2GQMA

Solution structure of human cu(i)-sco1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
173
structure length
173
Chain Sequence
SFTGKPLLGGPFSLTTHTGERKTDKDYLGQWLLIYFGFTHCPDVCPEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPYRKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SCO1 protein homolog, mitochondrial
publication title A hint for the function of human Sco1 from different structures.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 51
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2006-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02630 SCO1-SenC SCO1/SenC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2gqmA00
4V1Ap 1T7PB 3L0HA 2FUG2 2CA8A 3BJ5A 1TTZA 1XVWA 3O76A 2C8UA 3QPMA 4PUFC 3VFIA 5IOXA 1GRXA 3I43A 2VD1A 4KDXA 2X8GA 5ECQB 3G7IA 1SKWB 2AV4A 1WIKA 1FB0A 4NHZA 3VI7A 5DDLA 3UEMA 4KSOA 3S9FA 2OBKA 5ECKB 5JCWA 1TI1A 18GSA 3CSIA 3F3QA 3R2QA 2CZ2A 1WWJA 5JCGA 2C0EA 4N11A 3C1SA 4KH7A 3EMXA 2DSAA 2YJHA 3M8NA 2HI7A 3CMIA 5IPGA 4KW6A 5JWOB 1AQXA 3KMOA 3IV4A 4KX4A 1O8WA 17GSA 3DKSA 4NPBA 1SD8A 3VWVA 1DBYA 3SBCA 1UN2A 3A2WA 4TVEA 3IA1A 1WE0A 2B5XA 1SL2B 1HNCA 3A5WA 4NV2A 1O73A 2WB9A 3GA4A 2LNTA 1GSYA 3GKMA 2E2MA 3M0FA 2JZSA 5KN0A 1A2LA 2VO4A 2B1KA 1MD3A 1TRVA 4PNFA 3GH9A 4MDCA 2G2QA 5EVOA 3ZZXA 2YANA 4K9ZA 6GSUA 2RUEA 4TRXA 4WBJA 3FR9A 2LRTA 3VK9A 1VRSD 2L4QA 4MH3A 2LV3A 3L9UA 4QL9A 1XWAA 3LG6A 19GSA 2LQOA 1PKZA 4OMVA 1M0UA 2NTOA 4MF6A 2JZTA 1BYEA 2JSZA 4KB3A 3TGZA 5CRDA 2H1GA 4O92A 2DJJA 1SL0B 3KP9A 2X99A 3FZ4A 3QCPA 5G1KA 2DJKA 4KSMA 3VI5A 5IMCA 1JZOA 5CP1A 2I9HA 2RM6A 2MMOA 1KTEA 1ZZYA 2H66A 2IMDA 4G2EA 1LBKA 1U88A 2OE0A 1EZKA 4NXIA 4WEYA 1MDKA 3WD6A 2YJ7A 4EF0A 4L0WA 4JEDA 1XWBA 3JCML 1AAZA 3MDKA 2HSYA 3ZFLA 3VLNA 2B7KA 1ST9A 2B6MA 4X43A 5IIZA 5DAKA 1T1VA 2KLXA 3GV1A 6GSXA 1GLQA 1QXHA 4MJCA 1LJRA 3IBHA 3EMPA 4LA1A 2PVQA 1X9SB 3CRTA 4G19A 4GQCA 2HE3A 3ME7A 4HZ4A 1FB6A 4LMVA 2E0QA 1GTIA 1JZWA 1PX7A 1XIYA 3TJGA 2MMZA 4I97A 4O5RA 2MBSA 1GSUA 4CW9A 4L8EA 3FR3A 4JZQA 2YOIA 4EL1A 5ECNB 4BWQA 4KCEA 4IJ3A 4MF7A 2PGTA 4N30A 3L9SA 3WYWA 1EP7A 4TKYA 1G6WA 4MABA 3NIVA 2GDRA 2XBIA 3DRNA 2V41A 1O8XA 4V2NA 5CNWA 4F0CA 4ZBAA 4XS4B 2GQLA 4RI7A 1TP9A 2D2ZA 2LNSA 2H1AA 1Q98A 1A2MA 2K18A 4EC0A 1U87A 3ZMKA 22GSA 2K9FA 2FWGA 3UAPA 3QR6A 4XS6A 1ZYQB 4OFMA 3ZLPA 3GX8A 1SKSB 4HZ2A 3PINA 3EU4A 3TJFA 6GSWA 3G7YA 2R3XA 4MH2A 3QAGA 1JZRA 4JE1A 3LSZA 12GSA 4HEA2 2J23A 3TKPA 1FAAA 2JL4A 4J2FA 4K6XA 4EO3A 2HZFA 1ERTA 3TJBA 3KH7A 3EYTA 1XW5A 1A0RP 3HA9A 2QC7A 2GZYA 1MDIA 3ERWA 3APOA 4OO4A 4NWYA 4ML1A 4ZBDA 1SK0A 5F0GA 4BA7A 5IO0A 3GTUA 3G9BA 4TR3A 1K0OA 1R7HA 4OWYA 2YWMA 4AJ6A 2DIZA 4DEJA 3ZTLA 1WOUA 2IFQA 1U3IA 5JWQB 1F3AA 5HFGA 3GL3A 1ML6A 4Q5QA 2P5RA 3BCKA 3KIJA 1VGLA 1FOVA 2DJ2A 3KJYA 4LL1B 2MMNA 2B1LA 3EURA 3D4TA 4ILFA 1F2EA 1VF1A 2BJXA 3K8NA 3ZFBA 1PSQA 1PL2A 3HHVA 4F03A 2JZRA 2CZ3A 2GSTA 2GSSA 2VIMA 5EY6A 3HKRA 2AB6A 3HYPA 3VWXA 2H72A 3TCOA 1X5CA 2EIQA 4TXOB 2VCQA 4IBPA 1T3BA 5HFKA 3F63A 4YQMA 4DVCA 4KDUA 4K7NA 4ZL8A 1W89A 3N9JA 1GUKA 4ZIJA 4LLRA 1O6JA 1NSWA 1B4QA 2MZCA 4MCUA 5IO2A 1ERWA 2VLUA 2B5EA 2VCZA 4ZL7A 3DIEA 2VL2C 2GQMA 3WT2A 4I8BA 3EVIA 4TOPA 3F4RA 3ERFA 2GZZA 1OKDA 2H1BA 5J41A 1SU9A 4I5QA 3GFKA 2LSTA 1I5GA 2GTUA 4X0XA 1OVNA 3OR5A 3KM6A 5ENUA 3ZVJA 4IW9A 3FRCA 5AIXA 5DALA 4KGIA 2FWEA 2R6KA 4E8HA 1YJ6A 4HJ2A 4IVFA 1DE1A 1B9YC 3WGXA 5FT3A 3TKSC 3KD0A 2JADA 1Y25A 2P31A 5FWGA 3W6GA 3D6IA 2IWTA 4K8MA 2LRCA 5H5QA 4I2UA 1V40A 1IYHA 3F6DA 1SJZA 1GWCA 3RPPA 2L59A 1V58A 2PERA 1OYJA 3L9VA 3MNGA 1PL1A 1EGRA 1A23A 1VF4A 2XPDA 4HI7A 3GKXA 1G7EA 4WBRD 2K8SA 2HFDA 3A2VA 3C7MA 5AISA 4JRRA 2ES7A 1ERUA 1E2YA 5A4WA 6GSSA 3FZAA 1V9WA 1XWGA 1GSSA 2DLXA 4NHWA 1Z5YE 3GKKA 5D9TA 1O81A 4G9HA 4MZWA 3NOFA 1TJDA 1Z6NA 2H75A 2MMAA 2TIRA 1XW9A 4PURA 4RQXA 2NBSA 3HY2A 3KP8A 1U6TA 2AYTA 4MPGA 1XOBA 1K3OA 3FZ5A 2H6YA 3D22A 1A8LA 2HZEA 4NV5A 1PD21 3ISOA 5KN3A 1USBA 3MAKA 2KUCA 1BG5A 1SK1A 2HYXA 4ZB6A 4CHSA 2L5LA 1XOAA 4TR0A 4ECCA 1UVZA 4WR4A 2CQ9A 2FA8A 2XBQA 2V2GA 3HD5A 1SK2A 2OA7A 3KH9A 1EGOA 1NHOA 4KCAA 4KNDA 2LTKA 2WFCA 1GSEA 1M2AA 1GSQA 4I6XA 2WULA 2X8HA 2DJ3A 8GSSA 4GSNA 2YN1A 4ACSA 4TXVA 4PUAA 5HR3A 4TW5A 4FH8A 5ECOB 1GTAA 2QGVA 2MYGA 2IMEA 1T00A 2CAQA 4PQ1A 2IN3A 3EE2A 5IMZA 3MSZA 2H74A 3E9JB 1F3BA 4IP6A 4GXZA 4OO5A 5IQYA 1Z7PA 1GUMA 4FO5A 4ZBBA 2O7KA 4EXJA 4KAEA 2WJUA 3CRUA 3W8JA 1FVKA 1THOA 5AGYA 2HT9A 2R5GA 1AC1A 4MP4A 2LUSA 5J4UA 2VL9A 2VD0A 4PGTA 5F8BA 2IPAA 4GCIA 4KUNA 2VAFA 1AW9A 3HCZA 4KE3A 3FHKA 2CAIA 3UARA 1ABAA 1XFLA 5DVBA 3IK7A 4PXOA 5E59A 1GSFA 2H70A 2FY6A 3F0IA 2XC2A 4Q5RA 5FHIA 1THXA 5IMDA 4XHMA 5F05A 2VCWA 4RI6A 2CVKA 2VLTA 1K0CA 3CXGA 3F3RA 3QDNA 3GHAA 2FCHA 5G5EA 1GNWA 2VOCA 3TRPA 2WGRA 2PPTA 5B8BA 5IMAA 5G1LA 3ZMLA 3HXSA 1YKCA 1RW1A 2V6KA 5KEJA 3Q6OA 5DQSA 3DGQA 1XBSA 3M9JA 1IYIA 2C4JA 3ED3A 1RQMA 5LNKe 3WT1A 5IMFA 2DMMA 4HDEA 3RPNA 2QKEA 3V1WA 1G7OA 4PNGA 2IIYA 3ZREA 2YPMA 1PN9A 2VL2A 4BVYA 1PX6A 1ERVA 4PX1A 2DJ1A 2FLSA 4KA0A 3TRXA 5GSTA 2OJLA 1KBNA 5CRHA 5ECSA 1SJ6A 2I4AA 5C04A 1GH2A 3DEXA 3PGTA 3ZVJD 4MPFA 2IMFA 2H0IA 1AQWA 5J9CA 3DWVA 2J9HA 5L71A 5G5FA 4HJMA 5ID2A 4GQFA 5ECPB 3VWWA 3D21A 3VPQA 2XPEA 2YZHA 2YCDA 3F4SA 3TKSA 2OBIA 1JLWA 4WETA 2B7JA 1PA3A 4OD7A 6GSTA 5D73A 1QUWA 1YF1A 5ECLB 2H01A 1DSBA 4MJAA 2VCTA 3CBUA 3LGCA 2C3QA 2JACA 2A2RA 4WF4A 2CVDA 2X8CA 3GX0A 2LJAA 3C71A 1XPVA 1XCCA 1EV9A 4ISDA 2L6DA 9GSSA 3UL3A 2CX4A 1MTCA 4ZL9A 1FVJA 4TXOA 5KN1A 3QMXA 2CT6A 5GAPD 1Q4JA 4FYCA 4TR1A 1ZYEA 1AUCA 1BAYA 5D96A 3O3TA 4EKZA 3APQA 2FD3A 4D73A 3LQ7A 3FR6A 3TUEA 1TRSA 1BEDA 3TKRA 3GRXA 3RHBA 4QL7A 3TOTA 4BL7A 2V32A 4RUVA 4IN0A 4EDZA 4ECJA 1S3AA 1OC9B 2GS3A 4X1UA 2AAWA 5LD0A 4H86A 4Q5FA 4MA9A 2IJYA 3KZQA 4O7HA 2DC5A 2E7PA 3DD3A 2RUFA 2FWHA 3QFAC 4GTUA 5IOWA 3IHQA 2YWIA 4HS1A 3HVXA 3D4MA 2VM1A 3LORA 4ECIA 1F37A 2HSHA 1SYRA 3DVXA 4IP1A 3H79A 2A4VA 1M2DA 3EU3A 4N10A 1YEXA 2F8FA 4AJ8A 2FHEA 5J3RA 1S3DA 5AN1A 2YWNA 2AJQB 1GL8A 5DAKB 1SJIA 5HFIA 2N5FA 1OE8A 3FZ9A 1O85A 14GSA 5G31A 5ABRA 1A8YA 2M46A 2LKUA 1G6YA 1URMA 4WXTA 4MZBA 1N8JA 4HOJA 2G0FA 4DSSA 3SWLA 3BOAA 1WJKA 2HRNA 1TW9A 3LFLA 3Q19A 3DVWA 1WRYA 2VL3A 4JR4A 3EINA 4AJ7A 3GSSA 2DJ0A 1NM3A 2YZUA 3C1RA 1T4ZA 2HLSA 5D8IA 2KP1A 4I2TA 1Y6EA 4XCSA 1PKWA 5DCGA 2O8VB 2ALBA 1ZMAA 1SD9A 2REMA 3HZ8A 2WCIA 3HVVA 2MBTA 1GULA 4GRFA 1DUGA 4F82A 3BCIA 1YKAA 3KTBA 3KCMA 4YAPA 3TKSE 2P5QA 4IQAA 3KXOA 2H8LA 3IRAA 1FHEA 3TKQA 2N5BA 13GSA 1TK8B 2WS2A 4P3YB 4ID0A 1BX9A 1EOGA 5D9XA 2VM2A 3QFBC 1JZDA 1UA5A 3WGDA 3NZNA 3RDWA 3RBTA 2H19A 2DBCA 4MJEA 2F51A 1S3CA 2EIOA 4BWSA 4OCEA 2OKAA 5ECIB 4GSTA 1TU8A 4XS1A 6GSVA 3QAWA 2LRNA 3ZITA 2NDOA 3UJ1A 1XWKA 3APSA 1ZL9A 4OFNA 1M9AA 3TB2A 1FO5A 1Z3EA 4IELA 3KGKA 4N0VA 2ON7A 3CYNA 3E3EA 3RHCA 2PVOC 1CQHA 4V2MA 5B8AA 3U5RE 3H1NA 1XW6A 2VLVA 3TOUA 5GSSA 5ELAA 3E0UA 3GIXA 3IK9A 2O87A 1ZCPA 3EC3A 1A2JA 1ZOFA 5IM9A 6GSYA 1X9WB 3CTFA 1MDJA 1XWCA 3BD2A 1VF3A 4MMMA 3GMFA 3DXBA 2F3MA 3F4TA 1ZGNA 2FWFA 4EVMA 3ZIJA 3ZRDA 1R5PA 1TRUA 2HXKA 4POBA 2VCVA 3RAZA 2GZPA 3LYPA 4ZB8A 1YEPA 3TJJA 3IE3A 3IOSA 3LEFA 4L5OA 3Q74A 3M9KA 1M2BA 2L4CA 5IPHA 3U6VA 4OCFA 1XVQA 4EUYA 1R4WA 1WPIA 4JU5A 11GSA 5ECHB 2H73A 2C0DA 4F0BA 2FNOA 3IXRA 1PMTA 3HJMA 2FA4A 4BPYA 2H30A 5HQPA 1M99A 3LXTA 1GUHA 5EPFA 4AF2A 3HVSA 1Z9HA 2QSIA 3F8UA 5DALB 2C0FA 1TDIA 2X64A 3KMNA 4O32A 3GYKA 4V1Ag 3GNJA 5CAXA 2BMXA 2AUVA 2JSYA 3IR4A 3UVHA 1KNGA 1B8XA 2F8AA 4KDYA 4ZXGA 2LJKA 5J5NA 1B9XC 1GSDA 4IQ1A 4ECBA 4XRDA 2YWOA 5DBQA 1OE7A 1SKRB 5E4WA 4HU7A 4FIWA 2B5YA 20GSA 5A4VA 2H0GA 3L78A 2C1YA 4N0ZA 10GSA 1I9DA 4WKWA 4ML6A 3A2XA 3QD9A 3ZIVA 5C00A 3HJOA 1GTUA 1XXUA 2CX3A 2H71A 1EWXA 1RK4A 3IAS2 4XS4A 2O85A 1GTBA 3C73A 3GURA 1HNBA 5HR0A 3GSTA 1MD4A 5KN2A 2F9SA 5JWRB 3PR8A 2PMTA 4TR4A 3GL5A 1PGTA 1YQ1A 4F2IA 2RM5A 5B7CA 2GT6A 3EWLA 2HZEB 4YAVA 2TRXA 2KOKA 4MF5A 2ON5A 7GSSA 1FW1A 2IMKA 1KEBA 5ECMB 1UC7A 2HRFA 1TI3A 1SENA 1EOHA 3DMLA 4K0NA 3TRQA 1OC9A 1QFNA 2C0GA 4BVXA 5G30A 1E6BA 3FK8A 1YY7A 1EEJA 3L4NA 4TN8A 1ACVA 2H1DA 2JU5A 4YQVA 1W4VA 4MJBA 2I81A 4HQSA 1YF0A 2H76A 5F07A 5DJMA 4IHUA 2PWJA 1AXDA 1A24A 4K7IA 2PN8A 2E2GA 3DYRA 2NPBA 1BJXA 1JFUA 4ULXA 1YZXA 2L57A 3ZL5A 2H0HA 3I69A 2CVBA 3P8WA 1EP8A 1X9MB 3A3TA 4MK3A 2YNXA 5IMVA 2TRCP 1NHYA 5AIVA 4AGSA 5HR1A 1WP0A 2DIYA 2I1UA 3QOUA 3GH6A 3BBYA 1K0AA 1F9MA 3N5OA 3P2AA 2RIIA 4GLTA 2A2SA 4Z7XA 4J56E 2GLRA 2GQKA 2H6XA 4ZILA 4YH2A 2L6CA 2L5OA 3CSHA 3ERGA 3UIWA 3LWAA 3FY7A 5H5RA 4DSRA 5A5KA 16GSA 3UOMA 1TXXA 1AIUA 2VCXA 5DQYA 2H6ZA 3UVTA 4WR5A 1X5DA 1N2AA 4K1FA 2M80A 1HD2A 4K2DA 4QQ7A 1T8EB 4XTSA 2DMLA 5H5SA 4GSSA 2KHPA 4E8EA 1F6MC 1QGVA 1V2AA 4DSQA 2LQQA 3D5JA 2LJRA 2YV9A 3ZYWA 3I9V2 2GSQA 1LU4A 4J57E 1J08A 2AHEA 1HYUA 5INYA 3HDCA 2B3SA 1JHBA 5CYYA 2IL3A 5D9VA 5CO3A 2R2JA 5J9BA 1V57A 2LS5A 3WGEA 3P90A 2O89A 4FYBA 2ZNMA 2PUKC 4POLA 2NVLA 3VURA 4PQIA 3J7Yb 1YDKA 3HZ4A 1EV4A 1T4YA 1DE2A 2OADA 3C8EA 2XHFA 4PQHA 2R37A 5GZZB 2WRTA 5JCUA 3W8SA 2HNLA 1ON4A 3KTLA 4K7OA 5HR2A 4IJIA 4MZCA 5F06A 1J0FA 4F9ZA 3LXZA 3F9UA 2EIRA 2GGTA 5ECRB 2ZUPA 5LCZA 2YP6A 5ID2B 3LJRA 1JLVA 4JBBA 2C3TA 1K3YA 1X5EA 5B6NA 2WZ9A 2K6VA 4EDYA 4MLYA 3FYGA 2OE3A 1SYXA 4K0GA 1O7UA 1B48A 1XZOA 3PH9A 2OE1A 1K0NA 3GKNA 1GP1A 4ZB9A 3P7XA 5A4UA 1VF2A 3IAM2 5EL8A 5CRGA 4LL4B 2WDUA 1OC8A 1OAZA 1OKTA 3AY8A 1PRXA 1M9BA 1TK5B 3QAVA 1SL1B 3Q18A 1H75A 1TRWA 2N5AA 3FW2A 2GT5A 2Z9SA 1U3AA 4IKHA 5DJLA 5ELGA 4WF5A 1TKDB 3IPZA 2PU9C 3ME8A 4OFTA 4TR1B 2CV4A 4FYUA 2V1MA 1Z7RA 1EEMA 1GLPA 4IS0A 4EE0A 4D73B 1PQNA 4G10A 2K8VA 4GWRA 4L0UA 3UBLA 1X0RA 5G2ZA 1FG4A 1K3LA 4POKA 5CREA 2EC4A 3H93A 2P0GA 1TOFA 3H8QA 5D93A 4RQRA 1R5AA 1HNAA 3IC4A 1J9BA 3VPTA 1QMVA 2IMIA 3M3MA 3J7Yk 4LMWA 3O6TA 1A0FA 4NAXA 2PBJA 1BQ7A 4CDOA 4HU9A 3M1GA 1NW2A 3F6FA 1K0MA 4GF0A 3GTUB 3FKFA 5GAND 2FGXA 1K0BA 3IDVA 1R26A 5COHA 3GN3A 1M7TA 4V2LA 1CQGA 2RLIA 3FEUA 2IFQB 1TU7A 3D0ZA 3GUSA 3UMAA 5DCHA 2C80A 2C3NA 4XIHA 2YV7A 1TK0B 2BTOT 3UBKA 3G7JA 1QK8A 4JR6A 4XRAA 3CSJA 5D9WA 1ILOA 3HJPA 3LYKA 4POMA 3US3A 2M72A 4IGJA 3VWUA 2GVPA 4L5LA 2GSRA 1HQOA 1OC3A 4Q5NA 1AQVA 1B4PA 1QQ2A 2KP2A 4DSSB 3MWHA 1G0TA 1K0DA 4NMUA 1V98A 1WMJA 2V6OA 1GNEA 4HUAA 3H4KA 5CRWA 1Z6MA 1MEKA 2ZCTA 3TDGA 3KEBA 2VUPA 2R4VA 4HQZA 5B6MA 2LEGA 2I3YA 2OACA 1C72A 3TJKA 4YQUA 1H4OA 3I6AA 3CTGA
