2E2GA

Crystal structure of archaeal peroxiredoxin, thioredoxin peroxidase from aeropyrum pernix k1 (pre-oxidation form)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
242
structure length
238
Chain Sequence
SIPLIGERFPEMEVTTDHGVIKLPDHYVSQGKWFVLFSHPADFTPVCTTEFVSFARRYEDFQRLGVDLIGLSVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLATHTVRGVFIVDARGVIRTMLYYPMELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEIIGEGLIVPPPTTEDQARARMESGQYRSLDWWFCWDTPASRDDVEEARRYLRRAAEKPAKLLYEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Probable peroxiredoxin
publication title Oxidation of archaeal peroxiredoxin involves a hypervalent sulfur intermediate
pubmed doi rcsb
source organism Aeropyrum pernix
total genus 76
structure length 238
sequence length 242
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1020.20 Alpha Beta 2-Layer Sandwich Antioxidant, Horf6; Chain A, domain 2 Antioxidant, Horf6; Chain A, domain 2 2e2gA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2e2gA01
1HD2A 1AW9A 3TKRA 3HZ8A 1M2BA 2LSTA 1XZOA 2RUFA 2DC5A 2A4VA 3L9VA 2LV3A 2O87A 4MK3A 4WBJA 5ABRA 4TN8A 1QXHA 4HS1A 1ERTA 2LS5A 4V2LA 1W89A 4BVYA 2FA8A 1K0OA 3C7MA 3L9SA 1NHOA 2DJ0A 4AJ8A 2PWJA 4IQAA 3IK7A 5A4WA 4NV2A 4MLYA 1G0TA 1M2DA 1O81A 3DVWA 3S9FA 1EEMA 3HYPA 3ISOA 4ULXA 4NXIA 5INYA 3ZMLA 2ZCTA 3CSHA 1GNWA 3RPPA 4BA7A 1GSFA 1J0FA 5HFKA 1TOFA 4YQUA 2IL3A 2OE1A 3J7Yb 12GSA 2RM5A 5HFGA 2E7PA 4FIWA 3ZITA 1OKDA 1ON4A 1F9MA 2NDOA 3KCMA 1K3LA 4MZWA 4ECBA 5CRWA 2X64A 1X9SB 3BBYA 1MD4A 2IMKA 5COHA 3QAWA 1A0RP 4GF0A 6GSYA 1XFLA 4RUVA 4BVXA 1GNEA 3ZIJA 5DQSA 3LQ7A 2OBIA 4AF2A 3VK9A 2KOKA 3F3RA 4XRAA 3EMXA 4ECJA 3EMPA 1WOUA 4IJ3A 5A4VA 4YQMA 2VO4A 3CYNA 1YEXA 2GSSA 2PU9C 1JZWA 3GIXA 3FRCA 3IR4A 1R5PA 3ZRDA 2MMOA 11GSA 3RHCA 6GSSA 4DEJA 5G2ZA 1MDJA 2NBSA 1FW1A 2X8GA 3RPNA 1GTUA 1Y6EA 1SKWB 3KMNA 1RW1A 1VF3A 2HSHA 1VF4A 2VCWA 2YN1A 5D9WA 2YV9A 3ZVJA 4MF5A 4GTUA 5KN0A 2WZ9A 2QSIA 4IJIA 3LSZA 1VGLA 1F3AA 2VD1A 2AJQB 3MAKA 5GSTA 3GNJA 3FZ4A 5ECMB 2B7JA 2CZ3A 3M0FA 4KW6A 1QK8A 3N9JA 4KSMA 1WP0A 1NM3A 2YZUA 4JU5A 4EO3A 5LNKe 1A23A 2NTOA 2VLTA 2GVPA 2MMAA 4V2NA 3EURA 5JWRB 1Z7RA 3E0UA 2LKUA 3FW2A 3DEXA 4MF7A 1HNCA 1EV9A 4KCEA 3FK8A 4JE1A 4NV5A 3HXSA 2G0FA 3FYGA 19GSA 1WIKA 4MP4A 2VUPA 2WFCA 2IJYA 2CQ9A 2H1GA 4K6XA 5HFIA 1SU9A 4IVFA 1ZZYA 2BJXA 1TK5B 3FKFA 2HSYA 5IPGA 1CQHA 1PD21 2H8LA 3FY7A 4BL7A 1T1VA 3HY2A 5D8IA 5JCUA 4IP1A 2H6XA 1XW9A 1Z6NA 1K0NA 5HR0A 2JSZA 2CVDA 4PNGA 4POKA 2A2SA 4N11A 3LGCA 2RIIA 5ID2B 3ERFA 2MMZA 14GSA 3V1WA 4XCSA 3A2VA 2H6YA 4OFMA 3M1GA 4ZIJA 4FYCA 4QL9A 3GX0A 3GHAA 5F07A 3HJMA 18GSA 3N5OA 2FNOA 4QL7A 2O89A 2M72A 1BEDA 4IP6A 2YCDA 4CW9A 4AJ7A 2LUSA 1PRXA 4KA0A 2YP6A 2JZSA 2REMA 1GLPA 5EY6A 2AHEA 5ELGA 4MH2A 1NSWA 3JCML 5IO2A 4O7HA 2VM2A 1XWCA 1FB0A 3Q19A 5JCGA 2AAWA 1JLVA 1TP9A 3CXGA 4DSSA 2WS2A 1THOA 1K0MA 2DIYA 2GSQA 2FWFA 3VWWA 3C71A 3O76A 3ZFBA 1X5EA 3QFBC 1ILOA 4I6XA 5F8BA 5D9VA 3CMIA 2C8UA 3CRTA 1EWXA 5GAPD 3HJPA 2K18A 1T4YA 4TXOA 5EPFA 5B8BA 1OKTA 2M46A 2HRFA 2B5YA 2K8VA 2P0GA 9GSSA 3HVVA 2EIOA 3KJYA 2IPAA 4KUNA 4XIHA 1XWAA 3VURA 4D73B 1MDIA 1HQOA 1PL2A 5IMCA 4WR5A 2VL3A 3FR9A 4NHWA 2GS3A 1U88A 2L4CA 1GLQA 1O85A 3E9JB 4YQVA 5G31A 1F2EA 2H74A 3H4KA 2VIMA 5IOWA 1OE7A 2C0DA 1PX7A 2YZHA 1GSYA 1JZOA 1DE1A 4ECCA 4IW9A 1EOHA 2FWEA 4WKWA 1XWBA 5IMDA 2PVQA 1WE0A 5G5EA 1SD8A 2IIYA 4KB3A 2EIRA 4MJAA 3C1SA 2PUKC 5ECRB 1K0BA 2MZCA 2R3XA 4XHMA 2IMIA 3R2QA 3AY8A 2CA8A 5DQYA 3GKXA 4IQ1A 3KEBA 1X9WB 1PSQA 1MD3A 3PINA 4K0GA 4PQIA 4HQSA 5KN2A 2N5AA 4TOPA 5J9BA 1THXA 3EYTA 2OE0A 4ML1A 4YH2A 1JZRA 3CBUA 5J3RA 2A2RA 2HT9A 1TRUA 2G2QA 2L57A 3H79A 1K0CA 1HNBA 2ALBA 3F6FA 1ERVA 3EE2A 2QGVA 6GSVA 2YWIA 4GRFA 1XCCA 1OE8A 5AISA 2GDRA 4IS0A 3RHBA 1WPIA 3QCPA 4KNDA 1TRVA 1BAYA 2TRCP 4G10A 2H75A 2VM1A 3WGDA 2XPDA 1GTAA 3GH6A 3LORA 3BJ5A 1J08A 1V2AA 3KH9A 5A4UA 4I2UA 4ZL8A 4IBPA 5D93A 2YJ7A 3QDNA 2FLSA 1UA5A 4V1Ag 3TRQA 3VWXA 2B5EA 6GSXA 1U87A 4DSSB 2FCHA 5F0GA 3E3EA 4RQRA 3LYPA 4KGIA 1M99A 1PL1A 4NMUA 1ZGNA 5A5KA 2P5RA 2F51A 2LTKA 1GUMA 1X5CA 4V2MA 4DSQA 2H70A 5H5QA 1GRXA 5ECHB 3ZZXA 3TJFA 4XRDA 5L71A 2I4AA 2OKAA 4TXOB 3UBLA 1AXDA 2F8FA 4X1UA 1M0UA 3QR6A 2KP1A 3GN3A 4EF0A 4OFTA 2PVOC 4L5OA 1S3DA 4MZCA 3I43A 1FO5A 1V40A 4ILFA 2K8SA 1QFNA 3IHQA 4GLTA 2I81A 4Q5NA 3ZIVA 2HRNA 1B8XA 3TJJA 1T7PB 4PGTA 1S3CA 3IA1A 2V41A 4PXOA 1V58A 2WB9A 3UEMA 4Z7XA 1F37A 1ZYEA 2GZZA 2HZFA 2GQLA 4F9ZA 3QAVA 2MBSA 1XVWA 2PPTA 4MABA 1GSQA 1PGTA 2ES7A 4O5RA 1Y25A 3M9JA 3MSZA 2B6MA 1TXXA 3APQA 3ZLPA 4V1Ap 1OC9A 5ID2A 3F4SA 5CO3A 13GSA 1AC1A 2VL2C 1G7EA 5ECPB 5CRDA 1GUHA 3F4TA 3TOUA 2OACA 2J23A 2X8HA 2RLIA 3F63A 5GZZB 1E2YA 2B5XA 1X9MB 3QD9A 1WWJA 1FVJA 3FZ5A 5CP1A 4KDUA 2DLXA 5C00A 1GSEA 4IGJA 1SYRA 3IXRA 4OO4A 1PMTA 1EEJA 2AUVA 2CAIA 4NPBA 2VCXA 4X0XA 4WR4A 1LU4A 1LBKA 3HKRA 2L59A 1YQ1A 3C73A 3LYKA 3A3TA 1TU7A 1B48A 4EKZA 3US3A 3GTUA 6GSUA 4PQHA 3KTLA 2WGRA 4MPGA 4PUAA 3FHKA 3GSTA 5H5RA 4L5LA 1YZXA 2L4QA 1PX6A 1XIYA 4Q5QA 2E2GA 1SL1B 2GQKA 1YY7A 1SJ6A 1A8LA 1O6JA 3TKPA 2R37A 2DMMA 4HU9A 3MDKA 4F82A 1NHYA 2HI7A 3M8NA 1ML6A 4D73A 2H76A 5ECOB 4IHUA 3DYRA 1F6MC 1I5GA 4TW5A 2EC4A 5AGYA 3P7XA 2F3MA 3IAM2 2C80A 4L0WA 4O32A 3F0IA 5AN1A 1FG4A 2LQOA 4K2DA 3ZYWA 2C1YA 2IFQB 4XS6A 2GT6A 3UAPA 1MEKA 2F9SA 4N0ZA 3PR8A 2VLVA 3BOAA 4HI7A 4JZQA 4DVCA 2XC2A 4ZB6A 2H30A 3FEUA 4QQ7A 3TCOA 1XXUA 5KN3A 4TKYA 4YAVA 4K7NA 4GSSA 4NHZA 3DKSA 4LA1A 4ZL9A 3SWLA 7GSSA 3EWLA 4ML6A 4N30A 3HZ4A 3LXZA 5C04A 3C8EA 2R2JA 1DUGA 4KAEA 3O6TA 1A0FA 4L8EA 4J2FA 1O8XA 1FB6A 2V2GA 5ECNB 1DE2A 2NVLA 4X43A 1GP1A 4PUFC 3WD6A 2LNSA 1OC9B 1C72A 5ECSA 1RQMA 3TKSC 1YKCA 3KGKA 3BD2A 1Q4JA 4GQCA 5IMZA 1XWGA 4GXZA 4JR4A 1X0RA 1GWCA 2O7KA 4K8MA 3KH7A 4PQ1A 2CX3A 2FWHA 1GTBA 5G30A 2TIRA 4ACSA 4N0VA 2FY6A 1DBYA 4HUAA 1AAZA 4XS1A 2GT5A 1T00A 4POBA 3P8WA 2N5FA 1BQ7A 1ACVA 3IPZA 5JWOB 3DD3A 1XPVA 1TI1A 2IWTA 5E4WA 2C0GA 3GTUB 1KBNA 2H0IA 4WETA 3NIVA 3GRXA 1TKDB 1V98A 1TDIA 4OWYA 1ZYQB 3DWVA 3GURA 3LEFA 5J5NA 1OAZA 3G7YA 1QMVA 5DCGA 3APOA 1RK4A 2J9HA 2KP2A 2YANA 2H1AA 5IIZA 3M3MA 3GH9A 2FUG2 2L5LA 3HA9A 4ZL7A 2VCVA 2R5GA 1YDKA 1V57A 4RQXA 1K3OA 2KLXA 4IELA 5EL8A 5IMFA 1SKRB 2VOCA 3IDVA 4TVEA 3D4TA 3TJKA 5FHIA 5LD0A 1WJKA 4K7OA 3UOMA 2CZ2A 1A2JA 3IC4A 3HVXA 3A2WA 1B4QA 2AV4A 3ZFLA 4EE0A 5J9CA 4WEYA 4EDZA 4H86A 4I5QA 1GSDA 1YEPA 3HD5A 3O3TA 1Z6MA 2YV7A 4F0BA 5DAKB 1X5DA 1B9YC 5ENUA 3PGTA 3CSJA 1H4OA 1FOVA 4F2IA 2XPEA 5D9XA 2OBKA 1PKWA 2B1LA 4PURA 1BX9A 4TR1A 5DDLA 4PX1A 2O85A 4J56E 3H8QA 4OFNA 1Z5YE 2JZTA 4HOJA 2VL2A 3MWHA 2PGTA 4TRXA 1AQVA 5DALB 4PNFA 2R6KA 3ZTLA 1H75A 2FWGA 4HDEA 3UVHA 3ME7A 3OR5A 2ZUPA 5AIXA 3P2AA 2H0GA 5GSSA 1NW2A 1AQWA 4LL4B 1XBSA 3A5WA 1GUKA 2ON7A 2YWOA 3QOUA 4EL1A 2GGTA 1IYIA 2LJRA 3ZMKA 1CQGA 4J57E 4OCFA 2H1DA 5G5FA 2WRTA 2CV4A 4KCAA 3IK9A 3KP9A 4BWQA 3IV4A 1ST9A 2VL9A 5HQPA 4IKHA 2LJKA 4RI6A 4LMWA 1XW5A 3D6IA 2JU5A 2JZRA 1HNAA 4KSOA 3SBCA 3GYKA 1TW9A 3GMFA 3TRXA 3U5RE 2H72A 3ZVJD 4AGSA 2VCQA 3HDCA 2E2MA 2DJ2A 3DRNA 3HHVA 5LCZA 3TJGA 4F03A 1URMA 3G9BA 2HXKA 1OC3A 4WXTA 3FR3A 1FHEA 2WULA 1USBA 2M80A 2OJLA 3TDGA 4E8EA 4ISDA 4GWRA 1M9AA 3GL3A 5KEJA 1V9WA 2HZEA 4LMVA 3L78A 5J41A 1VF2A 3HVSA 3PH9A 1PA3A 3KXOA 3QFAC 2B3SA 6GSWA 5J4UA 1JHBA 5B6MA 3ZREA 1R4WA 3DMLA 2YWNA 3U6VA 3M9KA 3MNGA 2DJKA 3GKKA 5IMVA 4KH7A 5CNWA 5ELAA 2IFQA 3DGQA 4KDXA 3ED3A 1T3BA 3GUSA 3KP8A 3NOFA 4LLRA 2IN3A 4MA9A 4FO5A 2V6KA 3DXBA 4OCEA 1YKAA 3F4RA 1EV4A 1SJIA 2H71A 5IQYA 1GL8A 3GV1A 2KHPA 1KNGA 2EIQA 1W4VA 2YNXA 4KE3A 2BMXA 3TRPA 4O92A 2VLUA 5CREA 2QC7A 3D22A 3P90A 3UMAA 5ECIB 4KX4A 4TR1B 1JLWA 3D0ZA 4Q5RA 3WT1A 3TKSA 2PMTA 2AB6A 4ZBAA 5CRGA 3LFLA 4XTSA 1EGRA 1OYJA 2B7KA 2JACA 2H01A 1Z9HA 1PQNA 3VWVA 1R5AA 2C3QA 4WBRD 4MPFA 1ZCPA 4E8HA 4KDYA 1ABAA 2LEGA 2QKEA 1Z3EA 5DVBA 1GULA 3IBHA 5GAND 4G2EA 3EU4A 1N2AA 2DIZA 1Z7PA 1M7TA 4JBBA 3GL5A 4BWSA 3LWAA 1EZKA 2L6DA 3H1NA 5ECLB 3IAS2 5IO0A 1SYXA 5ECQB 1R7HA 2X8CA 3EC3A 1A24A 2XBQA 3LXTA 4HZ2A 3Q74A 1J9BA 2E0QA 1VF1A 3VI5A 8GSSA 4XS4A 1MTCA 2H6ZA 4EDYA 2H19A 2DJ1A 3VWUA 3FR6A 1TJDA 1B4PA 2FA4A 1Q98A 1SL0B 5IOXA 3D21A 5IM9A 1GH2A 2R4VA 2C0FA 2GSRA 2B1KA 4NWYA 1S3AA 3IE3A 3UVTA 2VCZA 2C3NA 4EC0A 3ERGA 1TRWA 2HE3A 2HLSA 5F06A 5FT3A 2X99A 2MBTA 4WF5A 1XOBA 3BCKA 3RBTA 1I9DA 3H93A 3IRAA 1SK0A 5JWQB 2NPBA 3LJRA 2V1MA 5H5SA 1FVKA 1TK8B 22GSA 2HZEB 20GSA 1WMJA 5JCWA 5B8AA 6GSTA 4MMMA 2YJHA 3F3QA 2RM6A 2RUEA 3KIJA 3VFIA 3QPMA 2GLRA 2ON5A 1UVZA 1ERUA 1FAAA 3VPTA 1EGOA 2HNLA 4OO5A 4GCIA 5DAKA 2DJJA 5EVOA 3F8UA 2BTOT 3DVXA 1JZDA 2CVBA 1MDKA 4F0CA 3K8NA 2IMEA 4RI7A 4JRRA 2GSTA 4JEDA 2GQMA 5D9TA 3WGEA 4HQZA 2YWMA 2F8AA 3TKSE 2JL4A 2H66A 3KTBA 3W6GA 3EINA 2KUCA 4DSRA 1IYHA 4FH8A 5DALA 2H73A 4MJEA 5DBQA 2VCTA 3TUEA 4BPYA 4OD7A 1G7OA 3ERWA 2VAFA 3GFKA 1QQ2A 4OMVA 2O8VB 2CX4A 5G1KA 3J7Yk 2PBJA 1UN2A 3G7IA 4ZB8A 3VI7A 2HYXA 2CVKA 3VPQA 4MH3A 1TK0B 4TXVA 4IN0A 2ZNMA 1QGVA 5CYYA 2GZPA 5FWGA 4GSNA 5CRHA 4K1FA 3D4MA 3L0HA 2P31A 3NZNA 1LJRA 4GSTA 1EP7A 2FGXA 17GSA 3GKMA 2K6VA 3GSSA 3UIWA 2MYGA 4XS4B 3BCIA 4CHSA 3TGZA 3I9V2 1T4ZA 1GTIA 1PN9A 1E6BA 1G6YA 1ZOFA 1YF0A 2YPMA 4YAPA 3EVIA 2CAQA 4I2TA 3QMXA 4MDCA 3UL3A 2L5OA 4TR3A 2LRNA 3APSA 1BJXA 1O7UA 1ERWA 1R26A 2N5BA 3GKNA 2DBCA 4FYBA 4ZB9A 1O73A 2D2ZA 3W8JA 1N8JA 3L9UA 3HJOA 4I8BA 2H0HA 4K7IA 1SKSB 3F6DA 1G6WA 1EP8A 2V6OA 2TRXA 3UARA 2DMLA 2LJAA 3WYWA 2DSAA 1TTZA 1GSUA 2GZYA 1UC7A 2FHEA 2CT6A 4EVMA 2I3YA 4K9ZA 2PN8A 1BYEA 3TB2A 2LNTA 2MMNA 1K3YA 3L4NA 4N10A 5HR3A 1YJ6A 4MCUA 3GX8A 3KMOA 1T8EB 1AQXA 3ZL5A 2GTUA 3TOTA 3UJ1A 10GSA 5KN1A 3CTFA 4FYUA 2L6CA 1OVNA 3LG6A 1K0DA 5DCHA 1VRSD 3CTGA 2VD0A 3RDWA 3DIEA 1XOAA 2C4JA 1AIUA 5B7CA 4Q5FA 4TR0A 3FZ9A 4HU7A 1U3AA 5D96A 4ZXGA 1YF1A 2LRTA 1U6TA 1F3BA 1XVQA 1SENA 3W8SA 5IMAA 4K0NA 2OADA 4POLA 1K0AA 2IMDA 4TR4A 2C0EA 2C3TA 5HR1A 3VLNA 4HZ4A 3HCZA 1DSBA 2K9FA 5CAXA 1BG5A 3TJBA 1TRSA 1QUWA 1KEBA 2I1UA 3Q18A 4MZBA 4MF6A 1JFUA 3GA4A 2P5QA 4WF4A 1SL2B 2DJ3A 3C1RA 2HFDA 2FD3A 2OA7A 3I6AA 5D73A 3D5JA 5DJLA 1M2AA 1SD9A 4NAXA 1PKZA 1SK2A 4POMA 4P3YB 5HR2A 5IPHA 3KM6A 3ME8A 3KD0A 4G19A 4I97A 1TU8A 2XHFA 1ZL9A 2YOIA 4JR6A 4ECIA 1M9BA 4EUYA 1WRYA 2OE3A 2IMFA 3KZQA 3WGXA 4G9HA 4EXJA 5G1LA 4MJCA 2AYTA 4ZBBA 2JADA 2XBIA 2PERA 1OC8A 4ZILA 5E59A 2LQQA 3CRUA 4HJMA 5AIVA 5B6NA 1AUCA 2WDUA 16GSA 4L0UA 1EOGA 2V32A 2I9HA 3WT2A 4ZBDA 2Z9SA 1O8WA 3G7JA 2JSYA 3F9UA 1XWKA 3UBKA 2LRCA 1ZMAA 5F05A 4HJ2A 3A2XA 2WCIA 5DJMA 4MJBA 3TKQA 1SJZA 4GQFA 3EU3A 1KTEA 3IOSA 1HYUA 3RAZA 4AJ6A 1B9XC 4LL1B 5ECKB 1TI3A 4CDOA 1A8YA 2WJUA 3CSIA 4HEA2 1A2LA 3FZAA 1GSSA 3I69A 1XW6A 3QAGA 1SK1A 1U3IA 3Q6OA 2H1BA 1A2MA 4ID0A
