA 3QD9A 4KW6A 4GWRA 2CAIA 3KMOA 1GP1A 3A2WA 1WJKA 5DALB 1Z7RA 1GNEA 3ZFBA 5IMZA 2HSYA 1YF1A 1DUGA 1EOGA 1XBSA 4MPGA 1OC3A 5IOXA 4KSOA 6GSSA 2ZUPA 5KN1A 1FOHA 3I43A 4MMMA 4IHUA 2HZFA 1FO5A 13GSA 4HI7A 2VM1A 3C1RA 3TRQA 3C73A 3WT1A 2LJRA 2E2MA 2GT6A 4ZB9A 1A8YA 1TU8A 4O7HA 4YAVA 2C3QA 1FVKA 3VPTA 2LJAA 6GSVA 3WYWA 2YP6A 5AIVA 4POKA 2FA8A 4CY6A 1DE2A 1YJ6A 2FNOA 5DVBA 3GIXA 1JFUA 2L5LA 1WE0A 2VD0A 2X4AA 3FR9A 1JZRA 2GQLA 2IFQB 4DSRA 2YN1A 2L4QA 2H1BA 5EVOA 4GSTA 3KH9A 1ERUA 3ZRDA 4NHWA 1RW1A 2DJ3A 4ZIJA 3TRPA 4XS4B 1ACVA 4G19A 5DJMA 1Q98A 3GUSA 1R4WA 4GTUA 2R0PA 1WMJA 2R2JA 5ECRB 4J56E 2B5YA 4KE3A 4POMA 5GAND 3HDCA 4EDZA 4FO5A 1PSQA 4PQ1A 3DD3A 4KAEA 1ZZYA 3FY7A 4OFTA 1U87A 3KTLA 3TJBA 4PQIA 1EV4A 1Z6MA 4IN0A 5COHA 1M2DA 3LG6A 5CO3A 3QR6A 2IWTA 2KP1A 3RBTA 2G2QA 4ZBBA 1WOUA 1KEBA 4PUFC 3UAPA 3F8UA 4OMVA 3LORA 3WGXA 5G2ZA 1X5DA 4GXZA 3N5OA 1M3IA 1XG8A 5ELAA 4KCEA 2DC5A 4OO4A 5ECMB 4BVXA 1URMA 2HE3A 2ZCTA 4ZL7A 1K0CA 4GLTA 3KTBA 2CV4A 3VK9A 1MDJA 2L4CA 1PX7A 5IMVA 2E0QA 4HSCX 4XCSA 2JACA 1TW9A 5ECSA 5IMFA 1GSUA 1A0FA 4POLA 3D6IA 2BTOT 5H5SA 3EU3A 3I9V2 2L59A 2OA7A 4XS6A 4V1Ag 1PFOA 14GSA 3RAZA 3ISOA 2WGRA 4ZB6A 2ON7A 3Q74A 3TB2A 1TP9A 3TJGA 5HFGA 2RIIA 3TUEA 1WP0A 2N5AA 3QFAC 3UBKA 3J7Yb 4KB3A 1YQ1A 2VCXA 4YQMA 4ACSA 3CRTA 1TRSA 2B5XA 1BEDA 3GKNA 3MSZA 1TJDA 1TRVA 3CTFA 1EV9A 1K0MA 1XVQA 4CHSA 4E8EA 3BOAA 1M0UA 5G5EA 3L9UA 4V2MA 5HFIA 3HA9A 4K8MA 1HNBA 5JWQB 2YWIA 1GSQA 3E9JB 1KTEA 5J9CA 3KZQA 2H70A 5J41A 5B6MA 2VIMA 2VLTA 4BL7B 5HFKA 4WR4A 2LQQA 6GSXA 2NTOA 2VM2A 4MF7A 2P5RA 3TKQA 2JADA 3FZAA 1OE8A 5BMUA 2OBKA 1SL0B 2AV4A 2HZEA 11GSA 4BA7A 4L5OA 3GV1A 3US3A 1BX9A 4TVEA 3TJKA 4MF6A 2B1LA 2IIYA 3QAGA 2GLRA 1K3LA 1ERVA 2NPBA 3F6FA 1JZWA 4GQCA 3R2QA 2VL9A 3M8NA 1SU9A 4F0CA 2PVOC 1T7PB 2C8UA 2OE0A 3CSJA 3F4RA 5L71A 2WFCA 4N0VA 1TK0B 1MD3A 3LWAA 3KIJA 2CZ3A 3HXSA 4D73A 4J2FA 2K8VA 1YKAA 4JRRA 3FYGA 3IK9A 4KF9A 2J9HA 4AJ7A 1S3CA 3GHAA 5JWOB 1E2YA 2NVLA 2K8SA 1I9DA 1R5AA 5DDLA 1XWGA 5AGYA 4DEJA 2TIRA 4NV2A 2LRTA 2NBSA 3W8SA 4EVMA 1ERWA 2AHEA 3HJPA 4XIHA 1MDKA 5JWRB 4ICYA 3CSHA 1XVWA 1VF4A 1PL2A 1GH2A 2DJ0A 2GQKA 2HSMA 3EURA 2LV3A 1A23A 4FYBA 4LL1B 5INYA 2HRFA 2R6KA 2V1MA 1TKDB 1ZYNA 5FWGA 1TXXA 4XHMA 3MWHA 3KP8A 4TR1B 3UARA 2VCZA 1ST9A 4JR4A 4DSSB 1EZKA 2YWOA 1F2EA 1EOHA 4EIPA 2HI7A 2O7KA 3E3EA 3KH7A 5G31A 5ECPB 4KNDA 2WULA 3KXOA 2XC2A 1OKDA 2L57A 5A4UA 3C8EA 20GSA 1PRXA 1A2JA 2WJUA 4HZ4A 2A4HA 2B6MA 4OFMA 2LS5A 4KSMA 4G0LA 3R3EA 4G0KA 5DQSA 1T3BA 2VO4A 5DALA 1T1VA 3SWLA 2EC4A 1MDIA 1EP8A 3D21A 1H75A 3KEBA 3UJ1A 3CMIA 5IMDA 2D2ZA 1JZDA 4YQUA 4K2DA 1Z9HA 2V32A 3A2XA 2HNLA 4KH7A 3IE3A 3AY8A 1V9WA 2M72A 1FW1A 1GLQA 3PPUA 1AIUA 1T4ZA 3MIXA 1GNWA 5G1LA 4HU7A 3IHQA 2H1DA 5ECHB 2WDUA 3ZLPA 4F82A 2DBCA 3HHVA 4ZL8A 2X64A 3ZIJA 2AAWA 4KCAA 3FW2A 4OWYA 2H74A 1S3RA 2MYGA 2P5QA 3QCPA 1SJIA 2RUFA 3RHCA 1LBKA 2OE1A 1SL2B 2IMKA 2EIQA 1NSWA 2PU9C 3TDGA 3HVNA 3VLNA 3H79A 1G7OA 3BD2A 1HNAA 3J7Yk 2IFQA 2JSYA 2H66A 3FZ5A 4I5QA 4QQ7A 2JSZA 1GRXA 2JZSA 4XS4A 4FQUA 4GSSA 3M1GA 4NWYA 2DJ2A 4BPYA 4EXJA 3FR3A 1AXDA 3FRCA 4N30A 4O32A 5CRHA 3WGEA 1SJ6A 2FUG2 2C0EA 2X99A 3HVVA 3UVTA 1RK4A 3U5RE 4HZ2A 3A5IA 2WS2A 5EPFA 2VLVA 1ZYEA 4EO3A 3V1WA 2BJXA 3CTGA 3M9KA 1GSEA 2YV9A 3WD6A 1SD9A 3H8QA 4MLYA 1FOVA 3KMNA 4BWSA 2TRXA 2OE3A 4NXIA 4EF0A 3I6AA 2VLUA 3UEMA 4TR0A 3IPZA 2CT6A 1PX6A 2DKIA 2LTKA 4X43A 3TKSE 4MZCA 3IK7A 1AW9A 2CX3A 4IQ1A 3EINA 3LXTA 4XS1A 2R0CA 3I69A 4IJ3A 3ZL5A 2O8VB 2B5EA 2IMEA 3A5WA 2GGTA 1O6JA 1G6WA 1SKRB 2MZCA 2RM5A 4ILFA 1DBYA 1AQVA 5D96A 1V2AA 3QFBC 3E0UA 2VUPA 2B7JA 4WF5A 2ZNMA 3GFKA 2CQ9A 2KLXA 4K7IA 4GCIA 5D9TA 4EUYA 2I81A 3QAVA 3GTUB 4JR6A 3IAM2 3GA4A 3VI5A 3QMXA 4JEDA 2H73A 3P8WA 4TW5A 6GSTA 3GX8A 2V6OA 1OVNA 3GH9A 2XHFA 4Z2TA 3ERGA 3DWVA 1B4QA 1QFNA 2V2GA 4MDCA 1XOAA 4RUVA 3C7MA 2LNTA 2YZHA 1ZMAA 1C72A 4Z2RA 4XRAA 5A4VA 2LNSA 3IC8A 1X9WB 2O85A 1Y6EA 3Q6OA 3IBHA 2LQOA 2QC7A 4XTSA 2BMXA 3ZMLA 2ES7A 1XPVA 2MBTA 1F3AA 2GDRA 4MK3A 3F4SA 1GUHA 1PMTA 2QKEA 4MJEA 1XW5A 4NMUA 3ZFLA 1GSSA 4BL7A 4K7OA 1PKWA 2O89A 3ME8A 2C0FA 4K1FA 1YF0A 1SYRA 4MF5A 1LJRA 5IIZA 4K0GA 3F63A 1OC9B 3DVWA 2KUCA 3ME7A 4ML1A 3H4KA 3DVXA 1S3DA 2HRAA 3W6GA 1SKSB 2HLSA 4Q5RA 1J0FA 2H1GA 2VOCA 4V1Ap 4AJ8A 2TRCP 5AIXA 5HR0A 5D9XA 4HEA2 1QMVA 3KM6A 1M99A 4MA9A 1XW9A 1W4VA 5DCGA 2JZRA 2AYTA 5F8BA 1CQGA 4POBA 4KDXA 1M3JA 3RPPA 1FB6A 4KUNA 2GQMA 4G0IA 1M7TA 4K0NA 1ZYQB 3GSTA 1MD4A 2CAQA 4EL1A 1G6YA 5ECKB 3EWLA 1FAAA 3UOMA 2DIYA 4K5SA 1N8JA 3TGZA 4WETA 1A2MA 1I5GA 2R3XA 2EIOA 1A0RP 2N5BA 1A8LA 2YWMA 1E6BA 3QOUA 1K0OA 1PN0A 4X1UA 1QUWA 2H71A 3C1SA 3L9SA 2F51A 4IVFA 5IOWA 4O92A 4NPBA 2J23A 3DKSA 3ZIVA 2GTUA 1U3IA 3MNGA 2DJ1A 1VF2A 4JBBA 3GYKA 1J9BA 1QQ2A 2YWNA 2DMMA 4PNGA 4PGTA 2AUVA 1UC7A 4TR1A 4TXVA 3GKMA 4EC0A 3PGTA 1VRSD 3G7JA 1AQXA 1Z7PA 3O76A 1CQHA 4DSSA 3DIEA 1J08A 2H01A 4WKWA 1SKWB 5D9WA 2NDOA 5KOWA 2IL3A 3BCKA 4G10A 1F37A
chains in the Genus database with same CATH topology
5HR1A 5C00A 3U6VA 3HJMA 1X5CA 1A2LA 4ZILA 4L0UA 3BCIA 3PH9A 1HYUA 1K0NA 4N0ZA 1B4PA 5EY6A 2RLIA 2PMTA 3RPNA 1GL8A 1GULA 1GLPA 1DSBA 1MEKA 4USSA 3FR6A 5DCHA 5E4WA 4CDOA 1WRYA 3EPTA 4BVYB 3ED3A 3WGDA 2EIRA 5FHIA 1UN2A 2JZTA 2FWFA 2LRCA 4IJIA 2FWHA 1BJXA 2H75A 1SYXA 2KP2A 3APSA 3KCMA 3EC3A 3LSZA 1SK0A 5IO0A 1MTCA 5AISA 5DQYA 2F8AA 2HT9A 1PD21 3CXGA 3D0ZA 4F9ZA 1GUMA 1X5EA 2FGXA 3ZITA 4TR3A 4KX4A 4YKFA 4FH8A 2VCWA 3LXZA 3CRUA 4TKYA 1YEPA 2I3YA 2REMA 1GSFA 2GSQA 2QGVA 1PN9A 3HD5A 3APQA 2FWGA 5H5QA 2KHPA 4TXOB 4K5RA 1ABAA 2RUEA 4G2EA 4HQSA 4L5LA 3S9FA 2L6CA 1O8WA 4CY8A 2GT5A 2JL4A 4Z2UA 3C71A 4ZBAA 2QSIA 2GSTA 5FT3A 4HS1A 2F8FA 3G7YA 3PINA 3TCOA 4WBRD 3K8NA 5C04A 1T4YA 2B3SA 1R7HA 4CW9A 1XWKA 1Q4JA 3DGQA 2PPTA 4ISDA 4LMVA 4ZBDA 4Q5QA 5IPHA 2A4VA 2F9SA 5ID2B 2MMAA 4IW9A 4YKGA 3VWVA 4MH2A 1VF1A 4I2TA 3IOSA 1R26A 2FCHA 2B7KA 5CREA 3QAWA 3FMWA 1HNCA 2C3NA 3L4NA 3G9BA 2H6XA 4WF4A 2DMLA 4IGJA 3EMPA 2H0GA 6GSWA 4GQFA 4TOPA 5LNKe 5IO2A 3CSIA 4EIQA 1EWXA 12GSA 4PQHA 1K0AA 1K3OA 4Q5NA 5GZZB 3IAS2 3EE2A 1EEMA 3RDWA 1V58A 4KDUA 3D4TA 2XBQA 2GZYA 3GMFA 1TRUA 3UBLA 1ZGNA 5F05A 2C3TA 2CVKA 3BBYA 5ECNB 2E2GA 4ECIA 6GSUA 1G7EA 1M9BA 5ECQB 2P31A 4K2XA 3GTUA 2CZ2A 4MP4A 4YAPA 3ZVJD 1KNGA 1W89A 1EP7A 3LEFA 2XBIA 5ECLB 3G7IA 4IP6A 4OO5A 3LJRA 1AAZA 5F07A 3ZVJA 5LD0A 2IMDA 4EE0A 4V2LA 1NW2A 5AN1A 1YKCA 1GTAA 1GTIA 1HQOA 3BJ5A 2GSSA 1OE7A 2ON5A 3NZNA 4ECBA 3FKFA 3TRXA 5HQPA 5BRTA 4MH3A 4F2IA 4N11A 5J5NA 4GRFA 2FY6A 1PKZA 1Z3EA 3MYDA 1TDIA 1FG4A 2GZZA 1R5PA 5ECOB 2GSRA 4QL9A 2GZPA 3TJJA 3HY2A 1SENA 4KGIA 3LYPA 1V40A 1RQMA 1M2BA 3A3TA 3CBUA 3H1NA 5H5RA 4I97A 2K18A 2R37A 5B6NA 1ZOFA 1BYEA 1OC9A 4HJ2A 1F3BA 2LUSA 2R4VA 3LGCA 1ML6A 5CRGA 3P90A 1K0BA 1NM3A 2LEGA 4ID0A 3GKKA 16GSA 2YJHA 2HXKA 4OFNA 4O5RA 1Y25A 4K7NA 1YZXA 3P2AA 3TJFA 2IN3A 2MMNA 3ERFA 10GSA 2UZ8A 4NV5A 3QDNA 3EMXA 4JZQA 4H86A 2PWJA 3GRXA 2DIZA 3OR5A 4F0BA 2WCIA 5ABRA 1QGVA 1Z6NA 4MZBA 1N2AA 1O7UA 5CRDA 2VL2C 1ZCPA 3VFIA 4OCFA 1XIYA 2OKAA 4A5PA 2C0GA 4ULXA 4P3YB 2A2SA 17GSA 3D22A 3M9JA 3IHGA 5ENUA 1XW6A 2IPAA 2DKHA 1GSDA 3APOA 2FD3A 2X8HA 2YNXA 4HUAA 1OYJA 3P7XA 2XPEA 1QK8A 1SD8A 1UVZA 4AGSA 3GH6A 3QPMA 5D93A 4F03A 2VCTA 3EYTA 5KN0A 2QA1A 6GSYA 5IQYA 2C80A 2FA4A 3HVSA 1KBNA 5CRWA 1M9AA 1PA3A 2CVBA 3JCML 1TK5B 1JLWA 4O5UA 5JCWA 2H72A 2M46A 2IMFA 3RHBA 3VURA 5LCZA 1X9MB 1X0RA 5IMAA 22GSA 5GAPD 1FVJA 1JZOA 2I9HA 2HFDA 2YJ7A 4PURA 3F0IA 1K0DA 4GF0A 2DJKA 