chains in the Genus database with same CATH superfamily
4V1Ap 1T7PB 3L0HA 2FUG2 2HRAA 2CA8A 3BJ5A 1TTZA 1XVWA 3O76A 4USSA 2C8UA 3QPMA 4PUFC 3VFIA 5IOXA 1GRXA 3I43A 2VD1A 4KDXA 2X8GA 5ECQB 3G7IA 4K5SA 1SKWB 2AV4A 1WIKA 1FB0A 4NHZA 3VI7A 5DDLA 3UEMA 4KSOA 3S9FA 2OBKA 5ECKB 5JCWA 1TI1A 18GSA 3CSIA 3F3QA 3R2QA 2CZ2A 1WWJA 5JCGA 2C0EA 4N11A 3C1SA 4KH7A 3EMXA 2DSAA 2YJHA 3M8NA 2HI7A 3CMIA 5IPGA 4KW6A 5JWOB 1AQXA 3KMOA 3IV4A 4KX4A 1O8WA 17GSA 3DKSA 4NPBA 1SD8A 3VWVA 1DBYA 3SBCA 1UN2A 3A2WA 4TVEA 3IA1A 1WE0A 2B5XA 1SL2B 1HNCA 3A5WA 4NV2A 1O73A 2WB9A 3GA4A 2LNTA 1GSYA 3GKMA 2E2MA 3M0FA 2JZSA 5KN0A 1A2LA 2VO4A 2B1KA 1MD3A 1TRVA 4PNFA 3GH9A 4MDCA 2G2QA 5EVOA 3ZZXA 2YANA 4K9ZA 6GSUA 2RUEA 4TRXA 4WBJA 3FR9A 2LRTA 3VK9A 1VRSD 2L4QA 5KOWA 4MH3A 2LV3A 3L9UA 4QL9A 1XWAA 3LG6A 19GSA 2LQOA 1PKZA 4OMVA 1M0UA 2NTOA 4MF6A 2JZTA 1BYEA 2JSZA 4KB3A 3TGZA 5CRDA 2H1GA 4O92A 2DJJA 1SL0B 3KP9A 2X99A 3FZ4A 3QCPA 5G1KA 2DJKA 4KSMA 3VI5A 5IMCA 1JZOA 5CP1A 2I9HA 2RM6A 2MMOA 3MIXA 1KTEA 1ZZYA 2H66A 2IMDA 4G2EA 1LBKA 1U88A 2OE0A 1EZKA 4NXIA 4WEYA 1MDKA 3WD6A 2YJ7A 4EF0A 4L0WA 4JEDA 1XWBA 3JCML 1AAZA 3MDKA 2HSYA 3ZFLA 3VLNA 2B7KA 1ST9A 2B6MA 4X43A 5IIZA 5DAKA 1T1VA 2KLXA 3GV1A 6GSXA 1GLQA 1QXHA 4MJCA 1LJRA 3IBHA 3EMPA 4LA1A 3CQFA 2PVQA 1X9SB 3CRTA 4ICYA 4G19A 4GQCA 2HE3A 3ME7A 4HZ4A 1FB6A 4LMVA 2E0QA 1GTIA 1JZWA 1PX7A 1XIYA 3TJGA 2MMZA 4I97A 4O5RA 2MBSA 1GSUA 4CW9A 4L8EA 3HVNA 3FR3A 4JZQA 2YOIA 4EL1A 5ECNB 4BWQA 4KCEA 4IJ3A 4MF7A 2PGTA 4N30A 3L9SA 3WYWA 1EP7A 4TKYA 1G6WA 4MABA 3NIVA 2GDRA 2XBIA 3DRNA 2V41A 4Z2RA 1O8XA 4V2NA 5CNWA 4F0CA 4K2XA 4ZBAA 4XS4B 4KF9A 2GQLA 4RI7A 1TP9A 2D2ZA 2LNSA 2H1AA 1Q98A 1A2MA 2K18A 4EC0A 1U87A 2DKHA 3ZMKA 22GSA 2K9FA 2FWGA 3UAPA 3QR6A 4XS6A 1ZYQB 4OFMA 3ZLPA 3GX8A 1SKSB 4HZ2A 3IC8A 3PINA 3EU4A 3TJFA 6GSWA 3G7YA 2R3XA 4MH2A 3QAGA 1JZRA 4JE1A 3LSZA 12GSA 4HEA2 2J23A 3TKPA 1FAAA 2JL4A 4J2FA 4K6XA 4EO3A 2HZFA 4MNNA 1ERTA 3TJBA 3KH7A 3EYTA 1XW5A 1A0RP 3HA9A 2QC7A 2GZYA 1MDIA 3ERWA 3APOA 4OO4A 4NWYA 4ML1A 4ZBDA 1SK0A 5F0GA 4BA7A 5IO0A 3GTUA 3G9BA 4TR3A 1K0OA 1R7HA 4OWYA 2YWMA 4AJ6A 2DIZA 4DEJA 3ZTLA 1WOUA 2IFQA 1U3IA 5JWQB 1F3AA 5HFGA 3GL3A 2UZ8A 1ML6A 4Q5QA 2P5RA 3BCKA 3KIJA 1VGLA 1FOVA 2DJ2A 3KJYA 4LL1B 2MMNA 2B1LA 3EURA 3D4TA 4ILFA 1F2EA 1VF1A 2BJXA 3K8NA 3ZFBA 1PSQA 1PL2A 3HHVA 4F03A 2JZRA 2CZ3A 2GSTA 2GSSA 2VIMA 5EY6A 3HKRA 2AB6A 3HYPA 3VWXA 4A5PA 2H72A 3TCOA 1X5CA 2EIQA 2R0PA 4TXOB 2VCQA 4IBPA 1T3BA 5HFKA 3F63A 4YQMA 4DVCA 4K5RA 4KDUA 4K7NA 4ZL8A 1W89A 3N9JA 1GUKA 4ZIJA 4LLRA 1O6JA 1NSWA 1B4QA 3A5IA 2MZCA 4MCUA 5IO2A 1ERWA 2VLUA 2B5EA 2VCZA 4ZL7A 3DIEA 2VL2C 2GQMA 3WT2A 4I8BA 2HSMA 3EVIA 4TOPA 3F4RA 3ERFA 3FMWA 2GZZA 1OKDA 2H1BA 5J41A 1SU9A 4I5QA 3GFKA 2LSTA 1I5GA 2GTUA 4X0XA 1OVNA 3OR5A 3KM6A 5ENUA 3ZVJA 4IW9A 3FRCA 4PTSA 5AIXA 5DALA 4KGIA 2FWEA 2R6KA 4E8HA 1YJ6A 4HJ2A 4IVFA 1DE1A 1B9YC 3WGXA 5FT3A 3TKSC 3KD0A 2JADA 1Y25A 2P31A 5FWGA 3W6GA 3D6IA 2IWTA 2X49A 4K8MA 2LRCA 5H5QA 4I2UA 1V40A 1IYHA 3F6DA 1SJZA 1GWCA 3RPPA 2L59A 1V58A 3MYDA 2PERA 1OYJA 3L9VA 3MNGA 1PL1A 1EGRA 1A23A 1VF4A 2XPDA 4HI7A 3GKXA 1G7EA 4WBRD 2K8SA 2HFDA 3A2VA 3C7MA 5AISA 4JRRA 2ES7A 1ERUA 1E2YA 5A4WA 6GSSA 3FZAA 1V9WA 1XWGA 1GSSA 2DLXA 4NHWA 1Z5YE 3GKKA 5D9TA 1O81A 3PPUA 4G9HA 4MZWA 3NOFA 1TJDA 1Z6NA 2H75A 2MMAA 2TIRA 1XW9A 4PURA 4RQXA 2NBSA 3HY2A 3KP8A 1U6TA 2AYTA 4MPGA 1XOBA 1K3OA 3FZ5A 2H6YA 3D22A 1A8LA 2HZEA 4NV5A 1PD21 3ISOA 5KN3A 1USBA 3MAKA 2KUCA 1BG5A 1SK1A 2HYXA 4ZB6A 4CHSA 2L5LA 1XOAA 4TR0A 4ECCA 1UVZA 4WR4A 2CQ9A 2FA8A 2XBQA 2V2GA 3HD5A 4G0IA 1SK2A 2OA7A 3KH9A 1EGOA 1NHOA 4KCAA 4KNDA 2LTKA 2R0GA 2WFCA 1GSEA 1M2AA 1GSQA 4I6XA 2WULA 2X8HA 2DJ3A 8GSSA 4GSNA 2YN1A 4ACSA 4TXVA 4PUAA 5HR3A 4TW5A 4FH8A 5ECOB 1GTAA 2QGVA 2MYGA 2IMEA 1T00A 4G0LA 2CAQA 4PQ1A 2IN3A 3EE2A 5IMZA 3MSZA 2H74A 3E9JB 1F3BA 4IP6A 4GXZA 4CY6A 4OO5A 5IQYA 1Z7PA 1GUMA 4FO5A 4ZBBA 2O7KA 4EIPA 4EXJA 4G0KA 4KAEA 2WJUA 4BIKA 3CRUA 3W8JA 1FVKA 1THOA 5AGYA 2HT9A 2R5GA 1AC1A 4MP4A 2LUSA 5J4UA 2VL9A 2VD0A 4PGTA 5F8BA 2IPAA 4GCIA 4KUNA 2VAFA 1AW9A 3HCZA 4KE3A 3FHKA 2CAIA 3UARA 1ABAA 1XFLA 5DVBA 3IK7A 4Z2TA 4PXOA 5E59A 1GSFA 2H70A 2FY6A 3F0IA 2XC2A 4Q5RA 5FHIA 1THXA 5IMDA 4XHMA 1ZYNA 5F05A 2VCWA 4RI6A 2CVKA 2VLTA 1K0CA 3CXGA 3F3RA 3QDNA 3GHAA 2FCHA 5G5EA 1GNWA 2VOCA 3TRPA 2WGRA 2PPTA 5B8BA 1M3JA 5IMAA 5G1LA 3ZMLA 3HXSA 1YKCA 1RW1A 2V6KA 5KEJA 3Q6OA 5DQSA 3DGQA 1XBSA 3M9JA 1IYIA 2C4JA 3ED3A 1RQMA 5LNKe 3WT1A 5IMFA 2DMMA 4HDEA 3RPNA 2QKEA 3V1WA 1G7OA 4O5QA 4PNGA 2IIYA 3ZREA 2YPMA 1PN9A 2VL2A 4BVYA 1PX6A 1ERVA 4PX1A 2DJ1A 2FLSA 4KA0A 3TRXA 5GSTA 2OJLA 1KBNA 5CRHA 2X4AA 1SJ6A 2I4AA 5ECSA 5C04A 1GH2A 3DEXA 3PGTA 3ZVJD 4MPFA 2IMFA 2H0IA 1AQWA 5J9CA 3DWVA 2J9HA 5L71A 5G5FA 4HJMA 5ID2A 1S3RA 4GQFA 5ECPB 3VWWA 3D21A 3VPQA 2XPEA 2YZHA 2YCDA 3F4SA 3TKSA 2OBIA 1JLWA 4WETA 2B7JA 1PA3A 4OD7A 6GSTA 5D73A 1QUWA 1YF1A 5ECLB 2H01A 4MJAA 1DSBA 2VCTA 3CBUA 3LGCA 2C3QA 2JACA 1ZYPA 2A2RA 4WF4A 2CVDA 2X8CA 3GX0A 2LJAA 3C71A 1XPVA 1XCCA 1EV9A 4ISDA 2L6DA 9GSSA 3UL3A 2CX4A 1MTCA 4ZL9A 2HRKA 4HSCX 1FVJA 4TXOA 5KN1A 3QMXA 2CT6A 5GAPD 1Q4JA 4FYCA 4TR1A 1ZYEA 1AUCA 1BAYA 5D96A 3O3TA 4EKZA 3APQA 2FD3A 4D73A 3LQ7A 3FR6A 3TUEA 1TRSA 1BEDA 3TKRA 3GRXA 3RHBA 4QL7A 3TOTA 4BL7A 2V32A 4RUVA 4IN0A 4EDZA 4ECJA 1S3AA 1OC9B 2GS3A 4X1UA 2AAWA 5LD0A 4BVXB 4H86A 4Q5FA 4MA9A 2IJYA 3KZQA 4O7HA 2DC5A 4YKGA 2E7PA 3DD3A 2RUFA 3LW9A 2FWHA 3QFAC 4GTUA 5IOWA 3IHQA 2YWIA 4HS1A 3HVXA 3D4MA 2VM1A 3LORA 4ECIA 1F37A 2HSHA 1SYRA 3DVXA 4IP1A 3H79A 2A4VA 1M2DA 3EU3A 4N10A 1YEXA 2F8FA 4AJ8A 2FHEA 5J3RA 5BMUA 1S3DA 5AN1A 2YWNA 2AJQB 1GL8A 5DAKB 1SJIA 5HFIA 2N5FA 1OE8A 3FZ9A 1O85A 14GSA 5G31A 5ABRA 1A8YA 2M46A 2LKUA 1G6YA 1URMA 4WXTA 4MZBA 1N8JA 4HOJA 2G0FA 4DSSA 3SWLA 3BOAA 1WJKA 2HRNA 1TW9A 3LFLA 3Q19A 3DVWA 1WRYA 2VL3A 4JR4A 3EINA 4AJ7A 3GSSA 2DJ0A 1NM3A 2YZUA 3C1RA 1T4ZA 2HLSA 5D8IA 5KOXA 2KP1A 4I2TA 1Y6EA 4XCSA 1PKWA 5DCGA 2O8VB 2ALBA 1ZMAA 1SD9A 2REMA 3HZ8A 2WCIA 3HVVA 2MBTA 1GULA 4GRFA 1DUGA 4F82A 3BCIA 1YKAA 3KTBA 3KCMA 4YAPA 3TKSE 2P5QA 4IQAA 3KXOA 2H8LA 3IRAA 1FHEA 1FOHA 3TKQA 2N5BA 13GSA 1TK8B 2WS2A 4P3YB 4ID0A 1BX9A 1EOGA 5D9XA 2VM2A 3QFBC 1JZDA 1UA5A 3WGDA 3NZNA 3RDWA 3RBTA 2H19A 2DBCA 4MJEA 4YKFA 2F51A 1S3CA 2EIOA 4BWSA 4OCEA 2OKAA 5ECIB 4GSTA 1TU8A 4XS1A 6GSVA 3QAWA 2LRNA 3ZITA 2NDOA 3UJ1A 1XWKA 2QA1A 3APSA 1ZL9A 4OFNA 1M9AA 3TB2A 1FO5A 1Z3EA 4IELA 3KGKA 4N0VA 2ON7A 3CYNA 3E3EA 3RHCA 2PVOC 1CQHA 4V2MA 5B8AA 3U5RE 3H1NA 1XW6A 2VLVA 3TOUA 5GSSA 4Z2UA 5ELAA 3E0UA 3GIXA 3IK9A 2O87A 1ZCPA 3EC3A 1A2JA 1ZOFA 5IM9A 6GSYA 1X9WB 3CTFA 1MDJA 1XWCA 3BD2A 1VF3A 4MMMA 3GMFA 3DXBA 2F3MA 3F4TA 1ZGNA 2FWFA 4EVMA 3ZIJA 3ZRDA 1R5PA 1TRUA 2HXKA 4POBA 2VCVA 3RAZA 2GZPA 3LYPA 4ZB8A 1YEPA 3TJJA 3IE3A 3IOSA 3LEFA 4L5OA 3Q74A 3M9KA 1M2BA 2L4CA 5IPHA 3U6VA 4OCFA 1XVQA 4EUYA 1R4WA 1WPIA 4JU5A 11GSA 5ECHB 2H73A 2C0DA 4F0BA 2FNOA 3IXRA 1PMTA 3HJMA 2FA4A 4BPYA 2H30A 5HQPA 1M99A 3LXTA 1GUHA 5EPFA 4AF2A 3HVSA 1Z9HA 2QSIA 3F8UA 5DALB 2C0FA 1TDIA 2X64A 3KMNA 4O32A 3GYKA 4V1Ag 3GNJA 5CAXA 2BMXA 2AUVA 2JSYA 3IR4A 3UVHA 1KNGA 1B8XA 2F8AA 4KDYA 4ZXGA 2LJKA 4CY8A 5J5NA 1B9XC 1GSDA 4IQ1A 4ECBA 4XRDA 2YWOA 5DBQA 1OE7A 1SKRB 5E4WA 4HU7A 4FIWA 2B5YA 20GSA 5A4VA 2H0GA 3L78A 2C1YA 4N0ZA 10GSA 1I9DA 4WKWA 4ML6A 3A2XA 3QD9A 3ZIVA 5C00A 3HJOA 1GTUA 1XXUA 2CX3A 2H71A 1EWXA 1RK4A 3IAS2 4XS4A 2O85A 4O5UA 1GTBA 3C73A 4FQUA 3GURA 1HNBA 5HR0A 3GSTA 1MD4A 5KN2A 2F9SA 5JWRB 3PR8A 2PMTA 4TR4A 3GL5A 1PGTA 1YQ1A 4F2IA 2RM5A 5B7CA 2GT6A 3EWLA 2HZEB 4YAVA 2TRXA 2KOKA 4MF5A 2ON5A 7GSSA 1FW1A 2IMKA 1KEBA 5ECMB 1UC7A 2HRFA 1TI3A 1SENA 1EOHA 3EPTA 3DMLA 4K0NA 3TRQA 1OC9A 1QFNA 2C0GA 4BVXA 5G30A 1E6BA 3FK8A 1YY7A 1EEJA 3L4NA 4TN8A 1ACVA 2H1DA 2JU5A 4YQVA 1W4VA 4MJBA 2I81A 4HQSA 1YF0A 2H76A 5F07A 5DJMA 4IHUA 2PWJA 1AXDA 1A24A 4K7IA 2PN8A 2E2GA 3DYRA 2NPBA 1BJXA 1JFUA 4ULXA 1YZXA 2L57A 3ZL5A 2H0HA 3I69A 2CVBA 3P8WA 1EP8A 1X9MB 1M3IA 3A3TA 4MK3A 2YNXA 5IMVA 2TRCP 1NHYA 5AIVA 4AGSA 5HR1A 1WP0A 2DIYA 2I1UA 3QOUA 3GH6A 3BBYA 1K0AA 1F9MA 3N5OA 3P2AA 2RIIA 4GLTA 2A2SA 4Z7XA 4J56E 2GLRA 2GQKA 2H6XA 1XG8A 4ZILA 4YH2A 2L6CA 2DKIA 2L5OA 3CSHA 3ERGA 3UIWA 3LWAA 3FY7A 5H5RA 4DSRA 5A5KA 16GSA 3UOMA 1TXXA 1AIUA 2VCXA 5DQYA 2H6ZA 3UVTA 4WR5A 1X5DA 1N2AA 4K1FA 2M80A 1HD2A 4K2DA 4QQ7A 1T8EB 4XTSA 2DMLA 5H5SA 4GSSA 2KHPA 4E8EA 1F6MC 1QGVA 1V2AA 3R3EA 4DSQA 2LQQA 3D5JA 2LJRA 2YV9A 3ZYWA 3I9V2 2GSQA 1LU4A 4J57E 1J08A 2AHEA 1HYUA 5INYA 3HDCA 