chains in the Genus database with same CATH superfamily
1HD2A 1AW9A 3TKRA 3HZ8A 1M2BA 2LSTA 1XZOA 2RUFA 2DC5A 2A4VA 3L9VA 2LV3A 2O87A 4MK3A 4WBJA 5ABRA 4TN8A 1QXHA 4HS1A 1ERTA 2LS5A 4V2LA 1W89A 4BVYA 2FA8A 1K0OA 3C7MA 3L9SA 1NHOA 2DJ0A 4AJ8A 2PWJA 4IQAA 3IK7A 5A4WA 4NV2A 4MLYA 1G0TA 1M2DA 1O81A 3DVWA 3S9FA 1EEMA 3HYPA 3ISOA 4ULXA 4NXIA 5INYA 3ZMLA 2ZCTA 3CSHA 1GNWA 3RPPA 4BA7A 1GSFA 1J0FA 5HFKA 1TOFA 4YQUA 2IL3A 2OE1A 3J7Yb 12GSA 2RM5A 5HFGA 2E7PA 4FIWA 3ZITA 1OKDA 1ON4A 1F9MA 2X49A 2NDOA 2X4AA 3KCMA 1K3LA 4MZWA 4ECBA 5CRWA 2X64A 1X9SB 3BBYA 1MD4A 3LW9A 2IMKA 5COHA 3QAWA 1A0RP 4GF0A 6GSYA 1XFLA 4RUVA 4BVXA 1GNEA 3ZIJA 5DQSA 3LQ7A 2OBIA 4AF2A 3VK9A 2KOKA 3EPTA 3F3RA 4XRAA 2UZ8A 3EMXA 4ECJA 3EMPA 1WOUA 4IJ3A 5A4VA 4YQMA 2VO4A 3CYNA 1YEXA 2GSSA 4Z2RA 2PU9C 1JZWA 3GIXA 3FRCA 3IR4A 1R5PA 3ZRDA 2MMOA 11GSA 3RHCA 6GSSA 4DEJA 5G2ZA 1MDJA 2NBSA 1FW1A 2X8GA 3RPNA 1GTUA 1Y6EA 1SKWB 3KMNA 1RW1A 1VF3A 2HSHA 1VF4A 2VCWA 2YN1A 5D9WA 2YV9A 3ZVJA 4MF5A 4GTUA 5KN0A 2WZ9A 2QSIA 4IJIA 3LSZA 1S3RA 1VGLA 1F3AA 2VD1A 2AJQB 3MAKA 4K2XA 5GSTA 3GNJA 3FZ4A 5ECMB 2B7JA 2CZ3A 3M0FA 4KW6A 3R3EA 1QK8A 3N9JA 4KSMA 1WP0A 1NM3A 2YZUA 1ZYPA 4JU5A 4EO3A 5LNKe 1A23A 2NTOA 2VLTA 2GVPA 2MMAA 4V2NA 3EURA 5JWRB 1Z7RA 3E0UA 2LKUA 3FW2A 3DEXA 4MF7A 1HNCA 1EV9A 4KCEA 3FK8A 4JE1A 4NV5A 3HXSA 2G0FA 3FYGA 19GSA 1XG8A 1WIKA 4MP4A 2VUPA 2WFCA 2IJYA 2CQ9A 2H1GA 4K6XA 5HFIA 1SU9A 4IVFA 1ZZYA 2BJXA 1TK5B 3FKFA 2HSYA 5IPGA 1CQHA 1PD21 2H8LA 3FY7A 4BL7A 1T1VA 3HY2A 5D8IA 5JCUA 4IP1A 4CY6A 2H6XA 1XW9A 1Z6NA 1K0NA 5HR0A 2JSZA 2CVDA 4PNGA 4POKA 2A2SA 4N11A 3LGCA 2RIIA 5ID2B 3ERFA 4G0LA 2MMZA 14GSA 3V1WA 5BMUA 4XCSA 3A2VA 2H6YA 4OFMA 3M1GA 4ZIJA 4FYCA 4QL9A 3GX0A 3GHAA 5F07A 3HJMA 18GSA 3N5OA 2FNOA 4QL7A 2O89A 2M72A 1BEDA 4IP6A 2YCDA 4CW9A 4AJ7A 2LUSA 1PRXA 4KA0A 2YP6A 2JZSA 2REMA 4BVXB 1GLPA 5EY6A 2AHEA 5ELGA 4MH2A 1NSWA 3JCML 5IO2A 4O7HA 2VM2A 1XWCA 1FB0A 3Q19A 5JCGA 2AAWA 1JLVA 1TP9A 3CXGA 2R0PA 4DSSA 2WS2A 1THOA 1K0MA 2DIYA 2GSQA 4K5SA 2FWFA 3VWWA 3C71A 3O76A 3ZFBA 1X5EA 3QFBC 1ILOA 4I6XA 5F8BA 5D9VA 3CMIA 2C8UA 3CRTA 1EWXA 5GAPD 3HJPA 2K18A 4EIPA 1T4YA 4TXOA 3A5IA 5EPFA 5B8BA 1OKTA 2M46A 2HRFA 2B5YA 2K8VA 2P0GA 9GSSA 3HVVA 2DKHA 2EIOA 3KJYA 2IPAA 4KUNA 4XIHA 1XWAA 3VURA 4D73B 1MDIA 1HQOA 1PL2A 5IMCA 4WR5A 2VL3A 3FR9A 4NHWA 2GS3A 1U88A 2L4CA 1GLQA 1O85A 5KOXA 3E9JB 4YQVA 5G31A 1F2EA 2H74A 3H4KA 2VIMA 5IOWA 1OE7A 2C0DA 1PX7A 2YZHA 1GSYA 1JZOA 1DE1A 4ECCA 4IW9A 1EOHA 2FWEA 4WKWA 1XWBA 5IMDA 2PVQA 1WE0A 5G5EA 1SD8A 2IIYA 4KB3A 2EIRA 4MJAA 3C1SA 2PUKC 5ECRB 1K0BA 2MZCA 2R3XA 4XHMA 2IMIA 3R2QA 3AY8A 2CA8A 5DQYA 3GKXA 4IQ1A 3KEBA 1X9WB 1PSQA 1MD3A 3PINA 4K0GA 4PQIA 4HQSA 5KN2A 2N5AA 4A5PA 4BL7B 4ICYA 4TOPA 5BRTA 5J9BA 1THXA 3EYTA 2OE0A 4ML1A 4YH2A 1JZRA 3CBUA 4Z2UA 5J3RA 2A2RA 2HT9A 1TRUA 2G2QA 2L57A 3H79A 1K0CA 1HNBA 2ALBA 3F6FA 1ERVA 3EE2A 2QGVA 3MIXA 6GSVA 2YWIA 4GRFA 1XCCA 1OE8A 5AISA 2GDRA 1PFOA 4IS0A 3RHBA 1WPIA 3QCPA 4KNDA 1TRVA 1BAYA 2TRCP 4G10A 2H75A 2VM1A 3WGDA 2XPDA 1GTAA 3GH6A 3LORA 3BJ5A 1J08A 1V2AA 3KH9A 5A4UA 4I2UA 4ZL8A 4IBPA 5D93A 2YJ7A 3QDNA 2FLSA 1UA5A 4V1Ag 3TRQA 3VWXA 2B5EA 6GSXA 1U87A 4DSSB 2FCHA 5F0GA 3E3EA 4RQRA 3LYPA 4KGIA 1M99A 1PL1A 4NMUA 1ZGNA 5A5KA 4G0IA 2P5RA 2F51A 2LTKA 1GUMA 1X5CA 4V2MA 4DSQA 2H70A 5H5QA 1GRXA 5ECHB 3ZZXA 3TJFA 4XRDA 5L71A 2I4AA 2OKAA 4TXOB 3UBLA 1AXDA 2F8FA 4X1UA 1M0UA 3QR6A 2KP1A 3GN3A 4EF0A 4OFTA 2PVOC 4L5OA 1S3DA 4MZCA 3I43A 1FO5A 1V40A 4ILFA 2K8SA 1QFNA 2HSMA 3IHQA 4GLTA 3CQFA 2I81A 4Q5NA 3ZIVA 2HRNA 1B8XA 3TJJA 1T7PB 4PGTA 1S3CA 3IA1A 2V41A 4PXOA 1V58A 2WB9A 3UEMA 4Z7XA 1F37A 1ZYEA 2GZZA 2HZFA 2GQLA 4F9ZA 3QAVA 2MBSA 1XVWA 2PPTA 4MABA 1GSQA 1PGTA 2ES7A 4O5RA 1Y25A 3M9JA 3MSZA 2B6MA 4G0KA 1TXXA 3APQA 3ZLPA 4V1Ap 1OC9A 5ID2A 3F4SA 5CO3A 13GSA 1AC1A 2VL2C 1G7EA 5ECPB 5CRDA 1GUHA 3F4TA 3TOUA 2OACA 2J23A 2X8HA 2RLIA 3F63A 5GZZB 1E2YA 2B5XA 1X9MB 3QD9A 1WWJA 1FVJA 3FZ5A 5CP1A 4KDUA 2DLXA 5C00A 1GSEA 4IGJA 1SYRA 3IXRA 4OO4A 1PMTA 1EEJA 2AUVA 3MYDA 2CAIA 4NPBA 2VCXA 4X0XA 4WR4A 1LU4A 1LBKA 3HKRA 2L59A 1YQ1A 3C73A 3LYKA 3A3TA 1TU7A 1B48A 4EKZA 3US3A 3GTUA 6GSUA 4PQHA 3KTLA 2WGRA 4MPGA 4PUAA 3FHKA 3GSTA 5H5RA 4L5LA 1YZXA 2L4QA 1PX6A 1XIYA 4Q5QA 2E2GA 1SL1B 2GQKA 1YY7A 1SJ6A 1A8LA 1O6JA 3TKPA 2R37A 2DMMA 4HU9A 3MDKA 4F82A 1NHYA 2HI7A 3M8NA 1ML6A 4D73A 2H76A 5ECOB 4IHUA 3DYRA 1F6MC 1I5GA 4TW5A 2EC4A 5AGYA 3P7XA 2F3MA 3IAM2 2C80A 2DKIA 3IC8A 4L0WA 4O32A 3F0IA 5AN1A 1FG4A 2LQOA 4K2DA 3ZYWA 2C1YA 2IFQB 4XS6A 2GT6A 3UAPA 1MEKA 2F9SA 4N0ZA 3PR8A 2VLVA 3BOAA 4HI7A 4JZQA 4DVCA 2XC2A 4ZB6A 2H30A 3FEUA 4QQ7A 3TCOA 1XXUA 5KN3A 4TKYA 4YAVA 4K7NA 4GSSA 4NHZA 3DKSA 4LA1A 4ZL9A 3SWLA 7GSSA 3EWLA 4ML6A 4N30A 3HZ4A 3LXZA 5C04A 3C8EA 2R2JA 1DUGA 4KAEA 3O6TA 1A0FA 4L8EA 4J2FA 1O8XA 1FB6A 2V2GA 5ECNB 1DE2A 2NVLA 4X43A 1GP1A 4PUFC 3WD6A 2LNSA 1OC9B 1C72A 5ECSA 1RQMA 3TKSC 1YKCA 3KGKA 3BD2A 1Q4JA 4GQCA 5IMZA 1XWGA 4GXZA 4JR4A 1X0RA 1GWCA 2O7KA 4K8MA 3KH7A 4PQ1A 2CX3A 2HRKA 2FWHA 1GTBA 5G30A 2TIRA 4ACSA 4N0VA 2FY6A 1DBYA 4HUAA 1AAZA 4XS1A 2GT5A 1T00A 4POBA 3P8WA 2N5FA 1BQ7A 1ACVA 3IPZA 5JWOB 3DD3A 1XPVA 1TI1A 2IWTA 5E4WA 2C0GA 4PTSA 3GTUB 1KBNA 2H0IA 4WETA 3NIVA 3GRXA 1TKDB 1V98A 1TDIA 4OWYA 1ZYQB 3DWVA 3GURA 3LEFA 5J5NA 1OAZA 3G7YA 1QMVA 5DCGA 3APOA 1RK4A 2J9HA 2KP2A 2YANA 2H1AA 5IIZA 3M3MA 3GH9A 2FUG2 2L5LA 3HA9A 4ZL7A 2VCVA 2R5GA 1YDKA 1V57A 4RQXA 1K3OA 2KLXA 4IELA 4K5RA 5EL8A 5IMFA 1SKRB 2VOCA 3IDVA 4TVEA 3D4TA 3TJKA 5FHIA 5LD0A 1WJKA 4K7OA 3UOMA 2CZ2A 1A2JA 3IC4A 3HVXA 3A2WA 1B4QA 2AV4A 3ZFLA 4EE0A 5J9CA 4WEYA 4EDZA 4H86A 4I5QA 1GSDA 1YEPA 3HD5A 3O3TA 1Z6MA 2YV7A 4F0BA 5DAKB 1X5DA 1B9YC 5ENUA 3PGTA 3CSJA 1H4OA 1FOVA 4F2IA 2R0GA 2XPEA 4MNNA 5D9XA 2OBKA 1PKWA 2B1LA 4PURA 1BX9A 4TR1A 5DDLA 4PX1A 2O85A 4J56E 3H8QA 4OFNA 1Z5YE 2JZTA 4HOJA 2VL2A 3MWHA 2PGTA 4TRXA 1AQVA 5DALB 4PNFA 2R6KA 3ZTLA 1H75A 2FWGA 4HDEA 3UVHA 4FQUA 3ME7A 3OR5A 2ZUPA 5AIXA 3P2AA 2H0GA 5GSSA 1NW2A 1AQWA 4LL4B 1XBSA 3A5WA 1GUKA 2ON7A 2YWOA 3QOUA 4EL1A 2GGTA 1IYIA 2LJRA 3ZMKA 1CQGA 4J57E 4OCFA 2H1DA 5G5FA 2WRTA 2CV4A 4KCAA 3IK9A 3KP9A 1M3JA 4BWQA 3IV4A 1ST9A 2VL9A 5HQPA 4IKHA 2LJKA 4RI6A 4LMWA 1XW5A 4X4JA 3D6IA 2JU5A 2JZRA 4KF9A 1HNAA 4KSOA 3SBCA 3GYKA 1TW9A 3GMFA 4YKFA 3TRXA 3U5RE 2H72A 3ZVJD 4AGSA 2VCQA 3HDCA 2E2MA 2DJ2A 3DRNA 3HHVA 5LCZA 4EIQA 3TJGA 4F03A 1URMA 3G9BA 2HXKA 1OC3A 1M3IA 4WXTA 3FR3A 1FHEA 2WULA 1USBA 2M80A 2OJLA 3TDGA 4E8EA 4ISDA 4GWRA 1M9AA 3GL3A 5KEJA 1V9WA 2HZEA 4LMVA 3L78A 5J41A 1VF2A 3HVSA 3PH9A 1PA3A 3KXOA 3QFAC 2B3SA 6GSWA 5J4UA 1JHBA 5B6MA 3ZREA 1R4WA 3DMLA 2YWNA 3U6VA 3M9KA 3MNGA 2DJKA 3GKKA 5IMVA 4KH7A 5CNWA 5ELAA 2IFQA 3DGQA 4KDXA 3ED3A 1T3BA 3GUSA 3KP8A 3NOFA 4LLRA 2IN3A 4MA9A 4FO5A 2V6KA 3DXBA 4OCEA 1YKAA 3F4RA 1EV4A 1SJIA 2H71A 5IQYA 1GL8A 2R0CA 3GV1A 2KHPA 1KNGA 2A4HA 2EIQA 4O5UA 1W4VA 2YNXA 4KE3A 2BMXA 3TRPA 4O92A 2VLUA 4Z2TA 5CREA 2QC7A 2HRAA 3D22A 3P90A 3UMAA 5ECIB 4KX4A 4TR1B 1JLWA 3D0ZA 4Q5RA 3WT1A 3TKSA 2PMTA 2AB6A 4ZBAA 5CRGA 3LFLA 4CY8A 4XTSA 1EGRA 1OYJA 1ZYNA 2B7KA 2JACA 2H01A 1Z9HA 1PQNA 3VWVA 1R5AA 2C3QA 4WBRD 4MPFA 1ZCPA 4E8HA 4KDYA 1ABAA 2LEGA 2QKEA 2QA1A 1Z3EA 5DVBA 1GULA 3IBHA 5GAND 4G2EA 3EU4A 1N2AA 2DIZA 1Z7PA 1M7TA 4JBBA 3GL5A 4BWSA 3LWAA 1EZKA 2L6DA 3H1NA 5ECLB 3IAS2 5IO0A 1SYXA 5ECQB 1R7HA 2X8CA 3EC3A 1A24A 2XBQA 3LXTA 4HZ2A 3Q74A 1J9BA 2E0QA 1VF1A 3VI5A 8GSSA 4XS4A 1MTCA 2H6ZA 4EDYA 2H19A 2DJ1A 3VWUA 3FR6A 1TJDA 1B4PA 2FA4A 1Q98A 1SL0B 5IOXA 3D21A 5IM9A 1GH2A 2R4VA 2C0FA 2GSRA 2B1KA 4NWYA 1S3AA 3IE3A 3UVTA 2VCZA 2C3NA 4EC0A 3ERGA 1TRWA 4HSCX 2HE3A 2HLSA 1FOHA 3IHGA 5F06A 5FT3A 2X99A 4O5QA 2MBTA 4WF5A 1XOBA 3BCKA 3RBTA 1I9DA 3H93A 3IRAA 1SK0A 5JWQB 2NPBA 3LJRA 2V1MA 5H5SA 1FVKA 1TK8B 22GSA 2HZEB 20GSA 1WMJA 5JCWA 5B8AA 6GSTA 4MMMA 2YJHA 3F3QA 2RM6A 2RUEA 3KIJA 3VFIA 3QPMA 2GLRA 2ON5A 1UVZA 1ERUA 1FAAA 3VPTA 1EGOA 2HNLA 4OO5A 4GCIA 5DAKA 2DJJA 5EVOA 3F8UA 2BTOT 3HVNA 3DVXA 1JZDA 2CVBA 1MDKA 4F0CA 3K8NA 2IMEA 4RI7A 4JRRA 2GSTA 4JEDA 2GQMA 5D9TA 3WGEA 4HQZA 2YWMA 2F8AA 3TKSE 2JL4A 2H66A 3KTBA 3W6GA 4BVYB 3EINA 2KUCA 4DSRA 1IYHA 4FH8A 5DALA 2H73A 4MJEA 5DBQA 2VCTA 3TUEA 4BPYA 4OD7A 1G7OA 3ERWA 2VAFA 3GFKA 1QQ2A 4OMVA 