1NHOA

Structural and functional characterization of a thioredoxin-like protein from methanobacterium thermoautotrophicum
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
85
structure length
85
Chain Sequence
b'MVVNIEVFTSPTCPYCPMAIEVVDEAKKEFGDKIDVEKIDIMVDREKAIEYGLMAVPAIAINGVVRFVGAPSREELFEAINDEME'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable Thioredoxin
publication title Structural and Functional Characterization of a Thioredoxin-like Protein (Mt0807) from Methanobacterium thermoautotrophicum
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Oxidoreductase
total genus 13
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2002-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1nhoA00
1G6YA 1R7HA 1DUGA 3DIEA 2A2SA 4O92A 5FHIA 2C0DA 3C71A 1GTAA 1EEJA 2YP6A 3HYPA 3GNJA 3L9SA 5JCWA 3HJMA 3LGCA 2B5YA 4HZ2A 4EE0A 4GQCA 2VIMA 3O3TA 3ZVJA 2B5XA 5CNWA 1X9SB 5LCZA 2VCQA 2ALBA 1RK4A 2WFCA 3TCOA 2XPEA 1EGOA 1ZOFA 1K0CA 4ML1A 2PN8A 3APQA 4YAVA 2YWOA 5CYYA 3ZREA 1XIYA 4PUAA 3DYRA 4V2MA 2FCHA 3C73A 2IJYA 2YCDA 1T4YA 3FZ5A 1YQ1A 4LL1B 2DC5A 4PXOA 4IBPA 4J56E 1BYEA 1SKSB 3GH9A 1V40A 3LEFA 3ZL5A 1ERTA 2FA8A 1QXHA 1ILOA 1HYUA 5KN1A 2HT9A 4ZB6A 1NM3A 4WR4A 2H01A 4KNDA 2K6VA 4F82A 2AUVA 3VFIA 2I4AA 4JU5A 1OYJA 2OE1A 2M72A 4G9HA 3VURA 1OC9A 2PPTA 1PQNA 5A4UA 4ZXGA 4EXJA 1Q4JA 2FLSA 2YWNA 1K3LA 3HKRA 4MZBA 2K18A 1GLPA 1VF4A 2FUG2 3D0ZA 2KLXA 3PGTA 2H1BA 3KH9A 2H76A 1U3IA 5IMFA 4XS4A 2L59A 3M9JA 5B6MA 3PH9A 3ZIJA 1SD9A 1U6TA 2DJ2A 3F6FA 5ECIB 1V2AA 2GT5A 2GSTA 2OADA 4O5RA 1E2YA 4TR4A 4QL7A 3FR3A 1TU8A 1FG4A 3LYPA 4D73A 6GSSA 1TRSA 4GQFA 4ECBA 3L78A 3DKSA 3E3EA 1X9MB 4PURA 3M8NA 3WD6A 3OR5A 1PGTA 1UN2A 3KGKA 4KH7A 1BAYA 3GHAA 4N30A 1WP0A 4I2TA 1OC3A 1Q98A 4IN0A 5DALA 4POBA 4JR6A 2ON5A 1AQXA 1GL8A 3A3TA 3GA4A 3UARA 3GKNA 4WBRD 2B5EA 3VWWA 2GQMA 3CSJA 4KA0A 4YQMA 3O6TA 3NZNA 5J9BA 1XOBA 4JE1A 3RPNA 1XW6A 5LD0A 1TDIA 1XBSA 3GYKA 1B4QA 2VL9A 4CW9A 3DXBA 4V1Ag 2YWIA 2GSSA 3RHBA 2B6MA 5ELGA 2P0GA 2FWHA 5FT3A 3GSTA 2DMLA 3LG6A 2HZFA 2XC2A 4MH2A 2JSZA 4HQSA 2O87A 4NHZA 3CRUA 3EU3A 4JR4A 4FYUA 3LORA 3HXSA 2HZEB 2VCWA 2RM5A 2FWGA 1AQVA 2GQKA 5L71A 1NHYA 4RI6A 3QD9A 4FO5A 3D21A 3H79A 5ENUA 1M0UA 3TGZA 5AIVA 2YN1A 1QUWA 3LXTA 4K7OA 2OA7A 1USBA 3R2QA 1GH2A 3FKFA 2CAQA 3UIWA 2DJ1A 4HZ4A 2RUEA 3IE3A 1SYXA 4CDOA 2YZHA 4HJMA 1Z6NA 5ID2A 1YKAA 2XPDA 2D2ZA 3UMAA 3MDKA 3F4SA 3J7Yk 2IN3A 1PN9A 4MPFA 3IK9A 3TKPA 4KGIA 1X0RA 3VWUA 1A2JA 2B1KA 4AJ6A 3EURA 5IQYA 2H73A 4JRRA 2MMOA 1RW1A 3WT1A 2GSRA 2CVBA 2OE0A 3P90A 2C0GA 3TJGA 5DQYA 1MEKA 1W89A 3I69A 1YY7A 2R4VA 5H5QA 1JZWA 3D5JA 4WR5A 5HFGA 2HSHA 3TKSA 1GNWA 1G0TA 2K9FA 5EPFA 2YV7A 3V1WA 4FYCA 1LBKA 3FEUA 4CHSA 4KDXA 4K8MA 2WULA 2DJ0A 4I6XA 1GUKA 1WRYA 1CQHA 1K0BA 3C7MA 4N11A 1XWKA 2HRNA 1GWCA 3QOUA 1T4ZA 5G31A 5G2ZA 1PX6A 1XWBA 4J2FA 3TB2A 2WS2A 2LSTA 2C3NA 5D9WA 3PR8A 1I9DA 2XBIA 1WPIA 1SYRA 4WXTA 1YJ6A 3CTGA 1VGLA 1RQMA 1ZYQB 3UBLA 4BVYA 1MD3A 2GZPA 2HLSA 1WIKA 1T00A 1E6BA 1OC9B 4GXZA 4OCFA 4EC0A 3MAKA 3ERWA 4TR1B 22GSA 3RPPA 2V6OA 2H75A 2LQOA 4BPYA 3IC4A 4ECIA 1VF1A 1AC1A 5IIZA 1GP1A 1O7UA 3ZLPA 4G10A 2OACA 4LA1A 2RM6A 1G7EA 1EV4A 3PINA 3ZRDA 4XS4B 3C8EA 5JWOB 1QQ2A 4V1Ap 1Z6MA 1M2AA 2GZZA 2WJUA 2I1UA 2VLVA 5DBQA 1TRVA 1URMA 2O8VB 4KSOA 1NSWA 2YJ7A 3U6VA 2H1GA 1R26A 1R4WA 3GX8A 3DD3A 1J0FA 1HNBA 1XW9A 3IAM2 3MWHA 1YEPA 5J5NA 4E8HA 2LJKA 2GDRA 2NDOA 3GFKA 2JSYA 2CZ3A 4L0WA 5ELAA 1MTCA 1K0MA 2C0FA 2HI7A 4HQZA 5KN3A 3J7Yb 3O76A 1TI3A 5DALB 1YF0A 3Q18A 3DGQA 2PGTA 1O85A 2IMIA 3CSHA 5EVOA 1OKTA 2LEGA 2DSAA 2L6DA 3CXGA 3TDGA 4KX4A 5IMCA 4ZL9A 1SD8A 2WGRA 1GLQA 1QK8A 3GN3A 3RHCA 4TOPA 4MJCA 2PBJA 1CQGA 2YNXA 4EVMA 1FB6A 4KDUA 4NAXA 5D9TA 4IP1A 3UJ1A 1KEBA 3VWXA 4AF2A 1O81A 2LNTA 4GSNA 1HQOA 1SJIA 3ZITA 5B7CA 2ZNMA 3BD2A 4GWRA 1SU9A 2AAWA 4MJBA 13GSA 1PRXA 1SK1A 1TOFA 4Q5NA 4OWYA 4OD7A 3I9V2 3P8WA 3I43A 4MJEA 4PX1A 5B8BA 5ECLB 3KCMA 4EL1A 3QFBC 4IJ3A 5ECKB 1WOUA 1B4PA 5IMVA 4WETA 2WB9A 4TR3A 4MP4A 5JWQB 2MMAA 1MDKA 4Q5FA 3F9UA 4KUNA 2GZYA 1F3AA 1BQ7A 4PGTA 2IMKA 1GNEA 5ECOB 4JZQA 4L5OA 2GGTA 4TW5A 3IA1A 4IW9A 1FOVA 2JACA 4ZB9A 1ZL9A 3D22A 19GSA 1JFUA 3KMNA 4O7HA 2VCTA 2R3XA 3A2XA 5ECPB 3KTLA 5ECMB 4BA7A 2IMEA 5ID2B 2JU5A 1SK0A 3ZIVA 2QSIA 4IQAA 2CX4A 1XVQA 3L4NA 4AGSA 2C8UA 4HDEA 4EUYA 3L0HA 2YV9A 1FO5A 1T7PB 1DE1A 1ZCPA 1FW1A 4NWYA 2WDUA 6GSXA 4DSRA 1BG5A 2H70A 5DAKA 3HZ8A 5CRDA 1F2EA 3Q6OA 2FWEA 1PKWA 2PU9C 5CRWA 2NBSA 1U88A 1V58A 3CTFA 1AAZA 1WWJA 4KW6A 1XCCA 2O85A 1QMVA 2LJRA 5E4WA 4XRDA 2N5AA 5GSTA 2PERA 1SKWB 3KMOA 4MLYA 4Z7XA 1GSDA 3TJBA 1M9AA 1JZOA 2NVLA 4POLA 3A5WA 4DSSA 4XS6A 1A24A 3CMIA 1XXUA 2RUFA 4KDYA 3QCPA 4DVCA 1TKDB 2JZRA 4K6XA 1Z7PA 1JLVA 6GSYA 3TRPA 3FY7A 1LU4A 4K2DA 1Z5YE 3ISOA 2OJLA 1K0DA 4GSSA 4ZBBA 2P5QA 2L4CA 1F6MC 1HNAA 3IOSA 1K3OA 1OE8A 3F3RA 1AW9A 2F8FA 4G19A 2IL3A 2LUSA 3G7JA 3W8JA 3HVSA 4TXOA 2OBKA 5KN0A 2B7KA 1AXDA 3WGXA 3KXOA 4XIHA 1AIUA 2GVPA 5A4VA 3KD0A 4JBBA 3F8UA 4MCUA 2F51A 3HZ4A 3TKQA 4EDZA 3DRNA 4RQRA 2EIQA 4WKWA 3NIVA 3UVTA 4F9ZA 4RUVA 3MNGA 1SL2B 2OKAA 4NV5A 3E9JB 3E0UA 3VWVA 5F0GA 3GL5A 2L6CA 1T1VA 1TW9A 3ME7A 4YQUA 3HJPA 3SWLA 5DCHA 1SENA 3HDCA 3GKMA 2L57A 1UVZA 4X1UA 5IPHA 4V2LA 3EINA 1AQWA 4XTSA 4F0CA 1JZRA 4GCIA 2IFQA 5ECNB 2GTUA 5GSSA 2O89A 2EIRA 5DCGA 1TK8B 1ERVA 3HJOA 4IQ1A 5CO3A 2H6ZA 1MDIA 2CZ2A 4MF5A 2IMDA 1TXXA 1ON4A 1G6WA 2VCVA 2E0QA 3GIXA 2CVDA 1M2DA 1T8EB 4MH3A 2VCZA 2DIYA 1EV9A 18GSA 2C0EA 1EZKA 2A4VA 1XFLA 6GSUA 2H8LA 2H66A 1ML6A 3C1RA 2M80A 5HFKA 2C3TA 3DVXA 2YPMA 4POKA 3IBHA 1PKZA 3CSIA 2FGXA 3KJYA 2ES7A 2H74A 3HVVA 1B8XA 4MZWA 3TJFA 1M9BA 5B8AA 1ACVA 2QKEA 2B3SA 4OO4A 3TJJA 1EP8A 4ML6A 3TRQA 4Q5RA 1O8XA 4I8BA 3UL3A 5JCUA 2GS3A 4ECJA 4K1FA 3QAGA 4MPGA 3G7YA 4IGJA 5F05A 1FHEA 2F9SA 17GSA 2H1DA 3IV4A 1A2LA 1VF3A 3GKXA 4FH8A 1TI1A 4F03A 4I5QA 3MSZA 3F4TA 3HHVA 5HR3A 2JADA 3AY8A 3EE2A 3IAS2 4MK3A 3CRTA 1DBYA 3KZQA 5FWGA 3GTUA 1YF1A 2DLXA 2OE3A 3LWAA 5HFIA 3F0IA 1FVJA 1X5DA 2IMFA 2H6YA 2V41A 1F9MA 3GSSA 5CREA 2MYGA 4I2UA 2V2GA 1OKDA 1OC8A 2GSQA 2LTKA 2L5LA 2P5RA 2PVQA 1YKCA 1EP7A 2HNLA 3TRXA 3FK8A 3GMFA 2E7PA 2G2QA 4TR0A 5ECRB 2KP2A 5EL8A 5COHA 4MABA 2VM1A 1PX7A 1TRWA 5HR1A 2F3MA 1MDJA 2EIOA 1X9WB 1S3CA 5DJMA 1THOA 4PNFA 10GSA 3IK7A 4ULXA 1O6JA 5D93A 1Z7RA 2VCXA 4BVXA 4MDCA 4OFNA 1LJRA 1Z3EA 5DAKB 1A8YA 1EWXA 1SL1B 2IWTA 4ACSA 5IMAA 1ZYEA 4HOJA 2RLIA 3D4TA 1N8JA 5CAXA 1FVKA 2E2MA 4ECCA 2LRCA 3RDWA 2YJHA 1ZGNA 2B7JA 2HRFA 4YAPA 2H6XA 3G7IA 1B48A 3CBUA 5D96A 4RQXA 4ISDA 1F37A 2C80A 1WMJA 3EVIA 4DSSB 2N5FA 3KEBA 4IS0A 4D73B 1GUHA 5J41A 1X5EA 5IO0A 2CT6A 3US3A 2H0GA 2K8SA 2AB6A 2E2GA 4NXIA 4XCSA 3FYGA 2HZEA 5DVBA 4PUFC 1EGRA 3VPTA 1TJDA 2LJAA 1TK0B 5KEJA 4LL4B 2DMMA 1UC7A 4POMA 3IR4A 3EWLA 4TXOB 3UBKA 1ERWA 1K0AA 1R5PA 4IELA 1V9WA 5DJLA 2A2RA 2VO4A 3ZTLA 1FAAA 2X64A 4MA9A 4G2EA 3KH7A 2YZUA 3EU4A 6GSTA 5J9CA 2I3YA 2VL3A 5AIXA 1TP9A 4K7IA 1VF2A 1AUCA 4TXVA 4HU7A 1S3AA 4MMMA 2HXKA 2WRTA 4FIWA 5IOWA 2HFDA 2FHEA 4PQ1A 2JZSA 4QL9A 1GSEA 1GSUA 3Q19A 8GSSA 3LFLA 3IRAA 3KP8A 1XW5A 3BCKA 2FA4A 1KNGA 3P7XA 2K8VA 2LRTA 1J9BA 4WEYA 4GF0A 3F3QA 1PSQA 1A0FA 1OE7A 3G9BA 5KN2A 2IFQB 2H0IA 2BJXA 3FR9A 1A8LA 2HYXA 2J9HA 3IPZA 14GSA 4TVEA 4N10A 4MF6A 4AJ8A 2L4QA 1WJKA 1EOHA 4HS1A 4NV2A 2CAIA 2FNOA 3RAZA 4EDYA 2X8CA 1A23A 2VLTA 4H86A 4WF4A 3F4RA 3HA9A 5D9VA 1SKRB 4HI7A 3CYNA 4N0VA 2DJKA 2PMTA 3LSZA 2YOIA 4ZB8A 2AYTA 4FYBA 3TKRA 3BCIA 4IHUA 2KUCA 1G7OA 2M46A 3DWVA 4HEA2 3QMXA 1O73A 5H5SA 3ERFA 2MBTA 4V2NA 1J08A 1M7TA 3TOTA 1U3AA 5IMZA 1GRXA 1ABAA 1ZZYA 1GSYA 1GSSA 5DDLA 2H71A 3H1NA 4DSQA 4TRXA 5D73A 3ZVJD 2MBSA 1H4OA 3ZMLA 4ZL8A 3IXRA 2XBQA 3W8SA 5D8IA 20GSA 2TRCP 4X43A 1YZXA 2GT6A 4KE3A 2ON7A 5G5FA 1K0OA 1YDKA 4TR1A 2VOCA 2CV4A 3IDVA 4KCEA 5JCGA 5CP1A 5AN1A 1V57A 4ILFA 1SJ6A 5H5RA 4EO3A 1OAZA 3BOAA 2PVOC 4YH2A 2DJJA 1NHOA 1UA5A 2LRNA 3QR6A 3VK9A 2VD0A 5EY6A 2H1AA 4K9ZA 2MZCA 3L9VA 5DQSA 3C1SA 1GULA 3TJKA 3FZ4A 1GUMA 3ZFLA 5HQPA 3GTUB 1IYHA 3FRCA 12GSA 3HY2A 5IPGA 1U87A 5G1KA 3D6IA 4HJ2A 3QDNA 3HVXA 2IPAA 2H30A 1R5AA 4IVFA 2VL2C 1WE0A 2N5BA 3DEXA 2REMA 16GSA 3VPQA 1GTUA 1IYIA 1M2BA 3WYWA 4K0GA 1HNCA 2R2JA 2WZ9A 1MD4A 3DVWA 5ABRA 2MMZA 1Z9HA 3QAVA 2VUPA 3EMPA 2LQQA 3SBCA 3U5RE 3N5OA 3DMLA 5D9XA 3WGDA 3LQ7A 1PD21 3JCML 5A5KA 3KP9A 3VI5A 5G1LA 4MJAA 1ST9A 3BJ5A 1XWAA 4DEJA 2G0FA 2VM2A 2C4JA 3UAPA 1GTIA 1PL2A 1DSBA 3H4KA 3S9FA 3P2AA 4KSMA 2OBIA 2PUKC 1SJZA 4GRFA 2DBCA 4Q5QA 3ZZXA 3EYTA 2X8HA 3QFAC 4NPBA 2CVKA 1SL0B 4N0ZA 3LXZA 5F06A 3GV1A 1X5CA 2J23A 4NHWA 3TKSC 3N9JA 1H75A 2IIYA 2VLUA 4OFTA 2BTOT 3UEMA 1A2MA 1GSQA 4P3YB 1GTBA 3WT2A 2VAFA 5LNKe 4L0UA 3HD5A 2BMXA 4ZILA 2YWMA 4TN8A 1QFNA 2LS5A 3GL3A 3ZYWA 2NPBA 4ZIJA 1B9XC 4E8EA 1B9YC 1I5GA 2DJ3A 3H8QA 3L9UA 4GLTA 3M0FA 5HR0A 4JEDA 1YEXA 2O7KA 5J4UA 4OFMA 1TU7A 2B1LA 4BL7A 1T3BA 2R37A 2VL2A 4XS1A 4HUAA 3TUEA 11GSA 2R6KA 3EC3A 2F8AA 1K0NA 1PL1A 3KM6A 3KTBA 4HU9A 2X8GA 3ME8A 4O32A 4BWSA 3TOUA 4GSTA 1VRSD 4IJIA 4WBJA 4EKZA 2LKUA 1N2AA 1PA3A 5GAND 3HCZA 1XVWA 3K8NA 2CA8A 2CX3A 2KOKA 3FW2A 1JHBA 5ECQB 3APOA 2Z9SA 2LNSA 4LLRA 1PMTA 1QGVA 2X99A 2GLRA 1FB0A 3NOFA 3EMXA 2WCIA 4RI7A 2FD3A 1NW2A 3Q74A 3GUSA 4OO5A 2R5GA 4J57E 5IMDA 7GSSA 5ECSA 3LYKA 4F2IA 2MMNA 9GSSA 4ZL7A 3RBTA 1THXA 4YQVA 5GZZB 4LMWA 3A2WA 3I6AA 4I97A 5G30A 4LMVA 2HSYA 4BWQA 2ZUPA 4EF0A 2NTOA 3H93A 2KP1A 4F0BA 3ERGA 2AHEA 2L5OA 3QPMA 4MZCA 4X0XA 4MF7A 2ZCTA 5F8BA 4TKYA 1Y6EA 2YANA 5JWRB 1KBNA 3VLNA 4IKHA 2AV4A 3ZFBA 3VI7A 2RIIA 4IP6A 1V98A 4OMVA 4NMUA 3UOMA 1XOAA 1BX9A 1TRUA 1K3YA 3APSA 1A0RP 3QAWA 5G5EA 4XHMA 3TKSE 1F3BA 5J3RA 4K0NA 4PQIA 5IOXA 3FR6A 1TTZA 2HE3A 1ERUA 2V32A 2H72A 1JZDA 1SK2A 5GAPD 3LJRA 1M99A 4L8EA 2XHFA 2P31A 2H0HA 2FWFA 2DIZA 2JZTA 2TIRA 2JL4A 3GURA 5E59A 3FHKA 2PWJA 2QC7A 2KHPA 2LV3A 1XWGA 1S3DA 6GSVA 1DE2A 4OCEA 3ED3A 3ZMKA 3F63A 1XPVA 5B6NA 3GH6A 5ECHB 5INYA 3GRXA 2VD1A 5A4WA 1W4VA 3M3MA 5IM9A 4AJ7A 1ZMAA 3FZ9A 3GX0A 4L5LA 1Y25A 4K7NA 3FZAA 2EC4A 1C72A 5IO2A 4KAEA 1JLWA 5AISA 4ZBAA 6GSWA 3W6GA 4PNGA 3BBYA 1KTEA 4ID0A 5C00A 5AGYA 2FY6A 2QGVA 1XWCA 1O8WA 3M1GA 3WGEA 3D4MA 3F6DA 1BJXA 4KCAA 4ZBDA 4KB3A 3UVHA 4XRAA 1XZOA 5CRGA 3A2VA 3KIJA 3GKKA 4QQ7A 2TRXA 5CRHA 3M9KA 5C04A 3IHQA 2I81A 4PQHA 1HD2A 4GTUA 2H19A 1TK5B 2C3QA 5HR2A 1OVNA 2I9HA 1GSFA 2AJQB 2GQLA 2C1YA 2V1MA 1BEDA 1EOGA 2V6KA 5F07A 2CQ9A 4WF5A 1EEMA