2B3SA 1JHBA 5CYYA 2IL3A 5D9VA 5CO3A 2R2JA 5J9BA 1V57A 2LS5A 3WGEA 3P90A 2O89A 4FYBA 2ZNMA 2PUKC 4POLA 2NVLA 3VURA 4PQIA 3J7Yb 1YDKA 3HZ4A 1EV4A 1T4YA 1DE2A 2OADA 4BVYB 3C8EA 2XHFA 4PQHA 2R37A 5GZZB 2WRTA 5JCUA 3W8SA 2HNLA 1ON4A 3KTLA 4K7OA 2A2PA 5HR2A 4IJIA 4MZCA 5F06A 1J0FA 4F9ZA 3LXZA 3F9UA 2EIRA 2GGTA 5ECRB 2ZUPA 1PFOA 5LCZA 2YP6A 5ID2B 3LJRA 1JLVA 4JBBA 1PN0A 2C3TA 1K3YA 1X5EA 5B6NA 2WZ9A 2K6VA 4EDYA 4MLYA 3FYGA 2OE3A 1SYXA 4K0GA 1O7UA 1B48A 1XZOA 3PH9A 2OE1A 1K0NA 3GKNA 2QA2A 1GP1A 4ZB9A 3P7XA 5A4UA 1VF2A 3IAM2 5EL8A 5CRGA 4LL4B 2WDUA 1OC8A 1OAZA 1OKTA 3AY8A 1PRXA 1M9BA 1TK5B 3QAVA 1SL1B 3Q18A 1H75A 1TRWA 2N5AA 3FW2A 2GT5A 2Z9SA 1U3AA 4IKHA 5DJLA 5ELGA 4WF5A 1TKDB 3IPZA 2PU9C 3ME8A 4OFTA 4TR1B 2CV4A 4FYUA 4X4JA 2V1MA 1Z7RA 1EEMA 1GLPA 4IS0A 4EE0A 4D73B 1PQNA 4G10A 2K8VA 4GWRA 4L0UA 3UBLA 1X0RA 5G2ZA 1FG4A 1K3LA 4EIQA 4POKA 5CREA 2EC4A 3H93A 2P0GA 1TOFA 3H8QA 4BL7B 5D93A 4RQRA 1R5AA 1HNAA 3IC4A 1J9BA 3VPTA 1QMVA 2IMIA 3M3MA 3J7Yk 4LMWA 3O6TA 1A0FA 4NAXA 2PBJA 1BQ7A 4CDOA 4HU9A 3M1GA 1NW2A 3F6FA 1K0MA 4GF0A 3GTUB 3FKFA 5GAND 2FGXA 1K0BA 3IDVA 1R26A 5COHA 3GN3A 1M7TA 4V2LA 1CQGA 2RLIA 3FEUA 2IFQB 1TU7A 3D0ZA 3GUSA 3UMAA 5DCHA 2C80A 2C3NA 4XIHA 2YV7A 2R0CA 1TK0B 2BTOT 3UBKA 3G7JA 1QK8A 4JR6A 4XRAA 3CSJA 5D9WA 1ILOA 3HJPA 3LYKA 4POMA 3US3A 2M72A 4IGJA 3VWUA 2GVPA 5BRTA 4L5LA 2GSRA 1HQOA 1OC3A 4Q5NA 1AQVA 1B4PA 1QQ2A 2KP2A 4DSSB 3MWHA 1G0TA 1K0DA 4NMUA 1V98A 1WMJA 2V6OA 1GNEA 4HUAA 3H4KA 5CRWA 1Z6MA 1MEKA 2ZCTA 3TDGA 3KEBA 2VUPA 2R4VA 4HQZA 5B6MA 2A4HA 2LEGA 2I3YA 2OACA 1C72A 3TJKA 3IHGA 4YQUA 1H4OA 3I6AA 3CTGA
chains in the Genus database with same CATH topology
4V1Ap 1T7PB 3L0HA 2FUG2 2HRAA 2CA8A 3BJ5A 1TTZA 1XVWA 3O76A 4USSA 2C8UA 3QPMA 4PUFC 3VFIA 5IOXA 1GRXA 3I43A 2VD1A 4KDXA 2X8GA 5ECQB 3G7IA 4K5SA 1SKWB 2AV4A 1WIKA 1FB0A 4NHZA 3VI7A 5DDLA 3UEMA 4KSOA 3S9FA 2OBKA 5ECKB 5JCWA 1TI1A 18GSA 3CSIA 3F3QA 3R2QA 2CZ2A 1WWJA 5JCGA 2C0EA 4N11A 3C1SA 4KH7A 3EMXA 2DSAA 2YJHA 3M8NA 2HI7A 3CMIA 5IPGA 4KW6A 5JWOB 1AQXA 3KMOA 3IV4A 4KX4A 1O8WA 17GSA 3DKSA 4NPBA 1SD8A 3VWVA 1DBYA 3SBCA 1UN2A 3A2WA 4TVEA 3IA1A 1WE0A 2B5XA 1SL2B 1HNCA 3A5WA 4NV2A 1O73A 2WB9A 3GA4A 2LNTA 1GSYA 3GKMA 2E2MA 3M0FA 2JZSA 5KN0A 1A2LA 2VO4A 2B1KA 1MD3A 1TRVA 4PNFA 3GH9A 4MDCA 2G2QA 5EVOA 3ZZXA 2YANA 4K9ZA 6GSUA 2RUEA 4TRXA 4WBJA 3FR9A 2LRTA 3VK9A 1VRSD 2L4QA 5KOWA 4MH3A 2LV3A 3L9UA 4QL9A 1XWAA 3LG6A 19GSA 2LQOA 1PKZA 4OMVA 1M0UA 2NTOA 4MF6A 2JZTA 1BYEA 2JSZA 4KB3A 3TGZA 5CRDA 2H1GA 4O92A 2DJJA 1SL0B 3KP9A 2X99A 3FZ4A 3QCPA 5G1KA 2DJKA 4KSMA 3VI5A 5IMCA 1JZOA 5CP1A 2I9HA 2RM6A 2MMOA 3MIXA 1KTEA 1ZZYA 2H66A 2IMDA 4G2EA 1LBKA 1U88A 2OE0A 1EZKA 4NXIA 4WEYA 1MDKA 3WD6A 2YJ7A 4EF0A 4L0WA 4JEDA 1XWBA 3JCML 1AAZA 3MDKA 2HSYA 3ZFLA 3VLNA 2B7KA 1ST9A 2B6MA 4X43A 5IIZA 5DAKA 1T1VA 2KLXA 3GV1A 6GSXA 1GLQA 1QXHA 4MJCA 1LJRA 3IBHA 3EMPA 4LA1A 2PVQA 1X9SB 3CRTA 4ICYA 4G19A 4GQCA 2HE3A 3ME7A 4HZ4A 1FB6A 4LMVA 2E0QA 1GTIA 1JZWA 1PX7A 1XIYA 3TJGA 2MMZA 4I97A 4O5RA 2MBSA 1GSUA 4CW9A 4L8EA 3FR3A 4JZQA 2YOIA 4EL1A 5ECNB 4BWQA 4KCEA 4IJ3A 4MF7A 2PGTA 4N30A 3L9SA 3WYWA 1EP7A 4TKYA 1G6WA 4MABA 3NIVA 2GDRA 2XBIA 3DRNA 2V41A 4Z2RA 1O8XA 4V2NA 5CNWA 4F0CA 4K2XA 4ZBAA 4XS4B 4KF9A 2GQLA 4RI7A 1TP9A 2D2ZA 2LNSA 2H1AA 1Q98A 1A2MA 2K18A 4EC0A 1U87A 2DKHA 3ZMKA 22GSA 2K9FA 2FWGA 3UAPA 3QR6A 4XS6A 1ZYQB 4OFMA 3ZLPA 3GX8A 1SKSB 4HZ2A 3IC8A 3PINA 3EU4A 3TJFA 6GSWA 3G7YA 2R3XA 4MH2A 3QAGA 1JZRA 4JE1A 3LSZA 12GSA 4HEA2 2J23A 3TKPA 1FAAA 2JL4A 4J2FA 4K6XA 4EO3A 2HZFA 4MNNA 1ERTA 3TJBA 3KH7A 3EYTA 1XW5A 1A0RP 3HA9A 2QC7A 2GZYA 1MDIA 3ERWA 3APOA 4OO4A 4NWYA 4ML1A 4ZBDA 1SK0A 5F0GA 4BA7A 5IO0A 3GTUA 3G9BA 4TR3A 1K0OA 1R7HA 4OWYA 2YWMA 4AJ6A 2DIZA 4DEJA 3ZTLA 1WOUA 2IFQA 1U3IA 5JWQB 1F3AA 5HFGA 3GL3A 2UZ8A 1ML6A 4Q5QA 2P5RA 3BCKA 3KIJA 1VGLA 1FOVA 2DJ2A 3KJYA 4LL1B 2MMNA 2B1LA 3EURA 3D4TA 4ILFA 1F2EA 1VF1A 2BJXA 3K8NA 3ZFBA 1PSQA 1PL2A 3HHVA 4F03A 2JZRA 2CZ3A 2GSTA 2GSSA 2VIMA 5EY6A 3HKRA 2AB6A 3HYPA 3VWXA 4A5PA 2H72A 3TCOA 1X5CA 2EIQA 2R0PA 4TXOB 2VCQA 4IBPA 1T3BA 5HFKA 3F63A 4YQMA 4DVCA 4K5RA 4KDUA 4K7NA 4ZL8A 1W89A 3N9JA 1GUKA 4ZIJA 4LLRA 1O6JA 1NSWA 1B4QA 3A5IA 2MZCA 4MCUA 5IO2A 1ERWA 2VLUA 2B5EA 2VCZA 4ZL7A 3DIEA 2VL2C 2GQMA 3WT2A 4I8BA 2HSMA 3EVIA 4TOPA 3F4RA 3ERFA 3FMWA 2GZZA 1OKDA 2H1BA 5J41A 1SU9A 4I5QA 3GFKA 2LSTA 1I5GA 2GTUA 4X0XA 1OVNA 3OR5A 3KM6A 5ENUA 3ZVJA 4IW9A 3FRCA 4PTSA 5AIXA 5DALA 4KGIA 2FWEA 2R6KA 4E8HA 1YJ6A 4HJ2A 4IVFA 1DE1A 1B9YC 3WGXA 5FT3A 3TKSC 3KD0A 2JADA 1Y25A 2P31A 5FWGA 3W6GA 3D6IA 2IWTA 2X49A 4K8MA 2LRCA 5H5QA 4I2UA 1V40A 1IYHA 3F6DA 1SJZA 1GWCA 3RPPA 2L59A 1V58A 3MYDA 2PERA 1OYJA 3L9VA 3MNGA 1PL1A 1EGRA 1A23A 1VF4A 2XPDA 4HI7A 3GKXA 1G7EA 4WBRD 2K8SA 2HFDA 3A2VA 3C7MA 5AISA 4JRRA 2ES7A 1ERUA 1E2YA 5A4WA 6GSSA 3FZAA 1V9WA 1XWGA 1GSSA 2DLXA 4NHWA 1Z5YE 3GKKA 5D9TA 1O81A 3PPUA 4G9HA 4MZWA 3NOFA 1TJDA 1Z6NA 2H75A 2MMAA 2TIRA 1XW9A 4PURA 4RQXA 2NBSA 3HY2A 3KP8A 1U6TA 2AYTA 4MPGA 1XOBA 1K3OA 3FZ5A 2H6YA 3D22A 1A8LA 2HZEA 4NV5A 1PD21 3ISOA 5KN3A 1USBA 3MAKA 2KUCA 1BG5A 1SK1A 2HYXA 4ZB6A 4CHSA 2L5LA 1XOAA 4TR0A 4ECCA 1UVZA 4WR4A 2CQ9A 2FA8A 2XBQA 2V2GA 3HD5A 4G0IA 1SK2A 2OA7A 3KH9A 1EGOA 1NHOA 4KCAA 4KNDA 2LTKA 2R0GA 2WFCA 1GSEA 1M2AA 1GSQA 4I6XA 2WULA 2X8HA 2DJ3A 8GSSA 4GSNA 2YN1A 4ACSA 4TXVA 4PUAA 5HR3A 4TW5A 4FH8A 5ECOB 1GTAA 2QGVA 2MYGA 2IMEA 1T00A 4G0LA 2CAQA 4PQ1A 2IN3A 3EE2A 5IMZA 3MSZA 2H74A 3E9JB 1F3BA 4IP6A 4GXZA 4CY6A 4OO5A 5IQYA 1Z7PA 1GUMA 4FO5A 4ZBBA 2O7KA 4EIPA 4EXJA 4G0KA 4KAEA 2WJUA 3CRUA 3W8JA 1FVKA 1THOA 5AGYA 2HT9A 2R5GA 1AC1A 4MP4A 2LUSA 5J4UA 2VL9A 2VD0A 4PGTA 5F8BA 2IPAA 4GCIA 4KUNA 2VAFA 1AW9A 3HCZA 4KE3A 3FHKA 2CAIA 3UARA 1ABAA 1XFLA 5DVBA 3IK7A 4Z2TA 4PXOA 5E59A 1GSFA 2H70A 2FY6A 3F0IA 2XC2A 4Q5RA 5FHIA 1THXA 5IMDA 4XHMA 1ZYNA 5F05A 2VCWA 4RI6A 2CVKA 2VLTA 1K0CA 3CXGA 3F3RA 3QDNA 3GHAA 2FCHA 5G5EA 1GNWA 2VOCA 3TRPA 2WGRA 2PPTA 5B8BA 5IMAA 5G1LA 3ZMLA 3HXSA 1YKCA 1RW1A 2V6KA 5KEJA 3Q6OA 5DQSA 3DGQA 1XBSA 3M9JA 1IYIA 2C4JA 3ED3A 1RQMA 5LNKe 3WT1A 5IMFA 2DMMA 4HDEA 3RPNA 2QKEA 3V1WA 1G7OA 4O5QA 4PNGA 2IIYA 3ZREA 2YPMA 1PN9A 2VL2A 4BVYA 1PX6A 1ERVA 4PX1A 2DJ1A 2FLSA 4KA0A 3TRXA 5GSTA 2OJLA 1KBNA 5CRHA 2X4AA 1SJ6A 2I4AA 5ECSA 5C04A 1GH2A 3DEXA 3PGTA 3ZVJD 4MPFA 2IMFA 2H0IA 1AQWA 5J9CA 3DWVA 2J9HA 5L71A 5G5FA 4HJMA 5ID2A 4GQFA 5ECPB 3VWWA 3D21A 3VPQA 2XPEA 2YZHA 2YCDA 3F4SA 3TKSA 2OBIA 1JLWA 4WETA 2B7JA 1PA3A 4OD7A 6GSTA 5D73A 1QUWA 1YF1A 5ECLB 2H01A 4MJAA 1DSBA 2VCTA 3CBUA 3LGCA 2C3QA 2JACA 1ZYPA 2A2RA 4WF4A 2CVDA 2X8CA 3GX0A 2LJAA 3C71A 1XPVA 1XCCA 1EV9A 4ISDA 2L6DA 9GSSA 3UL3A 2CX4A 1MTCA 4ZL9A 2HRKA 1FVJA 4TXOA 5KN1A 3QMXA 2CT6A 5GAPD 1Q4JA 4FYCA 4TR1A 1ZYEA 1AUCA 1BAYA 5D96A 3O3TA 4EKZA 3APQA 2FD3A 4D73A 3LQ7A 3FR6A 3TUEA 1TRSA 1BEDA 3TKRA 3GRXA 3RHBA 4QL7A 3TOTA 4BL7A 2V32A 4RUVA 4IN0A 4EDZA 4ECJA 1S3AA 1OC9B 2GS3A 4X1UA 2AAWA 5LD0A 4BVXB 4H86A 4Q5FA 4MA9A 2IJYA 3KZQA 4O7HA 2DC5A 4YKGA 2E7PA 3DD3A 2RUFA 3LW9A 2FWHA 3QFAC 4GTUA 5IOWA 3IHQA 2YWIA 4HS1A 3HVXA 3D4MA 2VM1A 3LORA 4ECIA 1F37A 2HSHA 1SYRA 3DVXA 4IP1A 3H79A 2A4VA 1M2DA 3EU3A 4N10A 1YEXA 2F8FA 4AJ8A 2FHEA 5J3RA 5BMUA 1S3DA 5AN1A 2YWNA 2AJQB 1GL8A 5DAKB 1SJIA 5HFIA 2N5FA 1OE8A 3FZ9A 1O85A 14GSA 5G31A 5ABRA 1A8YA 2M46A 2LKUA 1G6YA 1URMA 4WXTA 4MZBA 1N8JA 4HOJA 2G0FA 4DSSA 3SWLA 3BOAA 1WJKA 2HRNA 1TW9A 3LFLA 3Q19A 3DVWA 1WRYA 2VL3A 4JR4A 3EINA 4AJ7A 3GSSA 2DJ0A 1NM3A 2YZUA 3C1RA 1T4ZA 2HLSA 5D8IA 5KOXA 2KP1A 4I2TA 1Y6EA 4XCSA 1PKWA 5DCGA 2O8VB 2ALBA 1ZMAA 1SD9A 2REMA 3HZ8A 2WCIA 3HVVA 2MBTA 1GULA 4GRFA 1DUGA 4F82A 3BCIA 1YKAA 3KTBA 3KCMA 4YAPA 3TKSE 2P5QA 4IQAA 3KXOA 2H8LA 3IRAA 1FHEA 1FOHA 3TKQA 2N5BA 13GSA 1TK8B 2WS2A 4P3YB 4ID0A 1BX9A 1EOGA 5D9XA 2VM2A 3QFBC 1JZDA 1UA5A 3WGDA 3NZNA 3RDWA 3RBTA 2H19A 2DBCA 4MJEA 4YKFA 2F51A 1S3CA 2EIOA 4BWSA 4OCEA 2OKAA 5ECIB 4GSTA 1TU8A 4XS1A 6GSVA 3QAWA 2LRNA 3ZITA 2NDOA 3UJ1A 1XWKA 2QA1A 3APSA 1ZL9A 4OFNA 1M9AA 3TB2A 1FO5A 1Z3EA 4IELA 3KGKA 4N0VA 2ON7A 3CYNA 3E3EA 3RHCA 2PVOC 1CQHA 4V2MA 5B8AA 3U5RE 3H1NA 1XW6A 2VLVA 3TOUA 5GSSA 4Z2UA 5ELAA 3E0UA 3GIXA 3IK9A 2O87A 1ZCPA 3EC3A 1A2JA 1ZOFA 5IM9A 6GSYA 1X9WB 3CTFA 1MDJA 1XWCA 3BD2A 1VF3A 4MMMA 3GMFA 3DXBA 2F3MA 3F4TA 1ZGNA 2FWFA 4EVMA 3ZIJA 3ZRDA 1R5PA 1TRUA 2HXKA 4POBA 2VCVA 3RAZA 2GZPA 3LYPA 4ZB8A 1YEPA 3TJJA 3IE3A 3IOSA 3LEFA 4L5OA 3Q74A 3M9KA 1M2BA 2L4CA 5IPHA 3U6VA 4OCFA 1XVQA 4EUYA 1R4WA 1WPIA 4JU5A 11GSA 5ECHB 2H73A 2C0DA 4F0BA 2FNOA 3IXRA 1PMTA 3HJMA 2FA4A 4BPYA 2H30A 5HQPA 1M99A 3LXTA 1GUHA 5EPFA 4AF2A 3HVSA 1Z9HA 2QSIA 3F8UA 5DALB 2C0FA 1TDIA 2X64A 3KMNA 4O32A 3GYKA 4V1Ag 3GNJA 5CAXA 2BMXA 2AUVA 2JSYA 3IR4A 3UVHA 1KNGA 1B8XA 2F8AA 4KDYA 4ZXGA 2LJKA 4CY8A 5J5NA 1B9XC 1GSDA 4IQ1A 4ECBA 4XRDA 2YWOA 5DBQA 1OE7A 1SKRB 5E4WA 4HU7A 4FIWA 2B5YA 20GSA 5A4VA 2H0GA 3L78A 2C1YA 4N0ZA 10GSA 1I9DA 4WKWA 4ML6A 3A2XA 3QD9A 3ZIVA 5C00A 3HJOA 1GTUA 1XXUA 2CX3A 2H71A 1EWXA 1RK4A 3IAS2 4XS4A 2O85A 4O5UA 1GTBA 3C73A 4FQUA 3GURA 1HNBA 5HR0A 3GSTA 1MD4A 5KN2A 2F9SA 5JWRB 3PR8A 2PMTA 4TR4A 3GL5A 1PGTA 1YQ1A 4F2IA 2RM5A 5B7CA 2GT6A 3EWLA 2HZEB 4YAVA 2TRXA 2KOKA 4MF5A 2ON5A 7GSSA 1FW1A 2IMKA 1KEBA 5ECMB 1UC7A 2HRFA 1TI3A 1SENA 1EOHA 3EPTA 3DMLA 4K0NA 3TRQA 1OC9A 1QFNA 2C0GA 4BVXA 5G30A 1E6BA 3FK8A 1YY7A 1EEJA 3L4NA 4TN8A 1ACVA 2H1DA 2JU5A 4YQVA 1W4VA 4MJBA 2I81A 4HQSA 1YF0A 2H76A 5F07A 