2GQMA

Solution structure of human cu(i)-sco1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
173
structure length
173
Chain Sequence
SFTGKPLLGGPFSLTTHTGERKTDKDYLGQWLLIYFGFTHCPDVCPEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPYRKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords SCO1 protein homolog, mitochondrial
publication title A hint for the function of human Sco1 from different structures.
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2006-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02630 SCO1-SenC SCO1/SenC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2gqmA00
4MDCA 4BWSA 1SYXA 3KEBA 3SBCA 3QD9A 2VCWA 3APOA 1QXHA 3DVWA 1R26A 2I3YA 2VCXA 3ME8A 1GP1A 5ECLB 5LCZA 3FYGA 2IJYA 2CX4A 5IMZA 3UMAA 3UOMA 4TOPA 3HJMA 4KSMA 2CA8A 3TKSE 1A8YA 3HCZA 5IO2A 3UIWA 1Z7PA 4OFNA 2R37A 4L5LA 5AGYA 3M9KA 22GSA 1Z7RA 2IMDA 3I9V2 3NIVA 3DIEA 3TKQA 3GKNA 3US3A 2PGTA 16GSA 3E0UA 2MMNA 3TJBA 2K9FA 5CP1A 2AAWA 5J9BA 2VM2A 8GSSA 2IL3A 2H1BA 5CYYA 2QC7A 4DSSB 1K0CA 1M9AA 2AB6A 1O81A 3PH9A 1F9MA 1EWXA 3L0HA 5G2ZA 4I2UA 4TR1A 4ECBA 3GIXA 2B7KA 1A8LA 3BCKA 4ZBBA 1O7UA 2HE3A 2VLUA 1K0AA 5F05A 3CSIA 2LNSA 1FHEA 1VRSD 2HZEA 4P3YB 5FWGA 11GSA 2ON5A 3ZYWA 2L5OA 2DLXA 1EZKA 1K0NA 1ZCPA 4EXJA 3F4SA 4IBPA 5J4UA 2L57A 4RQRA 1GTBA 3DYRA 2X8HA 2YP6A 1EOGA 4PURA 3QAGA 3DRNA 2O89A 5ID2A 3MDKA 2KUCA 2MMZA 4MP4A 5A4VA 12GSA 4EC0A 3IR4A 3EU3A 1U3AA 5CAXA 4XRDA 3DWVA 1R5AA 2DC5A 2FGXA 3HXSA 4KE3A 5D9TA 2PBJA 4E8EA 3QCPA 2G2QA 3WGEA 1X9MB 1GLPA 4H86A 2MYGA 1ZMAA 1AQWA 1GNEA 1K0OA 1TJDA 3O76A 2B5YA 1GWCA 2QGVA 1YEPA 3CSJA 4POMA 2GSQA 3A2VA 1YKAA 2WCIA 5IMFA 3HVVA 4NMUA 4N0VA 4MJAA 4DEJA 3ERGA 5LNKe 3TUEA 4K6XA 3K8NA 4V1Ag 4KCEA 4MF5A 3IHQA 2CVKA 2HSHA 4ECCA 1ZGNA 3KZQA 3ZL5A 1XWCA 4DSRA 2ES7A 1T1VA 1WE0A 5D8IA 3WGXA 4ULXA 1AW9A 4EO3A 5H5RA 4HJMA 2GSTA 5FT3A 3IDVA 5ECSA 4F2IA 4BPYA 2OA7A 5CRWA 1ZL9A 5GSTA 5C04A 4NHWA 2CV4A 3IV4A 2VAFA 3A5WA 2H71A 2H1DA 1U3IA 2FWFA 1ERWA 1TU8A 2VL2A 1UA5A 4F0BA 4KAEA 4JE1A 1JZWA 1T3BA 2GS3A 2G0FA 3C8EA 2LKUA 2X8GA 2DJ0A 3QFBC 2LEGA 4Z7XA 1EP7A 1UN2A 4DSQA 2GGTA 4D73A 1PGTA 3HD5A 3KMNA 2H0HA 3KH7A 3AY8A 3F6DA 3KMOA 2H66A 1KEBA 5G1KA 5ECHB 3VPQA 4K7OA 5DJMA 1X5DA 3TKSA 1KBNA 2BTOT 4KX4A 2E2GA 1SJZA 2A2SA 2HXKA 3E9JB 3FHKA 1GUKA 1EEMA 1I9DA 4IP1A 1QMVA 4IKHA 3Q74A 1X9WB 2YJHA 3GNJA 3LG6A 3VWUA 3KTBA 5CREA 3HY2A 4CW9A 4PNFA 4MZBA 2WJUA 1MEKA 5DJLA 3ZIVA 5DBQA 2LUSA 1G6YA 1RK4A 1MD3A 4HQZA 2DIZA 4OFMA 1YZXA 2X8CA 1S3CA 4IHUA 1TW9A 3O6TA 3HJPA 1B8XA 3ZLPA 2MBTA 3IK7A 3FW2A 2C0GA 5J3RA 2GZZA 2YNXA 2C3QA 4FIWA 1PQNA 5B8BA 6GSVA 3Q19A 1Y25A 1GSDA 4PNGA 4RQXA 5FHIA 1WIKA 2B3SA 2ZCTA 5AIXA 3ZTLA 3DKSA 2FA8A 3MNGA 3PR8A 4AJ7A 4POBA 3A3TA 4EDYA 1TK8B 3ZREA 2NVLA 4QL7A 2FCHA 4JR4A 2FD3A 2IFQA 2YWIA 4F82A 4I97A 3G7JA 1AC1A 1GTUA 2YWMA 1R4WA 3VURA 1FAAA 4HI7A 1ILOA 3L9UA 2PN8A 2HI7A 3GH6A 1FW1A 1V9WA 1TRUA 4ZBAA 3G7YA 2DJ2A 3TRPA 1A2LA 4IN0A 4EDZA 1B9XC 1M2BA 1U6TA 5DQYA 3GYKA 4LL1B 4PGTA 2TRXA 4IGJA 2IWTA 5F0GA 1PKWA 3GX8A 1YEXA 3VWXA 5COHA 10GSA 4PXOA 4WBRD 4BWQA 2OE0A 5B6MA 1GH2A 2WGRA 5IPGA 2EIQA 3ME7A 1OC9B 1ML6A 3LORA 1WWJA 3M3MA 3G7IA 4ZL9A 2K6VA 1YDKA 1NM3A 3QFAC 5G31A 2DJ1A 3ED3A 4POKA 2L6CA 4XIHA 2LRNA 3L4NA 2D2ZA 1ERVA 4O5RA 6GSXA 1JHBA 3TJJA 3QPMA 4KUNA 3KP8A 2YZHA 3IA1A 5JWOB 3UEMA 4WR4A 1XWGA 1UVZA 2GLRA 2H19A 3MSZA 1ZYEA 4K1FA 6GSTA 3RHCA 4PQHA 2YCDA 1AAZA 4BVXA 1OE8A 7GSSA 2OBIA 4HS1A 2IMIA 2VO4A 4ZB6A 6GSUA 3ZRDA 1PX6A 3LXTA 2GVPA 4LLRA 2AUVA 1J9BA 3VFIA 4TR0A 4TKYA 3C1SA 1QGVA 18GSA 4K7NA 2C1YA 5HR1A 3ERFA 1X9SB 2JSYA 1AUCA 2EIRA 1F2EA 2ZNMA 1GSEA 3DGQA 2IMFA 3EU4A 4Q5RA 2WRTA 3IOSA 4ZXGA 2DMMA 3HVSA 2HZFA 2B1KA 5ELGA 3GURA 1SK2A 2K8SA 5DALB 4ILFA 1OVNA 4L0UA 1VF4A 2N5BA 2GDRA 2B7JA 4NV2A 3KM6A 2CT6A 1TK5B 1GSQA 4K7IA 4XCSA 1URMA 2VLTA 2A2RA 5F8BA 1ZOFA 3DVXA 5B6NA 1IYIA 2E0QA 5A5KA 1Z6MA 1FB6A 1XOBA 4IS0A 2HYXA 1MTCA 3G9BA 2Z9SA 4XS1A 3TKPA 3IK9A 3FEUA 2H6XA 3E3EA 20GSA 5IQYA 2AYTA 1Q98A 5AISA 2YWNA 1N2AA 1GUHA 3TB2A 3F8UA 4ZILA 1W4VA 5HFIA 2YANA 2GQMA 1TRWA 1ZYQB 2O8VB 1BEDA 2P0GA 