chains in the Genus database with same CATH superfamily
1G6YA 3A5IA 1R7HA 1DUGA 3DIEA 2A2SA 4O92A 5FHIA 2C0DA 3C71A 1GTAA 1EEJA 2YP6A 3HYPA 3GNJA 3L9SA 5JCWA 3HJMA 3LGCA 2B5YA 4HZ2A 4EE0A 4GQCA 2VIMA 3O3TA 3ZVJA 2B5XA 5CNWA 1X9SB 5LCZA 2VCQA 2ALBA 1RK4A 2WFCA 3TCOA 2XPEA 1EGOA 1ZOFA 1K0CA 4ML1A 2PN8A 4CY6A 3APQA 4YAVA 2YWOA 5CYYA 3ZREA 1XIYA 4PUAA 3DYRA 4V2MA 2FCHA 3C73A 2IJYA 2YCDA 1T4YA 3FZ5A 4BL7B 1YQ1A 4K5RA 4LL1B 2DC5A 3LW9A 4PXOA 4IBPA 4J56E 1BYEA 1SKSB 3GH9A 1V40A 3LEFA 3ZL5A 1ERTA 2FA8A 1QXHA 1ILOA 1HYUA 5KN1A 2HT9A 4ZB6A 1NM3A 4WR4A 2H01A 4KNDA 2K6VA 4F82A 2AUVA 3VFIA 2I4AA 4JU5A 1OYJA 2OE1A 2M72A 4G9HA 3VURA 1OC9A 2PPTA 1PQNA 5A4UA 4ZXGA 4EXJA 1Q4JA 3EPTA 2FLSA 2YWNA 1K3LA 3HKRA 4MZBA 2K18A 1GLPA 1VF4A 2FUG2 3D0ZA 2KLXA 3PGTA 2H1BA 3KH9A 2H76A 1U3IA 5IMFA 4XS4A 2L59A 3M9JA 5B6MA 3PH9A 3ZIJA 1SD9A 1U6TA 2DJ2A 3F6FA 5ECIB 1V2AA 2GT5A 2GSTA 2OADA 4O5RA 1E2YA 4TR4A 4QL7A 3FR3A 1TU8A 1FG4A 3LYPA 4D73A 6GSSA 1TRSA 4GQFA 4ECBA 3L78A 3DKSA 3E3EA 1X9MB 4PURA 3M8NA 3WD6A 3OR5A 1PGTA 1UN2A 3KGKA 4KH7A 1BAYA 3GHAA 4N30A 1WP0A 4I2TA 1OC3A 1Q98A 4IN0A 5DALA 4POBA 4JR6A 2ON5A 1AQXA 1GL8A 3A3TA 3GA4A 3UARA 3GKNA 4WBRD 2B5EA 3VWWA 2GQMA 3CSJA 4KA0A 4YQMA 3O6TA 3NZNA 5J9BA 1XOBA 4JE1A 3RPNA 1XW6A 5LD0A 1TDIA 1XBSA 3GYKA 1B4QA 2VL9A 4CW9A 3DXBA 4V1Ag 2YWIA 2GSSA 3RHBA 2B6MA 5ELGA 2P0GA 2FWHA 5FT3A 5BRTA 3GSTA 2DMLA 3LG6A 2HZFA 2XC2A 4MH2A 2JSZA 4HQSA 2O87A 4NHZA 3CRUA 3EU3A 4JR4A 4FYUA 3LORA 3HXSA 2HZEB 2VCWA 2RM5A 2FWGA 1AQVA 2GQKA 5L71A 1NHYA 4RI6A 3QD9A 4ICYA 4FO5A 3D21A 3H79A 5ENUA 1M0UA 3TGZA 5AIVA 2YN1A 1QUWA 3LXTA 4K7OA 2OA7A 1USBA 3R2QA 1GH2A 3FKFA 2CAQA 3UIWA 2DJ1A 4HZ4A 2RUEA 3IE3A 1SYXA 4CDOA 4G0LA 2YZHA 4HJMA 1Z6NA 5ID2A 1YKAA 2XPDA 2D2ZA 3UMAA 3MDKA 3F4SA 3J7Yk 2IN3A 1PN9A 4MPFA 3IK9A 3TKPA 4KGIA 1X0RA 3VWUA 1A2JA 2B1KA 4AJ6A 3EURA 4YKFA 5IQYA 2H73A 4JRRA 2MMOA 1RW1A 3WT1A 2GSRA 2CVBA 2OE0A 3P90A 2C0GA 3TJGA 5DQYA 1MEKA 1W89A 3I69A 1YY7A 2R4VA 2R0GA 5H5QA 1JZWA 3D5JA 4WR5A 5HFGA 2HSHA 3TKSA 1GNWA 1G0TA 2K9FA 5EPFA 2YV7A 3V1WA 4FYCA 1LBKA 3FEUA 4CHSA 4KDXA 4K8MA 1ZYNA 2WULA 2DJ0A 2HRKA 4I6XA 5BMUA 1GUKA 1WRYA 1CQHA 1K0BA 3C7MA 4N11A 1XWKA 2HRNA 1GWCA 3QOUA 1T4ZA 5G31A 5G2ZA 1PX6A 1XWBA 4J2FA 3TB2A 2WS2A 2LSTA 2C3NA 5D9WA 3PR8A 1I9DA 2XBIA 1WPIA 1SYRA 4WXTA 1YJ6A 3CTGA 1VGLA 1RQMA 1ZYQB 3UBLA 4BVYA 1MD3A 2GZPA 2HLSA 1WIKA 1T00A 1E6BA 1OC9B 4GXZA 4OCFA 4EC0A 3MAKA 3ERWA 4TR1B 22GSA 3RPPA 2V6OA 2H75A 2LQOA 4BPYA 3IC4A 4ECIA 1VF1A 1AC1A 5IIZA 1GP1A 1O7UA 3ZLPA 4G10A 2OACA 4LA1A 2RM6A 1G7EA 1EV4A 3PINA 3ZRDA 4XS4B 3C8EA 5JWOB 1QQ2A 4V1Ap 1Z6MA 1M2AA 2GZZA 2WJUA 2I1UA 2VLVA 5DBQA 1TRVA 1URMA 2O8VB 4KSOA 4Z2RA 1NSWA 2YJ7A 3U6VA 2H1GA 1R26A 1R4WA 3GX8A 3DD3A 1J0FA 1HNBA 1XW9A 3IAM2 3MWHA 1YEPA 5J5NA 2UZ8A 4E8HA 2LJKA 2GDRA 2NDOA 3GFKA 2JSYA 2CZ3A 4L0WA 5ELAA 1MTCA 1K0MA 2C0FA 2HI7A 4HQZA 5KN3A 3J7Yb 3O76A 1TI3A 5DALB 1YF0A 3Q18A 3DGQA 2PGTA 1O85A 2IMIA 3CSHA 5EVOA 1OKTA 2LEGA 2DSAA 2L6DA 3CXGA 3TDGA 4KX4A 5IMCA 4ZL9A 1SD8A 2WGRA 1GLQA 1QK8A 3GN3A 3RHCA 4TOPA 4MJCA 2PBJA 1CQGA 2R0CA 2YNXA 4EVMA 1FB6A 4KDUA 4NAXA 5D9TA 4IP1A 3UJ1A 1KEBA 3VWXA 4AF2A 1O81A 2LNTA 4GSNA 1HQOA 1SJIA 3ZITA 5B7CA 2ZNMA 3BD2A 4GWRA 1SU9A 2AAWA 4MJBA 13GSA 1PRXA 1SK1A 1TOFA 4Q5NA 4OWYA 4OD7A 3I9V2 3P8WA 3I43A 4MJEA 4PX1A 5B8BA 5ECLB 3KCMA 4EL1A 3QFBC 4G0KA 4IJ3A 5ECKB 1WOUA 1B4PA 5IMVA 4WETA 2WB9A 4TR3A 4MP4A 5JWQB 2MMAA 1MDKA 4Q5FA 3F9UA 4KUNA 2GZYA 1F3AA 1BQ7A 4PGTA 2IMKA 1GNEA 1PFOA 5ECOB 4JZQA 4L5OA 2GGTA 4TW5A 3IA1A 4IW9A 1FOVA 2JACA 4ZB9A 1ZL9A 3D22A 19GSA 3FMWA 1JFUA 3KMNA 4O7HA 2VCTA 2R3XA 3A2XA 5ECPB 3KTLA 5ECMB 4BA7A 2IMEA 3PPUA 5ID2B 2JU5A 1SK0A 3ZIVA 2QSIA 4IQAA 2CX4A 1XVQA 3L4NA 4AGSA 2C8UA 4HDEA 4EUYA 3L0HA 2YV9A 1FO5A 1T7PB 1DE1A 1ZCPA 4EIQA 1FW1A 4NWYA 2WDUA 6GSXA 4DSRA 1BG5A 2H70A 5DAKA 3HZ8A 5CRDA 1F2EA 3Q6OA 2FWEA 1PKWA 2PU9C 5CRWA 2NBSA 1U88A 1V58A 3CTFA 1AAZA 1WWJA 4KW6A 1XCCA 2O85A 1QMVA 2LJRA 5E4WA 4XRDA 2N5AA 5GSTA 2PERA 1SKWB 3KMOA 4MLYA 4Z7XA 1GSDA 3TJBA 1M9AA 1JZOA 2NVLA 3HVNA 4POLA 2R0PA 3A5WA 4DSSA 4XS6A 1A24A 3CMIA 1XXUA 2RUFA 4KDYA 3QCPA 4DVCA 1TKDB 2JZRA 4K6XA 4K2XA 1Z7PA 1JLVA 6GSYA 3TRPA 3FY7A 1LU4A 4K2DA 1Z5YE 3ISOA 2OJLA 1K0DA 4GSSA 4ZBBA 2P5QA 2L4CA 1F6MC 1HNAA 3IOSA 1K3OA 1OE8A 4K5SA 3F3RA 1AW9A 2F8FA 4G19A 2IL3A 2LUSA 2X49A 3G7JA 4BVYB 3W8JA 3HVSA 4TXOA 2OBKA 5KN0A 2B7KA 1AXDA 3WGXA 3KXOA 4XIHA 1AIUA 2GVPA 5A4VA 3KD0A 4JBBA 3F8UA 4MCUA 2F51A 3HZ4A 4HSCX 3TKQA 4EDZA 3DRNA 4RQRA 2EIQA 4WKWA 3NIVA 3UVTA 4F9ZA 4RUVA 3MNGA 1SL2B 2OKAA 4NV5A 3E9JB 3E0UA 3VWVA 5F0GA 3GL5A 2L6CA 1T1VA 1TW9A 3ME7A 4YQUA 3HJPA 3SWLA 5DCHA 1SENA 3HDCA 3GKMA 2L57A 1UVZA 4X1UA 5IPHA 4V2LA 3EINA 1AQWA 4XTSA 4F0CA 1JZRA 4GCIA 2IFQA 5ECNB 2GTUA 5GSSA 2O89A 2EIRA 4USSA 5DCGA 1TK8B 1ERVA 3HJOA 4IQ1A 5CO3A 2H6ZA 1MDIA 2CZ2A 4MF5A 2IMDA 1TXXA 1ON4A 1G6WA 2VCVA 2E0QA 3GIXA 2CVDA 1M2DA 1T8EB 4MH3A 2VCZA 4A5PA 2DIYA 1EV9A 18GSA 2C0EA 1EZKA 2A4VA 1XFLA 6GSUA 2H8LA 2H66A 1ML6A 3C1RA 2M80A 5HFKA 2C3TA 3DVXA 2YPMA 4Z2UA 4POKA 3IBHA 1PKZA 3CSIA 2FGXA 3KJYA 2ES7A 2H74A 3HVVA 1B8XA 4MZWA 1EEMA 3TJFA 1M9BA 5B8AA 1ACVA 2QKEA 2B3SA 4OO4A 3TJJA 1EP8A 4ML6A 3TRQA 4Q5RA 1O8XA 4I8BA 2HSMA 3UL3A 5JCUA 2GS3A 4ECJA 4K1FA 3QAGA 4MPGA 3G7YA 4IGJA 5F05A 1FHEA 2F9SA 17GSA 2H1DA 4X4JA 3IV4A 1A2LA 1VF3A 3GKXA 4FH8A 1TI1A 4F03A 4I5QA 3MSZA 3F4TA 3HHVA 5HR3A 2JADA 3AY8A 3EE2A 3IAS2 4MK3A 3CRTA 1DBYA 3KZQA 5FWGA 3GTUA 1YF1A 2DLXA 2OE3A 3LWAA 5HFIA 3F0IA 1FVJA 1X5DA 2IMFA 2H6YA 2V41A 1F9MA 3GSSA 5CREA 2MYGA 4I2UA 2V2GA 1OKDA 1OC8A 2GSQA 2LTKA 4O5UA 2L5LA 2P5RA 2PVQA 1YKCA 1EP7A 2HNLA 3TRXA 3FK8A 3GMFA 2E7PA 2G2QA 4TR0A 5ECRB 2KP2A 5EL8A 5COHA 4MABA 2VM1A 1PX7A 1TRWA 5HR1A 2F3MA 1MDJA 2EIOA 4CY8A 1X9WB 1S3CA 5DJMA 1THOA 4PNFA 10GSA 3IK7A 4ULXA 1O6JA 5D93A 1Z7RA 2VCXA 4BVXA 4MDCA 4OFNA 1LJRA 1Z3EA 5DAKB 1A8YA 1EWXA 1SL1B 2IWTA 3MIXA 4ACSA 5IMAA 1ZYEA 4HOJA 2RLIA 3D4TA 1N8JA 5CAXA 1FVKA 2E2MA 4ECCA 2LRCA 3IC8A 2YJHA 3RDWA 1ZGNA 2B7JA 2HRFA 4YAPA 2H6XA 3G7IA 1B48A 3CBUA 5D96A 4RQXA 4ISDA 1F37A 2C80A 1WMJA 3EVIA 4DSSB 2N5FA 3KEBA 4IS0A 4D73B 1GUHA 5J41A 1X5EA 5IO0A 2CT6A 3US3A 4KF9A 2H0GA 2K8SA 2AB6A 2E2GA 4NXIA 4XCSA 3FYGA 2HZEA 5DVBA 4PUFC 1EGRA 3VPTA 1TJDA 2LJAA 1TK0B 5KEJA 4LL4B 1M3JA 2DMMA 1UC7A 4POMA 3IR4A 3EWLA 4TXOB 3UBKA 1ERWA 1K0AA 1R5PA 4IELA 1V9WA 5DJLA 2A2RA 2VO4A 3ZTLA 1FAAA 2X64A 4MA9A 4G2EA 3KH7A 2YZUA 3EU4A 6GSTA 5J9CA 2I3YA 2VL3A 5AIXA 1TP9A 4K7IA 1VF2A 1AUCA 4TXVA 4HU7A 1S3AA 4MMMA 2HXKA 2WRTA 4FIWA 5IOWA 2HFDA 2FHEA 4PQ1A 2JZSA 4QL9A 1GSEA 1GSUA 3Q19A 8GSSA 3LFLA 3IRAA 3KP8A 1XW5A 3BCKA 4Z2TA 2FA4A 1KNGA 3P7XA 2K8VA 2LRTA 1J9BA 4WEYA 4GF0A 3F3QA 1PSQA 1A0FA 1OE7A 3G9BA 5KN2A 2IFQB 2H0IA 2BJXA 3FR9A 1A8LA 2HYXA 2J9HA 3IPZA 14GSA 4TVEA 4N10A 4MF6A 4AJ8A 2L4QA 1WJKA 1EOHA 4HS1A 4NV2A 2CAIA 2FNOA 3RAZA 4EDYA 2X8CA 1A23A 2VLTA 4H86A 4WF4A 3IHGA 3F4RA 3HA9A 5D9VA 1SKRB 4HI7A 3CYNA 4N0VA 2DJKA 2PMTA 3LSZA 2YOIA 4ZB8A 2AYTA 4FYBA 3TKRA 3BCIA 1M3IA 4IHUA 2KUCA 1G7OA 2M46A 3DWVA 4HEA2 3QMXA 1O73A 5H5SA 3ERFA 2MBTA 4V2NA 1J08A 1M7TA 3TOTA 1U3AA 5IMZA 1GRXA 1ABAA 1ZZYA 1GSYA 1GSSA 5DDLA 2H71A 3H1NA 4DSQA 4TRXA 5D73A 3ZVJD 2MBSA 1H4OA 3ZMLA 4ZL8A 3IXRA 2XBQA 3W8SA 5D8IA 20GSA 2TRCP 4X43A 1YZXA 2GT6A 4KE3A 2ON7A 5G5FA 1K0OA 1YDKA 4TR1A 2VOCA 2CV4A 3IDVA 4KCEA 5JCGA 5CP1A 5AN1A 1V57A 4ILFA 1SJ6A 5H5RA 4EO3A 1OAZA 1XG8A 3BOAA 2PVOC 4YH2A 2DJJA 1NHOA 1UA5A 2LRNA 3QR6A 3VK9A 2VD0A 5EY6A 2H1AA 4K9ZA 2MZCA 3L9VA 5DQSA 3C1SA 3CQFA 1GULA 3TJKA 3FZ4A 1GUMA 3ZFLA 5HQPA 3GTUB 1IYHA 4G0IA 2HRAA 3FRCA 12GSA 3HY2A 5IPGA 1U87A 5G1KA 3D6IA 4HJ2A 3QDNA 1PN0A 3HVXA 2IPAA 2H30A 1R5AA 4IVFA 2VL2C 1WE0A 2N5BA 3DEXA 2REMA 16GSA 3VPQA 1GTUA 1IYIA 1M2BA 3WYWA 4K0GA 1HNCA 2R2JA 2WZ9A 1MD4A 3DVWA 5ABRA 4MNNA 2MMZA 1Z9HA 3QAVA 2VUPA 3EMPA 2LQQA 3SBCA 3U5RE 3N5OA 3DMLA 5D9XA 3WGDA 2QA2A 3LQ7A 1PD21 3JCML 4EIPA 5A5KA 3KP9A 3VI5A 5G1LA 4MJAA 1ST9A 3BJ5A 1XWAA 4DEJA 4BVXB 2G0FA 2VM2A 2C4JA 3UAPA 1GTIA 1PL2A 1DSBA 3H4KA 3S9FA 3P2AA 4KSMA 2OBIA 2PUKC 1SJZA 4GRFA 2DBCA 4Q5QA 3ZZXA 3EYTA 2X8HA 3QFAC 4NPBA 2CVKA 1SL0B 4N0ZA 3LXZA 2A4HA 5F06A 3GV1A 1X5CA 2J23A 4NHWA 3TKSC 3N9JA 1H75A 2IIYA 2VLUA 4OFTA 2BTOT 3UEMA 1A2MA 1S3RA 1GSQA 4P3YB 1GTBA 3WT2A 2VAFA 5LNKe 4L0UA 3HD5A 2BMXA 4ZILA 2YWMA 4TN8A 1QFNA 2LS5A 3GL3A 3ZYWA 2NPBA 4ZIJA 1B9XC 4E8EA 1B9YC 3R3EA 1I5GA 2DJ3A 3H8QA 3L9UA 4GLTA 3M0FA 5HR0A 