5F06A 2CX4A 3IDVA 4LL4B 4MABA 1XCCA 3FZ4A 5ELGA 1IYIA 2HRNA 3GURA 1YDKA 3VWWA 4IQAA 2L5OA 4MJBA 1SL1B 1BG5A 2OJLA 2DJJA 2Z9SA 3EU4A 4JE1A 1ZL9A 5HR2A 1U3AA 1PGTA 2K6VA 1BAYA 5DBQA 2C1YA 1A24A 2MMOA 3GX0A 1OKTA 1F9MA 3TOUA 2LSTA 1THOA 2A2PA 4BVYA 2E7PA 5IM9A 3ZREA 1GTBA 5G30A 5J4UA 2FWEA 4HOJA 1GWCA 5G1KA 4KDYA 4NAXA 2FLSA 2L6DA 5D73A 5DJLA 5G5FA 4Q5FA 1JLVA 3VWXA 4ZXGA 4N10A 3WT2A 1OC8A 2PGTA 4PX1A 2H30A 3UVHA 2LKUA 4IS0A 1O8XA 2V41A 1EEJA 1ERTA 1Z5YE 1TU7A 4Z7XA 4KA0A 3F9UA 3UIWA 3GN3A 1B48A 1ZYPA 1AUCA 9GSSA 3HJOA 4LA1A 2C4JA 2AJQB 1TI1A 2PBJA 5IMCA 4TXOA 5A5KA 1B8XA 2VL2A 1NHOA 5GSSA 5CNWA 4L8EA 3HZ8A 3HVXA 2F3MA 1NHYA 2VAFA 3ZMKA 1WWJA 2VD1A 2M80A 4FYUA 4AJ6A 4K6XA 1TOFA 4ZB8A 1WIKA 3KJYA 3HZ4A 4GSNA 3LYKA 2R0GA 4DSQA 4HQZA 4X4JA 3DMLA 3ZZXA 1PL1A 3L78A 4LMWA 2YOIA 2A2RA 2WRTA 1TTZA 4ECJA 2GVPA 3IR4A 4RQRA 3H93A 5KN3A 4WBJA 2GS3A 5JCGA 5CP1A 3GL3A 5ID2A 3TKSC 18GSA 3TOTA 1XZOA 4HDEA 3LQ7A 3KP9A 2OBIA 2H1AA 3IRAA 4I6XA 4AF2A 4MCUA 1GUKA 1S3AA 3D4MA 1VF3A 1YEXA 4MNNA 4NHZA 1V57A 2G0FA 4RI7A 4BVXB 4LLRA 4PNFA 1O81A 3M3MA 2IJYA 4MPFA 7GSSA 4G9HA 1QXHA 1TK8B 3L9VA 2VCVA 1GTUA 4DVCA 4RI6A 1VGLA 3LFLA 2YANA 3IC4A 4OCEA 1X9SB 5HR3A 4ML6A 3M0FA 4RQXA 1THXA 3MAKA 1BQ7A 2OADA 4OD7A 1XFLA 3ERWA 19GSA 5KEJA 5A4WA 1AC1A 3HCZA 2B1KA 3ZTLA 5B7CA 3VWUA 2H0IA 4EKZA 1ON4A 1FB0A 4YQVA 3HKRA 4ZL9A 3LW9A 3EVIA 3MDKA 3IV4A 1O85A 1ILOA 2I1UA 3VPQA 2V6KA 2K9FA 2HRKA 3GSSA 2WZ9A 2I4AA 2KOKA 4FYCA 2H6ZA 1K3YA 2PVQA 3TKRA 5D8IA 1DE1A 3HYPA 2CA8A 4JU5A 2WB9A 1XXUA 1O73A 3PR8A 2VCQA 1WPIA 1B9XC 4WEYA 2X49A 1SJZA 2P0GA 4HJMA 3SBCA 1M2AA 3FHKA 5KOXA 2QA2A 1FHEA 5CAXA 5DAKA 2PERA 3N9JA 2H6YA 2LJKA 2MMZA 4MJCA 1F6MC 1EGOA 2HZEB 3O6TA 3GNJA 1V98A 2H8LA 5GSTA 3KD0A 4XRDA 3GL5A 5B8AA 3TKPA 3DYRA 1HD2A 2YZUA 4X0XA 2CVDA 3F4TA 3FK8A 3L0HA 1EGRA 1OAZA 2X8GA 2LRNA 4IBPA 1GSYA 4MJAA 5ECIB 3A2VA 1T00A 4HU9A 3UMAA 1SK1A 1LU4A 4WR5A 2H76A 3DEXA 2FHEA 3TKSA 4D73B 3F3RA 2DSAA 2N5FA 1U6TA 2HYXA 2AB6A 3D5JA 4E8HA 1IYHA 3Q19A 1JHBA 1SK2A 2PN8A 1XWAA 3UL3A 3F3QA 1XWCA 8GSSA 2DLXA 2MBSA 3DXBA 1PQNA 2HSHA 4O5QA 1U88A 4V2NA 4WXTA 2H19A 5E59A 5KN2A 4BWQA 1TRWA 2ALBA 2R5GA 4TR4A 3W8JA 2JU5A 1H4OA 3O3TA 4TRXA 3NOFA 4IELA 2VL3A 4YH2A 1AQWA 2YCDA 2OACA 4K9ZA 1T8EB 5JCUA 3NIVA 5J3RA 4EDYA 1YY7A 4QL7A 5F0GA 1B9YC 5EL8A 1USBA 5J9BA 2O87A 1XWBA 2C0DA 3KGKA 1XOBA 1G0TA 3CYNA 1TI3A 4I8BA 3DRNA 4PTSA 2IMIA 5DAKB 4ECCA 2X8CA 3FEUA 2RM6A 3GKXA 3Q18A 4IP1A 3IXRA 5IPGA 4FIWA 5D9VA 3FZ9A 3VI7A 4PXOA 2YPMA 1UA5A 4IKHA 4J57E 4TN8A 3ZYWA 4I2UA 3IA1A 5B8BA 4PUAA 4L0WA 2YV7A 2PUKC 3F6DA 5CYYA 4MZWA 2XPDA 2H0HA 3QD9A 4KW6A 4GWRA 2CAIA 3KMOA 1GP1A 3A2WA 1WJKA 5DALB 1Z7RA 1GNEA 3ZFBA 5IMZA 2HSYA 1YF1A 1DUGA 1EOGA 1XBSA 4MPGA 1OC3A 5IOXA 4KSOA 6GSSA 2ZUPA 5KN1A 1FOHA 3I43A 4MMMA 4IHUA 2HZFA 1FO5A 13GSA 4HI7A 2VM1A 3C1RA 3TRQA 3C73A 3WT1A 2LJRA 2E2MA 2GT6A 4ZB9A 1A8YA 1TU8A 4O7HA 4YAVA 2C3QA 1FVKA 3VPTA 2LJAA 6GSVA 3WYWA 2YP6A 5AIVA 4POKA 2FA8A 4CY6A 1DE2A 1YJ6A 2FNOA 5DVBA 3GIXA 1JFUA 2L5LA 1WE0A 2VD0A 2X4AA 3FR9A 1JZRA 2GQLA 2IFQB 4DSRA 2YN1A 2L4QA 2H1BA 5EVOA 4GSTA 3KH9A 1ERUA 3ZRDA 4NHWA 1RW1A 2DJ3A 4ZIJA 3TRPA 4XS4B 1ACVA 4G19A 5DJMA 1Q98A 3GUSA 1R4WA 4GTUA 2R0PA 1WMJA 2R2JA 5ECRB 4J56E 2B5YA 4KE3A 4POMA 5GAND 3HDCA 4EDZA 4FO5A 1PSQA 4PQ1A 3DD3A 4KAEA 1ZZYA 3FY7A 4OFTA 1U87A 3KTLA 3TJBA 4PQIA 1EV4A 1Z6MA 4IN0A 5COHA 1M2DA 3LG6A 5CO3A 3QR6A 2IWTA 2KP1A 3RBTA 2G2QA 4ZBBA 1WOUA 1KEBA 4PUFC 3UAPA 3F8UA 4OMVA 3LORA 3WGXA 5G2ZA 1X5DA 4GXZA 3N5OA 5ELAA 4KCEA 2DC5A 4OO4A 5ECMB 4BVXA 1URMA 2HE3A 2ZCTA 4ZL7A 1K0CA 4GLTA 3KTBA 2CV4A 3VK9A 1MDJA 2L4CA 1PX7A 5IMVA 2E0QA 4XCSA 2JACA 1TW9A 5ECSA 5IMFA 1GSUA 1A0FA 4POLA 3D6IA 2BTOT 5H5SA 3EU3A 3I9V2 2L59A 2OA7A 4XS6A 4V1Ag 14GSA 3RAZA 3ISOA 2WGRA 4ZB6A 2ON7A 3Q74A 3TB2A 1TP9A 3TJGA 5HFGA 2RIIA 3TUEA 1WP0A 2N5AA 3QFAC 3UBKA 3J7Yb 4KB3A 1YQ1A 2VCXA 4YQMA 4ACSA 3CRTA 1TRSA 2B5XA 1BEDA 3GKNA 3MSZA 1TJDA 1TRVA 3CTFA 1EV9A 1K0MA 1XVQA 4CHSA 4E8EA 3BOAA 1M0UA 5G5EA 3L9UA 4V2MA 5HFIA 3HA9A 4K8MA 1HNBA 5JWQB 2YWIA 1GSQA 3E9JB 1KTEA 5J9CA 3KZQA 2H70A 5J41A 5B6MA 2VIMA 2VLTA 4BL7B 5HFKA 4WR4A 2LQQA 6GSXA 2NTOA 2VM2A 4MF7A 2P5RA 3TKQA 2JADA 3FZAA 1OE8A 5BMUA 2OBKA 1SL0B 2AV4A 2HZEA 11GSA 4BA7A 4L5OA 3GV1A 3US3A 1BX9A 4TVEA 3TJKA 4MF6A 2B1LA 2IIYA 3QAGA 2GLRA 1K3LA 1ERVA 2NPBA 3F6FA 1JZWA 4GQCA 3R2QA 2VL9A 3M8NA 1SU9A 4F0CA 2PVOC 1T7PB 2C8UA 2OE0A 3CSJA 3F4RA 5L71A 2WFCA 4N0VA 1TK0B 1MD3A 3LWAA 3KIJA 2CZ3A 3HXSA 4D73A 4J2FA 2K8VA 1YKAA 4JRRA 3FYGA 3IK9A 4KF9A 2J9HA 4AJ7A 1S3CA 3GHAA 5JWOB 1E2YA 2NVLA 2K8SA 1I9DA 1R5AA 5DDLA 1XWGA 5AGYA 4DEJA 2TIRA 4NV2A 2LRTA 2NBSA 3W8SA 4EVMA 1ERWA 2AHEA 3HJPA 4XIHA 1MDKA 5JWRB 4ICYA 3CSHA 1XVWA 1VF4A 1PL2A 1GH2A 2DJ0A 2GQKA 2HSMA 3EURA 2LV3A 1A23A 4FYBA 4LL1B 5INYA 2HRFA 2R6KA 2V1MA 1TKDB 1ZYNA 5FWGA 1TXXA 4XHMA 3MWHA 3KP8A 4TR1B 3UARA 2VCZA 1ST9A 4JR4A 4DSSB 1EZKA 2YWOA 1F2EA 1EOHA 4EIPA 2HI7A 2O7KA 3E3EA 3KH7A 5G31A 5ECPB 4KNDA 2WULA 3KXOA 2XC2A 1OKDA 2L57A 5A4UA 3C8EA 20GSA 1PRXA 1A2JA 2WJUA 4HZ4A 2A4HA 2B6MA 4OFMA 2LS5A 4KSMA 4G0LA 3R3EA 4G0KA 5DQSA 1T3BA 2VO4A 5DALA 1T1VA 3SWLA 2EC4A 1MDIA 1EP8A 3D21A 1H75A 3KEBA 3UJ1A 3CMIA 5IMDA 2D2ZA 1JZDA 4YQUA 4K2DA 1Z9HA 2V32A 3A2XA 2HNLA 4KH7A 3IE3A 3AY8A 1V9WA 2M72A 1FW1A 1GLQA 3PPUA 1AIUA 1T4ZA 3MIXA 1GNWA 5G1LA 4HU7A 3IHQA 2H1DA 5ECHB 2WDUA 3ZLPA 4F82A 2DBCA 3HHVA 4ZL8A 2X64A 3ZIJA 2AAWA 4KCAA 3FW2A 4OWYA 2H74A 2MYGA 2P5QA 3QCPA 1SJIA 2RUFA 3RHCA 1LBKA 2OE1A 1SL2B 2IMKA 2EIQA 1NSWA 2PU9C 3TDGA 3VLNA 3H79A 1G7OA 3BD2A 1HNAA 3J7Yk 2IFQA 2JSYA 2H66A 3FZ5A 4I5QA 4QQ7A 2JSZA 1GRXA 2JZSA 4XS4A 4FQUA 4GSSA 3M1GA 4NWYA 2DJ2A 4BPYA 4EXJA 3FR3A 1AXDA 3FRCA 4N30A 4O32A 5CRHA 3WGEA 1SJ6A 2FUG2 2C0EA 2X99A 3HVVA 3UVTA 1RK4A 3U5RE 4HZ2A 3A5IA 2WS2A 5EPFA 2VLVA 1ZYEA 4EO3A 3V1WA 2BJXA 3CTGA 3M9KA 1GSEA 2YV9A 3WD6A 1SD9A 3H8QA 4MLYA 1FOVA 3KMNA 4BWSA 2TRXA 2OE3A 4NXIA 4EF0A 3I6AA 2VLUA 3UEMA 4TR0A 3IPZA 2CT6A 1PX6A 2DKIA 2LTKA 4X43A 3TKSE 4MZCA 3IK7A 1AW9A 2CX3A 4IQ1A 3EINA 3LXTA 4XS1A 2R0CA 3I69A 4IJ3A 3ZL5A 2O8VB 2B5EA 2IMEA 3A5WA 2GGTA 1O6JA 1G6WA 1SKRB 2MZCA 2RM5A 4ILFA 1DBYA 1AQVA 5D96A 1V2AA 3QFBC 3E0UA 2VUPA 2B7JA 4WF5A 2ZNMA 3GFKA 2CQ9A 2KLXA 4K7IA 4GCIA 5D9TA 4EUYA 2I81A 3QAVA 3GTUB 4JR6A 3IAM2 3GA4A 3VI5A 3QMXA 4JEDA 2H73A 3P8WA 4TW5A 6GSTA 3GX8A 2V6OA 1OVNA 3GH9A 2XHFA 4Z2TA 3ERGA 3DWVA 1B4QA 1QFNA 2V2GA 4MDCA 1XOAA 4RUVA 3C7MA 2LNTA 2YZHA 1ZMAA 1C72A 4Z2RA 4XRAA 5A4VA 2LNSA 3IC8A 1X9WB 2O85A 1Y6EA 3Q6OA 3IBHA 2LQOA 2QC7A 4XTSA 2BMXA 3ZMLA 2ES7A 1XPVA 2MBTA 1F3AA 2GDRA 4MK3A 3F4SA 1GUHA 1PMTA 2QKEA 4MJEA 1XW5A 4NMUA 3ZFLA 1GSSA 4BL7A 4K7OA 1PKWA 2O89A 3ME8A 2C0FA 4K1FA 1YF0A 1SYRA 4MF5A 1LJRA 5IIZA 4K0GA 3F63A 1OC9B 3DVWA 2KUCA 3ME7A 4ML1A 3H4KA 3DVXA 1S3DA 2HRAA 3W6GA 1SKSB 2HLSA 4Q5RA 1J0FA 2H1GA 2VOCA 4V1Ap 4AJ8A 2TRCP 5AIXA 5HR0A 5D9XA 4HEA2 1QMVA 3KM6A 1M99A 4MA9A 1XW9A 1W4VA 5DCGA 2JZRA 2AYTA 5F8BA 1CQGA 4POBA 4KDXA 3RPPA 1FB6A 4KUNA 2GQMA 4G0IA 1M7TA 4K0NA 1ZYQB 3GSTA 1MD4A 2CAQA 4EL1A 1G6YA 5ECKB 3EWLA 1FAAA 3UOMA 2DIYA 4K5SA 1N8JA 3TGZA 4WETA 1A2MA 1I5GA 2R3XA 2EIOA 1A0RP 2N5BA 1A8LA 2YWMA 1E6BA 3QOUA 1K0OA 1PN0A 4X1UA 1QUWA 2H71A 3C1SA 3L9SA 2F51A 4IVFA 5IOWA 4O92A 4NPBA 2J23A 3DKSA 3ZIVA 2GTUA 1U3IA 3MNGA 2DJ1A 1VF2A 4JBBA 3GYKA 1J9BA 1QQ2A 2YWNA 2DMMA 4PNGA 4PGTA 2AUVA 1UC7A 4TR1A 4TXVA 3GKMA 4EC0A 3PGTA 1VRSD 3G7JA 1AQXA 1Z7PA 3O76A 1CQHA 4DSSA 3DIEA 1J08A 