3TKRA

Crystal structure of full-length human peroxiredoxin 4 with t118e mutation
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
197
structure length
197
Chain Sequence
HLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFEHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Peroxiredoxin-4
publication title Structural insights into the peroxidase activity and inactivation of human peroxiredoxin 4
pubmed doi rcsb
source organism Homo sapiens
total genus 65
structure length 197
sequence length 197
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2011-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3tkrA00
4POLA 4O32A 2AJQB 4WR5A 1TRUA 1GLPA 4XS4B 3GL5A 3VI7A 1KTEA 3KMOA 4ML6A 4MJAA 1SENA 1X0RA 5HR1A 4LL1B 1Y6EA 4TXOA 1F9MA 1GULA 3HY2A 1PSQA 4WF4A 1QK8A 2KP2A 5IIZA 4WETA 3KEBA 2CV4A 1IYIA 1G7OA 2H30A 1ZYQB 3WT1A 2PERA 3CMIA 4MF7A 1IYHA 3TRQA 1LJRA 3HXSA 2MMAA 1WPIA 4GSSA 2OADA 5J5NA 4HJMA 1UN2A 2V6OA 2N5BA 5IMZA 1ILOA 2YANA 1ZGNA 2IMEA 5B8AA 4NPBA 4NMUA 5COHA 2NDOA 2V41A 3ZIJA 4YQMA 3IOSA 1B9XC 1OC9B 4PQHA 2P5QA 2HLSA 2WS2A 1O81A 1F2EA 2DJKA 1JZDA 3C8EA 2CVKA 5AIVA 1M9BA 1GSQA 5DAKB 5IMVA 1ERTA 4TOPA 1THOA 2H70A 4HZ4A 1XVWA 1K0BA 1QGVA 2C80A 2IFQB 3CRTA 3H8QA 1EOGA 2YP6A 2CAQA 4EKZA 5LCZA 1E2YA 1J08A 2LUSA 4J56E 3W6GA 3F3RA 2PVOC 3A2VA 3M3MA 2ON5A 20GSA 3RPPA 1Q4JA 3IK9A 4G2EA 2E0QA 1K0CA 4IVFA 3ZL5A 2F9SA 1XWGA 1TI1A 3QPMA 4NHZA 1TK8B 2I4AA 3GURA 1WWJA 5H5QA 2CZ3A 3EE2A 3HCZA 1R7HA 3GA4A 3F3QA 2MBTA 4GLTA 3TKQA 4WBJA 4MH3A 4AGSA 4NWYA 2A4VA 4LMWA 1EP8A 5ECMB 2F8AA 3W8JA 1V40A 3V1WA 2VLTA 2VCXA 5D9WA 1K0MA 2K9FA 2R3XA 3IA1A 1UA5A 4V1Ag 2ES7A 3FZAA 3RDWA 3GUSA 3O3TA 4K0NA 5ECPB 4MP4A 2N5FA 1Z6NA 2QGVA 3FHKA 1GP1A 2E7PA 2VCQA 2H6ZA 3F4RA 2L59A 3FW2A 3FYGA 3HJPA 1MEKA 5ECIB 4ZBAA 2WFCA 1T7PB 4ID0A 2RLIA 2IMKA 4HU9A 3LXTA 1G0TA 4I8BA 3HVSA 2XBIA 2AHEA 4I97A 1ZZYA 2B5XA 5CYYA 2PMTA 3TRPA 2R2JA 3HVXA 2YWIA 3HYPA 3TOTA 4AJ8A 2VL2C 1OE7A 1GH2A 2LS5A 2YV9A 4YAVA 5DQSA 1TDIA 1O8XA 3PINA 1QUWA 4XCSA 2WB9A 1ZYEA 4QL9A 1GUHA 3KXOA 3LORA 3P7XA 3TJFA 2O87A 3TKSC 3DRNA 3H4KA 2LJKA 1G6YA 2DBCA 3HVVA 2MBSA 2WULA 3I9V2 4GSNA 1SD8A 13GSA 4IN0A 3TJJA 1EV9A 4L8EA 4TR4A 3APOA 3ZFLA 3TJBA 5DDLA 1NW2A 3GX0A 3G7IA 1J0FA 3QAWA 3KD0A 1XW9A 3M0FA 5IMAA 3JCML 4GF0A 1GSUA 3DIEA 4TR1A 2HRFA 1TU8A 3KTLA 1GSEA 1OE8A 1URMA 4ACSA 4I2TA 2EIOA 2E2MA 3E0UA 5JCUA 4K7NA 4K9ZA 1Y25A 2G2QA 4NV2A 4KE3A 6GSVA 3MDKA 5JCGA 2CQ9A 3N5OA 3TKRA 5IO2A 1K0DA 4IHUA 3GSSA 2AB6A 1V9WA 3MNGA 2WGRA 4WR4A 5J41A 4ECCA 4GWRA 1PL2A 4HEA2 4BL7A 1ON4A 3G9BA 4PXOA 3TKSE 2FUG2 2LV3A 2WZ9A 2C0EA 1HYUA 3ZYWA 2L57A 1XOBA 1K3LA 1NHOA 1SYRA 1F37A 4GSTA 6GSYA 3APSA 4MZWA 1T4ZA 1VGLA 2GSTA 5ECHB 1TK5B 4N10A 4RI6A 3TGZA 4F2IA 5IQYA 2HZFA 5F05A 4L5LA 4ZBBA 3BCIA 2IMIA 5IM9A 3C7MA 2GLRA 6GSUA 2PU9C 2IIYA 1RW1A 4GQCA 3GNJA 2B5YA 2YJ7A 3PH9A 5G31A 2FLSA 4TRXA 1TOFA 3CTFA 4KH7A 4POMA 1VF3A 3GKNA 1N2AA 5KN3A 3QOUA 3FEUA 3HJMA 5B6NA 1YDKA 2CVDA 1GTUA 3UEMA 2H1AA 5IMFA 1MDJA 5ENUA 3FR6A 3VWXA 1XWBA 3L9SA 1OKDA 2GT5A 2B7KA 3GH9A 3UIWA 3BBYA 5CRDA 5AISA 5CRHA 2GGTA 3VK9A 5DJLA 1YZXA 1WMJA 1TP9A 14GSA 4HDEA 4NHWA 4Q5RA 2OACA 2H8LA 4FYBA 4H86A 4TKYA 4OD7A 3TCOA 5C00A 1O73A 2L5LA 1JZWA 2K8SA 1PKZA 4Q5QA 2HT9A 3LJRA 3G7JA 4JU5A 4PURA 1A2JA 2YZHA 1WRYA 3IBHA 4MLYA 3LQ7A 2C0DA 5KN1A 3PR8A 4ECIA 5D73A 5AN1A 3ZREA 3ED3A 5AGYA 4PNGA 4KAEA 4FYCA 3IAS2 1MD4A 4XTSA 1K0NA 1Q98A 5A4VA 2RUFA 1SK0A 5ID2A 4TR3A 2FWFA 2VL2A 3O76A 1TRWA 2DC5A 1W89A 2F8FA 2B7JA 4Z7XA 4JE1A 1OVNA 3IAM2 3GN3A 3M8NA 4ZBDA 4CW9A 1CQGA 4PX1A 1AC1A 2CVBA 2GSSA 3ZITA 1A23A 5JCWA 4K8MA 3TKSA 3FZ5A 1PKWA 3O6TA 4NXIA 2VM2A 1GTAA 1ZCPA 4MK3A 1BQ7A 5G2ZA 1EGOA 1JLVA 4IQAA 2LTKA 5GSSA 1MDKA 3I6AA 4WBRD 3IV4A 1FB6A 2FGXA 2REMA 2VUPA 2I9HA 1BJXA 3D0ZA 2GT6A 1SKWB 1R5PA 3ZMKA 1HNCA 1O8WA 4FH8A 1TK0B 1YY7A 1I5GA 3TRXA 3HHVA 2XC2A 3LSZA 3CSJA 1U3IA 4ZL9A 2VOCA 1A0FA 1FOVA 5KEJA 3UBKA 5G30A 4D73B 3C71A 2BTOT 1Z7PA 4X0XA 1PL1A 2M46A 2I81A 1MDIA 3GKKA 1PD21 2PBJA 1R4WA 4EO3A 3KP8A 4IS0A 2GTUA 4KB3A 1T1VA 4MJBA 3LGCA 2QKEA 5FHIA 1FB0A 2O7KA 1SKRB 3HA9A 2NTOA 2H0GA 2VCZA 3EU3A 3IC4A 4BVXA 2GZPA 2CZ2A 2HNLA 1THXA 3C1RA 3U6VA 4DSSB 1UC7A 3D4MA 4JR4A 3UMAA 4KDXA 5DCHA 3ERWA 4BVYA 4IELA 5DJMA 1TU7A 4K1FA 16GSA 2A2RA 5G5EA 4MF6A 2O89A 2C0GA 3P8WA 1T4YA 4JEDA 4TVEA 3HZ8A 4EXJA 5DALB 5J9CA 1M2BA 4I2UA 5CRGA 4XRDA 4V1Ap 1JZRA 1YJ6A 2JSZA 5F0GA 4POKA 1NHYA 1A24A 3FZ9A 5IMDA 1PN9A 1AQWA 9GSSA 1M0UA 1I9DA 1EGRA 3IR4A 4KSMA 2YWOA 4MJCA 3A2WA 1LU4A 3EINA 3GYKA 2C1YA 4ZILA 1PA3A 1XPVA 1GLQA 3QD9A 2VO4A 4F03A 1AUCA 1PGTA 3VURA 3BD2A 2LRTA 1U3AA 2N5AA 5IOWA 5CAXA 4QL7A 1C72A 1K0AA 1WE0A 1GTIA 1M2AA 4XS4A 2PUKC 5D9VA 2XHFA 1U87A 2HXKA 4FYUA 3GL3A 5DBQA 3IPZA 5ELGA 5IMCA 4KUNA 1WIKA 3DVWA 2DJ2A 1JLWA 2H66A 1Z7RA 5ECRB 4CHSA 1U88A 3UBLA 4EVMA 3Q74A 4OFNA 5A5KA 3EURA 5ECSA 1W4VA 4WEYA 1FAAA 1FHEA 3VWWA 5E59A 1XVQA 2JL4A 4HU7A 1SD9A 3ZFBA 4PQIA 1Z6MA 1X9SB 2VD1A 2R37A 4X43A 1V98A 3F0IA 1A8LA 2R4VA 2PN8A 1EEMA 1OC9A 2M72A 6GSSA 3US3A 3KZQA 3HJOA 3DVXA 1ML6A 2EIRA 1TRSA 5JWQB 5KN0A 2GQLA 1K3YA 1SK1A 1ERWA 5ECNB 4KGIA 5DAKA 1GSDA 1GUMA 1SK2A 5LNKe 1ACVA 1KEBA 2DJ3A 3LYKA 2IFQA 4MH2A 2IMFA 3CYNA 4MPGA 2R6KA 3W8SA 4EDYA 5CREA 4L0UA 2H1GA 4BA7A 3QDNA 2H75A 2OJLA 1GSSA 3MWHA 2FNOA 4MMMA 3Q19A 4XS6A 2IN3A 1PX6A 4O5RA 5D96A 1WP0A 2F3MA 1AW9A 2HSHA 4HOJA 3UOMA 4ML1A 1PX7A 2H76A 5B6MA 1GNWA 4Q5FA 4XRAA 2ON7A 5GZZB 1V57A 2TRXA 4OCEA 1FVKA 3QCPA 5EVOA 5F8BA 3NIVA 4TN8A 1VF1A 1AAZA 4DVCA 4XHMA 4RQXA 4G9HA 2MMOA 2K6VA 3F9UA 2WRTA 4YQUA 5JWOB 2GZYA 2MYGA 1XCCA 1XBSA 3LXZA 4EC0A 2DIYA 1BYEA 4N0ZA 3MSZA 1GRXA 2LNTA 3F4TA 1TW9A 4IW9A 1FVJA 1O7UA 2RUEA 2YNXA 2AUVA 1HQOA 7GSSA 1BAYA 2HZEB 2ALBA 1WJKA 2YN1A 1X5EA 3L9UA 1OC3A 2WCIA 4OCFA 5G1LA 3D5JA 4ZXGA 5A4UA 5ECQB 2J23A 2GQKA 4GRFA 2A2SA 1XWCA 1PRXA 2AAWA 4IP1A 5D9TA 2GVPA 3RAZA 1NM3A 4G10A 3M9KA 2CAIA 1GWCA 3A5WA 1Z5YE 3FK8A 2C4JA 3Q6OA 1YKCA 3TJGA 6GSXA 2MZCA 4KCEA 1XFLA 5HFIA 2GQMA 2CX4A 5GAND 3G7YA 3GX8A 4JRRA 1DSBA 2TIRA 5D8IA 2X99A 1R26A 1AQXA 4POBA 3GTUB 4IKHA 2YOIA 2CX3A 4L5OA 2K8VA 2PGTA 2DJ1A 5FT3A 2OA7A 3GSTA 1NSWA 3QAVA 2JSYA 2X8HA 5KN2A 4KW6A 3RPNA 4DSQA 1TTZA 3NZNA 1Z3EA 3EMPA 4Q5NA 3LYPA 1K0OA 4V2MA 4TXOB 2E2GA 3CTGA 1AQVA 2FA8A 2QC7A 3QR6A 2LJAA 5J9BA 3C73A 4F82A 2H74A 1GNEA 3ZIVA 1M9AA 2H71A 1OC8A 4ZL8A 4N0VA 2OE1A 4O92A 3KCMA 3BJ5A 5ECLB 5INYA 2LNSA 4DEJA 1F6MC 4HUAA 4IQ1A 11GSA 5EY6A 3EC3A 1DBYA 1GTBA 2KP1A 5C04A 1OAZA 3KM6A 1K3OA 2JZTA 2P31A 2HRNA 1JHBA 4LMVA 1SL1B 4OFTA 8GSSA 1MTCA 4E8HA 4RUVA 2WJUA 1ABAA 2B6MA 4JZQA 2KOKA 4MF5A 1HD2A 1JFUA 1TKDB 1PMTA 1X5DA 3K8NA 5EL8A 5D93A 3M1GA 2L4QA 3VWVA 1DE2A 3D4TA 1FG4A 1BX9A 3BCKA 4E8EA 4G19A 3KH9A 4BPYA 4YAPA 3ZLPA 3HZ4A 1XIYA 4V2LA 3TDGA 6GSWA 3DEXA 2IL3A 3U5RE 2DMLA 1SJ6A 2DJJA 4EL1A 2ZCTA 3FRCA 1ST9A 2B5EA 2CT6A 4HJ2A 4GXZA 2AV4A 2LRCA 4KDUA 3GIXA 1DE1A 1DUGA 4ECBA 2OBIA 4PUAA 3DKSA 5GAPD 2P5RA 3WT2A 4XS1A 1SJZA 19GSA 1XWKA 2H1DA 1XOAA 4AJ6A 3EWLA 2G0FA 2RM5A 1S3DA 1M2DA 3FKFA 3KP9A 2VL3A 3OR5A 4DSRA 5AIXA 3DMLA 1QXHA 2H6YA 2QSIA 3D22A 2YWMA 2IWTA 3QFAC 3P90A 1XWAA 2BJXA 3TKPA 2BMXA 4KDYA 4OWYA 3WYWA 2V32A 3GFKA 1SL2B 1B48A 3NOFA 1A2MA 2OE3A 1T8EB 2EC4A 3DYRA 1EP7A 4V2NA 4OMVA 4I6XA 3D6IA 3WGEA 3UARA 4OO5A 4WF5A 3RHCA 1EEJA 4KCAA 5DQYA 3HD5A 1M7TA 5HFKA 3N9JA 1B4PA 5J4UA 1XW5A 3TJKA 4PGTA 4KSOA 1BEDA 2X64A 1A0RP 2NPBA 1OYJA 1AIUA 1F3BA 17GSA 4JBBA 1A8YA 4EF0A 2VLUA 2ZNMA 2GSQA 2R5GA 5IOXA 6GSTA 1B4QA 3Q18A 1ZOFA 1RK4A 2VLVA 3F63A 3ZRDA 2B1KA 3H93A 3KH7A 3CSHA 4EDZA 2FHEA 5EPFA 4MPFA 3L0HA 5JWRB 1H4OA 2FWGA 4NV5A 5ELAA 3RBTA 3CRUA 3M9JA 4N11A 2RM6A 4LLRA 4OO4A 3VPQA 2HFDA 1X9MB 2O85A 2VIMA 2V6KA 1EOHA 2F51A 1A2LA 1TI3A 2VM1A 5CRWA 3DXBA 2P0GA 2VCVA 2C8UA 1H75A 2LQQA 5ECKB 2DSAA 5F07A 1PQNA 2X8CA 3IE3A 1O6JA 2D2ZA 1QQ2A 3ZTLA 1OKTA 4J2FA 4F9ZA 2HE3A 4HS1A 1EZKA 2HYXA 2H01A 5IPGA 2YPMA 5IPHA 3WGXA 4K0GA 10GSA 1YKAA 5CP1A 1HNAA 2H0HA 1O85A 4TR1B 3LG6A 2O8VB 3GHAA 3L78A 2DIZA 1KNGA 4I5QA 1BG5A 2GSRA 4D73A 5HR3A 1N8JA 3UAPA 1LBKA 2RIIA 4KA0A 1WOUA 4K6XA 3SWLA 3EMXA 2NVLA 5D9XA 2YWNA 4MCUA 5G1KA 3KMNA 3C1SA 2L6CA 2FY6A 1M99A 3IRAA 1E6BA 1YEPA 3FR9A 1KBNA 1ZMAA 1HNBA 4PNFA 3F4SA 1F3AA 3ZVJA 1YEXA 4DSSA 2KHPA 2VL9A 3D21A 3WGDA 2YV7A 1G7EA 2VCTA 3FR3A 3QAGA 1UVZA 2PWJA 4JR6A 1FO5A 4MJEA 3KTBA 2H73A 4NAXA 2C3QA 2FWHA 3VPTA 4KNDA 2MMZA 3ERGA 3UVTA 3TOUA 5B7CA 4QQ7A 2LKUA 3LWAA 3LFLA 3QMXA 4IGJA 5DALA 1AXDA 3AY8A 1TXXA 3F6FA 2IJYA 2HI7A 2JZRA 2IPAA 5CNWA 2VCWA 18GSA 3UL3A 2JADA 2JU5A 2IMDA 2HSYA 2C3NA 1SU9A 3VWUA 1V2AA 4PUFC 2K18A 3KIJA 2EIQA 3BOAA 3FZ4A 1QMVA 1SYXA 5H5RA 4MABA 2V2GA 1ZL9A 4IJIA 3CXGA 3VI5A 3KGKA 2TRCP 4RQRA 3ISOA 2AYTA 4OFMA 3EYTA 2I3YA 3IHQA 5J3RA 22GSA 2CA8A 3CSIA 2L6DA 1USBA 2VAFA 1VRSD 4EE0A 2MMNA 2XPDA 2ZUPA 2H1BA 3CBUA 4MA9A 1XW6A 3TUEA 4ECJA 2JACA 1JZOA 3VFIA 1SJIA 3HDCA 3ZZXA 4AJ7A 2LSTA 3L4NA 2YZUA 2OKAA 4RI7A 1GSFA 3GMFA 1ERUA 3J7Yb 4PQ1A 4FO5A 2LJRA 1S3AA 3SBCA 4ULXA 4N30A 1YQ1A 5FWGA 4MDCA 1TRVA 2J9HA 3ZMLA 1QFNA 2LRNA 4IJ3A 3ME8A 2FCHA 2FD3A 3UVHA 4ZB8A 3F6DA 1Z9HA 5ID2B 1U6TA 3I43A 3EVIA 2FA4A 4YH2A 1T3BA 4IBPA 1SL0B 3VLNA 3ZVJD 3WD6A 3PGTA 4KX4A 5L71A 3IK7A 4MZBA 4WKWA 5ABRA 5DCGA 2VD0A 5B8BA 4MZCA 4BWQA 1YF1A 4ISDA 2KUCA 3MAKA 4P3YB 4ZB6A 3GH6A 5LD0A 2L4CA 1GL8A 3ERFA 2PPTA 5IO0A 2NBSA 4FIWA 4ZIJA 5HR2A 2WDUA 2H19A 4TW5A 3L9VA 1TJDA 1GUKA 4HI7A 4J57E 2XPEA 2DLXA 2JZSA 4GQFA 4ZL7A 2H6XA 5GSTA 4ILFA 5H5SA 3QFBC 3A2XA 1XXUA 3H79A 4HQSA 3P2AA 2Z9SA 1G6WA 1S3CA 5F06A 1ERVA 4K7OA 2DMMA 3ME7A 1GSYA 2LQOA 2FWEA 1XZOA 3TB2A 4K2DA 3DD3A 3R2QA 4IP6A 5CO3A 3UJ1A 2X8GA 5G5FA 2OBKA 4X1UA 4EUYA 3A3TA 4F0CA 3HKRA 4AF2A 2PVQA 3RHBA 2DJ0A 2I1UA 2LEGA 3IDVA 1R5AA 1EV4A 1X5CA 2YJHA 4LA1A 1T00A 2M80A 5DVBA 4F0BA 2OE0A 3DWVA 3EU4A 4TR0A 1MD3A 2GS3A 3H1NA 4HQZA 3I69A 5HQPA 3J7Yk 2XBQA 5HFGA 1B9YC 3IXRA 3E9JB 3F8UA 3KJYA 4BWSA 3FY7A 1CQHA 3DGQA 3GKXA 2B3SA 3GKMA 1V58A 2C0FA 1SKSB 2HZEA 2KLXA 3APQA 4K7IA 1EWXA 4ZB9A 1YF0A 12GSA 4TXVA 2B1LA 1FW1A 2GDRA 5ECOB 1RQMA 2V1MA 4WXTA 4LL4B 4O7HA 1B8XA 3GRXA 4GCIA 1VF4A 4CDOA 2H72A 3GV1A 4L0WA 3E3EA 5E4WA 2C3TA 3S9FA 4YQVA 2L5OA 1VF2A 2GZZA 4GTUA 2H0IA 4HZ2A 5HR0A 4XIHA 5A4WA 3GTUA 1X9WB 1J9BA 3LEFA 2YCDA