4JEDA 1YEXA 2O7KA 5J4UA 4OFMA 1TU7A 4O5QA 2B1LA 4BL7A 1T3BA 2R37A 2VL2A 4XS1A 4HUAA 3TUEA 11GSA 2R6KA 3EC3A 2F8AA 1K0NA 1PL1A 3KM6A 3KTBA 4HU9A 2X8GA 3ME8A 4O32A 4BWSA 3TOUA 4GSTA 1VRSD 4IJIA 4WBJA 4EKZA 2LKUA 1N2AA 1PA3A 5GAND 3HCZA 1XVWA 3K8NA 2CA8A 2CX3A 2KOKA 3FW2A 1JHBA 5ECQB 3APOA 2Z9SA 2LNSA 4LLRA 1PMTA 1QGVA 2X99A 2GLRA 1FB0A 3NOFA 3EMXA 2WCIA 4RI7A 2FD3A 1NW2A 3Q74A 3MYDA 1FOHA 3GUSA 4OO5A 2R5GA 4J57E 5IMDA 5KOXA 7GSSA 5ECSA 3LYKA 4F2IA 2MMNA 9GSSA 4ZL7A 3RBTA 1THXA 4YQVA 5GZZB 4LMWA 3A2WA 1ZYPA 3I6AA 4I97A 5G30A 4LMVA 2HSYA 4BWQA 2ZUPA 4EF0A 2NTOA 3H93A 2KP1A 4F0BA 4BIKA 3ERGA 2AHEA 2L5OA 3QPMA 4MZCA 4X0XA 4MF7A 2ZCTA 5F8BA 4TKYA 2YANA 5JWRB 1KBNA 3VLNA 2QA1A 4IKHA 2AV4A 3ZFBA 3VI7A 2RIIA 4IP6A 1V98A 4OMVA 4NMUA 3UOMA 1XOAA 1BX9A 1TRUA 1K3YA 3APSA 1A0RP 3QAWA 5G5EA 4XHMA 3TKSE 1F3BA 5J3RA 4K0NA 4PQIA 5IOXA 4FQUA 3FR6A 4YKGA 1TTZA 2HE3A 1ERUA 2V32A 2H72A 1JZDA 1SK2A 5GAPD 3LJRA 1M99A 2A2PA 4L8EA 2XHFA 2P31A 2H0HA 2FWFA 2DIZA 2JZTA 2TIRA 2JL4A 3GURA 3FHKA 5E59A 2PWJA 2QC7A 4PTSA 2KHPA 2X4AA 2LV3A 1XWGA 1S3DA 6GSVA 1DE2A 4OCEA 3ED3A 3ZMKA 3F63A 1XPVA 5B6NA 3GH6A 5ECHB 5INYA 3GRXA 2VD1A 5A4WA 1W4VA 3M3MA 5IM9A 4AJ7A 1ZMAA 3FZ9A 3GX0A 4L5LA 1Y25A 4K7NA 5KOWA 3FZAA 2EC4A 1C72A 5IO2A 4KAEA 1JLWA 5AISA 4ZBAA 6GSWA 3W6GA 4PNGA 3BBYA 1KTEA 4ID0A 5C00A 5AGYA 2FY6A 2QGVA 1XWCA 1O8WA 3M1GA 3WGEA 3D4MA 3F6DA 1BJXA 4KCAA 4ZBDA 4KB3A 3UVHA 4XRAA 1XZOA 5CRGA 3A2VA 3KIJA 3GKKA 4QQ7A 2TRXA 5CRHA 3M9KA 5C04A 3IHQA 2I81A 4PQHA 1HD2A 4GTUA 2H19A 1TK5B 2C3QA 5HR2A 1OVNA 2I9HA 1GSFA 2DKIA 2DKHA 2AJQB 2GQLA 2C1YA 2V1MA 1BEDA 1EOGA 2V6KA 5F07A 2CQ9A 4WF5A 1Y6EA
chains in the Genus database with same CATH topology
1G6YA 3A5IA 1R7HA 1DUGA 3DIEA 2A2SA 4O92A 5FHIA 2C0DA 3C71A 1GTAA 1EEJA 2YP6A 3HYPA 3GNJA 3L9SA 5JCWA 3HJMA 3LGCA 2B5YA 4HZ2A 4EE0A 4GQCA 2VIMA 3O3TA 3ZVJA 2B5XA 5CNWA 1X9SB 5LCZA 2VCQA 2ALBA 1RK4A 2WFCA 3TCOA 2XPEA 1EGOA 1ZOFA 1K0CA 4ML1A 2PN8A 4CY6A 3APQA 4YAVA 2YWOA 5CYYA 3ZREA 1XIYA 4PUAA 3DYRA 4V2MA 2FCHA 3C73A 2IJYA 2YCDA 1T4YA 3FZ5A 4BL7B 1YQ1A 4K5RA 4LL1B 2DC5A 3LW9A 4PXOA 4IBPA 4J56E 1BYEA 1SKSB 3GH9A 1V40A 3LEFA 3ZL5A 1ERTA 2FA8A 1QXHA 1ILOA 1HYUA 5KN1A 2HT9A 4ZB6A 1NM3A 4WR4A 2H01A 4KNDA 2K6VA 4F82A 2AUVA 3VFIA 2I4AA 4JU5A 1OYJA 2OE1A 2M72A 4G9HA 3VURA 1OC9A 2PPTA 1PQNA 5A4UA 4ZXGA 4EXJA 1Q4JA 3EPTA 2FLSA 2YWNA 1K3LA 3HKRA 4MZBA 2K18A 1GLPA 1VF4A 2FUG2 3D0ZA 2KLXA 3PGTA 2H1BA 3KH9A 2H76A 1U3IA 5IMFA 4XS4A 2L59A 3M9JA 5B6MA 3PH9A 3ZIJA 1SD9A 1U6TA 2DJ2A 3F6FA 5ECIB 1V2AA 2GT5A 2GSTA 2OADA 4O5RA 1E2YA 4TR4A 4QL7A 3FR3A 1TU8A 1FG4A 3LYPA 4D73A 6GSSA 1TRSA 4GQFA 4ECBA 3L78A 3DKSA 3E3EA 1X9MB 4PURA 3M8NA 3WD6A 3OR5A 1PGTA 1UN2A 3KGKA 4KH7A 1BAYA 3GHAA 4N30A 1WP0A 4I2TA 1OC3A 1Q98A 4IN0A 5DALA 4POBA 4JR6A 2ON5A 1AQXA 1GL8A 3A3TA 3GA4A 3UARA 3GKNA 4WBRD 2B5EA 3VWWA 2GQMA 3CSJA 4KA0A 4YQMA 3O6TA 3NZNA 5J9BA 1XOBA 4JE1A 3RPNA 1XW6A 5LD0A 1TDIA 1XBSA 3GYKA 1B4QA 2VL9A 4CW9A 3DXBA 4V1Ag 2YWIA 2GSSA 3RHBA 2B6MA 5ELGA 2P0GA 2FWHA 5FT3A 5BRTA 3GSTA 2DMLA 3LG6A 2HZFA 2XC2A 4MH2A 2JSZA 4HQSA 2O87A 4NHZA 3CRUA 3EU3A 4JR4A 4FYUA 3LORA 3HXSA 2HZEB 2VCWA 2RM5A 2FWGA 1AQVA 2GQKA 5L71A 1NHYA 4RI6A 3QD9A 4ICYA 4FO5A 3D21A 3H79A 5ENUA 1M0UA 3TGZA 5AIVA 2YN1A 1QUWA 3LXTA 4K7OA 2OA7A 1USBA 3R2QA 1GH2A 3FKFA 2CAQA 3UIWA 2DJ1A 4HZ4A 2RUEA 3IE3A 1SYXA 4CDOA 4G0LA 2YZHA 4HJMA 1Z6NA 5ID2A 1YKAA 2XPDA 2D2ZA 3UMAA 3MDKA 3F4SA 3J7Yk 2IN3A 1PN9A 4MPFA 3IK9A 3TKPA 4KGIA 1X0RA 3VWUA 1A2JA 2B1KA 4AJ6A 3EURA 4YKFA 5IQYA 2H73A 4JRRA 2MMOA 1RW1A 3WT1A 2GSRA 2CVBA 2OE0A 3P90A 2C0GA 3TJGA 5DQYA 1MEKA 1W89A 3I69A 1YY7A 2R4VA 2R0GA 5H5QA 1JZWA 3D5JA 4WR5A 5HFGA 2HSHA 3TKSA 1GNWA 1G0TA 2K9FA 5EPFA 2YV7A 3V1WA 4FYCA 1LBKA 3FEUA 4CHSA 4KDXA 4K8MA 1ZYNA 2WULA 2DJ0A 2HRKA 4I6XA 5BMUA 1GUKA 1WRYA 1CQHA 1K0BA 3C7MA 4N11A 1XWKA 2HRNA 1GWCA 3QOUA 1T4ZA 5G31A 5G2ZA 1PX6A 1XWBA 4J2FA 3TB2A 2WS2A 2LSTA 2C3NA 5D9WA 3PR8A 1I9DA 2XBIA 1WPIA 1SYRA 4WXTA 1YJ6A 3CTGA 1VGLA 1RQMA 1ZYQB 3UBLA 4BVYA 1MD3A 2GZPA 2HLSA 1WIKA 1T00A 1E6BA 1OC9B 4GXZA 4OCFA 4EC0A 3MAKA 3ERWA 4TR1B 22GSA 3RPPA 2V6OA 2H75A 2LQOA 4BPYA 3IC4A 4ECIA 1VF1A 1AC1A 5IIZA 1GP1A 1O7UA 3ZLPA 4G10A 2OACA 4LA1A 2RM6A 1G7EA 1EV4A 3PINA 3ZRDA 4XS4B 3C8EA 5JWOB 1QQ2A 4V1Ap 1Z6MA 1M2AA 2GZZA 2WJUA 2I1UA 2VLVA 5DBQA 1TRVA 1URMA 2O8VB 4KSOA 4Z2RA 1NSWA 2YJ7A 3U6VA 2H1GA 1R26A 1R4WA 3GX8A 3DD3A 1J0FA 1HNBA 1XW9A 3IAM2 3MWHA 1YEPA 5J5NA 2UZ8A 4E8HA 2LJKA 2GDRA 2NDOA 3GFKA 2JSYA 2CZ3A 4L0WA 5ELAA 1MTCA 1K0MA 2C0FA 2HI7A 4HQZA 5KN3A 3J7Yb 3O76A 1TI3A 5DALB 1YF0A 3Q18A 3DGQA 2PGTA 1O85A 2IMIA 3CSHA 5EVOA 1OKTA 2LEGA 2DSAA 2L6DA 3CXGA 3TDGA 4KX4A 5IMCA 4ZL9A 1SD8A 2WGRA 1GLQA 1QK8A 3GN3A 3RHCA 4TOPA 4MJCA 2PBJA 1CQGA 2R0CA 2YNXA 4EVMA 1FB6A 4KDUA 4NAXA 5D9TA 4IP1A 3UJ1A 1KEBA 3VWXA 4AF2A 1O81A 2LNTA 4GSNA 1HQOA 1SJIA 3ZITA 5B7CA 2ZNMA 3BD2A 4GWRA 1SU9A 2AAWA 4MJBA 13GSA 1PRXA 1SK1A 1TOFA 4Q5NA 4OWYA 4OD7A 3I9V2 3P8WA 3I43A 4MJEA 4PX1A 5B8BA 5ECLB 3KCMA 4EL1A 3QFBC 4G0KA 4IJ3A 5ECKB 1WOUA 1B4PA 5IMVA 4WETA 2WB9A 4TR3A 4MP4A 5JWQB 2MMAA 1MDKA 4Q5FA 3F9UA 4KUNA 2GZYA 1F3AA 1BQ7A 4PGTA 2IMKA 1GNEA 5ECOB 4JZQA 4L5OA 2GGTA 4TW5A 3IA1A 4IW9A 1FOVA 2JACA 4ZB9A 1ZL9A 3D22A 19GSA 3FMWA 1JFUA 3KMNA 4O7HA 2VCTA 2R3XA 3A2XA 5ECPB 3KTLA 5ECMB 4BA7A 2IMEA 3PPUA 5ID2B 2JU5A 1SK0A 3ZIVA 2QSIA 4IQAA 2CX4A 1XVQA 3L4NA 4AGSA 2C8UA 4HDEA 4EUYA 3L0HA 2YV9A 1FO5A 1T7PB 1DE1A 1ZCPA 4EIQA 1FW1A 4NWYA 2WDUA 6GSXA 4DSRA 1BG5A 2H70A 5DAKA 3HZ8A 5CRDA 1F2EA 3Q6OA 2FWEA 1PKWA 2PU9C 5CRWA 2NBSA 1U88A 1V58A 3CTFA 1AAZA 1WWJA 4KW6A 1XCCA 2O85A 1QMVA 2LJRA 5E4WA 4XRDA 2N5AA 5GSTA 2PERA 1SKWB 3KMOA 4MLYA 4Z7XA 1GSDA 3TJBA 1M9AA 1JZOA 2NVLA 4POLA 2R0PA 3A5WA 4DSSA 4XS6A 1A24A 3CMIA 1XXUA 2RUFA 4KDYA 3QCPA 4DVCA 1TKDB 2JZRA 4K6XA 4K2XA 1Z7PA 1JLVA 6GSYA 3TRPA 3FY7A 1LU4A 4K2DA 1Z5YE 3ISOA 2OJLA 1K0DA 4GSSA 4ZBBA 2P5QA 2L4CA 1F6MC 1HNAA 3IOSA 1K3OA 1OE8A 4K5SA 3F3RA 1AW9A 2F8FA 4G19A 2IL3A 2LUSA 2X49A 3G7JA 4BVYB 3W8JA 3HVSA 4TXOA 2OBKA 5KN0A 2B7KA 1AXDA 3WGXA 3KXOA 4XIHA 1AIUA 2GVPA 5A4VA 3KD0A 4JBBA 3F8UA 4MCUA 2F51A 3HZ4A 3TKQA 4EDZA 3DRNA 4RQRA 2EIQA 4WKWA 3NIVA 3UVTA 4F9ZA 4RUVA 3MNGA 1SL2B 2OKAA 4NV5A 3E9JB 3E0UA 3VWVA 5F0GA 3GL5A 2L6CA 1T1VA 1TW9A 3ME7A 4YQUA 3HJPA 3SWLA 5DCHA 1SENA 3HDCA 3GKMA 2L57A 1UVZA 4X1UA 5IPHA 4V2LA 3EINA 1AQWA 4XTSA 4F0CA 1JZRA 4GCIA 2IFQA 5ECNB 2GTUA 5GSSA 2O89A 2EIRA 4USSA 5DCGA 1TK8B 1ERVA 3HJOA 4IQ1A 5CO3A 2H6ZA 1MDIA 2CZ2A 4MF5A 2IMDA 1TXXA 1ON4A 1G6WA 2VCVA 2E0QA 3GIXA 2CVDA 1M2DA 1T8EB 4MH3A 2VCZA 4A5PA 2DIYA 1EV9A 18GSA 2C0EA 1EZKA 2A4VA 1XFLA 6GSUA 2H8LA 2H66A 1ML6A 3C1RA 2M80A 5HFKA 2C3TA 3DVXA 2YPMA 4Z2UA 4POKA 3IBHA 1PKZA 3CSIA 2FGXA 3KJYA 2ES7A 2H74A 3HVVA 1B8XA 4MZWA 3TJFA 1M9BA 5B8AA 1ACVA 2QKEA 2B3SA 4OO4A 3TJJA 1EP8A 4ML6A 3TRQA 4Q5RA 1O8XA 4I8BA 2HSMA 3UL3A 5JCUA 2GS3A 4ECJA 4K1FA 3QAGA 4MPGA 3G7YA 4IGJA 5F05A 1FHEA 2F9SA 17GSA 2H1DA 4X4JA 3IV4A 1A2LA 1VF3A 3GKXA 4FH8A 1TI1A 4F03A 4I5QA 3MSZA 3F4TA 3HHVA 5HR3A 2JADA 3AY8A 3EE2A 3IAS2 4MK3A 3CRTA 1DBYA 3KZQA 5FWGA 3GTUA 1YF1A 2DLXA 2OE3A 3LWAA 5HFIA 3F0IA 1FVJA 1X5DA 2IMFA 2H6YA 2V41A 1F9MA 3GSSA 5CREA 2MYGA 4I2UA 2V2GA 1OKDA 1OC8A 2GSQA 2LTKA 4O5UA 2L5LA 2P5RA 2PVQA 1YKCA 1EP7A 2HNLA 3TRXA 3FK8A 3GMFA 2E7PA 2G2QA 4TR0A 5ECRB 2KP2A 5EL8A 5COHA 4MABA 2VM1A 1PX7A 1TRWA 5HR1A 2F3MA 1MDJA 2EIOA 4CY8A 1X9WB 1S3CA 5DJMA 1THOA 4PNFA 10GSA 3IK7A 4ULXA 1O6JA 5D93A 1Z7RA 2VCXA 4BVXA 4MDCA 4OFNA 1LJRA 1Z3EA 5DAKB 1A8YA 1EWXA 1SL1B 2IWTA 3MIXA 4ACSA 5IMAA 1ZYEA 4HOJA 2RLIA 3D4TA 1N8JA 5CAXA 1FVKA 2E2MA 4ECCA 2LRCA 3IC8A 2YJHA 3RDWA 1ZGNA 2B7JA 2HRFA 4YAPA 2H6XA 3G7IA 1B48A 3CBUA 5D96A 4RQXA 4ISDA 1F37A 2C80A 1WMJA 3EVIA 4DSSB 2N5FA 3KEBA 4IS0A 4D73B 1GUHA 5J41A 1X5EA 5IO0A 2CT6A 3US3A 4KF9A 2H0GA 2K8SA 2AB6A 2E2GA 4NXIA 4XCSA 3FYGA 2HZEA 5DVBA 4PUFC 1EGRA 3VPTA 1TJDA 2LJAA 1TK0B 5KEJA 4LL4B 2DMMA 1UC7A 4POMA 3IR4A 3EWLA 4TXOB 3UBKA 1ERWA 1K0AA 1R5PA 4IELA 1V9WA 5DJLA 2A2RA 2VO4A 3ZTLA 1FAAA 2X64A 4MA9A 4G2EA 3KH7A 2YZUA 3EU4A 6GSTA 5J9CA 2I3YA 2VL3A 5AIXA 1TP9A 4K7IA 1VF2A 1AUCA 4TXVA 4HU7A 1S3AA 4MMMA 2HXKA 2WRTA 4FIWA 5IOWA 2HFDA 2FHEA 4PQ1A 2JZSA 4QL9A 1GSEA 1GSUA 3Q19A 8GSSA 3LFLA 3IRAA 3KP8A 1XW5A 3BCKA 4Z2TA 2FA4A 1KNGA 3P7XA 2K8VA 2LRTA 1J9BA 4WEYA 4GF0A 3F3QA 1PSQA 1A0FA 1OE7A 3G9BA 5KN2A 2IFQB 2H0IA 2BJXA 3FR9A 1A8LA 2HYXA 2J9HA 3IPZA 14GSA 4TVEA 4N10A 4MF6A 4AJ8A 2L4QA 1WJKA 1EOHA 4HS1A 4NV2A 2CAIA 2FNOA 3RAZA 4EDYA 2X8CA 1A23A 2VLTA 4H86A 4WF4A 3IHGA 3F4RA 3HA9A 5D9VA 1SKRB 4HI7A 3CYNA 4N0VA 2DJKA 2PMTA 3LSZA 2YOIA 4ZB8A 2AYTA 4FYBA 3TKRA 3BCIA 4IHUA 2KUCA 1G7OA 2M46A 3DWVA 4HEA2 3QMXA 1O73A 5H5SA 3ERFA 2MBTA 4V2NA 1J08A 1M7TA 3TOTA 1U3AA 5IMZA 1GRXA 1ABAA 1ZZYA 1GSYA 1GSSA 5DDLA 2H71A 3H1NA 4DSQA 4TRXA 5D73A 3ZVJD 2MBSA 1H4OA 3ZMLA 4ZL8A 3IXRA 2XBQA 3W8SA 5D8IA 20GSA 2TRCP 4X43A 1YZXA 2GT6A 4KE3A 2ON7A 5G5FA 1K0OA 1YDKA 4TR1A 2VOCA 2CV4A 3IDVA 4KCEA 5JCGA 5CP1A 5AN1A 1V57A 4ILFA 1SJ6A 5H5RA 4EO3A 1OAZA 3BOAA 2PVOC 4YH2A 2DJJA 1NHOA 1UA5A 2LRNA 3QR6A 3VK9A 2VD0A 5EY6A 2H1AA 4K9ZA 2MZCA 3L9VA 5DQSA 3C1SA 1GULA 3TJKA 3FZ4A 1GUMA 3ZFLA 5HQPA 3GTUB 1IYHA 4G0IA 2HRAA 3FRCA 12GSA 3HY2A 5IPGA 1U87A 5G1KA 3D6IA 4HJ2A 3QDNA 1PN0A 3HVXA 2IPAA 2H30A 1R5AA 4IVFA 2VL2C 1WE0A 2N5BA 3DEXA 2REMA 16GSA 3VPQA 1GTUA 1IYIA 1M2BA 3WYWA 4K0GA 1HNCA 2R2JA 