3SWLA 5G30A 2DJJA 1V40A 3KGKA 3WT1A 2DIYA 1TRVA 2RM6A 2V6OA 2B1LA 1TK0B 3FR3A 4OMVA 1TRSA 3GFKA 1GRXA 5KN2A 1B9YC 4PUFC 3FKFA 1VGLA 1SD8A 2LJRA 4IVFA 1THOA 5H5QA 5HFGA 2HNLA 2DBCA 4BL7A 4K2DA 2V2GA 2H72A 3ZMKA 3IE3A 3TOUA 3S9FA 2LJKA 5IO0A 4J2FA 2NBSA 4TXOB 2J23A 1GSSA 3M9JA 5IOXA 4JU5A 4MABA 1JFUA 1NW2A 1SJIA 3IPZA 2GSSA 3GSSA 1HYUA 3FY7A 3F4TA 1FVJA 3GKXA 1J0FA 1OAZA 2LTKA 2C4JA 1JLVA 4YAPA 2DMLA 1K0DA 4GSNA 2DSAA 2AJQB 4EE0A 4TR1B 2ALBA 2GT6A 3D5JA 3ZVJA 5INYA 2NPBA 4O92A 5GSSA 1PKZA 1XW6A 3HKRA 2BMXA 4WBJA 2RUEA 3VWWA 1OKTA 1XVQA 2FUG2 2WB9A 3DD3A 2EIOA 1F6MC 2C0FA 5F06A 3F6FA 3GN3A 1KTEA 1XWBA 2JACA 3ZZXA 2LRTA 4IJ3A 3UBKA 3F9UA 4KB3A 2YZUA 4WKWA 2P31A 3EINA 3WD6A 3IRAA 4X43A 4YH2A 4AJ8A 4O7HA 2L4CA 5ID2B 3CXGA 2VLVA 4OFTA 5D73A 4OCFA 4IW9A 4TW5A 4K0NA 4NHZA 4MPFA 4ECJA 2VCVA 2CVBA 1NHOA 1BYEA 4HOJA 5D9VA 5D9WA 5DAKA 1EGRA 2H0IA 5B8AA 5GAND 3GTUA 4F03A 4MPGA 4NPBA 2OJLA 4HU9A 3KCMA 4TXVA 3HZ4A 4K0GA 5EVOA 4QQ7A 4ACSA 2FWEA 2HT9A 3D21A 1XWKA 2M80A 4FYUA 2X99A 3CBUA 4YAVA 4O32A 1SL2B 3QAWA 1SL1B 1R7HA 4IP6A 4G9HA 4XHMA 1M2DA 5CNWA 1TKDB 3WT2A 3FZ9A 3ERWA 4HQSA 1XVWA 3UARA 1HQOA 3C7MA 1A0RP 2YJ7A 3TJKA 1M0UA 4MH3A 4AF2A 3HDCA 1E6BA 1GLQA 1XPVA 4GXZA 3RPNA 3LYPA 1VF3A 2LQOA 1PL2A 2OE1A 1A2MA 3FR9A 2TRCP 5CRDA 3N5OA 3EYTA 1X5CA 2HRFA 2RM5A 5KEJA 2I9HA 1EGOA 1ERTA 2C3TA 3ZIJA 3PINA 1G7OA 5LD0A 1EP8A 3CRUA 1Q4JA 3QR6A 5G1LA 1XXUA 3KD0A 1HNCA 4IQAA 2JU5A 4F0CA 1QFNA 4D73B 1RQMA 4MA9A 3LWAA 3H1NA 2M72A 1O85A 1USBA 4EF0A 2WULA 1Z6NA 2XC2A 3C73A 2BJXA 1ZZYA 2P5RA 5J9CA 1Z9HA 4EL1A 4V2MA 5ECIB 1XCCA 3CMIA 3UVHA 2NTOA 4MK3A 3L9SA 2EC4A 1ACVA 1TU7A 2C8UA 2CAIA 1G7EA 3VLNA 4G10A 4MMMA 2CVDA 2H73A 1T4ZA 3FZAA 1THXA 2R3XA 2KLXA 1OC9A 3Q18A 14GSA 1BJXA 4OO5A 4L0WA 4LMVA 3N9JA 3TRXA 1XWAA 4JR6A 4NAXA 2R2JA 5ABRA 3HA9A 1I5GA 3L78A 1V98A 3F3QA 3R2QA 4EVMA 1Z3EA 3KH9A 3FRCA 4ZL7A 1GTIA 3GRXA 1HNAA 4TR3A 1Y6EA 2VL9A 2HFDA 2XBQA 1N8JA 3D6IA 1A23A 1XBSA 1K0BA 5IM9A 3TKRA 2XPDA 2CZ2A 3I69A 2AV4A 5ECOB 2IFQB 1LBKA 4CHSA 3CRTA 2V41A 2JZRA 4BA7A 3UJ1A 3GHAA 2F51A 4K8MA 1ST9A 2CQ9A 2FA4A 4GF0A 1OE7A 2YN1A 4KDXA 3GL5A 4YQVA 1K3YA 5IOWA 1K0MA 4I2TA 4HEA2 4GRFA 1EEJA 3CSHA 2LSTA 3QMXA 2PVOC 2VCTA 4TVEA 2N5FA 1PX7A 1VF2A 2VL3A 5IPHA 5KN3A 2C0EA 4N0ZA 1ON4A 3GMFA 4G2EA 6GSSA 5KN0A 1QUWA 4YQUA 4MF7A 1SD9A 2VM1A 3F4RA 4GCIA 4MZWA 3KIJA 2H1GA 5CRGA 4V2LA 4G19A 1JZRA 2QSIA 2JL4A 3EWLA 4LMWA 4IELA 2WS2A 1BAYA 5EL8A 1H4OA 1JZDA 2ON7A 3Q6OA 5ECNB 2DJ3A 2JZSA 3EMPA 3LJRA 3J7Yk 1V57A 4GQCA 1GSUA 5DVBA 3BOAA 3VK9A 2L4QA 6GSWA 5IMVA 4WETA 1F3AA 2FLSA 2WZ9A 1PL1A 4LA1A 5D93A 5IMDA 3FZ4A 1DUGA 3F3RA 1T8EB 2HSYA 3W8JA 1U88A 4DSSA 2V1MA 5HR3A 4AJ6A 1X5EA 3ZITA 2H01A 2H8LA 4X0XA 1GL8A 4HDEA 2GTUA 1PMTA 4RUVA 2OACA 2TIRA 5C00A 2H30A 4XS4B 5D96A 5IMAA 3EC3A 3ZFLA 1MD4A 5DDLA 4NXIA 3DXBA 3WGDA 1VF1A 3W6GA 3ISOA 4YQMA 5HQPA 4XRAA 4OD7A 4ZB9A 2RUFA 1GSFA 2VCZA 4TXOA 3P90A 4KGIA 4ZBDA 1O8XA 4LL4B 4ZIJA 3P8WA 4HZ2A 4TRXA 3EVIA 3M8NA 2KOKA 2HLSA 1GUMA 5D9XA 2F8AA 3J7Yb 4GQFA 2GT5A 2H1AA 2LRCA 1BX9A 4V2NA 1G6WA 3H4KA 1YY7A 3NZNA 5B7CA 1PN9A 3EE2A 2A4VA 2JADA 1O8WA 4I5QA 1DSBA 2IMEA 5IIZA 3F0IA 1WOUA 2F8FA 2VOCA 2P5QA 1TI3A 2H74A 3APSA 5DQSA 19GSA 2MBSA 3QOUA 2R4VA 2IIYA 2FY6A 4XTSA 1PD21 5IMCA 1C72A 1MDKA 2IN3A 2CX3A 4WF4A 1KNGA 4Q5NA 4L5OA 2MMOA 1J08A 2R5GA 2O87A 4GLTA 3IXRA 2GSRA 2H6YA 1DBYA 3RPPA 2KP2A 1RW1A 3BBYA 2QKEA 4GWRA 3LQ7A 1B4QA 2YV7A 2KP1A 1YF0A 2MZCA 1XZOA 1W89A 3WYWA 5JCGA 3ZMLA 3GUSA 2LV3A 4X1UA 4MJEA 2M46A 1YJ6A 2K8VA 4FH8A 3MWHA 3CTGA 4EKZA 5JCWA 1SENA 2HZEB 3U6VA 1BG5A 2J9HA 5AN1A 4FO5A 2X64A 1OYJA 1YQ1A 3IC4A 4MH2A 3P7XA 2GQKA 2WFCA 5G5FA 3EURA 3GA4A 4PQ1A 2K18A 1QK8A 4KW6A 1XIYA 3FK8A 3D4TA 3TDGA 1SYRA 4GTUA 1AIUA 2L59A 5ECQB 2NDOA 3IAS2 3PGTA 3LEFA 5ECKB 4MZCA 1TOFA 2H6ZA 5AIVA 3UAPA 5DCHA 2V6KA 2PWJA 3LFLA 4WF5A 3O3TA 4N11A 1DE2A 1T00A 2IMKA 3U5RE 3A2WA 3OR5A 3LYKA 3D22A 2OE3A 2B5XA 2C80A 4ML1A 3RBTA 5E59A 2VUPA 4WXTA 2LNTA 1OKDA 4KH7A 2GQLA 4MF6A 4V1Ap 1SKRB 2VL2C 4I6XA 1WRYA 1LU4A 2YWOA 4KDUA 4L8EA 1WPIA 1TP9A 5GZZB 5HFKA 3ZVJD 1GSYA 2ZUPA 3IBHA 