5DJMA 4IHUA 2PWJA 1AXDA 1A24A 4K7IA 2PN8A 2E2GA 3DYRA 2NPBA 1BJXA 1JFUA 4ULXA 1YZXA 2L57A 3ZL5A 2H0HA 3I69A 2CVBA 3P8WA 1EP8A 1X9MB 3A3TA 4MK3A 2YNXA 5IMVA 2TRCP 1NHYA 5AIVA 4AGSA 5HR1A 1WP0A 2DIYA 2I1UA 3QOUA 3GH6A 3BBYA 1K0AA 1F9MA 3N5OA 3P2AA 2RIIA 4GLTA 2A2SA 4Z7XA 4J56E 2GLRA 2GQKA 2H6XA 4ZILA 4YH2A 2L6CA 2DKIA 2L5OA 3CSHA 3ERGA 3UIWA 3LWAA 3FY7A 5H5RA 4DSRA 5A5KA 16GSA 3UOMA 1TXXA 1AIUA 2VCXA 5DQYA 2H6ZA 3UVTA 4WR5A 1X5DA 1N2AA 4K1FA 2M80A 1HD2A 4K2DA 4QQ7A 1T8EB 4XTSA 2DMLA 5H5SA 4GSSA 2KHPA 4E8EA 1F6MC 1QGVA 1V2AA 3R3EA 4DSQA 2LQQA 3D5JA 2LJRA 2YV9A 3ZYWA 3I9V2 2GSQA 1LU4A 4J57E 1J08A 2AHEA 1HYUA 5INYA 3HDCA 2B3SA 1JHBA 5CYYA 2IL3A 5D9VA 5CO3A 2R2JA 5J9BA 1V57A 2LS5A 3WGEA 3P90A 2O89A 4FYBA 2ZNMA 2PUKC 4POLA 2NVLA 3VURA 4PQIA 3J7Yb 1YDKA 3HZ4A 1EV4A 1T4YA 1DE2A 2OADA 4BVYB 3C8EA 2XHFA 4PQHA 2R37A 5GZZB 2WRTA 5JCUA 3W8SA 2HNLA 1ON4A 3KTLA 4K7OA 2A2PA 5HR2A 4IJIA 4MZCA 5F06A 1J0FA 4F9ZA 3LXZA 3F9UA 2EIRA 2GGTA 5ECRB 2ZUPA 5LCZA 2YP6A 5ID2B 3LJRA 1JLVA 4JBBA 1PN0A 2C3TA 1K3YA 1X5EA 5B6NA 2WZ9A 2K6VA 4EDYA 4MLYA 3FYGA 2OE3A 1SYXA 4K0GA 1O7UA 1B48A 1XZOA 3PH9A 2OE1A 1K0NA 3GKNA 2QA2A 1GP1A 4ZB9A 3P7XA 5A4UA 1VF2A 3IAM2 5EL8A 5CRGA 4LL4B 2WDUA 1OC8A 1OAZA 1OKTA 3AY8A 1PRXA 1M9BA 1TK5B 3QAVA 1SL1B 3Q18A 1H75A 1TRWA 2N5AA 3FW2A 2GT5A 2Z9SA 1U3AA 4IKHA 5DJLA 5ELGA 4WF5A 1TKDB 3IPZA 2PU9C 3ME8A 4OFTA 4TR1B 2CV4A 4FYUA 4X4JA 2V1MA 1Z7RA 1EEMA 1GLPA 4IS0A 4EE0A 4D73B 1PQNA 4G10A 2K8VA 4GWRA 4L0UA 3UBLA 1X0RA 5G2ZA 1FG4A 1K3LA 4EIQA 4POKA 5CREA 2EC4A 3H93A 2P0GA 1TOFA 3H8QA 4BL7B 5D93A 4RQRA 1R5AA 1HNAA 3IC4A 1J9BA 3VPTA 1QMVA 2IMIA 3M3MA 3J7Yk 4LMWA 3O6TA 1A0FA 4NAXA 2PBJA 1BQ7A 4CDOA 4HU9A 3M1GA 1NW2A 3F6FA 1K0MA 4GF0A 3GTUB 3FKFA 5GAND 2FGXA 1K0BA 3IDVA 1R26A 5COHA 3GN3A 1M7TA 4V2LA 1CQGA 2RLIA 3FEUA 2IFQB 1TU7A 3D0ZA 3GUSA 3UMAA 5DCHA 2C80A 2C3NA 4XIHA 2YV7A 2R0CA 1TK0B 2BTOT 3UBKA 3G7JA 1QK8A 4JR6A 4XRAA 3CSJA 5D9WA 1ILOA 3HJPA 3LYKA 4POMA 3US3A 2M72A 4IGJA 3VWUA 2GVPA 5BRTA 4L5LA 2GSRA 1HQOA 1OC3A 4Q5NA 1AQVA 1B4PA 1QQ2A 2KP2A 4DSSB 3MWHA 1G0TA 1K0DA 4NMUA 1V98A 1WMJA 2V6OA 1GNEA 4HUAA 3H4KA 5CRWA 1Z6MA 1MEKA 2ZCTA 3TDGA 3KEBA 2VUPA 2R4VA 4HQZA 5B6MA 2A4HA 2LEGA 2I3YA 2OACA 1C72A 3TJKA 3IHGA 4YQUA 1H4OA 3I6AA 3CTGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V1A p;  1T7P B;  3L0H A;  2FUG 2;  2CA8 A;  3BJ5 A;  1TTZ A;  1XVW A;  3O76 A;  2C8U A;  3QPM A;  4PUF C;  3VFI A;  5IOX A;  1GRX A;  3I43 A;  2VD1 A;  4KDX A;  2X8G A;  5ECQ B;  3G7I A;  1SKW B;  2AV4 A;  1WIK A;  1FB0 A;  4NHZ A;  3VI7 A;  5DDL A;  3UEM A;  4KSO A;  3S9F A;  2OBK A;  5ECK B;  5JCW A;  1TI1 A;  18GS A;  3CSI A;  3F3Q A;  3R2Q A;  2CZ2 A;  1WWJ A;  5JCG A;  2C0E A;  4N11 A;  3C1S A;  4KH7 A;  3EMX A;  2DSA A;  2YJH A;  3M8N A;  2HI7 A;  3CMI A;  5IPG A;  4KW6 A;  5JWO B;  1AQX A;  3KMO A;  3IV4 A;  4KX4 A;  1O8W A;  17GS A;  3DKS A;  4NPB A;  1SD8 A;  3VWV A;  1DBY A;  3SBC A;  1UN2 A;  3A2W A;  4TVE A;  3IA1 A;  1WE0 A;  2B5X A;  1SL2 B;  1HNC A;  3A5W A;  4NV2 A;  1O73 A;  2WB9 A;  3GA4 A;  2LNT A;  1GSY A;  3GKM A;  2E2M A;  3M0F A;  2JZS A;  5KN0 A;  1A2L A;  2VO4 A;  2B1K A;  1MD3 A;  1TRV A;  4PNF A;  3GH9 A;  4MDC A;  2G2Q A;  5EVO A;  3ZZX A;  2YAN A;  4K9Z A;  6GSU A;  2RUE A;  4TRX A;  4WBJ A;  3FR9 A;  2LRT A;  3VK9 A;  1VRS D;  2L4Q A;  4MH3 A;  2LV3 A;  3L9U A;  4QL9 A;  1XWA A;  3LG6 A;  19GS A;  2LQO A;  1PKZ A;  4OMV A;  1M0U A;  2NTO A;  4MF6 A;  2JZT A;  1BYE A;  2JSZ A;  4KB3 A;  3TGZ A;  5CRD A;  2H1G A;  4O92 A;  2DJJ A;  1SL0 B;  3KP9 A;  2X99 A;  3FZ4 A;  3QCP A;  5G1K A;  2DJK A;  4KSM A;  3VI5 A;  5IMC A;  1JZO A;  5CP1 A;  2I9H A;  2RM6 A;  2MMO A;  1KTE A;  1ZZY A;  2H66 A;  2IMD A;  4G2E A;  1LBK A;  1U88 A;  2OE0 A;  1EZK A;  4NXI A;  4WEY A;  1MDK A;  3WD6 A;  2YJ7 A;  4EF0 A;  4L0W A;  4JED A;  1XWB A;  3JCM L;  1AAZ A;  3MDK A;  2HSY A;  3ZFL A;  3VLN A;  2B7K A;  1ST9 A;  2B6M A;  4X43 A;  5IIZ A;  5DAK A;  1T1V A;  2KLX A;  3GV1 A;  6GSX A;  1GLQ A;  1QXH A;  4MJC A;  1LJR A;  3IBH A;  3EMP A;  4LA1 A;  2PVQ A;  1X9S B;  3CRT A;  4G19 A;  4GQC A;  2HE3 A;  3ME7 A;  4HZ4 A;  1FB6 A;  4LMV A;  2E0Q A;  1GTI A;  1JZW A;  1PX7 A;  1XIY A;  3TJG A;  2MMZ A;  4I97 A;  4O5R A;  2MBS A;  1GSU A;  4CW9 A;  4L8E A;  3FR3 A;  4JZQ A;  2YOI A;  4EL1 A;  5ECN B;  4BWQ A;  4KCE A;  4IJ3 A;  4MF7 A;  2PGT A;  4N30 A;  3L9S A;  3WYW A;  1EP7 A;  4TKY A;  1G6W A;  4MAB A;  3NIV A;  2GDR A;  2XBI A;  3DRN A;  2V41 A;  1O8X A;  4V2N A;  5CNW A;  4F0C A;  4ZBA A;  4XS4 B;  2GQL A;  4RI7 A;  1TP9 A;  2D2Z A;  2LNS A;  2H1A A;  1Q98 A;  1A2M A;  2K18 A;  4EC0 A;  1U87 A;  3ZMK A;  22GS A;  2K9F A;  2FWG A;  3UAP A;  3QR6 A;  4XS6 A;  1ZYQ B;  4OFM A;  3ZLP A;  3GX8 A;  1SKS B;  4HZ2 A;  3PIN A;  3EU4 A;  3TJF A;  6GSW A;  3G7Y A;  2R3X A;  4MH2 A;  3QAG A;  1JZR A;  4JE1 A;  3LSZ A;  12GS A;  4HEA 2;  2J23 A;  3TKP A;  1FAA A;  2JL4 A;  4J2F A;  4K6X A;  4EO3 A;  2HZF A;  1ERT A;  3TJB A;  3KH7 A;  3EYT A;  1XW5 A;  1A0R P;  3HA9 A;  2QC7 A;  2GZY A;  1MDI A;  3ERW A;  3APO A;  4OO4 A;  4NWY A;  4ML1 A;  4ZBD A;  1SK0 A;  5F0G A;  4BA7 A;  5IO0 A;  3GTU A;  3G9B A;  4TR3 A;  1K0O A;  1R7H A;  4OWY A;  2YWM A;  4AJ6 A;  2DIZ A;  4DEJ A;  3ZTL A;  1WOU A;  2IFQ A;  1U3I A;  5JWQ B;  1F3A A;  5HFG A;  3GL3 A;  1ML6 A;  4Q5Q A;  2P5R A;  3BCK A;  3KIJ A;  1VGL A;  1FOV A;  2DJ2 A;  3KJY A;  4LL1 B;  2MMN A;  2B1L A;  3EUR A;  3D4T A;  4ILF A;  1F2E A;  1VF1 A;  2BJX A;  3K8N A;  3ZFB A;  1PSQ A;  1PL2 A;  3HHV A;  4F03 A;  2JZR A;  2CZ3 A;  2GST A;  2GSS A;  2VIM A;  5EY6 A;  3HKR A;  2AB6 A;  3HYP A;  3VWX A;  2H72 A;  3TCO A;  1X5C A;  2EIQ A;  4TXO B;  2VCQ A;  4IBP A;  1T3B A;  5HFK A;  3F63 A;  4YQM A;  4DVC A;  4KDU A;  4K7N A;  4ZL8 A;  1W89 A;  3N9J A;  1GUK A;  4ZIJ A;  4LLR A;  1O6J A;  1NSW A;  1B4Q A;  2MZC A;  4MCU A;  5IO2 A;  1ERW A;  2VLU A;  2B5E A;  2VCZ A;  4ZL7 A;  3DIE A;  2VL2 C;  2GQM A;  3WT2 A;  4I8B A;  3EVI A;  4TOP A;  3F4R A;  3ERF A;  2GZZ A;  1OKD A;  2H1B A;  5J41 A;  1SU9 A;  4I5Q A;  3GFK A;  2LST A;  1I5G A;  2GTU A;  4X0X A;  1OVN A;  3OR5 A;  3KM6 A;  5ENU A;  3ZVJ A;  4IW9 A;  3FRC A;  5AIX A;  5DAL A;  4KGI A;  2FWE A;  2R6K A;  4E8H A;  1YJ6 A;  4HJ2 A;  4IVF A;  1DE1 A;  1B9Y C;  3WGX A;  5FT3 A;  3TKS C;  3KD0 A;  2JAD A;  1Y25 A;  2P31 A;  5FWG A;  3W6G A;  3D6I A;  2IWT A;  4K8M A;  2LRC A;  5H5Q A;  4I2U A;  1V40 A;  1IYH A;  3F6D A;  1SJZ A;  1GWC A;  3RPP A;  2L59 A;  1V58 A;  2PER A;  1OYJ A;  3L9V A;  3MNG A;  1PL1 A;  1EGR A;  1A23 A;  1VF4 A;  2XPD A;  4HI7 A;  3GKX A;  1G7E A;  4WBR D;  2K8S A;  2HFD A;  3A2V A;  3C7M A;  5AIS A;  4JRR A;  2ES7 A;  1ERU A;  1E2Y A;  5A4W A;  6GSS A;  3FZA A;  1V9W A;  1XWG A;  1GSS A;  2DLX A;  4NHW A;  1Z5Y E;  3GKK A;  5D9T A;  1O81 A;  4G9H A;  4MZW A;  3NOF A;  1TJD A;  1Z6N A;  2H75 A;  2MMA A;  2TIR A;  1XW9 A;  4PUR A;  4RQX A;  2NBS A;  3HY2 A;  3KP8 A;  1U6T A;  2AYT A;  4MPG A;  1XOB A;  1K3O A;  3FZ5 A;  2H6Y A;  3D22 A;  1A8L A;  2HZE A;  4NV5 A;  1PD2 1;  3ISO A;  5KN3 A;  1USB A;  3MAK A;  2KUC A;  1BG5 A;  1SK1 A;  2HYX A;  4ZB6 A;  4CHS A;  2L5L A;  1XOA A;  4TR0 A;  4ECC A;  1UVZ A;  4WR4 A;  2CQ9 A;  2FA8 A;  2XBQ A;  2V2G A;  3HD5 A;  1SK2 A;  2OA7 A;  3KH9 A;  1EGO A;  1NHO A;  4KCA A;  4KND A;  2LTK A;  2WFC A;  1GSE A;  1M2A A;  1GSQ A;  4I6X A;  2WUL A;  2X8H A;  2DJ3 A;  8GSS A;  4GSN A;  2YN1 A;  4ACS A;  4TXV A;  4PUA A;  5HR3 A;  4TW5 A;  4FH8 A;  5ECO B;  1GTA A;  2QGV A;  2MYG A;  2IME A;  1T00 A;  2CAQ A;  4PQ1 A;  2IN3 A;  3EE2 A;  5IMZ A;  3MSZ A;  2H74 A;  3E9J B;  1F3B A;  4IP6 A;  4GXZ A;  4OO5 A;  5IQY A;  1Z7P A;  1GUM A;  4FO5 A;  4ZBB A;  2O7K A;  4EXJ A;  4KAE A;  2WJU A;  3CRU A;  3W8J A;  1FVK A;  1THO A;  5AGY A;  2HT9 A;  2R5G A;  1AC1 A;  4MP4 A;  2LUS A;  5J4U A;  2VL9 A;  2VD0 A;  4PGT A;  5F8B A;  2IPA A;  4GCI A;  4KUN A;  2VAF A;  1AW9 A;  3HCZ A;  4KE3 A;  3FHK A;  2CAI A;  3UAR A;  1ABA A;  1XFL A;  5DVB A;  3IK7 A;  4PXO A;  5E59 A;  1GSF A;  2H70 A;  2FY6 A;  3F0I A;  2XC2 A;  4Q5R A;  5FHI A;  1THX A;  5IMD A;  4XHM A;  5F05 A;  2VCW A;  4RI6 A;  2CVK A;  2VLT A;  1K0C A;  3CXG A;  3F3R A;  3QDN A;  3GHA A;  2FCH A;  5G5E A;  1GNW A;  2VOC A;  3TRP A;  2WGR A;  2PPT A;  5B8B A;  5IMA A;  5G1L A;  3ZML A;  3HXS A;  1YKC A;  1RW1 A;  2V6K A;  5KEJ A;  3Q6O A;  5DQS A;  3DGQ A;  1XBS A;  3M9J A;  1IYI A;  2C4J A;  3ED3 A;  1RQM A;  5LNK e;  3WT1 A;  5IMF A;  2DMM A;  4HDE A;  3RPN A;  2QKE A;  3V1W A;  1G7O A;  4PNG A;  2IIY A;  3ZRE A;  2YPM A;  1PN9 A;  2VL2 A;  4BVY A;  1PX6 A;  1ERV A;  4PX1 A;  2DJ1 A;  2FLS A;  4KA0 A;  3TRX A;  5GST A;  2OJL A;  1KBN A;  5CRH A;  5ECS A;  1SJ6 A;  2I4A A;  5C04 A;  1GH2 A;  3DEX A;  3PGT A;  3ZVJ D;  4MPF A;  2IMF A;  2H0I A;  1AQW A;  5J9C A;  3DWV A;  2J9H A;  5L71 A;  5G5F A;  4HJM A;  5ID2 A;  4GQF A;  5ECP B;  3VWW A;  3D21 A;  3VPQ A;  2XPE A;  2YZH A;  2YCD A;  3F4S A;  3TKS A;  2OBI A;  1JLW A;  4WET A;  2B7J A;  1PA3 A;  4OD7 A;  6GST A;  5D73 A;  1QUW A;  1YF1 A;  5ECL B;  2H01 A;  1DSB A;  4MJA A;  2VCT A;  3CBU A;  3LGC A;  2C3Q A;  2JAC A;  2A2R A;  4WF4 A;  2CVD A;  2X8C A;  3GX0 A;  2LJA A;  3C71 A;  1XPV A;  