2O8VB 2CX4A 5G1KA 3J7Yk 2PBJA 1UN2A 3G7IA 4ZB8A 3VI7A 2HYXA 3PPUA 2CVKA 3VPQA 4MH3A 1TK0B 4TXVA 4IN0A 2ZNMA 1QGVA 5CYYA 2GZPA 5FWGA 4GSNA 5CRHA 4YKGA 4K1FA 3D4MA 3L0HA 2P31A 3NZNA 1LJRA 4GSTA 1EP7A 2FGXA 17GSA 3GKMA 2K6VA 3GSSA 3UIWA 2MYGA 4XS4B 3BCIA 4CHSA 3TGZA 3I9V2 1T4ZA 1GTIA 1PN9A 1E6BA 1G6YA 1ZOFA 1YF0A 2YPMA 4YAPA 3EVIA 2CAQA 4I2TA 3QMXA 4MDCA 3UL3A 2L5OA 4TR3A 2LRNA 3APSA 1BJXA 1O7UA 1ERWA 1R26A 2N5BA 3GKNA 2DBCA 4FYBA 4ZB9A 1O73A 2D2ZA 3W8JA 1N8JA 3L9UA 3HJOA 4I8BA 2H0HA 4K7IA 1SKSB 3F6DA 1G6WA 1EP8A 2V6OA 2TRXA 3UARA 2DMLA 2LJAA 3WYWA 2DSAA 1TTZA 1GSUA 2GZYA 1UC7A 2FHEA 2CT6A 4EVMA 2I3YA 4K9ZA 2PN8A 1BYEA 3TB2A 4BIKA 2LNTA 2MMNA 1K3YA 3L4NA 4N10A 5HR3A 1YJ6A 4MCUA 3GX8A 3KMOA 1T8EB 1AQXA 3ZL5A 2GTUA 3TOTA 3UJ1A 10GSA 5KN1A 3CTFA 4FYUA 2L6CA 1OVNA 3LG6A 1K0DA 5DCHA 1VRSD 3CTGA 2VD0A 3RDWA 3DIEA 1XOAA 2C4JA 1AIUA 5B7CA 4Q5FA 4TR0A 3FZ9A 4HU7A 1U3AA 5D96A 4ZXGA 1YF1A 2LRTA 1U6TA 1F3BA 1XVQA 1SENA 3W8SA 5IMAA 4K0NA 2OADA 4POLA 1K0AA 2IMDA 4TR4A 2C0EA 2C3TA 5HR1A 3VLNA 5KOWA 4HZ4A 3HCZA 1DSBA 2K9FA 5CAXA 1BG5A 3TJBA 1TRSA 1QUWA 1KEBA 2I1UA 3Q18A 4MZBA 4MF6A 1JFUA 3GA4A 2P5QA 4WF4A 1SL2B 2DJ3A 3C1RA 2HFDA 2FD3A 2OA7A 3I6AA 5D73A 3D5JA 5DJLA 1M2AA 1SD9A 4NAXA 1PKZA 1SK2A 4POMA 4P3YB 5HR2A 5IPHA 3KM6A 3ME8A 3KD0A 4G19A 4I97A 1TU8A 2XHFA 1ZL9A 2YOIA 4JR6A 4ECIA 1M9BA 4EUYA 1WRYA 2OE3A 2IMFA 3KZQA 3WGXA 4G9HA 4EXJA 5G1LA 4MJCA 2AYTA 4ZBBA 2JADA 2XBIA 2PERA 1OC8A 4ZILA 5E59A 2LQQA 3CRUA 4HJMA 5AIVA 5B6NA 1AUCA 4USSA 2WDUA 16GSA 4L0UA 1EOGA 2V32A 2I9HA 3WT2A 4ZBDA 2Z9SA 1O8WA 3G7JA 2JSYA 3F9UA 1XWKA 3FMWA 3UBKA 2LRCA 1ZMAA 5F05A 4HJ2A 3A2XA 2WCIA 5DJMA 4MJBA 3TKQA 1SJZA 4GQFA 3EU3A 1KTEA 3IOSA 1HYUA 3RAZA 4AJ6A 1PN0A 1B9XC 4LL1B 2QA2A 5ECKB 1TI3A 4CDOA 1A8YA 2WJUA 3CSIA 4HEA2 1A2LA 3FZAA 1GSSA 3I69A 1XW6A 3QAGA 1SK1A 1U3IA 3Q6OA 2H1BA 2A2PA 1A2MA 4ID0A
chains in the Genus database with same CATH topology
1HD2A 1AW9A 3TKRA 3HZ8A 1M2BA 2LSTA 1XZOA 2RUFA 2DC5A 2A4VA 3L9VA 2LV3A 2O87A 4MK3A 4WBJA 5ABRA 4TN8A 1QXHA 4HS1A 1ERTA 2LS5A 4V2LA 1W89A 4BVYA 2FA8A 1K0OA 3C7MA 3L9SA 1NHOA 2DJ0A 4AJ8A 2PWJA 4IQAA 3IK7A 5A4WA 4NV2A 4MLYA 1G0TA 1M2DA 1O81A 3DVWA 3S9FA 1EEMA 3HYPA 3ISOA 4ULXA 4NXIA 5INYA 3ZMLA 2ZCTA 3CSHA 1GNWA 3RPPA 4BA7A 1GSFA 1J0FA 5HFKA 1TOFA 4YQUA 2IL3A 2OE1A 3J7Yb 12GSA 2RM5A 5HFGA 2E7PA 4FIWA 3ZITA 1OKDA 1ON4A 1F9MA 2X49A 2NDOA 2X4AA 3KCMA 1K3LA 4MZWA 4ECBA 5CRWA 2X64A 1X9SB 3BBYA 1MD4A 3LW9A 2IMKA 5COHA 3QAWA 1A0RP 4GF0A 6GSYA 1XFLA 4RUVA 4BVXA 1GNEA 3ZIJA 5DQSA 3LQ7A 2OBIA 4AF2A 3VK9A 2KOKA 3EPTA 3F3RA 4XRAA 2UZ8A 3EMXA 4ECJA 3EMPA 1WOUA 4IJ3A 5A4VA 4YQMA 2VO4A 3CYNA 1YEXA 2GSSA 4Z2RA 2PU9C 1JZWA 3GIXA 3FRCA 3IR4A 1R5PA 3ZRDA 2MMOA 11GSA 3RHCA 6GSSA 4DEJA 5G2ZA 1MDJA 2NBSA 1FW1A 2X8GA 3RPNA 1GTUA 1Y6EA 1SKWB 3KMNA 1RW1A 1VF3A 2HSHA 1VF4A 2VCWA 2YN1A 5D9WA 2YV9A 3ZVJA 4MF5A 4GTUA 5KN0A 2WZ9A 2QSIA 4IJIA 3LSZA 1VGLA 1F3AA 2VD1A 2AJQB 3MAKA 4K2XA 5GSTA 3GNJA 3FZ4A 5ECMB 2B7JA 2CZ3A 3M0FA 4KW6A 3R3EA 1QK8A 3N9JA 4KSMA 1WP0A 1NM3A 2YZUA 1ZYPA 4JU5A 4EO3A 5LNKe 1A23A 2NTOA 2VLTA 2GVPA 2MMAA 4V2NA 3EURA 5JWRB 1Z7RA 3E0UA 2LKUA 3FW2A 3DEXA 4MF7A 1HNCA 1EV9A 4KCEA 3FK8A 4JE1A 4NV5A 3HXSA 2G0FA 3FYGA 19GSA 1WIKA 4MP4A 2VUPA 2WFCA 2IJYA 2CQ9A 2H1GA 4K6XA 5HFIA 1SU9A 4IVFA 1ZZYA 2BJXA 1TK5B 3FKFA 2HSYA 5IPGA 1CQHA 1PD21 2H8LA 3FY7A 4BL7A 1T1VA 3HY2A 5D8IA 5JCUA 4IP1A 4CY6A 2H6XA 1XW9A 1Z6NA 1K0NA 5HR0A 2JSZA 2CVDA 4PNGA 4POKA 2A2SA 4N11A 3LGCA 2RIIA 5ID2B 3ERFA 4G0LA 2MMZA 14GSA 3V1WA 5BMUA 4XCSA 3A2VA 2H6YA 4OFMA 3M1GA 4ZIJA 4FYCA 4QL9A 3GX0A 3GHAA 5F07A 3HJMA 18GSA 3N5OA 2FNOA 4QL7A 2O89A 2M72A 1BEDA 4IP6A 2YCDA 4CW9A 4AJ7A 2LUSA 1PRXA 4KA0A 2YP6A 2JZSA 2REMA 4BVXB 1GLPA 5EY6A 2AHEA 5ELGA 4MH2A 1NSWA 3JCML 5IO2A 4O7HA 2VM2A 1XWCA 1FB0A 3Q19A 5JCGA 2AAWA 1JLVA 1TP9A 3CXGA 2R0PA 4DSSA 2WS2A 1THOA 1K0MA 2DIYA 2GSQA 4K5SA 2FWFA 3VWWA 3C71A 3O76A 3ZFBA 1X5EA 3QFBC 1ILOA 4I6XA 5F8BA 5D9VA 3CMIA 2C8UA 3CRTA 1EWXA 5GAPD 3HJPA 2K18A 4EIPA 1T4YA 4TXOA 3A5IA 5EPFA 5B8BA 1OKTA 2M46A 2HRFA 2B5YA 2K8VA 2P0GA 9GSSA 3HVVA 2DKHA 2EIOA 3KJYA 2IPAA 4KUNA 4XIHA 1XWAA 3VURA 4D73B 1MDIA 1HQOA 1PL2A 5IMCA 4WR5A 2VL3A 3FR9A 4NHWA 2GS3A 1U88A 2L4CA 1GLQA 1O85A 5KOXA 3E9JB 4YQVA 5G31A 1F2EA 2H74A 3H4KA 2VIMA 5IOWA 1OE7A 2C0DA 1PX7A 2YZHA 1GSYA 1JZOA 1DE1A 4ECCA 4IW9A 1EOHA 2FWEA 4WKWA 1XWBA 5IMDA 2PVQA 1WE0A 5G5EA 1SD8A 2IIYA 4KB3A 2EIRA 4MJAA 3C1SA 2PUKC 5ECRB 1K0BA 2MZCA 2R3XA 4XHMA 2IMIA 3R2QA 3AY8A 2CA8A 5DQYA 3GKXA 4IQ1A 3KEBA 1X9WB 1PSQA 1MD3A 3PINA 4K0GA 4PQIA 4HQSA 5KN2A 2N5AA 4A5PA 4BL7B 4ICYA 4TOPA 5BRTA 5J9BA 1THXA 3EYTA 2OE0A 4ML1A 4YH2A 1JZRA 3CBUA 4Z2UA 5J3RA 2A2RA 2HT9A 1TRUA 2G2QA 2L57A 3H79A 1K0CA 1HNBA 2ALBA 3F6FA 1ERVA 3EE2A 2QGVA 3MIXA 6GSVA 2YWIA 4GRFA 1XCCA 1OE8A 5AISA 2GDRA 4IS0A 3RHBA 1WPIA 3QCPA 4KNDA 1TRVA 1BAYA 2TRCP 4G10A 2H75A 2VM1A 3WGDA 2XPDA 1GTAA 3GH6A 3LORA 3BJ5A 1J08A 1V2AA 3KH9A 5A4UA 4I2UA 4ZL8A 4IBPA 5D93A 2YJ7A 3QDNA 2FLSA 1UA5A 4V1Ag 3TRQA 3VWXA 2B5EA 6GSXA 1U87A 4DSSB 2FCHA 5F0GA 3E3EA 4RQRA 3LYPA 4KGIA 1M99A 1PL1A 4NMUA 1ZGNA 5A5KA 4G0IA 2P5RA 2F51A 2LTKA 1GUMA 1X5CA 4V2MA 4DSQA 2H70A 5H5QA 1GRXA 5ECHB 3ZZXA 3TJFA 4XRDA 5L71A 2I4AA 2OKAA 4TXOB 3UBLA 1AXDA 2F8FA 4X1UA 1M0UA 3QR6A 2KP1A 3GN3A 4EF0A 4OFTA 2PVOC 4L5OA 1S3DA 4MZCA 3I43A 1FO5A 1V40A 4ILFA 2K8SA 1QFNA 2HSMA 3IHQA 4GLTA 2I81A 4Q5NA 3ZIVA 2HRNA 1B8XA 3TJJA 1T7PB 4PGTA 1S3CA 3IA1A 2V41A 4PXOA 1V58A 2WB9A 3UEMA 4Z7XA 1F37A 1ZYEA 2GZZA 2HZFA 2GQLA 4F9ZA 3QAVA 2MBSA 1XVWA 2PPTA 4MABA 1GSQA 1PGTA 2ES7A 4O5RA 1Y25A 3M9JA 3MSZA 2B6MA 4G0KA 1TXXA 3APQA 3ZLPA 4V1Ap 1OC9A 5ID2A 3F4SA 5CO3A 13GSA 1AC1A 2VL2C 1G7EA 5ECPB 5CRDA 1GUHA 3F4TA 3TOUA 2OACA 2J23A 2X8HA 2RLIA 3F63A 5GZZB 1E2YA 2B5XA 1X9MB 3QD9A 1WWJA 1FVJA 3FZ5A 5CP1A 4KDUA 2DLXA 5C00A 1GSEA 4IGJA 1SYRA 3IXRA 4OO4A 1PMTA 1EEJA 2AUVA 3MYDA 2CAIA 4NPBA 2VCXA 4X0XA 4WR4A 1LU4A 1LBKA 3HKRA 2L59A 1YQ1A 3C73A 3LYKA 3A3TA 1TU7A 1B48A 4EKZA 3US3A 3GTUA 6GSUA 4PQHA 3KTLA 2WGRA 4MPGA 4PUAA 3FHKA 3GSTA 5H5RA 4L5LA 1YZXA 2L4QA 1PX6A 1XIYA 4Q5QA 2E2GA 1SL1B 2GQKA 1YY7A 1SJ6A 1A8LA 1O6JA 3TKPA 2R37A 2DMMA 4HU9A 3MDKA 4F82A 1NHYA 2HI7A 3M8NA 1ML6A 4D73A 2H76A 5ECOB 4IHUA 3DYRA 1F6MC 1I5GA 4TW5A 2EC4A 5AGYA 3P7XA 2F3MA 3IAM2 2C80A 2DKIA 3IC8A 4L0WA 4O32A 3F0IA 5AN1A 1FG4A 2LQOA 4K2DA 3ZYWA 2C1YA 2IFQB 4XS6A 2GT6A 3UAPA 1MEKA 2F9SA 4N0ZA 3PR8A 2VLVA 3BOAA 4HI7A 4JZQA 4DVCA 2XC2A 4ZB6A 2H30A 3FEUA 4QQ7A 3TCOA 1XXUA 5KN3A 4TKYA 4YAVA 4K7NA 4GSSA 4NHZA 3DKSA 4LA1A 4ZL9A 3SWLA 7GSSA 3EWLA 4ML6A 4N30A 3HZ4A 3LXZA 5C04A 3C8EA 2R2JA 1DUGA 4KAEA 3O6TA 1A0FA 4L8EA 4J2FA 1O8XA 1FB6A 2V2GA 5ECNB 1DE2A 2NVLA 4X43A 1GP1A 4PUFC 3WD6A 2LNSA 1OC9B 1C72A 5ECSA 1RQMA 3TKSC 1YKCA 3KGKA 3BD2A 1Q4JA 4GQCA 5IMZA 1XWGA 4GXZA 4JR4A 1X0RA 1GWCA 2O7KA 4K8MA 3KH7A 4PQ1A 2CX3A 2HRKA 2FWHA 1GTBA 5G30A 2TIRA 4ACSA 4N0VA 2FY6A 1DBYA 4HUAA 1AAZA 4XS1A 2GT5A 1T00A 4POBA 3P8WA 2N5FA 1BQ7A 1ACVA 3IPZA 5JWOB 3DD3A 1XPVA 1TI1A 2IWTA 5E4WA 2C0GA 4PTSA 3GTUB 1KBNA 2H0IA 4WETA 3NIVA 3GRXA 1TKDB 1V98A 1TDIA 4OWYA 1ZYQB 3DWVA 3GURA 3LEFA 5J5NA 1OAZA 3G7YA 1QMVA 5DCGA 3APOA 1RK4A 2J9HA 2KP2A 2YANA 2H1AA 5IIZA 3M3MA 3GH9A 2FUG2 2L5LA 3HA9A 4ZL7A 2VCVA 2R5GA 1YDKA 1V57A 4RQXA 1K3OA 2KLXA 4IELA 4K5RA 5EL8A 5IMFA 1SKRB 2VOCA 3IDVA 4TVEA 3D4TA 3TJKA 5FHIA 5LD0A 1WJKA 4K7OA 3UOMA 2CZ2A 1A2JA 3IC4A 3HVXA 3A2WA 1B4QA 2AV4A 3ZFLA 4EE0A 5J9CA 4WEYA 4EDZA 4H86A 4I5QA 1GSDA 1YEPA 3HD5A 3O3TA 1Z6MA 2YV7A 4F0BA 5DAKB 1X5DA 1B9YC 5ENUA 3PGTA 3CSJA 1H4OA 1FOVA 4F2IA 2R0GA 2XPEA 4MNNA 5D9XA 2OBKA 1PKWA 2B1LA 4PURA 1BX9A 4TR1A 5DDLA 4PX1A 2O85A 4J56E 3H8QA 4OFNA 1Z5YE 2JZTA 4HOJA 2VL2A 3MWHA 2PGTA 4TRXA 1AQVA 5DALB 4PNFA 2R6KA 3ZTLA 1H75A 2FWGA 4HDEA 3UVHA 4FQUA 3ME7A 3OR5A 2ZUPA 5AIXA 3P2AA 2H0GA 5GSSA 1NW2A 1AQWA 4LL4B 1XBSA 3A5WA 1GUKA 2ON7A 2YWOA 3QOUA 4EL1A 2GGTA 1IYIA 2LJRA 3ZMKA 1CQGA 4J57E 4OCFA 2H1DA 5G5FA 2WRTA 2CV4A 4KCAA 3IK9A 3KP9A 4BWQA 3IV4A 1ST9A 2VL9A 5HQPA 4IKHA 2LJKA 4RI6A 4LMWA 1XW5A 4X4JA 3D6IA 2JU5A 2JZRA 4KF9A 1HNAA 4KSOA 3SBCA 3GYKA 1TW9A 3GMFA 4YKFA 3TRXA 3U5RE 2H72A 3ZVJD 4AGSA 2VCQA 3HDCA 2E2MA 2DJ2A 3DRNA 3HHVA 5LCZA 4EIQA 3TJGA 4F03A 1URMA 3G9BA 2HXKA 1OC3A 4WXTA 3FR3A 1FHEA 2WULA 1USBA 2M80A 2OJLA 3TDGA 4E8EA 4ISDA 4GWRA 1M9AA 3GL3A 5KEJA 1V9WA 2HZEA 4LMVA 3L78A 5J41A 1VF2A 3HVSA 3PH9A 1PA3A 3KXOA 3QFAC 2B3SA 6GSWA 5J4UA 1JHBA 5B6MA 3ZREA 1R4WA 3DMLA 2YWNA 3U6VA 3M9KA 3MNGA 2DJKA 3GKKA 5IMVA 4KH7A 5CNWA 5ELAA 2IFQA 3DGQA 4KDXA 3ED3A 1T3BA 3GUSA 3KP8A 3NOFA 4LLRA 2IN3A 4MA9A 4FO5A 2V6KA 3DXBA 4OCEA 1YKAA 3F4RA 1EV4A 1SJIA 2H71A 5IQYA 1GL8A 2R0CA 3GV1A 2KHPA 1KNGA 2A4HA 2EIQA 4O5UA 1W4VA 2YNXA 4KE3A 2BMXA 3TRPA 4O92A 2VLUA 4Z2TA 5CREA 2QC7A 2HRAA 3D22A 3P90A 3UMAA 5ECIB 4KX4A 4TR1B 1JLWA 3D0ZA 4Q5RA 3WT1A 3TKSA 2PMTA 2AB6A 4ZBAA 5CRGA 3LFLA 4CY8A 4XTSA 1EGRA 1OYJA 1ZYNA 2B7KA 2JACA 2H01A 1Z9HA 1PQNA 3VWVA 1R5AA 2C3QA 4WBRD 4MPFA 1ZCPA 4E8HA 4KDYA 1ABAA 2LEGA 2QKEA 2QA1A 1Z3EA 5DVBA 1GULA 3IBHA 5GAND 4G2EA 3EU4A 1N2AA 2DIZA 1Z7PA 1M7TA 4JBBA 3GL5A 4BWSA 3LWAA 1EZKA 2L6DA 3H1NA 5ECLB 3IAS2 5IO0A 1SYXA 5ECQB 1R7HA 2X8CA 3EC3A 1A24A 2XBQA 3LXTA 4HZ2A 3Q74A 1J9BA 2E0QA 1VF1A 3VI5A 8GSSA 4XS4A 1MTCA 2H6ZA 4EDYA 2H19A 2DJ1A 3VWUA 3FR6A 1TJDA 1B4PA 2FA4A 1Q98A 1SL0B 5IOXA 3D21A 5IM9A 1GH2A 2R4VA 2C0FA 2GSRA 2B1KA 4NWYA 1S3AA 3IE3A 3UVTA 2VCZA 2C3NA 4EC0A 3ERGA 