2WZ9A 1MD4A 3DVWA 5ABRA 4MNNA 2MMZA 1Z9HA 3QAVA 2VUPA 3EMPA 2LQQA 3SBCA 3U5RE 3N5OA 3DMLA 5D9XA 3WGDA 2QA2A 3LQ7A 1PD21 3JCML 4EIPA 5A5KA 3KP9A 3VI5A 5G1LA 4MJAA 1ST9A 3BJ5A 1XWAA 4DEJA 4BVXB 2G0FA 2VM2A 2C4JA 3UAPA 1GTIA 1PL2A 1DSBA 3H4KA 3S9FA 3P2AA 4KSMA 2OBIA 2PUKC 1SJZA 4GRFA 2DBCA 4Q5QA 3ZZXA 3EYTA 2X8HA 3QFAC 4NPBA 2CVKA 1SL0B 4N0ZA 3LXZA 2A4HA 5F06A 3GV1A 1X5CA 2J23A 4NHWA 3TKSC 3N9JA 1H75A 2IIYA 2VLUA 4OFTA 2BTOT 3UEMA 1A2MA 1GSQA 4P3YB 1GTBA 3WT2A 2VAFA 5LNKe 4L0UA 3HD5A 2BMXA 4ZILA 2YWMA 4TN8A 1QFNA 2LS5A 3GL3A 3ZYWA 2NPBA 4ZIJA 1B9XC 4E8EA 1B9YC 3R3EA 1I5GA 2DJ3A 3H8QA 3L9UA 4GLTA 3M0FA 5HR0A 4JEDA 1YEXA 2O7KA 5J4UA 4OFMA 1TU7A 4O5QA 2B1LA 4BL7A 1T3BA 2R37A 2VL2A 4XS1A 4HUAA 3TUEA 11GSA 2R6KA 3EC3A 2F8AA 1K0NA 1PL1A 3KM6A 3KTBA 4HU9A 2X8GA 3ME8A 4O32A 4BWSA 3TOUA 4GSTA 1VRSD 4IJIA 4WBJA 4EKZA 2LKUA 1N2AA 1PA3A 5GAND 3HCZA 1XVWA 3K8NA 2CA8A 2CX3A 2KOKA 3FW2A 1JHBA 5ECQB 3APOA 2Z9SA 2LNSA 4LLRA 1PMTA 1QGVA 2X99A 2GLRA 1FB0A 3NOFA 3EMXA 2WCIA 4RI7A 2FD3A 1NW2A 3Q74A 3MYDA 1FOHA 3GUSA 4OO5A 2R5GA 4J57E 5IMDA 5KOXA 7GSSA 5ECSA 3LYKA 4F2IA 2MMNA 9GSSA 4ZL7A 3RBTA 1THXA 4YQVA 5GZZB 4LMWA 3A2WA 1ZYPA 3I6AA 4I97A 5G30A 4LMVA 2HSYA 4BWQA 2ZUPA 4EF0A 2NTOA 3H93A 2KP1A 4F0BA 3ERGA 2AHEA 2L5OA 3QPMA 4MZCA 4X0XA 4MF7A 2ZCTA 5F8BA 4TKYA 1Y6EA 2YANA 5JWRB 1KBNA 3VLNA 2QA1A 4IKHA 2AV4A 3ZFBA 3VI7A 2RIIA 4IP6A 1V98A 4OMVA 4NMUA 3UOMA 1XOAA 1BX9A 1TRUA 1K3YA 3APSA 1A0RP 3QAWA 5G5EA 4XHMA 3TKSE 1F3BA 5J3RA 4K0NA 4PQIA 5IOXA 4FQUA 3FR6A 4YKGA 1TTZA 2HE3A 1ERUA 2V32A 2H72A 1JZDA 1SK2A 5GAPD 3LJRA 1M99A 2A2PA 4L8EA 2XHFA 2P31A 2H0HA 2FWFA 2DIZA 2JZTA 2TIRA 2JL4A 3GURA 3FHKA 5E59A 2PWJA 2QC7A 4PTSA 2KHPA 2X4AA 2LV3A 1XWGA 1S3DA 6GSVA 1DE2A 4OCEA 3ED3A 3ZMKA 3F63A 1XPVA 5B6NA 3GH6A 5ECHB 5INYA 3GRXA 2VD1A 5A4WA 1W4VA 3M3MA 5IM9A 4AJ7A 1ZMAA 3FZ9A 3GX0A 4L5LA 1Y25A 4K7NA 5KOWA 3FZAA 2EC4A 1C72A 5IO2A 4KAEA 1JLWA 5AISA 4ZBAA 6GSWA 3W6GA 4PNGA 3BBYA 1KTEA 4ID0A 5C00A 5AGYA 2FY6A 2QGVA 1XWCA 1O8WA 3M1GA 3WGEA 3D4MA 3F6DA 1BJXA 4KCAA 4ZBDA 4KB3A 3UVHA 4XRAA 1XZOA 5CRGA 3A2VA 3KIJA 3GKKA 4QQ7A 2TRXA 5CRHA 3M9KA 5C04A 3IHQA 2I81A 4PQHA 1HD2A 4GTUA 2H19A 1TK5B 2C3QA 5HR2A 1OVNA 2I9HA 1GSFA 2DKIA 2DKHA 2AJQB 2GQLA 2C1YA 2V1MA 1BEDA 1EOGA 2V6KA 5F07A 2CQ9A 4WF5A 1EEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G6Y A;  1R7H A;  1DUG A;  3DIE A;  2A2S A;  4O92 A;  5FHI A;  2C0D A;  3C71 A;  1GTA A;  1EEJ A;  2YP6 A;  3HYP A;  3GNJ A;  3L9S A;  5JCW A;  3HJM A;  3LGC A;  2B5Y A;  4HZ2 A;  4EE0 A;  4GQC A;  2VIM A;  3O3T A;  3ZVJ A;  2B5X A;  5CNW A;  1X9S B;  5LCZ A;  2VCQ A;  2ALB A;  1RK4 A;  2WFC A;  3TCO A;  2XPE A;  1EGO A;  1ZOF A;  1K0C A;  4ML1 A;  2PN8 A;  3APQ A;  4YAV A;  2YWO A;  5CYY A;  3ZRE A;  1XIY A;  4PUA A;  3DYR A;  4V2M A;  2FCH A;  3C73 A;  2IJY A;  2YCD A;  1T4Y A;  3FZ5 A;  1YQ1 A;  4LL1 B;  2DC5 A;  4PXO A;  4IBP A;  4J56 E;  1BYE A;  1SKS B;  3GH9 A;  1V40 A;  3LEF A;  3ZL5 A;  1ERT A;  2FA8 A;  1QXH A;  1ILO A;  1HYU A;  5KN1 A;  2HT9 A;  4ZB6 A;  1NM3 A;  4WR4 A;  2H01 A;  4KND A;  2K6V A;  4F82 A;  2AUV A;  3VFI A;  2I4A A;  4JU5 A;  1OYJ A;  2OE1 A;  2M72 A;  4G9H A;  3VUR A;  1OC9 A;  2PPT A;  1PQN A;  5A4U A;  4ZXG A;  4EXJ A;  1Q4J A;  2FLS A;  2YWN A;  1K3L A;  3HKR A;  4MZB A;  2K18 A;  1GLP A;  1VF4 A;  2FUG 2;  3D0Z A;  2KLX A;  3PGT A;  2H1B A;  3KH9 A;  2H76 A;  1U3I A;  5IMF A;  4XS4 A;  2L59 A;  3M9J A;  5B6M A;  3PH9 A;  3ZIJ A;  1SD9 A;  1U6T A;  2DJ2 A;  3F6F A;  5ECI B;  1V2A A;  2GT5 A;  2GST A;  2OAD A;  4O5R A;  1E2Y A;  4TR4 A;  4QL7 A;  3FR3 A;  1TU8 A;  1FG4 A;  3LYP A;  4D73 A;  6GSS A;  1TRS A;  4GQF A;  4ECB A;  3L78 A;  3DKS A;  3E3E A;  1X9M B;  4PUR A;  3M8N A;  3WD6 A;  3OR5 A;  1PGT A;  1UN2 A;  3KGK A;  4KH7 A;  1BAY A;  3GHA A;  4N30 A;  1WP0 A;  4I2T A;  1OC3 A;  1Q98 A;  4IN0 A;  5DAL A;  4POB A;  4JR6 A;  2ON5 A;  1AQX A;  1GL8 A;  3A3T A;  3GA4 A;  3UAR A;  3GKN A;  4WBR D;  2B5E A;  3VWW A;  2GQM A;  3CSJ A;  4KA0 A;  4YQM A;  3O6T A;  3NZN A;  5J9B A;  1XOB A;  4JE1 A;  3RPN A;  1XW6 A;  5LD0 A;  1TDI A;  1XBS A;  3GYK A;  1B4Q A;  2VL9 A;  4CW9 A;  3DXB A;  4V1A g;  2YWI A;  2GSS A;  3RHB A;  2B6M A;  5ELG A;  2P0G A;  2FWH A;  5FT3 A;  3GST A;  2DML A;  3LG6 A;  2HZF A;  2XC2 A;  4MH2 A;  2JSZ A;  4HQS A;  2O87 A;  4NHZ A;  3CRU A;  3EU3 A;  4JR4 A;  4FYU A;  3LOR A;  3HXS A;  2HZE B;  2VCW A;  2RM5 A;  2FWG A;  1AQV A;  2GQK A;  5L71 A;  1NHY A;  4RI6 A;  3QD9 A;  4FO5 A;  3D21 A;  3H79 A;  5ENU A;  1M0U A;  3TGZ A;  5AIV A;  2YN1 A;  1QUW A;  3LXT A;  4K7O A;  2OA7 A;  1USB A;  3R2Q A;  1GH2 A;  3FKF A;  2CAQ A;  3UIW A;  2DJ1 A;  4HZ4 A;  2RUE A;  3IE3 A;  1SYX A;  4CDO A;  2YZH A;  4HJM A;  1Z6N A;  5ID2 A;  1YKA A;  2XPD A;  2D2Z A;  3UMA A;  3MDK A;  3F4S A;  3J7Y k;  2IN3 A;  1PN9 A;  4MPF A;  3IK9 A;  3TKP A;  4KGI A;  1X0R A;  3VWU A;  1A2J A;  2B1K A;  4AJ6 A;  3EUR A;  5IQY A;  2H73 A;  4JRR A;  2MMO A;  1RW1 A;  3WT1 A;  2GSR A;  2CVB A;  2OE0 A;  3P90 A;  2C0G A;  3TJG A;  5DQY A;  1MEK A;  1W89 A;  3I69 A;  1YY7 A;  2R4V A;  5H5Q A;  1JZW A;  3D5J A;  4WR5 A;  5HFG A;  2HSH A;  3TKS A;  1GNW A;  1G0T A;  2K9F A;  5EPF A;  2YV7 A;  3V1W A;  4FYC A;  1LBK A;  3FEU A;  4CHS A;  4KDX A;  4K8M A;  2WUL A;  2DJ0 A;  4I6X A;  1GUK A;  1WRY A;  1CQH A;  1K0B A;  3C7M A;  4N11 A;  1XWK A;  2HRN A;  1GWC A;  3QOU A;  1T4Z A;  5G31 A;  5G2Z A;  1PX6 A;  1XWB A;  4J2F A;  3TB2 A;  2WS2 A;  2LST A;  2C3N A;  5D9W A;  3PR8 A;  1I9D A;  2XBI A;  1WPI A;  1SYR A;  4WXT A;  1YJ6 A;  3CTG A;  1VGL A;  1RQM A;  1ZYQ B;  3UBL A;  4BVY A;  1MD3 A;  2GZP A;  2HLS A;  1WIK A;  1T00 A;  1E6B A;  1OC9 B;  4GXZ A;  4OCF A;  4EC0 A;  3MAK A;  3ERW A;  4TR1 B;  22GS A;  3RPP A;  2V6O A;  2H75 A;  2LQO A;  4BPY A;  3IC4 A;  4ECI A;  1VF1 A;  1AC1 A;  5IIZ A;  1GP1 A;  1O7U A;  3ZLP A;  4G10 A;  2OAC A;  4LA1 A;  2RM6 A;  1G7E A;  1EV4 A;  3PIN A;  3ZRD A;  4XS4 B;  3C8E A;  5JWO B;  1QQ2 A;  4V1A p;  1Z6M A;  1M2A A;  2GZZ A;  2WJU A;  2I1U A;  2VLV A;  5DBQ A;  1TRV A;  1URM A;  2O8V B;  4KSO A;  1NSW A;  2YJ7 A;  3U6V A;  2H1G A;  1R26 A;  1R4W A;  3GX8 A;  3DD3 A;  1J0F A;  1HNB A;  1XW9 A;  3IAM 2;  3MWH A;  1YEP A;  5J5N A;  4E8H A;  2LJK A;  2GDR A;  2NDO A;  3GFK A;  2JSY A;  2CZ3 A;  4L0W A;  5ELA A;  1MTC A;  1K0M A;  2C0F A;  2HI7 A;  4HQZ A;  5KN3 A;  3J7Y b;  3O76 A;  1TI3 A;  5DAL B;  1YF0 A;  3Q18 A;  3DGQ A;  2PGT A;  1O85 A;  2IMI A;  3CSH A;  5EVO A;  1OKT A;  2LEG A;  2DSA A;  2L6D A;  3CXG A;  3TDG A;  4KX4 A;  5IMC A;  4ZL9 A;  1SD8 A;  2WGR A;  1GLQ A;  1QK8 A;  3GN3 A;  3RHC A;  4TOP A;  4MJC A;  2PBJ A;  1CQG A;  2YNX A;  4EVM A;  1FB6 A;  4KDU A;  4NAX A;  5D9T A;  4IP1 A;  3UJ1 A;  1KEB A;  3VWX A;  4AF2 A;  1O81 A;  2LNT A;  4GSN A;  1HQO A;  1SJI A;  3ZIT A;  5B7C A;  2ZNM A;  3BD2 A;  4GWR A;  1SU9 A;  2AAW A;  4MJB A;  13GS A;  1PRX A;  1SK1 A;  1TOF A;  4Q5N A;  4OWY A;  4OD7 A;  3I9V 2;  3P8W A;  3I43 A;  4MJE A;  4PX1 A;  5B8B A;  5ECL B;  3KCM A;  4EL1 A;  3QFB C;  4IJ3 A;  5ECK B;  1WOU A;  1B4P A;  5IMV A;  4WET A;  2WB9 A;  4TR3 A;  4MP4 A;  5JWQ B;  2MMA A;  1MDK A;  4Q5F A;  3F9U A;  4KUN A;  2GZY A;  1F3A A;  1BQ7 A;  4PGT A;  2IMK A;  1GNE A;  5ECO B;  4JZQ A;  4L5O A;  2GGT A;  4TW5 A;  3IA1 A;  4IW9 A;  1FOV A;  2JAC A;  4ZB9 A;  1ZL9 A;  3D22 A;  19GS A;  1JFU A;  3KMN A;  4O7H A;  2VCT A;  2R3X A;  3A2X A;  5ECP B;  3KTL A;  5ECM B;  4BA7 A;  2IME A;  5ID2 B;  2JU5 A;  1SK0 A;  3ZIV A;  2QSI A;  4IQA A;  2CX4 A;  1XVQ A;  3L4N A;  4AGS A;  2C8U A;  4HDE A;  4EUY A;  3L0H A;  2YV9 A;  1FO5 A;  1T7P B;  1DE1 A;  1ZCP A;  1FW1 A;  4NWY A;  2WDU A;  6GSX A;  4DSR A;  1BG5 A;  2H70 A;  5DAK A;  3HZ8 A;  5CRD A;  1F2E A;  3Q6O A;  2FWE A;  1PKW A;  2PU9 C;  5CRW A;  2NBS A;  1U88 A;  1V58 A;  3CTF A;  1AAZ A;  1WWJ A;  4KW6 A;  1XCC A;  2O85 A;  1QMV A;  2LJR A;  5E4W A;  4XRD A;  2N5A A;  5GST A;  2PER A;  1SKW B;  3KMO A;  4MLY A;  4Z7X A;  1GSD A;  3TJB A;  1M9A A;  1JZO A;  2NVL A;  4POL A;  3A5W A;  4DSS A;  4XS6 A;  1A24 A;  3CMI A;  1XXU A;  2RUF A;  4KDY A;  3QCP A;  4DVC A;  1TKD B;  2JZR A;  4K6X A;  1Z7P A;  1JLV A;  6GSY A;  3TRP A;  3FY7 A;  1LU4 A;  4K2D A;  1Z5Y E;  3ISO A;  2OJL A;  1K0D A;  4GSS A;  4ZBB A;  2P5Q A;  2L4C A;  1F6M C;  1HNA A;  3IOS A;  1K3O A;  1OE8 A;  3F3R A;  1AW9 A;  2F8F A;  4G19 A;  2IL3 A;  2LUS A;  3G7J A;  3W8J A;  3HVS A;  4TXO A;  2OBK A;  5KN0 A;  2B7K A;  1AXD A;  3WGX A;  3KXO A;  4XIH A;  1AIU A;  2GVP A;  5A4V A;  3KD0 A;  4JBB A;  3F8U A;  4MCU A;  2F51 A;  3HZ4 A;  3TKQ A;  4EDZ A;  3DRN A;  4RQR A;  2EIQ A;  4WKW A;  3NIV A;  3UVT A;  4F9Z A;  4RUV A;  3MNG A;  1SL2 B;  2OKA A;  4NV5 A;  3E9J B;  3E0U A;  3VWV A;  5F0G A;  3GL5 A;  2L6C A;  1T1V A;  1TW9 A;  3ME7 A;  4YQU A;  3HJP A;  3SWL A;  5DCH A;  1SEN A;  3HDC A;  3GKM A;  2L57 A;  1UVZ A;  4X1U A;  5IPH A;  4V2L A;  3EIN A;  1AQW A;  4XTS A;  4F0C A;  1JZR A;  4GCI A;  2IFQ A;  5ECN B;  2GTU A;  5GSS A;  2O89 A;  2EIR A;  5DCG A;  1TK8 B;  1ERV A;  3HJO A;  4IQ1 A;  5CO3 A;  2H6Z A;  1MDI A;  2CZ2 A;  4MF5 A;  2IMD A;  1TXX A;  1ON4 A;  1G6W A;  2VCV A;  2E0Q A;  3GIX A;  2CVD A;  1M2D A;  1T8E B;  4MH3 A;  