1SKWB 2XHFA 3BJ5A 1V2AA 2IPAA 3HJOA 4PQIA 1XFLA 1M9BA 1PRXA 4E8HA 1AXDA 2H70A 4KA0A 5E4WA 3BCIA 2RLIA 2OADA 3FZ5A 4MLYA 4OO4A 2JZTA 2KHPA 1GULA 1BQ7A 3RAZA 3NOFA 2GZYA 3KTLA 3QAVA 4J57E 5ECRB 2CAQA 4F9ZA 2F3MA 4IQ1A 2CZ3A 1EOHA 4TN8A 4NWYA 2FWHA 2XPEA 3TKSC 4GSSA 3I43A 3UBLA 1JLWA 1O73A 5DAKB 1M99A 2VCQA 3GTUB 5GAPD 4Q5QA 4TR4A 4MJCA 1PSQA 1K3OA 1CQHA 2PUKC 3HZ8A 2LS5A 2I4AA 2PERA 5JCUA 3A2XA 3RDWA 1WP0A 1S3AA 2B6MA 3VI5A 1HNBA 1MDIA 5CRHA 2FNOA 1ABAA 1YKCA 3CTFA 4FYBA 4K9ZA 4ID0A 17GSA 1FVKA 2REMA 3GKMA 2H76A 1TTZA 2I1UA 2B5EA 2PMTA 1IYHA 1GNWA 1FOVA 4HU7A 4JBBA 1F37A 1JZOA 4HZ4A 1SKSB 1F3BA 1LJRA 2C0DA 3CYNA 3DEXA 4OCEA 4PUAA 3VPTA 2H75A 2FHEA 4KDYA 3KJYA 5G5EA 3GL3A 3VWVA 2R6KA 1XW5A 2YPMA 1M7TA 1PA3A 1T4YA 1A2JA 4QL9A 4JRRA 5L71A 3GV1A 4EUYA 1WJKA 3MAKA 5CO3A 3C71A 3TJFA 1CQGA 13GSA 3UVTA 2VIMA 1B4PA 1HD2A 2O7KA 1NSWA 3D0ZA 4JZQA 2E7PA 5ECPB 3TJGA 1SJ6A 4N30A 4IJIA 1S3DA 2VD1A 1AQXA 2OBKA 1TXXA 1SK0A 4KNDA 1M2AA 1R5PA 1AQVA 2FWGA 5JWQB 2C3NA 1U87A 5ENUA 1EV9A 4RI6A 1XOAA 5J5NA 1MDJA 1QQ2A 2AHEA 5JWRB 4ML6A 2VD0A 4N10A 4WEYA 1EV4A 1SK1A 5KN1A 5A4UA 3D4MA 1TI1A 9GSSA 4PX1A 2H0GA 1XW9A 4WR5A 4ZB8A 2GZPA 2L6DA 5EY6A 5ECMB 3P2AA 4ISDA 3M1GA 3LXZA 3VI7A 2I81A 1YF1A 4JEDA 4MCUA 4ECIA 4MJBA 1K3LA 1OC8A 1A24A 5HR2A 3KXOA 2O85A 4ZL8A 4AGSA 3LGCA 4HJ2A 2YV9A 1E2YA 1V58A 1SL0B 3M0FA 6GSYA 2HRNA 3F63A 5DCGA 3I6AA 4KCAA 1SU9A 4XS6A 3HYPA 3KP9A 3TGZA 3APQA 5HR0A 3IAM2 4GSTA 3LSZA 3GSTA 2V32A 3V1WA 1NHYA 2LJAA 5DALA 5A4WA 3GX0A 1DE1A 4KSOA 5EPFA 3TRQA 2L5LA 1X0RA 3H93A 3EMXA 4RI7A 2E2MA 1B48A 4J56E 1T7PB 2JSZA 5J41A 5H5SA 1FB0A 3JCML 4Q5FA 2RIIA 4OWYA 2N5AA 3RHBA 2OKAA 3QDNA 2WDUA 1FO5A 1A0FA 1OC3A 1GTAA 3TCOA 2PPTA 4HUAA 3FR6A 4FYCA 1ERUA 3UL3A 4BVYA 3H8QA 3HVXA 4POLA 4NV5A 3BD2A 3GKKA 2LQQA 5ELAA 1FG4A 2YOIA 4XS4A 3GH9A 3DMLA 1Z5YE 1O6JA 2MMAA 4DVCA 1TDIA 3ZFBA 2PVQA 3HHVA 2PU9C 4CDOA 2XBIA 2F9SA 3W8SA 3TOTA 1UC7A 3H79A 4I8BA 2DJKA 3L9VA 1G0TA 1WMJA 5F07A 1H75A 3C1RA
chains in the Genus database with same CATH superfamily
4MDCA 4BWSA 1SYXA 4BIKA 3KEBA 3SBCA 3QD9A 2VCWA 3APOA 1QXHA 3DVWA 1R26A 2I3YA 2VCXA 3ME8A 1GP1A 5ECLB 5LCZA 3FYGA 2IJYA 2CX4A 5IMZA 3UMAA 3UOMA 4TOPA 3HJMA 4KSMA 2CA8A 3TKSE 1A8YA 3HCZA 5IO2A 3UIWA 1Z7PA 4OFNA 2R37A 4L5LA 5AGYA 3M9KA 22GSA 4O5QA 1Z7RA 2IMDA 3I9V2 3NIVA 3DIEA 3TKQA 3GKNA 3US3A 2PGTA 16GSA 3E0UA 2MMNA 3TJBA 2K9FA 5CP1A 2AAWA 5J9BA 2VM2A 8GSSA 2IL3A 2H1BA 5CYYA 2QC7A 4DSSB 1K0CA 1M9AA 2AB6A 1O81A 3PH9A 1F9MA 1EWXA 3L0HA 5G2ZA 4I2UA 4TR1A 4ECBA 3GIXA 2B7KA 1A8LA 3BCKA 4ZBBA 4K5RA 1O7UA 2HE3A 2DKIA 2VLUA 1K0AA 5F05A 3CSIA 2LNSA 1FHEA 1VRSD 2HZEA 4P3YB 5FWGA 11GSA 2ON5A 2R0CA 3ZYWA 2HRKA 2L5OA 2DLXA 1EZKA 1K0NA 1ZCPA 4EXJA 3F4SA 4IBPA 5J4UA 2DKHA 2L57A 4RQRA 1GTBA 3DYRA 2X8HA 2YP6A 1EOGA 4PURA 3QAGA 3DRNA 2O89A 5ID2A 3MDKA 2KUCA 2MMZA 4MP4A 5A4VA 4USSA 4BL7B 12GSA 4EC0A 3IR4A 3EU3A 1U3AA 5CAXA 4XRDA 3DWVA 1R5AA 2DC5A 2FGXA 3IC8A 3HXSA 4KE3A 5D9TA 2PBJA 4E8EA 3QCPA 2G2QA 3WGEA 1X9MB 1GLPA 4H86A 2MYGA 1ZMAA 1AQWA 1GNEA 1K0OA 1TJDA 3O76A 2B5YA 1GWCA 2QGVA 1YEPA 3CSJA 4POMA 2GSQA 3A2VA 1YKAA 2WCIA 5IMFA 3HVVA 4NMUA 4N0VA 4MJAA 4DEJA 3ERGA 5LNKe 2QA1A 3TUEA 4K6XA 3K8NA 4V1Ag 4KCEA 4MF5A 3IHQA 2CVKA 2HRAA 2HSHA 4ECCA 1ZGNA 3KZQA 4PTSA 3ZL5A 1XWCA 4DSRA 2ES7A 1T1VA 1WE0A 5D8IA 3WGXA 3FMWA 4ULXA 1AW9A 4EO3A 5H5RA 4HJMA 2GSTA 5FT3A 3IDVA 5ECSA 4F2IA 4BPYA 2OA7A 5CRWA 1ZL9A 5GSTA 5C04A 4NHWA 2CV4A 3IV4A 2VAFA 3A5WA 2H71A 2H1DA 1U3IA 2FWFA 1ERWA 1TU8A 2VL2A 1UA5A 4F0BA 4KAEA 4JE1A 1JZWA 1T3BA 2GS3A 2G0FA 3C8EA 2LKUA 2X8GA 2DJ0A 3QFBC 2LEGA 4Z7XA 1EP7A 1UN2A 4DSQA 3IHGA 2GGTA 4D73A 4G0LA 1PGTA 3HD5A 3KMNA 2H0HA 3KH7A 3AY8A 3F6DA 3KMOA 2H66A 1KEBA 5G1KA 5ECHB 3VPQA 4K7OA 5DJMA 1X5DA 3TKSA 1KBNA 2BTOT 4KX4A 2HSMA 2E2GA 1SJZA 2A2SA 2HXKA 3E9JB 3FHKA 1GUKA 1EEMA 1I9DA 4IP1A 1QMVA 4IKHA 3Q74A 1X9WB 2YJHA 3GNJA 3LG6A 3VWUA 3KTBA 5CREA 3HY2A 4CW9A 4PNFA 4MZBA 3EPTA 2WJUA 1MEKA 5DJLA 3ZIVA 5DBQA 2LUSA 1G6YA 1RK4A 1MD3A 4HQZA 2DIZA 4OFMA 1YZXA 2X8CA 1S3CA 4IHUA 1TW9A 3O6TA 3HJPA 1B8XA 3ZLPA 2MBTA 3IK7A 3FW2A 2C0GA 5J3RA 