1XCC A;  1EV9 A;  4ISD A;  2L6D A;  9GSS A;  3UL3 A;  2CX4 A;  1MTC A;  4ZL9 A;  1FVJ A;  4TXO A;  5KN1 A;  3QMX A;  2CT6 A;  5GAP D;  1Q4J A;  4FYC A;  4TR1 A;  1ZYE A;  1AUC A;  1BAY A;  5D96 A;  3O3T A;  4EKZ A;  3APQ A;  2FD3 A;  4D73 A;  3LQ7 A;  3FR6 A;  3TUE A;  1TRS A;  1BED A;  3TKR A;  3GRX A;  3RHB A;  4QL7 A;  3TOT A;  4BL7 A;  2V32 A;  4RUV A;  4IN0 A;  4EDZ A;  4ECJ A;  1S3A A;  1OC9 B;  2GS3 A;  4X1U A;  2AAW A;  5LD0 A;  4H86 A;  4Q5F A;  4MA9 A;  2IJY A;  3KZQ A;  4O7H A;  2DC5 A;  2E7P A;  3DD3 A;  2RUF A;  2FWH A;  3QFA C;  4GTU A;  5IOW A;  3IHQ A;  2YWI A;  4HS1 A;  3HVX A;  3D4M A;  2VM1 A;  3LOR A;  4ECI A;  1F37 A;  2HSH A;  1SYR A;  3DVX A;  4IP1 A;  3H79 A;  2A4V A;  1M2D A;  3EU3 A;  4N10 A;  1YEX A;  2F8F A;  4AJ8 A;  2FHE A;  5J3R A;  1S3D A;  5AN1 A;  2YWN A;  2AJQ B;  1GL8 A;  5DAK B;  1SJI A;  5HFI A;  2N5F A;  1OE8 A;  3FZ9 A;  1O85 A;  14GS A;  5G31 A;  5ABR A;  1A8Y A;  2M46 A;  2LKU A;  1G6Y A;  1URM A;  4WXT A;  4MZB A;  1N8J A;  4HOJ A;  2G0F A;  4DSS A;  3SWL A;  3BOA A;  1WJK A;  2HRN A;  1TW9 A;  3LFL A;  3Q19 A;  3DVW A;  1WRY A;  2VL3 A;  4JR4 A;  3EIN A;  4AJ7 A;  3GSS A;  2DJ0 A;  1NM3 A;  2YZU A;  3C1R A;  1T4Z A;  2HLS A;  5D8I A;  2KP1 A;  4I2T A;  1Y6E A;  4XCS A;  1PKW A;  5DCG A;  2O8V B;  2ALB A;  1ZMA A;  1SD9 A;  2REM A;  3HZ8 A;  2WCI A;  3HVV A;  2MBT A;  1GUL A;  4GRF A;  1DUG A;  4F82 A;  3BCI A;  1YKA A;  3KTB A;  3KCM A;  4YAP A;  3TKS E;  2P5Q A;  4IQA A;  3KXO A;  2H8L A;  3IRA A;  1FHE A;  3TKQ A;  2N5B A;  13GS A;  1TK8 B;  2WS2 A;  4P3Y B;  4ID0 A;  1BX9 A;  1EOG A;  5D9X A;  2VM2 A;  3QFB C;  1JZD A;  1UA5 A;  3WGD A;  3NZN A;  3RDW A;  3RBT A;  2H19 A;  2DBC A;  4MJE A;  2F51 A;  1S3C A;  2EIO A;  4BWS A;  4OCE A;  2OKA A;  5ECI B;  4GST A;  1TU8 A;  4XS1 A;  6GSV A;  3QAW A;  2LRN A;  3ZIT A;  2NDO A;  3UJ1 A;  1XWK A;  3APS A;  1ZL9 A;  4OFN A;  1M9A A;  3TB2 A;  1FO5 A;  1Z3E A;  4IEL A;  3KGK A;  4N0V A;  2ON7 A;  3CYN A;  3E3E A;  3RHC A;  2PVO C;  1CQH A;  4V2M A;  5B8A A;  3U5R E;  3H1N A;  1XW6 A;  2VLV A;  3TOU A;  5GSS A;  5ELA A;  3E0U A;  3GIX A;  3IK9 A;  2O87 A;  1ZCP A;  3EC3 A;  1A2J A;  1ZOF A;  5IM9 A;  6GSY A;  1X9W B;  3CTF A;  1MDJ A;  1XWC A;  3BD2 A;  1VF3 A;  4MMM A;  3GMF A;  3DXB A;  2F3M A;  3F4T A;  1ZGN A;  2FWF A;  4EVM A;  3ZIJ A;  3ZRD A;  1R5P A;  1TRU A;  2HXK A;  4POB A;  2VCV A;  3RAZ A;  2GZP A;  3LYP A;  4ZB8 A;  1YEP A;  3TJJ A;  3IE3 A;  3IOS A;  3LEF A;  4L5O A;  3Q74 A;  3M9K A;  1M2B A;  2L4C A;  5IPH A;  3U6V A;  4OCF A;  1XVQ A;  4EUY A;  1R4W A;  1WPI A;  4JU5 A;  11GS A;  5ECH B;  2H73 A;  2C0D A;  4F0B A;  2FNO A;  3IXR A;  1PMT A;  3HJM A;  2FA4 A;  4BPY A;  2H30 A;  5HQP A;  1M99 A;  3LXT A;  1GUH A;  5EPF A;  4AF2 A;  3HVS A;  1Z9H A;  2QSI A;  3F8U A;  5DAL B;  2C0F A;  1TDI A;  2X64 A;  3KMN A;  4O32 A;  3GYK A;  4V1A g;  3GNJ A;  5CAX A;  2BMX A;  2AUV A;  2JSY A;  3IR4 A;  3UVH A;  1KNG A;  1B8X A;  2F8A A;  4KDY A;  4ZXG A;  2LJK A;  5J5N A;  1B9X C;  1GSD A;  4IQ1 A;  4ECB A;  4XRD A;  2YWO A;  5DBQ A;  1OE7 A;  1SKR B;  5E4W A;  4HU7 A;  4FIW A;  2B5Y A;  20GS A;  5A4V A;  2H0G A;  3L78 A;  2C1Y A;  4N0Z A;  10GS A;  1I9D A;  4WKW A;  4ML6 A;  3A2X A;  3QD9 A;  3ZIV A;  5C00 A;  3HJO A;  1GTU A;  1XXU A;  2CX3 A;  2H71 A;  1EWX A;  1RK4 A;  3IAS 2;  4XS4 A;  2O85 A;  1GTB A;  3C73 A;  3GUR A;  1HNB A;  5HR0 A;  3GST A;  1MD4 A;  5KN2 A;  2F9S A;  5JWR B;  3PR8 A;  2PMT A;  4TR4 A;  3GL5 A;  1PGT A;  1YQ1 A;  4F2I A;  2RM5 A;  5B7C A;  2GT6 A;  3EWL A;  2HZE B;  4YAV A;  2TRX A;  2KOK A;  4MF5 A;  2ON5 A;  7GSS A;  1FW1 A;  2IMK A;  1KEB A;  5ECM B;  1UC7 A;  2HRF A;  1TI3 A;  1SEN A;  1EOH A;  3DML A;  4K0N A;  3TRQ A;  1OC9 A;  1QFN A;  2C0G A;  4BVX A;  5G30 A;  1E6B A;  3FK8 A;  1YY7 A;  1EEJ A;  3L4N A;  4TN8 A;  1ACV A;  2H1D A;  2JU5 A;  4YQV A;  1W4V A;  4MJB A;  2I81 A;  4HQS A;  1YF0 A;  2H76 A;  5F07 A;  5DJM A;  4IHU A;  2PWJ A;  1AXD A;  1A24 A;  4K7I A;  2PN8 A;  2E2G A;  3DYR A;  2NPB A;  1BJX A;  1JFU A;  4ULX A;  1YZX A;  2L57 A;  3ZL5 A;  2H0H A;  3I69 A;  2CVB A;  3P8W A;  1EP8 A;  1X9M B;  3A3T A;  4MK3 A;  2YNX A;  5IMV A;  2TRC P;  1NHY A;  5AIV A;  4AGS A;  5HR1 A;  1WP0 A;  2DIY A;  2I1U A;  3QOU A;  3GH6 A;  3BBY A;  1K0A A;  1F9M A;  3N5O A;  3P2A A;  2RII A;  4GLT A;  2A2S A;  4Z7X A;  4J56 E;  2GLR A;  2GQK A;  2H6X A;  4ZIL A;  4YH2 A;  2L6C A;  2L5O A;  3CSH A;  3ERG A;  3UIW A;  3LWA A;  3FY7 A;  5H5R A;  4DSR A;  5A5K A;  16GS A;  3UOM A;  1TXX A;  1AIU A;  2VCX A;  5DQY A;  2H6Z A;  3UVT A;  4WR5 A;  1X5D A;  1N2A A;  4K1F A;  2M80 A;  1HD2 A;  4K2D A;  4QQ7 A;  1T8E B;  4XTS A;  2DML A;  5H5S A;  4GSS A;  2KHP A;  4E8E A;  1F6M C;  1QGV A;  1V2A A;  4DSQ A;  2LQQ A;  3D5J A;  2LJR A;  2YV9 A;  3ZYW A;  3I9V 2;  2GSQ A;  1LU4 A;  4J57 E;  1J08 A;  2AHE A;  1HYU A;  5INY A;  3HDC A;  2B3S A;  1JHB A;  5CYY A;  2IL3 A;  5D9V A;  5CO3 A;  2R2J A;  5J9B A;  1V57 A;  2LS5 A;  3WGE A;  3P90 A;  2O89 A;  4FYB A;  2ZNM A;  2PUK C;  4POL A;  2NVL A;  3VUR A;  4PQI A;  3J7Y b;  1YDK A;  3HZ4 A;  1EV4 A;  1T4Y A;  1DE2 A;  2OAD A;  3C8E A;  2XHF A;  4PQH A;  2R37 A;  5GZZ B;  2WRT A;  5JCU A;  3W8S A;  2HNL A;  1ON4 A;  3KTL A;  4K7O A;  5HR2 A;  4IJI A;  4MZC A;  5F06 A;  1J0F A;  4F9Z A;  3LXZ A;  3F9U A;  2EIR A;  2GGT A;  5ECR B;  2ZUP A;  5LCZ A;  2YP6 A;  5ID2 B;  3LJR A;  1JLV A;  4JBB A;  2C3T A;  1K3Y A;  1X5E A;  5B6N A;  2WZ9 A;  2K6V A;  4EDY A;  4MLY A;  3FYG A;  2OE3 A;  1SYX A;  4K0G A;  1O7U A;  1B48 A;  1XZO A;  3PH9 A;  2OE1 A;  1K0N A;  3GKN A;  1GP1 A;  4ZB9 A;  3P7X A;  5A4U A;  1VF2 A;  3IAM 2;  5EL8 A;  5CRG A;  4LL4 B;  2WDU A;  1OC8 A;  1OAZ A;  1OKT A;  3AY8 A;  1PRX A;  1M9B A;  1TK5 B;  3QAV A;  1SL1 B;  3Q18 A;  1H75 A;  1TRW A;  2N5A A;  3FW2 A;  2GT5 A;  2Z9S A;  1U3A A;  4IKH A;  5DJL A;  5ELG A;  4WF5 A;  1TKD B;  3IPZ A;  2PU9 C;  3ME8 A;  4OFT A;  4TR1 B;  2CV4 A;  4FYU A;  2V1M A;  1Z7R A;  1EEM A;  1GLP A;  4IS0 A;  4EE0 A;  4D73 B;  1PQN A;  4G10 A;  2K8V A;  4GWR A;  4L0U A;  3UBL A;  1X0R A;  5G2Z A;  1FG4 A;  1K3L A;  4POK A;  5CRE A;  2EC4 A;  3H93 A;  2P0G A;  1TOF A;  3H8Q A;  5D93 A;  4RQR A;  1R5A A;  1HNA A;  3IC4 A;  1J9B A;  3VPT A;  1QMV A;  2IMI A;  3M3M A;  3J7Y k;  4LMW A;  3O6T A;  1A0F A;  4NAX A;  2PBJ A;  1BQ7 A;  4CDO A;  4HU9 A;  3M1G A;  1NW2 A;  3F6F A;  1K0M A;  4GF0 A;  3GTU B;  3FKF A;  5GAN D;  2FGX A;  1K0B A;  3IDV A;  1R26 A;  5COH A;  3GN3 A;  1M7T A;  4V2L A;  1CQG A;  2RLI A;  3FEU A;  2IFQ B;  1TU7 A;  3D0Z A;  3GUS A;  3UMA A;  5DCH A;  2C80 A;  2C3N A;  4XIH A;  2YV7 A;  1TK0 B;  2BTO T;  3UBK A;  3G7J A;  1QK8 A;  4JR6 A;  4XRA A;  3CSJ A;  5D9W A;  1ILO A;  3HJP A;  3LYK A;  4POM A;  3US3 A;  2M72 A;  4IGJ A;  3VWU A;  2GVP A;  4L5L A;  2GSR A;  1HQO A;  1OC3 A;  4Q5N A;  1AQV A;  1B4P A;  1QQ2 A;  2KP2 A;  4DSS B;  3MWH A;  1G0T A;  1K0D A;  4NMU A;  1V98 A;  1WMJ A;  2V6O A;  1GNE A;  4HUA A;  3H4K A;  5CRW A;  1Z6M A;  1MEK A;  2ZCT A;  3TDG A;  3KEB A;  2VUP A;  2R4V A;  4HQZ A;  5B6M A;  2LEG A;  2I3Y A;  2OAC A;  1C72 A;  3TJK A;  4YQU A;  1H4O A;  3I6A A;  3CTG A; 
#chains in the Genus database with same CATH topology
 4V1A p;  1T7P B;  3L0H A;  2FUG 2;  2HRA A;  2CA8 A;  3BJ5 A;  1TTZ A;  1XVW A;  3O76 A;  4USS A;  2C8U A;  3QPM A;  4PUF C;  3VFI A;  5IOX A;  1GRX A;  3I43 A;  2VD1 A;  4KDX A;  2X8G A;  5ECQ B;  3G7I A;  4K5S A;  1SKW B;  2AV4 A;  1WIK A;  1FB0 A;  4NHZ A;  3VI7 A;  5DDL A;  3UEM A;  4KSO A;  3S9F A;  2OBK A;  5ECK B;  5JCW A;  1TI1 A;  18GS A;  3CSI A;  3F3Q A;  3R2Q A;  2CZ2 A;  1WWJ A;  5JCG A;  2C0E A;  4N11 A;  3C1S A;  4KH7 A;  3EMX A;  2DSA A;  2YJH A;  3M8N A;  2HI7 A;  3CMI A;  5IPG A;  4KW6 A;  5JWO B;  1AQX A;  3KMO A;  3IV4 A;  4KX4 A;  1O8W A;  17GS A;  3DKS A;  4NPB A;  1SD8 A;  3VWV A;  1DBY A;  3SBC A;  1UN2 A;  3A2W A;  4TVE A;  3IA1 A;  1WE0 A;  2B5X A;  1SL2 B;  1HNC A;  3A5W A;  4NV2 A;  1O73 A;  2WB9 A;  3GA4 A;  2LNT A;  1GSY A;  3GKM A;  2E2M A;  3M0F A;  2JZS A;  5KN0 A;  1A2L A;  2VO4 A;  2B1K A;  1MD3 A;  1TRV A;  4PNF A;  3GH9 A;  4MDC A;  2G2Q A;  5EVO A;  3ZZX A;  2YAN A;  4K9Z A;  6GSU A;  2RUE A;  4TRX A;  4WBJ A;  3FR9 A;  2LRT A;  3VK9 A;  1VRS D;  2L4Q A;  5KOW A;  4MH3 A;  2LV3 A;  3L9U A;  4QL9 A;  1XWA A;  3LG6 A;  19GS A;  2LQO A;  1PKZ A;  4OMV A;  1M0U A;  2NTO A;  4MF6 A;  2JZT A;  1BYE A;  2JSZ A;  4KB3 A;  3TGZ A;  5CRD A;  2H1G A;  4O92 A;  2DJJ A;  1SL0 B;  3KP9 A;  2X99 A;  3FZ4 A;  3QCP A;  5G1K A;  2DJK A;  4KSM A;  3VI5 A;  5IMC A;  1JZO A;  5CP1 A;  2I9H A;  2RM6 A;  2MMO A;  3MIX A;  1KTE A;  1ZZY A;  2H66 A;  2IMD A;  4G2E A;  1LBK A;  1U88 A;  2OE0 A;  1EZK A;  4NXI A;  4WEY A;  1MDK A;  3WD6 A;  2YJ7 A;  4EF0 A;  4L0W A;  4JED A;  1XWB A;  3JCM L;  1AAZ A;  3MDK A;  2HSY A;  3ZFL A;  3VLN A;  2B7K A;  1ST9 A;  2B6M A;  4X43 A;  5IIZ A;  5DAK A;  1T1V A;  2KLX A;  3GV1 A;  6GSX A;  1GLQ A;  1QXH A;  4MJC A;  1LJR A;  3IBH A;  3EMP A;  4LA1 A;  3CQF A;  2PVQ A;  1X9S B;  3CRT A;  4ICY A;  4G19 A;  4GQC A;  2HE3 A;  3ME7 A;  4HZ4 A;  1FB6 A;  4LMV A;  2E0Q A;  1GTI A;  1JZW A;  1PX7 A;  