1TRWA 2HE3A 2HLSA 1FOHA 3IHGA 5F06A 5FT3A 2X99A 4O5QA 2MBTA 4WF5A 1XOBA 3BCKA 3RBTA 1I9DA 3H93A 3IRAA 1SK0A 5JWQB 2NPBA 3LJRA 2V1MA 5H5SA 1FVKA 1TK8B 22GSA 2HZEB 20GSA 1WMJA 5JCWA 5B8AA 6GSTA 4MMMA 2YJHA 3F3QA 2RM6A 2RUEA 3KIJA 3VFIA 3QPMA 2GLRA 2ON5A 1UVZA 1ERUA 1FAAA 3VPTA 1EGOA 2HNLA 4OO5A 4GCIA 5DAKA 2DJJA 5EVOA 3F8UA 2BTOT 3DVXA 1JZDA 2CVBA 1MDKA 4F0CA 3K8NA 2IMEA 4RI7A 4JRRA 2GSTA 4JEDA 2GQMA 5D9TA 3WGEA 4HQZA 2YWMA 2F8AA 3TKSE 2JL4A 2H66A 3KTBA 3W6GA 4BVYB 3EINA 2KUCA 4DSRA 1IYHA 4FH8A 5DALA 2H73A 4MJEA 5DBQA 2VCTA 3TUEA 4BPYA 4OD7A 1G7OA 3ERWA 2VAFA 3GFKA 1QQ2A 4OMVA 2O8VB 2CX4A 5G1KA 3J7Yk 2PBJA 1UN2A 3G7IA 4ZB8A 3VI7A 2HYXA 3PPUA 2CVKA 3VPQA 4MH3A 1TK0B 4TXVA 4IN0A 2ZNMA 1QGVA 5CYYA 2GZPA 5FWGA 4GSNA 5CRHA 4YKGA 4K1FA 3D4MA 3L0HA 2P31A 3NZNA 1LJRA 4GSTA 1EP7A 2FGXA 17GSA 3GKMA 2K6VA 3GSSA 3UIWA 2MYGA 4XS4B 3BCIA 4CHSA 3TGZA 3I9V2 1T4ZA 1GTIA 1PN9A 1E6BA 1G6YA 1ZOFA 1YF0A 2YPMA 4YAPA 3EVIA 2CAQA 4I2TA 3QMXA 4MDCA 3UL3A 2L5OA 4TR3A 2LRNA 3APSA 1BJXA 1O7UA 1ERWA 1R26A 2N5BA 3GKNA 2DBCA 4FYBA 4ZB9A 1O73A 2D2ZA 3W8JA 1N8JA 3L9UA 3HJOA 4I8BA 2H0HA 4K7IA 1SKSB 3F6DA 1G6WA 1EP8A 2V6OA 2TRXA 3UARA 2DMLA 2LJAA 3WYWA 2DSAA 1TTZA 1GSUA 2GZYA 1UC7A 2FHEA 2CT6A 4EVMA 2I3YA 4K9ZA 2PN8A 1BYEA 3TB2A 2LNTA 2MMNA 1K3YA 3L4NA 4N10A 5HR3A 1YJ6A 4MCUA 3GX8A 3KMOA 1T8EB 1AQXA 3ZL5A 2GTUA 3TOTA 3UJ1A 10GSA 5KN1A 3CTFA 4FYUA 2L6CA 1OVNA 3LG6A 1K0DA 5DCHA 1VRSD 3CTGA 2VD0A 3RDWA 3DIEA 1XOAA 2C4JA 1AIUA 5B7CA 4Q5FA 4TR0A 3FZ9A 4HU7A 1U3AA 5D96A 4ZXGA 1YF1A 2LRTA 1U6TA 1F3BA 1XVQA 1SENA 3W8SA 5IMAA 4K0NA 2OADA 4POLA 1K0AA 2IMDA 4TR4A 2C0EA 2C3TA 5HR1A 3VLNA 5KOWA 4HZ4A 3HCZA 1DSBA 2K9FA 5CAXA 1BG5A 3TJBA 1TRSA 1QUWA 1KEBA 2I1UA 3Q18A 4MZBA 4MF6A 1JFUA 3GA4A 2P5QA 4WF4A 1SL2B 2DJ3A 3C1RA 2HFDA 2FD3A 2OA7A 3I6AA 5D73A 3D5JA 5DJLA 1M2AA 1SD9A 4NAXA 1PKZA 1SK2A 4POMA 4P3YB 5HR2A 5IPHA 3KM6A 3ME8A 3KD0A 4G19A 4I97A 1TU8A 2XHFA 1ZL9A 2YOIA 4JR6A 4ECIA 1M9BA 4EUYA 1WRYA 2OE3A 2IMFA 3KZQA 3WGXA 4G9HA 4EXJA 5G1LA 4MJCA 2AYTA 4ZBBA 2JADA 2XBIA 2PERA 1OC8A 4ZILA 5E59A 2LQQA 3CRUA 4HJMA 5AIVA 5B6NA 1AUCA 4USSA 2WDUA 16GSA 4L0UA 1EOGA 2V32A 2I9HA 3WT2A 4ZBDA 2Z9SA 1O8WA 3G7JA 2JSYA 3F9UA 1XWKA 3FMWA 3UBKA 2LRCA 1ZMAA 5F05A 4HJ2A 3A2XA 2WCIA 5DJMA 4MJBA 3TKQA 1SJZA 4GQFA 3EU3A 1KTEA 3IOSA 1HYUA 3RAZA 4AJ6A 1PN0A 1B9XC 4LL1B 2QA2A 5ECKB 1TI3A 4CDOA 1A8YA 2WJUA 3CSIA 4HEA2 1A2LA 3FZAA 1GSSA 3I69A 1XW6A 3QAGA 1SK1A 1U3IA 3Q6OA 2H1BA 2A2PA 1A2MA 4ID0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HD2 A;  1AW9 A;  3TKR A;  3HZ8 A;  1M2B A;  2LST A;  1XZO A;  2RUF A;  2DC5 A;  2A4V A;  3L9V A;  2LV3 A;  2O87 A;  4MK3 A;  4WBJ A;  5ABR A;  4TN8 A;  1QXH A;  4HS1 A;  1ERT A;  2LS5 A;  4V2L A;  1W89 A;  4BVY A;  2FA8 A;  1K0O A;  3C7M A;  3L9S A;  1NHO A;  2DJ0 A;  4AJ8 A;  2PWJ A;  4IQA A;  3IK7 A;  5A4W A;  4NV2 A;  4MLY A;  1G0T A;  1M2D A;  1O81 A;  3DVW A;  3S9F A;  1EEM A;  3HYP A;  3ISO A;  4ULX A;  4NXI A;  5INY A;  3ZML A;  2ZCT A;  3CSH A;  1GNW A;  3RPP A;  4BA7 A;  1GSF A;  1J0F A;  5HFK A;  1TOF A;  4YQU A;  2IL3 A;  2OE1 A;  3J7Y b;  12GS A;  2RM5 A;  5HFG A;  2E7P A;  4FIW A;  3ZIT A;  1OKD A;  1ON4 A;  1F9M A;  2NDO A;  3KCM A;  1K3L A;  4MZW A;  4ECB A;  5CRW A;  2X64 A;  1X9S B;  3BBY A;  1MD4 A;  2IMK A;  5COH A;  3QAW A;  1A0R P;  4GF0 A;  6GSY A;  1XFL A;  4RUV A;  4BVX A;  1GNE A;  3ZIJ A;  5DQS A;  3LQ7 A;  2OBI A;  4AF2 A;  3VK9 A;  2KOK A;  3F3R A;  4XRA A;  3EMX A;  4ECJ A;  3EMP A;  1WOU A;  4IJ3 A;  5A4V A;  4YQM A;  2VO4 A;  3CYN A;  1YEX A;  2GSS A;  2PU9 C;  1JZW A;  3GIX A;  3FRC A;  3IR4 A;  1R5P A;  3ZRD A;  2MMO A;  11GS A;  3RHC A;  6GSS A;  4DEJ A;  5G2Z A;  1MDJ A;  2NBS A;  1FW1 A;  2X8G A;  3RPN A;  1GTU A;  1Y6E A;  1SKW B;  3KMN A;  1RW1 A;  1VF3 A;  2HSH A;  1VF4 A;  2VCW A;  2YN1 A;  5D9W A;  2YV9 A;  3ZVJ A;  4MF5 A;  4GTU A;  5KN0 A;  2WZ9 A;  2QSI A;  4IJI A;  3LSZ A;  1VGL A;  1F3A A;  2VD1 A;  2AJQ B;  3MAK A;  5GST A;  3GNJ A;  3FZ4 A;  5ECM B;  2B7J A;  2CZ3 A;  3M0F A;  4KW6 A;  1QK8 A;  3N9J A;  4KSM A;  1WP0 A;  1NM3 A;  2YZU A;  4JU5 A;  4EO3 A;  5LNK e;  1A23 A;  2NTO A;  2VLT A;  2GVP A;  2MMA A;  4V2N A;  3EUR A;  5JWR B;  1Z7R A;  3E0U A;  2LKU A;  3FW2 A;  3DEX A;  4MF7 A;  1HNC A;  1EV9 A;  4KCE A;  3FK8 A;  4JE1 A;  4NV5 A;  3HXS A;  2G0F A;  3FYG A;  19GS A;  1WIK A;  4MP4 A;  2VUP A;  2WFC A;  2IJY A;  2CQ9 A;  2H1G A;  4K6X A;  5HFI A;  1SU9 A;  4IVF A;  1ZZY A;  2BJX A;  1TK5 B;  3FKF A;  2HSY A;  5IPG A;  1CQH A;  1PD2 1;  2H8L A;  3FY7 A;  4BL7 A;  1T1V A;  3HY2 A;  5D8I A;  5JCU A;  4IP1 A;  2H6X A;  1XW9 A;  1Z6N A;  1K0N A;  5HR0 A;  2JSZ A;  2CVD A;  4PNG A;  4POK A;  2A2S A;  4N11 A;  3LGC A;  2RII A;  5ID2 B;  3ERF A;  2MMZ A;  14GS A;  3V1W A;  4XCS A;  3A2V A;  2H6Y A;  4OFM A;  3M1G A;  4ZIJ A;  4FYC A;  4QL9 A;  3GX0 A;  3GHA A;  5F07 A;  3HJM A;  18GS A;  3N5O A;  2FNO A;  4QL7 A;  2O89 A;  2M72 A;  1BED A;  4IP6 A;  2YCD A;  4CW9 A;  4AJ7 A;  2LUS A;  1PRX A;  4KA0 A;  2YP6 A;  2JZS A;  2REM A;  1GLP A;  5EY6 A;  2AHE A;  5ELG A;  4MH2 A;  1NSW A;  3JCM L;  5IO2 A;  4O7H A;  2VM2 A;  1XWC A;  1FB0 A;  3Q19 A;  5JCG A;  2AAW A;  1JLV A;  1TP9 A;  3CXG A;  4DSS A;  2WS2 A;  1THO A;  1K0M A;  2DIY A;  2GSQ A;  2FWF A;  3VWW A;  3C71 A;  3O76 A;  3ZFB A;  1X5E A;  3QFB C;  1ILO A;  4I6X A;  5F8B A;  5D9V A;  3CMI A;  2C8U A;  3CRT A;  1EWX A;  5GAP D;  3HJP A;  2K18 A;  1T4Y A;  4TXO A;  5EPF A;  5B8B A;  1OKT A;  2M46 A;  2HRF A;  2B5Y A;  2K8V A;  2P0G A;  9GSS A;  3HVV A;  2EIO A;  3KJY A;  2IPA A;  4KUN A;  4XIH A;  1XWA A;  3VUR A;  4D73 B;  1MDI A;  1HQO A;  1PL2 A;  5IMC A;  4WR5 A;  2VL3 A;  3FR9 A;  4NHW A;  2GS3 A;  1U88 A;  2L4C A;  1GLQ A;  1O85 A;  3E9J B;  4YQV A;  5G31 A;  1F2E A;  2H74 A;  3H4K A;  2VIM A;  5IOW A;  1OE7 A;  2C0D A;  1PX7 A;  2YZH A;  1GSY A;  1JZO A;  1DE1 A;  4ECC A;  4IW9 A;  1EOH A;  2FWE A;  4WKW A;  1XWB A;  5IMD A;  2PVQ A;  1WE0 A;  5G5E A;  1SD8 A;  2IIY A;  4KB3 A;  2EIR A;  4MJA A;  3C1S A;  2PUK C;  5ECR B;  1K0B A;  2MZC A;  2R3X A;  4XHM A;  2IMI A;  3R2Q A;  3AY8 A;  2CA8 A;  5DQY A;  3GKX A;  4IQ1 A;  3KEB A;  1X9W B;  1PSQ A;  1MD3 A;  3PIN A;  4K0G A;  4PQI A;  4HQS A;  5KN2 A;  2N5A A;  4TOP A;  5J9B A;  1THX A;  3EYT A;  2OE0 A;  4ML1 A;  4YH2 A;  1JZR A;  3CBU A;  5J3R A;  2A2R A;  2HT9 A;  1TRU A;  2G2Q A;  2L57 A;  3H79 A;  1K0C A;  1HNB A;  2ALB A;  3F6F A;  1ERV A;  3EE2 A;  2QGV A;  6GSV A;  2YWI A;  4GRF A;  1XCC A;  1OE8 A;  5AIS A;  2GDR A;  4IS0 A;  3RHB A;  1WPI A;  3QCP A;  4KND A;  1TRV A;  1BAY A;  2TRC P;  4G10 A;  2H75 A;  2VM1 A;  3WGD A;  2XPD A;  1GTA A;  3GH6 A;  3LOR A;  3BJ5 A;  1J08 A;  1V2A A;  3KH9 A;  5A4U A;  4I2U A;  4ZL8 A;  4IBP A;  5D93 A;  2YJ7 A;  3QDN A;  2FLS A;  1UA5 A;  4V1A g;  3TRQ A;  3VWX A;  2B5E A;  6GSX A;  1U87 A;  4DSS B;  2FCH A;  5F0G A;  3E3E A;  4RQR A;  3LYP A;  4KGI A;  1M99 A;  1PL1 A;  4NMU A;  1ZGN A;  5A5K A;  2P5R A;  2F51 A;  2LTK A;  1GUM A;  1X5C A;  4V2M A;  4DSQ A;  2H70 A;  5H5Q A;  1GRX A;  5ECH B;  3ZZX A;  3TJF A;  4XRD A;  5L71 A;  2I4A A;  2OKA A;  4TXO B;  3UBL A;  1AXD A;  2F8F A;  4X1U A;  1M0U A;  3QR6 A;  2KP1 A;  3GN3 A;  4EF0 A;  4OFT A;  2PVO C;  4L5O A;  1S3D A;  4MZC A;  3I43 A;  1FO5 A;  1V40 A;  4ILF A;  2K8S A;  1QFN A;  3IHQ A;  4GLT A;  2I81 A;  4Q5N A;  3ZIV A;  2HRN A;  1B8X A;  3TJJ A;  1T7P B;  4PGT A;  1S3C A;  3IA1 A;  2V41 A;  4PXO A;  1V58 A;  2WB9 A;  3UEM A;  4Z7X A;  1F37 A;  1ZYE A;  2GZZ A;  2HZF A;  2GQL A;  4F9Z A;  3QAV A;  2MBS A;  1XVW A;  2PPT A;  4MAB A;  1GSQ A;  1PGT A;  2ES7 A;  4O5R A;  1Y25 A;  3M9J A;  3MSZ A;  2B6M A;  1TXX A;  3APQ A;  3ZLP A;  4V1A p;  1OC9 A;  5ID2 A;  3F4S A;  5CO3 A;  13GS A;  1AC1 A;  2VL2 C;  1G7E A;  5ECP B;  5CRD A;  1GUH A;  3F4T A;  3TOU A;  2OAC A;  2J23 A;  2X8H A;  2RLI A;  3F63 A;  5GZZ B;  1E2Y A;  2B5X A;  1X9M B;  3QD9 A;  1WWJ A;  1FVJ A;  3FZ5 A;  5CP1 A;  4KDU A;  2DLX A;  5C00 A;  1GSE A;  4IGJ A;  1SYR A;  3IXR A;  4OO4 A;  1PMT A;  1EEJ A;  2AUV A;  2CAI A;  4NPB A;  2VCX A;  4X0X A;  4WR4 A;  1LU4 A;  1LBK A;  3HKR A;  2L59 A;  1YQ1 A;  3C73 A;  3LYK A;  3A3T A;  1TU7 A;  1B48 A;  4EKZ A;  3US3 A;  3GTU A;  6GSU A;  4PQH A;  3KTL A;  2WGR A;  4MPG A;  4PUA A;  3FHK A;  3GST A;  5H5R A;  4L5L A;  1YZX A;  2L4Q A;  1PX6 A;  1XIY A;  4Q5Q A;  2E2G A;  1SL1 B;  2GQK A;  1YY7 A;  1SJ6 A;  1A8L A;  1O6J A;  3TKP A;  2R37 A;  2DMM A;  4HU9 A;  3MDK A;  4F82 A;  1NHY A;  2HI7 A;  3M8N A;  1ML6 A;  4D73 A;  2H76 A;  5ECO B;  4IHU A;  3DYR A;  1F6M C;  1I5G A;  4TW5 A;  2EC4 A;  5AGY A;  3P7X A;  2F3M A;  3IAM 2;  2C80 A;  4L0W A;  4O32 A;  3F0I A;  5AN1 A;  1FG4 A;  2LQO A;  4K2D A;  3ZYW A;  2C1Y A;  2IFQ B;  4XS6 A;  2GT6 A;  3UAP A;  1MEK A;  2F9S A;  4N0Z A;  3PR8 A;  2VLV A;  3BOA A;  4HI7 A;  4JZQ A;  4DVC A;  2XC2 A;  4ZB6 A;  2H30 A;  3FEU A;  4QQ7 A;  3TCO A;  1XXU A;  5KN3 A;  4TKY A;  4YAV A;  4K7N A;  4GSS A;  4NHZ A;  3DKS A;  4LA1 A;  4ZL9 A;  3SWL A;  7GSS A;  3EWL A;  4ML6 A;  4N30 A;  3HZ4 A;  3LXZ A;  5C04 A;  3C8E A;  2R2J A;  1DUG A;  4KAE A;  3O6T A;  1A0F A;  4L8E A;  4J2F A;  1O8X A;  1FB6 A;  2V2G A;  5ECN B;  1DE2 A;  2NVL A;  4X43 A;  1GP1 A;  4PUF C;  3WD6 A;  2LNS