chains in the Genus database with same CATH superfamily
4POLA 4O32A 2AJQB 4WR5A 1TRUA 1GLPA 4XS4B 3GL5A 3VI7A 1KTEA 3KMOA 4ML6A 4MJAA 1SENA 1X0RA 3FMWA 5HR1A 4LL1B 1Y6EA 4TXOA 1F9MA 1GULA 3HY2A 1PSQA 4WF4A 1QK8A 2KP2A 5IIZA 4WETA 4MNNA 3KEBA 2CV4A 1IYIA 1G7OA 2H30A 1ZYQB 3WT1A 2PERA 3CMIA 4MF7A 1IYHA 3TRQA 1LJRA 3HXSA 2MMAA 1WPIA 4GSSA 2OADA 5J5NA 4HJMA 1UN2A 2V6OA 2N5BA 5IMZA 3A5IA 1ILOA 2YANA 1ZGNA 2IMEA 5B8AA 4NPBA 4NMUA 5COHA 2NDOA 2V41A 3ZIJA 4YQMA 3IOSA 1B9XC 1OC9B 4PQHA 2P5QA 2HLSA 2WS2A 1O81A 1F2EA 2DJKA 1JZDA 3C8EA 2X4AA 2CVKA 5AIVA 1M9BA 1GSQA 5DAKB 5IMVA 1ERTA 4TOPA 1THOA 2H70A 4HZ4A 1XVWA 1K0BA 1QGVA 2C80A 2IFQB 3CRTA 3H8QA 1EOGA 2YP6A 2CAQA 4EKZA 5LCZA 1E2YA 1J08A 2LUSA 4J56E 3W6GA 3F3RA 2PVOC 4PTSA 3A2VA 3M3MA 2ON5A 20GSA 3RPPA 1Q4JA 3IK9A 4G2EA 2E0QA 1K0CA 4IVFA 3ZL5A 2F9SA 1XWGA 1TI1A 3QPMA 4NHZA 1TK8B 2I4AA 3GURA 1WWJA 5H5QA 2CZ3A 3EE2A 3HCZA 1R7HA 3GA4A 3F3QA 2MBTA 4GLTA 3TKQA 4WBJA 4MH3A 4AGSA 4NWYA 2A4VA 4LMWA 1EP8A 5ECMB 2F8AA 3W8JA 1V40A 3V1WA 2VLTA 2VCXA 5D9WA 1K0MA 1PN0A 2K9FA 2R3XA 3IA1A 1UA5A 4V1Ag 2ES7A 3FZAA 3RDWA 2HRKA 3GUSA 3O3TA 4K0NA 5ECPB 4MP4A 2N5FA 1Z6NA 2QGVA 3FHKA 1GP1A 1XG8A 2E7PA 2VCQA 2H6ZA 3F4RA 2L59A 3FW2A 3FYGA 2A4HA 3HJPA 1MEKA 5ECIB 4ZBAA 2WFCA 1T7PB 4ID0A 2RLIA 2IMKA 4HU9A 3LXTA 1G0TA 4I8BA 3HVSA 2XBIA 2AHEA 4I97A 1ZZYA 2B5XA 5CYYA 2PMTA 3TRPA 4K5RA 2R2JA 3HVXA 2YWIA 3HYPA 3TOTA 4AJ8A 2VL2C 1OE7A 1GH2A 2LS5A 2YV9A 4YAVA 3PPUA 5DQSA 1TDIA 1O8XA 3IC8A 3PINA 1QUWA 4XCSA 2QA1A 2WB9A 1ZYEA 4QL9A 1GUHA 3KXOA 3LORA 3P7XA 3TJFA 2O87A 3TKSC 3DRNA 3H4KA 2LJKA 1G6YA 2DBCA 3EPTA 3HVVA 2MBSA 2WULA 3I9V2 4GSNA 4EIPA 1SD8A 13GSA 4IN0A 3TJJA 1EV9A 4L8EA 4TR4A 3APOA 3ZFLA 3TJBA 5DDLA 1NW2A 3GX0A 3G7IA 1J0FA 3QAWA 3KD0A 1XW9A 3M0FA 5IMAA 3JCML 4GF0A 1GSUA 3DIEA 4TR1A 2HRFA 4BIKA 1TU8A 3KTLA 4ICYA 1GSEA 1OE8A 1URMA 4ACSA 4I2TA 2EIOA 2E2MA 3E0UA 5JCUA 4K7NA 4K9ZA 1Y25A 2G2QA 4NV2A 4KE3A 6GSVA 3MDKA 5JCGA 2CQ9A 3N5OA 3TKRA 5IO2A 1K0DA 4IHUA 3GSSA 2AB6A 1V9WA 3MNGA 2WGRA 4WR4A 5J41A 4ECCA 4GWRA 1PL2A 4HEA2 4BL7A 1ON4A 3G9BA 4PXOA 3TKSE 2FUG2 2LV3A 2WZ9A 2C0EA 1HYUA 3ZYWA 2L57A 1XOBA 1K3LA 1NHOA 1SYRA 1F37A 4GSTA 6GSYA 3APSA 4MZWA 1T4ZA 1VGLA 2GSTA 4A5PA 5ECHB 1TK5B 4N10A 4RI6A 3TGZA 4F2IA 5IQYA 2HZFA 5F05A 4L5LA 4ZBBA 3BCIA 2IMIA 5IM9A 3C7MA 2GLRA 6GSUA 2PU9C 2IIYA 1RW1A 4GQCA 3GNJA 2B5YA 2YJ7A 3PH9A 5G31A 2FLSA 4TRXA 1TOFA 3CTFA 4KH7A 4POMA 1VF3A 3GKNA 1N2AA 5KN3A 3QOUA 3FEUA 2HSMA 3HJMA 5B6NA 1YDKA 2CVDA 1GTUA 3UEMA 2H1AA 5IMFA 1MDJA 5ENUA 3FR6A 3VWXA 1XWBA 3L9SA 1OKDA 4X4JA 2GT5A 2B7KA 3GH9A 3UIWA 3BBYA 5CRDA 5AISA 4CY6A 5CRHA 2GGTA 3VK9A 5DJLA 1YZXA 1WMJA 1TP9A 14GSA 4HDEA 4NHWA 4Q5RA 2OACA 2H8LA 4FYBA 4H86A 4TKYA 4OD7A 3TCOA 5C00A 1O73A 2L5LA 1JZWA 2DKIA 2K8SA 1PKZA 4Q5QA 2HT9A 3LJRA 3G7JA 4JU5A 4PURA 1A2JA 2YZHA 1WRYA 3IBHA 4MLYA 3LQ7A 2C0DA 5KN1A 3PR8A 4ECIA 5D73A 5AN1A 3ZREA 3ED3A 5AGYA 4PNGA 4G0LA 4KAEA 4FYCA 3IAS2 1MD4A 4XTSA 1K0NA 1Q98A 5A4VA 2RUFA 1SK0A 5ID2A 4TR3A 2FWFA 2VL2A 3O76A 1TRWA 2DC5A 1W89A 2F8FA 2B7JA 4Z7XA 4JE1A 1OVNA 3IAM2 3GN3A 3M8NA 2X49A 4ZBDA 4CW9A 1CQGA 4PX1A 1AC1A 2CVBA 2GSSA 3ZITA 1A23A 5JCWA 4K8MA 3TKSA 3FZ5A 1PKWA 3O6TA 4NXIA 2VM2A 1GTAA 1ZCPA 4MK3A 1BQ7A 5G2ZA 1EGOA 1JLVA 4IQAA 2LTKA 5GSSA 1MDKA 3I6AA 4WBRD 3IV4A 1FB6A 2FGXA 2REMA 2VUPA 2I9HA 1BJXA 3D0ZA 2GT6A 1SKWB 1R5PA 3ZMKA 1HNCA 1O8WA 4FH8A 1TK0B 1YY7A 1I5GA 3TRXA 3HHVA 2XC2A 3LSZA 4K2XA 2QA2A 3CSJA 1U3IA 4ZL9A 2VOCA 1A0FA 1FOVA 5KEJA 3UBKA 5G30A 4D73B 3C71A 2BTOT 1Z7PA 4X0XA 1PL1A 2M46A 2I81A 1MDIA 3GKKA 1PD21 2PBJA 1R4WA 4EO3A 3KP8A 4IS0A 2GTUA 4KB3A 1T1VA 4MJBA 3LGCA 2QKEA 5FHIA 1FB0A 2O7KA 1SKRB 3HA9A 2NTOA 2H0GA 2VCZA 3EU3A 3IC4A 4BVXA 2GZPA 2CZ2A 2HNLA 4HSCX 1THXA 3C1RA 3U6VA 4DSSB 1UC7A 3D4MA 4JR4A 3UMAA 4KDXA 5DCHA 3ERWA 4BVYA 4IELA 5DJMA 1TU7A 4K1FA 16GSA 2A2RA 5G5EA 4MF6A 2O89A 2C0GA 3P8WA 1T4YA 4JEDA 4TVEA 3HZ8A 4EXJA 5DALB 1M3IA 5J9CA 1M2BA 4I2UA 5CRGA 4XRDA 4V1Ap 1JZRA 1YJ6A 2JSZA 5F0GA 4POKA 1NHYA 1A24A 3FZ9A 5BMUA 5IMDA 1PN9A 1AQWA 9GSSA 1M0UA 1I9DA 4USSA 1EGRA 3IR4A 4KSMA 2YWOA 4MJCA 3A2WA 1LU4A 3EINA 3GYKA 2C1YA 4ZILA 1PA3A 1XPVA 1GLQA 3QD9A 2VO4A 4F03A 1AUCA 1PGTA 3VURA 3BD2A 2LRTA 1U3AA 2N5AA 5IOWA 5CAXA 4QL7A 1C72A 1K0AA 1WE0A 1GTIA 1M2AA 4XS4A 2PUKC 5D9VA 2XHFA 1U87A 2HXKA 4FYUA 3GL3A 5DBQA 3IPZA 5ELGA 5IMCA 4KUNA 1WIKA 3DVWA 2DJ2A 1JLWA 2H66A 1Z7RA 5ECRB 4CHSA 1U88A 3UBLA 4EVMA 3Q74A 4OFNA 5A5KA 3EURA 5ECSA 1W4VA 4WEYA 1FAAA 1FHEA 3VWWA 5E59A 4O5QA 1XVQA 2JL4A 4HU7A 1SD9A 3ZFBA 4PQIA 1Z6MA 1X9SB 2VD1A 2R37A 4X43A 1V98A 3F0IA 1A8LA 2R4VA 2PN8A 1EEMA 1S3RA 1OC9A 2M72A 6GSSA 3US3A 3KZQA 3HJOA 3DVXA 1ML6A 2EIRA 1TRSA 5JWQB 5KN0A 2GQLA 1K3YA 1SK1A 1ERWA 5ECNB 4KGIA 5DAKA 1GSDA 1GUMA 1SK2A 5LNKe 1ACVA 1KEBA 2DJ3A 3LYKA 2IFQA 4MH2A 2IMFA 3CYNA 4MPGA 2R6KA 3W8SA 1ZYNA 4EDYA 5CREA 4L0UA 2H1GA 4BA7A 3QDNA 2H75A 2OJLA 1GSSA 4KF9A 3MWHA 2FNOA 4MMMA 3Q19A 4XS6A 2IN3A 1PX6A 4O5RA 5D96A 1WP0A 2F3MA 1AW9A 2HSHA 4HOJA 3UOMA 4Z2RA 4ML1A 1PX7A 2H76A 5B6MA 1GNWA 4Q5FA 4XRAA 2ON7A 5GZZB 1V57A 2TRXA 4OCEA 1FVKA 3QCPA 5EVOA 5F8BA 3NIVA 4TN8A 4YKFA 1VF1A 1AAZA 4DVCA 4XHMA 4RQXA 4G9HA 2MMOA 2K6VA 3F9UA 2WRTA 4YQUA 5JWOB 5KOWA 2GZYA 2MYGA 1XCCA 1XBSA 3LXZA 4Z2UA 4EC0A 2DIYA 1BYEA 4N0ZA 3MSZA 1GRXA 2LNTA 3F4TA 1TW9A 4IW9A 1FVJA 1O7UA 2RUEA 2YNXA 2AUVA 1HQOA 7GSSA 1BAYA 2HZEB 2ALBA 1WJKA 2YN1A 1X5EA 3L9UA 1OC3A 2WCIA 4OCFA 5G1LA 3D5JA 4ZXGA 5A4UA 5ECQB 2J23A 2GQKA 4GRFA 2A2SA 1XWCA 1PRXA 2AAWA 4IP1A 5D9TA 2GVPA 3RAZA 1NM3A 4G10A 3M9KA 2CAIA 1GWCA 3A5WA 1Z5YE 3FK8A 2C4JA 3Q6OA 1YKCA 3TJGA 6GSXA 2MZCA 4KCEA 1XFLA 5HFIA 2GQMA 2CX4A 5GAND 3G7YA 3GX8A 4JRRA 1DSBA 2TIRA 5D8IA 2X99A 1R26A 1AQXA 1ZYPA 3GTUB 4IKHA 4POBA 2YOIA 2CX3A 4L5OA 2K8VA 2PGTA 1PFOA 2DJ1A 5FT3A 2OA7A 3GSTA 1NSWA 3QAVA 2JSYA 2X8HA 5KN2A 4KW6A 3RPNA 4DSQA 1TTZA 3NZNA 1Z3EA 3EMPA 4Q5NA 3LYPA 1K0OA 4V2MA 4TXOB 2E2GA 3CTGA 1AQVA 2FA8A 2QC7A 3QR6A 2LJAA 5J9BA 3C73A 4F82A 2H74A 1GNEA 3ZIVA 1M9AA 2H71A 1OC8A 4ZL8A 4N0VA 2OE1A 4O92A 3KCMA 3BJ5A 5ECLB 5INYA 2LNSA 4DEJA 1F6MC 4HUAA 4IQ1A 11GSA 5EY6A 3EC3A 1DBYA 1GTBA 2KP1A 5C04A 1OAZA 3KM6A 1K3OA 2JZTA 2P31A 5BRTA 2R0PA 2HRNA 1JHBA 4LMVA 1SL1B 4OFTA 8GSSA 1MTCA 4E8HA 4RUVA 2WJUA 1ABAA 2B6MA 4JZQA 2KOKA 4MF5A 1HD2A 1JFUA 1TKDB 1M3JA 1PMTA 1X5DA 3K8NA 4G0IA 5EL8A 5D93A 3M1GA 2L4QA 4O5UA 3VWVA 1DE2A 3CQFA 3D4TA 1FG4A 1BX9A 3BCKA 4E8EA 4G19A 3KH9A 4BPYA 4YAPA 3ZLPA 3HZ4A 1XIYA 4V2LA 3TDGA 6GSWA 3DEXA 2IL3A 3U5RE 2DMLA 1SJ6A 2DJJA 4EL1A 2ZCTA 3FRCA 1ST9A 2B5EA 2CT6A 4HJ2A 4GXZA 2AV4A 2LRCA 4KDUA 3GIXA 1DE1A 1DUGA 4ECBA 2OBIA 2A2PA 4PUAA 3DKSA 5GAPD 2P5RA 3WT2A 4XS1A 1SJZA 19GSA 1XWKA 2H1DA 1XOAA 4AJ6A 3EWLA 2G0FA 2RM5A 1S3DA 1M2DA 3FKFA 3KP9A 2VL3A 3OR5A 4DSRA 5AIXA 3DMLA 1QXHA 2H6YA 2QSIA 3D22A 2YWMA 2IWTA 3QFAC 3P90A 1XWAA 2BJXA 3TKPA 2BMXA 4KDYA 4OWYA 3WYWA 3MIXA 2V32A 3GFKA 1SL2B 1B48A 3NOFA 1A2MA 2OE3A 1T8EB 2EC4A 3DYRA 1EP7A 4V2NA 4OMVA 4I6XA 3D6IA 3WGEA 3UARA 4OO5A 4WF5A 3RHCA 1EEJA 4KCAA 5DQYA 3HD5A 1M7TA 5HFKA 3N9JA 1B4PA 5J4UA 1XW5A 3TJKA 4PGTA 4KSOA 1BEDA 2X64A 1A0RP 2NPBA 1OYJA 1AIUA 1F3BA 17GSA 4JBBA 1A8YA 4EF0A 2VLUA 2ZNMA 2GSQA 2R5GA 5IOXA 6GSTA 1B4QA 3Q18A 1ZOFA 1RK4A 2VLVA 3F63A 3ZRDA 2B1KA 3H93A 3KH7A 3CSHA 4EDZA 2FHEA 5EPFA 4MPFA 3L0HA 5JWRB 1H4OA 2FWGA 4NV5A 5ELAA 3RBTA 3CRUA 3M9JA 4N11A 2RM6A 4CY8A 4LLRA 2DKHA 4OO4A 3VPQA 2HFDA 1X9MB 2O85A 2VIMA 2V6KA 1EOHA 2F51A 1A2LA 1TI3A 2VM1A 5CRWA 3DXBA 2P0GA 2VCVA 2C8UA 1H75A 2LQQA 5ECKB 2DSAA 5F07A 1PQNA 2X8CA 3IE3A 1O6JA 2D2ZA 1QQ2A 3ZTLA 1OKTA 4J2FA 4F9ZA 2HE3A 4HS1A 1EZKA 2UZ8A 2HYXA 4G0KA 2H01A 5IPGA 2YPMA 5IPHA 3WGXA 4K0GA 10GSA 1YKAA 5CP1A 1HNAA 2H0HA 1O85A 4TR1B 3LG6A 2O8VB 3GHAA 3L78A 2DIZA 1KNGA 4I5QA 1BG5A 2GSRA 4D73A 5HR3A 1N8JA 3UAPA 1LBKA 2RIIA 4KA0A 1WOUA 4K6XA 3SWLA 3EMXA 2NVLA 5D9XA 2YWNA 4MCUA 5G1KA 3KMNA 3C1SA 2L6CA 2FY6A 1M99A 3IRAA 1E6BA 1YEPA 4Z2TA 3FR9A 1KBNA 1ZMAA 1HNBA 4PNFA 3F4SA 1F3AA 4BL7B 3ZVJA 1YEXA 4DSSA 2KHPA 4EIQA 2VL9A 3D21A 3WGDA 2YV7A 1G7EA 2VCTA 3FR3A 3QAGA 1UVZA 2PWJA 4JR6A 1FO5A 4MJEA 3KTBA 5KOXA 2H73A 4NAXA 2C3QA 2FWHA 3VPTA 4KNDA 2MMZA 3ERGA 3UVTA 3TOUA 5B7CA 4QQ7A 2LKUA 3LWAA 3LFLA 3QMXA 4IGJA 5DALA 1AXDA 3AY8A 1TXXA 3F6FA 2IJYA 2HI7A 2JZRA 3MYDA 2IPAA 5CNWA 2VCWA 18GSA 1FOHA 3UL3A 2JADA 2JU5A 2IMDA 2HSYA 2C3NA 1SU9A 3VWUA 1V2AA 4PUFC 2K18A 3KIJA 2EIQA 3BOAA 3FZ4A 1QMVA 1SYXA 5H5RA 4MABA 2V2GA 1ZL9A 4IJIA 3CXGA 3VI5A 3KGKA 2TRCP 4RQRA 3ISOA 2AYTA 4OFMA 