2H01A 4WKWA 1SKWB 5D9WA 2NDOA 5KOWA 2IL3A 3BCKA 4G10A 1F37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HR1 A;  5C00 A;  3U6V A;  3HJM A;  1X5C A;  1A2L A;  4ZIL A;  4L0U A;  3BCI A;  3PH9 A;  1HYU A;  1K0N A;  4N0Z A;  1B4P A;  5EY6 A;  2RLI A;  2PMT A;  3RPN A;  1GL8 A;  1GUL A;  1GLP A;  1DSB A;  1MEK A;  3FR6 A;  5DCH A;  5E4W A;  4CDO A;  1WRY A;  3ED3 A;  3WGD A;  2EIR A;  5FHI A;  1UN2 A;  2JZT A;  2FWF A;  2LRC A;  4IJI A;  2FWH A;  1BJX A;  2H75 A;  1SYX A;  2KP2 A;  3APS A;  3KCM A;  3EC3 A;  3LSZ A;  1SK0 A;  5IO0 A;  1MTC A;  5AIS A;  5DQY A;  2F8A A;  2HT9 A;  1PD2 1;  3CXG A;  3D0Z A;  4F9Z A;  1GUM A;  1X5E A;  2FGX A;  3ZIT A;  4TR3 A;  4KX4 A;  4FH8 A;  2VCW A;  3LXZ A;  3CRU A;  4TKY A;  1YEP A;  2I3Y A;  2REM A;  1GSF A;  2GSQ A;  2QGV A;  1PN9 A;  3HD5 A;  3APQ A;  2FWG A;  5H5Q A;  2KHP A;  4TXO B;  1ABA A;  2RUE A;  4G2E A;  4HQS A;  4L5L A;  3S9F A;  2L6C A;  1O8W A;  2GT5 A;  2JL4 A;  3C71 A;  4ZBA A;  2QSI A;  2GST A;  5FT3 A;  4HS1 A;  2F8F A;  3G7Y A;  3PIN A;  3TCO A;  4WBR D;  3K8N A;  5C04 A;  1T4Y A;  2B3S A;  1R7H A;  4CW9 A;  1XWK A;  1Q4J A;  3DGQ A;  2PPT A;  4ISD A;  4LMV A;  4ZBD A;  4Q5Q A;  5IPH A;  2A4V A;  2F9S A;  5ID2 B;  2MMA A;  4IW9 A;  3VWV A;  4MH2 A;  1VF1 A;  4I2T A;  3IOS A;  1R26 A;  2FCH A;  2B7K A;  5CRE A;  3QAW A;  1HNC A;  2C3N A;  3L4N A;  3G9B A;  2H6X A;  4WF4 A;  2DML A;  4IGJ A;  3EMP A;  2H0G A;  6GSW A;  4GQF A;  4TOP A;  5LNK e;  5IO2 A;  3CSI A;  1EWX A;  12GS A;  4PQH A;  1K0A A;  1K3O A;  4Q5N A;  5GZZ B;  3IAS 2;  3EE2 A;  1EEM A;  3RDW A;  1V58 A;  4KDU A;  3D4T A;  2XBQ A;  2GZY A;  3GMF A;  1TRU A;  3UBL A;  1ZGN A;  5F05 A;  2C3T A;  2CVK A;  3BBY A;  5ECN B;  2E2G A;  4ECI A;  6GSU A;  1G7E A;  1M9B A;  5ECQ B;  2P31 A;  3GTU A;  2CZ2 A;  4MP4 A;  4YAP A;  3ZVJ D;  1KNG A;  1W89 A;  1EP7 A;  3LEF A;  2XBI A;  5ECL B;  3G7I A;  4IP6 A;  4OO5 A;  3LJR A;  1AAZ A;  5F07 A;  3ZVJ A;  5LD0 A;  2IMD A;  4EE0 A;  4V2L A;  1NW2 A;  5AN1 A;  1YKC A;  1GTA A;  1GTI A;  1HQO A;  3BJ5 A;  2GSS A;  1OE7 A;  2ON5 A;  3NZN A;  4ECB A;  3FKF A;  3TRX A;  5HQP A;  4MH3 A;  4F2I A;  4N11 A;  5J5N A;  4GRF A;  2FY6 A;  1PKZ A;  1Z3E A;  1TDI A;  1FG4 A;  2GZZ A;  1R5P A;  5ECO B;  2GSR A;  4QL9 A;  2GZP A;  3TJJ A;  3HY2 A;  1SEN A;  4KGI A;  3LYP A;  1V40 A;  1RQM A;  1M2B A;  3A3T A;  3CBU A;  3H1N A;  5H5R A;  4I97 A;  2K18 A;  2R37 A;  5B6N A;  1ZOF A;  1BYE A;  1OC9 A;  4HJ2 A;  1F3B A;  2LUS A;  2R4V A;  3LGC A;  1ML6 A;  5CRG A;  3P90 A;  1K0B A;  1NM3 A;  2LEG A;  4ID0 A;  3GKK A;  16GS A;  2YJH A;  2HXK A;  4OFN A;  4O5R A;  1Y25 A;  4K7N A;  1YZX A;  3P2A A;  3TJF A;  2IN3 A;  2MMN A;  3ERF A;  10GS A;  4NV5 A;  3QDN A;  3EMX A;  4JZQ A;  4H86 A;  2PWJ A;  3GRX A;  2DIZ A;  3OR5 A;  4F0B A;  2WCI A;  5ABR A;  1QGV A;  1Z6N A;  4MZB A;  1N2A A;  1O7U A;  5CRD A;  2VL2 C;  1ZCP A;  3VFI A;  4OCF A;  1XIY A;  2OKA A;  2C0G A;  4ULX A;  4P3Y B;  2A2S A;  17GS A;  3D22 A;  3M9J A;  5ENU A;  1XW6 A;  2IPA A;  1GSD A;  3APO A;  2FD3 A;  2X8H A;  2YNX A;  4HUA A;  1OYJ A;  3P7X A;  2XPE A;  1QK8 A;  1SD8 A;  1UVZ A;  4AGS A;  3GH6 A;  3QPM A;  5D93 A;  4F03 A;  2VCT A;  3EYT A;  5KN0 A;  6GSY A;  5IQY A;  2C80 A;  2FA4 A;  3HVS A;  1KBN A;  5CRW A;  1M9A A;  1PA3 A;  2CVB A;  3JCM L;  1TK5 B;  1JLW A;  5JCW A;  2H72 A;  2M46 A;  2IMF A;  3RHB A;  3VUR A;  5LCZ A;  1X9M B;  1X0R A;  5IMA A;  22GS A;  5GAP D;  1FVJ A;  1JZO A;  2I9H A;  2HFD A;  2YJ7 A;  4PUR A;  3F0I A;  1K0D A;  4GF0 A;  2DJK A;  5F06 A;  2CX4 A;  3IDV A;  4LL4 B;  4MAB A;  1XCC A;  3FZ4 A;  5ELG A;  1IYI A;  2HRN A;  3GUR A;  1YDK A;  3VWW A;  4IQA A;  2L5O A;  4MJB A;  1SL1 B;  1BG5 A;  2OJL A;  2DJJ A;  2Z9S A;  3EU4 A;  4JE1 A;  1ZL9 A;  5HR2 A;  1U3A A;  1PGT A;  2K6V A;  1BAY A;  5DBQ A;  2C1Y A;  1A24 A;  2MMO A;  3GX0 A;  1OKT A;  1F9M A;  3TOU A;  2LST A;  1THO A;  4BVY A;  2E7P A;  5IM9 A;  3ZRE A;  1GTB A;  5G30 A;  5J4U A;  2FWE A;  4HOJ A;  1GWC A;  5G1K A;  4KDY A;  4NAX A;  2FLS A;  2L6D A;  5D73 A;  5DJL A;  5G5F A;  4Q5F A;  1JLV A;  3VWX A;  4ZXG A;  4N10 A;  3WT2 A;  1OC8 A;  2PGT A;  4PX1 A;  2H30 A;  3UVH A;  2LKU A;  4IS0 A;  1O8X A;  2V41 A;  1EEJ A;  1ERT A;  1Z5Y E;  1TU7 A;  4Z7X A;  4KA0 A;  3F9U A;  3UIW A;  3GN3 A;  1B48 A;  1AUC A;  9GSS A;  3HJO A;  4LA1 A;  2C4J A;  2AJQ B;  1TI1 A;  2PBJ A;  5IMC A;  4TXO A;  5A5K A;  1B8X A;  2VL2 A;  1NHO A;  5GSS A;  5CNW A;  4L8E A;  3HZ8 A;  3HVX A;  2F3M A;  1NHY A;  2VAF A;  3ZMK A;  1WWJ A;  2VD1 A;  2M80 A;  4FYU A;  4AJ6 A;  4K6X A;  1TOF A;  4ZB8 A;  1WIK A;  3KJY A;  3HZ4 A;  4GSN A;  3LYK A;  4DSQ A;  4HQZ A;  3DML A;  3ZZX A;  1PL1 A;  3L78 A;  4LMW A;  2YOI A;  2A2R A;  2WRT A;  1TTZ A;  4ECJ A;  2GVP A;  3IR4 A;  4RQR A;  3H93 A;  5KN3 A;  4WBJ A;  2GS3 A;  5JCG A;  5CP1 A;  3GL3 A;  5ID2 A;  3TKS C;  18GS A;  3TOT A;  1XZO A;  4HDE A;  3LQ7 A;  3KP9 A;  2OBI A;  2H1A A;  3IRA A;  4I6X A;  4AF2 A;  4MCU A;  1GUK A;  1S3A A;  3D4M A;  1VF3 A;  1YEX A;  4NHZ A;  1V57 A;  2G0F A;  4RI7 A;  4LLR A;  4PNF A;  1O81 A;  3M3M A;  2IJY A;  4MPF A;  7GSS A;  4G9H A;  1QXH A;  1TK8 B;  3L9V A;  2VCV A;  1GTU A;  4DVC A;  4RI6 A;  1VGL A;  3LFL A;  2YAN A;  3IC4 A;  4OCE A;  1X9S B;  5HR3 A;  4ML6 A;  3M0F A;  4RQX A;  1THX A;  3MAK A;  1BQ7 A;  2OAD A;  4OD7 A;  1XFL A;  3ERW A;  19GS A;  5KEJ A;  5A4W A;  1AC1 A;  3HCZ A;  2B1K A;  3ZTL A;  5B7C A;  3VWU A;  2H0I A;  4EKZ A;  1ON4 A;  1FB0 A;  4YQV A;  3HKR A;  4ZL9 A;  3EVI A;  3MDK A;  3IV4 A;  1O85 A;  1ILO A;  2I1U A;  3VPQ A;  2V6K A;  2K9F A;  3GSS A;  2WZ9 A;  2I4A A;  2KOK A;  4FYC A;  2H6Z A;  1K3Y A;  2PVQ A;  3TKR A;  5D8I A;  1DE1 A;  3HYP A;  2CA8 A;  4JU5 A;  2WB9 A;  1XXU A;  1O73 A;  3PR8 A;  2VCQ A;  1WPI A;  1B9X C;  4WEY A;  1SJZ A;  2P0G A;  4HJM A;  3SBC A;  1M2A A;  3FHK A;  1FHE A;  5CAX A;  5DAK A;  2PER A;  3N9J A;  2H6Y A;  2LJK A;  2MMZ A;  4MJC A;  1F6M C;  1EGO A;  2HZE B;  3O6T A;  3GNJ A;  1V98 A;  2H8L A;  5GST A;  3KD0 A;  4XRD A;  3GL5 A;  5B8A A;  3TKP A;  3DYR A;  1HD2 A;  2YZU A;  4X0X A;  2CVD A;  3F4T A;  3FK8 A;  3L0H A;  1EGR A;  1OAZ A;  2X8G A;  2LRN A;  4IBP A;  1GSY A;  4MJA A;  5ECI B;  3A2V A;  1T00 A;  4HU9 A;  3UMA A;  1SK1 A;  1LU4 A;  4WR5 A;  2H76 A;  3DEX A;  2FHE A;  3TKS A;  4D73 B;  3F3R A;  2DSA A;  2N5F A;  1U6T A;  2HYX A;  2AB6 A;  3D5J A;  4E8H A;  1IYH A;  3Q19 A;  1JHB A;  1SK2 A;  2PN8 A;  1XWA A;  3UL3 A;  3F3Q A;  1XWC A;  8GSS A;  2DLX A;  2MBS A;  3DXB A;  1PQN A;  2HSH A;  1U88 A;  4V2N A;  4WXT A;  2H19 A;  5E59 A;  5KN2 A;  4BWQ A;  1TRW A;  2ALB A;  2R5G A;  4TR4 A;  3W8J A;  2JU5 A;  1H4O A;  3O3T A;  4TRX A;  3NOF A;  4IEL A;  2VL3 A;  4YH2 A;  1AQW A;  2YCD A;  2OAC A;  4K9Z A;  1T8E B;  5JCU A;  3NIV A;  5J3R A;  4EDY A;  1YY7 A;  4QL7 A;  5F0G A;  1B9Y C;  5EL8 A;  1USB A;  5J9B A;  2O87 A;  1XWB A;  2C0D A;  3KGK A;  1XOB A;  1G0T A;  3CYN A;  1TI3 A;  4I8B A;  3DRN A;  2IMI A;  5DAK B;  4ECC A;  2X8C A;  3FEU A;  2RM6 A;  3GKX A;  3Q18 A;  4IP1 A;  3IXR A;  5IPG A;  4FIW A;  5D9V A;  3FZ9 A;  3VI7 A;  4PXO A;  2YPM A;  1UA5 A;  4IKH A;  4J57 E;  4TN8 A;  3ZYW A;  4I2U A;  3IA1 A;  5B8B A;  4PUA A;  4L0W A;  2YV7 A;  2PUK C;  3F6D A;  5CYY A;  4MZW A;  2XPD A;  2H0H