1XIY A;  3TJG A;  2MMZ A;  4I97 A;  4O5R A;  2MBS A;  1GSU A;  4CW9 A;  4L8E A;  3HVN A;  3FR3 A;  4JZQ A;  2YOI A;  4EL1 A;  5ECN B;  4BWQ A;  4KCE A;  4IJ3 A;  4MF7 A;  2PGT A;  4N30 A;  3L9S A;  3WYW A;  1EP7 A;  4TKY A;  1G6W A;  4MAB A;  3NIV A;  2GDR A;  2XBI A;  3DRN A;  2V41 A;  4Z2R A;  1O8X A;  4V2N A;  5CNW A;  4F0C A;  4K2X A;  4ZBA A;  4XS4 B;  4KF9 A;  2GQL A;  4RI7 A;  1TP9 A;  2D2Z A;  2LNS A;  2H1A A;  1Q98 A;  1A2M A;  2K18 A;  4EC0 A;  1U87 A;  2DKH A;  3ZMK A;  22GS A;  2K9F A;  2FWG A;  3UAP A;  3QR6 A;  4XS6 A;  1ZYQ B;  4OFM A;  3ZLP A;  3GX8 A;  1SKS B;  4HZ2 A;  3IC8 A;  3PIN A;  3EU4 A;  3TJF A;  6GSW A;  3G7Y A;  2R3X A;  4MH2 A;  3QAG A;  1JZR A;  4JE1 A;  3LSZ A;  12GS A;  4HEA 2;  2J23 A;  3TKP A;  1FAA A;  2JL4 A;  4J2F A;  4K6X A;  4EO3 A;  2HZF A;  4MNN A;  1ERT A;  3TJB A;  3KH7 A;  3EYT A;  1XW5 A;  1A0R P;  3HA9 A;  2QC7 A;  2GZY A;  1MDI A;  3ERW A;  3APO A;  4OO4 A;  4NWY A;  4ML1 A;  4ZBD A;  1SK0 A;  5F0G A;  4BA7 A;  5IO0 A;  3GTU A;  3G9B A;  4TR3 A;  1K0O A;  1R7H A;  4OWY A;  2YWM A;  4AJ6 A;  2DIZ A;  4DEJ A;  3ZTL A;  1WOU A;  2IFQ A;  1U3I A;  5JWQ B;  1F3A A;  5HFG A;  3GL3 A;  2UZ8 A;  1ML6 A;  4Q5Q A;  2P5R A;  3BCK A;  3KIJ A;  1VGL A;  1FOV A;  2DJ2 A;  3KJY A;  4LL1 B;  2MMN A;  2B1L A;  3EUR A;  3D4T A;  4ILF A;  1F2E A;  1VF1 A;  2BJX A;  3K8N A;  3ZFB A;  1PSQ A;  1PL2 A;  3HHV A;  4F03 A;  2JZR A;  2CZ3 A;  2GST A;  2GSS A;  2VIM A;  5EY6 A;  3HKR A;  2AB6 A;  3HYP A;  3VWX A;  4A5P A;  2H72 A;  3TCO A;  1X5C A;  2EIQ A;  2R0P A;  4TXO B;  2VCQ A;  4IBP A;  1T3B A;  5HFK A;  3F63 A;  4YQM A;  4DVC A;  4K5R A;  4KDU A;  4K7N A;  4ZL8 A;  1W89 A;  3N9J A;  1GUK A;  4ZIJ A;  4LLR A;  1O6J A;  1NSW A;  1B4Q A;  3A5I A;  2MZC A;  4MCU A;  5IO2 A;  1ERW A;  2VLU A;  2B5E A;  2VCZ A;  4ZL7 A;  3DIE A;  2VL2 C;  2GQM A;  3WT2 A;  4I8B A;  2HSM A;  3EVI A;  4TOP A;  3F4R A;  3ERF A;  3FMW A;  2GZZ A;  1OKD A;  2H1B A;  5J41 A;  1SU9 A;  4I5Q A;  3GFK A;  2LST A;  1I5G A;  2GTU A;  4X0X A;  1OVN A;  3OR5 A;  3KM6 A;  5ENU A;  3ZVJ A;  4IW9 A;  3FRC A;  4PTS A;  5AIX A;  5DAL A;  4KGI A;  2FWE A;  2R6K A;  4E8H A;  1YJ6 A;  4HJ2 A;  4IVF A;  1DE1 A;  1B9Y C;  3WGX A;  5FT3 A;  3TKS C;  3KD0 A;  2JAD A;  1Y25 A;  2P31 A;  5FWG A;  3W6G A;  3D6I A;  2IWT A;  2X49 A;  4K8M A;  2LRC A;  5H5Q A;  4I2U A;  1V40 A;  1IYH A;  3F6D A;  1SJZ A;  1GWC A;  3RPP A;  2L59 A;  1V58 A;  3MYD A;  2PER A;  1OYJ A;  3L9V A;  3MNG A;  1PL1 A;  1EGR A;  1A23 A;  1VF4 A;  2XPD A;  4HI7 A;  3GKX A;  1G7E A;  4WBR D;  2K8S A;  2HFD A;  3A2V A;  3C7M A;  5AIS A;  4JRR A;  2ES7 A;  1ERU A;  1E2Y A;  5A4W A;  6GSS A;  3FZA A;  1V9W A;  1XWG A;  1GSS A;  2DLX A;  4NHW A;  1Z5Y E;  3GKK A;  5D9T A;  1O81 A;  3PPU A;  4G9H A;  4MZW A;  3NOF A;  1TJD A;  1Z6N A;  2H75 A;  2MMA A;  2TIR A;  1XW9 A;  4PUR A;  4RQX A;  2NBS A;  3HY2 A;  3KP8 A;  1U6T A;  2AYT A;  4MPG A;  1XOB A;  1K3O A;  3FZ5 A;  2H6Y A;  3D22 A;  1A8L A;  2HZE A;  4NV5 A;  1PD2 1;  3ISO A;  5KN3 A;  1USB A;  3MAK A;  2KUC A;  1BG5 A;  1SK1 A;  2HYX A;  4ZB6 A;  4CHS A;  2L5L A;  1XOA A;  4TR0 A;  4ECC A;  1UVZ A;  4WR4 A;  2CQ9 A;  2FA8 A;  2XBQ A;  2V2G A;  3HD5 A;  4G0I A;  1SK2 A;  2OA7 A;  3KH9 A;  1EGO A;  1NHO A;  4KCA A;  4KND A;  2LTK A;  2R0G A;  2WFC A;  1GSE A;  1M2A A;  1GSQ A;  4I6X A;  2WUL A;  2X8H A;  2DJ3 A;  8GSS A;  4GSN A;  2YN1 A;  4ACS A;  4TXV A;  4PUA A;  5HR3 A;  4TW5 A;  4FH8 A;  5ECO B;  1GTA A;  2QGV A;  2MYG A;  2IME A;  1T00 A;  4G0L A;  2CAQ A;  4PQ1 A;  2IN3 A;  3EE2 A;  5IMZ A;  3MSZ A;  2H74 A;  3E9J B;  1F3B A;  4IP6 A;  4GXZ A;  4CY6 A;  4OO5 A;  5IQY A;  1Z7P A;  1GUM A;  4FO5 A;  4ZBB A;  2O7K A;  4EIP A;  4EXJ A;  4G0K A;  4KAE A;  2WJU A;  4BIK A;  3CRU A;  3W8J A;  1FVK A;  1THO A;  5AGY A;  2HT9 A;  2R5G A;  1AC1 A;  4MP4 A;  2LUS A;  5J4U A;  2VL9 A;  2VD0 A;  4PGT A;  5F8B A;  2IPA A;  4GCI A;  4KUN A;  2VAF A;  1AW9 A;  3HCZ A;  4KE3 A;  3FHK A;  2CAI A;  3UAR A;  1ABA A;  1XFL A;  5DVB A;  3IK7 A;  4Z2T A;  4PXO A;  5E59 A;  1GSF A;  2H70 A;  2FY6 A;  3F0I A;  2XC2 A;  4Q5R A;  5FHI A;  1THX A;  5IMD A;  4XHM A;  1ZYN A;  5F05 A;  2VCW A;  4RI6 A;  2CVK A;  2VLT A;  1K0C A;  3CXG A;  3F3R A;  3QDN A;  3GHA A;  2FCH A;  5G5E A;  1GNW A;  2VOC A;  3TRP A;  2WGR A;  2PPT A;  5B8B A;  1M3J A;  5IMA A;  5G1L A;  3ZML A;  3HXS A;  1YKC A;  1RW1 A;  2V6K A;  5KEJ A;  3Q6O A;  5DQS A;  3DGQ A;  1XBS A;  3M9J A;  1IYI A;  2C4J A;  3ED3 A;  1RQM A;  5LNK e;  3WT1 A;  5IMF A;  2DMM A;  4HDE A;  3RPN A;  2QKE A;  3V1W A;  1G7O A;  4O5Q A;  4PNG A;  2IIY A;  3ZRE A;  2YPM A;  1PN9 A;  2VL2 A;  4BVY A;  1PX6 A;  1ERV A;  4PX1 A;  2DJ1 A;  2FLS A;  4KA0 A;  3TRX A;  5GST A;  2OJL A;  1KBN A;  5CRH A;  2X4A A;  1SJ6 A;  2I4A A;  5ECS A;  5C04 A;  1GH2 A;  3DEX A;  3PGT A;  3ZVJ D;  4MPF A;  2IMF A;  2H0I A;  1AQW A;  5J9C A;  3DWV A;  2J9H A;  5L71 A;  5G5F A;  4HJM A;  5ID2 A;  1S3R A;  4GQF A;  5ECP B;  3VWW A;  3D21 A;  3VPQ A;  2XPE A;  2YZH A;  2YCD A;  3F4S A;  3TKS A;  2OBI A;  1JLW A;  4WET A;  2B7J A;  1PA3 A;  4OD7 A;  6GST A;  5D73 A;  1QUW A;  1YF1 A;  5ECL B;  2H01 A;  4MJA A;  1DSB A;  2VCT A;  3CBU A;  3LGC A;  2C3Q A;  2JAC A;  1ZYP A;  2A2R A;  4WF4 A;  2CVD A;  2X8C A;  3GX0 A;  2LJA A;  3C71 A;  1XPV A;  1XCC A;  1EV9 A;  4ISD A;  2L6D A;  9GSS A;  3UL3 A;  2CX4 A;  1MTC A;  4ZL9 A;  2HRK A;  4HSC X;  1FVJ A;  4TXO A;  5KN1 A;  3QMX A;  2CT6 A;  5GAP D;  1Q4J A;  4FYC A;  4TR1 A;  1ZYE A;  1AUC A;  1BAY A;  5D96 A;  3O3T A;  4EKZ A;  3APQ A;  2FD3 A;  4D73 A;  3LQ7 A;  3FR6 A;  3TUE A;  1TRS A;  1BED A;  3TKR A;  3GRX A;  3RHB A;  4QL7 A;  3TOT A;  4BL7 A;  2V32 A;  4RUV A;  4IN0 A;  4EDZ A;  4ECJ A;  1S3A A;  1OC9 B;  2GS3 A;  4X1U A;  2AAW A;  5LD0 A;  4BVX B;  4H86 A;  4Q5F A;  4MA9 A;  2IJY A;  3KZQ A;  4O7H A;  2DC5 A;  4YKG A;  2E7P A;  3DD3 A;  2RUF A;  3LW9 A;  2FWH A;  3QFA C;  4GTU A;  5IOW A;  3IHQ A;  2YWI A;  4HS1 A;  3HVX A;  3D4M A;  2VM1 A;  3LOR A;  4ECI A;  1F37 A;  2HSH A;  1SYR A;  3DVX A;  4IP1 A;  3H79 A;  2A4V A;  1M2D A;  3EU3 A;  4N10 A;  1YEX A;  2F8F A;  4AJ8 A;  2FHE A;  5J3R A;  5BMU A;  1S3D A;  5AN1 A;  2YWN A;  2AJQ B;  1GL8 A;  5DAK B;  1SJI A;  5HFI A;  2N5F A;  1OE8 A;  3FZ9 A;  1O85 A;  14GS A;  5G31 A;  5ABR A;  1A8Y A;  2M46 A;  2LKU A;  1G6Y A;  1URM A;  4WXT A;  4MZB A;  1N8J A;  4HOJ A;  2G0F A;  4DSS A;  3SWL A;  3BOA A;  1WJK A;  2HRN A;  1TW9 A;  3LFL A;  3Q19 A;  3DVW A;  1WRY A;  2VL3 A;  4JR4 A;  3EIN A;  4AJ7 A;  3GSS A;  2DJ0 A;  1NM3 A;  2YZU A;  3C1R A;  1T4Z A;  2HLS A;  5D8I A;  5KOX A;  2KP1 A;  4I2T A;  1Y6E A;  4XCS A;  1PKW A;  5DCG A;  2O8V B;  2ALB A;  1ZMA A;  1SD9 A;  2REM A;  3HZ8 A;  2WCI A;  3HVV A;  2MBT A;  1GUL A;  4GRF A;  1DUG A;  4F82 A;  3BCI A;  1YKA A;  3KTB A;  3KCM A;  4YAP A;  3TKS E;  2P5Q A;  4IQA A;  3KXO A;  2H8L A;  3IRA A;  1FHE A;  1FOH A;  3TKQ A;  2N5B A;  13GS A;  1TK8 B;  2WS2 A;  4P3Y B;  4ID0 A;  1BX9 A;  1EOG A;  5D9X A;  2VM2 A;  3QFB C;  1JZD A;  1UA5 A;  3WGD A;  3NZN A;  3RDW A;  3RBT A;  2H19 A;  2DBC A;  4MJE A;  4YKF A;  2F51 A;  1S3C A;  2EIO A;  4BWS A;  4OCE A;  2OKA A;  5ECI B;  4GST A;  1TU8 A;  4XS1 A;  6GSV A;  3QAW A;  2LRN A;  3ZIT A;  2NDO A;  3UJ1 A;  1XWK A;  2QA1 A;  3APS A;  1ZL9 A;  4OFN A;  1M9A A;  3TB2 A;  1FO5 A;  1Z3E A;  4IEL A;  3KGK A;  4N0V A;  2ON7 A;  3CYN A;  3E3E A;  3RHC A;  2PVO C;  1CQH A;  4V2M A;  5B8A A;  3U5R E;  3H1N A;  1XW6 A;  2VLV A;  3TOU A;  5GSS A;  4Z2U A;  5ELA A;  3E0U A;  3GIX A;  3IK9 A;  2O87 A;  1ZCP A;  3EC3 A;  1A2J A;  1ZOF A;  5IM9 A;  6GSY A;  1X9W B;  3CTF A;  1MDJ A;  1XWC A;  3BD2 A;  1VF3 A;  4MMM A;  3GMF A;  3DXB A;  2F3M A;  3F4T A;  1ZGN A;  2FWF A;  4EVM A;  3ZIJ A;  3ZRD A;  1R5P A;  1TRU A;  2HXK A;  4POB A;  2VCV A;  3RAZ A;  2GZP A;  3LYP A;  4ZB8 A;  1YEP A;  3TJJ A;  3IE3 A;  3IOS A;  3LEF A;  4L5O A;  3Q74 A;  3M9K A;  1M2B A;  2L4C A;  5IPH A;  3U6V A;  4OCF A;  1XVQ A;  4EUY A;  1R4W A;  1WPI A;  4JU5 A;  11GS A;  5ECH B;  2H73 A;  2C0D A;  4F0B A;  2FNO A;  3IXR A;  1PMT A;  3HJM A;  2FA4 A;  4BPY A;  2H30 A;  5HQP A;  1M99 A;  3LXT A;  1GUH A;  5EPF A;  4AF2 A;  3HVS A;  1Z9H A;  2QSI A;  3F8U A;  5DAL B;  2C0F A;  1TDI A;  2X64 A;  3KMN A;  4O32 A;  3GYK A;  4V1A g;  3GNJ A;  5CAX A;  2BMX A;  2AUV A;  2JSY A;  3IR4 A;  3UVH A;  1KNG A;  1B8X A;  2F8A A;  4KDY A;  4ZXG A;  2LJK A;  4CY8 A;  5J5N A;  1B9X C;  1GSD A;  4IQ1 A;  4ECB A;  4XRD A;  2YWO A;  5DBQ A;  1OE7 A;  1SKR B;  5E4W A;  4HU7 A;  4FIW A;  2B5Y A;  20GS A;  5A4V A;  2H0G A;  3L78 A;  2C1Y A;  4N0Z A;  10GS A;  1I9D A;  4WKW A;  4ML6 A;  3A2X A;  3QD9 A;  3ZIV A;  5C00 A;  3HJO A;  1GTU A;  1XXU A;  2CX3 A;  2H71 A;  1EWX A;  1RK4 A;  3IAS 2;  4XS4 A;  2O85 A;  4O5U A;  1GTB A;  3C73 A;  4FQU A;  3GUR A;  1HNB A;  5HR0 A;  3GST A;  1MD4 A;  5KN2 A;  2F9S A;  5JWR B;  3PR8 A;  2PMT A;  4TR4 A;  3GL5 A;  1PGT A;  1YQ1 A;  4F2I A;  2RM5 A;  5B7C A;  2GT6 A;  3EWL A;  2HZE B;  4YAV A;  2TRX A;  2KOK A;  4MF5 A;  2ON5 A;  7GSS A;  1FW1 A;  2IMK A;  1KEB A;  5ECM B;  1UC7 A;  2HRF A;  1TI3 A;  1SEN A;  1EOH A;  3EPT A;  3DML