2GZZA 2YNXA 2C3QA 4FIWA 1PQNA 5B8BA 6GSVA 3Q19A 1Y25A 1GSDA 4PNGA 4RQXA 5FHIA 1WIKA 2B3SA 2ZCTA 5AIXA 3ZTLA 3DKSA 2FA8A 3MNGA 3PR8A 3PPUA 4AJ7A 4POBA 3A3TA 4EDYA 1TK8B 3ZREA 2NVLA 4QL7A 2FCHA 4JR4A 2FD3A 2IFQA 2YWIA 4F82A 4I97A 3G7JA 3MYDA 1AC1A 1S3RA 1GTUA 2YWMA 1R4WA 3VURA 1FAAA 4HI7A 1ILOA 3L9UA 2PN8A 2HI7A 3GH6A 1FW1A 1V9WA 1TRUA 4ZBAA 3G7YA 2DJ2A 3TRPA 1A2LA 4IN0A 4EDZA 1B9XC 1M2BA 1U6TA 5DQYA 3GYKA 4LL1B 4PGTA 2TRXA 2X4AA 4IGJA 2IWTA 5F0GA 1PKWA 3GX8A 1YEXA 3VWXA 5COHA 10GSA 4PXOA 4WBRD 4BWQA 2OE0A 5B6MA 1GH2A 2WGRA 5IPGA 2EIQA 3ME7A 1OC9B 1ML6A 3LORA 1WWJA 3M3MA 3G7IA 4ZL9A 2K6VA 1YDKA 1NM3A 3QFAC 5G31A 2DJ1A 3ED3A 4POKA 2L6CA 4XIHA 2LRNA 3L4NA 2D2ZA 1ERVA 4O5RA 6GSXA 1JHBA 3TJJA 3QPMA 4KUNA 3KP8A 2YZHA 4G0KA 3IA1A 5JWOB 3UEMA 4Z2TA 4WR4A 1XWGA 1UVZA 2GLRA 2H19A 3MSZA 1ZYEA 4K1FA 6GSTA 3RHCA 4PQHA 2YCDA 1AAZA 4BVXA 1OE8A 7GSSA 2OBIA 4HS1A 2IMIA 2VO4A 4ZB6A 6GSUA 3ZRDA 1PX6A 3LXTA 2GVPA 4LLRA 2AUVA 1J9BA 3VFIA 4TR0A 4TKYA 3C1SA 1QGVA 18GSA 4K7NA 2C1YA 5HR1A 3ERFA 1X9SB 2JSYA 1AUCA 2EIRA 1F2EA 2ZNMA 1GSEA 3DGQA 2IMFA 4O5UA 3EU4A 4Q5RA 2WRTA 3IOSA 4ZXGA 2DMMA 3HVSA 2HZFA 2B1KA 5ELGA 3GURA 1SK2A 2K8SA 5DALB 4ILFA 1OVNA 4L0UA 4CY8A 4MNNA 1VF4A 2N5BA 2GDRA 2B7JA 4NV2A 3KM6A 2CT6A 1TK5B 1GSQA 4K7IA 4XCSA 1URMA 2VLTA 2A2RA 5F8BA 1ZOFA 3DVXA 5B6NA 1IYIA 2E0QA 5A5KA 1Z6MA 1FB6A 1XOBA 4IS0A 2HYXA 1MTCA 3G9BA 4HSCX 4BVYB 2Z9SA 4XS1A 3TKPA 3IK9A 3FEUA 2H6XA 3E3EA 20GSA 4A5PA 2AYTA 5IQYA 1Q98A 5AISA 2YWNA 1N2AA 1GUHA 3TB2A 3F8UA 4ZILA 1W4VA 5HFIA 2YANA 2GQMA 1TRWA 1ZYQB 2O8VB 1BEDA 2P0GA 3SWLA 5G30A 2DJJA 1V40A 3KGKA 3WT1A 2DIYA 1TRVA 2RM6A 2V6OA 2B1LA 4CY6A 1TK0B 3FR3A 4OMVA 1TRSA 3GFKA 1GRXA 5KN2A 1B9YC 4PUFC 3FKFA 1VGLA 1SD8A 2LJRA 4IVFA 1THOA 5H5QA 5HFGA 2HNLA 2DBCA 4BL7A 4K2DA 2V2GA 2H72A 3ZMKA 3IE3A 3TOUA 3S9FA 2LJKA 5IO0A 4J2FA 2NBSA 4TXOB 2J23A 1GSSA 3M9JA 5IOXA 4JU5A 4MABA 1JFUA 1NW2A 1SJIA 3IPZA 2GSSA 3GSSA 1HYUA 3FY7A 3F4TA 1FVJA 3GKXA 1J0FA 1OAZA 2LTKA 2C4JA 1JLVA 4YAPA 2DMLA 1K0DA 4GSNA 2DSAA 2AJQB 4EE0A 4TR1B 2ALBA 2GT6A 3D5JA 3ZVJA 5INYA 2NPBA 4O92A 5GSSA 1PKZA 1XW6A 3HKRA 2BMXA 4WBJA 2RUEA 3VWWA 1OKTA 1XVQA 2FUG2 2WB9A 3DD3A 2EIOA 1F6MC 2C0FA 5F06A 3F6FA 3GN3A 1KTEA 1XWBA 2JACA 3ZZXA 2LRTA 4IJ3A 3UBKA 3F9UA 4KB3A 2YZUA 4WKWA 2P31A 3EINA 3WD6A 3IRAA 4X43A 1M3JA 4YH2A 4AJ8A 4O7HA 4X4JA 2L4CA 5ID2B 3CXGA 2VLVA 4OFTA 5D73A 4OCFA 4IW9A 4TW5A 4K0NA 4NHZA 4MPFA 4ECJA 2VCVA 2CVBA 1NHOA 1BYEA 4HOJA 5D9VA 5D9WA 5DAKA 1EGRA 2H0IA 5B8AA 5GAND 3GTUA 4F03A 4MPGA 4NPBA 2OJLA 4HU9A 3KCMA 4TXVA 3HZ4A 4K0GA 5EVOA 4QQ7A 4ACSA 2FWEA 2HT9A 4K2XA 3D21A 1XWKA 2M80A 4FYUA 2X99A 3CBUA 4YAVA 4O32A 1SL2B 3QAWA 1SL1B 1R7HA 4IP6A 4G9HA 1M3IA 4XHMA 1M2DA 5CNWA 1TKDB 3WT2A 3FZ9A 3ERWA 4HQSA 1XVWA 4YKFA 3UARA 1HQOA 3C7MA 1A0RP 2YJ7A 3TJKA 1M0UA 4MH3A 4AF2A 3HDCA 1E6BA 1GLQA 1XPVA 4GXZA 3RPNA 3LYPA 1VF3A 2LQOA 1PL2A 2OE1A 1A2MA 3FR9A 2TRCP 5CRDA 3N5OA 3EYTA 1X5CA 2HRFA 2RM5A 5KEJA 2I9HA 5KOXA 1EGOA 1ERTA 2C3TA 3ZIJA 3PINA 1G7OA 5LD0A 1EP8A 3CRUA 1Q4JA 3QR6A 5G1LA 1XXUA 3KD0A 1HNCA 4IQAA 2JU5A 4F0CA 1QFNA 4D73B 1RQMA 4MA9A 3LWAA 3H1NA 2M72A 1O85A 1USBA 4EF0A 2WULA 1Z6NA 2XC2A 3C73A 2BJXA 1ZZYA 2P5RA 5J9CA 1Z9HA 4EL1A 4V2MA 5ECIB 1XCCA 3CMIA 3UVHA 2NTOA 4MK3A 3L9SA 2EC4A 1ACVA 1TU7A 2C8UA 2CAIA 1G7EA 3A5IA 3VLNA 4G10A 3MIXA 4MMMA 2CVDA 2QA2A 2H73A 2UZ8A 1T4ZA 3FZAA 1THXA 2R3XA 2KLXA 1OC9A 3Q18A 14GSA 1BJXA 4OO5A 4L0WA 4LMVA 3N9JA 3TRXA 1XWAA 4JR6A 4NAXA 2R2JA 5ABRA 3HA9A 1I5GA 3L78A 1V98A 3F3QA 3R2QA 4EVMA 1Z3EA 3KH9A 3FRCA 4ZL7A 1ZYPA 2A4HA 1GTIA 3GRXA 1HNAA 4TR3A 1Y6EA 2VL9A 2HFDA 2XBQA 1N8JA 3D6IA 1A23A 1XBSA 1K0BA 5IM9A 3TKRA 2XPDA 2CZ2A 3I69A 2AV4A 5ECOB 2IFQB 1LBKA 4CHSA 3CRTA 2V41A 2JZRA 4BA7A 3UJ1A 3GHAA 2F51A 4K8MA 1ST9A 2CQ9A 2FA4A 4GF0A 1OE7A 2YN1A 4KDXA 3GL5A 4YQVA 1K3YA 5IOWA 1K0MA 4I2TA 4HEA2 4GRFA 1EEJA 3CSHA 2LSTA 3QMXA 2PVOC 2VCTA 4TVEA 2N5FA 1PX7A 1VF2A 2VL3A 5IPHA 5KN3A 2C0EA 4N0ZA 1ON4A 3GMFA 4G2EA 6GSSA 5KN0A 4Z2RA 1QUWA 4YQUA 4MF7A 1SD9A 2VM1A 3F4RA 4GCIA 4MZWA 3KIJA 2H1GA 5CRGA 4V2LA 4G19A 1JZRA 2QSIA 2JL4A 3EWLA 