A;  3QD9 A;  4KW6 A;  4GWR A;  2CAI A;  3KMO A;  1GP1 A;  3A2W A;  1WJK A;  5DAL B;  1Z7R A;  1GNE A;  3ZFB A;  5IMZ A;  2HSY A;  1YF1 A;  1DUG A;  1EOG A;  1XBS A;  4MPG A;  1OC3 A;  5IOX A;  4KSO A;  6GSS A;  2ZUP A;  5KN1 A;  3I43 A;  4MMM A;  4IHU A;  2HZF A;  1FO5 A;  13GS A;  4HI7 A;  2VM1 A;  3C1R A;  3TRQ A;  3C73 A;  3WT1 A;  2LJR A;  2E2M A;  2GT6 A;  4ZB9 A;  1A8Y A;  1TU8 A;  4O7H A;  4YAV A;  2C3Q A;  1FVK A;  3VPT A;  2LJA A;  6GSV A;  3WYW A;  2YP6 A;  5AIV A;  4POK A;  2FA8 A;  1DE2 A;  1YJ6 A;  2FNO A;  5DVB A;  3GIX A;  1JFU A;  2L5L A;  1WE0 A;  2VD0 A;  3FR9 A;  1JZR A;  2GQL A;  2IFQ B;  4DSR A;  2YN1 A;  2L4Q A;  2H1B A;  5EVO A;  4GST A;  3KH9 A;  1ERU A;  3ZRD A;  4NHW A;  1RW1 A;  2DJ3 A;  4ZIJ A;  3TRP A;  4XS4 B;  1ACV A;  4G19 A;  5DJM A;  1Q98 A;  3GUS A;  1R4W A;  4GTU A;  1WMJ A;  2R2J A;  5ECR B;  4J56 E;  2B5Y A;  4KE3 A;  4POM A;  5GAN D;  3HDC A;  4EDZ A;  4FO5 A;  1PSQ A;  4PQ1 A;  3DD3 A;  4KAE A;  1ZZY A;  3FY7 A;  4OFT A;  1U87 A;  3KTL A;  3TJB A;  4PQI A;  1EV4 A;  1Z6M A;  4IN0 A;  5COH A;  1M2D A;  3LG6 A;  5CO3 A;  3QR6 A;  2IWT A;  2KP1 A;  3RBT A;  2G2Q A;  4ZBB A;  1WOU A;  1KEB A;  4PUF C;  3UAP A;  3F8U A;  4OMV A;  3LOR A;  3WGX A;  5G2Z A;  1X5D A;  4GXZ A;  3N5O A;  5ELA A;  4KCE A;  2DC5 A;  4OO4 A;  5ECM B;  4BVX A;  1URM A;  2HE3 A;  2ZCT A;  4ZL7 A;  1K0C A;  4GLT A;  3KTB A;  2CV4 A;  3VK9 A;  1MDJ A;  2L4C A;  1PX7 A;  5IMV A;  2E0Q A;  4XCS A;  2JAC A;  1TW9 A;  5ECS A;  5IMF A;  1GSU A;  1A0F A;  4POL A;  3D6I A;  2BTO T;  5H5S A;  3EU3 A;  3I9V 2;  2L59 A;  2OA7 A;  4XS6 A;  4V1A g;  14GS A;  3RAZ A;  3ISO A;  2WGR A;  4ZB6 A;  2ON7 A;  3Q74 A;  3TB2 A;  1TP9 A;  3TJG A;  5HFG A;  2RII A;  3TUE A;  1WP0 A;  2N5A A;  3QFA C;  3UBK A;  3J7Y b;  4KB3 A;  1YQ1 A;  2VCX A;  4YQM A;  4ACS A;  3CRT A;  1TRS A;  2B5X A;  1BED A;  3GKN A;  3MSZ A;  1TJD A;  1TRV A;  3CTF A;  1EV9 A;  1K0M A;  1XVQ A;  4CHS A;  4E8E A;  3BOA A;  1M0U A;  5G5E A;  3L9U A;  4V2M A;  5HFI A;  3HA9 A;  4K8M A;  1HNB A;  5JWQ B;  2YWI A;  1GSQ A;  3E9J B;  1KTE A;  5J9C A;  3KZQ A;  2H70 A;  5J41 A;  5B6M A;  2VIM A;  2VLT A;  5HFK A;  4WR4 A;  2LQQ A;  6GSX A;  2NTO A;  2VM2 A;  4MF7 A;  2P5R A;  3TKQ A;  2JAD A;  3FZA A;  1OE8 A;  2OBK A;  1SL0 B;  2AV4 A;  2HZE A;  11GS A;  4BA7 A;  4L5O A;  3GV1 A;  3US3 A;  1BX9 A;  4TVE A;  3TJK A;  4MF6 A;  2B1L A;  2IIY A;  3QAG A;  2GLR A;  1K3L A;  1ERV A;  2NPB A;  3F6F A;  1JZW A;  4GQC A;  3R2Q A;  2VL9 A;  3M8N A;  1SU9 A;  4F0C A;  2PVO C;  1T7P B;  2C8U A;  2OE0 A;  3CSJ A;  3F4R A;  5L71 A;  2WFC A;  4N0V A;  1TK0 B;  1MD3 A;  3LWA A;  3KIJ A;  2CZ3 A;  3HXS A;  4D73 A;  4J2F A;  2K8V A;  1YKA A;  4JRR A;  3FYG A;  3IK9 A;  2J9H A;  4AJ7 A;  1S3C A;  3GHA A;  5JWO B;  1E2Y A;  2NVL A;  2K8S A;  1I9D A;  1R5A A;  5DDL A;  1XWG A;  5AGY A;  4DEJ A;  2TIR A;  4NV2 A;  2LRT A;  2NBS A;  3W8S A;  4EVM A;  1ERW A;  2AHE A;  3HJP A;  4XIH A;  1MDK A;  5JWR B;  3CSH A;  1XVW A;  1VF4 A;  1PL2 A;  1GH2 A;  2DJ0 A;  2GQK A;  3EUR A;  2LV3 A;  1A23 A;  4FYB A;  4LL1 B;  5INY A;  2HRF A;  2R6K A;  2V1M A;  1TKD B;  5FWG A;  1TXX A;  4XHM A;  3MWH A;  3KP8 A;  4TR1 B;  3UAR A;  2VCZ A;  1ST9 A;  4JR4 A;  4DSS B;  1EZK A;  2YWO A;  1F2E A;  1EOH A;  2HI7 A;  2O7K A;  3E3E A;  3KH7 A;  5G31 A;  5ECP B;  4KND A;  2WUL A;  3KXO A;  2XC2 A;  1OKD A;  2L57 A;  5A4U A;  3C8E A;  20GS A;  1PRX A;  1A2J A;  2WJU A;  4HZ4 A;  2B6M A;  4OFM A;  2LS5 A;  4KSM A;  5DQS A;  1T3B A;  2VO4 A;  5DAL A;  1T1V A;  3SWL A;  2EC4 A;  1MDI A;  1EP8 A;  3D21 A;  1H75 A;  3KEB A;  3UJ1 A;  3CMI A;  5IMD A;  2D2Z A;  1JZD A;  4YQU A;  4K2D A;  1Z9H A;  2V32 A;  3A2X A;  2HNL A;  4KH7 A;  3IE3 A;  3AY8 A;  1V9W A;  2M72 A;  1FW1 A;  1GLQ A;  1AIU A;  1T4Z A;  1GNW A;  5G1L A;  4HU7 A;  3IHQ A;  2H1D A;  5ECH B;  2WDU A;  3ZLP A;  4F82 A;  2DBC A;  3HHV A;  4ZL8 A;  2X64 A;  3ZIJ A;  2AAW A;  4KCA A;  3FW2 A;  4OWY A;  2H74 A;  2MYG A;  2P5Q A;  3QCP A;  1SJI A;  2RUF A;  3RHC A;  1LBK A;  2OE1 A;  1SL2 B;  2IMK A;  2EIQ A;  1NSW A;  2PU9 C;  3TDG A;  3VLN A;  3H79 A;  1G7O A;  3BD2 A;  1HNA A;  3J7Y k;  2IFQ A;  2JSY A;  2H66 A;  3FZ5 A;  4I5Q A;  4QQ7 A;  2JSZ A;  1GRX A;  2JZS A;  4XS4 A;  4GSS A;  3M1G A;  4NWY A;  2DJ2 A;  4BPY A;  4EXJ A;  3FR3 A;  1AXD A;  3FRC A;  4N30 A;  4O32 A;  5CRH A;  3WGE A;  1SJ6 A;  2FUG 2;  2C0E A;  2X99 A;  3HVV A;  3UVT A;  1RK4 A;  3U5R E;  4HZ2 A;  2WS2 A;  5EPF A;  2VLV A;  1ZYE A;  4EO3 A;  3V1W A;  2BJX A;  3CTG A;  3M9K A;  1GSE A;  2YV9 A;  3WD6 A;  1SD9 A;  3H8Q A;  4MLY A;  1FOV A;  3KMN A;  4BWS A;  2TRX A;  2OE3 A;  4NXI A;  4EF0 A;  3I6A A;  2VLU A;  3UEM A;  4TR0 A;  3IPZ A;  2CT6 A;  1PX6 A;  2LTK A;  4X43 A;  3TKS E;  4MZC A;  3IK7 A;  1AW9 A;  2CX3 A;  4IQ1 A;  3EIN A;  3LXT A;  4XS1 A;  3I69 A;  4IJ3 A;  3ZL5 A;  2O8V B;  2B5E A;  2IME A;  3A5W A;  2GGT A;  1O6J A;  1G6W A;  1SKR B;  2MZC A;  2RM5 A;  4ILF A;  1DBY A;  1AQV A;  5D96 A;  1V2A A;  3QFB C;  3E0U A;  2VUP A;  2B7J A;  4WF5 A;  2ZNM A;  3GFK A;  2CQ9 A;  2KLX A;  4K7I A;  4GCI A;  5D9T A;  4EUY A;  2I81 A;  3QAV A;  3GTU B;  4JR6 A;  3IAM 2;  3GA4 A;  3VI5 A;  3QMX A;  4JED A;  2H73 A;  3P8W A;  4TW5 A;  6GST A;  3GX8 A;  2V6O A;  1OVN A;  3GH9 A;  2XHF A;  3ERG A;  3DWV A;  1B4Q A;  1QFN A;  2V2G A;  4MDC A;  1XOA A;  4RUV A;  3C7M A;  2LNT A;  2YZH A;  1ZMA A;  1C72 A;  4XRA A;  5A4V A;  2LNS A;  1X9W B;  2O85 A;  1Y6E A;  3Q6O A;  3IBH A;  2LQO A;  2QC7 A;  4XTS A;  2BMX A;  3ZML A;  2ES7 A;  1XPV A;  2MBT A;  1F3A A;  2GDR A;  4MK3 A;  3F4S A;  1GUH A;  1PMT A;  2QKE A;  4MJE A;  1XW5 A;  4NMU A;  3ZFL A;  1GSS A;  4BL7 A;  4K7O A;  1PKW A;  2O89 A;  3ME8 A;  2C0F A;  4K1F A;  1YF0 A;  1SYR A;  4MF5 A;  1LJR A;  5IIZ A;  4K0G A;  3F63 A;  1OC9 B;  3DVW A;  2KUC A;  3ME7 A;  4ML1 A;  3H4K A;  3DVX A;  1S3D A;  3W6G A;  1SKS B;  2HLS A;  4Q5R A;  1J0F A;  2H1G A;  2VOC A;  4V1A p;  4AJ8 A;  2TRC P;  5AIX A;  5HR0 A;  5D9X A;  4HEA 2;  1QMV A;  3KM6 A;  1M99 A;  4MA9 A;  1XW9 A;  1W4V A;  5DCG A;  2JZR A;  2AYT A;  5F8B A;  1CQG A;  4KDX A;  4POB A;  3RPP A;  1FB6 A;  4KUN A;  2GQM A;  1M7T A;  4K0N A;  1ZYQ B;  3GST A;  1MD4 A;  2CAQ A;  4EL1 A;  1G6Y A;  5ECK B;  3EWL A;  1FAA A;  3UOM A;  2DIY A;  1N8J A;  3TGZ A;  4WET A;  1A2M A;  1I5G A;  2R3X A;  2EIO A;  1A0R P;  2N5B A;  1A8L A;  2YWM A;  1E6B A;  3QOU A;  1K0O A;  4X1U A;  1QUW A;  2H71 A;  3C1S A;  3L9S A;  2F51 A;  4IVF A;  5IOW A;  4O92 A;  4NPB A;  2J23 A;  3DKS A;  3ZIV A;  2GTU A;  1U3I A;  3MNG A;  2DJ1 A;  1VF2 A;  4JBB A;  3GYK A;  1J9B A;  1QQ2 A;  2YWN A;  2DMM A;  4PNG A;  4PGT A;  2AUV A;  1UC7 A;  4TR1 A;  4TXV A;  3GKM A;  4EC0 A;  3PGT A;  1VRS D;  3G7J A;  1AQX A;  1Z7P A;  3O76 A;  1CQH A;  4DSS A;  3DIE A;  1J08 A;  2H01 A;  4WKW A;  1SKW B;  5D9W A;  2NDO A;  2IL3 A;  3BCK A;  4G10 A;  1F37 A; 
#chains in the Genus database with same CATH topology