A;  4K0N A;  3TRQ A;  1OC9 A;  1QFN A;  2C0G A;  4BVX A;  5G30 A;  1E6B A;  3FK8 A;  1YY7 A;  1EEJ A;  3L4N A;  4TN8 A;  1ACV A;  2H1D A;  2JU5 A;  4YQV A;  1W4V A;  4MJB A;  2I81 A;  4HQS A;  1YF0 A;  2H76 A;  5F07 A;  5DJM A;  4IHU A;  2PWJ A;  1AXD A;  1A24 A;  4K7I A;  2PN8 A;  2E2G A;  3DYR A;  2NPB A;  1BJX A;  1JFU A;  4ULX A;  1YZX A;  2L57 A;  3ZL5 A;  2H0H A;  3I69 A;  2CVB A;  3P8W A;  1EP8 A;  1X9M B;  1M3I A;  3A3T A;  4MK3 A;  2YNX A;  5IMV A;  2TRC P;  1NHY A;  5AIV A;  4AGS A;  5HR1 A;  1WP0 A;  2DIY A;  2I1U A;  3QOU A;  3GH6 A;  3BBY A;  1K0A A;  1F9M A;  3N5O A;  3P2A A;  2RII A;  4GLT A;  2A2S A;  4Z7X A;  4J56 E;  2GLR A;  2GQK A;  2H6X A;  1XG8 A;  4ZIL A;  4YH2 A;  2L6C A;  2DKI A;  2L5O A;  3CSH A;  3ERG A;  3UIW A;  3LWA A;  3FY7 A;  5H5R A;  4DSR A;  5A5K A;  16GS A;  3UOM A;  1TXX A;  1AIU A;  2VCX A;  5DQY A;  2H6Z A;  3UVT A;  4WR5 A;  1X5D A;  1N2A A;  4K1F A;  2M80 A;  1HD2 A;  4K2D A;  4QQ7 A;  1T8E B;  4XTS A;  2DML A;  5H5S A;  4GSS A;  2KHP A;  4E8E A;  1F6M C;  1QGV A;  1V2A A;  3R3E A;  4DSQ A;  2LQQ A;  3D5J A;  2LJR A;  2YV9 A;  3ZYW A;  3I9V 2;  2GSQ A;  1LU4 A;  4J57 E;  1J08 A;  2AHE A;  1HYU A;  5INY A;  3HDC A;  2B3S A;  1JHB A;  5CYY A;  2IL3 A;  5D9V A;  5CO3 A;  2R2J A;  5J9B A;  1V57 A;  2LS5 A;  3WGE A;  3P90 A;  2O89 A;  4FYB A;  2ZNM A;  2PUK C;  4POL A;  2NVL A;  3VUR A;  4PQI A;  3J7Y b;  1YDK A;  3HZ4 A;  1EV4 A;  1T4Y A;  1DE2 A;  2OAD A;  4BVY B;  3C8E A;  2XHF A;  4PQH A;  2R37 A;  5GZZ B;  2WRT A;  5JCU A;  3W8S A;  2HNL A;  1ON4 A;  3KTL A;  4K7O A;  2A2P A;  5HR2 A;  4IJI A;  4MZC A;  5F06 A;  1J0F A;  4F9Z A;  3LXZ A;  3F9U A;  2EIR A;  2GGT A;  5ECR B;  2ZUP A;  1PFO A;  5LCZ A;  2YP6 A;  5ID2 B;  3LJR A;  1JLV A;  4JBB A;  1PN0 A;  2C3T A;  1K3Y A;  1X5E A;  5B6N A;  2WZ9 A;  2K6V A;  4EDY A;  4MLY A;  3FYG A;  2OE3 A;  1SYX A;  4K0G A;  1O7U A;  1B48 A;  1XZO A;  3PH9 A;  2OE1 A;  1K0N A;  3GKN A;  2QA2 A;  1GP1 A;  4ZB9 A;  3P7X A;  5A4U A;  1VF2 A;  3IAM 2;  5EL8 A;  5CRG A;  4LL4 B;  2WDU A;  1OC8 A;  1OAZ A;  1OKT A;  3AY8 A;  1PRX A;  1M9B A;  1TK5 B;  3QAV A;  1SL1 B;  3Q18 A;  1H75 A;  1TRW A;  2N5A A;  3FW2 A;  2GT5 A;  2Z9S A;  1U3A A;  4IKH A;  5DJL A;  5ELG A;  4WF5 A;  1TKD B;  3IPZ A;  2PU9 C;  3ME8 A;  4OFT A;  4TR1 B;  2CV4 A;  4FYU A;  4X4J A;  2V1M A;  1Z7R A;  1EEM A;  1GLP A;  4IS0 A;  4EE0 A;  4D73 B;  1PQN A;  4G10 A;  2K8V A;  4GWR A;  4L0U A;  3UBL A;  1X0R A;  5G2Z A;  1FG4 A;  1K3L A;  4EIQ A;  4POK A;  5CRE A;  2EC4 A;  3H93 A;  2P0G A;  1TOF A;  3H8Q A;  4BL7 B;  5D93 A;  4RQR A;  1R5A A;  1HNA A;  3IC4 A;  1J9B A;  3VPT A;  1QMV A;  2IMI A;  3M3M A;  3J7Y k;  4LMW A;  3O6T A;  1A0F A;  4NAX A;  2PBJ A;  1BQ7 A;  4CDO A;  4HU9 A;  3M1G A;  1NW2 A;  3F6F A;  1K0M A;  4GF0 A;  3GTU B;  3FKF A;  5GAN D;  2FGX A;  1K0B A;  3IDV A;  1R26 A;  5COH A;  3GN3 A;  1M7T A;  4V2L A;  1CQG A;  2RLI A;  3FEU A;  2IFQ B;  1TU7 A;  3D0Z A;  3GUS A;  3UMA A;  5DCH A;  2C80 A;  2C3N A;  4XIH A;  2YV7 A;  2R0C A;  1TK0 B;  2BTO T;  3UBK A;  3G7J A;  1QK8 A;  4JR6 A;  4XRA A;  3CSJ A;  5D9W A;  1ILO A;  3HJP A;  3LYK A;  4POM A;  3US3 A;  2M72 A;  4IGJ A;  3VWU A;  2GVP A;  5BRT A;  4L5L A;  2GSR A;  1HQO A;  1OC3 A;  4Q5N A;  1AQV A;  1B4P A;  1QQ2 A;  2KP2 A;  4DSS B;  3MWH A;  1G0T A;  1K0D A;  4NMU A;  1V98 A;  1WMJ A;  2V6O A;  1GNE A;  4HUA A;  3H4K A;  5CRW A;  1Z6M A;  1MEK A;  2ZCT A;  3TDG A;  3KEB A;  2VUP A;  2R4V A;  4HQZ A;  5B6M A;  2A4H A;  2LEG A;  2I3Y A;  2OAC A;  1C72 A;  3TJK A;  3IHG A;  4YQU A;  1H4O A;  3I6A A;  3CTG A; 
#chains in the Genus database with same CATH homology
 4V1A p;  1T7P B;  3L0H A;  2FUG 2;  2HRA A;  2CA8 A;  3BJ5 A;  1TTZ A;  1XVW A;  3O76 A;  4USS A;  2C8U A;  3QPM A;  4PUF C;  3VFI A;  5IOX A;  1GRX A;  3I43 A;  2VD1 A;  4KDX A;  2X8G A;  5ECQ B;  3G7I A;  4K5S A;  1SKW B;  2AV4 A;  1WIK A;  1FB0 A;  4NHZ A;  3VI7 A;  5DDL A;  3UEM A;  4KSO A;  3S9F A;  2OBK A;  5ECK B;  5JCW A;  1TI1 A;  18GS A;  3CSI A;  3F3Q A;  3R2Q A;  2CZ2 A;  1WWJ A;  5JCG A;  2C0E A;  4N11 A;  3C1S A;  4KH7 A;  3EMX A;  2DSA A;  2YJH A;  3M8N A;  2HI7 A;  3CMI A;  5IPG A;  4KW6 A;  5JWO B;  1AQX A;  3KMO A;  3IV4 A;  4KX4 A;  1O8W A;  17GS A;  3DKS A;  4NPB A;  1SD8 A;  3VWV A;  1DBY A;  3SBC A;  1UN2 A;  3A2W A;  4TVE A;  3IA1 A;  1WE0 A;  2B5X A;  1SL2 B;  1HNC A;  3A5W A;  4NV2 A;  1O73 A;  2WB9 A;  3GA4 A;  2LNT A;  1GSY A;  3GKM A;  2E2M A;  3M0F A;  2JZS A;  5KN0 A;  1A2L A;  2VO4 A;  2B1K A;  1MD3 A;  1TRV A;  4PNF A;  3GH9 A;  4MDC A;  2G2Q A;  5EVO A;  3ZZX A;  2YAN A;  4K9Z A;  6GSU A;  2RUE A;  4TRX A;  4WBJ A;  3FR9 A;  2LRT A;  3VK9 A;  1VRS D;  2L4Q A;  5KOW A;  4MH3 A;  2LV3 A;  3L9U A;  4QL9 A;  1XWA A;  3LG6 A;  19GS A;  2LQO A;  1PKZ A;  4OMV A;  1M0U A;  2NTO A;  4MF6 A;  2JZT A;  1BYE A;  2JSZ A;  4KB3 A;  3TGZ A;  5CRD A;  2H1G A;  4O92 A;  2DJJ A;  1SL0 B;  3KP9 A;  2X99 A;  3FZ4 A;  3QCP A;  5G1K A;  2DJK A;  4KSM A;  3VI5 A;  5IMC A;  1JZO A;  5CP1 A;  2I9H A;  2RM6 A;  2MMO A;  3MIX A;  1KTE A;  1ZZY A;  2H66 A;  2IMD A;  4G2E A;  1LBK A;  1U88 A;  2OE0 A;  1EZK A;  4NXI A;  4WEY A;  1MDK A;  3WD6 A;  2YJ7 A;  4EF0 A;  4L0W A;  4JED A;  1XWB A;  3JCM L;  1AAZ A;  3MDK A;  2HSY A;  3ZFL A;  3VLN A;  2B7K A;  1ST9 A;  2B6M A;  4X43 A;  5IIZ A;  5DAK A;  1T1V A;  2KLX A;  3GV1 A;  6GSX A;  1GLQ A;  1QXH A;  4MJC A;  1LJR A;  3IBH A;  3EMP A;  4LA1 A;  2PVQ A;  1X9S B;  3CRT A;  4ICY A;  4G19 A;  4GQC A;  2HE3 A;  3ME7 A;  4HZ4 A;  1FB6 A;  4LMV A;  2E0Q A;  1GTI A;  1JZW A;  1PX7 A;  1XIY A;  3TJG A;  2MMZ A;  4I97 A;  4O5R A;  2MBS A;  1GSU A;  4CW9 A;  4L8E A;  3FR3 A;  4JZQ A;  2YOI A;  4EL1 A;  5ECN B;  4BWQ A;  4KCE A;  4IJ3 A;  4MF7 A;  2PGT A;  4N30 A;  3L9S A;  3WYW A;  1EP7 A;  4TKY A;  1G6W A;  4MAB A;  3NIV A;  2GDR A;  2XBI A;  3DRN A;  2V41 A;  4Z2R A;  1O8X A;  4V2N A;  5CNW A;  4F0C A;  4K2X A;  4ZBA A;  4XS4 B;  4KF9 A;  2GQL A;  4RI7 A;  1TP9 A;  2D2Z A;  2LNS A;  2H1A A;  1Q98 A;  1A2M A;  2K18 A;  4EC0 A;  1U87 A;  2DKH A;  3ZMK A;  22GS A;  2K9F A;  2FWG A;  3UAP A;  3QR6 A;  4XS6 A;  1ZYQ B;  4OFM A;  3ZLP A;  3GX8 A;  1SKS B;  4HZ2 A;  3IC8 A;  3PIN A;  3EU4 A;  3TJF A;  6GSW A;  3G7Y A;  2R3X A;  4MH2 A;  3QAG A;  1JZR A;  4JE1 A;  3LSZ A;  12GS A;  4HEA 2;  2J23 A;  3TKP A;  1FAA A;  2JL4 A;  4J2F A;  4K6X A;  4EO3 A;  2HZF A;  4MNN A;  1ERT A;  3TJB A;  3KH7 A;  3EYT A;  1XW5 A;  1A0R P;  3HA9 A;  2QC7 A;  2GZY A;  1MDI A;  3ERW A;  3APO A;  4OO4 A;  4NWY A;  4ML1 A;  4ZBD A;  1SK0 A;  5F0G A;  4BA7 A;  5IO0 A;  3GTU A;  3G9B A;  4TR3 A;  1K0O A;  1R7H A;  4OWY A;  2YWM A;  4AJ6 A;  2DIZ A;  4DEJ A;  3ZTL A;  1WOU A;  2IFQ A;  1U3I A;  5JWQ B;  1F3A A;  5HFG A;  3GL3 A;  2UZ8 A;  1ML6 A;  4Q5Q A;  2P5R A;  3BCK A;  3KIJ A;  1VGL A;  1FOV A;  2DJ2 A;  3KJY A;  4LL1 B;  2MMN A;  2B1L A;  3EUR A;  3D4T A;  4ILF A;  1F2E A;  1VF1 A;  2BJX A;  3K8N A;  3ZFB A;  1PSQ A;  1PL2 A;  3HHV A;  4F03 A;  2JZR A;  2CZ3 A;  2GST A;  2GSS A;  2VIM A;  5EY6 A;  3HKR A;  2AB6 A;  3HYP A;  3VWX A;  4A5P A;  2H72 A;  3TCO A;  1X5C A;  2EIQ A;  2R0P A;  4TXO B;  2VCQ A;  4IBP A;  1T3B A;  5HFK A;  3F63 A;  4YQM A;  4DVC A;  4K5R A;  4KDU A;  4K7N A;  4ZL8 A;  1W89 A;  3N9J A;  1GUK A;  4ZIJ A;  4LLR A;  1O6J A;  1NSW A;  1B4Q A;  3A5I A;  2MZC A;  4MCU A;  5IO2 A;  1ERW A;  2VLU A;  2B5E A;  2VCZ A;  4ZL7 A;  3DIE A;  2VL2 C;  2GQM A;  3WT2 A;  4I8B A;  2HSM A;  3EVI A;  4TOP A;  3F4R A;  3ERF A;  3FMW A;  2GZZ A;  1OKD A;  2H1B A;  5J41 A;  1SU9 A;  4I5Q A;  3GFK A;  2LST A;  1I5G A;  2GTU A;  4X0X A;  1OVN A;  3OR5 A;  3KM6 A;  5ENU A;  3ZVJ A;  4IW9 A;  3FRC A;  4PTS A;  5AIX A;  5DAL A;  4KGI A;  2FWE A;  2R6K A;  4E8H A;  1YJ6 A;  4HJ2 A;  4IVF A;  1DE1 A;  1B9Y C;  3WGX A;  5FT3 A;  3TKS C;  3KD0 A;  2JAD A;  1Y25 A;  2P31 A;  5FWG A;  3W6G A;  3D6I A;  2IWT A;  2X49 A;  4K8M A;  2LRC A;  5H5Q A;  4I2U A;  1V40 A;  1IYH A;  3F6D A;  1SJZ A;  1GWC A;  3RPP A;  2L59 A;  1V58 A;  3MYD A;  2PER A;  1OYJ A;  3L9V A;  3MNG A;  1PL1 A;  1EGR A;  1A23 A;  1VF4 A;  2XPD A;  4HI7 A;  3GKX A;  1G7E A;  4WBR D;  2K8S A;  2HFD A;  3A2V A;  3C7M A;  5AIS A;  4JRR A;  2ES7 A;  1ERU A;  1E2Y A;  5A4W A;  6GSS A;  3FZA A;  1V9W A;  1XWG A;  1GSS A;  2DLX A;  4NHW A;  1Z5Y E;  3GKK A;  5D9T A;  1O81 A;  3PPU A;  4G9H A;  4MZW A;  3NOF A;  1TJD A;  1Z6N A;  2H75 A;  2MMA A;  2TIR A;  1XW9 A;  4PUR A;  4RQX A;  2NBS A;  3HY2 A;  3KP8 A;  1U6T A;  2AYT A;  4MPG A;  1XOB A;  1K3O A;  3FZ5 A;  2H6Y A;  3D22 A;  1A8L A;  2HZE A;  4NV5 A;  1PD2 1;  3ISO A;  5KN3 A;  1USB A;  3MAK A;  2KUC A;  1BG5 A;  1SK1 A;  2HYX A;  4ZB6 A;  4CHS A;  2L5L A;  1XOA A;  4TR0 A;  4ECC A;  1UVZ A;  4WR4 A;  2CQ9 A;  2FA8 A;  2XBQ A;  2V2G A;  3HD5 A;  4G0I A;  1SK2 A;  2OA7 A;  3KH9 A;  1EGO A;  1NHO A;  4KCA A;  4KND A;  2LTK A;  2R0G A;  2WFC A;  1GSE A;  1M2A A;  1GSQ A;  4I6X A;  2WUL A;  2X8H A;  2DJ3 A;  8GSS A;  4GSN A;  2YN1 A;  4ACS A;  4TXV A;  4PUA A;  5HR3 A;  4TW5 A;  4FH8 A;  5ECO B;  1GTA A;  2QGV A;  2MYG A;  2IME A;  1T00 A;  4G0L A;  2CAQ A;  4PQ1 A;  2IN3 A;  3EE2 A;  5IMZ A;  3MSZ A;  