A;  1OC9 B;  1C72 A;  5ECS A;  1RQM A;  3TKS C;  1YKC A;  3KGK A;  3BD2 A;  1Q4J A;  4GQC A;  5IMZ A;  1XWG A;  4GXZ A;  4JR4 A;  1X0R A;  1GWC A;  2O7K A;  4K8M A;  3KH7 A;  4PQ1 A;  2CX3 A;  2FWH A;  1GTB A;  5G30 A;  2TIR A;  4ACS A;  4N0V A;  2FY6 A;  1DBY A;  4HUA A;  1AAZ A;  4XS1 A;  2GT5 A;  1T00 A;  4POB A;  3P8W A;  2N5F A;  1BQ7 A;  1ACV A;  3IPZ A;  5JWO B;  3DD3 A;  1XPV A;  1TI1 A;  2IWT A;  5E4W A;  2C0G A;  3GTU B;  1KBN A;  2H0I A;  4WET A;  3NIV A;  3GRX A;  1TKD B;  1V98 A;  1TDI A;  4OWY A;  1ZYQ B;  3DWV A;  3GUR A;  3LEF A;  5J5N A;  1OAZ A;  3G7Y A;  1QMV A;  5DCG A;  3APO A;  1RK4 A;  2J9H A;  2KP2 A;  2YAN A;  2H1A A;  5IIZ A;  3M3M A;  3GH9 A;  2FUG 2;  2L5L A;  3HA9 A;  4ZL7 A;  2VCV A;  2R5G A;  1YDK A;  1V57 A;  4RQX A;  1K3O A;  2KLX A;  4IEL A;  5EL8 A;  5IMF A;  1SKR B;  2VOC A;  3IDV A;  4TVE A;  3D4T A;  3TJK A;  5FHI A;  5LD0 A;  1WJK A;  4K7O A;  3UOM A;  2CZ2 A;  1A2J A;  3IC4 A;  3HVX A;  3A2W A;  1B4Q A;  2AV4 A;  3ZFL A;  4EE0 A;  5J9C A;  4WEY A;  4EDZ A;  4H86 A;  4I5Q A;  1GSD A;  1YEP A;  3HD5 A;  3O3T A;  1Z6M A;  2YV7 A;  4F0B A;  5DAK B;  1X5D A;  1B9Y C;  5ENU A;  3PGT A;  3CSJ A;  1H4O A;  1FOV A;  4F2I A;  2XPE A;  5D9X A;  2OBK A;  1PKW A;  2B1L A;  4PUR A;  1BX9 A;  4TR1 A;  5DDL A;  4PX1 A;  2O85 A;  4J56 E;  3H8Q A;  4OFN A;  1Z5Y E;  2JZT A;  4HOJ A;  2VL2 A;  3MWH A;  2PGT A;  4TRX A;  1AQV A;  5DAL B;  4PNF A;  2R6K A;  3ZTL A;  1H75 A;  2FWG A;  4HDE A;  3UVH A;  3ME7 A;  3OR5 A;  2ZUP A;  5AIX A;  3P2A A;  2H0G A;  5GSS A;  1NW2 A;  1AQW A;  4LL4 B;  1XBS A;  3A5W A;  1GUK A;  2ON7 A;  2YWO A;  3QOU A;  4EL1 A;  2GGT A;  1IYI A;  2LJR A;  3ZMK A;  1CQG A;  4J57 E;  4OCF A;  2H1D A;  5G5F A;  2WRT A;  2CV4 A;  4KCA A;  3IK9 A;  3KP9 A;  4BWQ A;  3IV4 A;  1ST9 A;  2VL9 A;  5HQP A;  4IKH A;  2LJK A;  4RI6 A;  4LMW A;  1XW5 A;  3D6I A;  2JU5 A;  2JZR A;  1HNA A;  4KSO A;  3SBC A;  3GYK A;  1TW9 A;  3GMF A;  3TRX A;  3U5R E;  2H72 A;  3ZVJ D;  4AGS A;  2VCQ A;  3HDC A;  2E2M A;  2DJ2 A;  3DRN A;  3HHV A;  5LCZ A;  3TJG A;  4F03 A;  1URM A;  3G9B A;  2HXK A;  1OC3 A;  4WXT A;  3FR3 A;  1FHE A;  2WUL A;  1USB A;  2M80 A;  2OJL A;  3TDG A;  4E8E A;  4ISD A;  4GWR A;  1M9A A;  3GL3 A;  5KEJ A;  1V9W A;  2HZE A;  4LMV A;  3L78 A;  5J41 A;  1VF2 A;  3HVS A;  3PH9 A;  1PA3 A;  3KXO A;  3QFA C;  2B3S A;  6GSW A;  5J4U A;  1JHB A;  5B6M A;  3ZRE A;  1R4W A;  3DML A;  2YWN A;  3U6V A;  3M9K A;  3MNG A;  2DJK A;  3GKK A;  5IMV A;  4KH7 A;  5CNW A;  5ELA A;  2IFQ A;  3DGQ A;  4KDX A;  3ED3 A;  1T3B A;  3GUS A;  3KP8 A;  3NOF A;  4LLR A;  2IN3 A;  4MA9 A;  4FO5 A;  2V6K A;  3DXB A;  4OCE A;  1YKA A;  3F4R A;  1EV4 A;  1SJI A;  2H71 A;  5IQY A;  1GL8 A;  3GV1 A;  2KHP A;  1KNG A;  2EIQ A;  1W4V A;  2YNX A;  4KE3 A;  2BMX A;  3TRP A;  4O92 A;  2VLU A;  5CRE A;  2QC7 A;  3D22 A;  3P90 A;  3UMA A;  5ECI B;  4KX4 A;  4TR1 B;  1JLW A;  3D0Z A;  4Q5R A;  3WT1 A;  3TKS A;  2PMT A;  2AB6 A;  4ZBA A;  5CRG A;  3LFL A;  4XTS A;  1EGR A;  1OYJ A;  2B7K A;  2JAC A;  2H01 A;  1Z9H A;  1PQN A;  3VWV A;  1R5A A;  2C3Q A;  4WBR D;  4MPF A;  1ZCP A;  4E8H A;  4KDY A;  1ABA A;  2LEG A;  2QKE A;  1Z3E A;  5DVB A;  1GUL A;  3IBH A;  5GAN D;  4G2E A;  3EU4 A;  1N2A A;  2DIZ A;  1Z7P A;  1M7T A;  4JBB A;  3GL5 A;  4BWS A;  3LWA A;  1EZK A;  2L6D A;  3H1N A;  5ECL B;  3IAS 2;  5IO0 A;  1SYX A;  5ECQ B;  1R7H A;  2X8C A;  3EC3 A;  1A24 A;  2XBQ A;  3LXT A;  4HZ2 A;  3Q74 A;  1J9B A;  2E0Q A;  1VF1 A;  3VI5 A;  8GSS A;  4XS4 A;  1MTC A;  2H6Z A;  4EDY A;  2H19 A;  2DJ1 A;  3VWU A;  3FR6 A;  1TJD A;  1B4P A;  2FA4 A;  1Q98 A;  1SL0 B;  5IOX A;  3D21 A;  5IM9 A;  1GH2 A;  2R4V A;  2C0F A;  2GSR A;  2B1K A;  4NWY A;  1S3A A;  3IE3 A;  3UVT A;  2VCZ A;  2C3N A;  4EC0 A;  3ERG A;  1TRW A;  2HE3 A;  2HLS A;  5F06 A;  5FT3 A;  2X99 A;  2MBT A;  4WF5 A;  1XOB A;  3BCK A;  3RBT A;  1I9D A;  3H93 A;  3IRA A;  1SK0 A;  5JWQ B;  2NPB A;  3LJR A;  2V1M A;  5H5S A;  1FVK A;  1TK8 B;  22GS A;  2HZE B;  20GS A;  1WMJ A;  5JCW A;  5B8A A;  6GST A;  4MMM A;  2YJH A;  3F3Q A;  2RM6 A;  2RUE A;  3KIJ A;  3VFI A;  3QPM A;  2GLR A;  2ON5 A;  1UVZ A;  1ERU A;  1FAA A;  3VPT A;  1EGO A;  2HNL A;  4OO5 A;  4GCI A;  5DAK A;  2DJJ A;  5EVO A;  3F8U A;  2BTO T;  3DVX A;  1JZD A;  2CVB A;  1MDK A;  4F0C A;  3K8N A;  2IME A;  4RI7 A;  4JRR A;  2GST A;  4JED A;  2GQM A;  5D9T A;  3WGE A;  4HQZ A;  2YWM A;  2F8A A;  3TKS E;  2JL4 A;  2H66 A;  3KTB A;  3W6G A;  3EIN A;  2KUC A;  4DSR A;  1IYH A;  4FH8 A;  5DAL A;  2H73 A;  4MJE A;  5DBQ A;  2VCT A;  3TUE A;  4BPY A;  4OD7 A;  1G7O A;  3ERW A;  2VAF A;  3GFK A;  1QQ2 A;  4OMV A;  2O8V B;  2CX4 A;  5G1K A;  3J7Y k;  2PBJ A;  1UN2 A;  3G7I A;  4ZB8 A;  3VI7 A;  2HYX A;  2CVK A;  3VPQ A;  4MH3 A;  1TK0 B;  4TXV A;  4IN0 A;  2ZNM A;  1QGV A;  5CYY A;  2GZP A;  5FWG A;  4GSN A;  5CRH A;  4K1F A;  3D4M A;  3L0H A;  2P31 A;  3NZN A;  1LJR A;  4GST A;  1EP7 A;  2FGX A;  17GS A;  3GKM A;  2K6V A;  3GSS A;  3UIW A;  2MYG A;  4XS4 B;  3BCI A;  4CHS A;  3TGZ A;  3I9V 2;  1T4Z A;  1GTI A;  1PN9 A;  1E6B A;  1G6Y A;  1ZOF A;  1YF0 A;  2YPM A;  4YAP A;  3EVI A;  2CAQ A;  4I2T A;  3QMX A;  4MDC A;  3UL3 A;  2L5O A;  4TR3 A;  2LRN A;  3APS A;  1BJX A;  1O7U A;  1ERW A;  1R26 A;  2N5B A;  3GKN A;  2DBC A;  4FYB A;  4ZB9 A;  1O73 A;  2D2Z A;  3W8J A;  1N8J A;  3L9U A;  3HJO A;  4I8B A;  2H0H A;  4K7I A;  1SKS B;  3F6D A;  1G6W A;  1EP8 A;  2V6O A;  2TRX A;  3UAR A;  2DML A;  2LJA A;  3WYW A;  2DSA A;  1TTZ A;  1GSU A;  2GZY A;  1UC7 A;  2FHE A;  2CT6 A;  4EVM A;  2I3Y A;  4K9Z A;  2PN8 A;  1BYE A;  3TB2 A;  2LNT A;  2MMN A;  1K3Y A;  3L4N A;  4N10 A;  5HR3 A;  1YJ6 A;  4MCU A;  3GX8 A;  3KMO A;  1T8E B;  1AQX A;  3ZL5 A;  2GTU A;  3TOT A;  3UJ1 A;  10GS A;  5KN1 A;  3CTF A;  4FYU A;  2L6C A;  1OVN A;  3LG6 A;  1K0D A;  5DCH A;  1VRS D;  3CTG A;  2VD0 A;  3RDW A;  3DIE A;  1XOA A;  2C4J A;  1AIU A;  5B7C A;  4Q5F A;  4TR0 A;  3FZ9 A;  4HU7 A;  1U3A A;  5D96 A;  4ZXG A;  1YF1 A;  2LRT A;  1U6T A;  1F3B A;  1XVQ A;  1SEN A;  3W8S A;  5IMA A;  4K0N A;  2OAD A;  4POL A;  1K0A A;  2IMD A;  4TR4 A;  2C0E A;  2C3T A;  5HR1 A;  3VLN A;  4HZ4 A;  3HCZ A;  1DSB A;  2K9F A;  5CAX A;  1BG5 A;  3TJB A;  1TRS A;  1QUW A;  1KEB A;  2I1U A;  3Q18 A;  4MZB A;  4MF6 A;  1JFU A;  3GA4 A;  2P5Q A;  4WF4 A;  1SL2 B;  2DJ3 A;  3C1R A;  2HFD A;  2FD3 A;  2OA7 A;  3I6A A;  5D73 A;  3D5J A;  5DJL A;  1M2A A;  1SD9 A;  4NAX A;  1PKZ A;  1SK2 A;  4POM A;  4P3Y B;  5HR2 A;  5IPH A;  3KM6 A;  3ME8 A;  3KD0 A;  4G19 A;  4I97 A;  1TU8 A;  2XHF A;  1ZL9 A;  2YOI A;  4JR6 A;  4ECI A;  1M9B A;  4EUY A;  1WRY A;  2OE3 A;  2IMF A;  3KZQ A;  3WGX A;  4G9H A;  4EXJ A;  5G1L A;  4MJC A;  2AYT A;  4ZBB A;  2JAD A;  2XBI A;  2PER A;  1OC8 A;  4ZIL A;  5E59 A;  2LQQ A;  3CRU A;  4HJM A;  5AIV A;  5B6N A;  1AUC A;  2WDU A;  16GS A;  4L0U A;  1EOG A;  2V32 A;  2I9H A;  3WT2 A;  4ZBD A;  2Z9S A;  1O8W A;  3G7J A;  2JSY A;  3F9U A;  1XWK A;  3UBK A;  2LRC A;  1ZMA A;  5F05 A;  4HJ2 A;  3A2X A;  2WCI A;  5DJM A;  4MJB A;  3TKQ A;  1SJZ A;  4GQF A;  3EU3 A;  1KTE A;  3IOS A;  1HYU A;  3RAZ A;  4AJ6 A;  1B9X C;  4LL1 B;  5ECK B;  1TI3 A;  4CDO A;  1A8Y A;  2WJU A;  3CSI A;  4HEA 2;  1A2L A;  3FZA A;  1GSS A;  3I69 A;  1XW6 A;  3QAG A;  1SK1 A;  1U3I A;  3Q6O A;  2H1B A;  1A2M A;  4ID0 A; 
#chains in the Genus database with same CATH topology
 1HD2 A;  1AW9 A;  3TKR A;  3HZ8 A;  1M2B A;  2LST A;  1XZO A;  2RUF A;  2DC5 A;  2A4V A;  3L9V A;  2LV3 A;  2O87 A;  4MK3 A;  4WBJ A;  5ABR A;  4TN8 A;  1QXH A;  4HS1 A;  1ERT A;  2LS5 A;  4V2L A;  1W89 A;  4BVY A;  2FA8 A;  1K0O A;  3C7M A;  3L9S A;  1NHO A;  2DJ0 A;  4AJ8 A;  2PWJ A;  4IQA A;  3IK7 A;  5A4W A;  4NV2 A;  4MLY A;  1G0T A;  1M2D A;  1O81 A;  3DVW A;  3S9F A;  1EEM A;  3HYP A;  3ISO A;  4ULX A;  4NXI A;  5INY A;  3ZML A;  2ZCT A;  3CSH A;  1GNW A;  3RPP A;  4BA7 A;  1GSF A;  1J0F A;  5HFK A;  1TOF A;  4YQU A;  2IL3 A;  2OE1 A;  3J7Y b;  12GS A;  2RM5 A;  5HFG A;  2E7P A;  4FIW A;  3ZIT A;  1OKD A;  1ON4 A;  1F9M A;  2X49 A;  2NDO A;  2X4A A;  3KCM A;  1K3L A;  4MZW A;  4ECB A;  5CRW A;  2X64 A;  1X9S B;  3BBY A;  1MD4 A;  3LW9 A;  2IMK A;  5COH A;  3QAW A;  1A0R P;  4GF0 A;  6GSY A;  1XFL A;  4RUV A;  4BVX A;  1GNE A;  3ZIJ A;  5DQS A;  3LQ7 A;  2OBI A;  4AF2 A;  3VK9 A;  2KOK A;  3EPT A;  3F3R A;  4XRA A;  2UZ8 A;  3EMX A;  4ECJ A;  3EMP A;  1WOU A;  4IJ3 A;  5A4V A;  4YQM A;  2VO4 A;  3CYN A;  1YEX A;  2GSS A;  4Z2R A;  2PU9 C;  1JZW A;  3GIX A;  3FRC A;  3IR4 A;  1R5P A;  3ZRD A;  2MMO A;  11GS A;  3RHC A;  6GSS A;  4DEJ A;  5G2Z A;  1MDJ A;  2NBS A;  1FW1 A;  2X8G A;  3RPN A;  1GTU A;  1Y6E A;  1SKW B;  3KMN A;  1RW1 A;  1VF3 A;  2HSH A;  1VF4 A;  2VCW A;  2YN1 A;  5D9W A;  2YV9 A;  3ZVJ A;  4MF5 A;  4GTU A;  5KN0 A;  2WZ9 A;  2QSI A;  4IJI A;  3LSZ A;  1S3R A;  1VGL A;  1F3A A;  2VD1 A;  2AJQ B;  3MAK A;  4K2X A;  5GST A;  3GNJ A;  3FZ4 A;  5ECM B;  2B7J A;  2CZ3 A;  3M0F A;  4KW6 A;  3R3E A;  1QK8 A;  3N9J A;  4KSM A;  1WP0 A;  1NM3 A;  2YZU A;  1ZYP A;  4JU5 A;  4EO3 A;  5LNK e;  1A23 A;  2NTO A;  2VLT A;  2GVP A;  2MMA A;  4V2N A;  3EUR A;  5JWR B;  1Z7R A;  3E0U A;  2LKU A;  3FW2 A;  3DEX A;  4MF7 