 5HR1 A;  5C00 A;  3U6V A;  3HJM A;  1X5C A;  1A2L A;  4ZIL A;  4L0U A;  3BCI A;  3PH9 A;  1HYU A;  1K0N A;  4N0Z A;  1B4P A;  5EY6 A;  2RLI A;  2PMT A;  3RPN A;  1GL8 A;  1GUL A;  1GLP A;  1DSB A;  1MEK A;  4USS A;  3FR6 A;  5DCH A;  5E4W A;  4CDO A;  1WRY A;  3EPT A;  4BVY B;  3ED3 A;  3WGD A;  2EIR A;  5FHI A;  1UN2 A;  2JZT A;  2FWF A;  2LRC A;  4IJI A;  2FWH A;  1BJX A;  2H75 A;  1SYX A;  2KP2 A;  3APS A;  3KCM A;  3EC3 A;  3LSZ A;  1SK0 A;  5IO0 A;  1MTC A;  5AIS A;  5DQY A;  2F8A A;  2HT9 A;  1PD2 1;  3CXG A;  3D0Z A;  4F9Z A;  1GUM A;  1X5E A;  2FGX A;  3ZIT A;  4TR3 A;  4KX4 A;  4YKF A;  4FH8 A;  2VCW A;  3LXZ A;  3CRU A;  4TKY A;  1YEP A;  2I3Y A;  2REM A;  1GSF A;  2GSQ A;  2QGV A;  1PN9 A;  3HD5 A;  3APQ A;  2FWG A;  5H5Q A;  2KHP A;  4TXO B;  4K5R A;  1ABA A;  2RUE A;  4G2E A;  4HQS A;  4L5L A;  3S9F A;  2L6C A;  1O8W A;  4CY8 A;  2GT5 A;  2JL4 A;  4Z2U A;  3C71 A;  4ZBA A;  2QSI A;  2GST A;  5FT3 A;  4HS1 A;  2F8F A;  3G7Y A;  3PIN A;  3TCO A;  4WBR D;  3K8N A;  5C04 A;  1T4Y A;  2B3S A;  1R7H A;  4CW9 A;  1XWK A;  1Q4J A;  3DGQ A;  2PPT A;  4ISD A;  4LMV A;  4ZBD A;  4Q5Q A;  5IPH A;  2A4V A;  2F9S A;  5ID2 B;  2MMA A;  4IW9 A;  4YKG A;  3VWV A;  4MH2 A;  1VF1 A;  4I2T A;  3IOS A;  1R26 A;  2FCH A;  2B7K A;  5CRE A;  3QAW A;  3FMW A;  1HNC A;  2C3N A;  3L4N A;  3G9B A;  2H6X A;  4WF4 A;  2DML A;  4IGJ A;  3EMP A;  2H0G A;  6GSW A;  4GQF A;  4TOP A;  5LNK e;  5IO2 A;  3CSI A;  4EIQ A;  1EWX A;  12GS A;  4PQH A;  1K0A A;  1K3O A;  4Q5N A;  5GZZ B;  3IAS 2;  3EE2 A;  1EEM A;  3RDW A;  1V58 A;  4KDU A;  3D4T A;  2XBQ A;  2GZY A;  3GMF A;  1TRU A;  3UBL A;  1ZGN A;  5F05 A;  2C3T A;  2CVK A;  3BBY A;  5ECN B;  2E2G A;  4ECI A;  6GSU A;  1G7E A;  1M9B A;  5ECQ B;  2P31 A;  4K2X A;  3GTU A;  2CZ2 A;  4MP4 A;  4YAP A;  3ZVJ D;  1KNG A;  1W89 A;  1EP7 A;  3LEF A;  2XBI A;  5ECL B;  3G7I A;  4IP6 A;  4OO5 A;  3LJR A;  1AAZ A;  5F07 A;  3ZVJ A;  5LD0 A;  2IMD A;  4EE0 A;  4V2L A;  1NW2 A;  5AN1 A;  1YKC A;  1GTA A;  1GTI A;  1HQO A;  3BJ5 A;  2GSS A;  1OE7 A;  2ON5 A;  3NZN A;  4ECB A;  3FKF A;  3TRX A;  5HQP A;  5BRT A;  4MH3 A;  4F2I A;  4N11 A;  5J5N A;  4GRF A;  2FY6 A;  1PKZ A;  1Z3E A;  3MYD A;  1TDI A;  1FG4 A;  2GZZ A;  1R5P A;  5ECO B;  2GSR A;  4QL9 A;  2GZP A;  3TJJ A;  3HY2 A;  1SEN A;  4KGI A;  3LYP A;  1V40 A;  1RQM A;  1M2B A;  3A3T A;  3CBU A;  3H1N A;  5H5R A;  4I97 A;  2K18 A;  2R37 A;  5B6N A;  1ZOF A;  1BYE A;  1OC9 A;  4HJ2 A;  1F3B A;  2LUS A;  2R4V A;  3LGC A;  1ML6 A;  5CRG A;  3P90 A;  1K0B A;  1NM3 A;  2LEG A;  4ID0 A;  3GKK A;  16GS A;  2YJH A;  2HXK A;  4OFN A;  4O5R A;  1Y25 A;  4K7N A;  1YZX A;  3P2A A;  3TJF A;  2IN3 A;  2MMN A;  3ERF A;  10GS A;  2UZ8 A;  4NV5 A;  3QDN A;  3EMX A;  4JZQ A;  4H86 A;  2PWJ A;  3GRX A;  2DIZ A;  3OR5 A;  4F0B A;  2WCI A;  5ABR A;  1QGV A;  1Z6N A;  4MZB A;  1N2A A;  1O7U A;  5CRD A;  2VL2 C;  1ZCP A;  3VFI A;  4OCF A;  1XIY A;  2OKA A;  4A5P A;  2C0G A;  4ULX A;  4P3Y B;  2A2S A;  17GS A;  3D22 A;  3M9J A;  3IHG A;  5ENU A;  1XW6 A;  2IPA A;  2DKH A;  1GSD A;  3APO A;  2FD3 A;  2X8H A;  2YNX A;  4HUA A;  1OYJ A;  3P7X A;  2XPE A;  1QK8 A;  1SD8 A;  1UVZ A;  4AGS A;  3GH6 A;  3QPM A;  5D93 A;  4F03 A;  2VCT A;  3EYT A;  5KN0 A;  2QA1 A;  6GSY A;  5IQY A;  2C80 A;  2FA4 A;  3HVS A;  1KBN A;  5CRW A;  1M9A A;  1PA3 A;  2CVB A;  3JCM L;  1TK5 B;  1JLW A;  4O5U A;  5JCW A;  2H72 A;  2M46 A;  2IMF A;  3RHB A;  3VUR A;  5LCZ A;  1X9M B;  1X0R A;  5IMA A;  22GS A;  5GAP D;  1FVJ A;  1JZO A;  2I9H A;  2HFD A;  2YJ7 A;  4PUR A;  3F0I A;  1K0D A;  4GF0 A;  2DJK A;  5F06 A;  2CX4 A;  3IDV A;  4LL4 B;  4MAB A;  1XCC A;  3FZ4 A;  5ELG A;  1IYI A;  2HRN A;  3GUR A;  1YDK A;  3VWW A;  4IQA A;  2L5O A;  4MJB A;  1SL1 B;  1BG5 A;  2OJL A;  2DJJ A;  2Z9S A;  3EU4 A;  4JE1 A;  1ZL9 A;  5HR2 A;  1U3A A;  1PGT A;  2K6V A;  1BAY A;  5DBQ A;  2C1Y A;  1A24 A;  2MMO A;  3GX0 A;  1OKT A;  1F9M A;  3TOU A;  2LST A;  1THO A;  2A2P A;  4BVY A;  2E7P A;  5IM9 A;  3ZRE A;  1GTB A;  5G30 A;  5J4U A;  2FWE A;  4HOJ A;  1GWC A;  5G1K A;  4KDY A;  4NAX A;  2FLS A;  2L6D A;  5D73 A;  5DJL A;  5G5F A;  4Q5F A;  1JLV A;  3VWX A;  4ZXG A;  4N10 A;  3WT2 A;  1OC8 A;  2PGT A;  4PX1 A;  2H30 A;  3UVH A;  2LKU A;  4IS0 A;  1O8X A;  2V41 A;  1EEJ A;  1ERT A;  1Z5Y E;  1TU7 A;  4Z7X A;  4KA0 A;  3F9U A;  3UIW A;  3GN3 A;  1B48 A;  1ZYP A;  1AUC A;  9GSS A;  3HJO A;  4LA1 A;  2C4J A;  2AJQ B;  1TI1 A;  2PBJ A;  5IMC A;  4TXO A;  5A5K A;  1B8X A;  2VL2 A;  1NHO A;  5GSS A;  5CNW A;  4L8E A;  3HZ8 A;  3HVX A;  2F3M A;  1NHY A;  2VAF A;  3ZMK A;  1WWJ A;  2VD1 A;  2M80 A;  4FYU A;  4AJ6 A;  4K6X A;  1TOF A;  4ZB8 A;  1WIK A;  3KJY A;  3HZ4 A;  4GSN A;  3LYK A;  2R0G A;  4DSQ A;  4HQZ A;  4X4J A;  3DML A;  3ZZX A;  1PL1 A;  3L78 A;  4LMW A;  2YOI A;  2A2R A;  2WRT A;  1TTZ A;  4ECJ A;  2GVP A;  3IR4 A;  4RQR A;  3H93 A;  5KN3 A;  4WBJ A;  2GS3 A;  5JCG A;  5CP1 A;  3GL3 A;  5ID2 A;  3TKS C;  18GS A;  3TOT A;  3CQF A;  1XZO A;  4HDE A;  3LQ7 A;  3KP9 A;  2OBI A;  2H1A A;  3IRA A;  4I6X A;  4AF2 A;  4MCU A;  1GUK A;  1S3A A;  3D4M A;  1VF3 A;  1YEX A;  4MNN A;  4NHZ A;  1V57 A;  2G0F A;  4RI7 A;  4BVX B;  4LLR A;  4PNF A;  1O81 A;  3M3M A;  2IJY A;  4MPF A;  7GSS A;  4G9H A;  1QXH A;  1TK8 B;  3L9V A;  2VCV A;  1GTU A;  4DVC A;  4RI6 A;  1VGL A;  3LFL A;  2YAN A;  3IC4 A;  4OCE A;  1X9S B;  5HR3 A;  4ML6 A;  3M0F A;  4RQX A;  1THX A;  3MAK A;  1BQ7 A;  2OAD A;  4OD7 A;  1XFL A;  3ERW A;  19GS A;  5KEJ A;  5A4W A;  1AC1 A;  3HCZ A;  2B1K A;  3ZTL A;  5B7C A;  3VWU A;  2H0I A;  4EKZ A;  1ON4 A;  1FB0 A;  4YQV A;  3HKR A;  4ZL9 A;  3LW9 A;  3EVI A;  3MDK A;  3IV4 A;  1O85 A;  1ILO A;  2I1U A;  3VPQ A;  2V6K A;  2K9F A;  2HRK A;  3GSS A;  2WZ9 A;  2I4A A;  2KOK A;  4FYC A;  2H6Z A;  1K3Y A;  2PVQ A;  3TKR A;  5D8I A;  1DE1 A;  3HYP A;  2CA8 A;  4JU5 A;  2WB9 A;  1XXU A;  1O73 A;  3PR8 A;  2VCQ A;  1WPI A;  1B9X C;  4WEY A;  2X49 A;  1SJZ A;  2P0G A;  4HJM A;  3SBC A;  1M2A A;  3FHK A;  5KOX A;  2QA2 A;  1FHE A;  5CAX A;  5DAK A;  2PER A;  3N9J A;  2H6Y A;  2LJK A;  2MMZ A;  4MJC A;  1F6M C;  1EGO A;  2HZE B;  3O6T A;  3GNJ A;  1V98 A;  2H8L A;  5GST A;  3KD0 A;  4XRD A;  3GL5 A;  5B8A A;  3TKP A;  3DYR A;  1HD2 A;  2YZU A;  4X0X A;  2CVD A;  3F4T A;  3FK8 A;  3L0H A;  1EGR A;  1OAZ A;  2X8G A;  2LRN A;  4IBP A;  1GSY A;  4MJA A;  5ECI B;  4BIK A;  3A2V A;  1T00 A;  4HU9 A;  3UMA A;  1SK1 A;  1LU4 A;  4WR5 A;  2H76 A;  3DEX A;  2FHE A;  3TKS A;  4D73 B;  3F3R A;  2DSA A;  2N5F A;  1U6T A;  2HYX A;  2AB6 A;  3D5J A;  4E8H A;  1IYH A;  3Q19 A;  1JHB A;  1SK2 A;  2PN8 A;  1XWA A;  3UL3 A;  3F3Q A;  1XWC A;  8GSS A;  2DLX A;  2MBS A;  3DXB A;  1PQN A;  2HSH A;  4O5Q A;  1U88 A;  4V2N A;  4WXT A;  2H19 A;  5E59 A;  5KN2 A;  4BWQ A;  1TRW A;  2ALB A;  2R5G A;  4TR4 A;  3W8J A;  2JU5 A;  1H4O A;  3O3T A;  4TRX A;  3NOF A;  4IEL A;  2VL3 A;  4YH2 A;  1AQW A;  2YCD A;  2OAC A;  4K9Z A;  1T8E B;  5JCU A;  3NIV A;  5J3R A;  4EDY A;  1YY7 A;  4QL7 A;  5F0G A;  1B9Y C;  5EL8 A;  1USB A;  5J9B A;  2O87 A;  1XWB A;  2C0D A;  3KGK A;  1XOB A;  1G0T A;  3CYN A;  1TI3 A;  4I8B A;  3DRN A;  4PTS A;  2IMI A;  5DAK B;  4ECC A;  2X8C A;  3FEU A;  2RM6 A;  3GKX A;  3Q18 A;  4IP1 A;  3IXR A;  5IPG A;  4FIW A;  5D9V A;  3FZ9 A;  3VI7 A;  4PXO A;  2YPM A;  1UA5 A;  4IKH A;  4J57 E;  4TN8 A;  3ZYW A;  4I2U A;  3IA1 A;  5B8B A;  4PUA A;  4L0W A;  2YV7 A;  2PUK C;  3F6D A;  5CYY A;  4MZW A;  2XPD A;  2H0H A;  3QD9 A;  4KW6 A;  4GWR A;  2CAI A;  3KMO A;  1GP1 A;  3A2W A;  1WJK A;  5DAL B;  1Z7R A;  1GNE A;  3ZFB A;  5IMZ A;  