3EYTA 2I3YA 3IHQA 5J3RA 22GSA 2CA8A 2HRAA 3CSIA 2L6DA 1USBA 2VAFA 1VRSD 4EE0A 2MMNA 2XPDA 2ZUPA 2H1BA 3CBUA 4MA9A 1XW6A 3TUEA 4ECJA 2JACA 1JZOA 3VFIA 1SJIA 3HDCA 3ZZXA 4AJ7A 2LSTA 3L4NA 2YZUA 2OKAA 4RI7A 1GSFA 3GMFA 1ERUA 3J7Yb 4PQ1A 4FO5A 2LJRA 1S3AA 3SBCA 4ULXA 4N30A 1YQ1A 5FWGA 4MDCA 1TRVA 2J9HA 4K5SA 3ZMLA 1QFNA 2LRNA 4IJ3A 3ME8A 2FCHA 3IHGA 2FD3A 3UVHA 2R0CA 4ZB8A 4FQUA 3F6DA 1Z9HA 5ID2B 1U6TA 3I43A 3EVIA 2FA4A 4YH2A 1T3BA 4IBPA 1SL0B 3VLNA 3ZVJD 3WD6A 3PGTA 4KX4A 5L71A 3IK7A 4MZBA 4WKWA 5ABRA 5DCGA 2VD0A 5B8BA 4MZCA 4BWQA 3LW9A 1YF1A 4ISDA 2KUCA 3MAKA 4P3YB 4ZB6A 3GH6A 5LD0A 2L4CA 1GL8A 3ERFA 2PPTA 5IO0A 2NBSA 4FIWA 4ZIJA 5HR2A 2WDUA 2H19A 4TW5A 3L9VA 1TJDA 1GUKA 4HI7A 4J57E 2XPEA 2DLXA 2JZSA 4GQFA 4ZL7A 2H6XA 5GSTA 4ILFA 5H5SA 3QFBC 3A2XA 1XXUA 3H79A 3R3EA 4HQSA 3P2AA 2Z9SA 1G6WA 1S3CA 5F06A 1ERVA 4K7OA 4YKGA 2DMMA 3ME7A 1GSYA 2LQOA 2FWEA 1XZOA 3TB2A 4K2DA 3DD3A 3R2QA 4IP6A 5CO3A 3UJ1A 2X8GA 5G5FA 2OBKA 4X1UA 4EUYA 3A3TA 4F0CA 3HKRA 4AF2A 2PVQA 3RHBA 2DJ0A 2I1UA 2LEGA 3IDVA 1R5AA 1EV4A 1X5CA 2YJHA 4LA1A 4BVXB 1T00A 2M80A 5DVBA 4F0BA 2OE0A 3DWVA 3EU4A 4TR0A 1MD3A 2GS3A 3H1NA 4HQZA 4BVYB 3I69A 5HQPA 3J7Yk 2R0GA 2XBQA 5HFGA 1B9YC 3IXRA 3E9JB 3F8UA 3KJYA 4BWSA 3FY7A 1CQHA 3DGQA 3GKXA 2B3SA 3GKMA 1V58A 2C0FA 1SKSB 2HZEA 2KLXA 3APQA 4K7IA 1EWXA 4ZB9A 1YF0A 12GSA 4TXVA 2B1LA 1FW1A 2GDRA 5ECOB 1RQMA 2V1MA 4WXTA 4LL4B 4O7HA 1B8XA 3GRXA 4GCIA 1VF4A 4CDOA 2H72A 3GV1A 4L0WA 3E3EA 5E4WA 2C3TA 3S9FA 4YQVA 2L5OA 1VF2A 2GZZA 4GTUA 2H0IA 4HZ2A 5HR0A 4XIHA 5A4WA 3GTUA 1X9WB 1J9BA 3HVNA 3LEFA 2YCDA
chains in the Genus database with same CATH topology
4POLA 4O32A 2AJQB 4WR5A 1TRUA 1GLPA 4XS4B 3GL5A 3VI7A 1KTEA 3KMOA 4ML6A 4MJAA 1SENA 1X0RA 3FMWA 5HR1A 4LL1B 1Y6EA 4TXOA 1F9MA 1GULA 3HY2A 1PSQA 4WF4A 1QK8A 2KP2A 5IIZA 4WETA 4MNNA 3KEBA 2CV4A 1IYIA 1G7OA 2H30A 1ZYQB 3WT1A 2PERA 3CMIA 4MF7A 1IYHA 3TRQA 1LJRA 3HXSA 2MMAA 1WPIA 4GSSA 2OADA 5J5NA 4HJMA 1UN2A 2V6OA 2N5BA 5IMZA 3A5IA 1ILOA 2YANA 1ZGNA 2IMEA 5B8AA 4NPBA 4NMUA 5COHA 2NDOA 2V41A 3ZIJA 4YQMA 3IOSA 1B9XC 1OC9B 4PQHA 2P5QA 2HLSA 2WS2A 1O81A 1F2EA 2DJKA 1JZDA 3C8EA 2X4AA 2CVKA 5AIVA 1M9BA 1GSQA 5DAKB 5IMVA 1ERTA 4TOPA 1THOA 2H70A 4HZ4A 1XVWA 1K0BA 1QGVA 2C80A 2IFQB 3CRTA 3H8QA 1EOGA 2YP6A 2CAQA 4EKZA 5LCZA 1E2YA 1J08A 2LUSA 4J56E 3W6GA 3F3RA 2PVOC 4PTSA 3A2VA 3M3MA 2ON5A 20GSA 3RPPA 1Q4JA 3IK9A 4G2EA 2E0QA 1K0CA 4IVFA 3ZL5A 2F9SA 1XWGA 1TI1A 3QPMA 4NHZA 1TK8B 2I4AA 3GURA 1WWJA 5H5QA 2CZ3A 3EE2A 3HCZA 1R7HA 3GA4A 3F3QA 2MBTA 4GLTA 3TKQA 4WBJA 4MH3A 4AGSA 4NWYA 2A4VA 4LMWA 1EP8A 5ECMB 2F8AA 3W8JA 1V40A 3V1WA 2VLTA 2VCXA 5D9WA 1K0MA 1PN0A 2K9FA 2R3XA 3IA1A 1UA5A 4V1Ag 2ES7A 3FZAA 3RDWA 2HRKA 3GUSA 3O3TA 4K0NA 5ECPB 4MP4A 2N5FA 1Z6NA 2QGVA 3FHKA 1GP1A 2E7PA 2VCQA 2H6ZA 3F4RA 2L59A 3FW2A 3FYGA 2A4HA 3HJPA 1MEKA 5ECIB 4ZBAA 2WFCA 1T7PB 4ID0A 2RLIA 2IMKA 4HU9A 3LXTA 1G0TA 4I8BA 3HVSA 2XBIA 2AHEA 4I97A 1ZZYA 2B5XA 5CYYA 2PMTA 3TRPA 4K5RA 2R2JA 3HVXA 2YWIA 3HYPA 3TOTA 4AJ8A 2VL2C 1OE7A 1GH2A 2LS5A 2YV9A 4YAVA 3PPUA 5DQSA 1TDIA 1O8XA 3IC8A 3PINA 1QUWA 4XCSA 2QA1A 2WB9A 1ZYEA 4QL9A 1GUHA 3KXOA 3LORA 3P7XA 3TJFA 2O87A 3TKSC 3DRNA 3H4KA 2LJKA 1G6YA 2DBCA 3EPTA 3HVVA 2MBSA 2WULA 3I9V2 4GSNA 4EIPA 1SD8A 13GSA 4IN0A 3TJJA 1EV9A 4L8EA 4TR4A 3APOA 3ZFLA 3TJBA 5DDLA 1NW2A 3GX0A 3G7IA 1J0FA 3QAWA 3KD0A 1XW9A 3M0FA 5IMAA 3JCML 4GF0A 1GSUA 3DIEA 4TR1A 2HRFA 1TU8A 3KTLA 4ICYA 1GSEA 1OE8A 1URMA 4ACSA 4I2TA 2EIOA 2E2MA 3E0UA 5JCUA 4K7NA 4K9ZA 1Y25A 2G2QA 4NV2A 4KE3A 6GSVA 3MDKA 5JCGA 2CQ9A 3N5OA 3TKRA 5IO2A 1K0DA 4IHUA 3GSSA 2AB6A 1V9WA 3MNGA 2WGRA 4WR4A 5J41A 4ECCA 4GWRA 1PL2A 4HEA2 4BL7A 1ON4A 3G9BA 4PXOA 3TKSE 2FUG2 2LV3A 2WZ9A 2C0EA 1HYUA 3ZYWA 2L57A 1XOBA 1K3LA 1NHOA 1SYRA 1F37A 4GSTA 6GSYA 3APSA 4MZWA 1T4ZA 1VGLA 2GSTA 4A5PA 5ECHB 1TK5B 4N10A 4RI6A 3TGZA 4F2IA 5IQYA 2HZFA 5F05A 4L5LA 4ZBBA 3BCIA 2IMIA 5IM9A 3C7MA 2GLRA 6GSUA 2PU9C 2IIYA 1RW1A 4GQCA 3GNJA 2B5YA 2YJ7A 3PH9A 5G31A 2FLSA 4TRXA 1TOFA 3CTFA 4KH7A 4POMA 1VF3A 3GKNA 1N2AA 5KN3A 3QOUA 3FEUA 2HSMA 3HJMA 5B6NA 1YDKA 2CVDA 1GTUA 3UEMA 2H1AA 5IMFA 1MDJA 5ENUA 3FR6A 3VWXA 1XWBA 3L9SA 1OKDA 4X4JA 2GT5A 2B7KA 3GH9A 3UIWA 3BBYA 5CRDA 5AISA 4CY6A 5CRHA 2GGTA 3VK9A 5DJLA 1YZXA 1WMJA 1TP9A 14GSA 4HDEA 4NHWA 4Q5RA 2OACA 2H8LA 4FYBA 4H86A 4TKYA 4OD7A 3TCOA 5C00A 1O73A 2L5LA 1JZWA 2DKIA 2K8SA 1PKZA 4Q5QA 2HT9A 3LJRA 3G7JA 4JU5A 4PURA 1A2JA 2YZHA 1WRYA 3IBHA 4MLYA 3LQ7A 2C0DA 5KN1A 3PR8A 4ECIA 5D73A 5AN1A 3ZREA 3ED3A 5AGYA 4PNGA 4G0LA 4KAEA 4FYCA 3IAS2 1MD4A 4XTSA 1K0NA 1Q98A 5A4VA 2RUFA 1SK0A 5ID2A 4TR3A 2FWFA 2VL2A 3O76A 1TRWA 2DC5A 1W89A 2F8FA 2B7JA 4Z7XA 4JE1A 1OVNA 3IAM2 3GN3A 3M8NA 2X49A 4ZBDA 4CW9A 1CQGA 4PX1A 1AC1A 2CVBA 2GSSA 3ZITA 1A23A 5JCWA 4K8MA 3TKSA 3FZ5A 1PKWA 3O6TA 4NXIA 2VM2A 1GTAA 1ZCPA 4MK3A 1BQ7A 5G2ZA 1EGOA 1JLVA 4IQAA 2LTKA 5GSSA 1MDKA 3I6AA 4WBRD 3IV4A 1FB6A 2FGXA 2REMA 2VUPA 2I9HA 1BJXA 3D0ZA 2GT6A 1SKWB 1R5PA 3ZMKA 1HNCA 1O8WA 4FH8A 1TK0B 1YY7A 1I5GA 3TRXA 3HHVA 2XC2A 3LSZA 4K2XA 2QA2A 3CSJA 1U3IA 4ZL9A 2VOCA 1A0FA 1FOVA 5KEJA 3UBKA 5G30A 4D73B 3C71A 2BTOT 1Z7PA 4X0XA 1PL1A 2M46A 2I81A 1MDIA 3GKKA 1PD21 2PBJA 1R4WA 4EO3A 3KP8A 4IS0A 2GTUA 4KB3A 1T1VA 4MJBA 3LGCA 2QKEA 5FHIA 1FB0A 2O7KA 1SKRB 3HA9A 2NTOA 2H0GA 2VCZA 3EU3A 3IC4A 4BVXA 2GZPA 2CZ2A 2HNLA 1THXA 3C1RA 3U6VA 4DSSB 1UC7A 3D4MA 4JR4A 3UMAA 4KDXA 5DCHA 3ERWA 4BVYA 4IELA 5DJMA 1TU7A 4K1FA 16GSA 2A2RA 5G5EA 4MF6A 2O89A 2C0GA 3P8WA 1T4YA 4JEDA 4TVEA 3HZ8A 4EXJA 5DALB 5J9CA 1M2BA 4I2UA 5CRGA 4XRDA 4V1Ap 1JZRA 1YJ6A 2JSZA 5F0GA 4POKA 1NHYA 1A24A 3FZ9A 5BMUA 5IMDA 1PN9A 1AQWA 9GSSA 1M0UA 1I9DA 4USSA 1EGRA 3IR4A 4KSMA 2YWOA 4MJCA 3A2WA 1LU4A 3EINA 3GYKA 2C1YA 4ZILA 1PA3A 1XPVA 1GLQA 3QD9A 2VO4A 4F03A 1AUCA 1PGTA 3VURA 3BD2A 2LRTA 1U3AA 2N5AA 5IOWA 5CAXA 4QL7A 1C72A 1K0AA 1WE0A 1GTIA 1M2AA 4XS4A 2PUKC 5D9VA 2XHFA 1U87A 2HXKA 4FYUA 3GL3A 5DBQA 3IPZA 5ELGA 5IMCA 4KUNA 1WIKA 3DVWA 2DJ2A 1JLWA 2H66A 1Z7RA 5ECRB 4CHSA 1U88A 3UBLA 4EVMA 3Q74A 4OFNA 5A5KA 3EURA 5ECSA 1W4VA 4WEYA 1FAAA 1FHEA 3VWWA 5E59A 4O5QA 1XVQA 2JL4A 4HU7A 1SD9A 3ZFBA 4PQIA 1Z6MA 1X9SB 2VD1A 2R37A 4X43A 1V98A 3F0IA 1A8LA 2R4VA 2PN8A 1EEMA 1OC9A 2M72A 6GSSA 3US3A 3KZQA 3HJOA 3DVXA 1ML6A 2EIRA 1TRSA 5JWQB 5KN0A 2GQLA 1K3YA 1SK1A 1ERWA 5ECNB 4KGIA 5DAKA 1GSDA 1GUMA 1SK2A 5LNKe 1ACVA 1KEBA 2DJ3A 3LYKA 2IFQA 4MH2A 2IMFA 3CYNA 4MPGA 2R6KA 3W8SA 1ZYNA 4EDYA 5CREA 4L0UA 2H1GA 4BA7A 3QDNA 2H75A 2OJLA 1GSSA 4KF9A 3MWHA 2FNOA 4MMMA 3Q19A 4XS6A 2IN3A 1PX6A 4O5RA 5D96A 1WP0A 2F3MA 1AW9A 2HSHA 4HOJA 3UOMA 4Z2RA 4ML1A 1PX7A 2H76A 5B6MA 1GNWA 4Q5FA 4XRAA 2ON7A 5GZZB 1V57A 2TRXA 4OCEA 1FVKA 3QCPA 5EVOA 5F8BA 3NIVA 4TN8A 4YKFA 1VF1A 1AAZA 4DVCA 4XHMA 4RQXA 4G9HA 2MMOA 2K6VA 3F9UA 2WRTA 4YQUA 5JWOB 5KOWA 2GZYA 2MYGA 1XCCA 1XBSA 3LXZA 4Z2UA 4EC0A 2DIYA 1BYEA 4N0ZA 3MSZA 1GRXA 2LNTA 3F4TA 1TW9A 4IW9A 1FVJA 1O7UA 2RUEA 2YNXA 2AUVA 1HQOA 7GSSA 1BAYA 2HZEB 2ALBA 1WJKA 2YN1A 1X5EA 3L9UA 1OC3A 2WCIA 4OCFA 5G1LA 3D5JA 4ZXGA 5A4UA 5ECQB 2J23A 2GQKA 4GRFA 2A2SA 1XWCA 1PRXA 2AAWA 4IP1A 5D9TA 2GVPA 3RAZA 1NM3A 4G10A 3M9KA 2CAIA 1GWCA 3A5WA 1Z5YE 3FK8A 2C4JA 3Q6OA 1YKCA 3TJGA 6GSXA 2MZCA 4KCEA 1XFLA 5HFIA 2GQMA 2CX4A 5GAND 3G7YA 3GX8A 4JRRA 1DSBA 2TIRA 5D8IA 2X99A 1R26A 1AQXA 1ZYPA 3GTUB 4IKHA 4POBA 2YOIA 2CX3A 4L5OA 2K8VA 2PGTA 2DJ1A 5FT3A 2OA7A 3GSTA 1NSWA 3QAVA 2JSYA 2X8HA 5KN2A 4KW6A 3RPNA 4DSQA 1TTZA 3NZNA 1Z3EA 3EMPA 4Q5NA 3LYPA 1K0OA 4V2MA 4TXOB 2E2GA 3CTGA 1AQVA 2FA8A 2QC7A 3QR6A 2LJAA 5J9BA 3C73A 4F82A 2H74A 1GNEA 3ZIVA 1M9AA 2H71A 1OC8A 4ZL8A 4N0VA 2OE1A 4O92A 3KCMA 3BJ5A 5ECLB 5INYA 2LNSA 4DEJA 1F6MC 4HUAA 4IQ1A 11GSA 5EY6A 3EC3A 1DBYA 1GTBA 2KP1A 5C04A 1OAZA 3KM6A 1K3OA 2JZTA 2P31A 5BRTA 2R0PA 2HRNA 1JHBA 4LMVA 1SL1B 4OFTA 8GSSA 1MTCA 4E8HA 4RUVA 2WJUA 1ABAA 2B6MA 4JZQA 2KOKA 4MF5A 1HD2A 1JFUA 1TKDB 1PMTA 1X5DA 3K8NA 4G0IA 5EL8A 5D93A 3M1GA 2L4QA 4O5UA 3VWVA 1DE2A 3D4TA 1FG4A 1BX9A 3BCKA 4E8EA 4G19A 3KH9A 4BPYA 4YAPA 3ZLPA 3HZ4A 1XIYA 4V2LA 3TDGA 6GSWA 3DEXA 2IL3A 3U5RE 2DMLA 1SJ6A 2DJJA 4EL1A 2ZCTA 3FRCA 1ST9A 2B5EA 2CT6A 4HJ2A 4GXZA 2AV4A 2LRCA 4KDUA 3GIXA 1DE1A 1DUGA 4ECBA 2OBIA 2A2PA 4PUAA 3DKSA 5GAPD 2P5RA 3WT2A 4XS1A 1SJZA 19GSA 1XWKA 2H1DA 1XOAA 4AJ6A 3EWLA 2G0FA 2RM5A 1S3DA 1M2DA 3FKFA 3KP9A 2VL3A 3OR5A 4DSRA 5AIXA 3DMLA 1QXHA 2H6YA 2QSIA 3D22A 2YWMA 2IWTA 3QFAC 3P90A 1XWAA 2BJXA 3TKPA 2BMXA 4KDYA 4OWYA 3WYWA 3MIXA 2V32A 3GFKA 1SL2B 1B48A 3NOFA 1A2MA 2OE3A 1T8EB 2EC4A 3DYRA 1EP7A 4V2NA 4OMVA 4I6XA 3D6IA 3WGEA 3UARA 4OO5A 4WF5A 3RHCA 1EEJA 4KCAA 5DQYA 3HD5A 1M7TA 5HFKA 3N9JA 1B4PA 5J4UA 1XW5A 3TJKA 4PGTA 4KSOA 1BEDA 2X64A 1A0RP 2NPBA 1OYJA 1AIUA 1F3BA 17GSA 4JBBA 1A8YA 4EF0A 2VLUA 2ZNMA 2GSQA 2R5GA 5IOXA 6GSTA 1B4QA 3Q18A 1ZOFA 1RK4A 2VLVA 3F63A 3ZRDA 2B1KA 3H93A 3KH7A 3CSHA 4EDZA 2FHEA 5EPFA 4MPFA 3L0HA 5JWRB 1H4OA 2FWGA 4NV5A 5ELAA 3RBTA 3CRUA 3M9JA 4N11A 2RM6A 4CY8A 4LLRA 2DKHA 4OO4A 3VPQA 2HFDA 1X9MB 2O85A 2VIMA 2V6KA 1EOHA 2F51A 1A2LA 1TI3A 2VM1A 5CRWA 3DXBA 2P0GA 2VCVA 2C8UA 1H75A 2LQQA 5ECKB 2DSAA 5F07A 1PQNA 2X8CA 3IE3A 1O6JA 2D2ZA 1QQ2A 3ZTLA 1OKTA 4J2FA 4F9ZA 2HE3A 4HS1A 1EZKA 2UZ8A 2HYXA 4G0KA 2H01A 5IPGA 2YPMA 5IPHA 3WGXA 4K0GA 10GSA 1YKAA 5CP1A 1HNAA 2H0HA 1O85A 4TR1B 3LG6A 2O8VB 3GHAA 3L78A 2DIZA 1KNGA 4I5QA 1BG5A 2GSRA 4D73A 5HR3A 1N8JA 3UAPA 1LBKA 2RIIA 4KA0A 1WOUA 4K6XA 3SWLA 