4LMWA 3LW9A 4IELA 2WS2A 1BAYA 5EL8A 1H4OA 1JZDA 2ON7A 3Q6OA 5ECNB 2DJ3A 2JZSA 3EMPA 3LJRA 3J7Yk 1V57A 4GQCA 1GSUA 5DVBA 3BOAA 3VK9A 2L4QA 6GSWA 5IMVA 4WETA 4FQUA 1F3AA 2FLSA 2WZ9A 1PL1A 4LA1A 5D93A 5IMDA 3FZ4A 1DUGA 3F3RA 1T8EB 1FOHA 2HSYA 3W8JA 1U88A 4DSSA 2V1MA 5HR3A 4AJ6A 1X5EA 3ZITA 2H01A 2H8LA 4X0XA 1GL8A 4HDEA 2GTUA 1PMTA 4RUVA 1PN0A 2OACA 2TIRA 5C00A 2H30A 4XS4B 5D96A 5IMAA 3EC3A 3ZFLA 4EIQA 1MD4A 5DDLA 2X49A 4NXIA 3DXBA 3WGDA 1VF1A 3W6GA 3ISOA 4YQMA 5HQPA 4XRAA 4OD7A 4ZB9A 2RUFA 1GSFA 2VCZA 4TXOA 3P90A 4KGIA 4ZBDA 1O8XA 4LL4B 4ZIJA 4K5SA 3P8WA 4HZ2A 4TRXA 3EVIA 3M8NA 2KOKA 2HLSA 1GUMA 5D9XA 2F8AA 3J7Yb 4GQFA 2GT5A 2H1AA 2LRCA 1BX9A 4V2NA 1G6WA 3H4KA 1YY7A 3NZNA 5B7CA 1PN9A 3EE2A 2A4VA 2JADA 1O8WA 4I5QA 1DSBA 2IMEA 4EIPA 5IIZA 3F0IA 1WOUA 2F8FA 2VOCA 2P5QA 1TI3A 2H74A 3APSA 5DQSA 19GSA 2MBSA 3QOUA 2R4VA 2IIYA 2FY6A 4XTSA 1PD21 5IMCA 1C72A 1MDKA 2IN3A 2CX3A 4WF4A 1KNGA 4Q5NA 4YKGA 4L5OA 2MMOA 1J08A 2R5GA 4G0IA 2O87A 4GLTA 3IXRA 4KF9A 2GSRA 2H6YA 1DBYA 3RPPA 2KP2A 1RW1A 3BBYA 2QKEA 4GWRA 3LQ7A 1B4QA 2YV7A 2KP1A 1YF0A 2MZCA 1XZOA 1W89A 3WYWA 5BRTA 5JCGA 3ZMLA 3GUSA 2LV3A 4X1UA 4MJEA 2M46A 1YJ6A 2K8VA 4FH8A 3MWHA 3CTGA 4EKZA 5JCWA 1SENA 2HZEB 3U6VA 1BG5A 2J9HA 5AN1A 4FO5A 2X64A 1OYJA 1YQ1A 3IC4A 4MH2A 3P7XA 2GQKA 2WFCA 5G5FA 3EURA 3GA4A 4PQ1A 2K18A 1QK8A 4KW6A 1XIYA 1PFOA 3FK8A 3D4TA 3TDGA 1SYRA 4GTUA 1AIUA 2L59A 5ECQB 2NDOA 3IAS2 3PGTA 3LEFA 5ECKB 4MZCA 1TOFA 2H6ZA 5AIVA 3UAPA 5DCHA 2V6KA 2PWJA 3LFLA 4WF5A 3O3TA 4N11A 1DE2A 1T00A 2IMKA 3U5RE 3A2WA 3OR5A 3LYKA 3D22A 2OE3A 2B5XA 2C80A 4ML1A 3RBTA 5E59A 2VUPA 4WXTA 2LNTA 1OKDA 4KH7A 2GQLA 4MF6A 4V1Ap 1SKRB 2VL2C 4I6XA 1WRYA 1LU4A 2YWOA 4KDUA 4L8EA 5KOWA 1WPIA 1TP9A 5GZZB 5HFKA 3ZVJD 1GSYA 2ZUPA 3IBHA 1SKWB 2XHFA 3BJ5A 1V2AA 2IPAA 3HJOA 4PQIA 1XFLA 1M9BA 1PRXA 4E8HA 1AXDA 1XG8A 2H70A 4KA0A 5E4WA 3BCIA 2RLIA 2OADA 3FZ5A 4MLYA 4OO4A 2R0PA 2JZTA 2KHPA 1GULA 1BQ7A 3RAZA 3CQFA 3NOFA 2GZYA 3KTLA 3QAVA 4J57E 5ECRB 2CAQA 4F9ZA 2F3MA 4IQ1A 2CZ3A 1EOHA 4TN8A 4NWYA 2FWHA 2XPEA 3TKSC 4GSSA 3I43A 3UBLA 1JLWA 1O73A 5DAKB 1M99A 2VCQA 3GTUB 5GAPD 4Q5QA 4TR4A 4MJCA 1PSQA 1K3OA 1CQHA 2PUKC 3HZ8A 2LS5A 2I4AA 2PERA 5JCUA 3A2XA 3RDWA 1WP0A 1S3AA 2B6MA 3VI5A 1HNBA 1MDIA 5CRHA 2FNOA 1ABAA 1YKCA 3CTFA 4FYBA 4K9ZA 4ID0A 17GSA 1FVKA 2REMA 3GKMA 2H76A 1TTZA 2I1UA 2B5EA 2PMTA 1IYHA 1GNWA 1FOVA 4HU7A 4JBBA 1F37A 1JZOA 4HZ4A 1SKSB 1F3BA 1LJRA 2C0DA 3CYNA 3DEXA 4OCEA 4PUAA 3VPTA 2H75A 2FHEA 4KDYA 3KJYA 5G5EA 3GL3A 3VWVA 2R6KA 1XW5A 2YPMA 1M7TA 1PA3A 1T4YA 1A2JA 4QL9A 4JRRA 5L71A 3GV1A 4EUYA 1WJKA 3MAKA 5CO3A 3C71A 3TJFA 4Z2UA 1CQGA 13GSA 3UVTA 2VIMA 1B4PA 1HD2A 2O7KA 1NSWA 3D0ZA 4JZQA 2E7PA 5ECPB 1ZYNA 3TJGA 1SJ6A 4N30A 4IJIA 1S3DA 2VD1A 1AQXA 2OBKA 1TXXA 1SK0A 4KNDA 1M2AA 1R5PA 1AQVA 2FWGA 5JWQB 2C3NA 1U87A 5ENUA 1EV9A 4RI6A 1XOAA 5J5NA 1MDJA 1QQ2A 2AHEA 5JWRB 4ML6A 2A2PA 2VD0A 4N10A 4WEYA 1EV4A 1SK1A 5KN1A 5A4UA 3D4MA 1TI1A 9GSSA 4PX1A 2H0GA 1XW9A 4WR5A 4ZB8A 2GZPA 2L6DA 5BMUA 5EY6A 5ECMB 3P2AA 4ISDA 3M1GA 3LXZA 3VI7A 2I81A 1YF1A 4JEDA 4MCUA 4ECIA 4MJBA 1K3LA 1OC8A 1A24A 5HR2A 3KXOA 2O85A 4ZL8A 4AGSA 3LGCA 4HJ2A 2YV9A 1E2YA 1V58A 1SL0B 3M0FA 6GSYA 2HRNA 3F63A 5DCGA 3I6AA 4KCAA 1SU9A 4XS6A 3HYPA 3KP9A 3TGZA 3APQA 5HR0A 3IAM2 4GSTA 3LSZA 3GSTA 2V32A 3V1WA 1NHYA 2LJAA 5DALA 5A4WA 3GX0A 1DE1A 4KSOA 5EPFA 3TRQA 2L5LA 1X0RA 3H93A 3EMXA 4RI7A 2E2MA 1B48A 3R3EA 4J56E 1T7PB 2JSZA 5J41A 5H5SA 1FB0A 3JCML 4Q5FA 2RIIA 4OWYA 2N5AA 3RHBA 2OKAA 3QDNA 2WDUA 1FO5A 1A0FA 1OC3A 1GTAA 3TCOA 2PPTA 4HUAA 3FR6A 4FYCA 1ERUA 3UL3A 4BVYA 3H8QA 3HVXA 4POLA 4NV5A 3BD2A 3GKKA 2LQQA 5ELAA 1FG4A 2YOIA 4XS4A 3GH9A 3DMLA 1Z5YE 1O6JA 2MMAA 4ICYA 4DVCA 2R0GA 1TDIA 3ZFBA 2PVQA 3HHVA 2PU9C 4BVXB 4CDOA 2XBIA 2F9SA 3W8SA 3TOTA 1UC7A 3HVNA 3H79A 4I8BA 2DJKA 3L9VA 1G0TA 1WMJA 1H75A 5F07A 3C1RA
chains in the Genus database with same CATH topology