2VCZ A;  2DIY A;  1EV9 A;  18GS A;  2C0E A;  1EZK A;  2A4V A;  1XFL A;  6GSU A;  2H8L A;  2H66 A;  1ML6 A;  3C1R A;  2M80 A;  5HFK A;  2C3T A;  3DVX A;  2YPM A;  4POK A;  3IBH A;  1PKZ A;  3CSI A;  2FGX A;  3KJY A;  2ES7 A;  2H74 A;  3HVV A;  1B8X A;  4MZW A;  3TJF A;  1M9B A;  5B8A A;  1ACV A;  2QKE A;  2B3S A;  4OO4 A;  3TJJ A;  1EP8 A;  4ML6 A;  3TRQ A;  4Q5R A;  1O8X A;  4I8B A;  3UL3 A;  5JCU A;  2GS3 A;  4ECJ A;  4K1F A;  3QAG A;  4MPG A;  3G7Y A;  4IGJ A;  5F05 A;  1FHE A;  2F9S A;  17GS A;  2H1D A;  3IV4 A;  1A2L A;  1VF3 A;  3GKX A;  4FH8 A;  1TI1 A;  4F03 A;  4I5Q A;  3MSZ A;  3F4T A;  3HHV A;  5HR3 A;  2JAD A;  3AY8 A;  3EE2 A;  3IAS 2;  4MK3 A;  3CRT A;  1DBY A;  3KZQ A;  5FWG A;  3GTU A;  1YF1 A;  2DLX A;  2OE3 A;  3LWA A;  5HFI A;  3F0I A;  1FVJ A;  1X5D A;  2IMF A;  2H6Y A;  2V41 A;  1F9M A;  3GSS A;  5CRE A;  2MYG A;  4I2U A;  2V2G A;  1OKD A;  1OC8 A;  2GSQ A;  2LTK A;  2L5L A;  2P5R A;  2PVQ A;  1YKC A;  1EP7 A;  2HNL A;  3TRX A;  3FK8 A;  3GMF A;  2E7P A;  2G2Q A;  4TR0 A;  5ECR B;  2KP2 A;  5EL8 A;  5COH A;  4MAB A;  2VM1 A;  1PX7 A;  1TRW A;  5HR1 A;  2F3M A;  1MDJ A;  2EIO A;  1X9W B;  1S3C A;  5DJM A;  1THO A;  4PNF A;  10GS A;  3IK7 A;  4ULX A;  1O6J A;  5D93 A;  1Z7R A;  2VCX A;  4BVX A;  4MDC A;  4OFN A;  1LJR A;  1Z3E A;  5DAK B;  1A8Y A;  1EWX A;  1SL1 B;  2IWT A;  4ACS A;  5IMA A;  1ZYE A;  4HOJ A;  2RLI A;  3D4T A;  1N8J A;  5CAX A;  1FVK A;  2E2M A;  4ECC A;  2LRC A;  3RDW A;  2YJH A;  1ZGN A;  2B7J A;  2HRF A;  4YAP A;  2H6X A;  3G7I A;  1B48 A;  3CBU A;  5D96 A;  4RQX A;  4ISD A;  1F37 A;  2C80 A;  1WMJ A;  3EVI A;  4DSS B;  2N5F A;  3KEB A;  4IS0 A;  4D73 B;  1GUH A;  5J41 A;  1X5E A;  5IO0 A;  2CT6 A;  3US3 A;  2H0G A;  2K8S A;  2AB6 A;  2E2G A;  4NXI A;  4XCS A;  3FYG A;  2HZE A;  5DVB A;  4PUF C;  1EGR A;  3VPT A;  1TJD A;  2LJA A;  1TK0 B;  5KEJ A;  4LL4 B;  2DMM A;  1UC7 A;  4POM A;  3IR4 A;  3EWL A;  4TXO B;  3UBK A;  1ERW A;  1K0A A;  1R5P A;  4IEL A;  1V9W A;  5DJL A;  2A2R A;  2VO4 A;  3ZTL A;  1FAA A;  2X64 A;  4MA9 A;  4G2E A;  3KH7 A;  2YZU A;  3EU4 A;  6GST A;  5J9C A;  2I3Y A;  2VL3 A;  5AIX A;  1TP9 A;  4K7I A;  1VF2 A;  1AUC A;  4TXV A;  4HU7 A;  1S3A A;  4MMM A;  2HXK A;  2WRT A;  4FIW A;  5IOW A;  2HFD A;  2FHE A;  4PQ1 A;  2JZS A;  4QL9 A;  1GSE A;  1GSU A;  3Q19 A;  8GSS A;  3LFL A;  3IRA A;  3KP8 A;  1XW5 A;  3BCK A;  2FA4 A;  1KNG A;  3P7X A;  2K8V A;  2LRT A;  1J9B A;  4WEY A;  4GF0 A;  3F3Q A;  1PSQ A;  1A0F A;  1OE7 A;  3G9B A;  5KN2 A;  2IFQ B;  2H0I A;  2BJX A;  3FR9 A;  1A8L A;  2HYX A;  2J9H A;  3IPZ A;  14GS A;  4TVE A;  4N10 A;  4MF6 A;  4AJ8 A;  2L4Q A;  1WJK A;  1EOH A;  4HS1 A;  4NV2 A;  2CAI A;  2FNO A;  3RAZ A;  4EDY A;  2X8C A;  1A23 A;  2VLT A;  4H86 A;  4WF4 A;  3F4R A;  3HA9 A;  5D9V A;  1SKR B;  4HI7 A;  3CYN A;  4N0V A;  2DJK A;  2PMT A;  3LSZ A;  2YOI A;  4ZB8 A;  2AYT A;  4FYB A;  3TKR A;  3BCI A;  4IHU A;  2KUC A;  1G7O A;  2M46 A;  3DWV A;  4HEA 2;  3QMX A;  1O73 A;  5H5S A;  3ERF A;  2MBT A;  4V2N A;  1J08 A;  1M7T A;  3TOT A;  1U3A A;  5IMZ A;  1GRX A;  1ABA A;  1ZZY A;  1GSY A;  1GSS A;  5DDL A;  2H71 A;  3H1N A;  4DSQ A;  4TRX A;  5D73 A;  3ZVJ D;  2MBS A;  1H4O A;  3ZML A;  4ZL8 A;  3IXR A;  2XBQ A;  3W8S A;  5D8I A;  20GS A;  2TRC P;  4X43 A;  1YZX A;  2GT6 A;  4KE3 A;  2ON7 A;  5G5F A;  1K0O A;  1YDK A;  4TR1 A;  2VOC A;  2CV4 A;  3IDV A;  4KCE A;  5JCG A;  5CP1 A;  5AN1 A;  1V57 A;  4ILF A;  1SJ6 A;  5H5R A;  4EO3 A;  1OAZ A;  3BOA A;  2PVO C;  4YH2 A;  2DJJ A;  1NHO A;  1UA5 A;  2LRN A;  3QR6 A;  3VK9 A;  2VD0 A;  5EY6 A;  2H1A A;  4K9Z A;  2MZC A;  3L9V A;  5DQS A;  3C1S A;  1GUL A;  3TJK A;  3FZ4 A;  1GUM A;  3ZFL A;  5HQP A;  3GTU B;  1IYH A;  3FRC A;  12GS A;  3HY2 A;  5IPG A;  1U87 A;  5G1K A;  3D6I A;  4HJ2 A;  3QDN A;  3HVX A;  2IPA A;  2H30 A;  1R5A A;  4IVF A;  2VL2 C;  1WE0 A;  2N5B A;  3DEX A;  2REM A;  16GS A;  3VPQ A;  1GTU A;  1IYI A;  1M2B A;  3WYW A;  4K0G A;  1HNC A;  2R2J A;  2WZ9 A;  1MD4 A;  3DVW A;  5ABR A;  2MMZ A;  1Z9H A;  3QAV A;  2VUP A;  3EMP A;  2LQQ A;  3SBC A;  3U5R E;  3N5O A;  3DML A;  5D9X A;  3WGD A;  3LQ7 A;  1PD2 1;  3JCM L;  5A5K A;  3KP9 A;  3VI5 A;  5G1L A;  4MJA A;  1ST9 A;  3BJ5 A;  1XWA A;  4DEJ A;  2G0F A;  2VM2 A;  2C4J A;  3UAP A;  1GTI A;  1PL2 A;  1DSB A;  3H4K A;  3S9F A;  3P2A A;  4KSM A;  2OBI A;  2PUK C;  1SJZ A;  4GRF A;  2DBC A;  4Q5Q A;  3ZZX A;  3EYT A;  2X8H A;  3QFA C;  4NPB A;  2CVK A;  1SL0 B;  4N0Z A;  3LXZ A;  5F06 A;  3GV1 A;  1X5C A;  2J23 A;  4NHW A;  3TKS C;  3N9J A;  1H75 A;  2IIY A;  2VLU A;  4OFT A;  2BTO T;  3UEM A;  1A2M A;  1GSQ A;  4P3Y B;  1GTB A;  3WT2 A;  2VAF A;  5LNK e;  4L0U A;  3HD5 A;  2BMX A;  4ZIL A;  2YWM A;  4TN8 A;  1QFN A;  2LS5 A;  3GL3 A;  3ZYW A;  2NPB A;  4ZIJ A;  1B9X C;  4E8E A;  1B9Y C;  1I5G A;  2DJ3 A;  3H8Q A;  3L9U A;  4GLT A;  3M0F A;  5HR0 A;  4JED A;  1YEX A;  2O7K A;  5J4U A;  4OFM A;  1TU7 A;  2B1L A;  4BL7 A;  1T3B A;  2R37 A;  2VL2 A;  4XS1 A;  4HUA A;  3TUE A;  11GS A;  2R6K A;  3EC3 A;  2F8A A;  1K0N A;  1PL1 A;  3KM6 A;  3KTB A;  4HU9 A;  2X8G A;  3ME8 A;  4O32 A;  4BWS A;  3TOU A;  4GST A;  1VRS D;  4IJI A;  4WBJ A;  4EKZ A;  2LKU A;  1N2A A;  1PA3 A;  5GAN D;  3HCZ A;  1XVW A;  3K8N A;  2CA8 A;  2CX3 A;  2KOK A;  3FW2 A;  1JHB A;  5ECQ B;  3APO A;  2Z9S A;  2LNS A;  4LLR A;  1PMT A;  1QGV A;  2X99 A;  2GLR A;  1FB0 A;  3NOF A;  3EMX A;  2WCI A;  4RI7 A;  2FD3 A;  1NW2 A;  3Q74 A;  3GUS A;  4OO5 A;  2R5G A;  4J57 E;  5IMD A;  7GSS A;  5ECS A;  3LYK A;  4F2I A;  2MMN A;  9GSS A;  4ZL7 A;  3RBT A;  1THX A;  4YQV A;  5GZZ B;  4LMW A;  3A2W A;  3I6A A;  4I97 A;  5G30 A;  4LMV A;  2HSY A;  4BWQ A;  2ZUP A;  4EF0 A;  2NTO A;  3H93 A;  2KP1 A;  4F0B A;  3ERG A;  2AHE A;  2L5O A;  3QPM A;  4MZC A;  4X0X A;  4MF7 A;  2ZCT A;  5F8B A;  4TKY A;  1Y6E A;  2YAN A;  5JWR B;  1KBN A;  3VLN A;  4IKH A;  2AV4 A;  3ZFB A;  3VI7 A;  2RII A;  4IP6 A;  1V98 A;  4OMV A;  4NMU A;  3UOM A;  1XOA A;  1BX9 A;  1TRU A;  1K3Y A;  3APS A;  1A0R P;  3QAW A;  5G5E A;  4XHM A;  3TKS E;  1F3B A;  5J3R A;  4K0N A;  4PQI A;  5IOX A;  3FR6 A;  1TTZ A;  2HE3 A;  1ERU A;  2V32 A;  2H72 A;  1JZD A;  1SK2 A;  5GAP D;  3LJR A;  1M99 A;  4L8E A;  2XHF A;  2P31 A;  2H0H A;  2FWF A;  2DIZ A;  2JZT A;  2TIR A;  2JL4 A;  3GUR A;  5E59 A;  3FHK A;  2PWJ A;  2QC7 A;  2KHP A;  2LV3 A;  1XWG A;  1S3D A;  6GSV A;  1DE2 A;  4OCE A;  3ED3 A;  3ZMK A;  3F63 A;  1XPV A;  5B6N A;  3GH6 A;  5ECH B;  5INY A;  3GRX A;  2VD1 A;  5A4W A;  1W4V A;  3M3M A;  5IM9 A;  4AJ7 A;  1ZMA A;  3FZ9 A;  3GX0 A;  4L5L A;  1Y25 A;  4K7N A;  3FZA A;  2EC4 A;  1C72 A;  5IO2 A;  4KAE A;  1JLW A;  5AIS A;  4ZBA A;  6GSW A;  3W6G A;  4PNG A;  3BBY A;  1KTE A;  4ID0 A;  5C00 A;  5AGY A;  2FY6 A;  2QGV A;  1XWC A;  1O8W A;  3M1G A;  3WGE A;  3D4M A;  3F6D A;  1BJX A;  4KCA A;  4ZBD A;  4KB3 A;  3UVH A;  4XRA A;  1XZO A;  5CRG A;  3A2V A;  3KIJ A;  3GKK A;  4QQ7 A;  2TRX A;  5CRH A;  3M9K A;  5C04 A;  3IHQ A;  2I81 A;  4PQH A;  1HD2 A;  4GTU A;  2H19 A;  1TK5 B;  2C3Q A;  5HR2 A;  1OVN A;  2I9H A;  1GSF A;  2AJQ B;  2GQL A;  2C1Y A;  2V1M A;  1BED A;  1EOG A;  2V6K A;  5F07 A;  2CQ9 A;  4WF5 A;  1EEM A; 
#chains in the Genus database with same CATH topology
 1G6Y A;  3A5I A;  1R7H A;  1DUG A;  3DIE A;  2A2S A;  4O92 A;  5FHI A;  2C0D A;  3C71 A;  1GTA A;  1EEJ A;  2YP6 A;  3HYP A;  3GNJ A;  3L9S A;  5JCW A;  3HJM A;  3LGC A;  2B5Y A;  4HZ2 A;  4EE0 A;  4GQC A;  2VIM A;  3O3T A;  3ZVJ A;  2B5X A;  5CNW A;  1X9S B;  5LCZ A;  2VCQ A;  2ALB A;  1RK4 A;  2WFC A;  3TCO A;  2XPE A;  1EGO A;  1ZOF A;  1K0C A;  4ML1 A;  2PN8 A;  4CY6 A;  3APQ A;  4YAV A;  2YWO A;  5CYY A;  3ZRE A;  1XIY A;  4PUA A;  3DYR A;  4V2M A;  2FCH A;  3C73 A;  2IJY A;  2YCD A;  1T4Y A;  3FZ5 A;  4BL7 B;  1YQ1 A;  4K5R A;  4LL1 B;  2DC5 A;  3LW9 A;  4PXO A;  4IBP A;  4J56 E;  1BYE A;  1SKS B;  3GH9 A;  1V40 A;  3LEF A;  3ZL5 A;  1ERT A;  2FA8 A;  1QXH A;  1ILO A;  1HYU A;  5KN1 A;  2HT9 A;  4ZB6 A;  1NM3 A;  4WR4 A;  2H01 A;  4KND A;  2K6V A;  4F82 A;  2AUV A;  3VFI A;  2I4A A;  4JU5 A;  1OYJ A;  2OE1 A;  2M72 A;  4G9H A;  3VUR A;  1OC9 A;  2PPT A;  1PQN A;  5A4U A;  4ZXG A;  4EXJ A;  1Q4J A;  3EPT A;  2FLS A;  2YWN A;  1K3L A;  3HKR A;  4MZB A;  2K18 A;  1GLP A;  1VF4 A;  2FUG 2;  3D0Z A;  2KLX A;  3PGT A;  2H1B A;  3KH9 A;  2H76 A;  1U3I A;  5IMF A;  4XS4 A;  2L59 A;  3M9J A;  5B6M A;  3PH9 A;  3ZIJ A;  1SD9 A;  1U6T A;  2DJ2 A;  3F6F A;  5ECI B;  1V2A A;  2GT5 A;  2GST A;  2OAD A;  4O5R A;  1E2Y A;  4TR4 A;  4QL7 A;  3FR3 A;  1TU8 A;  1FG4 A;  3LYP A;  4D73 A;  6GSS A;  1TRS A;  4GQF A;  4ECB A;  3L78 A;  3DKS A;  3E3E A;  1X9M B;  4PUR A;  3M8N A;  3WD6 A;  3OR5 A;  1PGT A;  1UN2 A;  3KGK A;  4KH7 A;  1BAY A;  3GHA A;  4N30 A;  1WP0 A;  4I2T A;  1OC3 A;  1Q98 A;  4IN0 A;  5DAL A;  4POB A;  4JR6 A;  2ON5 A;  1AQX A;  1GL8 A;  3A3T A;  3GA4 A;  3UAR A;  3GKN A;  4WBR D;  2B5E A;  3VWW A;  2GQM A;  3CSJ A;  4KA0 A;  4YQM A;  3O6T A;  3NZN A;  5J9B A;  1XOB A;  4JE1 A;  3RPN A;  1XW6 A;  5LD0 A;  1TDI A;  1XBS A;  3GYK A;  1B4Q A;  2VL9 A;  4CW9 A;  3DXB A;  4V1A g;  2YWI A;  2GSS A;  3RHB A;  2B6M A;  5ELG A;  