3EMXA 2NVLA 5D9XA 2YWNA 4MCUA 5G1KA 3KMNA 3C1SA 2L6CA 2FY6A 1M99A 3IRAA 1E6BA 1YEPA 4Z2TA 3FR9A 1KBNA 1ZMAA 1HNBA 4PNFA 3F4SA 1F3AA 4BL7B 3ZVJA 1YEXA 4DSSA 2KHPA 4EIQA 2VL9A 3D21A 3WGDA 2YV7A 1G7EA 2VCTA 3FR3A 3QAGA 1UVZA 2PWJA 4JR6A 1FO5A 4MJEA 3KTBA 5KOXA 2H73A 4NAXA 2C3QA 2FWHA 3VPTA 4KNDA 2MMZA 3ERGA 3UVTA 3TOUA 5B7CA 4QQ7A 2LKUA 3LWAA 3LFLA 3QMXA 4IGJA 5DALA 1AXDA 3AY8A 1TXXA 3F6FA 2IJYA 2HI7A 2JZRA 3MYDA 2IPAA 5CNWA 2VCWA 18GSA 1FOHA 3UL3A 2JADA 2JU5A 2IMDA 2HSYA 2C3NA 1SU9A 3VWUA 1V2AA 4PUFC 2K18A 3KIJA 2EIQA 3BOAA 3FZ4A 1QMVA 1SYXA 5H5RA 4MABA 2V2GA 1ZL9A 4IJIA 3CXGA 3VI5A 3KGKA 2TRCP 4RQRA 3ISOA 2AYTA 4OFMA 3EYTA 2I3YA 3IHQA 5J3RA 22GSA 2CA8A 2HRAA 3CSIA 2L6DA 1USBA 2VAFA 1VRSD 4EE0A 2MMNA 2XPDA 2ZUPA 2H1BA 3CBUA 4MA9A 1XW6A 3TUEA 4ECJA 2JACA 1JZOA 3VFIA 1SJIA 3HDCA 3ZZXA 4AJ7A 2LSTA 3L4NA 2YZUA 2OKAA 4RI7A 1GSFA 3GMFA 1ERUA 3J7Yb 4PQ1A 4FO5A 2LJRA 1S3AA 3SBCA 4ULXA 4N30A 1YQ1A 5FWGA 4MDCA 1TRVA 2J9HA 4K5SA 3ZMLA 1QFNA 2LRNA 4IJ3A 3ME8A 2FCHA 3IHGA 2FD3A 3UVHA 2R0CA 4ZB8A 4FQUA 3F6DA 1Z9HA 5ID2B 1U6TA 3I43A 3EVIA 2FA4A 4YH2A 1T3BA 4IBPA 1SL0B 3VLNA 3ZVJD 3WD6A 3PGTA 4KX4A 5L71A 3IK7A 4MZBA 4WKWA 5ABRA 5DCGA 2VD0A 5B8BA 4MZCA 4BWQA 3LW9A 1YF1A 4ISDA 2KUCA 3MAKA 4P3YB 4ZB6A 3GH6A 5LD0A 2L4CA 1GL8A 3ERFA 2PPTA 5IO0A 2NBSA 4FIWA 4ZIJA 5HR2A 2WDUA 2H19A 4TW5A 3L9VA 1TJDA 1GUKA 4HI7A 4J57E 2XPEA 2DLXA 2JZSA 4GQFA 4ZL7A 2H6XA 5GSTA 4ILFA 5H5SA 3QFBC 3A2XA 1XXUA 3H79A 3R3EA 4HQSA 3P2AA 2Z9SA 1G6WA 1S3CA 5F06A 1ERVA 4K7OA 4YKGA 2DMMA 3ME7A 1GSYA 2LQOA 2FWEA 1XZOA 3TB2A 4K2DA 3DD3A 3R2QA 4IP6A 5CO3A 3UJ1A 2X8GA 5G5FA 2OBKA 4X1UA 4EUYA 3A3TA 4F0CA 3HKRA 4AF2A 2PVQA 3RHBA 2DJ0A 2I1UA 2LEGA 3IDVA 1R5AA 1EV4A 1X5CA 2YJHA 4LA1A 4BVXB 1T00A 2M80A 5DVBA 4F0BA 2OE0A 3DWVA 3EU4A 4TR0A 1MD3A 2GS3A 3H1NA 4HQZA 4BVYB 3I69A 5HQPA 3J7Yk 2R0GA 2XBQA 5HFGA 1B9YC 3IXRA 3E9JB 3F8UA 3KJYA 4BWSA 3FY7A 1CQHA 3DGQA 3GKXA 2B3SA 3GKMA 1V58A 2C0FA 1SKSB 2HZEA 2KLXA 3APQA 4K7IA 1EWXA 4ZB9A 1YF0A 12GSA 4TXVA 2B1LA 1FW1A 2GDRA 5ECOB 1RQMA 2V1MA 4WXTA 4LL4B 4O7HA 1B8XA 3GRXA 4GCIA 1VF4A 4CDOA 2H72A 3GV1A 4L0WA 3E3EA 5E4WA 2C3TA 3S9FA 4YQVA 2L5OA 1VF2A 2GZZA 4GTUA 2H0IA 4HZ2A 5HR0A 4XIHA 5A4WA 3GTUA 1X9WB 1J9BA 3LEFA 2YCDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4POL A;  4O32 A;  2AJQ B;  4WR5 A;  1TRU A;  1GLP A;  4XS4 B;  3GL5 A;  3VI7 A;  1KTE A;  3KMO A;  4ML6 A;  4MJA A;  1SEN A;  1X0R A;  5HR1 A;  4LL1 B;  1Y6E A;  4TXO A;  1F9M A;  1GUL A;  3HY2 A;  1PSQ A;  4WF4 A;  1QK8 A;  2KP2 A;  5IIZ A;  4WET A;  3KEB A;  2CV4 A;  1IYI A;  1G7O A;  2H30 A;  1ZYQ B;  3WT1 A;  2PER A;  3CMI A;  4MF7 A;  1IYH A;  3TRQ A;  1LJR A;  3HXS A;  2MMA A;  1WPI A;  4GSS A;  2OAD A;  5J5N A;  4HJM A;  1UN2 A;  2V6O A;  2N5B A;  5IMZ A;  1ILO A;  2YAN A;  1ZGN A;  2IME A;  5B8A A;  4NPB A;  4NMU A;  5COH A;  2NDO A;  2V41 A;  3ZIJ A;  4YQM A;  3IOS A;  1B9X C;  1OC9 B;  4PQH A;  2P5Q A;  2HLS A;  2WS2 A;  1O81 A;  1F2E A;  2DJK A;  1JZD A;  3C8E A;  2CVK A;  5AIV A;  1M9B A;  1GSQ A;  5DAK B;  5IMV A;  1ERT A;  4TOP A;  1THO A;  2H70 A;  4HZ4 A;  1XVW A;  1K0B A;  1QGV A;  2C80 A;  2IFQ B;  3CRT A;  3H8Q A;  1EOG A;  2YP6 A;  2CAQ A;  4EKZ A;  5LCZ A;  1E2Y A;  1J08 A;  2LUS A;  4J56 E;  3W6G A;  3F3R A;  2PVO C;  3A2V A;  3M3M A;  2ON5 A;  20GS A;  3RPP A;  1Q4J A;  3IK9 A;  4G2E A;  2E0Q A;  1K0C A;  4IVF A;  3ZL5 A;  2F9S A;  1XWG A;  1TI1 A;  3QPM A;  4NHZ A;  1TK8 B;  2I4A A;  3GUR A;  1WWJ A;  5H5Q A;  2CZ3 A;  3EE2 A;  3HCZ A;  1R7H A;  3GA4 A;  3F3Q A;  2MBT A;  4GLT A;  3TKQ A;  4WBJ A;  4MH3 A;  4AGS A;  4NWY A;  2A4V A;  4LMW A;  1EP8 A;  5ECM B;  2F8A A;  3W8J A;  1V40 A;  3V1W A;  2VLT A;  2VCX A;  5D9W A;  1K0M A;  2K9F A;  2R3X A;  3IA1 A;  1UA5 A;  4V1A g;  2ES7 A;  3FZA A;  3RDW A;  3GUS A;  3O3T A;  4K0N A;  5ECP B;  4MP4 A;  2N5F A;  1Z6N A;  2QGV A;  3FHK A;  1GP1 A;  2E7P A;  2VCQ A;  2H6Z A;  3F4R A;  2L59 A;  3FW2 A;  3FYG A;  3HJP A;  1MEK A;  5ECI B;  4ZBA A;  2WFC A;  1T7P B;  4ID0 A;  2RLI A;  2IMK A;  4HU9 A;  3LXT A;  1G0T A;  4I8B A;  3HVS A;  2XBI A;  2AHE A;  4I97 A;  1ZZY A;  2B5X A;  5CYY A;  2PMT A;  3TRP A;  2R2J A;  3HVX A;  2YWI A;  3HYP A;  3TOT A;  4AJ8 A;  2VL2 C;  1OE7 A;  1GH2 A;  2LS5 A;  2YV9 A;  4YAV A;  5DQS A;  1TDI A;  1O8X A;  3PIN A;  1QUW A;  4XCS A;  2WB9 A;  1ZYE A;  4QL9 A;  1GUH A;  3KXO A;  3LOR A;  3P7X A;  3TJF A;  2O87 A;  3TKS C;  3DRN A;  3H4K A;  2LJK A;  1G6Y A;  2DBC A;  3HVV A;  2MBS A;  2WUL A;  3I9V 2;  4GSN A;  1SD8 A;  13GS A;  4IN0 A;  3TJJ A;  1EV9 A;  4L8E A;  4TR4 A;  3APO A;  3ZFL A;  3TJB A;  5DDL A;  1NW2 A;  3GX0 A;  3G7I A;  1J0F A;  3QAW A;  3KD0 A;  1XW9 A;  3M0F A;  5IMA A;  3JCM L;  4GF0 A;  1GSU A;  3DIE A;  4TR1 A;  2HRF A;  1TU8 A;  3KTL A;  1GSE A;  1OE8 A;  1URM A;  4ACS A;  4I2T A;  2EIO A;  2E2M A;  3E0U A;  5JCU A;  4K7N A;  4K9Z A;  1Y25 A;  2G2Q A;  4NV2 A;  4KE3 A;  6GSV A;  3MDK A;  5JCG A;  2CQ9 A;  3N5O A;  3TKR A;  5IO2 A;  1K0D A;  4IHU A;  3GSS A;  2AB6 A;  1V9W A;  3MNG A;  2WGR A;  4WR4 A;  5J41 A;  4ECC A;  4GWR A;  1PL2 A;  4HEA 2;  4BL7 A;  1ON4 A;  3G9B A;  4PXO A;  3TKS E;  2FUG 2;  2LV3 A;  2WZ9 A;  2C0E A;  1HYU A;  3ZYW A;  2L57 A;  1XOB A;  1K3L A;  1NHO A;  1SYR A;  1F37 A;  4GST A;  6GSY A;  3APS A;  4MZW A;  1T4Z A;  1VGL A;  2GST A;  5ECH B;  1TK5 B;  4N10 A;  4RI6 A;  3TGZ A;  4F2I A;  5IQY A;  2HZF A;  5F05 A;  4L5L A;  4ZBB A;  3BCI A;  2IMI A;  5IM9 A;  3C7M A;  2GLR A;  6GSU A;  2PU9 C;  2IIY A;  1RW1 A;  4GQC A;  3GNJ A;  2B5Y A;  2YJ7 A;  3PH9 A;  5G31 A;  2FLS A;  4TRX A;  1TOF A;  3CTF A;  4KH7 A;  4POM A;  1VF3 A;  3GKN A;  1N2A A;  5KN3 A;  3QOU A;  3FEU A;  3HJM A;  5B6N A;  1YDK A;  2CVD A;  1GTU A;  3UEM A;  2H1A A;  5IMF A;  1MDJ A;  5ENU A;  3FR6 A;  3VWX A;  1XWB A;  3L9S A;  1OKD A;  2GT5 A;  2B7K A;  3GH9 A;  3UIW A;  3BBY A;  5CRD A;  5AIS A;  5CRH A;  2GGT A;  3VK9 A;  5DJL A;  1YZX A;  1WMJ A;  1TP9 A;  14GS A;  4HDE A;  4NHW A;  4Q5R A;  2OAC A;  2H8L A;  4FYB A;  4H86 A;  4TKY A;  4OD7 A;  3TCO A;  5C00 A;  1O73 A;  2L5L A;  1JZW A;  2K8S A;  1PKZ A;  4Q5Q A;  2HT9 A;  3LJR A;  3G7J A;  4JU5 A;  4PUR A;  1A2J A;  2YZH A;  1WRY A;  3IBH A;  4MLY A;  3LQ7 A;  2C0D A;  5KN1 A;  3PR8 A;  4ECI A;  5D73 A;  5AN1 A;  3ZRE A;  3ED3 A;  5AGY A;  4PNG A;  4KAE A;  4FYC A;  3IAS 2;  1MD4 A;  4XTS A;  1K0N A;  1Q98 A;  5A4V A;  2RUF A;  1SK0 A;  5ID2 A;  4TR3 A;  2FWF A;  2VL2 A;  3O76 A;  1TRW A;  2DC5 A;  1W89 A;  2F8F A;  2B7J A;  4Z7X A;  4JE1 A;  1OVN A;  3IAM 2;  3GN3 A;  3M8N A;  4ZBD A;  4CW9 A;  1CQG A;  4PX1 A;  1AC1 A;  2CVB A;  2GSS A;  3ZIT A;  1A23 A;  5JCW A;  4K8M A;  3TKS A;  3FZ5 A;  1PKW A;  3O6T A;  4NXI A;  2VM2 A;  1GTA A;  1ZCP A;  4MK3 A;  1BQ7 A;  5G2Z A;  1EGO A;  1JLV A;  4IQA A;  2LTK A;  5GSS A;  1MDK A;  3I6A A;  4WBR D;  3IV4 A;  1FB6 A;  2FGX A;  2REM A;  2VUP A;  2I9H A;  1BJX A;  3D0Z A;  2GT6 A;  1SKW B;  1R5P A;  3ZMK A;  1HNC A;  1O8W A;  4FH8 A;  1TK0 B;  1YY7 A;  1I5G A;  3TRX A;  3HHV A;  2XC2 A;  3LSZ A;  3CSJ A;  1U3I A;  4ZL9 A;  2VOC A;  1A0F A;  1FOV A;  5KEJ A;  3UBK A;  5G30 A;  4D73 B;  3C71 A;  2BTO T;  1Z7P A;  4X0X A;  1PL1 A;  2M46 A;  2I81 A;  1MDI A;  3GKK A;  1PD2 1;  2PBJ A;  1R4W A;  4EO3 A;  3KP8 A;  4IS0 A;  2GTU A;  4KB3 A;  1T1V A;  4MJB A;  3LGC A;  2QKE A;  5FHI A;  1FB0 A;  2O7K A;  1SKR B;  3HA9 A;  2NTO A;  2H0G A;  2VCZ A;  3EU3 A;  3IC4 A;  4BVX A;  2GZP A;  2CZ2 A;  2HNL A;  1THX A;  3C1R A;  3U6V A;  4DSS B;  1UC7 A;  3D4M A;  4JR4 A;  3UMA A;  4KDX A;  5DCH A;  3ERW A;  4BVY A;  4IEL A;  5DJM A;  1TU7 A;  4K1F A;  16GS A;  2A2R A;  5G5E A;  4MF6 A;  2O89 A;  2C0G A;  3P8W A;  1T4Y A;  4JED A;  4TVE A;  3HZ8 A;  4EXJ A;  5DAL B;  5J9C A;  1M2B A;  4I2U A;  5CRG A;  4XRD A;  4V1A p;  1JZR A;  1YJ6 A;  2JSZ A;  5F0G A;  4POK A;  1NHY A;  1A24 A;  3FZ9 A;  5IMD A;  1PN9 A;  1AQW A;  9GSS A;  1M0U A;  1I9D A;  1EGR A;  3IR4 A;  4KSM A;  2YWO A;  4MJC A;  3A2W A;  1LU4 A;  3EIN A;  3GYK A;  2C1Y A;  4ZIL A;  1PA3 A;  1XPV A;  1GLQ A;  3QD9 A;  2VO4 A;  4F03 A;  1AUC A;  1PGT A;  3VUR A;  3BD2 A;  2LRT A;  1U3A A;  2N5A A;  5IOW A;  5CAX A;  4QL7 A;  1C72 A;  1K0A A;  1WE0 A;  1GTI A;  1M2A A;  4XS4 A;  2PUK C;  5D9V A;  2XHF A;  1U87 A;  2HXK A;  4FYU A;  3GL3 A;  5DBQ A;  3IPZ A;  5ELG A;  5IMC A;  4KUN A;  1WIK A;  3DVW A;  2DJ2 A;  1JLW A;  2H66 A;  1Z7R A;  5ECR B;  4CHS A;  1U88 A;  3UBL A;  4EVM A;  3Q74 A;  4OFN A;  5A5K A;  3EUR A;  5ECS A;  1W4V A;  4WEY A;  1FAA A;  1FHE A;  3VWW A;  5E59 A;  1XVQ A;  2JL4 A;  4HU7 A;  1SD9 A;  3ZFB A;  4PQI A;  1Z6M A;  1X9S B;  2VD1 A;  2R37 A;  4X43 A;  1V98 A;  3F0I A;  1A8L A;  2R4V A;  2PN8 A;  1EEM A;  1OC9 A;  2M72 A;  6GSS A;  3US3 A;  3KZQ A;  3HJO A;  3DVX A;  1ML6 A;  2EIR A;  1TRS A;  5JWQ B;  5KN0 A;  2GQL A;  1K3Y A;  1SK1 A;  1ERW A;  5ECN B;  4KGI A;  5DAK A;  1GSD A;  1GUM A;  1SK2 A;  5LNK e;  1ACV A;  1KEB A;  2DJ3 A;  3LYK A;  2IFQ A;  4MH2 A;  2IMF A;  3CYN A;  4MPG A;  2R6K A;  3W8S A;  4EDY A;  5CRE A;  4L0U A;  2H1G A;  4BA7 A;  3QDN A;  2H75 A;  2OJL A;  1GSS A;  3MWH A;  2FNO A;  4MMM A;  3Q19 A;  4XS6 A;  2IN3 A;  1PX6 A;  4O5R A;  5D96 A;  1WP0 A;  2F3M