2HSY A;  1YF1 A;  1DUG A;  1EOG A;  1XBS A;  4MPG A;  1OC3 A;  5IOX A;  4KSO A;  6GSS A;  2ZUP A;  5KN1 A;  1FOH A;  3I43 A;  4MMM A;  4IHU A;  2HZF A;  1FO5 A;  13GS A;  4HI7 A;  2VM1 A;  3C1R A;  3TRQ A;  3C73 A;  3WT1 A;  2LJR A;  2E2M A;  2GT6 A;  4ZB9 A;  1A8Y A;  1TU8 A;  4O7H A;  4YAV A;  2C3Q A;  1FVK A;  3VPT A;  2LJA A;  6GSV A;  3WYW A;  2YP6 A;  5AIV A;  4POK A;  2FA8 A;  4CY6 A;  1DE2 A;  1YJ6 A;  2FNO A;  5DVB A;  3GIX A;  1JFU A;  2L5L A;  1WE0 A;  2VD0 A;  2X4A A;  3FR9 A;  1JZR A;  2GQL A;  2IFQ B;  4DSR A;  2YN1 A;  2L4Q A;  2H1B A;  5EVO A;  4GST A;  3KH9 A;  1ERU A;  3ZRD A;  4NHW A;  1RW1 A;  2DJ3 A;  4ZIJ A;  3TRP A;  4XS4 B;  1ACV A;  4G19 A;  5DJM A;  1Q98 A;  3GUS A;  1R4W A;  4GTU A;  2R0P A;  1WMJ A;  2R2J A;  5ECR B;  4J56 E;  2B5Y A;  4KE3 A;  4POM A;  5GAN D;  3HDC A;  4EDZ A;  4FO5 A;  1PSQ A;  4PQ1 A;  3DD3 A;  4KAE A;  1ZZY A;  3FY7 A;  4OFT A;  1U87 A;  3KTL A;  3TJB A;  4PQI A;  1EV4 A;  1Z6M A;  4IN0 A;  5COH A;  1M2D A;  3LG6 A;  5CO3 A;  3QR6 A;  2IWT A;  2KP1 A;  3RBT A;  2G2Q A;  4ZBB A;  1WOU A;  1KEB A;  4PUF C;  3UAP A;  3F8U A;  4OMV A;  3LOR A;  3WGX A;  5G2Z A;  1X5D A;  4GXZ A;  3N5O A;  1M3I A;  1XG8 A;  5ELA A;  4KCE A;  2DC5 A;  4OO4 A;  5ECM B;  4BVX A;  1URM A;  2HE3 A;  2ZCT A;  4ZL7 A;  1K0C A;  4GLT A;  3KTB A;  2CV4 A;  3VK9 A;  1MDJ A;  2L4C A;  1PX7 A;  5IMV A;  2E0Q A;  4HSC X;  4XCS A;  2JAC A;  1TW9 A;  5ECS A;  5IMF A;  1GSU A;  1A0F A;  4POL A;  3D6I A;  2BTO T;  5H5S A;  3EU3 A;  3I9V 2;  2L59 A;  2OA7 A;  4XS6 A;  4V1A g;  1PFO A;  14GS A;  3RAZ A;  3ISO A;  2WGR A;  4ZB6 A;  2ON7 A;  3Q74 A;  3TB2 A;  1TP9 A;  3TJG A;  5HFG A;  2RII A;  3TUE A;  1WP0 A;  2N5A A;  3QFA C;  3UBK A;  3J7Y b;  4KB3 A;  1YQ1 A;  2VCX A;  4YQM A;  4ACS A;  3CRT A;  1TRS A;  2B5X A;  1BED A;  3GKN A;  3MSZ A;  1TJD A;  1TRV A;  3CTF A;  1EV9 A;  1K0M A;  1XVQ A;  4CHS A;  4E8E A;  3BOA A;  1M0U A;  5G5E A;  3L9U A;  4V2M A;  5HFI A;  3HA9 A;  4K8M A;  1HNB A;  5JWQ B;  2YWI A;  1GSQ A;  3E9J B;  1KTE A;  5J9C A;  3KZQ A;  2H70 A;  5J41 A;  5B6M A;  2VIM A;  2VLT A;  4BL7 B;  5HFK A;  4WR4 A;  2LQQ A;  6GSX A;  2NTO A;  2VM2 A;  4MF7 A;  2P5R A;  3TKQ A;  2JAD A;  3FZA A;  1OE8 A;  5BMU A;  2OBK A;  1SL0 B;  2AV4 A;  2HZE A;  11GS A;  4BA7 A;  4L5O A;  3GV1 A;  3US3 A;  1BX9 A;  4TVE A;  3TJK A;  4MF6 A;  2B1L A;  2IIY A;  3QAG A;  2GLR A;  1K3L A;  1ERV A;  2NPB A;  3F6F A;  1JZW A;  4GQC A;  3R2Q A;  2VL9 A;  3M8N A;  1SU9 A;  4F0C A;  2PVO C;  1T7P B;  2C8U A;  2OE0 A;  3CSJ A;  3F4R A;  5L71 A;  2WFC A;  4N0V A;  1TK0 B;  1MD3 A;  3LWA A;  3KIJ A;  2CZ3 A;  3HXS A;  4D73 A;  4J2F A;  2K8V A;  1YKA A;  4JRR A;  3FYG A;  3IK9 A;  4KF9 A;  2J9H A;  4AJ7 A;  1S3C A;  3GHA A;  5JWO B;  1E2Y A;  2NVL A;  2K8S A;  1I9D A;  1R5A A;  5DDL A;  1XWG A;  5AGY A;  4DEJ A;  2TIR A;  4NV2 A;  2LRT A;  2NBS A;  3W8S A;  4EVM A;  1ERW A;  2AHE A;  3HJP A;  4XIH A;  1MDK A;  5JWR B;  4ICY A;  3CSH A;  1XVW A;  1VF4 A;  1PL2 A;  1GH2 A;  2DJ0 A;  2GQK A;  2HSM A;  3EUR A;  2LV3 A;  1A23 A;  4FYB A;  4LL1 B;  5INY A;  2HRF A;  2R6K A;  2V1M A;  1TKD B;  1ZYN A;  5FWG A;  1TXX A;  4XHM A;  3MWH A;  3KP8 A;  4TR1 B;  3UAR A;  2VCZ A;  1ST9 A;  4JR4 A;  4DSS B;  1EZK A;  2YWO A;  1F2E A;  1EOH A;  4EIP A;  2HI7 A;  2O7K A;  3E3E A;  3KH7 A;  5G31 A;  5ECP B;  4KND A;  2WUL A;  3KXO A;  2XC2 A;  1OKD A;  2L57 A;  5A4U A;  3C8E A;  20GS A;  1PRX A;  1A2J A;  2WJU A;  4HZ4 A;  2A4H A;  2B6M A;  4OFM A;  2LS5 A;  4KSM A;  4G0L A;  3R3E A;  4G0K A;  5DQS A;  1T3B A;  2VO4 A;  5DAL A;  1T1V A;  3SWL A;  2EC4 A;  1MDI A;  1EP8 A;  3D21 A;  1H75 A;  3KEB A;  3UJ1 A;  3CMI A;  5IMD A;  2D2Z A;  1JZD A;  4YQU A;  4K2D A;  1Z9H A;  2V32 A;  3A2X A;  2HNL A;  4KH7 A;  3IE3 A;  3AY8 A;  1V9W A;  2M72 A;  1FW1 A;  1GLQ A;  3PPU A;  1AIU A;  1T4Z A;  3MIX A;  1GNW A;  5G1L A;  4HU7 A;  3IHQ A;  2H1D A;  5ECH B;  2WDU A;  3ZLP A;  4F82 A;  2DBC A;  3HHV A;  4ZL8 A;  2X64 A;  3ZIJ A;  2AAW A;  4KCA A;  3FW2 A;  4OWY A;  2H74 A;  1S3R A;  2MYG A;  2P5Q A;  3QCP A;  1SJI A;  2RUF A;  3RHC A;  1LBK A;  2OE1 A;  1SL2 B;  2IMK A;  2EIQ A;  1NSW A;  2PU9 C;  3TDG A;  3HVN A;  3VLN A;  3H79 A;  1G7O A;  3BD2 A;  1HNA A;  3J7Y k;  2IFQ A;  2JSY A;  2H66 A;  3FZ5 A;  4I5Q A;  4QQ7 A;  2JSZ A;  1GRX A;  2JZS A;  4XS4 A;  4FQU A;  4GSS A;  3M1G A;  4NWY A;  2DJ2 A;  4BPY A;  4EXJ A;  3FR3 A;  1AXD A;  3FRC A;  4N30 A;  4O32 A;  5CRH A;  3WGE A;  1SJ6 A;  2FUG 2;  2C0E A;  2X99 A;  3HVV A;  3UVT A;  1RK4 A;  3U5R E;  4HZ2 A;  3A5I A;  2WS2 A;  5EPF A;  2VLV A;  1ZYE A;  4EO3 A;  3V1W A;  2BJX A;  3CTG A;  3M9K A;  1GSE A;  2YV9 A;  3WD6 A;  1SD9 A;  3H8Q A;  4MLY A;  1FOV A;  3KMN A;  4BWS A;  2TRX A;  2OE3 A;  4NXI A;  4EF0 A;  3I6A A;  2VLU A;  3UEM A;  4TR0 A;  3IPZ A;  2CT6 A;  1PX6 A;  2DKI A;  2LTK A;  4X43 A;  3TKS E;  4MZC A;  3IK7 A;  1AW9 A;  2CX3 A;  4IQ1 A;  3EIN A;  3LXT A;  4XS1 A;  2R0C A;  3I69 A;  4IJ3 A;  3ZL5 A;  2O8V B;  2B5E A;  2IME A;  3A5W A;  2GGT A;  1O6J A;  1G6W A;  1SKR B;  2MZC A;  2RM5 A;  4ILF A;  1DBY A;  1AQV A;  5D96 A;  1V2A A;  3QFB C;  3E0U A;  2VUP A;  2B7J A;  4WF5 A;  2ZNM A;  3GFK A;  2CQ9 A;  2KLX A;  4K7I A;  4GCI A;  5D9T A;  4EUY A;  2I81 A;  3QAV A;  3GTU B;  4JR6 A;  3IAM 2;  3GA4 A;  3VI5 A;  3QMX A;  4JED A;  2H73 A;  3P8W A;  4TW5 A;  6GST A;  3GX8 A;  2V6O A;  1OVN A;  3GH9 A;  2XHF A;  4Z2T A;  3ERG A;  3DWV A;  1B4Q A;  1QFN A;  2V2G A;  4MDC A;  1XOA A;  4RUV A;  3C7M A;  2LNT A;  2YZH A;  1ZMA A;  1C72 A;  4Z2R A;  4XRA A;  5A4V A;  2LNS A;  3IC8 A;  1X9W B;  2O85 A;  1Y6E A;  3Q6O A;  3IBH A;  2LQO A;  2QC7 A;  4XTS A;  2BMX A;  3ZML A;  2ES7 A;  1XPV A;  2MBT A;  1F3A A;  2GDR A;  4MK3 A;  3F4S A;  1GUH A;  1PMT A;  2QKE A;  4MJE A;  1XW5 A;  4NMU A;  3ZFL A;  1GSS A;  4BL7 A;  4K7O A;  1PKW A;  2O89 A;  3ME8 A;  2C0F A;  4K1F A;  1YF0 A;  1SYR A;  4MF5 A;  1LJR A;  5IIZ A;  4K0G A;  3F63 A;  1OC9 B;  3DVW A;  2KUC A;  3ME7 A;  4ML1 A;  3H4K A;  3DVX A;  1S3D A;  2HRA A;  3W6G A;  1SKS B;  2HLS A;  4Q5R A;  1J0F A;  2H1G A;  2VOC A;  4V1A p;  4AJ8 A;  2TRC P;  5AIX A;  5HR0 A;  5D9X A;  4HEA 2;  1QMV A;  3KM6 A;  1M99 A;  4MA9 A;  1XW9 A;  1W4V A;  5DCG A;  2JZR A;  2AYT A;  5F8B A;  1CQG A;  4POB A;  4KDX A;  1M3J A;  3RPP A;  1FB6 A;  4KUN A;  2GQM A;  4G0I A;  1M7T A;  4K0N A;  1ZYQ B;  3GST A;  1MD4 A;  2CAQ A;  4EL1 A;  1G6Y A;  5ECK B;  3EWL A;  1FAA A;  3UOM A;  2DIY A;  4K5S A;  1N8J A;  3TGZ A;  4WET A;  1A2M A;  1I5G A;  2R3X A;  2EIO A;  1A0R P;  2N5B A;  1A8L A;  2YWM A;  1E6B A;  3QOU A;  1K0O A;  1PN0 A;  4X1U A;  1QUW A;  2H71 A;  3C1S A;  3L9S A;  2F51 A;  4IVF A;  5IOW A;  4O92 A;  4NPB A;  2J23 A;  3DKS A;  3ZIV A;  2GTU A;  1U3I A;  3MNG A;  2DJ1 A;  1VF2 A;  4JBB A;  3GYK A;  1J9B A;  1QQ2 A;  2YWN A;  2DMM A;  4PNG A;  4PGT A;  2AUV A;  1UC7 A;  4TR1 A;  4TXV A;  3GKM A;  4EC0 A;  3PGT A;  1VRS D;  3G7J A;  1AQX A;  1Z7P A;  3O76 A;  1CQH A;  4DSS A;  3DIE A;  1J08 A;  2H01 A;  4WKW A;  1SKW B;  5D9W A;  2NDO A;  5KOW A;  2IL3 A;  3BCK A;  4G10 A;  1F37 A; 
#chains in the Genus database with same CATH homology