4MDCA 4BWSA 1SYXA 3KEBA 3SBCA 3QD9A 2VCWA 3APOA 1QXHA 3DVWA 1R26A 2I3YA 2VCXA 3ME8A 1GP1A 5ECLB 5LCZA 3FYGA 2IJYA 2CX4A 5IMZA 3UMAA 3UOMA 4TOPA 3HJMA 4KSMA 2CA8A 3TKSE 1A8YA 3HCZA 5IO2A 3UIWA 1Z7PA 4OFNA 2R37A 4L5LA 5AGYA 3M9KA 22GSA 4O5QA 1Z7RA 2IMDA 3I9V2 3NIVA 3DIEA 3TKQA 3GKNA 3US3A 2PGTA 16GSA 3E0UA 2MMNA 3TJBA 2K9FA 5CP1A 2AAWA 5J9BA 2VM2A 8GSSA 2IL3A 2H1BA 5CYYA 2QC7A 4DSSB 1K0CA 1M9AA 2AB6A 1O81A 3PH9A 1F9MA 1EWXA 3L0HA 5G2ZA 4I2UA 4TR1A 4ECBA 3GIXA 2B7KA 1A8LA 3BCKA 4ZBBA 4K5RA 1O7UA 2HE3A 2DKIA 2VLUA 1K0AA 5F05A 3CSIA 2LNSA 1FHEA 1VRSD 2HZEA 4P3YB 5FWGA 11GSA 2ON5A 2R0CA 3ZYWA 2HRKA 2L5OA 2DLXA 1EZKA 1K0NA 1ZCPA 4EXJA 3F4SA 4IBPA 5J4UA 2DKHA 2L57A 4RQRA 1GTBA 3DYRA 2X8HA 2YP6A 1EOGA 4PURA 3QAGA 3DRNA 2O89A 5ID2A 3MDKA 2KUCA 2MMZA 4MP4A 5A4VA 4USSA 4BL7B 12GSA 4EC0A 3IR4A 3EU3A 1U3AA 5CAXA 4XRDA 3DWVA 1R5AA 2DC5A 2FGXA 3IC8A 3HXSA 4KE3A 5D9TA 2PBJA 4E8EA 3QCPA 2G2QA 3WGEA 1X9MB 1GLPA 4H86A 2MYGA 1ZMAA 1AQWA 1GNEA 1K0OA 1TJDA 3O76A 2B5YA 1GWCA 2QGVA 1YEPA 3CSJA 4POMA 2GSQA 3A2VA 1YKAA 2WCIA 5IMFA 3HVVA 4NMUA 4N0VA 4MJAA 4DEJA 3ERGA 5LNKe 2QA1A 3TUEA 4K6XA 3K8NA 4V1Ag 4KCEA 4MF5A 3IHQA 2CVKA 2HRAA 2HSHA 4ECCA 1ZGNA 3KZQA 4PTSA 3ZL5A 1XWCA 4DSRA 2ES7A 1T1VA 1WE0A 5D8IA 3WGXA 3FMWA 4ULXA 1AW9A 4EO3A 5H5RA 4HJMA 2GSTA 5FT3A 3IDVA 5ECSA 4F2IA 4BPYA 2OA7A 5CRWA 1ZL9A 5GSTA 5C04A 4NHWA 2CV4A 3IV4A 2VAFA 3A5WA 2H71A 2H1DA 1U3IA 2FWFA 1ERWA 1TU8A 2VL2A 1UA5A 4F0BA 4KAEA 4JE1A 1JZWA 1T3BA 2GS3A 2G0FA 3C8EA 2LKUA 2X8GA 2DJ0A 3QFBC 2LEGA 4Z7XA 1EP7A 1UN2A 4DSQA 3IHGA 2GGTA 4D73A 4G0LA 1PGTA 3HD5A 3KMNA 2H0HA 3KH7A 3AY8A 3F6DA 3KMOA 2H66A 1KEBA 5G1KA 5ECHB 3VPQA 4K7OA 5DJMA 1X5DA 3TKSA 1KBNA 2BTOT 4KX4A 2HSMA 2E2GA 1SJZA 2A2SA 2HXKA 3E9JB 3FHKA 1GUKA 1EEMA 1I9DA 4IP1A 1QMVA 4IKHA 3Q74A 1X9WB 2YJHA 3GNJA 3LG6A 3VWUA 3KTBA 5CREA 3HY2A 4CW9A 4PNFA 4MZBA 3EPTA 2WJUA 1MEKA 5DJLA 3ZIVA 5DBQA 2LUSA 1G6YA 1RK4A 1MD3A 4HQZA 2DIZA 4OFMA 1YZXA 2X8CA 1S3CA 4IHUA 1TW9A 3O6TA 3HJPA 1B8XA 3ZLPA 2MBTA 3IK7A 3FW2A 2C0GA 5J3RA 2GZZA 2YNXA 2C3QA 4FIWA 1PQNA 5B8BA 6GSVA 3Q19A 1Y25A 1GSDA 4PNGA 4RQXA 5FHIA 1WIKA 2B3SA 2ZCTA 5AIXA 3ZTLA 3DKSA 2FA8A 3MNGA 3PR8A 3PPUA 4AJ7A 4POBA 3A3TA 4EDYA 1TK8B 3ZREA 2NVLA 4QL7A 2FCHA 4JR4A 2FD3A 2IFQA 2YWIA 4F82A 4I97A 3G7JA 3MYDA 1AC1A 1GTUA 2YWMA 1R4WA 3VURA 1FAAA 4HI7A 1ILOA 3L9UA 2PN8A 2HI7A 3GH6A 1FW1A 1V9WA 1TRUA 4ZBAA 3G7YA 2DJ2A 3TRPA 1A2LA 4IN0A 4EDZA 1B9XC 1M2BA 1U6TA 5DQYA 3GYKA 4LL1B 4PGTA 2TRXA 2X4AA 4IGJA 2IWTA 5F0GA 1PKWA 3GX8A 1YEXA 3VWXA 5COHA 10GSA 4PXOA 4WBRD 4BWQA 2OE0A 5B6MA 1GH2A 2WGRA 5IPGA 2EIQA 3ME7A 1OC9B 1ML6A 3LORA 1WWJA 3M3MA 3G7IA 4ZL9A 2K6VA 1YDKA 1NM3A 3QFAC 5G31A 2DJ1A 3ED3A 4POKA 2L6CA 4XIHA 2LRNA 3L4NA 2D2ZA 1ERVA 4O5RA 6GSXA 1JHBA 3TJJA 3QPMA 4KUNA 3KP8A 2YZHA 4G0KA 3IA1A 5JWOB 3UEMA 4Z2TA 4WR4A 1XWGA 1UVZA 2GLRA 2H19A 3MSZA 1ZYEA 4K1FA 6GSTA 3RHCA 4PQHA 2YCDA 1AAZA 4BVXA 1OE8A 7GSSA 2OBIA 4HS1A 2IMIA 2VO4A 4ZB6A 6GSUA 3ZRDA 1PX6A 3LXTA 2GVPA 4LLRA 2AUVA 1J9BA 3VFIA 4TR0A 4TKYA 3C1SA 1QGVA 18GSA 4K7NA 2C1YA 5HR1A 3ERFA 1X9SB 2JSYA 1AUCA 2EIRA 1F2EA 2ZNMA 1GSEA 3DGQA 2IMFA 4O5UA 3EU4A 4Q5RA 2WRTA 3IOSA 4ZXGA 2DMMA 3HVSA 2HZFA 2B1KA 5ELGA 3GURA 1SK2A 2K8SA 5DALB 4ILFA 1OVNA 4L0UA 4CY8A 4MNNA 1VF4A 2N5BA 2GDRA 2B7JA 4NV2A 3KM6A 2CT6A 1TK5B 1GSQA 4K7IA 4XCSA 1URMA 2VLTA 2A2RA 5F8BA 1ZOFA 3DVXA 5B6NA 1IYIA 2E0QA 5A5KA 1Z6MA 1FB6A 1XOBA 4IS0A 2HYXA 1MTCA 3G9BA 4BVYB 2Z9SA 4XS1A 3TKPA 3IK9A 3FEUA 2H6XA 3E3EA 20GSA 4A5PA 2AYTA 5IQYA 1Q98A 5AISA 2YWNA 1N2AA 1GUHA 3TB2A 3F8UA 4ZILA 1W4VA 5HFIA 2YANA 2GQMA 1TRWA 1ZYQB 2O8VB 1BEDA 2P0GA 3SWLA 5G30A 2DJJA 1V40A 3KGKA 3WT1A 2DIYA 1TRVA 2RM6A 2V6OA 2B1LA 4CY6A 1TK0B 3FR3A 4OMVA 1TRSA 3GFKA 1GRXA 5KN2A 1B9YC 4PUFC 3FKFA 1VGLA 1SD8A 2LJRA 4IVFA 1THOA 5H5QA 5HFGA 2HNLA 2DBCA 4BL7A 4K2DA 2V2GA 2H72A 3ZMKA 3IE3A 3TOUA 3S9FA 2LJKA 5IO0A 4J2FA 2NBSA 4TXOB 2J23A 1GSSA 3M9JA 5IOXA 4JU5A 4MABA 1JFUA 1NW2A 1SJIA 3IPZA 2GSSA 3GSSA 1HYUA 3FY7A 3F4TA 1FVJA 3GKXA 1J0FA 1OAZA 2LTKA 2C4JA 1JLVA 4YAPA 2DMLA 1K0DA 4GSNA 2DSAA 2AJQB 4EE0A 4TR1B 2ALBA 2GT6A 3D5JA 3ZVJA 5INYA 2NPBA 4O92A 5GSSA 1PKZA 1XW6A 3HKRA 2BMXA 4WBJA 2RUEA 3VWWA 1OKTA 1XVQA 2FUG2 2WB9A 3DD3A 2EIOA 1F6MC 2C0FA 5F06A 3F6FA 3GN3A 1KTEA 1XWBA 2JACA 3ZZXA 2LRTA 4IJ3A 3UBKA 3F9UA 