A;  1AW9 A;  2HSH A;  4HOJ A;  3UOM A;  4ML1 A;  1PX7 A;  2H76 A;  5B6M A;  1GNW A;  4Q5F A;  4XRA A;  2ON7 A;  5GZZ B;  1V57 A;  2TRX A;  4OCE A;  1FVK A;  3QCP A;  5EVO A;  5F8B A;  3NIV A;  4TN8 A;  1VF1 A;  1AAZ A;  4DVC A;  4XHM A;  4RQX A;  4G9H A;  2MMO A;  2K6V A;  3F9U A;  2WRT A;  4YQU A;  5JWO B;  2GZY A;  2MYG A;  1XCC A;  1XBS A;  3LXZ A;  4EC0 A;  2DIY A;  1BYE A;  4N0Z A;  3MSZ A;  1GRX A;  2LNT A;  3F4T A;  1TW9 A;  4IW9 A;  1FVJ A;  1O7U A;  2RUE A;  2YNX A;  2AUV A;  1HQO A;  7GSS A;  1BAY A;  2HZE B;  2ALB A;  1WJK A;  2YN1 A;  1X5E A;  3L9U A;  1OC3 A;  2WCI A;  4OCF A;  5G1L A;  3D5J A;  4ZXG A;  5A4U A;  5ECQ B;  2J23 A;  2GQK A;  4GRF A;  2A2S A;  1XWC A;  1PRX A;  2AAW A;  4IP1 A;  5D9T A;  2GVP A;  3RAZ A;  1NM3 A;  4G10 A;  3M9K A;  2CAI A;  1GWC A;  3A5W A;  1Z5Y E;  3FK8 A;  2C4J A;  3Q6O A;  1YKC A;  3TJG A;  6GSX A;  2MZC A;  4KCE A;  1XFL A;  5HFI A;  2GQM A;  2CX4 A;  5GAN D;  3G7Y A;  3GX8 A;  4JRR A;  1DSB A;  2TIR A;  5D8I A;  2X99 A;  1R26 A;  1AQX A;  4POB A;  3GTU B;  4IKH A;  2YOI A;  2CX3 A;  4L5O A;  2K8V A;  2PGT A;  2DJ1 A;  5FT3 A;  2OA7 A;  3GST A;  1NSW A;  3QAV A;  2JSY A;  2X8H A;  5KN2 A;  4KW6 A;  3RPN A;  4DSQ A;  1TTZ A;  3NZN A;  1Z3E A;  3EMP A;  4Q5N A;  3LYP A;  1K0O A;  4V2M A;  4TXO B;  2E2G A;  3CTG A;  1AQV A;  2FA8 A;  2QC7 A;  3QR6 A;  2LJA A;  5J9B A;  3C73 A;  4F82 A;  2H74 A;  1GNE A;  3ZIV A;  1M9A A;  2H71 A;  1OC8 A;  4ZL8 A;  4N0V A;  2OE1 A;  4O92 A;  3KCM A;  3BJ5 A;  5ECL B;  5INY A;  2LNS A;  4DEJ A;  1F6M C;  4HUA A;  4IQ1 A;  11GS A;  5EY6 A;  3EC3 A;  1DBY A;  1GTB A;  2KP1 A;  5C04 A;  1OAZ A;  3KM6 A;  1K3O A;  2JZT A;  2P31 A;  2HRN A;  1JHB A;  4LMV A;  1SL1 B;  4OFT A;  8GSS A;  1MTC A;  4E8H A;  4RUV A;  2WJU A;  1ABA A;  2B6M A;  4JZQ A;  2KOK A;  4MF5 A;  1HD2 A;  1JFU A;  1TKD B;  1PMT A;  1X5D A;  3K8N A;  5EL8 A;  5D93 A;  3M1G A;  2L4Q A;  3VWV A;  1DE2 A;  3D4T A;  1FG4 A;  1BX9 A;  3BCK A;  4E8E A;  4G19 A;  3KH9 A;  4BPY A;  4YAP A;  3ZLP A;  3HZ4 A;  1XIY A;  4V2L A;  3TDG A;  6GSW A;  3DEX A;  2IL3 A;  3U5R E;  2DML A;  1SJ6 A;  2DJJ A;  4EL1 A;  2ZCT A;  3FRC A;  1ST9 A;  2B5E A;  2CT6 A;  4HJ2 A;  4GXZ A;  2AV4 A;  2LRC A;  4KDU A;  3GIX A;  1DE1 A;  1DUG A;  4ECB A;  2OBI A;  4PUA A;  3DKS A;  5GAP D;  2P5R A;  3WT2 A;  4XS1 A;  1SJZ A;  19GS A;  1XWK A;  2H1D A;  1XOA A;  4AJ6 A;  3EWL A;  2G0F A;  2RM5 A;  1S3D A;  1M2D A;  3FKF A;  3KP9 A;  2VL3 A;  3OR5 A;  4DSR A;  5AIX A;  3DML A;  1QXH A;  2H6Y A;  2QSI A;  3D22 A;  2YWM A;  2IWT A;  3QFA C;  3P90 A;  1XWA A;  2BJX A;  3TKP A;  2BMX A;  4KDY A;  4OWY A;  3WYW A;  2V32 A;  3GFK A;  1SL2 B;  1B48 A;  3NOF A;  1A2M A;  2OE3 A;  1T8E B;  2EC4 A;  3DYR A;  1EP7 A;  4V2N A;  4OMV A;  4I6X A;  3D6I A;  3WGE A;  3UAR A;  4OO5 A;  4WF5 A;  3RHC A;  1EEJ A;  4KCA A;  5DQY A;  3HD5 A;  1M7T A;  5HFK A;  3N9J A;  1B4P A;  5J4U A;  1XW5 A;  3TJK A;  4PGT A;  4KSO A;  1BED A;  2X64 A;  1A0R P;  2NPB A;  1OYJ A;  1AIU A;  1F3B A;  17GS A;  4JBB A;  1A8Y A;  4EF0 A;  2VLU A;  2ZNM A;  2GSQ A;  2R5G A;  5IOX A;  6GST A;  1B4Q A;  3Q18 A;  1ZOF A;  1RK4 A;  2VLV A;  3F63 A;  3ZRD A;  2B1K A;  3H93 A;  3KH7 A;  3CSH A;  4EDZ A;  2FHE A;  5EPF A;  4MPF A;  3L0H A;  5JWR B;  1H4O A;  2FWG A;  4NV5 A;  5ELA A;  3RBT A;  3CRU A;  3M9J A;  4N11 A;  2RM6 A;  4LLR A;  4OO4 A;  3VPQ A;  2HFD A;  1X9M B;  2O85 A;  2VIM A;  2V6K A;  1EOH A;  2F51 A;  1A2L A;  1TI3 A;  2VM1 A;  5CRW A;  3DXB A;  2P0G A;  2VCV A;  2C8U A;  1H75 A;  2LQQ A;  5ECK B;  2DSA A;  5F07 A;  1PQN A;  2X8C A;  3IE3 A;  1O6J A;  2D2Z A;  1QQ2 A;  3ZTL A;  1OKT A;  4J2F A;  4F9Z A;  2HE3 A;  4HS1 A;  1EZK A;  2HYX A;  2H01 A;  5IPG A;  2YPM A;  5IPH A;  3WGX A;  4K0G A;  10GS A;  1YKA A;  5CP1 A;  1HNA A;  2H0H A;  1O85 A;  4TR1 B;  3LG6 A;  2O8V B;  3GHA A;  3L78 A;  2DIZ A;  1KNG A;  4I5Q A;  1BG5 A;  2GSR A;  4D73 A;  5HR3 A;  1N8J A;  3UAP A;  1LBK A;  2RII A;  4KA0 A;  1WOU A;  4K6X A;  3SWL A;  3EMX A;  2NVL A;  5D9X A;  2YWN A;  4MCU A;  5G1K A;  3KMN A;  3C1S A;  2L6C A;  2FY6 A;  1M99 A;  3IRA A;  1E6B A;  1YEP A;  3FR9 A;  1KBN A;  1ZMA A;  1HNB A;  4PNF A;  3F4S A;  1F3A A;  3ZVJ A;  1YEX A;  4DSS A;  2KHP A;  2VL9 A;  3D21 A;  3WGD A;  2YV7 A;  1G7E A;  2VCT A;  3FR3 A;  3QAG A;  1UVZ A;  2PWJ A;  4JR6 A;  1FO5 A;  4MJE A;  3KTB A;  2H73 A;  4NAX A;  2C3Q A;  2FWH A;  3VPT A;  4KND A;  2MMZ A;  3ERG A;  3UVT A;  3TOU A;  5B7C A;  4QQ7 A;  2LKU A;  3LWA A;  3LFL A;  3QMX A;  4IGJ A;  5DAL A;  1AXD A;  3AY8 A;  1TXX A;  3F6F A;  2IJY A;  2HI7 A;  2JZR A;  2IPA A;  5CNW A;  2VCW A;  18GS A;  3UL3 A;  2JAD A;  2JU5 A;  2IMD A;  2HSY A;  2C3N A;  1SU9 A;  3VWU A;  1V2A A;  4PUF C;  2K18 A;  3KIJ A;  2EIQ A;  3BOA A;  3FZ4 A;  1QMV A;  1SYX A;  5H5R A;  4MAB A;  2V2G A;  1ZL9 A;  4IJI A;  3CXG A;  3VI5 A;  3KGK A;  2TRC P;  4RQR A;  3ISO A;  2AYT A;  4OFM A;  3EYT A;  2I3Y A;  3IHQ A;  5J3R A;  22GS A;  2CA8 A;  3CSI A;  2L6D A;  1USB A;  2VAF A;  1VRS D;  4EE0 A;  2MMN A;  2XPD A;  2ZUP A;  2H1B A;  3CBU A;  4MA9 A;  1XW6 A;  3TUE A;  4ECJ A;  2JAC A;  1JZO A;  3VFI A;  1SJI A;  3HDC A;  3ZZX A;  4AJ7 A;  2LST A;  3L4N A;  2YZU A;  2OKA A;  4RI7 A;  1GSF A;  3GMF A;  1ERU A;  3J7Y b;  4PQ1 A;  4FO5 A;  2LJR A;  1S3A A;  3SBC A;  4ULX A;  4N30 A;  1YQ1 A;  5FWG A;  4MDC A;  1TRV A;  2J9H A;  3ZML A;  1QFN A;  2LRN A;  4IJ3 A;  3ME8 A;  2FCH A;  2FD3 A;  3UVH A;  4ZB8 A;  3F6D A;  1Z9H A;  5ID2 B;  1U6T A;  3I43 A;  3EVI A;  2FA4 A;  4YH2 A;  1T3B A;  4IBP A;  1SL0 B;  3VLN A;  3ZVJ D;  3WD6 A;  3PGT A;  4KX4 A;  5L71 A;  3IK7 A;  4MZB A;  4WKW A;  5ABR A;  5DCG A;  2VD0 A;  5B8B A;  4MZC A;  4BWQ A;  1YF1 A;  4ISD A;  2KUC A;  3MAK A;  4P3Y B;  4ZB6 A;  3GH6 A;  5LD0 A;  2L4C A;  1GL8 A;  3ERF A;  2PPT A;  5IO0 A;  2NBS A;  4FIW A;  4ZIJ A;  5HR2 A;  2WDU A;  2H19 A;  4TW5 A;  3L9V A;  1TJD A;  1GUK A;  4HI7 A;  4J57 E;  2XPE A;  2DLX A;  2JZS A;  4GQF A;  4ZL7 A;  2H6X A;  5GST A;  4ILF A;  5H5S A;  3QFB C;  3A2X A;  1XXU A;  3H79 A;  4HQS A;  3P2A A;  2Z9S A;  1G6W A;  1S3C A;  5F06 A;  1ERV A;  4K7O A;  2DMM A;  3ME7 A;  1GSY A;  2LQO A;  2FWE A;  1XZO A;  3TB2 A;  4K2D A;  3DD3 A;  3R2Q A;  4IP6 A;  5CO3 A;  3UJ1 A;  2X8G A;  5G5F A;  2OBK A;  4X1U A;  4EUY A;  3A3T A;  4F0C A;  3HKR A;  4AF2 A;  2PVQ A;  3RHB A;  2DJ0 A;  2I1U A;  2LEG A;  3IDV A;  1R5A A;  1EV4 A;  1X5C A;  2YJH A;  4LA1 A;  1T00 A;  2M80 A;  5DVB A;  4F0B A;  2OE0 A;  3DWV A;  3EU4 A;  4TR0 A;  1MD3 A;  2GS3 A;  3H1N A;  4HQZ A;  3I69 A;  5HQP A;  3J7Y k;  2XBQ A;  5HFG A;  1B9Y C;  3IXR A;  3E9J B;  3F8U A;  3KJY A;  4BWS A;  3FY7 A;  1CQH A;  3DGQ A;  3GKX A;  2B3S A;  3GKM A;  1V58 A;  2C0F A;  1SKS B;  2HZE A;  2KLX A;  3APQ A;  4K7I A;  1EWX A;  4ZB9 A;  1YF0 A;  12GS A;  4TXV A;  2B1L A;  1FW1 A;  2GDR A;  5ECO B;  1RQM A;  2V1M A;  4WXT A;  4LL4 B;  4O7H A;  1B8X A;  3GRX A;  4GCI A;  1VF4 A;  4CDO A;  2H72 A;  3GV1 A;  4L0W A;  3E3E A;  5E4W A;  2C3T A;  3S9F A;  4YQV A;  2L5O A;  1VF2 A;  2GZZ A;  4GTU A;  2H0I A;  4HZ2 A;  5HR0 A;  4XIH A;  5A4W A;  3GTU A;  1X9W B;  1J9B A;  3LEF A;  2YCD A; 
#chains in the Genus database with same CATH topology
 4POL A;  4O32 A;  2AJQ B;  4WR5 A;  1TRU A;  1GLP A;  4XS4 B;  3GL5 A;  3VI7 A;  1KTE A;  3KMO A;  4ML6 A;  4MJA A;  1SEN A;  1X0R A;  3FMW A;  5HR1 A;  4LL1 B;  1Y6E A;  4TXO A;  1F9M A;  1GUL A;  3HY2 A;  1PSQ A;  4WF4 A;  1QK8 A;  2KP2 A;  5IIZ A;  4WET A;  4MNN A;  3KEB A;  2CV4 A;  1IYI A;  1G7O A;  2H30 A;  1ZYQ B;  3WT1 A;  2PER A;  3CMI A;  4MF7 A;  1IYH A;  3TRQ A;  1LJR A;  3HXS A;  2MMA A;  1WPI A;  4GSS A;  2OAD A;  5J5N A;  4HJM A;  1UN2 A;  2V6O A;  2N5B A;  5IMZ A;  3A5I A;  1ILO A;  2YAN A;  1ZGN A;  2IME A;  5B8A A;  4NPB A;  4NMU A;  5COH A;  2NDO A;  2V41 A;  3ZIJ A;  4YQM A;  3IOS A;  1B9X C;  1OC9 B;  4PQH A;  2P5Q A;  2HLS A;  2WS2 A;  1O81 A;  1F2E A;  2DJK A;  1JZD A;  3C8E A;  2X4A A;  2CVK A;  5AIV A;  1M9B A;  1GSQ A;  5DAK B;  5IMV A;  1ERT A;  4TOP A;  1THO A;  2H70 A;  4HZ4 A;  1XVW A;  1K0B A;  1QGV A;  2C80 A;  2IFQ B;  3CRT A;  3H8Q A;  1EOG A;  2YP6 A;  2CAQ A;  4EKZ A;  5LCZ A;  1E2Y A;  1J08 A;  2LUS A;  4J56 E;  3W6G A;  3F3R A;  2PVO C;  4PTS A;  3A2V A;  3M3M A;  2ON5 A;  20GS A;  3RPP A;  1Q4J A;  3IK9 A;  4G2E A;  2E0Q A;  1K0C A;  4IVF A;  3ZL5 A;  2F9S A;  1XWG A;  1TI1 A;  3QPM A;  4NHZ A;  1TK8 B;  2I4A A;  3GUR A;  1WWJ A;  5H5Q A;  2CZ3 A;  3EE2 A;  3HCZ A;  1R7H A;  3GA4 A;  3F3Q A;  2MBT A;  4GLT A;  3TKQ A;  4WBJ A;  4MH3 A;  4AGS A;  4NWY A;  2A4V A;  4LMW A;  1EP8 A;  5ECM B;  2F8A A;  3W8J A;  1V40 A;  3V1W A;  2VLT A;  2VCX A;  5D9W A;  1K0M A;  1PN0 A;  2K9F A;  2R3X A;  3IA1 A;  1UA5 A;  4V1A g;  2ES7 A;  3FZA A;  3RDW A;  2HRK A;  3GUS A;  3O3T A;  4K0N A;  5ECP B;  4MP4 A;  2N5F A;  1Z6N A;  2QGV A;  3FHK A;  1GP1 A;  1XG8 A;  2E7P A;  2VCQ A;  2H6Z A;  3F4R A;  2L59 A;  3FW2 A;  3FYG A;  2A4H A;  3HJP A;  1MEK A;  5ECI B;  4ZBA A;  2WFC A;  1T7P B;  4ID0 A;  2RLI A;  2IMK A;  4HU9 A;  3LXT A;  1G0T A;  4I8B A;  3HVS A;  2XBI A;  2AHE A;  4I97 A;  1ZZY A;  2B5X A;  5CYY A;  2PMT A;  3TRP A;  4K5R