 5HR1 A;  5C00 A;  3U6V A;  3HJM A;  1X5C A;  1A2L A;  4ZIL A;  4L0U A;  3BCI A;  3PH9 A;  1HYU A;  1K0N A;  4N0Z A;  1B4P A;  5EY6 A;  2RLI A;  2PMT A;  3RPN A;  1GL8 A;  1GUL A;  1GLP A;  1DSB A;  1MEK A;  4USS A;  3FR6 A;  5DCH A;  5E4W A;  4CDO A;  1WRY A;  3EPT A;  4BVY B;  3ED3 A;  3WGD A;  2EIR A;  5FHI A;  1UN2 A;  2JZT A;  2FWF A;  2LRC A;  4IJI A;  2FWH A;  1BJX A;  2H75 A;  1SYX A;  2KP2 A;  3APS A;  3KCM A;  3EC3 A;  3LSZ A;  1SK0 A;  5IO0 A;  1MTC A;  5AIS A;  5DQY A;  2F8A A;  2HT9 A;  1PD2 1;  3CXG A;  3D0Z A;  4F9Z A;  1GUM A;  1X5E A;  2FGX A;  3ZIT A;  4TR3 A;  4KX4 A;  4YKF A;  4FH8 A;  2VCW A;  3LXZ A;  3CRU A;  4TKY A;  1YEP A;  2I3Y A;  2REM A;  1GSF A;  2GSQ A;  2QGV A;  1PN9 A;  3HD5 A;  3APQ A;  2FWG A;  5H5Q A;  2KHP A;  4TXO B;  4K5R A;  1ABA A;  2RUE A;  4G2E A;  4HQS A;  4L5L A;  3S9F A;  2L6C A;  1O8W A;  4CY8 A;  2GT5 A;  2JL4 A;  4Z2U A;  3C71 A;  4ZBA A;  2QSI A;  2GST A;  5FT3 A;  4HS1 A;  2F8F A;  3G7Y A;  3PIN A;  3TCO A;  4WBR D;  3K8N A;  5C04 A;  1T4Y A;  2B3S A;  1R7H A;  4CW9 A;  1XWK A;  1Q4J A;  3DGQ A;  2PPT A;  4ISD A;  4LMV A;  4ZBD A;  4Q5Q A;  5IPH A;  2A4V A;  2F9S A;  5ID2 B;  2MMA A;  4IW9 A;  4YKG A;  3VWV A;  4MH2 A;  1VF1 A;  4I2T A;  3IOS A;  1R26 A;  2FCH A;  2B7K A;  5CRE A;  3QAW A;  3FMW A;  1HNC A;  2C3N A;  3L4N A;  3G9B A;  2H6X A;  4WF4 A;  2DML A;  4IGJ A;  3EMP A;  2H0G A;  6GSW A;  4GQF A;  4TOP A;  5LNK e;  5IO2 A;  3CSI A;  4EIQ A;  1EWX A;  12GS A;  4PQH A;  1K0A A;  1K3O A;  4Q5N A;  5GZZ B;  3IAS 2;  3EE2 A;  1EEM A;  3RDW A;  1V58 A;  4KDU A;  3D4T A;  2XBQ A;  2GZY A;  3GMF A;  1TRU A;  3UBL A;  1ZGN A;  5F05 A;  2C3T A;  2CVK A;  3BBY A;  5ECN B;  2E2G A;  4ECI A;  6GSU A;  1G7E A;  1M9B A;  5ECQ B;  2P31 A;  4K2X A;  3GTU A;  2CZ2 A;  4MP4 A;  4YAP A;  3ZVJ D;  1KNG A;  1W89 A;  1EP7 A;  3LEF A;  2XBI A;  5ECL B;  3G7I A;  4IP6 A;  4OO5 A;  3LJR A;  1AAZ A;  5F07 A;  3ZVJ A;  5LD0 A;  2IMD A;  4EE0 A;  4V2L A;  1NW2 A;  5AN1 A;  1YKC A;  1GTA A;  1GTI A;  1HQO A;  3BJ5 A;  2GSS A;  1OE7 A;  2ON5 A;  3NZN A;  4ECB A;  3FKF A;  3TRX A;  5HQP A;  5BRT A;  4MH3 A;  4F2I A;  4N11 A;  5J5N A;  4GRF A;  2FY6 A;  1PKZ A;  1Z3E A;  3MYD A;  1TDI A;  1FG4 A;  2GZZ A;  1R5P A;  5ECO B;  2GSR A;  4QL9 A;  2GZP A;  3TJJ A;  3HY2 A;  1SEN A;  4KGI A;  3LYP A;  1V40 A;  1RQM A;  1M2B A;  3A3T A;  3CBU A;  3H1N A;  5H5R A;  4I97 A;  2K18 A;  2R37 A;  5B6N A;  1ZOF A;  1BYE A;  1OC9 A;  4HJ2 A;  1F3B A;  2LUS A;  2R4V A;  3LGC A;  1ML6 A;  5CRG A;  3P90 A;  1K0B A;  1NM3 A;  2LEG A;  4ID0 A;  3GKK A;  16GS A;  2YJH A;  2HXK A;  4OFN A;  4O5R A;  1Y25 A;  4K7N A;  1YZX A;  3P2A A;  3TJF A;  2IN3 A;  2MMN A;  3ERF A;  10GS A;  2UZ8 A;  4NV5 A;  3QDN A;  3EMX A;  4JZQ A;  4H86 A;  2PWJ A;  3GRX A;  2DIZ A;  3OR5 A;  4F0B A;  2WCI A;  5ABR A;  1QGV A;  1Z6N A;  4MZB A;  1N2A A;  1O7U A;  5CRD A;  2VL2 C;  1ZCP A;  3VFI A;  4OCF A;  1XIY A;  2OKA A;  4A5P A;  2C0G A;  4ULX A;  4P3Y B;  2A2S A;  17GS A;  3D22 A;  3M9J A;  3IHG A;  5ENU A;  1XW6 A;  2IPA A;  2DKH A;  1GSD A;  3APO A;  2FD3 A;  2X8H A;  2YNX A;  4HUA A;  1OYJ A;  3P7X A;  2XPE A;  1QK8 A;  1SD8 A;  1UVZ A;  4AGS A;  3GH6 A;  3QPM A;  5D93 A;  4F03 A;  2VCT A;  3EYT A;  5KN0 A;  2QA1 A;  6GSY A;  5IQY A;  2C80 A;  2FA4 A;  3HVS A;  1KBN A;  5CRW A;  1M9A A;  1PA3 A;  2CVB A;  3JCM L;  1TK5 B;  1JLW A;  4O5U A;  5JCW A;  2H72 A;  2M46 A;  2IMF A;  3RHB A;  3VUR A;  5LCZ A;  1X9M B;  1X0R A;  5IMA A;  22GS A;  5GAP D;  1FVJ A;  1JZO A;  2I9H A;  2HFD A;  2YJ7 A;  4PUR A;  3F0I A;  1K0D A;  4GF0 A;  2DJK A;  5F06 A;  2CX4 A;  3IDV A;  4LL4 B;  4MAB A;  1XCC A;  3FZ4 A;  5ELG A;  1IYI A;  2HRN A;  3GUR A;  1YDK A;  3VWW A;  4IQA A;  2L5O A;  4MJB A;  1SL1 B;  1BG5 A;  2OJL A;  2DJJ A;  2Z9S A;  3EU4 A;  4JE1 A;  1ZL9 A;  5HR2 A;  1U3A A;  1PGT A;  2K6V A;  1BAY A;  5DBQ A;  2C1Y A;  1A24 A;  2MMO A;  3GX0 A;  1OKT A;  1F9M A;  3TOU A;  2LST A;  1THO A;  2A2P A;  4BVY A;  2E7P A;  5IM9 A;  3ZRE A;  1GTB A;  5G30 A;  5J4U A;  2FWE A;  4HOJ A;  1GWC A;  5G1K A;  4KDY A;  4NAX A;  2FLS A;  2L6D A;  5D73 A;  5DJL A;  5G5F A;  4Q5F A;  1JLV A;  3VWX A;  4ZXG A;  4N10 A;  3WT2 A;  1OC8 A;  2PGT A;  4PX1 A;  2H30 A;  3UVH A;  2LKU A;  4IS0 A;  1O8X A;  2V41 A;  1EEJ A;  1ERT A;  1Z5Y E;  1TU7 A;  4Z7X A;  4KA0 A;  3F9U A;  3UIW A;  3GN3 A;  1B48 A;  1ZYP A;  1AUC A;  9GSS A;  3HJO A;  4LA1 A;  2C4J A;  2AJQ B;  1TI1 A;  2PBJ A;  5IMC A;  4TXO A;  5A5K A;  1B8X A;  2VL2 A;  1NHO A;  5GSS A;  5CNW A;  4L8E A;  3HZ8 A;  3HVX A;  2F3M A;  1NHY A;  2VAF A;  3ZMK A;  1WWJ A;  2VD1 A;  2M80 A;  4FYU A;  4AJ6 A;  4K6X A;  1TOF A;  4ZB8 A;  1WIK A;  3KJY A;  3HZ4 A;  4GSN A;  3LYK A;  2R0G A;  4DSQ A;  4HQZ A;  4X4J A;  3DML A;  3ZZX A;  1PL1 A;  3L78 A;  4LMW A;  2YOI A;  2A2R A;  2WRT A;  1TTZ A;  4ECJ A;  2GVP A;  3IR4 A;  4RQR A;  3H93 A;  5KN3 A;  4WBJ A;  2GS3 A;  5JCG A;  5CP1 A;  3GL3 A;  5ID2 A;  3TKS C;  18GS A;  3TOT A;  1XZO A;  4HDE A;  3LQ7 A;  3KP9 A;  2OBI A;  2H1A A;  3IRA A;  4I6X A;  4AF2 A;  4MCU A;  1GUK A;  1S3A A;  3D4M A;  1VF3 A;  1YEX A;  4MNN A;  4NHZ A;  1V57 A;  2G0F A;  4RI7 A;  4BVX B;  4LLR A;  4PNF A;  1O81 A;  3M3M A;  2IJY A;  4MPF A;  7GSS A;  4G9H A;  1QXH A;  1TK8 B;  3L9V A;  2VCV A;  1GTU A;  4DVC A;  4RI6 A;  1VGL A;  3LFL A;  2YAN A;  3IC4 A;  4OCE A;  1X9S B;  5HR3 A;  4ML6 A;  3M0F A;  4RQX A;  1THX A;  3MAK A;  1BQ7 A;  2OAD A;  4OD7 A;  1XFL A;  3ERW A;  19GS A;  5KEJ A;  5A4W A;  1AC1 A;  3HCZ A;  2B1K A;  3ZTL A;  5B7C A;  3VWU A;  2H0I A;  4EKZ A;  1ON4 A;  1FB0 A;  4YQV A;  3HKR A;  4ZL9 A;  3LW9 A;  3EVI A;  3MDK A;  3IV4 A;  1O85 A;  1ILO A;  2I1U A;  3VPQ A;  2V6K A;  2K9F A;  2HRK A;  3GSS A;  2WZ9 A;  2I4A A;  2KOK A;  4FYC A;  2H6Z A;  1K3Y A;  2PVQ A;  3TKR A;  5D8I A;  1DE1 A;  3HYP A;  2CA8 A;  4JU5 A;  2WB9 A;  1XXU A;  1O73 A;  3PR8 A;  2VCQ A;  1WPI A;  1B9X C;  4WEY A;  2X49 A;  1SJZ A;  2P0G A;  4HJM A;  3SBC A;  1M2A A;  3FHK A;  5KOX A;  2QA2 A;  1FHE A;  5CAX A;  5DAK A;  2PER A;  3N9J A;  2H6Y A;  2LJK A;  2MMZ A;  4MJC A;  1F6M C;  1EGO A;  2HZE B;  3O6T A;  3GNJ A;  1V98 A;  2H8L A;  5GST A;  3KD0 A;  4XRD A;  3GL5 A;  5B8A A;  3TKP A;  3DYR A;  1HD2 A;  2YZU A;  4X0X A;  2CVD A;  3F4T A;  3FK8 A;  3L0H A;  1EGR A;  1OAZ A;  2X8G A;  2LRN A;  4IBP A;  1GSY A;  4MJA A;  5ECI B;  3A2V A;  1T00 A;  4HU9 A;  3UMA A;  1SK1 A;  1LU4 A;  4WR5 A;  2H76 A;  3DEX A;  2FHE A;  3TKS A;  4D73 B;  3F3R A;  2DSA A;  2N5F A;  1U6T A;  2HYX A;  2AB6 A;  3D5J A;  4E8H A;  1IYH A;  3Q19 A;  1JHB A;  1SK2 A;  2PN8 A;  1XWA A;  3UL3 A;  3F3Q A;  1XWC A;  8GSS A;  2DLX A;  2MBS A;  3DXB A;  1PQN A;  2HSH A;  4O5Q A;  1U88 A;  4V2N A;  4WXT A;  2H19 A;  5E59 A;  5KN2 A;  4BWQ A;  1TRW A;  2ALB A;  2R5G A;  4TR4 A;  3W8J A;  2JU5 A;  1H4O A;  3O3T A;  4TRX A;  3NOF A;  4IEL A;  2VL3 A;  4YH2 A;  1AQW A;  2YCD A;  2OAC A;  4K9Z A;  1T8E B;  5JCU A;  3NIV A;  5J3R A;  4EDY A;  1YY7 A;  4QL7 A;  5F0G A;  1B9Y C;  5EL8 A;  1USB A;  5J9B A;  2O87 A;  1XWB A;  2C0D A;  3KGK A;  1XOB A;  1G0T A;  3CYN A;  1TI3 A;  4I8B A;  3DRN A;  4PTS A;  2IMI A;  5DAK B;  4ECC A;  2X8C A;  3FEU A;  2RM6 A;  3GKX A;  3Q18 A;  4IP1 A;  3IXR A;  5IPG A;  4FIW A;  5D9V A;  3FZ9 A;  3VI7 A;  4PXO A;  2YPM A;  1UA5 A;  4IKH A;  4J57 E;  4TN8 A;  3ZYW A;  4I2U A;  3IA1 A;  5B8B A;  4PUA A;  4L0W