4KB3A 2YZUA 4WKWA 2P31A 3EINA 3WD6A 3IRAA 4X43A 4YH2A 4AJ8A 4O7HA 4X4JA 2L4CA 5ID2B 3CXGA 2VLVA 4OFTA 5D73A 4OCFA 4IW9A 4TW5A 4K0NA 4NHZA 4MPFA 4ECJA 2VCVA 2CVBA 1NHOA 1BYEA 4HOJA 5D9VA 5D9WA 5DAKA 1EGRA 2H0IA 5B8AA 5GAND 3GTUA 4F03A 4MPGA 4NPBA 2OJLA 4HU9A 3KCMA 4TXVA 3HZ4A 4K0GA 5EVOA 4QQ7A 4ACSA 2FWEA 2HT9A 4K2XA 3D21A 1XWKA 2M80A 4FYUA 2X99A 3CBUA 4YAVA 4O32A 1SL2B 3QAWA 1SL1B 1R7HA 4IP6A 4G9HA 4XHMA 1M2DA 5CNWA 1TKDB 3WT2A 3FZ9A 3ERWA 4HQSA 1XVWA 4YKFA 3UARA 1HQOA 3C7MA 1A0RP 2YJ7A 3TJKA 1M0UA 4MH3A 4AF2A 3HDCA 1E6BA 1GLQA 1XPVA 4GXZA 3RPNA 3LYPA 1VF3A 2LQOA 1PL2A 2OE1A 1A2MA 3FR9A 2TRCP 5CRDA 3N5OA 3EYTA 1X5CA 2HRFA 2RM5A 5KEJA 2I9HA 5KOXA 1EGOA 1ERTA 2C3TA 3ZIJA 3PINA 1G7OA 5LD0A 1EP8A 3CRUA 1Q4JA 3QR6A 5G1LA 1XXUA 3KD0A 1HNCA 4IQAA 2JU5A 4F0CA 1QFNA 4D73B 1RQMA 4MA9A 3LWAA 3H1NA 2M72A 1O85A 1USBA 4EF0A 2WULA 1Z6NA 2XC2A 3C73A 2BJXA 1ZZYA 2P5RA 5J9CA 1Z9HA 4EL1A 4V2MA 5ECIB 1XCCA 3CMIA 3UVHA 2NTOA 4MK3A 3L9SA 2EC4A 1ACVA 1TU7A 2C8UA 2CAIA 1G7EA 3A5IA 3VLNA 4G10A 3MIXA 4MMMA 2CVDA 2QA2A 2H73A 2UZ8A 1T4ZA 3FZAA 1THXA 2R3XA 2KLXA 1OC9A 3Q18A 14GSA 1BJXA 4OO5A 4L0WA 4LMVA 3N9JA 3TRXA 1XWAA 4JR6A 4NAXA 2R2JA 5ABRA 3HA9A 1I5GA 3L78A 1V98A 3F3QA 3R2QA 4EVMA 1Z3EA 3KH9A 3FRCA 4ZL7A 1ZYPA 2A4HA 1GTIA 3GRXA 1HNAA 4TR3A 1Y6EA 2VL9A 2HFDA 2XBQA 1N8JA 3D6IA 1A23A 1XBSA 1K0BA 5IM9A 3TKRA 2XPDA 2CZ2A 3I69A 2AV4A 5ECOB 2IFQB 1LBKA 4CHSA 3CRTA 2V41A 2JZRA 4BA7A 3UJ1A 3GHAA 2F51A 4K8MA 1ST9A 2CQ9A 2FA4A 4GF0A 1OE7A 2YN1A 4KDXA 3GL5A 4YQVA 1K3YA 5IOWA 1K0MA 4I2TA 4HEA2 4GRFA 1EEJA 3CSHA 2LSTA 3QMXA 2PVOC 2VCTA 4TVEA 2N5FA 1PX7A 1VF2A 2VL3A 5IPHA 5KN3A 2C0EA 4N0ZA 1ON4A 3GMFA 4G2EA 6GSSA 5KN0A 4Z2RA 1QUWA 4YQUA 4MF7A 1SD9A 2VM1A 3F4RA 4GCIA 4MZWA 3KIJA 2H1GA 5CRGA 4V2LA 4G19A 1JZRA 2QSIA 2JL4A 3EWLA 4LMWA 3LW9A 4IELA 2WS2A 1BAYA 5EL8A 1H4OA 1JZDA 2ON7A 3Q6OA 5ECNB 2DJ3A 2JZSA 3EMPA 3LJRA 3J7Yk 1V57A 4GQCA 1GSUA 5DVBA 3BOAA 3VK9A 2L4QA 6GSWA 5IMVA 4WETA 4FQUA 1F3AA 2FLSA 2WZ9A 1PL1A 4LA1A 5D93A 5IMDA 3FZ4A 1DUGA 3F3RA 1T8EB 1FOHA 2HSYA 3W8JA 1U88A 4DSSA 2V1MA 5HR3A 4AJ6A 1X5EA 3ZITA 2H01A 2H8LA 4X0XA 1GL8A 4HDEA 2GTUA 1PMTA 4RUVA 1PN0A 2OACA 2TIRA 5C00A 2H30A 4XS4B 5D96A 5IMAA 3EC3A 3ZFLA 4EIQA 1MD4A 5DDLA 2X49A 4NXIA 3DXBA 3WGDA 1VF1A 3W6GA 3ISOA 4YQMA 5HQPA 4XRAA 4OD7A 4ZB9A 2RUFA 1GSFA 2VCZA 4TXOA 3P90A 4KGIA 4ZBDA 1O8XA 4LL4B 4ZIJA 4K5SA 3P8WA 4HZ2A 4TRXA 3EVIA 3M8NA 2KOKA 2HLSA 1GUMA 5D9XA 2F8AA 3J7Yb 4GQFA 2GT5A 2H1AA 2LRCA 1BX9A 4V2NA 1G6WA 3H4KA 1YY7A 3NZNA 5B7CA 1PN9A 3EE2A 2A4VA 2JADA 1O8WA 4I5QA 1DSBA 2IMEA 4EIPA 5IIZA 3F0IA 1WOUA 2F8FA 2VOCA 2P5QA 1TI3A 2H74A 3APSA 5DQSA 19GSA 2MBSA 3QOUA 2R4VA 2IIYA 2FY6A 4XTSA 1PD21 5IMCA 1C72A 1MDKA 2IN3A 2CX3A 4WF4A 1KNGA 4Q5NA 4YKGA 4L5OA 2MMOA 1J08A 2R5GA 4G0IA 2O87A 4GLTA 3IXRA 4KF9A 2GSRA 2H6YA 1DBYA 3RPPA 2KP2A 1RW1A 3BBYA 2QKEA 4GWRA 3LQ7A 1B4QA 2YV7A 2KP1A 1YF0A 2MZCA 1XZOA 1W89A 3WYWA 5BRTA 5JCGA 3ZMLA 3GUSA 2LV3A 4X1UA 4MJEA 2M46A 1YJ6A 2K8VA 4FH8A 3MWHA 3CTGA 4EKZA 5JCWA 1SENA 2HZEB 3U6VA 1BG5A 2J9HA 5AN1A 4FO5A 2X64A 1OYJA 1YQ1A 3IC4A 4MH2A 3P7XA 2GQKA 2WFCA 5G5FA 3EURA 3GA4A 4PQ1A 2K18A 1QK8A 4KW6A 1XIYA 3FK8A 3D4TA 3TDGA 1SYRA 4GTUA 1AIUA 2L59A 5ECQB 2NDOA 3IAS2 3PGTA 3LEFA 5ECKB 4MZCA 1TOFA 2H6ZA 5AIVA 3UAPA 5DCHA 2V6KA 2PWJA 3LFLA 4WF5A 3O3TA 4N11A 1DE2A 1T00A 2IMKA 3U5RE 3A2WA 3OR5A 3LYKA 3D22A 2OE3A 2B5XA 2C80A 4ML1A 3RBTA 5E59A 2VUPA 4WXTA 2LNTA 1OKDA 4KH7A 2GQLA 4MF6A 4V1Ap 1SKRB 2VL2C 4I6XA 1WRYA 1LU4A 2YWOA 4KDUA 4L8EA 5KOWA 1WPIA 1TP9A 5GZZB 5HFKA 3ZVJD 1GSYA 2ZUPA 3IBHA 1SKWB 2XHFA 3BJ5A 1V2AA 2IPAA 3HJOA 4PQIA 1XFLA 1M9BA 1PRXA 4E8HA 1AXDA 2H70A 4KA0A 5E4WA 3BCIA 2RLIA 2OADA 3FZ5A 4MLYA 4OO4A 2R0PA 2JZTA 2KHPA 1GULA 1BQ7A 3RAZA 3NOFA 2GZYA 3KTLA 3QAVA 4J57E 5ECRB 2CAQA 4F9ZA 2F3MA 4IQ1A 2CZ3A 1EOHA 4TN8A 4NWYA 2FWHA 2XPEA 3TKSC 4GSSA 3I43A 3UBLA 1JLWA 1O73A 5DAKB 1M99A 2VCQA 3GTUB 5GAPD 4Q5QA 4TR4A 4MJCA 1PSQA 1K3OA 1CQHA 2PUKC 3HZ8A 2LS5A 2I4AA 2PERA 5JCUA 3A2XA 3RDWA 1WP0A 1S3AA 2B6MA 3VI5A 1HNBA 1MDIA 5CRHA 2FNOA 1ABAA 1YKCA 3CTFA 4FYBA 4K9ZA 4ID0A 17GSA 