2P0G A;  2FWH A;  5FT3 A;  5BRT A;  3GST A;  2DML A;  3LG6 A;  2HZF A;  2XC2 A;  4MH2 A;  2JSZ A;  4HQS A;  2O87 A;  4NHZ A;  3CRU A;  3EU3 A;  4JR4 A;  4FYU A;  3LOR A;  3HXS A;  2HZE B;  2VCW A;  2RM5 A;  2FWG A;  1AQV A;  2GQK A;  5L71 A;  1NHY A;  4RI6 A;  3QD9 A;  4ICY A;  4FO5 A;  3D21 A;  3H79 A;  5ENU A;  1M0U A;  3TGZ A;  5AIV A;  2YN1 A;  1QUW A;  3LXT A;  4K7O A;  2OA7 A;  1USB A;  3R2Q A;  1GH2 A;  3FKF A;  2CAQ A;  3UIW A;  2DJ1 A;  4HZ4 A;  2RUE A;  3IE3 A;  1SYX A;  4CDO A;  4G0L A;  2YZH A;  4HJM A;  1Z6N A;  5ID2 A;  1YKA A;  2XPD A;  2D2Z A;  3UMA A;  3MDK A;  3F4S A;  3J7Y k;  2IN3 A;  1PN9 A;  4MPF A;  3IK9 A;  3TKP A;  4KGI A;  1X0R A;  3VWU A;  1A2J A;  2B1K A;  4AJ6 A;  3EUR A;  4YKF A;  5IQY A;  2H73 A;  4JRR A;  2MMO A;  1RW1 A;  3WT1 A;  2GSR A;  2CVB A;  2OE0 A;  3P90 A;  2C0G A;  3TJG A;  5DQY A;  1MEK A;  1W89 A;  3I69 A;  1YY7 A;  2R4V A;  2R0G A;  5H5Q A;  1JZW A;  3D5J A;  4WR5 A;  5HFG A;  2HSH A;  3TKS A;  1GNW A;  1G0T A;  2K9F A;  5EPF A;  2YV7 A;  3V1W A;  4FYC A;  1LBK A;  3FEU A;  4CHS A;  4KDX A;  4K8M A;  1ZYN A;  2WUL A;  2DJ0 A;  2HRK A;  4I6X A;  5BMU A;  1GUK A;  1WRY A;  1CQH A;  1K0B A;  3C7M A;  4N11 A;  1XWK A;  2HRN A;  1GWC A;  3QOU A;  1T4Z A;  5G31 A;  5G2Z A;  1PX6 A;  1XWB A;  4J2F A;  3TB2 A;  2WS2 A;  2LST A;  2C3N A;  5D9W A;  3PR8 A;  1I9D A;  2XBI A;  1WPI A;  1SYR A;  4WXT A;  1YJ6 A;  3CTG A;  1VGL A;  1RQM A;  1ZYQ B;  3UBL A;  4BVY A;  1MD3 A;  2GZP A;  2HLS A;  1WIK A;  1T00 A;  1E6B A;  1OC9 B;  4GXZ A;  4OCF A;  4EC0 A;  3MAK A;  3ERW A;  4TR1 B;  22GS A;  3RPP A;  2V6O A;  2H75 A;  2LQO A;  4BPY A;  3IC4 A;  4ECI A;  1VF1 A;  1AC1 A;  5IIZ A;  1GP1 A;  1O7U A;  3ZLP A;  4G10 A;  2OAC A;  4LA1 A;  2RM6 A;  1G7E A;  1EV4 A;  3PIN A;  3ZRD A;  4XS4 B;  3C8E A;  5JWO B;  1QQ2 A;  4V1A p;  1Z6M A;  1M2A A;  2GZZ A;  2WJU A;  2I1U A;  2VLV A;  5DBQ A;  1TRV A;  1URM A;  2O8V B;  4KSO A;  4Z2R A;  1NSW A;  2YJ7 A;  3U6V A;  2H1G A;  1R26 A;  1R4W A;  3GX8 A;  3DD3 A;  1J0F A;  1HNB A;  1XW9 A;  3IAM 2;  3MWH A;  1YEP A;  5J5N A;  2UZ8 A;  4E8H A;  2LJK A;  2GDR A;  2NDO A;  3GFK A;  2JSY A;  2CZ3 A;  4L0W A;  5ELA A;  1MTC A;  1K0M A;  2C0F A;  2HI7 A;  4HQZ A;  5KN3 A;  3J7Y b;  3O76 A;  1TI3 A;  5DAL B;  1YF0 A;  3Q18 A;  3DGQ A;  2PGT A;  1O85 A;  2IMI A;  3CSH A;  5EVO A;  1OKT A;  2LEG A;  2DSA A;  2L6D A;  3CXG A;  3TDG A;  4KX4 A;  5IMC A;  4ZL9 A;  1SD8 A;  2WGR A;  1GLQ A;  1QK8 A;  3GN3 A;  3RHC A;  4TOP A;  4MJC A;  2PBJ A;  1CQG A;  2R0C A;  2YNX A;  4EVM A;  1FB6 A;  4KDU A;  4NAX A;  5D9T A;  4IP1 A;  3UJ1 A;  1KEB A;  3VWX A;  4AF2 A;  1O81 A;  2LNT A;  4GSN A;  1HQO A;  1SJI A;  3ZIT A;  5B7C A;  2ZNM A;  3BD2 A;  4GWR A;  1SU9 A;  2AAW A;  4MJB A;  13GS A;  1PRX A;  1SK1 A;  1TOF A;  4Q5N A;  4OWY A;  4OD7 A;  3I9V 2;  3P8W A;  3I43 A;  4MJE A;  4PX1 A;  5B8B A;  5ECL B;  3KCM A;  4EL1 A;  3QFB C;  4G0K A;  4IJ3 A;  5ECK B;  1WOU A;  1B4P A;  5IMV A;  4WET A;  2WB9 A;  4TR3 A;  4MP4 A;  5JWQ B;  2MMA A;  1MDK A;  4Q5F A;  3F9U A;  4KUN A;  2GZY A;  1F3A A;  1BQ7 A;  4PGT A;  2IMK A;  1GNE A;  1PFO A;  5ECO B;  4JZQ A;  4L5O A;  2GGT A;  4TW5 A;  3IA1 A;  4IW9 A;  1FOV A;  2JAC A;  4ZB9 A;  1ZL9 A;  3D22 A;  19GS A;  3FMW A;  1JFU A;  3KMN A;  4O7H A;  2VCT A;  2R3X A;  3A2X A;  5ECP B;  3KTL A;  5ECM B;  4BA7 A;  2IME A;  3PPU A;  5ID2 B;  2JU5 A;  1SK0 A;  3ZIV A;  2QSI A;  4IQA A;  2CX4 A;  1XVQ A;  3L4N A;  4AGS A;  2C8U A;  4HDE A;  4EUY A;  3L0H A;  2YV9 A;  1FO5 A;  1T7P B;  1DE1 A;  1ZCP A;  4EIQ A;  1FW1 A;  4NWY A;  2WDU A;  6GSX A;  4DSR A;  1BG5 A;  2H70 A;  5DAK A;  3HZ8 A;  5CRD A;  1F2E A;  3Q6O A;  2FWE A;  1PKW A;  2PU9 C;  5CRW A;  2NBS A;  1U88 A;  1V58 A;  3CTF A;  1AAZ A;  1WWJ A;  4KW6 A;  1XCC A;  2O85 A;  1QMV A;  2LJR A;  5E4W A;  4XRD A;  2N5A A;  5GST A;  2PER A;  1SKW B;  3KMO A;  4MLY A;  4Z7X A;  1GSD A;  3TJB A;  1M9A A;  1JZO A;  2NVL A;  3HVN A;  4POL A;  2R0P A;  3A5W A;  4DSS A;  4XS6 A;  1A24 A;  3CMI A;  1XXU A;  2RUF A;  4KDY A;  3QCP A;  4DVC A;  1TKD B;  2JZR A;  4K6X A;  4K2X A;  1Z7P A;  1JLV A;  6GSY A;  3TRP A;  3FY7 A;  1LU4 A;  4K2D A;  1Z5Y E;  3ISO A;  2OJL A;  1K0D A;  4GSS A;  4ZBB A;  2P5Q A;  2L4C A;  1F6M C;  1HNA A;  3IOS A;  1K3O A;  1OE8 A;  4K5S A;  3F3R A;  1AW9 A;  2F8F A;  4G19 A;  2IL3 A;  2LUS A;  2X49 A;  3G7J A;  4BVY B;  3W8J A;  3HVS A;  4TXO A;  2OBK A;  5KN0 A;  2B7K A;  1AXD A;  3WGX A;  3KXO A;  4XIH A;  1AIU A;  2GVP A;  5A4V A;  3KD0 A;  4JBB A;  3F8U A;  4MCU A;  2F51 A;  3HZ4 A;  4HSC X;  3TKQ A;  4EDZ A;  3DRN A;  4RQR A;  2EIQ A;  4WKW A;  3NIV A;  3UVT A;  4F9Z A;  4RUV A;  3MNG A;  1SL2 B;  2OKA A;  4NV5 A;  3E9J B;  3E0U A;  3VWV A;  5F0G A;  3GL5 A;  2L6C A;  1T1V A;  1TW9 A;  3ME7 A;  4YQU A;  3HJP A;  3SWL A;  5DCH A;  1SEN A;  3HDC A;  3GKM A;  2L57 A;  1UVZ A;  4X1U A;  5IPH A;  4V2L A;  3EIN A;  1AQW A;  4XTS A;  4F0C A;  1JZR A;  4GCI A;  2IFQ A;  5ECN B;  2GTU A;  5GSS A;  2O89 A;  2EIR A;  4USS A;  5DCG A;  1TK8 B;  1ERV A;  3HJO A;  4IQ1 A;  5CO3 A;  2H6Z A;  1MDI A;  2CZ2 A;  4MF5 A;  2IMD A;  1TXX A;  1ON4 A;  1G6W A;  2VCV A;  2E0Q A;  3GIX A;  2CVD A;  1M2D A;  1T8E B;  4MH3 A;  2VCZ A;  4A5P A;  2DIY A;  1EV9 A;  18GS A;  2C0E A;  1EZK A;  2A4V A;  1XFL A;  6GSU A;  2H8L A;  2H66 A;  1ML6 A;  3C1R A;  2M80 A;  5HFK A;  2C3T A;  3DVX A;  2YPM A;  4Z2U A;  4POK A;  3IBH A;  1PKZ A;  3CSI A;  2FGX A;  3KJY A;  2ES7 A;  2H74 A;  3HVV A;  1B8X A;  4MZW A;  1EEM A;  3TJF A;  1M9B A;  5B8A A;  1ACV A;  2QKE A;  2B3S A;  4OO4 A;  3TJJ A;  1EP8 A;  4ML6 A;  3TRQ A;  4Q5R A;  1O8X A;  4I8B A;  2HSM A;  3UL3 A;  5JCU A;  2GS3 A;  4ECJ A;  4K1F A;  3QAG A;  4MPG A;  3G7Y A;  4IGJ A;  5F05 A;  1FHE A;  2F9S A;  17GS A;  2H1D A;  4X4J A;  3IV4 A;  1A2L A;  1VF3 A;  3GKX A;  4FH8 A;  1TI1 A;  4F03 A;  4I5Q A;  3MSZ A;  3F4T A;  3HHV A;  5HR3 A;  2JAD A;  3AY8 A;  3EE2 A;  3IAS 2;  4MK3 A;  3CRT A;  1DBY A;  3KZQ A;  5FWG A;  3GTU A;  1YF1 A;  2DLX A;  2OE3 A;  3LWA A;  5HFI A;  3F0I A;  1FVJ A;  1X5D A;  2IMF A;  2H6Y A;  2V41 A;  1F9M A;  3GSS A;  5CRE A;  2MYG A;  4I2U A;  2V2G A;  1OKD A;  1OC8 A;  2GSQ A;  2LTK A;  4O5U A;  2L5L A;  2P5R A;  2PVQ A;  1YKC A;  1EP7 A;  2HNL A;  3TRX A;  3FK8 A;  3GMF A;  2E7P A;  2G2Q A;  4TR0 A;  5ECR B;  2KP2 A;  5EL8 A;  5COH A;  4MAB A;  2VM1 A;  1PX7 A;  1TRW A;  5HR1 A;  2F3M A;  1MDJ A;  2EIO A;  4CY8 A;  1X9W B;  1S3C A;  5DJM A;  1THO A;  4PNF A;  10GS A;  3IK7 A;  4ULX A;  1O6J A;  5D93 A;  1Z7R A;  2VCX A;  4BVX A;  4MDC A;  4OFN A;  1LJR A;  1Z3E A;  5DAK B;  1A8Y A;  1EWX A;  1SL1 B;  2IWT A;  3MIX A;  4ACS A;  5IMA A;  1ZYE A;  4HOJ A;  2RLI A;  3D4T A;  1N8J A;  5CAX A;  1FVK A;  2E2M A;  4ECC A;  2LRC A;  3IC8 A;  2YJH A;  3RDW A;  1ZGN A;  2B7J A;  2HRF A;  4YAP A;  2H6X A;  3G7I A;  1B48 A;  3CBU A;  5D96 A;  4RQX A;  4ISD A;  1F37 A;  2C80 A;  1WMJ A;  3EVI A;  4DSS B;  2N5F A;  3KEB A;  4IS0 A;  4D73 B;  1GUH A;  5J41 A;  1X5E A;  5IO0 A;  2CT6 A;  3US3 A;  4KF9 A;  2H0G A;  2K8S A;  2AB6 A;  2E2G A;  4NXI A;  4XCS A;  3FYG A;  2HZE A;  5DVB A;  4PUF C;  1EGR A;  3VPT A;  1TJD A;  2LJA A;  1TK0 B;  5KEJ A;  4LL4 B;  1M3J A;  2DMM A;  1UC7 A;  4POM A;  3IR4 A;  3EWL A;  4TXO B;  3UBK A;  1ERW A;  1K0A A;  1R5P A;  4IEL A;  1V9W A;  5DJL A;  2A2R A;  2VO4 A;  3ZTL A;  1FAA A;  2X64 A;  4MA9 A;  4G2E A;  3KH7 A;  2YZU A;  3EU4 A;  6GST A;  5J9C A;  2I3Y A;  2VL3 A;  5AIX A;  1TP9 A;  4K7I A;  1VF2 A;  1AUC A;  4TXV A;  4HU7 A;  1S3A A;  4MMM A;  2HXK A;  2WRT A;  4FIW A;  5IOW A;  2HFD A;  2FHE A;  4PQ1 A;  2JZS A;  4QL9 A;  1GSE A;  1GSU A;  3Q19 A;  8GSS A;  3LFL A;  3IRA A;  3KP8 A;  1XW5 A;  3BCK A;  4Z2T A;  2FA4 A;  1KNG A;  3P7X A;  2K8V A;  2LRT A;  1J9B A;  4WEY A;  4GF0 A;  3F3Q A;  1PSQ A;  1A0F A;  1OE7 A;  3G9B A;  5KN2 A;  2IFQ B;  2H0I A;  2BJX A;  3FR9 A;  1A8L A;  2HYX A;  2J9H A;  3IPZ A;  14GS A;  4TVE A;  4N10 A;  4MF6 A;  4AJ8 A;  2L4Q A;  1WJK A;  1EOH A;  4HS1 A;  4NV2 A;  2CAI A;  2FNO A;  3RAZ A;  4EDY A;  2X8C A;  1A23 A;  2VLT A;  4H86 A;  4WF4 A;  3IHG A;  3F4R A;  3HA9 A;  5D9V A;  1SKR B;  4HI7 A;  3CYN A;  4N0V A;  2DJK A;  2PMT A;  3LSZ A;  2YOI A;  4ZB8 A;  2AYT A;  4FYB A;  3TKR A;  3BCI A;  1M3I A;  4IHU A;  2KUC A;  1G7O A;  2M46 A;  3DWV A;  4HEA 2;  3QMX A;  1O73 A;  5H5S A;  3ERF A;  2MBT A;  4V2N A;  1J08 A;  1M7T A;  3TOT A;  1U3A A;  5IMZ A;  1GRX A;  1ABA A;  1ZZY A;  1GSY A;  1GSS A;  5DDL A;  2H71 A;  3H1N A;  4DSQ A;  4TRX A;  5D73 A;  3ZVJ D;  2MBS A;  1H4O A;  3ZML A;  4ZL8 A;  3IXR A;  2XBQ A;  3W8S A;  5D8I A;  20GS A;  2TRC P;  4X43 A;  1YZX A;  2GT6 A;  4KE3 A;  2ON7 A;  5G5F A;  1K0O A;  1YDK A;  4TR1 A;  2VOC A;  2CV4 A;  3IDV A;  4KCE A;  5JCG A;  5CP1 A;  5AN1 A;  1V57 A;  4ILF A;  1SJ6 A;  5H5R A;  4EO3 A;  1OAZ A;  1XG8 A;  3BOA A;  2PVO C;  4YH2 A;  2DJJ A;  1NHO A;  1UA5 A;  2LRN A;  3QR6 A;  3VK9 A;  2VD0 A;  5EY6 A;  2H1A A;  4K9Z A;  2MZC A;  3L9V A;  5DQS A;  3C1S A;  3CQF A;  1GUL A;  3TJK A;  3FZ4 A;  1GUM A;  3ZFL A;  5HQP A;  3GTU B;  1IYH A;  4G0I A;  2HRA A;  3FRC A;  12GS A;  3HY2 A;  5IPG A;  1U87 A;  5G1K A;  3D6I