A;  1HNC A;  1EV9 A;  4KCE A;  3FK8 A;  4JE1 A;  4NV5 A;  3HXS A;  2G0F A;  3FYG A;  19GS A;  1XG8 A;  1WIK A;  4MP4 A;  2VUP A;  2WFC A;  2IJY A;  2CQ9 A;  2H1G A;  4K6X A;  5HFI A;  1SU9 A;  4IVF A;  1ZZY A;  2BJX A;  1TK5 B;  3FKF A;  2HSY A;  5IPG A;  1CQH A;  1PD2 1;  2H8L A;  3FY7 A;  4BL7 A;  1T1V A;  3HY2 A;  5D8I A;  5JCU A;  4IP1 A;  4CY6 A;  2H6X A;  1XW9 A;  1Z6N A;  1K0N A;  5HR0 A;  2JSZ A;  2CVD A;  4PNG A;  4POK A;  2A2S A;  4N11 A;  3LGC A;  2RII A;  5ID2 B;  3ERF A;  4G0L A;  2MMZ A;  14GS A;  3V1W A;  5BMU A;  4XCS A;  3A2V A;  2H6Y A;  4OFM A;  3M1G A;  4ZIJ A;  4FYC A;  4QL9 A;  3GX0 A;  3GHA A;  5F07 A;  3HJM A;  18GS A;  3N5O A;  2FNO A;  4QL7 A;  2O89 A;  2M72 A;  1BED A;  4IP6 A;  2YCD A;  4CW9 A;  4AJ7 A;  2LUS A;  1PRX A;  4KA0 A;  2YP6 A;  2JZS A;  2REM A;  4BVX B;  1GLP A;  5EY6 A;  2AHE A;  5ELG A;  4MH2 A;  1NSW A;  3JCM L;  5IO2 A;  4O7H A;  2VM2 A;  1XWC A;  1FB0 A;  3Q19 A;  5JCG A;  2AAW A;  1JLV A;  1TP9 A;  3CXG A;  2R0P A;  4DSS A;  2WS2 A;  1THO A;  1K0M A;  2DIY A;  2GSQ A;  4K5S A;  2FWF A;  3VWW A;  3C71 A;  3O76 A;  3ZFB A;  1X5E A;  3QFB C;  1ILO A;  4I6X A;  5F8B A;  5D9V A;  3CMI A;  2C8U A;  3CRT A;  1EWX A;  5GAP D;  3HJP A;  2K18 A;  4EIP A;  1T4Y A;  4TXO A;  3A5I A;  5EPF A;  5B8B A;  1OKT A;  2M46 A;  2HRF A;  2B5Y A;  2K8V A;  2P0G A;  9GSS A;  3HVV A;  2DKH A;  2EIO A;  3KJY A;  2IPA A;  4KUN A;  4XIH A;  1XWA A;  3VUR A;  4D73 B;  1MDI A;  1HQO A;  1PL2 A;  5IMC A;  4WR5 A;  2VL3 A;  3FR9 A;  4NHW A;  2GS3 A;  1U88 A;  2L4C A;  1GLQ A;  1O85 A;  5KOX A;  3E9J B;  4YQV A;  5G31 A;  1F2E A;  2H74 A;  3H4K A;  2VIM A;  5IOW A;  1OE7 A;  2C0D A;  1PX7 A;  2YZH A;  1GSY A;  1JZO A;  1DE1 A;  4ECC A;  4IW9 A;  1EOH A;  2FWE A;  4WKW A;  1XWB A;  5IMD A;  2PVQ A;  1WE0 A;  5G5E A;  1SD8 A;  2IIY A;  4KB3 A;  2EIR A;  4MJA A;  3C1S A;  2PUK C;  5ECR B;  1K0B A;  2MZC A;  2R3X A;  4XHM A;  2IMI A;  3R2Q A;  3AY8 A;  2CA8 A;  5DQY A;  3GKX A;  4IQ1 A;  3KEB A;  1X9W B;  1PSQ A;  1MD3 A;  3PIN A;  4K0G A;  4PQI A;  4HQS A;  5KN2 A;  2N5A A;  4A5P A;  4BL7 B;  4ICY A;  4TOP A;  5BRT A;  5J9B A;  1THX A;  3EYT A;  2OE0 A;  4ML1 A;  4YH2 A;  1JZR A;  3CBU A;  4Z2U A;  5J3R A;  2A2R A;  2HT9 A;  1TRU A;  2G2Q A;  2L57 A;  3H79 A;  1K0C A;  1HNB A;  2ALB A;  3F6F A;  1ERV A;  3EE2 A;  2QGV A;  3MIX A;  6GSV A;  2YWI A;  4GRF A;  1XCC A;  1OE8 A;  5AIS A;  2GDR A;  1PFO A;  4IS0 A;  3RHB A;  1WPI A;  3QCP A;  4KND A;  1TRV A;  1BAY A;  2TRC P;  4G10 A;  2H75 A;  2VM1 A;  3WGD A;  2XPD A;  1GTA A;  3GH6 A;  3LOR A;  3BJ5 A;  1J08 A;  1V2A A;  3KH9 A;  5A4U A;  4I2U A;  4ZL8 A;  4IBP A;  5D93 A;  2YJ7 A;  3QDN A;  2FLS A;  1UA5 A;  4V1A g;  3TRQ A;  3VWX A;  2B5E A;  6GSX A;  1U87 A;  4DSS B;  2FCH A;  5F0G A;  3E3E A;  4RQR A;  3LYP A;  4KGI A;  1M99 A;  1PL1 A;  4NMU A;  1ZGN A;  5A5K A;  4G0I A;  2P5R A;  2F51 A;  2LTK A;  1GUM A;  1X5C A;  4V2M A;  4DSQ A;  2H70 A;  5H5Q A;  1GRX A;  5ECH B;  3ZZX A;  3TJF A;  4XRD A;  5L71 A;  2I4A A;  2OKA A;  4TXO B;  3UBL A;  1AXD A;  2F8F A;  4X1U A;  1M0U A;  3QR6 A;  2KP1 A;  3GN3 A;  4EF0 A;  4OFT A;  2PVO C;  4L5O A;  1S3D A;  4MZC A;  3I43 A;  1FO5 A;  1V40 A;  4ILF A;  2K8S A;  1QFN A;  2HSM A;  3IHQ A;  4GLT A;  3CQF A;  2I81 A;  4Q5N A;  3ZIV A;  2HRN A;  1B8X A;  3TJJ A;  1T7P B;  4PGT A;  1S3C A;  3IA1 A;  2V41 A;  4PXO A;  1V58 A;  2WB9 A;  3UEM A;  4Z7X A;  1F37 A;  1ZYE A;  2GZZ A;  2HZF A;  2GQL A;  4F9Z A;  3QAV A;  2MBS A;  1XVW A;  2PPT A;  4MAB A;  1GSQ A;  1PGT A;  2ES7 A;  4O5R A;  1Y25 A;  3M9J A;  3MSZ A;  2B6M A;  4G0K A;  1TXX A;  3APQ A;  3ZLP A;  4V1A p;  1OC9 A;  5ID2 A;  3F4S A;  5CO3 A;  13GS A;  1AC1 A;  2VL2 C;  1G7E A;  5ECP B;  5CRD A;  1GUH A;  3F4T A;  3TOU A;  2OAC A;  2J23 A;  2X8H A;  2RLI A;  3F63 A;  5GZZ B;  1E2Y A;  2B5X A;  1X9M B;  3QD9 A;  1WWJ A;  1FVJ A;  3FZ5 A;  5CP1 A;  4KDU A;  2DLX A;  5C00 A;  1GSE A;  4IGJ A;  1SYR A;  3IXR A;  4OO4 A;  1PMT A;  1EEJ A;  2AUV A;  3MYD A;  2CAI A;  4NPB A;  2VCX A;  4X0X A;  4WR4 A;  1LU4 A;  1LBK A;  3HKR A;  2L59 A;  1YQ1 A;  3C73 A;  3LYK A;  3A3T A;  1TU7 A;  1B48 A;  4EKZ A;  3US3 A;  3GTU A;  6GSU A;  4PQH A;  3KTL A;  2WGR A;  4MPG A;  4PUA A;  3FHK A;  3GST A;  5H5R A;  4L5L A;  1YZX A;  2L4Q A;  1PX6 A;  1XIY A;  4Q5Q A;  2E2G A;  1SL1 B;  2GQK A;  1YY7 A;  1SJ6 A;  1A8L A;  1O6J A;  3TKP A;  2R37 A;  2DMM A;  4HU9 A;  3MDK A;  4F82 A;  1NHY A;  2HI7 A;  3M8N A;  1ML6 A;  4D73 A;  2H76 A;  5ECO B;  4IHU A;  3DYR A;  1F6M C;  1I5G A;  4TW5 A;  2EC4 A;  5AGY A;  3P7X A;  2F3M A;  3IAM 2;  2C80 A;  2DKI A;  3IC8 A;  4L0W A;  4O32 A;  3F0I A;  5AN1 A;  1FG4 A;  2LQO A;  4K2D A;  3ZYW A;  2C1Y A;  2IFQ B;  4XS6 A;  2GT6 A;  3UAP A;  1MEK A;  2F9S A;  4N0Z A;  3PR8 A;  2VLV A;  3BOA A;  4HI7 A;  4JZQ A;  4DVC A;  2XC2 A;  4ZB6 A;  2H30 A;  3FEU A;  4QQ7 A;  3TCO A;  1XXU A;  5KN3 A;  4TKY A;  4YAV A;  4K7N A;  4GSS A;  4NHZ A;  3DKS A;  4LA1 A;  4ZL9 A;  3SWL A;  7GSS A;  3EWL A;  4ML6 A;  4N30 A;  3HZ4 A;  3LXZ A;  5C04 A;  3C8E A;  2R2J A;  1DUG A;  4KAE A;  3O6T A;  1A0F A;  4L8E A;  4J2F A;  1O8X A;  1FB6 A;  2V2G A;  5ECN B;  1DE2 A;  2NVL A;  4X43 A;  1GP1 A;  4PUF C;  3WD6 A;  2LNS A;  1OC9 B;  1C72 A;  5ECS A;  1RQM A;  3TKS C;  1YKC A;  3KGK A;  3BD2 A;  1Q4J A;  4GQC A;  5IMZ A;  1XWG A;  4GXZ A;  4JR4 A;  1X0R A;  1GWC A;  2O7K A;  4K8M A;  3KH7 A;  4PQ1 A;  2CX3 A;  2HRK A;  2FWH A;  1GTB A;  5G30 A;  2TIR A;  4ACS A;  4N0V A;  2FY6 A;  1DBY A;  4HUA A;  1AAZ A;  4XS1 A;  2GT5 A;  1T00 A;  4POB A;  3P8W A;  2N5F A;  1BQ7 A;  1ACV A;  3IPZ A;  5JWO B;  3DD3 A;  1XPV A;  1TI1 A;  2IWT A;  5E4W A;  2C0G A;  4PTS A;  3GTU B;  1KBN A;  2H0I A;  4WET A;  3NIV A;  3GRX A;  1TKD B;  1V98 A;  1TDI A;  4OWY A;  1ZYQ B;  3DWV A;  3GUR A;  3LEF A;  5J5N A;  1OAZ A;  3G7Y A;  1QMV A;  5DCG A;  3APO A;  1RK4 A;  2J9H A;  2KP2 A;  2YAN A;  2H1A A;  5IIZ A;  3M3M A;  3GH9 A;  2FUG 2;  2L5L A;  3HA9 A;  4ZL7 A;  2VCV A;  2R5G A;  1YDK A;  1V57 A;  4RQX A;  1K3O A;  2KLX A;  4IEL A;  4K5R A;  5EL8 A;  5IMF A;  1SKR B;  2VOC A;  3IDV A;  4TVE A;  3D4T A;  3TJK A;  5FHI A;  5LD0 A;  1WJK A;  4K7O A;  3UOM A;  2CZ2 A;  1A2J A;  3IC4 A;  3HVX A;  3A2W A;  1B4Q A;  2AV4 A;  3ZFL A;  4EE0 A;  5J9C A;  4WEY A;  4EDZ A;  4H86 A;  4I5Q A;  1GSD A;  1YEP A;  3HD5 A;  3O3T A;  1Z6M A;  2YV7 A;  4F0B A;  5DAK B;  1X5D A;  1B9Y C;  5ENU A;  3PGT A;  3CSJ A;  1H4O A;  1FOV A;  4F2I A;  2R0G A;  2XPE A;  4MNN A;  5D9X A;  2OBK A;  1PKW A;  2B1L A;  4PUR A;  1BX9 A;  4TR1 A;  5DDL A;  4PX1 A;  2O85 A;  4J56 E;  3H8Q A;  4OFN A;  1Z5Y E;  2JZT A;  4HOJ A;  2VL2 A;  3MWH A;  2PGT A;  4TRX A;  1AQV A;  5DAL B;  4PNF A;  2R6K A;  3ZTL A;  1H75 A;  2FWG A;  4HDE A;  3UVH A;  4FQU A;  3ME7 A;  3OR5 A;  2ZUP A;  5AIX A;  3P2A A;  2H0G A;  5GSS A;  1NW2 A;  1AQW A;  4LL4 B;  1XBS A;  3A5W A;  1GUK A;  2ON7 A;  2YWO A;  3QOU A;  4EL1 A;  2GGT A;  1IYI A;  2LJR A;  3ZMK A;  1CQG A;  4J57 E;  4OCF A;  2H1D A;  5G5F A;  2WRT A;  2CV4 A;  4KCA A;  3IK9 A;  3KP9 A;  1M3J A;  4BWQ A;  3IV4 A;  1ST9 A;  2VL9 A;  5HQP A;  4IKH A;  2LJK A;  4RI6 A;  4LMW A;  1XW5 A;  4X4J A;  3D6I A;  2JU5 A;  2JZR A;  4KF9 A;  1HNA A;  4KSO A;  3SBC A;  3GYK A;  1TW9 A;  3GMF A;  4YKF A;  3TRX A;  3U5R E;  2H72 A;  3ZVJ D;  4AGS A;  2VCQ A;  3HDC A;  2E2M A;  2DJ2 A;  3DRN A;  3HHV A;  5LCZ A;  4EIQ A;  3TJG A;  4F03 A;  1URM A;  3G9B A;  2HXK A;  1OC3 A;  1M3I A;  4WXT A;  3FR3 A;  1FHE A;  2WUL A;  1USB A;  2M80 A;  2OJL A;  3TDG A;  4E8E A;  4ISD A;  4GWR A;  1M9A A;  3GL3 A;  5KEJ A;  1V9W A;  2HZE A;  4LMV A;  3L78 A;  5J41 A;  1VF2 A;  3HVS A;  3PH9 A;  1PA3 A;  3KXO A;  3QFA C;  2B3S A;  6GSW A;  5J4U A;  1JHB A;  5B6M A;  3ZRE A;  1R4W A;  3DML A;  2YWN A;  3U6V A;  3M9K A;  3MNG A;  2DJK A;  3GKK A;  5IMV A;  4KH7 A;  5CNW A;  5ELA A;  2IFQ A;  3DGQ A;  4KDX A;  3ED3 A;  1T3B A;  3GUS A;  3KP8 A;  3NOF A;  4LLR A;  2IN3 A;  4MA9 A;  4FO5 A;  2V6K A;  3DXB A;  4OCE A;  1YKA A;  3F4R A;  1EV4 A;  1SJI A;  2H71 A;  5IQY A;  1GL8 A;  2R0C A;  3GV1 A;  2KHP A;  1KNG A;  2A4H A;  2EIQ A;  4O5U A;  1W4V A;  2YNX A;  4KE3 A;  2BMX A;  3TRP A;  4O92 A;  2VLU A;  4Z2T A;  5CRE A;  2QC7 A;  2HRA A;  3D22 A;  3P90 A;  3UMA A;  5ECI B;  4KX4 A;  4TR1 B;  1JLW A;  3D0Z A;  4Q5R A;  3WT1 A;  3TKS A;  2PMT A;  2AB6 A;  4ZBA A;  5CRG A;  3LFL A;  4CY8 A;  4XTS A;  1EGR A;  1OYJ A;  1ZYN A;  2B7K A;  2JAC A;  2H01 A;  1Z9H A;  1PQN A;  3VWV A;  1R5A A;  2C3Q A;  4WBR D;  4MPF A;  1ZCP A;  4E8H A;  4KDY A;  1ABA A;  2LEG A;  2QKE A;  2QA1 A;  1Z3E A;  5DVB A;  1GUL A;  3IBH A;  5GAN D;  4G2E A;  3EU4 A;  1N2A A;  2DIZ A;  1Z7P A;  1M7T A;  4JBB A;  3GL5 A;  4BWS A;  3LWA A;  1EZK A;  2L6D A;  3H1N A;  5ECL B;  3IAS 2;  5IO0 A;  1SYX A;  5ECQ B;  1R7H A;  2X8C A;  3EC3 A;  1A24 A;  2XBQ A;  3LXT A;  4HZ2 A;  3Q74 A;  1J9B A;  2E0Q A;  1VF1 A;  3VI5 A;  8GSS A;  4XS4 A;  1MTC A;  2H6Z A;  4EDY A;  2H19 A;  2DJ1 A;  3VWU A;  3FR6 A;  1TJD A;  1B4P A;  2FA4 A;  1Q98 A;  1SL0 B;  5IOX A;  3D21 A;  5IM9 A;  1GH2 A;  2R4V A;  2C0F A;  2GSR A;  2B1K A;  4NWY A;  1S3A A;  3IE3 A;  3UVT A;  2VCZ A;  2C3N A;  4EC0 A;  3ERG A;  1TRW