A;  2R2J A;  3HVX A;  2YWI A;  3HYP A;  3TOT A;  4AJ8 A;  2VL2 C;  1OE7 A;  1GH2 A;  2LS5 A;  2YV9 A;  4YAV A;  3PPU A;  5DQS A;  1TDI A;  1O8X A;  3IC8 A;  3PIN A;  1QUW A;  4XCS A;  2QA1 A;  2WB9 A;  1ZYE A;  4QL9 A;  1GUH A;  3KXO A;  3LOR A;  3P7X A;  3TJF A;  2O87 A;  3TKS C;  3DRN A;  3H4K A;  2LJK A;  1G6Y A;  2DBC A;  3EPT A;  3HVV A;  2MBS A;  2WUL A;  3I9V 2;  4GSN A;  4EIP A;  1SD8 A;  13GS A;  4IN0 A;  3TJJ A;  1EV9 A;  4L8E A;  4TR4 A;  3APO A;  3ZFL A;  3TJB A;  5DDL A;  1NW2 A;  3GX0 A;  3G7I A;  1J0F A;  3QAW A;  3KD0 A;  1XW9 A;  3M0F A;  5IMA A;  3JCM L;  4GF0 A;  1GSU A;  3DIE A;  4TR1 A;  2HRF A;  4BIK A;  1TU8 A;  3KTL A;  4ICY A;  1GSE A;  1OE8 A;  1URM A;  4ACS A;  4I2T A;  2EIO A;  2E2M A;  3E0U A;  5JCU A;  4K7N A;  4K9Z A;  1Y25 A;  2G2Q A;  4NV2 A;  4KE3 A;  6GSV A;  3MDK A;  5JCG A;  2CQ9 A;  3N5O A;  3TKR A;  5IO2 A;  1K0D A;  4IHU A;  3GSS A;  2AB6 A;  1V9W A;  3MNG A;  2WGR A;  4WR4 A;  5J41 A;  4ECC A;  4GWR A;  1PL2 A;  4HEA 2;  4BL7 A;  1ON4 A;  3G9B A;  4PXO A;  3TKS E;  2FUG 2;  2LV3 A;  2WZ9 A;  2C0E A;  1HYU A;  3ZYW A;  2L57 A;  1XOB A;  1K3L A;  1NHO A;  1SYR A;  1F37 A;  4GST A;  6GSY A;  3APS A;  4MZW A;  1T4Z A;  1VGL A;  2GST A;  4A5P A;  5ECH B;  1TK5 B;  4N10 A;  4RI6 A;  3TGZ A;  4F2I A;  5IQY A;  2HZF A;  5F05 A;  4L5L A;  4ZBB A;  3BCI A;  2IMI A;  5IM9 A;  3C7M A;  2GLR A;  6GSU A;  2PU9 C;  2IIY A;  1RW1 A;  4GQC A;  3GNJ A;  2B5Y A;  2YJ7 A;  3PH9 A;  5G31 A;  2FLS A;  4TRX A;  1TOF A;  3CTF A;  4KH7 A;  4POM A;  1VF3 A;  3GKN A;  1N2A A;  5KN3 A;  3QOU A;  3FEU A;  2HSM A;  3HJM A;  5B6N A;  1YDK A;  2CVD A;  1GTU A;  3UEM A;  2H1A A;  5IMF A;  1MDJ A;  5ENU A;  3FR6 A;  3VWX A;  1XWB A;  3L9S A;  1OKD A;  4X4J A;  2GT5 A;  2B7K A;  3GH9 A;  3UIW A;  3BBY A;  5CRD A;  5AIS A;  4CY6 A;  5CRH A;  2GGT A;  3VK9 A;  5DJL A;  1YZX A;  1WMJ A;  1TP9 A;  14GS A;  4HDE A;  4NHW A;  4Q5R A;  2OAC A;  2H8L A;  4FYB A;  4H86 A;  4TKY A;  4OD7 A;  3TCO A;  5C00 A;  1O73 A;  2L5L A;  1JZW A;  2DKI A;  2K8S A;  1PKZ A;  4Q5Q A;  2HT9 A;  3LJR A;  3G7J A;  4JU5 A;  4PUR A;  1A2J A;  2YZH A;  1WRY A;  3IBH A;  4MLY A;  3LQ7 A;  2C0D A;  5KN1 A;  3PR8 A;  4ECI A;  5D73 A;  5AN1 A;  3ZRE A;  3ED3 A;  5AGY A;  4PNG A;  4G0L A;  4KAE A;  4FYC A;  3IAS 2;  1MD4 A;  4XTS A;  1K0N A;  1Q98 A;  5A4V A;  2RUF A;  1SK0 A;  5ID2 A;  4TR3 A;  2FWF A;  2VL2 A;  3O76 A;  1TRW A;  2DC5 A;  1W89 A;  2F8F A;  2B7J A;  4Z7X A;  4JE1 A;  1OVN A;  3IAM 2;  3GN3 A;  3M8N A;  2X49 A;  4ZBD A;  4CW9 A;  1CQG A;  4PX1 A;  1AC1 A;  2CVB A;  2GSS A;  3ZIT A;  1A23 A;  5JCW A;  4K8M A;  3TKS A;  3FZ5 A;  1PKW A;  3O6T A;  4NXI A;  2VM2 A;  1GTA A;  1ZCP A;  4MK3 A;  1BQ7 A;  5G2Z A;  1EGO A;  1JLV A;  4IQA A;  2LTK A;  5GSS A;  1MDK A;  3I6A A;  4WBR D;  3IV4 A;  1FB6 A;  2FGX A;  2REM A;  2VUP A;  2I9H A;  1BJX A;  3D0Z A;  2GT6 A;  1SKW B;  1R5P A;  3ZMK A;  1HNC A;  1O8W A;  4FH8 A;  1TK0 B;  1YY7 A;  1I5G A;  3TRX A;  3HHV A;  2XC2 A;  3LSZ A;  4K2X A;  2QA2 A;  3CSJ A;  1U3I A;  4ZL9 A;  2VOC A;  1A0F A;  1FOV A;  5KEJ A;  3UBK A;  5G30 A;  4D73 B;  3C71 A;  2BTO T;  1Z7P A;  4X0X A;  1PL1 A;  2M46 A;  2I81 A;  1MDI A;  3GKK A;  1PD2 1;  2PBJ A;  1R4W A;  4EO3 A;  3KP8 A;  4IS0 A;  2GTU A;  4KB3 A;  1T1V A;  4MJB A;  3LGC A;  2QKE A;  5FHI A;  1FB0 A;  2O7K A;  1SKR B;  3HA9 A;  2NTO A;  2H0G A;  2VCZ A;  3EU3 A;  3IC4 A;  4BVX A;  2GZP A;  2CZ2 A;  2HNL A;  4HSC X;  1THX A;  3C1R A;  3U6V A;  4DSS B;  1UC7 A;  3D4M A;  4JR4 A;  3UMA A;  4KDX A;  5DCH A;  3ERW A;  4BVY A;  4IEL A;  5DJM A;  1TU7 A;  4K1F A;  16GS A;  2A2R A;  5G5E A;  4MF6 A;  2O89 A;  2C0G A;  3P8W A;  1T4Y A;  4JED A;  4TVE A;  3HZ8 A;  4EXJ A;  5DAL B;  1M3I A;  5J9C A;  1M2B A;  4I2U A;  5CRG A;  4XRD A;  4V1A p;  1JZR A;  1YJ6 A;  2JSZ A;  5F0G A;  4POK A;  1NHY A;  1A24 A;  3FZ9 A;  5BMU A;  5IMD A;  1PN9 A;  1AQW A;  9GSS A;  1M0U A;  1I9D A;  4USS A;  1EGR A;  3IR4 A;  4KSM A;  2YWO A;  4MJC A;  3A2W A;  1LU4 A;  3EIN A;  3GYK A;  2C1Y A;  4ZIL A;  1PA3 A;  1XPV A;  1GLQ A;  3QD9 A;  2VO4 A;  4F03 A;  1AUC A;  1PGT A;  3VUR A;  3BD2 A;  2LRT A;  1U3A A;  2N5A A;  5IOW A;  5CAX A;  4QL7 A;  1C72 A;  1K0A A;  1WE0 A;  1GTI A;  1M2A A;  4XS4 A;  2PUK C;  5D9V A;  2XHF A;  1U87 A;  2HXK A;  4FYU A;  3GL3 A;  5DBQ A;  3IPZ A;  5ELG A;  5IMC A;  4KUN A;  1WIK A;  3DVW A;  2DJ2 A;  1JLW A;  2H66 A;  1Z7R A;  5ECR B;  4CHS A;  1U88 A;  3UBL A;  4EVM A;  3Q74 A;  4OFN A;  5A5K A;  3EUR A;  5ECS A;  1W4V A;  4WEY A;  1FAA A;  1FHE A;  3VWW A;  5E59 A;  4O5Q A;  1XVQ A;  2JL4 A;  4HU7 A;  1SD9 A;  3ZFB A;  4PQI A;  1Z6M A;  1X9S B;  2VD1 A;  2R37 A;  4X43 A;  1V98 A;  3F0I A;  1A8L A;  2R4V A;  2PN8 A;  1EEM A;  1S3R A;  1OC9 A;  2M72 A;  6GSS A;  3US3 A;  3KZQ A;  3HJO A;  3DVX A;  1ML6 A;  2EIR A;  1TRS A;  5JWQ B;  5KN0 A;  2GQL A;  1K3Y A;  1SK1 A;  1ERW A;  5ECN B;  4KGI A;  5DAK A;  1GSD A;  1GUM A;  1SK2 A;  5LNK e;  1ACV A;  1KEB A;  2DJ3 A;  3LYK A;  2IFQ A;  4MH2 A;  2IMF A;  3CYN A;  4MPG A;  2R6K A;  3W8S A;  1ZYN A;  4EDY A;  5CRE A;  4L0U A;  2H1G A;  4BA7 A;  3QDN A;  2H75 A;  2OJL A;  1GSS A;  4KF9 A;  3MWH A;  2FNO A;  4MMM A;  3Q19 A;  4XS6 A;  2IN3 A;  1PX6 A;  4O5R A;  5D96 A;  1WP0 A;  2F3M A;  1AW9 A;  2HSH A;  4HOJ A;  3UOM A;  4Z2R A;  4ML1 A;  1PX7 A;  2H76 A;  5B6M A;  1GNW A;  4Q5F A;  4XRA A;  2ON7 A;  5GZZ B;  1V57 A;  2TRX A;  4OCE A;  1FVK A;  3QCP A;  5EVO A;  5F8B A;  3NIV A;  4TN8 A;  4YKF A;  1VF1 A;  1AAZ A;  4DVC A;  4XHM A;  4RQX A;  4G9H A;  2MMO A;  2K6V A;  3F9U A;  2WRT A;  4YQU A;  5JWO B;  5KOW A;  2GZY A;  2MYG A;  1XCC A;  1XBS A;  3LXZ A;  4Z2U A;  4EC0 A;  2DIY A;  1BYE A;  4N0Z A;  3MSZ A;  1GRX A;  2LNT A;  3F4T A;  1TW9 A;  4IW9 A;  1FVJ A;  1O7U A;  2RUE A;  2YNX A;  2AUV A;  1HQO A;  7GSS A;  1BAY A;  2HZE B;  2ALB A;  1WJK A;  2YN1 A;  1X5E A;  3L9U A;  1OC3 A;  2WCI A;  4OCF A;  5G1L A;  3D5J A;  4ZXG A;  5A4U A;  5ECQ B;  2J23 A;  2GQK A;  4GRF A;  2A2S A;  1XWC A;  1PRX A;  2AAW A;  4IP1 A;  5D9T A;  2GVP A;  3RAZ A;  1NM3 A;  4G10 A;  3M9K A;  2CAI A;  1GWC A;  3A5W A;  1Z5Y E;  3FK8 A;  2C4J A;  3Q6O A;  1YKC A;  3TJG A;  6GSX A;  2MZC A;  4KCE A;  1XFL A;  5HFI A;  2GQM A;  2CX4 A;  5GAN D;  3G7Y A;  3GX8 A;  4JRR A;  1DSB A;  2TIR A;  5D8I A;  2X99 A;  1R26 A;  1AQX A;  1ZYP A;  3GTU B;  4IKH A;  4POB A;  2YOI A;  2CX3 A;  4L5O A;  2K8V A;  2PGT A;  1PFO A;  2DJ1 A;  5FT3 A;  2OA7 A;  3GST A;  1NSW A;  3QAV A;  2JSY A;  2X8H A;  5KN2 A;  4KW6 A;  3RPN A;  4DSQ A;  1TTZ A;  3NZN A;  1Z3E A;  3EMP A;  4Q5N A;  3LYP A;  1K0O A;  4V2M A;  4TXO B;  2E2G A;  3CTG A;  1AQV A;  2FA8 A;  2QC7 A;  3QR6 A;  2LJA A;  5J9B A;  3C73 A;  4F82 A;  2H74 A;  1GNE A;  3ZIV A;  1M9A A;  2H71 A;  1OC8 A;  4ZL8 A;  4N0V A;  2OE1 A;  4O92 A;  3KCM A;  3BJ5 A;  5ECL B;  5INY A;  2LNS A;  4DEJ A;  1F6M C;  4HUA A;  4IQ1 A;  11GS A;  5EY6 A;  3EC3 A;  1DBY A;  1GTB A;  2KP1 A;  5C04 A;  1OAZ A;  3KM6 A;  1K3O A;  2JZT A;  2P31 A;  5BRT A;  2R0P A;  2HRN A;  1JHB A;  4LMV A;  1SL1 B;  4OFT A;  8GSS A;  1MTC A;  4E8H A;  4RUV A;  2WJU A;  1ABA A;  2B6M A;  4JZQ A;  2KOK A;  4MF5 A;  1HD2 A;  1JFU A;  1TKD B;  1M3J A;  1PMT A;  1X5D A;  3K8N A;  4G0I A;  5EL8 A;  5D93 A;  3M1G A;  2L4Q A;  4O5U A;  3VWV A;  1DE2 A;  3CQF A;  3D4T A;  1FG4 A;  1BX9 A;  3BCK A;  4E8E A;  4G19 A;  3KH9 A;  4BPY A;  4YAP A;  3ZLP A;  3HZ4 A;  1XIY A;  4V2L A;  3TDG A;  6GSW A;  3DEX A;  2IL3 A;  3U5R E;  2DML A;  1SJ6 A;  2DJJ A;  4EL1 A;  2ZCT A;  3FRC A;  1ST9 A;  2B5E A;  2CT6 A;  4HJ2 A;  4GXZ A;  2AV4 A;  2LRC A;  4KDU A;  3GIX A;  1DE1 A;  1DUG A;  4ECB A;  2OBI A;  2A2P A;  4PUA A;  3DKS A;  5GAP D;  2P5R A;  3WT2 A;  4XS1 A;  1SJZ A;  19GS A;  1XWK A;  2H1D A;  1XOA A;  4AJ6 A;  3EWL A;  2G0F A;  2RM5 A;  1S3D A;  1M2D A;  3FKF A;  3KP9 A;  2VL3 A;  3OR5 A;  4DSR A;  5AIX A;  3DML A;  1QXH A;  2H6Y A;  2QSI A;  3D22 A;  2YWM A;  2IWT A;  3QFA C;  3P90 A;  1XWA A;  2BJX A;  3TKP A;  2BMX A;  4KDY A;  4OWY A;  3WYW A;  3MIX A;  2V32 A;  3GFK A;  1SL2 B;  1B48 A;  3NOF A;  1A2M A;  2OE3 A;  1T8E B;  2EC4 A;  3DYR A;  1EP7 A;  4V2N A;  4OMV A;  4I6X A;  3D6I A;  3WGE A;  3UAR A;  4OO5 A;  4WF5 A;  3RHC A;  1EEJ A;  4KCA A;  5DQY A;  3HD5 A;  1M7T A;  5HFK A;  3N9J A;  1B4P A;  5J4U A;  1XW5 A;  3TJK A;  4PGT A;  4KSO A;  1BED A;  2X64 A;  1A0R P;  2NPB A;  1OYJ A;  1AIU A;  1F3B A;  17GS A;  4JBB A;  1A8Y A;  4EF0 A;  2VLU A;  2ZNM A;  2GSQ A;  2R5G A;  5IOX A;  6GST A;  1B4Q A;  3Q18 A;  1ZOF A;  1RK4 A;  2VLV A;  3F63 A;  3ZRD A;  2B1K A;  3H93 A;  3KH7 A;  3CSH A;  4EDZ A;  2FHE A;  5EPF A;  4MPF A;  3L0H A;  5JWR B;  1H4O A;  2FWG A;  4NV5 A;  5ELA A;  3RBT A;  3CRU A;  3M9J A;  4N11 A;  2RM6 A;  4CY8 A;  4LLR A;  2DKH A;  4OO4 A;  3VPQ A;  2HFD A;  1X9M B;  2O85 A;  2VIM A;  2V6K A;  1EOH A;  2F51 A;  1A2L A;  1TI3 A;  2VM1 A;  5CRW A;  3DXB A;  2P0G A;  2VCV A;  2C8U A;  1H75 A;  2LQQ A;  5ECK B;  2DSA A;  5F07 A;  1PQN A;  2X8C A;  3IE3 A;  1O6J A;  2D2Z A;  1QQ2 A;  3ZTL A;  1OKT A;  4J2F A;  4F9Z A;  2HE3 A;  4HS1 A;  1EZK A;  2UZ8 A;  2HYX A;  4G0K A;  2H01 A;  5IPG A;  2YPM