A;  4HJ2 A;  3QDN A;  1PN0 A;  3HVX A;  2IPA A;  2H30 A;  1R5A A;  4IVF A;  2VL2 C;  1WE0 A;  2N5B A;  3DEX A;  2REM A;  16GS A;  3VPQ A;  1GTU A;  1IYI A;  1M2B A;  3WYW A;  4K0G A;  1HNC A;  2R2J A;  2WZ9 A;  1MD4 A;  3DVW A;  5ABR A;  4MNN A;  2MMZ A;  1Z9H A;  3QAV A;  2VUP A;  3EMP A;  2LQQ A;  3SBC A;  3U5R E;  3N5O A;  3DML A;  5D9X A;  3WGD A;  2QA2 A;  3LQ7 A;  1PD2 1;  3JCM L;  4EIP A;  5A5K A;  3KP9 A;  3VI5 A;  5G1L A;  4MJA A;  1ST9 A;  3BJ5 A;  1XWA A;  4DEJ A;  4BVX B;  2G0F A;  2VM2 A;  2C4J A;  3UAP A;  1GTI A;  1PL2 A;  1DSB A;  3H4K A;  3S9F A;  3P2A A;  4KSM A;  2OBI A;  2PUK C;  1SJZ A;  4GRF A;  2DBC A;  4Q5Q A;  3ZZX A;  3EYT A;  2X8H A;  3QFA C;  4NPB A;  2CVK A;  1SL0 B;  4N0Z A;  3LXZ A;  2A4H A;  5F06 A;  3GV1 A;  1X5C A;  2J23 A;  4NHW A;  3TKS C;  3N9J A;  1H75 A;  2IIY A;  2VLU A;  4OFT A;  2BTO T;  3UEM A;  1A2M A;  1S3R A;  1GSQ A;  4P3Y B;  1GTB A;  3WT2 A;  2VAF A;  5LNK e;  4L0U A;  3HD5 A;  2BMX A;  4ZIL A;  2YWM A;  4TN8 A;  1QFN A;  2LS5 A;  3GL3 A;  3ZYW A;  2NPB A;  4ZIJ A;  1B9X C;  4E8E A;  1B9Y C;  3R3E A;  1I5G A;  2DJ3 A;  3H8Q A;  3L9U A;  4GLT A;  3M0F A;  5HR0 A;  4JED A;  1YEX A;  2O7K A;  5J4U A;  4OFM A;  1TU7 A;  4O5Q A;  2B1L A;  4BL7 A;  1T3B A;  2R37 A;  2VL2 A;  4XS1 A;  4HUA A;  3TUE A;  11GS A;  2R6K A;  3EC3 A;  2F8A A;  1K0N A;  1PL1 A;  3KM6 A;  3KTB A;  4HU9 A;  2X8G A;  3ME8 A;  4O32 A;  4BWS A;  3TOU A;  4GST A;  1VRS D;  4IJI A;  4WBJ A;  4EKZ A;  2LKU A;  1N2A A;  1PA3 A;  5GAN D;  3HCZ A;  1XVW A;  3K8N A;  2CA8 A;  2CX3 A;  2KOK A;  3FW2 A;  1JHB A;  5ECQ B;  3APO A;  2Z9S A;  2LNS A;  4LLR A;  1PMT A;  1QGV A;  2X99 A;  2GLR A;  1FB0 A;  3NOF A;  3EMX A;  2WCI A;  4RI7 A;  2FD3 A;  1NW2 A;  3Q74 A;  3MYD A;  1FOH A;  3GUS A;  4OO5 A;  2R5G A;  4J57 E;  5IMD A;  5KOX A;  7GSS A;  5ECS A;  3LYK A;  4F2I A;  2MMN A;  9GSS A;  4ZL7 A;  3RBT A;  1THX A;  4YQV A;  5GZZ B;  4LMW A;  3A2W A;  1ZYP A;  3I6A A;  4I97 A;  5G30 A;  4LMV A;  2HSY A;  4BWQ A;  2ZUP A;  4EF0 A;  2NTO A;  3H93 A;  2KP1 A;  4F0B A;  4BIK A;  3ERG A;  2AHE A;  2L5O A;  3QPM A;  4MZC A;  4X0X A;  4MF7 A;  2ZCT A;  5F8B A;  4TKY A;  2YAN A;  5JWR B;  1KBN A;  3VLN A;  2QA1 A;  4IKH A;  2AV4 A;  3ZFB A;  3VI7 A;  2RII A;  4IP6 A;  1V98 A;  4OMV A;  4NMU A;  3UOM A;  1XOA A;  1BX9 A;  1TRU A;  1K3Y A;  3APS A;  1A0R P;  3QAW A;  5G5E A;  4XHM A;  3TKS E;  1F3B A;  5J3R A;  4K0N A;  4PQI A;  5IOX A;  4FQU A;  3FR6 A;  4YKG A;  1TTZ A;  2HE3 A;  1ERU A;  2V32 A;  2H72 A;  1JZD A;  1SK2 A;  5GAP D;  3LJR A;  1M99 A;  2A2P A;  4L8E A;  2XHF A;  2P31 A;  2H0H A;  2FWF A;  2DIZ A;  2JZT A;  2TIR A;  2JL4 A;  3GUR A;  3FHK A;  5E59 A;  2PWJ A;  2QC7 A;  4PTS A;  2KHP A;  2X4A A;  2LV3 A;  1XWG A;  1S3D A;  6GSV A;  1DE2 A;  4OCE A;  3ED3 A;  3ZMK A;  3F63 A;  1XPV A;  5B6N A;  3GH6 A;  5ECH B;  5INY A;  3GRX A;  2VD1 A;  5A4W A;  1W4V A;  3M3M A;  5IM9 A;  4AJ7 A;  1ZMA A;  3FZ9 A;  3GX0 A;  4L5L A;  1Y25 A;  4K7N A;  5KOW A;  3FZA A;  2EC4 A;  1C72 A;  5IO2 A;  4KAE A;  1JLW A;  5AIS A;  4ZBA A;  6GSW A;  3W6G A;  4PNG A;  3BBY A;  1KTE A;  4ID0 A;  5C00 A;  5AGY A;  2FY6 A;  2QGV A;  1XWC A;  1O8W A;  3M1G A;  3WGE A;  3D4M A;  3F6D A;  1BJX A;  4KCA A;  4ZBD A;  4KB3 A;  3UVH A;  4XRA A;  1XZO A;  5CRG A;  3A2V A;  3KIJ A;  3GKK A;  4QQ7 A;  2TRX A;  5CRH A;  3M9K A;  5C04 A;  3IHQ A;  2I81 A;  4PQH A;  1HD2 A;  4GTU A;  2H19 A;  1TK5 B;  2C3Q A;  5HR2 A;  1OVN A;  2I9H A;  1GSF A;  2DKI A;  2DKH A;  2AJQ B;  2GQL A;  2C1Y A;  2V1M A;  1BED A;  1EOG A;  2V6K A;  5F07 A;  2CQ9 A;  4WF5 A;  1Y6E A; 
#chains in the Genus database with same CATH homology
 1G6Y A;  3A5I A;  1R7H A;  1DUG A;  3DIE A;  2A2S A;  4O92 A;  5FHI A;  2C0D A;  3C71 A;  1GTA A;  1EEJ A;  2YP6 A;  3HYP A;  3GNJ A;  3L9S A;  5JCW A;  3HJM A;  3LGC A;  2B5Y A;  4HZ2 A;  4EE0 A;  4GQC A;  2VIM A;  3O3T A;  3ZVJ A;  2B5X A;  5CNW A;  1X9S B;  5LCZ A;  2VCQ A;  2ALB A;  1RK4 A;  2WFC A;  3TCO A;  2XPE A;  1EGO A;  1ZOF A;  1K0C A;  4ML1 A;  2PN8 A;  4CY6 A;  3APQ A;  4YAV A;  2YWO A;  5CYY A;  3ZRE A;  1XIY A;  4PUA A;  3DYR A;  4V2M A;  2FCH A;  3C73 A;  2IJY A;  2YCD A;  1T4Y A;  3FZ5 A;  4BL7 B;  1YQ1 A;  4K5R A;  4LL1 B;  2DC5 A;  3LW9 A;  4PXO A;  4IBP A;  4J56 E;  1BYE A;  1SKS B;  3GH9 A;  1V40 A;  3LEF A;  3ZL5 A;  1ERT A;  2FA8 A;  1QXH A;  1ILO A;  1HYU A;  5KN1 A;  2HT9 A;  4ZB6 A;  1NM3 A;  4WR4 A;  2H01 A;  4KND A;  2K6V A;  4F82 A;  2AUV A;  3VFI A;  2I4A A;  4JU5 A;  1OYJ A;  2OE1 A;  2M72 A;  4G9H A;  3VUR A;  1OC9 A;  2PPT A;  1PQN A;  5A4U A;  4ZXG A;  4EXJ A;  1Q4J A;  3EPT A;  2FLS A;  2YWN A;  1K3L A;  3HKR A;  4MZB A;  2K18 A;  1GLP A;  1VF4 A;  2FUG 2;  3D0Z A;  2KLX A;  3PGT A;  2H1B A;  3KH9 A;  2H76 A;  1U3I A;  5IMF A;  4XS4 A;  2L59 A;  3M9J A;  5B6M A;  3PH9 A;  3ZIJ A;  1SD9 A;  1U6T A;  2DJ2 A;  3F6F A;  5ECI B;  1V2A A;  2GT5 A;  2GST A;  2OAD A;  4O5R A;  1E2Y A;  4TR4 A;  4QL7 A;  3FR3 A;  1TU8 A;  1FG4 A;  3LYP A;  4D73 A;  6GSS A;  1TRS A;  4GQF A;  4ECB A;  3L78 A;  3DKS A;  3E3E A;  1X9M B;  4PUR A;  3M8N A;  3WD6 A;  3OR5 A;  1PGT A;  1UN2 A;  3KGK A;  4KH7 A;  1BAY A;  3GHA A;  4N30 A;  1WP0 A;  4I2T A;  1OC3 A;  1Q98 A;  4IN0 A;  5DAL A;  4POB A;  4JR6 A;  2ON5 A;  1AQX A;  1GL8 A;  3A3T A;  3GA4 A;  3UAR A;  3GKN A;  4WBR D;  2B5E A;  3VWW A;  2GQM A;  3CSJ A;  4KA0 A;  4YQM A;  3O6T A;  3NZN A;  5J9B A;  1XOB A;  4JE1 A;  3RPN A;  1XW6 A;  5LD0 A;  1TDI A;  1XBS A;  3GYK A;  1B4Q A;  2VL9 A;  4CW9 A;  3DXB A;  4V1A g;  2YWI A;  2GSS A;  3RHB A;  2B6M A;  5ELG A;  2P0G A;  2FWH A;  5FT3 A;  5BRT A;  3GST A;  2DML A;  3LG6 A;  2HZF A;  2XC2 A;  4MH2 A;  2JSZ A;  4HQS A;  2O87 A;  4NHZ A;  3CRU A;  3EU3 A;  4JR4 A;  4FYU A;  3LOR A;  3HXS A;  2HZE B;  2VCW A;  2RM5 A;  2FWG A;  1AQV A;  2GQK A;  5L71 A;  1NHY A;  4RI6 A;  3QD9 A;  4ICY A;  4FO5 A;  3D21 A;  3H79 A;  5ENU A;  1M0U A;  3TGZ A;  5AIV A;  2YN1 A;  1QUW A;  3LXT A;  4K7O A;  2OA7 A;  1USB A;  3R2Q A;  1GH2 A;  3FKF A;  2CAQ A;  3UIW A;  2DJ1 A;  4HZ4 A;  2RUE A;  3IE3 A;  1SYX A;  4CDO A;  4G0L A;  2YZH A;  4HJM A;  1Z6N A;  5ID2 A;  1YKA A;  2XPD A;  2D2Z A;  3UMA A;  3MDK A;  3F4S A;  3J7Y k;  2IN3 A;  1PN9 A;  4MPF A;  3IK9 A;  3TKP A;  4KGI A;  1X0R A;  3VWU A;  1A2J A;  2B1K A;  4AJ6 A;  3EUR A;  4YKF A;  5IQY A;  2H73 A;  4JRR A;  2MMO A;  1RW1 A;  3WT1 A;  2GSR A;  2CVB A;  2OE0 A;  3P90 A;  2C0G A;  3TJG A;  5DQY A;  1MEK A;  1W89 A;  3I69 A;  1YY7 A;  2R4V A;  2R0G A;  5H5Q A;  1JZW A;  3D5J A;  4WR5 A;  5HFG A;  2HSH A;  3TKS A;  1GNW A;  1G0T A;  2K9F A;  5EPF A;  2YV7 A;  3V1W A;  4FYC A;  1LBK A;  3FEU A;  4CHS A;  4KDX A;  4K8M A;  1ZYN A;  2WUL A;  2DJ0 A;  2HRK A;  4I6X A;  5BMU A;  1GUK A;  1WRY A;  1CQH A;  1K0B A;  3C7M A;  4N11 A;  1XWK A;  2HRN A;  1GWC A;  3QOU A;  1T4Z A;  5G31 A;  5G2Z A;  1PX6 A;  1XWB A;  4J2F A;  3TB2 A;  2WS2 A;  2LST A;  2C3N A;  5D9W A;  3PR8 A;  1I9D A;  2XBI A;  1WPI A;  1SYR A;  4WXT A;  1YJ6 A;  3CTG A;  1VGL A;  1RQM A;  1ZYQ B;  3UBL A;  4BVY A;  1MD3 A;  2GZP A;  2HLS A;  1WIK A;  1T00 A;  1E6B A;  1OC9 B;  4GXZ A;  4OCF A;  4EC0 A;  3MAK A;  3ERW A;  4TR1 B;  22GS A;  3RPP A;  2V6O A;  2H75 A;  2LQO A;  4BPY A;  3IC4 A;  4ECI A;  1VF1 A;  1AC1 A;  5IIZ A;  1GP1 A;  1O7U A;  3ZLP A;  4G10 A;  2OAC A;  4LA1 A;  2RM6 A;  1G7E A;  1EV4 A;  3PIN A;  3ZRD A;  4XS4 B;  3C8E A;  5JWO B;  1QQ2 A;  4V1A p;  1Z6M A;  1M2A A;  2GZZ A;  2WJU A;  2I1U A;  2VLV A;  5DBQ A;  1TRV A;  1URM A;  2O8V B;  4KSO A;  4Z2R A;  1NSW A;  2YJ7 A;  3U6V A;  2H1G A;  1R26 A;  1R4W A;  3GX8 A;  3DD3 A;  1J0F A;  1HNB A;  1XW9 A;  3IAM 2;  3MWH A;  1YEP A;  5J5N A;  2UZ8 A;  4E8H A;  2LJK A;  2GDR A;  2NDO A;  3GFK A;  2JSY A;  2CZ3 A;  4L0W A;  5ELA A;  1MTC A;  1K0M A;  2C0F A;  2HI7 A;  4HQZ A;  5KN3 A;  3J7Y b;  3O76 A;  1TI3 A;  5DAL B;  1YF0 A;  3Q18 A;  3DGQ A;  2PGT A;  1O85 A;  2IMI A;  3CSH A;  5EVO A;  1OKT A;  2LEG A;  2DSA A;  2L6D A;  3CXG A;  3TDG A;  4KX4 A;  5IMC A;  4ZL9 A;  1SD8 A;  2WGR A;  1GLQ A;  1QK8 A;  3GN3 A;  3RHC A;  4TOP A;  4MJC A;  2PBJ A;  1CQG A;  2R0C A;  2YNX A;  4EVM A;  1FB6 A;  4KDU A;  4NAX A;  5D9T A;  4IP1 A;  3UJ1 A;  1KEB A;  3VWX A;  4AF2 A;  1O81 A;  2LNT A;  4GSN A;  1HQO A;  1SJI A;  3ZIT A;  5B7C A;  2ZNM A;  3BD2 A;  4GWR A;  1SU9 A;  2AAW A;  4MJB A;  13GS A;  1PRX A;  1SK1 A;  1TOF A;  4Q5N A;  4OWY A;  4OD7 A;  3I9V 2;  3P8W A;  3I43 A;  4MJE A;  4PX1 A;  5B8B A;  5ECL B;  3KCM A;  4EL1 A;  3QFB C;  4G0K A;  4IJ3 A;  5ECK B;  1WOU A;  1B4P A;  5IMV A;  4WET A;  2WB9 A;  4TR3 A;  4MP4 A;  5JWQ B;  2MMA A;  1MDK A;  4Q5F A;  3F9U A;  4KUN A;  2GZY A;  1F3A A;  1BQ7 A;  4PGT A;  2IMK A;  1GNE A;  5ECO B;  4JZQ A;  4L5O A;  2GGT A;  4TW5 A;  3IA1 A;  4IW9 A;  1FOV A;  2JAC A;  4ZB9 A;  1ZL9 A;  3D22 A;  19GS A;  3FMW A;  1JFU A;  3KMN A;  4O7H A;  2VCT A;  2R3X A;  3A2X A;  5ECP B;  3KTL A;  5ECM B;  4BA7 A;  2IME A;  3PPU A;  5ID2 B;  2JU5 A;  1SK0 A;  3ZIV A;  2QSI A;  4IQA A;  2CX4 A;  1XVQ A;  3L4N A;  4AGS A;  2C8U A;  4HDE A;  4EUY A;  3L0H A;  2YV9 A;  1FO5 A;  1T7P B;  1DE1 A;  1ZCP A;  4EIQ A;  1FW1 A;  4NWY A;  2WDU