2H74 A;  3E9J B;  1F3B A;  4IP6 A;  4GXZ A;  4CY6 A;  4OO5 A;  5IQY A;  1Z7P A;  1GUM A;  4FO5 A;  4ZBB A;  2O7K A;  4EIP A;  4EXJ A;  4G0K A;  4KAE A;  2WJU A;  3CRU A;  3W8J A;  1FVK A;  1THO A;  5AGY A;  2HT9 A;  2R5G A;  1AC1 A;  4MP4 A;  2LUS A;  5J4U A;  2VL9 A;  2VD0 A;  4PGT A;  5F8B A;  2IPA A;  4GCI A;  4KUN A;  2VAF A;  1AW9 A;  3HCZ A;  4KE3 A;  3FHK A;  2CAI A;  3UAR A;  1ABA A;  1XFL A;  5DVB A;  3IK7 A;  4Z2T A;  4PXO A;  5E59 A;  1GSF A;  2H70 A;  2FY6 A;  3F0I A;  2XC2 A;  4Q5R A;  5FHI A;  1THX A;  5IMD A;  4XHM A;  1ZYN A;  5F05 A;  2VCW A;  4RI6 A;  2CVK A;  2VLT A;  1K0C A;  3CXG A;  3F3R A;  3QDN A;  3GHA A;  2FCH A;  5G5E A;  1GNW A;  2VOC A;  3TRP A;  2WGR A;  2PPT A;  5B8B A;  5IMA A;  5G1L A;  3ZML A;  3HXS A;  1YKC A;  1RW1 A;  2V6K A;  5KEJ A;  3Q6O A;  5DQS A;  3DGQ A;  1XBS A;  3M9J A;  1IYI A;  2C4J A;  3ED3 A;  1RQM A;  5LNK e;  3WT1 A;  5IMF A;  2DMM A;  4HDE A;  3RPN A;  2QKE A;  3V1W A;  1G7O A;  4O5Q A;  4PNG A;  2IIY A;  3ZRE A;  2YPM A;  1PN9 A;  2VL2 A;  4BVY A;  1PX6 A;  1ERV A;  4PX1 A;  2DJ1 A;  2FLS A;  4KA0 A;  3TRX A;  5GST A;  2OJL A;  1KBN A;  5CRH A;  2X4A A;  1SJ6 A;  2I4A A;  5ECS A;  5C04 A;  1GH2 A;  3DEX A;  3PGT A;  3ZVJ D;  4MPF A;  2IMF A;  2H0I A;  1AQW A;  5J9C A;  3DWV A;  2J9H A;  5L71 A;  5G5F A;  4HJM A;  5ID2 A;  4GQF A;  5ECP B;  3VWW A;  3D21 A;  3VPQ A;  2XPE A;  2YZH A;  2YCD A;  3F4S A;  3TKS A;  2OBI A;  1JLW A;  4WET A;  2B7J A;  1PA3 A;  4OD7 A;  6GST A;  5D73 A;  1QUW A;  1YF1 A;  5ECL B;  2H01 A;  4MJA A;  1DSB A;  2VCT A;  3CBU A;  3LGC A;  2C3Q A;  2JAC A;  1ZYP A;  2A2R A;  4WF4 A;  2CVD A;  2X8C A;  3GX0 A;  2LJA A;  3C71 A;  1XPV A;  1XCC A;  1EV9 A;  4ISD A;  2L6D A;  9GSS A;  3UL3 A;  2CX4 A;  1MTC A;  4ZL9 A;  2HRK A;  1FVJ A;  4TXO A;  5KN1 A;  3QMX A;  2CT6 A;  5GAP D;  1Q4J A;  4FYC A;  4TR1 A;  1ZYE A;  1AUC A;  1BAY A;  5D96 A;  3O3T A;  4EKZ A;  3APQ A;  2FD3 A;  4D73 A;  3LQ7 A;  3FR6 A;  3TUE A;  1TRS A;  1BED A;  3TKR A;  3GRX A;  3RHB A;  4QL7 A;  3TOT A;  4BL7 A;  2V32 A;  4RUV A;  4IN0 A;  4EDZ A;  4ECJ A;  1S3A A;  1OC9 B;  2GS3 A;  4X1U A;  2AAW A;  5LD0 A;  4BVX B;  4H86 A;  4Q5F A;  4MA9 A;  2IJY A;  3KZQ A;  4O7H A;  2DC5 A;  4YKG A;  2E7P A;  3DD3 A;  2RUF A;  3LW9 A;  2FWH A;  3QFA C;  4GTU A;  5IOW A;  3IHQ A;  2YWI A;  4HS1 A;  3HVX A;  3D4M A;  2VM1 A;  3LOR A;  4ECI A;  1F37 A;  2HSH A;  1SYR A;  3DVX A;  4IP1 A;  3H79 A;  2A4V A;  1M2D A;  3EU3 A;  4N10 A;  1YEX A;  2F8F A;  4AJ8 A;  2FHE A;  5J3R A;  5BMU A;  1S3D A;  5AN1 A;  2YWN A;  2AJQ B;  1GL8 A;  5DAK B;  1SJI A;  5HFI A;  2N5F A;  1OE8 A;  3FZ9 A;  1O85 A;  14GS A;  5G31 A;  5ABR A;  1A8Y A;  2M46 A;  2LKU A;  1G6Y A;  1URM A;  4WXT A;  4MZB A;  1N8J A;  4HOJ A;  2G0F A;  4DSS A;  3SWL A;  3BOA A;  1WJK A;  2HRN A;  1TW9 A;  3LFL A;  3Q19 A;  3DVW A;  1WRY A;  2VL3 A;  4JR4 A;  3EIN A;  4AJ7 A;  3GSS A;  2DJ0 A;  1NM3 A;  2YZU A;  3C1R A;  1T4Z A;  2HLS A;  5D8I A;  5KOX A;  2KP1 A;  4I2T A;  1Y6E A;  4XCS A;  1PKW A;  5DCG A;  2O8V B;  2ALB A;  1ZMA A;  1SD9 A;  2REM A;  3HZ8 A;  2WCI A;  3HVV A;  2MBT A;  1GUL A;  4GRF A;  1DUG A;  4F82 A;  3BCI A;  1YKA A;  3KTB A;  3KCM A;  4YAP A;  3TKS E;  2P5Q A;  4IQA A;  3KXO A;  2H8L A;  3IRA A;  1FHE A;  1FOH A;  3TKQ A;  2N5B A;  13GS A;  1TK8 B;  2WS2 A;  4P3Y B;  4ID0 A;  1BX9 A;  1EOG A;  5D9X A;  2VM2 A;  3QFB C;  1JZD A;  1UA5 A;  3WGD A;  3NZN A;  3RDW A;  3RBT A;  2H19 A;  2DBC A;  4MJE A;  4YKF A;  2F51 A;  1S3C A;  2EIO A;  4BWS A;  4OCE A;  2OKA A;  5ECI B;  4GST A;  1TU8 A;  4XS1 A;  6GSV A;  3QAW A;  2LRN A;  3ZIT A;  2NDO A;  3UJ1 A;  1XWK A;  2QA1 A;  3APS A;  1ZL9 A;  4OFN A;  1M9A A;  3TB2 A;  1FO5 A;  1Z3E A;  4IEL A;  3KGK A;  4N0V A;  2ON7 A;  3CYN A;  3E3E A;  3RHC A;  2PVO C;  1CQH A;  4V2M A;  5B8A A;  3U5R E;  3H1N A;  1XW6 A;  2VLV A;  3TOU A;  5GSS A;  4Z2U A;  5ELA A;  3E0U A;  3GIX A;  3IK9 A;  2O87 A;  1ZCP A;  3EC3 A;  1A2J A;  1ZOF A;  5IM9 A;  6GSY A;  1X9W B;  3CTF A;  1MDJ A;  1XWC A;  3BD2 A;  1VF3 A;  4MMM A;  3GMF A;  3DXB A;  2F3M A;  3F4T A;  1ZGN A;  2FWF A;  4EVM A;  3ZIJ A;  3ZRD A;  1R5P A;  1TRU A;  2HXK A;  4POB A;  2VCV A;  3RAZ A;  2GZP A;  3LYP A;  4ZB8 A;  1YEP A;  3TJJ A;  3IE3 A;  3IOS A;  3LEF A;  4L5O A;  3Q74 A;  3M9K A;  1M2B A;  2L4C A;  5IPH A;  3U6V A;  4OCF A;  1XVQ A;  4EUY A;  1R4W A;  1WPI A;  4JU5 A;  11GS A;  5ECH B;  2H73 A;  2C0D A;  4F0B A;  2FNO A;  3IXR A;  1PMT A;  3HJM A;  2FA4 A;  4BPY A;  2H30 A;  5HQP A;  1M99 A;  3LXT A;  1GUH A;  5EPF A;  4AF2 A;  3HVS A;  1Z9H A;  2QSI A;  3F8U A;  5DAL B;  2C0F A;  1TDI A;  2X64 A;  3KMN A;  4O32 A;  3GYK A;  4V1A g;  3GNJ A;  5CAX A;  2BMX A;  2AUV A;  2JSY A;  3IR4 A;  3UVH A;  1KNG A;  1B8X A;  2F8A A;  4KDY A;  4ZXG A;  2LJK A;  4CY8 A;  5J5N A;  1B9X C;  1GSD A;  4IQ1 A;  4ECB A;  4XRD A;  2YWO A;  5DBQ A;  1OE7 A;  1SKR B;  5E4W A;  4HU7 A;  4FIW A;  2B5Y A;  20GS A;  5A4V A;  2H0G A;  3L78 A;  2C1Y A;  4N0Z A;  10GS A;  1I9D A;  4WKW A;  4ML6 A;  3A2X A;  3QD9 A;  3ZIV A;  5C00 A;  3HJO A;  1GTU A;  1XXU A;  2CX3 A;  2H71 A;  1EWX A;  1RK4 A;  3IAS 2;  4XS4 A;  2O85 A;  4O5U A;  1GTB A;  3C73 A;  4FQU A;  3GUR A;  1HNB A;  5HR0 A;  3GST A;  1MD4 A;  5KN2 A;  2F9S A;  5JWR B;  3PR8 A;  2PMT A;  4TR4 A;  3GL5 A;  1PGT A;  1YQ1 A;  4F2I A;  2RM5 A;  5B7C A;  2GT6 A;  3EWL A;  2HZE B;  4YAV A;  2TRX A;  2KOK A;  4MF5 A;  2ON5 A;  7GSS A;  1FW1 A;  2IMK A;  1KEB A;  5ECM B;  1UC7 A;  2HRF A;  1TI3 A;  1SEN A;  1EOH A;  3EPT A;  3DML A;  4K0N A;  3TRQ A;  1OC9 A;  1QFN A;  2C0G A;  4BVX A;  5G30 A;  1E6B A;  3FK8 A;  1YY7 A;  1EEJ A;  3L4N A;  4TN8 A;  1ACV A;  2H1D A;  2JU5 A;  4YQV A;  1W4V A;  4MJB A;  2I81 A;  4HQS A;  1YF0 A;  2H76 A;  5F07 A;  5DJM A;  4IHU A;  2PWJ A;  1AXD A;  1A24 A;  4K7I A;  2PN8 A;  2E2G A;  3DYR A;  2NPB A;  1BJX A;  1JFU A;  4ULX A;  1YZX A;  2L57 A;  3ZL5 A;  2H0H A;  3I69 A;  2CVB A;  3P8W A;  1EP8 A;  1X9M B;  3A3T A;  4MK3 A;  2YNX A;  5IMV A;  2TRC P;  1NHY A;  5AIV A;  4AGS A;  5HR1 A;  1WP0 A;  2DIY A;  2I1U A;  3QOU A;  3GH6 A;  3BBY A;  1K0A A;  1F9M A;  3N5O A;  3P2A A;  2RII A;  4GLT A;  2A2S A;  4Z7X A;  4J56 E;  2GLR A;  2GQK A;  2H6X A;  4ZIL A;  4YH2 A;  2L6C A;  2DKI A;  2L5O A;  3CSH A;  3ERG A;  3UIW A;  3LWA A;  3FY7 A;  5H5R A;  4DSR A;  5A5K A;  16GS A;  3UOM A;  1TXX A;  1AIU A;  2VCX A;  5DQY A;  2H6Z A;  3UVT A;  4WR5 A;  1X5D A;  1N2A A;  4K1F A;  2M80 A;  1HD2 A;  4K2D A;  4QQ7 A;  1T8E B;  4XTS A;  2DML A;  5H5S A;  4GSS A;  2KHP A;  4E8E A;  1F6M C;  1QGV A;  1V2A A;  3R3E A;  4DSQ A;  2LQQ A;  3D5J A;  2LJR A;  2YV9 A;  3ZYW A;  3I9V 2;  2GSQ A;  1LU4 A;  4J57 E;  1J08 A;  2AHE A;  1HYU A;  5INY A;  3HDC A;  2B3S A;  1JHB A;  5CYY A;  2IL3 A;  5D9V A;  5CO3 A;  2R2J A;  5J9B A;  1V57 A;  2LS5 A;  3WGE A;  3P90 A;  2O89 A;  4FYB A;  2ZNM A;  2PUK C;  4POL A;  2NVL A;  3VUR A;  4PQI A;  3J7Y b;  1YDK A;  3HZ4 A;  1EV4 A;  1T4Y A;  1DE2 A;  2OAD A;  4BVY B;  3C8E A;  2XHF A;  4PQH A;  2R37 A;  5GZZ B;  2WRT A;  5JCU A;  3W8S A;  2HNL A;  1ON4 A;  3KTL A;  4K7O A;  2A2P A;  5HR2 A;  4IJI A;  4MZC A;  5F06 A;  1J0F A;  4F9Z A;  3LXZ A;  3F9U A;  2EIR A;  2GGT A;  5ECR B;  2ZUP A;  5LCZ A;  2YP6 A;  5ID2 B;  3LJR A;  1JLV A;  4JBB A;  1PN0 A;  2C3T A;  1K3Y A;  1X5E A;  5B6N A;  2WZ9 A;  2K6V A;  4EDY A;  4MLY A;  3FYG A;  2OE3 A;  1SYX A;  4K0G A;  1O7U A;  1B48 A;  1XZO A;  3PH9 A;  2OE1 A;  1K0N A;  3GKN A;  2QA2 A;  1GP1 A;  4ZB9 A;  3P7X A;  5A4U A;  1VF2 A;  3IAM 2;  5EL8 A;  5CRG A;  4LL4 B;  2WDU A;  1OC8 A;  1OAZ A;  1OKT A;  3AY8 A;  1PRX A;  1M9B A;  1TK5 B;  3QAV A;  1SL1 B;  3Q18 A;  1H75 A;  1TRW A;  2N5A A;  3FW2 A;  2GT5 A;  2Z9S A;  1U3A A;  4IKH A;  5DJL A;  5ELG A;  4WF5 A;  1TKD B;  3IPZ A;  2PU9 C;  3ME8 A;  4OFT A;  4TR1 B;  2CV4 A;  4FYU A;  4X4J A;  2V1M A;  1Z7R A;  1EEM A;  1GLP A;  4IS0 A;  4EE0 A;  4D73 B;  1PQN A;  4G10 A;  2K8V A;  4GWR A;  4L0U A;  3UBL A;  1X0R A;  5G2Z A;  1FG4 A;  1K3L A;  4EIQ A;  4POK A;  5CRE A;  2EC4 A;  3H93 A;  2P0G A;  1TOF A;  3H8Q A;  4BL7 B;  5D93 A;  4RQR A;  1R5A A;  1HNA A;  3IC4 A;  1J9B A;  3VPT A;  1QMV A;  2IMI A;  3M3M A;  3J7Y k;  4LMW A;  3O6T A;  1A0F A;  4NAX A;  2PBJ A;  1BQ7 A;  4CDO A;  4HU9 A;  3M1G A;  1NW2 A;  3F6F A;  1K0M A;  4GF0 A;  3GTU B;  3FKF A;  5GAN D;  2FGX A;  1K0B A;  3IDV A;  1R26 A;  5COH A;  3GN3 A;  1M7T A;  4V2L A;  1CQG A;  2RLI A;  3FEU A;  2IFQ B;  1TU7 A;  3D0Z A;  3GUS A;  3UMA A;  5DCH A;  2C80 A;  2C3N A;  4XIH A;  2YV7 A;  2R0C A;  1TK0 B;  2BTO T;  3UBK A;  3G7J A;  1QK8 A;  4JR6 A;  4XRA A;  3CSJ A;  5D9W A;  1ILO A;  3HJP A;  3LYK A;  4POM A;  3US3 A;  2M72 A;  4IGJ A;  3VWU A;  2GVP A;  5BRT A;  4L5L A;  2GSR A;  1HQO A;  1OC3 A;  4Q5N A;  1AQV A;  1B4P A;  1QQ2 A;  2KP2 A;  4DSS B;  3MWH A;  1G0T A;  1K0D A;  4NMU A;  1V98 A;  1WMJ A;  2V6O A;  1GNE A;  4HUA A;  3H4K A;  5CRW A;  1Z6M A;  1MEK A;  2ZCT A;  3TDG A;  3KEB A;  2VUP A;  2R4V A;  4HQZ A;  5B6M A;  2A4H A;  2LEG A;  2I3Y A;  2OAC A;  1C72 A;  3TJK A;  3IHG A;  4YQU A;  1H4O A;  3I6A A;  3CTG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...