A;  5IPH A;  3WGX A;  4K0G A;  10GS A;  1YKA A;  5CP1 A;  1HNA A;  2H0H A;  1O85 A;  4TR1 B;  3LG6 A;  2O8V B;  3GHA A;  3L78 A;  2DIZ A;  1KNG A;  4I5Q A;  1BG5 A;  2GSR A;  4D73 A;  5HR3 A;  1N8J A;  3UAP A;  1LBK A;  2RII A;  4KA0 A;  1WOU A;  4K6X A;  3SWL A;  3EMX A;  2NVL A;  5D9X A;  2YWN A;  4MCU A;  5G1K A;  3KMN A;  3C1S A;  2L6C A;  2FY6 A;  1M99 A;  3IRA A;  1E6B A;  1YEP A;  4Z2T A;  3FR9 A;  1KBN A;  1ZMA A;  1HNB A;  4PNF A;  3F4S A;  1F3A A;  4BL7 B;  3ZVJ A;  1YEX A;  4DSS A;  2KHP A;  4EIQ A;  2VL9 A;  3D21 A;  3WGD A;  2YV7 A;  1G7E A;  2VCT A;  3FR3 A;  3QAG A;  1UVZ A;  2PWJ A;  4JR6 A;  1FO5 A;  4MJE A;  3KTB A;  5KOX A;  2H73 A;  4NAX A;  2C3Q A;  2FWH A;  3VPT A;  4KND A;  2MMZ A;  3ERG A;  3UVT A;  3TOU A;  5B7C A;  4QQ7 A;  2LKU A;  3LWA A;  3LFL A;  3QMX A;  4IGJ A;  5DAL A;  1AXD A;  3AY8 A;  1TXX A;  3F6F A;  2IJY A;  2HI7 A;  2JZR A;  3MYD A;  2IPA A;  5CNW A;  2VCW A;  18GS A;  1FOH A;  3UL3 A;  2JAD A;  2JU5 A;  2IMD A;  2HSY A;  2C3N A;  1SU9 A;  3VWU A;  1V2A A;  4PUF C;  2K18 A;  3KIJ A;  2EIQ A;  3BOA A;  3FZ4 A;  1QMV A;  1SYX A;  5H5R A;  4MAB A;  2V2G A;  1ZL9 A;  4IJI A;  3CXG A;  3VI5 A;  3KGK A;  2TRC P;  4RQR A;  3ISO A;  2AYT A;  4OFM A;  3EYT A;  2I3Y A;  3IHQ A;  5J3R A;  22GS A;  2CA8 A;  2HRA A;  3CSI A;  2L6D A;  1USB A;  2VAF A;  1VRS D;  4EE0 A;  2MMN A;  2XPD A;  2ZUP A;  2H1B A;  3CBU A;  4MA9 A;  1XW6 A;  3TUE A;  4ECJ A;  2JAC A;  1JZO A;  3VFI A;  1SJI A;  3HDC A;  3ZZX A;  4AJ7 A;  2LST A;  3L4N A;  2YZU A;  2OKA A;  4RI7 A;  1GSF A;  3GMF A;  1ERU A;  3J7Y b;  4PQ1 A;  4FO5 A;  2LJR A;  1S3A A;  3SBC A;  4ULX A;  4N30 A;  1YQ1 A;  5FWG A;  4MDC A;  1TRV A;  2J9H A;  4K5S A;  3ZML A;  1QFN A;  2LRN A;  4IJ3 A;  3ME8 A;  2FCH A;  3IHG A;  2FD3 A;  3UVH A;  2R0C A;  4ZB8 A;  4FQU A;  3F6D A;  1Z9H A;  5ID2 B;  1U6T A;  3I43 A;  3EVI A;  2FA4 A;  4YH2 A;  1T3B A;  4IBP A;  1SL0 B;  3VLN A;  3ZVJ D;  3WD6 A;  3PGT A;  4KX4 A;  5L71 A;  3IK7 A;  4MZB A;  4WKW A;  5ABR A;  5DCG A;  2VD0 A;  5B8B A;  4MZC A;  4BWQ A;  3LW9 A;  1YF1 A;  4ISD A;  2KUC A;  3MAK A;  4P3Y B;  4ZB6 A;  3GH6 A;  5LD0 A;  2L4C A;  1GL8 A;  3ERF A;  2PPT A;  5IO0 A;  2NBS A;  4FIW A;  4ZIJ A;  5HR2 A;  2WDU A;  2H19 A;  4TW5 A;  3L9V A;  1TJD A;  1GUK A;  4HI7 A;  4J57 E;  2XPE A;  2DLX A;  2JZS A;  4GQF A;  4ZL7 A;  2H6X A;  5GST A;  4ILF A;  5H5S A;  3QFB C;  3A2X A;  1XXU A;  3H79 A;  3R3E A;  4HQS A;  3P2A A;  2Z9S A;  1G6W A;  1S3C A;  5F06 A;  1ERV A;  4K7O A;  4YKG A;  2DMM A;  3ME7 A;  1GSY A;  2LQO A;  2FWE A;  1XZO A;  3TB2 A;  4K2D A;  3DD3 A;  3R2Q A;  4IP6 A;  5CO3 A;  3UJ1 A;  2X8G A;  5G5F A;  2OBK A;  4X1U A;  4EUY A;  3A3T A;  4F0C A;  3HKR A;  4AF2 A;  2PVQ A;  3RHB A;  2DJ0 A;  2I1U A;  2LEG A;  3IDV A;  1R5A A;  1EV4 A;  1X5C A;  2YJH A;  4LA1 A;  4BVX B;  1T00 A;  2M80 A;  5DVB A;  4F0B A;  2OE0 A;  3DWV A;  3EU4 A;  4TR0 A;  1MD3 A;  2GS3 A;  3H1N A;  4HQZ A;  4BVY B;  3I69 A;  5HQP A;  3J7Y k;  2R0G A;  2XBQ A;  5HFG A;  1B9Y C;  3IXR A;  3E9J B;  3F8U A;  3KJY A;  4BWS A;  3FY7 A;  1CQH A;  3DGQ A;  3GKX A;  2B3S A;  3GKM A;  1V58 A;  2C0F A;  1SKS B;  2HZE A;  2KLX A;  3APQ A;  4K7I A;  1EWX A;  4ZB9 A;  1YF0 A;  12GS A;  4TXV A;  2B1L A;  1FW1 A;  2GDR A;  5ECO B;  1RQM A;  2V1M A;  4WXT A;  4LL4 B;  4O7H A;  1B8X A;  3GRX A;  4GCI A;  1VF4 A;  4CDO A;  2H72 A;  3GV1 A;  4L0W A;  3E3E A;  5E4W A;  2C3T A;  3S9F A;  4YQV A;  2L5O A;  1VF2 A;  2GZZ A;  4GTU A;  2H0I A;  4HZ2 A;  5HR0 A;  4XIH A;  5A4W A;  3GTU A;  1X9W B;  1J9B A;  3HVN A;  3LEF A;  2YCD A; 
#chains in the Genus database with same CATH homology
 4POL A;  4O32 A;  2AJQ B;  4WR5 A;  1TRU A;  1GLP A;  4XS4 B;  3GL5 A;  3VI7 A;  1KTE A;  3KMO A;  4ML6 A;  4MJA A;  1SEN A;  1X0R A;  3FMW A;  5HR1 A;  4LL1 B;  1Y6E A;  4TXO A;  1F9M A;  1GUL A;  3HY2 A;  1PSQ A;  4WF4 A;  1QK8 A;  2KP2 A;  5IIZ A;  4WET A;  4MNN A;  3KEB A;  2CV4 A;  1IYI A;  1G7O A;  2H30 A;  1ZYQ B;  3WT1 A;  2PER A;  3CMI A;  4MF7 A;  1IYH A;  3TRQ A;  1LJR A;  3HXS A;  2MMA A;  1WPI A;  4GSS A;  2OAD A;  5J5N A;  4HJM A;  1UN2 A;  2V6O A;  2N5B A;  5IMZ A;  3A5I A;  1ILO A;  2YAN A;  1ZGN A;  2IME A;  5B8A A;  4NPB A;  4NMU A;  5COH A;  2NDO A;  2V41 A;  3ZIJ A;  4YQM A;  3IOS A;  1B9X C;  1OC9 B;  4PQH A;  2P5Q A;  2HLS A;  2WS2 A;  1O81 A;  1F2E A;  2DJK A;  1JZD A;  3C8E A;  2X4A A;  2CVK A;  5AIV A;  1M9B A;  1GSQ A;  5DAK B;  5IMV A;  1ERT A;  4TOP A;  1THO A;  2H70 A;  4HZ4 A;  1XVW A;  1K0B A;  1QGV A;  2C80 A;  2IFQ B;  3CRT A;  3H8Q A;  1EOG A;  2YP6 A;  2CAQ A;  4EKZ A;  5LCZ A;  1E2Y A;  1J08 A;  2LUS A;  4J56 E;  3W6G A;  3F3R A;  2PVO C;  4PTS A;  3A2V A;  3M3M A;  2ON5 A;  20GS A;  3RPP A;  1Q4J A;  3IK9 A;  4G2E A;  2E0Q A;  1K0C A;  4IVF A;  3ZL5 A;  2F9S A;  1XWG A;  1TI1 A;  3QPM A;  4NHZ A;  1TK8 B;  2I4A A;  3GUR A;  1WWJ A;  5H5Q A;  2CZ3 A;  3EE2 A;  3HCZ A;  1R7H A;  3GA4 A;  3F3Q A;  2MBT A;  4GLT A;  3TKQ A;  4WBJ A;  4MH3 A;  4AGS A;  4NWY A;  2A4V A;  4LMW A;  1EP8 A;  5ECM B;  2F8A A;  3W8J A;  1V40 A;  3V1W A;  2VLT A;  2VCX A;  5D9W A;  1K0M A;  1PN0 A;  2K9F A;  2R3X A;  3IA1 A;  1UA5 A;  4V1A g;  2ES7 A;  3FZA A;  3RDW A;  2HRK A;  3GUS A;  3O3T A;  4K0N A;  5ECP B;  4MP4 A;  2N5F A;  1Z6N A;  2QGV A;  3FHK A;  1GP1 A;  2E7P A;  2VCQ A;  2H6Z A;  3F4R A;  2L59 A;  3FW2 A;  3FYG A;  2A4H A;  3HJP A;  1MEK A;  5ECI B;  4ZBA A;  2WFC A;  1T7P B;  4ID0 A;  2RLI A;  2IMK A;  4HU9 A;  3LXT A;  1G0T A;  4I8B A;  3HVS A;  2XBI A;  2AHE A;  4I97 A;  1ZZY A;  2B5X A;  5CYY A;  2PMT A;  3TRP A;  4K5R A;  2R2J A;  3HVX A;  2YWI A;  3HYP A;  3TOT A;  4AJ8 A;  2VL2 C;  1OE7 A;  1GH2 A;  2LS5 A;  2YV9 A;  4YAV A;  3PPU A;  5DQS A;  1TDI A;  1O8X A;  3IC8 A;  3PIN A;  1QUW A;  4XCS A;  2QA1 A;  2WB9 A;  1ZYE A;  4QL9 A;  1GUH A;  3KXO A;  3LOR A;  3P7X A;  3TJF A;  2O87 A;  3TKS C;  3DRN A;  3H4K A;  2LJK A;  1G6Y A;  2DBC A;  3EPT A;  3HVV A;  2MBS A;  2WUL A;  3I9V 2;  4GSN A;  4EIP A;  1SD8 A;  13GS A;  4IN0 A;  3TJJ A;  1EV9 A;  4L8E A;  4TR4 A;  3APO A;  3ZFL A;  3TJB A;  5DDL A;  1NW2 A;  3GX0 A;  3G7I A;  1J0F A;  3QAW A;  3KD0 A;  1XW9 A;  3M0F A;  5IMA A;  3JCM L;  4GF0 A;  1GSU A;  3DIE A;  4TR1 A;  2HRF A;  1TU8 A;  3KTL A;  4ICY A;  1GSE A;  1OE8 A;  1URM A;  4ACS A;  4I2T A;  2EIO A;  2E2M A;  3E0U A;  5JCU A;  4K7N A;  4K9Z A;  1Y25 A;  2G2Q A;  4NV2 A;  4KE3 A;  6GSV A;  3MDK A;  5JCG A;  2CQ9 A;  3N5O A;  3TKR A;  5IO2 A;  1K0D A;  4IHU A;  3GSS A;  2AB6 A;  1V9W A;  3MNG A;  2WGR A;  4WR4 A;  5J41 A;  4ECC A;  4GWR A;  1PL2 A;  4HEA 2;  4BL7 A;  1ON4 A;  3G9B A;  4PXO A;  3TKS E;  2FUG 2;  2LV3 A;  2WZ9 A;  2C0E A;  1HYU A;  3ZYW A;  2L57 A;  1XOB A;  1K3L A;  1NHO A;  1SYR A;  1F37 A;  4GST A;  6GSY A;  3APS A;  4MZW A;  1T4Z A;  1VGL A;  2GST A;  4A5P A;  5ECH B;  1TK5 B;  4N10 A;  4RI6 A;  3TGZ A;  4F2I A;  5IQY A;  2HZF A;  5F05 A;  4L5L A;  4ZBB A;  3BCI A;  2IMI A;  5IM9 A;  3C7M A;  2GLR A;  6GSU A;  2PU9 C;  2IIY A;  1RW1 A;  4GQC A;  3GNJ A;  2B5Y A;  2YJ7 A;  3PH9 A;  5G31 A;  2FLS A;  4TRX A;  1TOF A;  3CTF A;  4KH7 A;  4POM A;  1VF3 A;  3GKN A;  1N2A A;  5KN3 A;  3QOU A;  3FEU A;  2HSM A;  3HJM A;  5B6N A;  1YDK A;  2CVD A;  1GTU A;  3UEM A;  2H1A A;  5IMF A;  1MDJ A;  5ENU A;  3FR6 A;  3VWX A;  1XWB A;  3L9S A;  1OKD A;  4X4J A;  2GT5 A;  2B7K A;  3GH9 A;  3UIW A;  3BBY A;  5CRD A;  5AIS A;  4CY6 A;  5CRH A;  2GGT A;  3VK9 A;  5DJL A;  1YZX A;  1WMJ A;  1TP9 A;  14GS A;  4HDE A;  4NHW A;  4Q5R A;  2OAC A;  2H8L A;  4FYB A;  4H86 A;  4TKY A;  4OD7 A;  3TCO A;  5C00 A;  1O73 A;  2L5L A;  1JZW A;  2DKI A;  2K8S A;  1PKZ A;  4Q5Q A;  2HT9 A;  3LJR A;  3G7J A;  4JU5 A;  4PUR A;  1A2J A;  2YZH A;  1WRY A;  3IBH A;  4MLY A;  3LQ7 A;  2C0D A;  5KN1 A;  3PR8 A;  4ECI A;  5D73 A;  5AN1 A;  3ZRE A;  3ED3 A;  5AGY A;  4PNG A;  4G0L A;  4KAE A;  4FYC A;  3IAS 2;  1MD4 A;  4XTS A;  1K0N A;  1Q98 A;  5A4V A;  2RUF A;  1SK0 A;  5ID2 A;  4TR3 A;  2FWF A;  2VL2 A;  3O76 A;  1TRW A;  2DC5 A;  1W89 A;  2F8F A;  2B7J A;  4Z7X A;  4JE1 A;  1OVN A;  3IAM 2;  3GN3 A;  3M8N A;  2X49 A;  4ZBD A;  4CW9 A;  1CQG A;  4PX1 A;  1AC1 A;  2CVB A;  2GSS A;  3ZIT A;  1A23 A;  5JCW A;  4K8M A;  3TKS A;  3FZ5 A;  1PKW A;  3O6T A;  4NXI A;  2VM2 A;  1GTA A;  1ZCP A;  4MK3 A;  1BQ7 A;  5G2Z A;  1EGO A;  1JLV A;  4IQA A;  2LTK A;  5GSS A;  1MDK A;  3I6A A;  4WBR D;  3IV4 A;  1FB6 A;  2FGX A;  2REM A;  2VUP A;  2I9H A;  1BJX A;  3D0Z A;  2GT6 A;  1SKW B;  1R5P A;  3ZMK A;  1HNC A;  1O8W A;  4FH8 A;  1TK0 B;  1YY7 A;  1I5G A;  3TRX A;  3HHV A;  2XC2 A;  3LSZ A;  4K2X A;  2QA2 A;  3CSJ A;  1U3I A;  4ZL9 A;  2VOC A;  1A0F A;  1FOV A;  5KEJ A;  3UBK A;  5G30 A;  4D73 B;  3C71 A;  2BTO T;  1Z7P A;  4X0X A;  1PL1 A;  2M46 A;  2I81 A;  1MDI A;  3GKK A;  1PD2 1;  2PBJ A;  1R4W A;  4EO3 A;  3KP8 A;  4IS0 A;  2GTU A;  4KB3 A;  1T1V A;  4MJB A;  3LGC A;  2QKE A;  5FHI A;  1FB0 A;  2O7K A;  1SKR B;  3HA9 A;  2NTO A;  2H0G A;  2VCZ A;  3EU3 A;  3IC4 A;  4BVX A;  2GZP A;  2CZ2 A;  2HNL A;  1THX A;  3C1R A;  3U6V A;  4DSS B;  1UC7 A;  3D4M A;  4JR4 A;  3UMA A;  4KDX A;  5DCH A;  3ERW A;  4BVY A;  4IEL A;  5DJM