A;  4HSC X;  2HE3 A;  2HLS A;  1FOH A;  3IHG A;  5F06 A;  5FT3 A;  2X99 A;  4O5Q A;  2MBT A;  4WF5 A;  1XOB A;  3BCK A;  3RBT A;  1I9D A;  3H93 A;  3IRA A;  1SK0 A;  5JWQ B;  2NPB A;  3LJR A;  2V1M A;  5H5S A;  1FVK A;  1TK8 B;  22GS A;  2HZE B;  20GS A;  1WMJ A;  5JCW A;  5B8A A;  6GST A;  4MMM A;  2YJH A;  3F3Q A;  2RM6 A;  2RUE A;  3KIJ A;  3VFI A;  3QPM A;  2GLR A;  2ON5 A;  1UVZ A;  1ERU A;  1FAA A;  3VPT A;  1EGO A;  2HNL A;  4OO5 A;  4GCI A;  5DAK A;  2DJJ A;  5EVO A;  3F8U A;  2BTO T;  3HVN A;  3DVX A;  1JZD A;  2CVB A;  1MDK A;  4F0C A;  3K8N A;  2IME A;  4RI7 A;  4JRR A;  2GST A;  4JED A;  2GQM A;  5D9T A;  3WGE A;  4HQZ A;  2YWM A;  2F8A A;  3TKS E;  2JL4 A;  2H66 A;  3KTB A;  3W6G A;  4BVY B;  3EIN A;  2KUC A;  4DSR A;  1IYH A;  4FH8 A;  5DAL A;  2H73 A;  4MJE A;  5DBQ A;  2VCT A;  3TUE A;  4BPY A;  4OD7 A;  1G7O A;  3ERW A;  2VAF A;  3GFK A;  1QQ2 A;  4OMV A;  2O8V B;  2CX4 A;  5G1K A;  3J7Y k;  2PBJ A;  1UN2 A;  3G7I A;  4ZB8 A;  3VI7 A;  2HYX A;  3PPU A;  2CVK A;  3VPQ A;  4MH3 A;  1TK0 B;  4TXV A;  4IN0 A;  2ZNM A;  1QGV A;  5CYY A;  2GZP A;  5FWG A;  4GSN A;  5CRH A;  4YKG A;  4K1F A;  3D4M A;  3L0H A;  2P31 A;  3NZN A;  1LJR A;  4GST A;  1EP7 A;  2FGX A;  17GS A;  3GKM A;  2K6V A;  3GSS A;  3UIW A;  2MYG A;  4XS4 B;  3BCI A;  4CHS A;  3TGZ A;  3I9V 2;  1T4Z A;  1GTI A;  1PN9 A;  1E6B A;  1G6Y A;  1ZOF A;  1YF0 A;  2YPM A;  4YAP A;  3EVI A;  2CAQ A;  4I2T A;  3QMX A;  4MDC A;  3UL3 A;  2L5O A;  4TR3 A;  2LRN A;  3APS A;  1BJX A;  1O7U A;  1ERW A;  1R26 A;  2N5B A;  3GKN A;  2DBC A;  4FYB A;  4ZB9 A;  1O73 A;  2D2Z A;  3W8J A;  1N8J A;  3L9U A;  3HJO A;  4I8B A;  2H0H A;  4K7I A;  1SKS B;  3F6D A;  1G6W A;  1EP8 A;  2V6O A;  2TRX A;  3UAR A;  2DML A;  2LJA A;  3WYW A;  2DSA A;  1TTZ A;  1GSU A;  2GZY A;  1UC7 A;  2FHE A;  2CT6 A;  4EVM A;  2I3Y A;  4K9Z A;  2PN8 A;  1BYE A;  3TB2 A;  4BIK A;  2LNT A;  2MMN A;  1K3Y A;  3L4N A;  4N10 A;  5HR3 A;  1YJ6 A;  4MCU A;  3GX8 A;  3KMO A;  1T8E B;  1AQX A;  3ZL5 A;  2GTU A;  3TOT A;  3UJ1 A;  10GS A;  5KN1 A;  3CTF A;  4FYU A;  2L6C A;  1OVN A;  3LG6 A;  1K0D A;  5DCH A;  1VRS D;  3CTG A;  2VD0 A;  3RDW A;  3DIE A;  1XOA A;  2C4J A;  1AIU A;  5B7C A;  4Q5F A;  4TR0 A;  3FZ9 A;  4HU7 A;  1U3A A;  5D96 A;  4ZXG A;  1YF1 A;  2LRT A;  1U6T A;  1F3B A;  1XVQ A;  1SEN A;  3W8S A;  5IMA A;  4K0N A;  2OAD A;  4POL A;  1K0A A;  2IMD A;  4TR4 A;  2C0E A;  2C3T A;  5HR1 A;  3VLN A;  5KOW A;  4HZ4 A;  3HCZ A;  1DSB A;  2K9F A;  5CAX A;  1BG5 A;  3TJB A;  1TRS A;  1QUW A;  1KEB A;  2I1U A;  3Q18 A;  4MZB A;  4MF6 A;  1JFU A;  3GA4 A;  2P5Q A;  4WF4 A;  1SL2 B;  2DJ3 A;  3C1R A;  2HFD A;  2FD3 A;  2OA7 A;  3I6A A;  5D73 A;  3D5J A;  5DJL A;  1M2A A;  1SD9 A;  4NAX A;  1PKZ A;  1SK2 A;  4POM A;  4P3Y B;  5HR2 A;  5IPH A;  3KM6 A;  3ME8 A;  3KD0 A;  4G19 A;  4I97 A;  1TU8 A;  2XHF A;  1ZL9 A;  2YOI A;  4JR6 A;  4ECI A;  1M9B A;  4EUY A;  1WRY A;  2OE3 A;  2IMF A;  3KZQ A;  3WGX A;  4G9H A;  4EXJ A;  5G1L A;  4MJC A;  2AYT A;  4ZBB A;  2JAD A;  2XBI A;  2PER A;  1OC8 A;  4ZIL A;  5E59 A;  2LQQ A;  3CRU A;  4HJM A;  5AIV A;  5B6N A;  1AUC A;  4USS A;  2WDU A;  16GS A;  4L0U A;  1EOG A;  2V32 A;  2I9H A;  3WT2 A;  4ZBD A;  2Z9S A;  1O8W A;  3G7J A;  2JSY A;  3F9U A;  1XWK A;  3FMW A;  3UBK A;  2LRC A;  1ZMA A;  5F05 A;  4HJ2 A;  3A2X A;  2WCI A;  5DJM A;  4MJB A;  3TKQ A;  1SJZ A;  4GQF A;  3EU3 A;  1KTE A;  3IOS A;  1HYU A;  3RAZ A;  4AJ6 A;  1PN0 A;  1B9X C;  4LL1 B;  2QA2 A;  5ECK B;  1TI3 A;  4CDO A;  1A8Y A;  2WJU A;  3CSI A;  4HEA 2;  1A2L A;  3FZA A;  1GSS A;  3I69 A;  1XW6 A;  3QAG A;  1SK1 A;  1U3I A;  3Q6O A;  2H1B A;  2A2P A;  1A2M A;  4ID0 A; 
#chains in the Genus database with same CATH homology
 1HD2 A;  1AW9 A;  3TKR A;  3HZ8 A;  1M2B A;  2LST A;  1XZO A;  2RUF A;  2DC5 A;  2A4V A;  3L9V A;  2LV3 A;  2O87 A;  4MK3 A;  4WBJ A;  5ABR A;  4TN8 A;  1QXH A;  4HS1 A;  1ERT A;  2LS5 A;  4V2L A;  1W89 A;  4BVY A;  2FA8 A;  1K0O A;  3C7M A;  3L9S A;  1NHO A;  2DJ0 A;  4AJ8 A;  2PWJ A;  4IQA A;  3IK7 A;  5A4W A;  4NV2 A;  4MLY A;  1G0T A;  1M2D A;  1O81 A;  3DVW A;  3S9F A;  1EEM A;  3HYP A;  3ISO A;  4ULX A;  4NXI A;  5INY A;  3ZML A;  2ZCT A;  3CSH A;  1GNW A;  3RPP A;  4BA7 A;  1GSF A;  1J0F A;  5HFK A;  1TOF A;  4YQU A;  2IL3 A;  2OE1 A;  3J7Y b;  12GS A;  2RM5 A;  5HFG A;  2E7P A;  4FIW A;  3ZIT A;  1OKD A;  1ON4 A;  1F9M A;  2X49 A;  2NDO A;  2X4A A;  3KCM A;  1K3L A;  4MZW A;  4ECB A;  5CRW A;  2X64 A;  1X9S B;  3BBY A;  1MD4 A;  3LW9 A;  2IMK A;  5COH A;  3QAW A;  1A0R P;  4GF0 A;  6GSY A;  1XFL A;  4RUV A;  4BVX A;  1GNE A;  3ZIJ A;  5DQS A;  3LQ7 A;  2OBI A;  4AF2 A;  3VK9 A;  2KOK A;  3EPT A;  3F3R A;  4XRA A;  2UZ8 A;  3EMX A;  4ECJ A;  3EMP A;  1WOU A;  4IJ3 A;  5A4V A;  4YQM A;  2VO4 A;  3CYN A;  1YEX A;  2GSS A;  4Z2R A;  2PU9 C;  1JZW A;  3GIX A;  3FRC A;  3IR4 A;  1R5P A;  3ZRD A;  2MMO A;  11GS A;  3RHC A;  6GSS A;  4DEJ A;  5G2Z A;  1MDJ A;  2NBS A;  1FW1 A;  2X8G A;  3RPN A;  1GTU A;  1Y6E A;  1SKW B;  3KMN A;  1RW1 A;  1VF3 A;  2HSH A;  1VF4 A;  2VCW A;  2YN1 A;  5D9W A;  2YV9 A;  3ZVJ A;  4MF5 A;  4GTU A;  5KN0 A;  2WZ9 A;  2QSI A;  4IJI A;  3LSZ A;  1VGL A;  1F3A A;  2VD1 A;  2AJQ B;  3MAK A;  4K2X A;  5GST A;  3GNJ A;  3FZ4 A;  5ECM B;  2B7J A;  2CZ3 A;  3M0F A;  4KW6 A;  3R3E A;  1QK8 A;  3N9J A;  4KSM A;  1WP0 A;  1NM3 A;  2YZU A;  1ZYP A;  4JU5 A;  4EO3 A;  5LNK e;  1A23 A;  2NTO A;  2VLT A;  2GVP A;  2MMA A;  4V2N A;  3EUR A;  5JWR B;  1Z7R A;  3E0U A;  2LKU A;  3FW2 A;  3DEX A;  4MF7 A;  1HNC A;  1EV9 A;  4KCE A;  3FK8 A;  4JE1 A;  4NV5 A;  3HXS A;  2G0F A;  3FYG A;  19GS A;  1WIK A;  4MP4 A;  2VUP A;  2WFC A;  2IJY A;  2CQ9 A;  2H1G A;  4K6X A;  5HFI A;  1SU9 A;  4IVF A;  1ZZY A;  2BJX A;  1TK5 B;  3FKF A;  2HSY A;  5IPG A;  1CQH A;  1PD2 1;  2H8L A;  3FY7 A;  4BL7 A;  1T1V A;  3HY2 A;  5D8I A;  5JCU A;  4IP1 A;  4CY6 A;  2H6X A;  1XW9 A;  1Z6N A;  1K0N A;  5HR0 A;  2JSZ A;  2CVD A;  4PNG A;  4POK A;  2A2S A;  4N11 A;  3LGC A;  2RII A;  5ID2 B;  3ERF A;  4G0L A;  2MMZ A;  14GS A;  3V1W A;  5BMU A;  4XCS A;  3A2V A;  2H6Y A;  4OFM A;  3M1G A;  4ZIJ A;  4FYC A;  4QL9 A;  3GX0 A;  3GHA A;  5F07 A;  3HJM A;  18GS A;  3N5O A;  2FNO A;  4QL7 A;  2O89 A;  2M72 A;  1BED A;  4IP6 A;  2YCD A;  4CW9 A;  4AJ7 A;  2LUS A;  1PRX A;  4KA0 A;  2YP6 A;  2JZS A;  2REM A;  4BVX B;  1GLP A;  5EY6 A;  2AHE A;  5ELG A;  4MH2 A;  1NSW A;  3JCM L;  5IO2 A;  4O7H A;  2VM2 A;  1XWC A;  1FB0 A;  3Q19 A;  5JCG A;  2AAW A;  1JLV A;  1TP9 A;  3CXG A;  2R0P A;  4DSS A;  2WS2 A;  1THO A;  1K0M A;  2DIY A;  2GSQ A;  4K5S A;  2FWF A;  3VWW A;  3C71 A;  3O76 A;  3ZFB A;  1X5E A;  3QFB C;  1ILO A;  4I6X A;  5F8B A;  5D9V A;  3CMI A;  2C8U A;  3CRT A;  1EWX A;  5GAP D;  3HJP A;  2K18 A;  4EIP A;  1T4Y A;  4TXO A;  3A5I A;  5EPF A;  5B8B A;  1OKT A;  2M46 A;  2HRF A;  2B5Y A;  2K8V A;  2P0G A;  9GSS A;  3HVV A;  2DKH A;  2EIO A;  3KJY A;  2IPA A;  4KUN A;  4XIH A;  1XWA A;  3VUR A;  4D73 B;  1MDI A;  1HQO A;  1PL2 A;  5IMC A;  4WR5 A;  2VL3 A;  3FR9 A;  4NHW A;  2GS3 A;  1U88 A;  2L4C A;  1GLQ A;  1O85 A;  5KOX A;  3E9J B;  4YQV A;  5G31 A;  1F2E A;  2H74 A;  3H4K A;  2VIM A;  5IOW A;  1OE7 A;  2C0D A;  1PX7 A;  2YZH A;  1GSY A;  1JZO A;  1DE1 A;  4ECC A;  4IW9 A;  1EOH A;  2FWE A;  4WKW A;  1XWB A;  5IMD A;  2PVQ A;  1WE0 A;  5G5E A;  1SD8 A;  2IIY A;  4KB3 A;  2EIR A;  4MJA A;  3C1S A;  2PUK C;  5ECR B;  1K0B A;  2MZC A;  2R3X A;  4XHM A;  2IMI A;  3R2Q A;  3AY8 A;  2CA8 A;  5DQY A;  3GKX A;  4IQ1 A;  3KEB A;  1X9W B;  1PSQ A;  1MD3 A;  3PIN A;  4K0G A;  4PQI A;  4HQS A;  5KN2 A;  2N5A A;  4A5P A;  4BL7 B;  4ICY A;  4TOP A;  5BRT A;  5J9B A;  1THX A;  3EYT A;  2OE0 A;  4ML1 A;  4YH2 A;  1JZR A;  3CBU A;  4Z2U A;  5J3R A;  2A2R A;  2HT9 A;  1TRU A;  2G2Q A;  2L57 A;  3H79 A;  1K0C A;  1HNB A;  2ALB A;  3F6F A;  1ERV A;  3EE2 A;  2QGV A;  3MIX A;  6GSV A;  2YWI A;  4GRF A;  1XCC A;  1OE8 A;  5AIS A;  2GDR A;  4IS0 A;  3RHB A;  1WPI A;  3QCP A;  4KND A;  1TRV A;  1BAY A;  2TRC P;  4G10 A;  2H75 A;  2VM1 A;  3WGD A;  2XPD A;  1GTA A;  3GH6 A;  3LOR A;  3BJ5 A;  1J08 A;  1V2A A;  3KH9 A;  5A4U A;  4I2U A;  4ZL8 A;  4IBP A;  5D93 A;  2YJ7 A;  3QDN A;  2FLS A;  1UA5 A;  4V1A g;  3TRQ A;  3VWX A;  2B5E A;  6GSX A;  1U87 A;  4DSS B;  2FCH A;  5F0G A;  3E3E A;  4RQR A;  3LYP A;  4KGI A;  1M99 A;  1PL1 A;  4NMU A;  1ZGN A;  5A5K A;  4G0I A;  2P5R A;  2F51 A;  2LTK A;  1GUM A;  1X5C A;  4V2M A;  4DSQ A;  2H70 A;  5H5Q A;  1GRX A;  5ECH B;  3ZZX A;  3TJF A;  4XRD A;  5L71 A;  2I4A A;  2OKA A;  4TXO B;  3UBL A;  1AXD A;  2F8F A;  4X1U A;  1M0U A;  3QR6 A;  2KP1 A;  3GN3 A;  4EF0 A;  4OFT A;  2PVO C;  4L5O A;  1S3D A;  4MZC A;  3I43 A;  1FO5 A;  1V40 A;  4ILF A;  2K8S A;  1QFN A;  2HSM A;  3IHQ A;  4GLT A;  2I81 A;  4Q5N A;  3ZIV A;  2HRN A;  1B8X A;  3TJJ A;  1T7P B;  4PGT A;  1S3C A;  3IA1 A;  2V41 A;  4PXO A;  1V58 A;  2WB9 A;  3UEM A;  4Z7X A;  1F37 A;  1ZYE A;  2GZZ A;  2HZF A;  2GQL A;  4F9Z A;  3QAV A;  2MBS A;  1XVW A;  2PPT A;  4MAB A;  1GSQ A;  1PGT A;  2ES7 A;  4O5R A;  1Y25 A;  3M9J A;  3MSZ A;  2B6M A;  4G0K A;  1TXX A;  3APQ A;  3ZLP A;  4V1A p;  1OC9 A;  5ID2 A;  3F4S A;  5CO3 A;  13GS