A;  6GSX A;  4DSR A;  1BG5 A;  2H70 A;  5DAK A;  3HZ8 A;  5CRD A;  1F2E A;  3Q6O A;  2FWE A;  1PKW A;  2PU9 C;  5CRW A;  2NBS A;  1U88 A;  1V58 A;  3CTF A;  1AAZ A;  1WWJ A;  4KW6 A;  1XCC A;  2O85 A;  1QMV A;  2LJR A;  5E4W A;  4XRD A;  2N5A A;  5GST A;  2PER A;  1SKW B;  3KMO A;  4MLY A;  4Z7X A;  1GSD A;  3TJB A;  1M9A A;  1JZO A;  2NVL A;  4POL A;  2R0P A;  3A5W A;  4DSS A;  4XS6 A;  1A24 A;  3CMI A;  1XXU A;  2RUF A;  4KDY A;  3QCP A;  4DVC A;  1TKD B;  2JZR A;  4K6X A;  4K2X A;  1Z7P A;  1JLV A;  6GSY A;  3TRP A;  3FY7 A;  1LU4 A;  4K2D A;  1Z5Y E;  3ISO A;  2OJL A;  1K0D A;  4GSS A;  4ZBB A;  2P5Q A;  2L4C A;  1F6M C;  1HNA A;  3IOS A;  1K3O A;  1OE8 A;  4K5S A;  3F3R A;  1AW9 A;  2F8F A;  4G19 A;  2IL3 A;  2LUS A;  2X49 A;  3G7J A;  4BVY B;  3W8J A;  3HVS A;  4TXO A;  2OBK A;  5KN0 A;  2B7K A;  1AXD A;  3WGX A;  3KXO A;  4XIH A;  1AIU A;  2GVP A;  5A4V A;  3KD0 A;  4JBB A;  3F8U A;  4MCU A;  2F51 A;  3HZ4 A;  3TKQ A;  4EDZ A;  3DRN A;  4RQR A;  2EIQ A;  4WKW A;  3NIV A;  3UVT A;  4F9Z A;  4RUV A;  3MNG A;  1SL2 B;  2OKA A;  4NV5 A;  3E9J B;  3E0U A;  3VWV A;  5F0G A;  3GL5 A;  2L6C A;  1T1V A;  1TW9 A;  3ME7 A;  4YQU A;  3HJP A;  3SWL A;  5DCH A;  1SEN A;  3HDC A;  3GKM A;  2L57 A;  1UVZ A;  4X1U A;  5IPH A;  4V2L A;  3EIN A;  1AQW A;  4XTS A;  4F0C A;  1JZR A;  4GCI A;  2IFQ A;  5ECN B;  2GTU A;  5GSS A;  2O89 A;  2EIR A;  4USS A;  5DCG A;  1TK8 B;  1ERV A;  3HJO A;  4IQ1 A;  5CO3 A;  2H6Z A;  1MDI A;  2CZ2 A;  4MF5 A;  2IMD A;  1TXX A;  1ON4 A;  1G6W A;  2VCV A;  2E0Q A;  3GIX A;  2CVD A;  1M2D A;  1T8E B;  4MH3 A;  2VCZ A;  4A5P A;  2DIY A;  1EV9 A;  18GS A;  2C0E A;  1EZK A;  2A4V A;  1XFL A;  6GSU A;  2H8L A;  2H66 A;  1ML6 A;  3C1R A;  2M80 A;  5HFK A;  2C3T A;  3DVX A;  2YPM A;  4Z2U A;  4POK A;  3IBH A;  1PKZ A;  3CSI A;  2FGX A;  3KJY A;  2ES7 A;  2H74 A;  3HVV A;  1B8X A;  4MZW A;  3TJF A;  1M9B A;  5B8A A;  1ACV A;  2QKE A;  2B3S A;  4OO4 A;  3TJJ A;  1EP8 A;  4ML6 A;  3TRQ A;  4Q5R A;  1O8X A;  4I8B A;  2HSM A;  3UL3 A;  5JCU A;  2GS3 A;  4ECJ A;  4K1F A;  3QAG A;  4MPG A;  3G7Y A;  4IGJ A;  5F05 A;  1FHE A;  2F9S A;  17GS A;  2H1D A;  4X4J A;  3IV4 A;  1A2L A;  1VF3 A;  3GKX A;  4FH8 A;  1TI1 A;  4F03 A;  4I5Q A;  3MSZ A;  3F4T A;  3HHV A;  5HR3 A;  2JAD A;  3AY8 A;  3EE2 A;  3IAS 2;  4MK3 A;  3CRT A;  1DBY A;  3KZQ A;  5FWG A;  3GTU A;  1YF1 A;  2DLX A;  2OE3 A;  3LWA A;  5HFI A;  3F0I A;  1FVJ A;  1X5D A;  2IMF A;  2H6Y A;  2V41 A;  1F9M A;  3GSS A;  5CRE A;  2MYG A;  4I2U A;  2V2G A;  1OKD A;  1OC8 A;  2GSQ A;  2LTK A;  4O5U A;  2L5L A;  2P5R A;  2PVQ A;  1YKC A;  1EP7 A;  2HNL A;  3TRX A;  3FK8 A;  3GMF A;  2E7P A;  2G2Q A;  4TR0 A;  5ECR B;  2KP2 A;  5EL8 A;  5COH A;  4MAB A;  2VM1 A;  1PX7 A;  1TRW A;  5HR1 A;  2F3M A;  1MDJ A;  2EIO A;  4CY8 A;  1X9W B;  1S3C A;  5DJM A;  1THO A;  4PNF A;  10GS A;  3IK7 A;  4ULX A;  1O6J A;  5D93 A;  1Z7R A;  2VCX A;  4BVX A;  4MDC A;  4OFN A;  1LJR A;  1Z3E A;  5DAK B;  1A8Y A;  1EWX A;  1SL1 B;  2IWT A;  3MIX A;  4ACS A;  5IMA A;  1ZYE A;  4HOJ A;  2RLI A;  3D4T A;  1N8J A;  5CAX A;  1FVK A;  2E2M A;  4ECC A;  2LRC A;  3IC8 A;  2YJH A;  3RDW A;  1ZGN A;  2B7J A;  2HRF A;  4YAP A;  2H6X A;  3G7I A;  1B48 A;  3CBU A;  5D96 A;  4RQX A;  4ISD A;  1F37 A;  2C80 A;  1WMJ A;  3EVI A;  4DSS B;  2N5F A;  3KEB A;  4IS0 A;  4D73 B;  1GUH A;  5J41 A;  1X5E A;  5IO0 A;  2CT6 A;  3US3 A;  4KF9 A;  2H0G A;  2K8S A;  2AB6 A;  2E2G A;  4NXI A;  4XCS A;  3FYG A;  2HZE A;  5DVB A;  4PUF C;  1EGR A;  3VPT A;  1TJD A;  2LJA A;  1TK0 B;  5KEJ A;  4LL4 B;  2DMM A;  1UC7 A;  4POM A;  3IR4 A;  3EWL A;  4TXO B;  3UBK A;  1ERW A;  1K0A A;  1R5P A;  4IEL A;  1V9W A;  5DJL A;  2A2R A;  2VO4 A;  3ZTL A;  1FAA A;  2X64 A;  4MA9 A;  4G2E A;  3KH7 A;  2YZU A;  3EU4 A;  6GST A;  5J9C A;  2I3Y A;  2VL3 A;  5AIX A;  1TP9 A;  4K7I A;  1VF2 A;  1AUC A;  4TXV A;  4HU7 A;  1S3A A;  4MMM A;  2HXK A;  2WRT A;  4FIW A;  5IOW A;  2HFD A;  2FHE A;  4PQ1 A;  2JZS A;  4QL9 A;  1GSE A;  1GSU A;  3Q19 A;  8GSS A;  3LFL A;  3IRA A;  3KP8 A;  1XW5 A;  3BCK A;  4Z2T A;  2FA4 A;  1KNG A;  3P7X A;  2K8V A;  2LRT A;  1J9B A;  4WEY A;  4GF0 A;  3F3Q A;  1PSQ A;  1A0F A;  1OE7 A;  3G9B A;  5KN2 A;  2IFQ B;  2H0I A;  2BJX A;  3FR9 A;  1A8L A;  2HYX A;  2J9H A;  3IPZ A;  14GS A;  4TVE A;  4N10 A;  4MF6 A;  4AJ8 A;  2L4Q A;  1WJK A;  1EOH A;  4HS1 A;  4NV2 A;  2CAI A;  2FNO A;  3RAZ A;  4EDY A;  2X8C A;  1A23 A;  2VLT A;  4H86 A;  4WF4 A;  3IHG A;  3F4R A;  3HA9 A;  5D9V A;  1SKR B;  4HI7 A;  3CYN A;  4N0V A;  2DJK A;  2PMT A;  3LSZ A;  2YOI A;  4ZB8 A;  2AYT A;  4FYB A;  3TKR A;  3BCI A;  4IHU A;  2KUC A;  1G7O A;  2M46 A;  3DWV A;  4HEA 2;  3QMX A;  1O73 A;  5H5S A;  3ERF A;  2MBT A;  4V2N A;  1J08 A;  1M7T A;  3TOT A;  1U3A A;  5IMZ A;  1GRX A;  1ABA A;  1ZZY A;  1GSY A;  1GSS A;  5DDL A;  2H71 A;  3H1N A;  4DSQ A;  4TRX A;  5D73 A;  3ZVJ D;  2MBS A;  1H4O A;  3ZML A;  4ZL8 A;  3IXR A;  2XBQ A;  3W8S A;  5D8I A;  20GS A;  2TRC P;  4X43 A;  1YZX A;  2GT6 A;  4KE3 A;  2ON7 A;  5G5F A;  1K0O A;  1YDK A;  4TR1 A;  2VOC A;  2CV4 A;  3IDV A;  4KCE A;  5JCG A;  5CP1 A;  5AN1 A;  1V57 A;  4ILF A;  1SJ6 A;  5H5R A;  4EO3 A;  1OAZ A;  3BOA A;  2PVO C;  4YH2 A;  2DJJ A;  1NHO A;  1UA5 A;  2LRN A;  3QR6 A;  3VK9 A;  2VD0 A;  5EY6 A;  2H1A A;  4K9Z A;  2MZC A;  3L9V A;  5DQS A;  3C1S A;  1GUL A;  3TJK A;  3FZ4 A;  1GUM A;  3ZFL A;  5HQP A;  3GTU B;  1IYH A;  4G0I A;  2HRA A;  3FRC A;  12GS A;  3HY2 A;  5IPG A;  1U87 A;  5G1K A;  3D6I A;  4HJ2 A;  3QDN A;  1PN0 A;  3HVX A;  2IPA A;  2H30 A;  1R5A A;  4IVF A;  2VL2 C;  1WE0 A;  2N5B A;  3DEX A;  2REM A;  16GS A;  3VPQ A;  1GTU A;  1IYI A;  1M2B A;  3WYW A;  4K0G A;  1HNC A;  2R2J A;  2WZ9 A;  1MD4 A;  3DVW A;  5ABR A;  4MNN A;  2MMZ A;  1Z9H A;  3QAV A;  2VUP A;  3EMP A;  2LQQ A;  3SBC A;  3U5R E;  3N5O A;  3DML A;  5D9X A;  3WGD A;  2QA2 A;  3LQ7 A;  1PD2 1;  3JCM L;  4EIP A;  5A5K A;  3KP9 A;  3VI5 A;  5G1L A;  4MJA A;  1ST9 A;  3BJ5 A;  1XWA A;  4DEJ A;  4BVX B;  2G0F A;  2VM2 A;  2C4J A;  3UAP A;  1GTI A;  1PL2 A;  1DSB A;  3H4K A;  3S9F A;  3P2A A;  4KSM A;  2OBI A;  2PUK C;  1SJZ A;  4GRF A;  2DBC A;  4Q5Q A;  3ZZX A;  3EYT A;  2X8H A;  3QFA C;  4NPB A;  2CVK A;  1SL0 B;  4N0Z A;  3LXZ A;  2A4H A;  5F06 A;  3GV1 A;  1X5C A;  2J23 A;  4NHW A;  3TKS C;  3N9J A;  1H75 A;  2IIY A;  2VLU A;  4OFT A;  2BTO T;  3UEM A;  1A2M A;  1GSQ A;  4P3Y B;  1GTB A;  3WT2 A;  2VAF A;  5LNK e;  4L0U A;  3HD5 A;  2BMX A;  4ZIL A;  2YWM A;  4TN8 A;  1QFN A;  2LS5 A;  3GL3 A;  3ZYW A;  2NPB A;  4ZIJ A;  1B9X C;  4E8E A;  1B9Y C;  3R3E A;  1I5G A;  2DJ3 A;  3H8Q A;  3L9U A;  4GLT A;  3M0F A;  5HR0 A;  4JED A;  1YEX A;  2O7K A;  5J4U A;  4OFM A;  1TU7 A;  4O5Q A;  2B1L A;  4BL7 A;  1T3B A;  2R37 A;  2VL2 A;  4XS1 A;  4HUA A;  3TUE A;  11GS A;  2R6K A;  3EC3 A;  2F8A A;  1K0N A;  1PL1 A;  3KM6 A;  3KTB A;  4HU9 A;  2X8G A;  3ME8 A;  4O32 A;  4BWS A;  3TOU A;  4GST A;  1VRS D;  4IJI A;  4WBJ A;  4EKZ A;  2LKU A;  1N2A A;  1PA3 A;  5GAN D;  3HCZ A;  1XVW A;  3K8N A;  2CA8 A;  2CX3 A;  2KOK A;  3FW2 A;  1JHB A;  5ECQ B;  3APO A;  2Z9S A;  2LNS A;  4LLR A;  1PMT A;  1QGV A;  2X99 A;  2GLR A;  1FB0 A;  3NOF A;  3EMX A;  2WCI A;  4RI7 A;  2FD3 A;  1NW2 A;  3Q74 A;  3MYD A;  1FOH A;  3GUS A;  4OO5 A;  2R5G A;  4J57 E;  5IMD A;  5KOX A;  7GSS A;  5ECS A;  3LYK A;  4F2I A;  2MMN A;  9GSS A;  4ZL7 A;  3RBT A;  1THX A;  4YQV A;  5GZZ B;  4LMW A;  3A2W A;  1ZYP A;  3I6A A;  4I97 A;  5G30 A;  4LMV A;  2HSY A;  4BWQ A;  2ZUP A;  4EF0 A;  2NTO A;  3H93 A;  2KP1 A;  4F0B A;  3ERG A;  2AHE A;  2L5O A;  3QPM A;  4MZC A;  4X0X A;  4MF7 A;  2ZCT A;  5F8B A;  4TKY A;  1Y6E A;  2YAN A;  5JWR B;  1KBN A;  3VLN A;  2QA1 A;  4IKH A;  2AV4 A;  3ZFB A;  3VI7 A;  2RII A;  4IP6 A;  1V98 A;  4OMV A;  4NMU A;  3UOM A;  1XOA A;  1BX9 A;  1TRU A;  1K3Y A;  3APS A;  1A0R P;  3QAW A;  5G5E A;  4XHM A;  3TKS E;  1F3B A;  5J3R A;  4K0N A;  4PQI A;  5IOX A;  4FQU A;  3FR6 A;  4YKG A;  1TTZ A;  2HE3 A;  1ERU A;  2V32 A;  2H72 A;  1JZD A;  1SK2 A;  5GAP D;  3LJR A;  1M99 A;  2A2P A;  4L8E A;  2XHF A;  2P31 A;  2H0H A;  2FWF A;  2DIZ A;  2JZT A;  2TIR A;  2JL4 A;  3GUR A;  3FHK A;  5E59 A;  2PWJ A;  2QC7 A;  4PTS A;  2KHP A;  2X4A A;  2LV3 A;  1XWG A;  1S3D A;  6GSV A;  1DE2 A;  4OCE A;  3ED3 A;  3ZMK A;  3F63 A;  1XPV A;  5B6N A;  3GH6 A;  5ECH B;  5INY A;  3GRX A;  2VD1 A;  5A4W A;  1W4V A;  3M3M A;  5IM9 A;  4AJ7 A;  1ZMA A;  3FZ9 A;  3GX0 A;  4L5L A;  1Y25 A;  4K7N A;  5KOW A;  3FZA A;  2EC4 A;  1C72 A;  5IO2 A;  4KAE A;  1JLW A;  5AIS A;  4ZBA A;  6GSW A;  3W6G A;  4PNG A;  3BBY A;  1KTE A;  4ID0 A;  5C00 A;  5AGY A;  2FY6 A;  2QGV A;  1XWC A;  1O8W A;  3M1G A;  3WGE A;  3D4M A;  3F6D A;  1BJX A;  4KCA A;  4ZBD A;  4KB3 A;  3UVH A;  4XRA A;  1XZO A;  5CRG A;  3A2V A;  3KIJ A;  3GKK A;  4QQ7 A;  2TRX A;  5CRH A;  3M9K A;  5C04 A;  3IHQ A;  2I81 A;  4PQH A;  1HD2 A;  4GTU A;  2H19 A;  1TK5 B;  2C3Q A;  5HR2 A;  1OVN A;  2I9H A;  1GSF A;  2DKI A;  2DKH A;  2AJQ B;  2GQL A;  2C1Y A;  2V1M A;  1BED A;  1EOG A;  2V6K A;  5F07 A;  2CQ9 A;  4WF5 A;  1EEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...