A;  1TU7 A;  4K1F A;  16GS A;  2A2R A;  5G5E A;  4MF6 A;  2O89 A;  2C0G A;  3P8W A;  1T4Y A;  4JED A;  4TVE A;  3HZ8 A;  4EXJ A;  5DAL B;  5J9C A;  1M2B A;  4I2U A;  5CRG A;  4XRD A;  4V1A p;  1JZR A;  1YJ6 A;  2JSZ A;  5F0G A;  4POK A;  1NHY A;  1A24 A;  3FZ9 A;  5BMU A;  5IMD A;  1PN9 A;  1AQW A;  9GSS A;  1M0U A;  1I9D A;  4USS A;  1EGR A;  3IR4 A;  4KSM A;  2YWO A;  4MJC A;  3A2W A;  1LU4 A;  3EIN A;  3GYK A;  2C1Y A;  4ZIL A;  1PA3 A;  1XPV A;  1GLQ A;  3QD9 A;  2VO4 A;  4F03 A;  1AUC A;  1PGT A;  3VUR A;  3BD2 A;  2LRT A;  1U3A A;  2N5A A;  5IOW A;  5CAX A;  4QL7 A;  1C72 A;  1K0A A;  1WE0 A;  1GTI A;  1M2A A;  4XS4 A;  2PUK C;  5D9V A;  2XHF A;  1U87 A;  2HXK A;  4FYU A;  3GL3 A;  5DBQ A;  3IPZ A;  5ELG A;  5IMC A;  4KUN A;  1WIK A;  3DVW A;  2DJ2 A;  1JLW A;  2H66 A;  1Z7R A;  5ECR B;  4CHS A;  1U88 A;  3UBL A;  4EVM A;  3Q74 A;  4OFN A;  5A5K A;  3EUR A;  5ECS A;  1W4V A;  4WEY A;  1FAA A;  1FHE A;  3VWW A;  5E59 A;  4O5Q A;  1XVQ A;  2JL4 A;  4HU7 A;  1SD9 A;  3ZFB A;  4PQI A;  1Z6M A;  1X9S B;  2VD1 A;  2R37 A;  4X43 A;  1V98 A;  3F0I A;  1A8L A;  2R4V A;  2PN8 A;  1EEM A;  1OC9 A;  2M72 A;  6GSS A;  3US3 A;  3KZQ A;  3HJO A;  3DVX A;  1ML6 A;  2EIR A;  1TRS A;  5JWQ B;  5KN0 A;  2GQL A;  1K3Y A;  1SK1 A;  1ERW A;  5ECN B;  4KGI A;  5DAK A;  1GSD A;  1GUM A;  1SK2 A;  5LNK e;  1ACV A;  1KEB A;  2DJ3 A;  3LYK A;  2IFQ A;  4MH2 A;  2IMF A;  3CYN A;  4MPG A;  2R6K A;  3W8S A;  1ZYN A;  4EDY A;  5CRE A;  4L0U A;  2H1G A;  4BA7 A;  3QDN A;  2H75 A;  2OJL A;  1GSS A;  4KF9 A;  3MWH A;  2FNO A;  4MMM A;  3Q19 A;  4XS6 A;  2IN3 A;  1PX6 A;  4O5R A;  5D96 A;  1WP0 A;  2F3M A;  1AW9 A;  2HSH A;  4HOJ A;  3UOM A;  4Z2R A;  4ML1 A;  1PX7 A;  2H76 A;  5B6M A;  1GNW A;  4Q5F A;  4XRA A;  2ON7 A;  5GZZ B;  1V57 A;  2TRX A;  4OCE A;  1FVK A;  3QCP A;  5EVO A;  5F8B A;  3NIV A;  4TN8 A;  4YKF A;  1VF1 A;  1AAZ A;  4DVC A;  4XHM A;  4RQX A;  4G9H A;  2MMO A;  2K6V A;  3F9U A;  2WRT A;  4YQU A;  5JWO B;  5KOW A;  2GZY A;  2MYG A;  1XCC A;  1XBS A;  3LXZ A;  4Z2U A;  4EC0 A;  2DIY A;  1BYE A;  4N0Z A;  3MSZ A;  1GRX A;  2LNT A;  3F4T A;  1TW9 A;  4IW9 A;  1FVJ A;  1O7U A;  2RUE A;  2YNX A;  2AUV A;  1HQO A;  7GSS A;  1BAY A;  2HZE B;  2ALB A;  1WJK A;  2YN1 A;  1X5E A;  3L9U A;  1OC3 A;  2WCI A;  4OCF A;  5G1L A;  3D5J A;  4ZXG A;  5A4U A;  5ECQ B;  2J23 A;  2GQK A;  4GRF A;  2A2S A;  1XWC A;  1PRX A;  2AAW A;  4IP1 A;  5D9T A;  2GVP A;  3RAZ A;  1NM3 A;  4G10 A;  3M9K A;  2CAI A;  1GWC A;  3A5W A;  1Z5Y E;  3FK8 A;  2C4J A;  3Q6O A;  1YKC A;  3TJG A;  6GSX A;  2MZC A;  4KCE A;  1XFL A;  5HFI A;  2GQM A;  2CX4 A;  5GAN D;  3G7Y A;  3GX8 A;  4JRR A;  1DSB A;  2TIR A;  5D8I A;  2X99 A;  1R26 A;  1AQX A;  1ZYP A;  3GTU B;  4IKH A;  4POB A;  2YOI A;  2CX3 A;  4L5O A;  2K8V A;  2PGT A;  2DJ1 A;  5FT3 A;  2OA7 A;  3GST A;  1NSW A;  3QAV A;  2JSY A;  2X8H A;  5KN2 A;  4KW6 A;  3RPN A;  4DSQ A;  1TTZ A;  3NZN A;  1Z3E A;  3EMP A;  4Q5N A;  3LYP A;  1K0O A;  4V2M A;  4TXO B;  2E2G A;  3CTG A;  1AQV A;  2FA8 A;  2QC7 A;  3QR6 A;  2LJA A;  5J9B A;  3C73 A;  4F82 A;  2H74 A;  1GNE A;  3ZIV A;  1M9A A;  2H71 A;  1OC8 A;  4ZL8 A;  4N0V A;  2OE1 A;  4O92 A;  3KCM A;  3BJ5 A;  5ECL B;  5INY A;  2LNS A;  4DEJ A;  1F6M C;  4HUA A;  4IQ1 A;  11GS A;  5EY6 A;  3EC3 A;  1DBY A;  1GTB A;  2KP1 A;  5C04 A;  1OAZ A;  3KM6 A;  1K3O A;  2JZT A;  2P31 A;  5BRT A;  2R0P A;  2HRN A;  1JHB A;  4LMV A;  1SL1 B;  4OFT A;  8GSS A;  1MTC A;  4E8H A;  4RUV A;  2WJU A;  1ABA A;  2B6M A;  4JZQ A;  2KOK A;  4MF5 A;  1HD2 A;  1JFU A;  1TKD B;  1PMT A;  1X5D A;  3K8N A;  4G0I A;  5EL8 A;  5D93 A;  3M1G A;  2L4Q A;  4O5U A;  3VWV A;  1DE2 A;  3D4T A;  1FG4 A;  1BX9 A;  3BCK A;  4E8E A;  4G19 A;  3KH9 A;  4BPY A;  4YAP A;  3ZLP A;  3HZ4 A;  1XIY A;  4V2L A;  3TDG A;  6GSW A;  3DEX A;  2IL3 A;  3U5R E;  2DML A;  1SJ6 A;  2DJJ A;  4EL1 A;  2ZCT A;  3FRC A;  1ST9 A;  2B5E A;  2CT6 A;  4HJ2 A;  4GXZ A;  2AV4 A;  2LRC A;  4KDU A;  3GIX A;  1DE1 A;  1DUG A;  4ECB A;  2OBI A;  2A2P A;  4PUA A;  3DKS A;  5GAP D;  2P5R A;  3WT2 A;  4XS1 A;  1SJZ A;  19GS A;  1XWK A;  2H1D A;  1XOA A;  4AJ6 A;  3EWL A;  2G0F A;  2RM5 A;  1S3D A;  1M2D A;  3FKF A;  3KP9 A;  2VL3 A;  3OR5 A;  4DSR A;  5AIX A;  3DML A;  1QXH A;  2H6Y A;  2QSI A;  3D22 A;  2YWM A;  2IWT A;  3QFA C;  3P90 A;  1XWA A;  2BJX A;  3TKP A;  2BMX A;  4KDY A;  4OWY A;  3WYW A;  3MIX A;  2V32 A;  3GFK A;  1SL2 B;  1B48 A;  3NOF A;  1A2M A;  2OE3 A;  1T8E B;  2EC4 A;  3DYR A;  1EP7 A;  4V2N A;  4OMV A;  4I6X A;  3D6I A;  3WGE A;  3UAR A;  4OO5 A;  4WF5 A;  3RHC A;  1EEJ A;  4KCA A;  5DQY A;  3HD5 A;  1M7T A;  5HFK A;  3N9J A;  1B4P A;  5J4U A;  1XW5 A;  3TJK A;  4PGT A;  4KSO A;  1BED A;  2X64 A;  1A0R P;  2NPB A;  1OYJ A;  1AIU A;  1F3B A;  17GS A;  4JBB A;  1A8Y A;  4EF0 A;  2VLU A;  2ZNM A;  2GSQ A;  2R5G A;  5IOX A;  6GST A;  1B4Q A;  3Q18 A;  1ZOF A;  1RK4 A;  2VLV A;  3F63 A;  3ZRD A;  2B1K A;  3H93 A;  3KH7 A;  3CSH A;  4EDZ A;  2FHE A;  5EPF A;  4MPF A;  3L0H A;  5JWR B;  1H4O A;  2FWG A;  4NV5 A;  5ELA A;  3RBT A;  3CRU A;  3M9J A;  4N11 A;  2RM6 A;  4CY8 A;  4LLR A;  2DKH A;  4OO4 A;  3VPQ A;  2HFD A;  1X9M B;  2O85 A;  2VIM A;  2V6K A;  1EOH A;  2F51 A;  1A2L A;  1TI3 A;  2VM1 A;  5CRW A;  3DXB A;  2P0G A;  2VCV A;  2C8U A;  1H75 A;  2LQQ A;  5ECK B;  2DSA A;  5F07 A;  1PQN A;  2X8C A;  3IE3 A;  1O6J A;  2D2Z A;  1QQ2 A;  3ZTL A;  1OKT A;  4J2F A;  4F9Z A;  2HE3 A;  4HS1 A;  1EZK A;  2UZ8 A;  2HYX A;  4G0K A;  2H01 A;  5IPG A;  2YPM A;  5IPH A;  3WGX A;  4K0G A;  10GS A;  1YKA A;  5CP1 A;  1HNA A;  2H0H A;  1O85 A;  4TR1 B;  3LG6 A;  2O8V B;  3GHA A;  3L78 A;  2DIZ A;  1KNG A;  4I5Q A;  1BG5 A;  2GSR A;  4D73 A;  5HR3 A;  1N8J A;  3UAP A;  1LBK A;  2RII A;  4KA0 A;  1WOU A;  4K6X A;  3SWL A;  3EMX A;  2NVL A;  5D9X A;  2YWN A;  4MCU A;  5G1K A;  3KMN A;  3C1S A;  2L6C A;  2FY6 A;  1M99 A;  3IRA A;  1E6B A;  1YEP A;  4Z2T A;  3FR9 A;  1KBN A;  1ZMA A;  1HNB A;  4PNF A;  3F4S A;  1F3A A;  4BL7 B;  3ZVJ A;  1YEX A;  4DSS A;  2KHP A;  4EIQ A;  2VL9 A;  3D21 A;  3WGD A;  2YV7 A;  1G7E A;  2VCT A;  3FR3 A;  3QAG A;  1UVZ A;  2PWJ A;  4JR6 A;  1FO5 A;  4MJE A;  3KTB A;  5KOX A;  2H73 A;  4NAX A;  2C3Q A;  2FWH A;  3VPT A;  4KND A;  2MMZ A;  3ERG A;  3UVT A;  3TOU A;  5B7C A;  4QQ7 A;  2LKU A;  3LWA A;  3LFL A;  3QMX A;  4IGJ A;  5DAL A;  1AXD A;  3AY8 A;  1TXX A;  3F6F A;  2IJY A;  2HI7 A;  2JZR A;  3MYD A;  2IPA A;  5CNW A;  2VCW A;  18GS A;  1FOH A;  3UL3 A;  2JAD A;  2JU5 A;  2IMD A;  2HSY A;  2C3N A;  1SU9 A;  3VWU A;  1V2A A;  4PUF C;  2K18 A;  3KIJ A;  2EIQ A;  3BOA A;  3FZ4 A;  1QMV A;  1SYX A;  5H5R A;  4MAB A;  2V2G A;  1ZL9 A;  4IJI A;  3CXG A;  3VI5 A;  3KGK A;  2TRC P;  4RQR A;  3ISO A;  2AYT A;  4OFM A;  3EYT A;  2I3Y A;  3IHQ A;  5J3R A;  22GS A;  2CA8 A;  2HRA A;  3CSI A;  2L6D A;  1USB A;  2VAF A;  1VRS D;  4EE0 A;  2MMN A;  2XPD A;  2ZUP A;  2H1B A;  3CBU A;  4MA9 A;  1XW6 A;  3TUE A;  4ECJ A;  2JAC A;  1JZO A;  3VFI A;  1SJI A;  3HDC A;  3ZZX A;  4AJ7 A;  2LST A;  3L4N A;  2YZU A;  2OKA A;  4RI7 A;  1GSF A;  3GMF A;  1ERU A;  3J7Y b;  4PQ1 A;  4FO5 A;  2LJR A;  1S3A A;  3SBC A;  4ULX A;  4N30 A;  1YQ1 A;  5FWG A;  4MDC A;  1TRV A;  2J9H A;  4K5S A;  3ZML A;  1QFN A;  2LRN A;  4IJ3 A;  3ME8 A;  2FCH A;  3IHG A;  2FD3 A;  3UVH A;  2R0C A;  4ZB8 A;  4FQU A;  3F6D A;  1Z9H A;  5ID2 B;  1U6T A;  3I43 A;  3EVI A;  2FA4 A;  4YH2 A;  1T3B A;  4IBP A;  1SL0 B;  3VLN A;  3ZVJ D;  3WD6 A;  3PGT A;  4KX4 A;  5L71 A;  3IK7 A;  4MZB A;  4WKW A;  5ABR A;  5DCG A;  2VD0 A;  5B8B A;  4MZC A;  4BWQ A;  3LW9 A;  1YF1 A;  4ISD A;  2KUC A;  3MAK A;  4P3Y B;  4ZB6 A;  3GH6 A;  5LD0 A;  2L4C A;  1GL8 A;  3ERF A;  2PPT A;  5IO0 A;  2NBS A;  4FIW A;  4ZIJ A;  5HR2 A;  2WDU A;  2H19 A;  4TW5 A;  3L9V A;  1TJD A;  1GUK A;  4HI7 A;  4J57 E;  2XPE A;  2DLX A;  2JZS A;  4GQF A;  4ZL7 A;  2H6X A;  5GST A;  4ILF A;  5H5S A;  3QFB C;  3A2X A;  1XXU A;  3H79 A;  3R3E A;  4HQS A;  3P2A A;  2Z9S A;  1G6W A;  1S3C A;  5F06 A;  1ERV A;  4K7O A;  4YKG A;  2DMM A;  3ME7 A;  1GSY A;  2LQO A;  2FWE A;  1XZO A;  3TB2 A;  4K2D A;  3DD3 A;  3R2Q A;  4IP6 A;  5CO3 A;  3UJ1 A;  2X8G A;  5G5F A;  2OBK A;  4X1U A;  4EUY A;  3A3T A;  4F0C A;  3HKR A;  4AF2 A;  2PVQ A;  3RHB A;  2DJ0 A;  2I1U A;  2LEG A;  3IDV A;  1R5A A;  1EV4 A;  1X5C A;  2YJH A;  4LA1 A;  4BVX B;  1T00 A;  2M80 A;  5DVB A;  4F0B A;  2OE0 A;  3DWV A;  3EU4 A;  4TR0 A;  1MD3 A;  2GS3 A;  3H1N A;  4HQZ A;  4BVY B;  3I69 A;  5HQP A;  3J7Y k;  2R0G A;  2XBQ A;  5HFG A;  1B9Y C;  3IXR A;  3E9J B;  3F8U A;  3KJY A;  4BWS A;  3FY7 A;  1CQH A;  3DGQ A;  3GKX A;  2B3S A;  3GKM A;  1V58 A;  2C0F A;  1SKS B;  2HZE A;  2KLX A;  3APQ A;  4K7I A;  1EWX A;  4ZB9 A;  1YF0 A;  12GS A;  4TXV A;  2B1L A;  1FW1 A;  2GDR A;  5ECO B;  1RQM A;  2V1M A;  4WXT A;  4LL4 B;  4O7H A;  1B8X A;  3GRX A;  4GCI A;  1VF4 A;  4CDO A;  2H72 A;  3GV1 A;  4L0W A;  3E3E A;  5E4W A;  2C3T A;  3S9F A;  4YQV A;  2L5O A;  1VF2 A;  2GZZ A;  4GTU A;  2H0I A;  4HZ2 A;  5HR0 A;  4XIH A;  5A4W A;  3GTU A;  1X9W B;  1J9B A;  3LEF A;  2YCD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...