A;  1AC1 A;  2VL2 C;  1G7E A;  5ECP B;  5CRD A;  1GUH A;  3F4T A;  3TOU A;  2OAC A;  2J23 A;  2X8H A;  2RLI A;  3F63 A;  5GZZ B;  1E2Y A;  2B5X A;  1X9M B;  3QD9 A;  1WWJ A;  1FVJ A;  3FZ5 A;  5CP1 A;  4KDU A;  2DLX A;  5C00 A;  1GSE A;  4IGJ A;  1SYR A;  3IXR A;  4OO4 A;  1PMT A;  1EEJ A;  2AUV A;  3MYD A;  2CAI A;  4NPB A;  2VCX A;  4X0X A;  4WR4 A;  1LU4 A;  1LBK A;  3HKR A;  2L59 A;  1YQ1 A;  3C73 A;  3LYK A;  3A3T A;  1TU7 A;  1B48 A;  4EKZ A;  3US3 A;  3GTU A;  6GSU A;  4PQH A;  3KTL A;  2WGR A;  4MPG A;  4PUA A;  3FHK A;  3GST A;  5H5R A;  4L5L A;  1YZX A;  2L4Q A;  1PX6 A;  1XIY A;  4Q5Q A;  2E2G A;  1SL1 B;  2GQK A;  1YY7 A;  1SJ6 A;  1A8L A;  1O6J A;  3TKP A;  2R37 A;  2DMM A;  4HU9 A;  3MDK A;  4F82 A;  1NHY A;  2HI7 A;  3M8N A;  1ML6 A;  4D73 A;  2H76 A;  5ECO B;  4IHU A;  3DYR A;  1F6M C;  1I5G A;  4TW5 A;  2EC4 A;  5AGY A;  3P7X A;  2F3M A;  3IAM 2;  2C80 A;  2DKI A;  3IC8 A;  4L0W A;  4O32 A;  3F0I A;  5AN1 A;  1FG4 A;  2LQO A;  4K2D A;  3ZYW A;  2C1Y A;  2IFQ B;  4XS6 A;  2GT6 A;  3UAP A;  1MEK A;  2F9S A;  4N0Z A;  3PR8 A;  2VLV A;  3BOA A;  4HI7 A;  4JZQ A;  4DVC A;  2XC2 A;  4ZB6 A;  2H30 A;  3FEU A;  4QQ7 A;  3TCO A;  1XXU A;  5KN3 A;  4TKY A;  4YAV A;  4K7N A;  4GSS A;  4NHZ A;  3DKS A;  4LA1 A;  4ZL9 A;  3SWL A;  7GSS A;  3EWL A;  4ML6 A;  4N30 A;  3HZ4 A;  3LXZ A;  5C04 A;  3C8E A;  2R2J A;  1DUG A;  4KAE A;  3O6T A;  1A0F A;  4L8E A;  4J2F A;  1O8X A;  1FB6 A;  2V2G A;  5ECN B;  1DE2 A;  2NVL A;  4X43 A;  1GP1 A;  4PUF C;  3WD6 A;  2LNS A;  1OC9 B;  1C72 A;  5ECS A;  1RQM A;  3TKS C;  1YKC A;  3KGK A;  3BD2 A;  1Q4J A;  4GQC A;  5IMZ A;  1XWG A;  4GXZ A;  4JR4 A;  1X0R A;  1GWC A;  2O7K A;  4K8M A;  3KH7 A;  4PQ1 A;  2CX3 A;  2HRK A;  2FWH A;  1GTB A;  5G30 A;  2TIR A;  4ACS A;  4N0V A;  2FY6 A;  1DBY A;  4HUA A;  1AAZ A;  4XS1 A;  2GT5 A;  1T00 A;  4POB A;  3P8W A;  2N5F A;  1BQ7 A;  1ACV A;  3IPZ A;  5JWO B;  3DD3 A;  1XPV A;  1TI1 A;  2IWT A;  5E4W A;  2C0G A;  4PTS A;  3GTU B;  1KBN A;  2H0I A;  4WET A;  3NIV A;  3GRX A;  1TKD B;  1V98 A;  1TDI A;  4OWY A;  1ZYQ B;  3DWV A;  3GUR A;  3LEF A;  5J5N A;  1OAZ A;  3G7Y A;  1QMV A;  5DCG A;  3APO A;  1RK4 A;  2J9H A;  2KP2 A;  2YAN A;  2H1A A;  5IIZ A;  3M3M A;  3GH9 A;  2FUG 2;  2L5L A;  3HA9 A;  4ZL7 A;  2VCV A;  2R5G A;  1YDK A;  1V57 A;  4RQX A;  1K3O A;  2KLX A;  4IEL A;  4K5R A;  5EL8 A;  5IMF A;  1SKR B;  2VOC A;  3IDV A;  4TVE A;  3D4T A;  3TJK A;  5FHI A;  5LD0 A;  1WJK A;  4K7O A;  3UOM A;  2CZ2 A;  1A2J A;  3IC4 A;  3HVX A;  3A2W A;  1B4Q A;  2AV4 A;  3ZFL A;  4EE0 A;  5J9C A;  4WEY A;  4EDZ A;  4H86 A;  4I5Q A;  1GSD A;  1YEP A;  3HD5 A;  3O3T A;  1Z6M A;  2YV7 A;  4F0B A;  5DAK B;  1X5D A;  1B9Y C;  5ENU A;  3PGT A;  3CSJ A;  1H4O A;  1FOV A;  4F2I A;  2R0G A;  2XPE A;  4MNN A;  5D9X A;  2OBK A;  1PKW A;  2B1L A;  4PUR A;  1BX9 A;  4TR1 A;  5DDL A;  4PX1 A;  2O85 A;  4J56 E;  3H8Q A;  4OFN A;  1Z5Y E;  2JZT A;  4HOJ A;  2VL2 A;  3MWH A;  2PGT A;  4TRX A;  1AQV A;  5DAL B;  4PNF A;  2R6K A;  3ZTL A;  1H75 A;  2FWG A;  4HDE A;  3UVH A;  4FQU A;  3ME7 A;  3OR5 A;  2ZUP A;  5AIX A;  3P2A A;  2H0G A;  5GSS A;  1NW2 A;  1AQW A;  4LL4 B;  1XBS A;  3A5W A;  1GUK A;  2ON7 A;  2YWO A;  3QOU A;  4EL1 A;  2GGT A;  1IYI A;  2LJR A;  3ZMK A;  1CQG A;  4J57 E;  4OCF A;  2H1D A;  5G5F A;  2WRT A;  2CV4 A;  4KCA A;  3IK9 A;  3KP9 A;  4BWQ A;  3IV4 A;  1ST9 A;  2VL9 A;  5HQP A;  4IKH A;  2LJK A;  4RI6 A;  4LMW A;  1XW5 A;  4X4J A;  3D6I A;  2JU5 A;  2JZR A;  4KF9 A;  1HNA A;  4KSO A;  3SBC A;  3GYK A;  1TW9 A;  3GMF A;  4YKF A;  3TRX A;  3U5R E;  2H72 A;  3ZVJ D;  4AGS A;  2VCQ A;  3HDC A;  2E2M A;  2DJ2 A;  3DRN A;  3HHV A;  5LCZ A;  4EIQ A;  3TJG A;  4F03 A;  1URM A;  3G9B A;  2HXK A;  1OC3 A;  4WXT A;  3FR3 A;  1FHE A;  2WUL A;  1USB A;  2M80 A;  2OJL A;  3TDG A;  4E8E A;  4ISD A;  4GWR A;  1M9A A;  3GL3 A;  5KEJ A;  1V9W A;  2HZE A;  4LMV A;  3L78 A;  5J41 A;  1VF2 A;  3HVS A;  3PH9 A;  1PA3 A;  3KXO A;  3QFA C;  2B3S A;  6GSW A;  5J4U A;  1JHB A;  5B6M A;  3ZRE A;  1R4W A;  3DML A;  2YWN A;  3U6V A;  3M9K A;  3MNG A;  2DJK A;  3GKK A;  5IMV A;  4KH7 A;  5CNW A;  5ELA A;  2IFQ A;  3DGQ A;  4KDX A;  3ED3 A;  1T3B A;  3GUS A;  3KP8 A;  3NOF A;  4LLR A;  2IN3 A;  4MA9 A;  4FO5 A;  2V6K A;  3DXB A;  4OCE A;  1YKA A;  3F4R A;  1EV4 A;  1SJI A;  2H71 A;  5IQY A;  1GL8 A;  2R0C A;  3GV1 A;  2KHP A;  1KNG A;  2A4H A;  2EIQ A;  4O5U A;  1W4V A;  2YNX A;  4KE3 A;  2BMX A;  3TRP A;  4O92 A;  2VLU A;  4Z2T A;  5CRE A;  2QC7 A;  2HRA A;  3D22 A;  3P90 A;  3UMA A;  5ECI B;  4KX4 A;  4TR1 B;  1JLW A;  3D0Z A;  4Q5R A;  3WT1 A;  3TKS A;  2PMT A;  2AB6 A;  4ZBA A;  5CRG A;  3LFL A;  4CY8 A;  4XTS A;  1EGR A;  1OYJ A;  1ZYN A;  2B7K A;  2JAC A;  2H01 A;  1Z9H A;  1PQN A;  3VWV A;  1R5A A;  2C3Q A;  4WBR D;  4MPF A;  1ZCP A;  4E8H A;  4KDY A;  1ABA A;  2LEG A;  2QKE A;  2QA1 A;  1Z3E A;  5DVB A;  1GUL A;  3IBH A;  5GAN D;  4G2E A;  3EU4 A;  1N2A A;  2DIZ A;  1Z7P A;  1M7T A;  4JBB A;  3GL5 A;  4BWS A;  3LWA A;  1EZK A;  2L6D A;  3H1N A;  5ECL B;  3IAS 2;  5IO0 A;  1SYX A;  5ECQ B;  1R7H A;  2X8C A;  3EC3 A;  1A24 A;  2XBQ A;  3LXT A;  4HZ2 A;  3Q74 A;  1J9B A;  2E0Q A;  1VF1 A;  3VI5 A;  8GSS A;  4XS4 A;  1MTC A;  2H6Z A;  4EDY A;  2H19 A;  2DJ1 A;  3VWU A;  3FR6 A;  1TJD A;  1B4P A;  2FA4 A;  1Q98 A;  1SL0 B;  5IOX A;  3D21 A;  5IM9 A;  1GH2 A;  2R4V A;  2C0F A;  2GSR A;  2B1K A;  4NWY A;  1S3A A;  3IE3 A;  3UVT A;  2VCZ A;  2C3N A;  4EC0 A;  3ERG A;  1TRW A;  2HE3 A;  2HLS A;  1FOH A;  3IHG A;  5F06 A;  5FT3 A;  2X99 A;  4O5Q A;  2MBT A;  4WF5 A;  1XOB A;  3BCK A;  3RBT A;  1I9D A;  3H93 A;  3IRA A;  1SK0 A;  5JWQ B;  2NPB A;  3LJR A;  2V1M A;  5H5S A;  1FVK A;  1TK8 B;  22GS A;  2HZE B;  20GS A;  1WMJ A;  5JCW A;  5B8A A;  6GST A;  4MMM A;  2YJH A;  3F3Q A;  2RM6 A;  2RUE A;  3KIJ A;  3VFI A;  3QPM A;  2GLR A;  2ON5 A;  1UVZ A;  1ERU A;  1FAA A;  3VPT A;  1EGO A;  2HNL A;  4OO5 A;  4GCI A;  5DAK A;  2DJJ A;  5EVO A;  3F8U A;  2BTO T;  3DVX A;  1JZD A;  2CVB A;  1MDK A;  4F0C A;  3K8N A;  2IME A;  4RI7 A;  4JRR A;  2GST A;  4JED A;  2GQM A;  5D9T A;  3WGE A;  4HQZ A;  2YWM A;  2F8A A;  3TKS E;  2JL4 A;  2H66 A;  3KTB A;  3W6G A;  4BVY B;  3EIN A;  2KUC A;  4DSR A;  1IYH A;  4FH8 A;  5DAL A;  2H73 A;  4MJE A;  5DBQ A;  2VCT A;  3TUE A;  4BPY A;  4OD7 A;  1G7O A;  3ERW A;  2VAF A;  3GFK A;  1QQ2 A;  4OMV A;  2O8V B;  2CX4 A;  5G1K A;  3J7Y k;  2PBJ A;  1UN2 A;  3G7I A;  4ZB8 A;  3VI7 A;  2HYX A;  3PPU A;  2CVK A;  3VPQ A;  4MH3 A;  1TK0 B;  4TXV A;  4IN0 A;  2ZNM A;  1QGV A;  5CYY A;  2GZP A;  5FWG A;  4GSN A;  5CRH A;  4YKG A;  4K1F A;  3D4M A;  3L0H A;  2P31 A;  3NZN A;  1LJR A;  4GST A;  1EP7 A;  2FGX A;  17GS A;  3GKM A;  2K6V A;  3GSS A;  3UIW A;  2MYG A;  4XS4 B;  3BCI A;  4CHS A;  3TGZ A;  3I9V 2;  1T4Z A;  1GTI A;  1PN9 A;  1E6B A;  1G6Y A;  1ZOF A;  1YF0 A;  2YPM A;  4YAP A;  3EVI A;  2CAQ A;  4I2T A;  3QMX A;  4MDC A;  3UL3 A;  2L5O A;  4TR3 A;  2LRN A;  3APS A;  1BJX A;  1O7U A;  1ERW A;  1R26 A;  2N5B A;  3GKN A;  2DBC A;  4FYB A;  4ZB9 A;  1O73 A;  2D2Z A;  3W8J A;  1N8J A;  3L9U A;  3HJO A;  4I8B A;  2H0H A;  4K7I A;  1SKS B;  3F6D A;  1G6W A;  1EP8 A;  2V6O A;  2TRX A;  3UAR A;  2DML A;  2LJA A;  3WYW A;  2DSA A;  1TTZ A;  1GSU A;  2GZY A;  1UC7 A;  2FHE A;  2CT6 A;  4EVM A;  2I3Y A;  4K9Z A;  2PN8 A;  1BYE A;  3TB2 A;  2LNT A;  2MMN A;  1K3Y A;  3L4N A;  4N10 A;  5HR3 A;  1YJ6 A;  4MCU A;  3GX8 A;  3KMO A;  1T8E B;  1AQX A;  3ZL5 A;  2GTU A;  3TOT A;  3UJ1 A;  10GS A;  5KN1 A;  3CTF A;  4FYU A;  2L6C A;  1OVN A;  3LG6 A;  1K0D A;  5DCH A;  1VRS D;  3CTG A;  2VD0 A;  3RDW A;  3DIE A;  1XOA A;  2C4J A;  1AIU A;  5B7C A;  4Q5F A;  4TR0 A;  3FZ9 A;  4HU7 A;  1U3A A;  5D96 A;  4ZXG A;  1YF1 A;  2LRT A;  1U6T A;  1F3B A;  1XVQ A;  1SEN A;  3W8S A;  5IMA A;  4K0N A;  2OAD A;  4POL A;  1K0A A;  2IMD A;  4TR4 A;  2C0E A;  2C3T A;  5HR1 A;  3VLN A;  5KOW A;  4HZ4 A;  3HCZ A;  1DSB A;  2K9F A;  5CAX A;  1BG5 A;  3TJB A;  1TRS A;  1QUW A;  1KEB A;  2I1U A;  3Q18 A;  4MZB A;  4MF6 A;  1JFU A;  3GA4 A;  2P5Q A;  4WF4 A;  1SL2 B;  2DJ3 A;  3C1R A;  2HFD A;  2FD3 A;  2OA7 A;  3I6A A;  5D73 A;  3D5J A;  5DJL A;  1M2A A;  1SD9 A;  4NAX A;  1PKZ A;  1SK2 A;  4POM A;  4P3Y B;  5HR2 A;  5IPH A;  3KM6 A;  3ME8 A;  3KD0 A;  4G19 A;  4I97 A;  1TU8 A;  2XHF A;  1ZL9 A;  2YOI A;  4JR6 A;  4ECI A;  1M9B A;  4EUY A;  1WRY A;  2OE3 A;  2IMF A;  3KZQ A;  3WGX A;  4G9H A;  4EXJ A;  5G1L A;  4MJC A;  2AYT A;  4ZBB A;  2JAD A;  2XBI A;  2PER A;  1OC8 A;  4ZIL A;  5E59 A;  2LQQ A;  3CRU A;  4HJM A;  5AIV A;  5B6N A;  1AUC A;  4USS A;  2WDU A;  16GS A;  4L0U A;  1EOG A;  2V32 A;  2I9H A;  3WT2 A;  4ZBD A;  2Z9S A;  1O8W A;  3G7J A;  2JSY A;  3F9U A;  1XWK A;  3FMW A;  3UBK A;  2LRC A;  1ZMA A;  5F05 A;  4HJ2 A;  3A2X A;  2WCI A;  5DJM A;  4MJB A;  3TKQ A;  1SJZ A;  4GQF A;  3EU3 A;  1KTE A;  3IOS A;  1HYU A;  3RAZ A;  4AJ6 A;  1PN0 A;  1B9X C;  4LL1 B;  2QA2 A;  5ECK B;  1TI3 A;  4CDO A;  1A8Y A;  2WJU A;  3CSI A;  4HEA 2;  1A2L A;  3FZA A;  1GSS A;  3I69 A;  1XW6 A;  3QAG A;  1SK1 A;  1U3I A;  3Q6O A;  2H1B A;  2A2P A;  1A2M A;  4ID0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...