A;  2YV7 A;  2PUK C;  3F6D A;  5CYY A;  4MZW A;  2XPD A;  2H0H A;  3QD9 A;  4KW6 A;  4GWR A;  2CAI A;  3KMO A;  1GP1 A;  3A2W A;  1WJK A;  5DAL B;  1Z7R A;  1GNE A;  3ZFB A;  5IMZ A;  2HSY A;  1YF1 A;  1DUG A;  1EOG A;  1XBS A;  4MPG A;  1OC3 A;  5IOX A;  4KSO A;  6GSS A;  2ZUP A;  5KN1 A;  1FOH A;  3I43 A;  4MMM A;  4IHU A;  2HZF A;  1FO5 A;  13GS A;  4HI7 A;  2VM1 A;  3C1R A;  3TRQ A;  3C73 A;  3WT1 A;  2LJR A;  2E2M A;  2GT6 A;  4ZB9 A;  1A8Y A;  1TU8 A;  4O7H A;  4YAV A;  2C3Q A;  1FVK A;  3VPT A;  2LJA A;  6GSV A;  3WYW A;  2YP6 A;  5AIV A;  4POK A;  2FA8 A;  4CY6 A;  1DE2 A;  1YJ6 A;  2FNO A;  5DVB A;  3GIX A;  1JFU A;  2L5L A;  1WE0 A;  2VD0 A;  2X4A A;  3FR9 A;  1JZR A;  2GQL A;  2IFQ B;  4DSR A;  2YN1 A;  2L4Q A;  2H1B A;  5EVO A;  4GST A;  3KH9 A;  1ERU A;  3ZRD A;  4NHW A;  1RW1 A;  2DJ3 A;  4ZIJ A;  3TRP A;  4XS4 B;  1ACV A;  4G19 A;  5DJM A;  1Q98 A;  3GUS A;  1R4W A;  4GTU A;  2R0P A;  1WMJ A;  2R2J A;  5ECR B;  4J56 E;  2B5Y A;  4KE3 A;  4POM A;  5GAN D;  3HDC A;  4EDZ A;  4FO5 A;  1PSQ A;  4PQ1 A;  3DD3 A;  4KAE A;  1ZZY A;  3FY7 A;  4OFT A;  1U87 A;  3KTL A;  3TJB A;  4PQI A;  1EV4 A;  1Z6M A;  4IN0 A;  5COH A;  1M2D A;  3LG6 A;  5CO3 A;  3QR6 A;  2IWT A;  2KP1 A;  3RBT A;  2G2Q A;  4ZBB A;  1WOU A;  1KEB A;  4PUF C;  3UAP A;  3F8U A;  4OMV A;  3LOR A;  3WGX A;  5G2Z A;  1X5D A;  4GXZ A;  3N5O A;  5ELA A;  4KCE A;  2DC5 A;  4OO4 A;  5ECM B;  4BVX A;  1URM A;  2HE3 A;  2ZCT A;  4ZL7 A;  1K0C A;  4GLT A;  3KTB A;  2CV4 A;  3VK9 A;  1MDJ A;  2L4C A;  1PX7 A;  5IMV A;  2E0Q A;  4XCS A;  2JAC A;  1TW9 A;  5ECS A;  5IMF A;  1GSU A;  1A0F A;  4POL A;  3D6I A;  2BTO T;  5H5S A;  3EU3 A;  3I9V 2;  2L59 A;  2OA7 A;  4XS6 A;  4V1A g;  14GS A;  3RAZ A;  3ISO A;  2WGR A;  4ZB6 A;  2ON7 A;  3Q74 A;  3TB2 A;  1TP9 A;  3TJG A;  5HFG A;  2RII A;  3TUE A;  1WP0 A;  2N5A A;  3QFA C;  3UBK A;  3J7Y b;  4KB3 A;  1YQ1 A;  2VCX A;  4YQM A;  4ACS A;  3CRT A;  1TRS A;  2B5X A;  1BED A;  3GKN A;  3MSZ A;  1TJD A;  1TRV A;  3CTF A;  1EV9 A;  1K0M A;  1XVQ A;  4CHS A;  4E8E A;  3BOA A;  1M0U A;  5G5E A;  3L9U A;  4V2M A;  5HFI A;  3HA9 A;  4K8M A;  1HNB A;  5JWQ B;  2YWI A;  1GSQ A;  3E9J B;  1KTE A;  5J9C A;  3KZQ A;  2H70 A;  5J41 A;  5B6M A;  2VIM A;  2VLT A;  4BL7 B;  5HFK A;  4WR4 A;  2LQQ A;  6GSX A;  2NTO A;  2VM2 A;  4MF7 A;  2P5R A;  3TKQ A;  2JAD A;  3FZA A;  1OE8 A;  5BMU A;  2OBK A;  1SL0 B;  2AV4 A;  2HZE A;  11GS A;  4BA7 A;  4L5O A;  3GV1 A;  3US3 A;  1BX9 A;  4TVE A;  3TJK A;  4MF6 A;  2B1L A;  2IIY A;  3QAG A;  2GLR A;  1K3L A;  1ERV A;  2NPB A;  3F6F A;  1JZW A;  4GQC A;  3R2Q A;  2VL9 A;  3M8N A;  1SU9 A;  4F0C A;  2PVO C;  1T7P B;  2C8U A;  2OE0 A;  3CSJ A;  3F4R A;  5L71 A;  2WFC A;  4N0V A;  1TK0 B;  1MD3 A;  3LWA A;  3KIJ A;  2CZ3 A;  3HXS A;  4D73 A;  4J2F A;  2K8V A;  1YKA A;  4JRR A;  3FYG A;  3IK9 A;  4KF9 A;  2J9H A;  4AJ7 A;  1S3C A;  3GHA A;  5JWO B;  1E2Y A;  2NVL A;  2K8S A;  1I9D A;  1R5A A;  5DDL A;  1XWG A;  5AGY A;  4DEJ A;  2TIR A;  4NV2 A;  2LRT A;  2NBS A;  3W8S A;  4EVM A;  1ERW A;  2AHE A;  3HJP A;  4XIH A;  1MDK A;  5JWR B;  4ICY A;  3CSH A;  1XVW A;  1VF4 A;  1PL2 A;  1GH2 A;  2DJ0 A;  2GQK A;  2HSM A;  3EUR A;  2LV3 A;  1A23 A;  4FYB A;  4LL1 B;  5INY A;  2HRF A;  2R6K A;  2V1M A;  1TKD B;  1ZYN A;  5FWG A;  1TXX A;  4XHM A;  3MWH A;  3KP8 A;  4TR1 B;  3UAR A;  2VCZ A;  1ST9 A;  4JR4 A;  4DSS B;  1EZK A;  2YWO A;  1F2E A;  1EOH A;  4EIP A;  2HI7 A;  2O7K A;  3E3E A;  3KH7 A;  5G31 A;  5ECP B;  4KND A;  2WUL A;  3KXO A;  2XC2 A;  1OKD A;  2L57 A;  5A4U A;  3C8E A;  20GS A;  1PRX A;  1A2J A;  2WJU A;  4HZ4 A;  2A4H A;  2B6M A;  4OFM A;  2LS5 A;  4KSM A;  4G0L A;  3R3E A;  4G0K A;  5DQS A;  1T3B A;  2VO4 A;  5DAL A;  1T1V A;  3SWL A;  2EC4 A;  1MDI A;  1EP8 A;  3D21 A;  1H75 A;  3KEB A;  3UJ1 A;  3CMI A;  5IMD A;  2D2Z A;  1JZD A;  4YQU A;  4K2D A;  1Z9H A;  2V32 A;  3A2X A;  2HNL A;  4KH7 A;  3IE3 A;  3AY8 A;  1V9W A;  2M72 A;  1FW1 A;  1GLQ A;  3PPU A;  1AIU A;  1T4Z A;  3MIX A;  1GNW A;  5G1L A;  4HU7 A;  3IHQ A;  2H1D A;  5ECH B;  2WDU A;  3ZLP A;  4F82 A;  2DBC A;  3HHV A;  4ZL8 A;  2X64 A;  3ZIJ A;  2AAW A;  4KCA A;  3FW2 A;  4OWY A;  2H74 A;  2MYG A;  2P5Q A;  3QCP A;  1SJI A;  2RUF A;  3RHC A;  1LBK A;  2OE1 A;  1SL2 B;  2IMK A;  2EIQ A;  1NSW A;  2PU9 C;  3TDG A;  3VLN A;  3H79 A;  1G7O A;  3BD2 A;  1HNA A;  3J7Y k;  2IFQ A;  2JSY A;  2H66 A;  3FZ5 A;  4I5Q A;  4QQ7 A;  2JSZ A;  1GRX A;  2JZS A;  4XS4 A;  4FQU A;  4GSS A;  3M1G A;  4NWY A;  2DJ2 A;  4BPY A;  4EXJ A;  3FR3 A;  1AXD A;  3FRC A;  4N30 A;  4O32 A;  5CRH A;  3WGE A;  1SJ6 A;  2FUG 2;  2C0E A;  2X99 A;  3HVV A;  3UVT A;  1RK4 A;  3U5R E;  4HZ2 A;  3A5I A;  2WS2 A;  5EPF A;  2VLV A;  1ZYE A;  4EO3 A;  3V1W A;  2BJX A;  3CTG A;  3M9K A;  1GSE A;  2YV9 A;  3WD6 A;  1SD9 A;  3H8Q A;  4MLY A;  1FOV A;  3KMN A;  4BWS A;  2TRX A;  2OE3 A;  4NXI A;  4EF0 A;  3I6A A;  2VLU A;  3UEM A;  4TR0 A;  3IPZ A;  2CT6 A;  1PX6 A;  2DKI A;  2LTK A;  4X43 A;  3TKS E;  4MZC A;  3IK7 A;  1AW9 A;  2CX3 A;  4IQ1 A;  3EIN A;  3LXT A;  4XS1 A;  2R0C A;  3I69 A;  4IJ3 A;  3ZL5 A;  2O8V B;  2B5E A;  2IME A;  3A5W A;  2GGT A;  1O6J A;  1G6W A;  1SKR B;  2MZC A;  2RM5 A;  4ILF A;  1DBY A;  1AQV A;  5D96 A;  1V2A A;  3QFB C;  3E0U A;  2VUP A;  2B7J A;  4WF5 A;  2ZNM A;  3GFK A;  2CQ9 A;  2KLX A;  4K7I A;  4GCI A;  5D9T A;  4EUY A;  2I81 A;  3QAV A;  3GTU B;  4JR6 A;  3IAM 2;  3GA4 A;  3VI5 A;  3QMX A;  4JED A;  2H73 A;  3P8W A;  4TW5 A;  6GST A;  3GX8 A;  2V6O A;  1OVN A;  3GH9 A;  2XHF A;  4Z2T A;  3ERG A;  3DWV A;  1B4Q A;  1QFN A;  2V2G A;  4MDC A;  1XOA A;  4RUV A;  3C7M A;  2LNT A;  2YZH A;  1ZMA A;  1C72 A;  4Z2R A;  4XRA A;  5A4V A;  2LNS A;  3IC8 A;  1X9W B;  2O85 A;  1Y6E A;  3Q6O A;  3IBH A;  2LQO A;  2QC7 A;  4XTS A;  2BMX A;  3ZML A;  2ES7 A;  1XPV A;  2MBT A;  1F3A A;  2GDR A;  4MK3 A;  3F4S A;  1GUH A;  1PMT A;  2QKE A;  4MJE A;  1XW5 A;  4NMU A;  3ZFL A;  1GSS A;  4BL7 A;  4K7O A;  1PKW A;  2O89 A;  3ME8 A;  2C0F A;  4K1F A;  1YF0 A;  1SYR A;  4MF5 A;  1LJR A;  5IIZ A;  4K0G A;  3F63 A;  1OC9 B;  3DVW A;  2KUC A;  3ME7 A;  4ML1 A;  3H4K A;  3DVX A;  1S3D A;  2HRA A;  3W6G A;  1SKS B;  2HLS A;  4Q5R A;  1J0F A;  2H1G A;  2VOC A;  4V1A p;  4AJ8 A;  2TRC P;  5AIX A;  5HR0 A;  5D9X A;  4HEA 2;  1QMV A;  3KM6 A;  1M99 A;  4MA9 A;  1XW9 A;  1W4V A;  5DCG A;  2JZR A;  2AYT A;  5F8B A;  1CQG A;  4POB A;  4KDX A;  3RPP A;  1FB6 A;  4KUN A;  2GQM A;  4G0I A;  1M7T A;  4K0N A;  1ZYQ B;  3GST A;  1MD4 A;  2CAQ A;  4EL1 A;  1G6Y A;  5ECK B;  3EWL A;  1FAA A;  3UOM A;  2DIY A;  4K5S A;  1N8J A;  3TGZ A;  4WET A;  1A2M A;  1I5G A;  2R3X A;  2EIO A;  1A0R P;  2N5B A;  1A8L A;  2YWM A;  1E6B A;  3QOU A;  1K0O A;  1PN0 A;  4X1U A;  1QUW A;  2H71 A;  3C1S A;  3L9S A;  2F51 A;  4IVF A;  5IOW A;  4O92 A;  4NPB A;  2J23 A;  3DKS A;  3ZIV A;  2GTU A;  1U3I A;  3MNG A;  2DJ1 A;  1VF2 A;  4JBB A;  3GYK A;  1J9B A;  1QQ2 A;  2YWN A;  2DMM A;  4PNG A;  4PGT A;  2AUV A;  1UC7 A;  4TR1 A;  4TXV A;  3GKM A;  4EC0 A;  3PGT A;  1VRS D;  3G7J A;  1AQX A;  1Z7P A;  3O76 A;  1CQH A;  4DSS A;  3DIE A;  1J08 A;  2H01 A;  4WKW A;  1SKW B;  5D9W A;  2NDO A;  5KOW A;  2IL3 A;  3BCK A;  4G10 A;  1F37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...