1FVKA 2REMA 3GKMA 2H76A 1TTZA 2I1UA 2B5EA 2PMTA 1IYHA 1GNWA 1FOVA 4HU7A 4JBBA 1F37A 1JZOA 4HZ4A 1SKSB 1F3BA 1LJRA 2C0DA 3CYNA 3DEXA 4OCEA 4PUAA 3VPTA 2H75A 2FHEA 4KDYA 3KJYA 5G5EA 3GL3A 3VWVA 2R6KA 1XW5A 2YPMA 1M7TA 1PA3A 1T4YA 1A2JA 4QL9A 4JRRA 5L71A 3GV1A 4EUYA 1WJKA 3MAKA 5CO3A 3C71A 3TJFA 4Z2UA 1CQGA 13GSA 3UVTA 2VIMA 1B4PA 1HD2A 2O7KA 1NSWA 3D0ZA 4JZQA 2E7PA 5ECPB 1ZYNA 3TJGA 1SJ6A 4N30A 4IJIA 1S3DA 2VD1A 1AQXA 2OBKA 1TXXA 1SK0A 4KNDA 1M2AA 1R5PA 1AQVA 2FWGA 5JWQB 2C3NA 1U87A 5ENUA 1EV9A 4RI6A 1XOAA 5J5NA 1MDJA 1QQ2A 2AHEA 5JWRB 4ML6A 2A2PA 2VD0A 4N10A 4WEYA 1EV4A 1SK1A 5KN1A 5A4UA 3D4MA 1TI1A 9GSSA 4PX1A 2H0GA 1XW9A 4WR5A 4ZB8A 2GZPA 2L6DA 5BMUA 5EY6A 5ECMB 3P2AA 4ISDA 3M1GA 3LXZA 3VI7A 2I81A 1YF1A 4JEDA 4MCUA 4ECIA 4MJBA 1K3LA 1OC8A 1A24A 5HR2A 3KXOA 2O85A 4ZL8A 4AGSA 3LGCA 4HJ2A 2YV9A 1E2YA 1V58A 1SL0B 3M0FA 6GSYA 2HRNA 3F63A 5DCGA 3I6AA 4KCAA 1SU9A 4XS6A 3HYPA 3KP9A 3TGZA 3APQA 5HR0A 3IAM2 4GSTA 3LSZA 3GSTA 2V32A 3V1WA 1NHYA 2LJAA 5DALA 5A4WA 3GX0A 1DE1A 4KSOA 5EPFA 3TRQA 2L5LA 1X0RA 3H93A 3EMXA 4RI7A 2E2MA 1B48A 3R3EA 4J56E 1T7PB 2JSZA 5J41A 5H5SA 1FB0A 3JCML 4Q5FA 2RIIA 4OWYA 2N5AA 3RHBA 2OKAA 3QDNA 2WDUA 1FO5A 1A0FA 1OC3A 1GTAA 3TCOA 2PPTA 4HUAA 3FR6A 4FYCA 1ERUA 3UL3A 4BVYA 3H8QA 3HVXA 4POLA 4NV5A 3BD2A 3GKKA 2LQQA 5ELAA 1FG4A 2YOIA 4XS4A 3GH9A 3DMLA 1Z5YE 1O6JA 2MMAA 4ICYA 4DVCA 2R0GA 1TDIA 3ZFBA 2PVQA 3HHVA 2PU9C 4BVXB 4CDOA 2XBIA 2F9SA 3W8SA 3TOTA 1UC7A 3H79A 4I8BA 2DJKA 3L9VA 1G0TA 1WMJA 1H75A 5F07A 3C1RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MDC A;  4BWS A;  1SYX A;  3KEB A;  3SBC A;  3QD9 A;  2VCW A;  3APO A;  1QXH A;  3DVW A;  1R26 A;  2I3Y A;  2VCX A;  3ME8 A;  1GP1 A;  5ECL B;  5LCZ A;  3FYG A;  2IJY A;  2CX4 A;  5IMZ A;  3UMA A;  3UOM A;  4TOP A;  3HJM A;  4KSM A;  2CA8 A;  3TKS E;  1A8Y A;  3HCZ A;  5IO2 A;  3UIW A;  1Z7P A;  4OFN A;  2R37 A;  4L5L A;  5AGY A;  3M9K A;  22GS A;  1Z7R A;  2IMD A;  3I9V 2;  3NIV A;  3DIE A;  3TKQ A;  3GKN A;  3US3 A;  2PGT A;  16GS A;  3E0U A;  2MMN A;  3TJB A;  2K9F A;  5CP1 A;  2AAW A;  5J9B A;  2VM2 A;  8GSS A;  2IL3 A;  2H1B A;  5CYY A;  2QC7 A;  4DSS B;  1K0C A;  1M9A A;  2AB6 A;  1O81 A;  3PH9 A;  1F9M A;  1EWX A;  3L0H A;  5G2Z A;  4I2U A;  4TR1 A;  4ECB A;  3GIX A;  2B7K A;  1A8L A;  3BCK A;  4ZBB A;  1O7U A;  2HE3 A;  2VLU A;  1K0A A;  5F05 A;  3CSI A;  2LNS A;  1FHE A;  1VRS D;  2HZE A;  4P3Y B;  5FWG A;  11GS A;  2ON5 A;  3ZYW A;  2L5O A;  2DLX A;  1EZK A;  1K0N A;  1ZCP A;  4EXJ A;  3F4S A;  4IBP A;  5J4U A;  2L57 A;  4RQR A;  1GTB A;  3DYR A;  2X8H A;  2YP6 A;  1EOG A;  4PUR A;  3QAG A;  3DRN A;  2O89 A;  5ID2 A;  3MDK A;  2KUC A;  2MMZ A;  4MP4 A;  5A4V A;  12GS A;  4EC0 A;  3IR4 A;  3EU3 A;  1U3A A;  5CAX A;  4XRD A;  3DWV A;  1R5A A;  2DC5 A;  2FGX A;  3HXS A;  4KE3 A;  5D9T A;  2PBJ A;  4E8E A;  3QCP A;  2G2Q A;  3WGE A;  1X9M B;  1GLP A;  4H86 A;  2MYG A;  1ZMA A;  1AQW A;  1GNE A;  1K0O A;  1TJD A;  3O76 A;  2B5Y A;  1GWC A;  2QGV A;  1YEP A;  3CSJ A;  4POM A;  2GSQ A;  3A2V A;  1YKA A;  2WCI A;  5IMF A;  3HVV A;  4NMU A;  4N0V A;  4MJA A;  4DEJ A;  3ERG A;  5LNK e;  3TUE A;  4K6X A;  3K8N A;  4V1A g;  4KCE A;  4MF5 A;  3IHQ A;  2CVK A;  2HSH A;  4ECC A;  1ZGN A;  3KZQ A;  3ZL5 A;  1XWC A;  4DSR A;  2ES7 A;  1T1V A;  1WE0 A;  5D8I A;  3WGX A;  4ULX A;  1AW9 A;  4EO3 A;  5H5R A;  4HJM A;  2GST A;  5FT3 A;  3IDV A;  5ECS A;  4F2I A;  4BPY A;  2OA7 A;  5CRW A;  1ZL9 A;  5GST A;  5C04 A;  4NHW A;  2CV4 A;  3IV4 A;  2VAF A;  3A5W A;  2H71 A;  2H1D A;  1U3I A;  2FWF A;  1ERW A;  1TU8 A;  2VL2 A;  1UA5 A;  4F0B A;  4KAE A;  4JE1 A;  1JZW A;  1T3B A;  2GS3 A;  2G0F A;  3C8E A;  2LKU A;  2X8G A;  2DJ0 A;  3QFB C;  2LEG A;  4Z7X A;  1EP7 A;  1UN2 A;  4DSQ A;  2GGT A;  4D73 A;  1PGT A;  3HD5 A;  3KMN A;  2H0H A;  3KH7 A;  3AY8 A;  3F6D A;  3KMO A;  2H66 A;  1KEB A;  5G1K A;  5ECH B;  3VPQ A;  4K7O A;  5DJM A;  1X5D A;  3TKS A;  1KBN A;  2BTO T;  4KX4 A;  2E2G A;  1SJZ A;  2A2S A;  2HXK A;  3E9J B;  3FHK A;  1GUK A;  1EEM A;  1I9D A;  4IP1 A;  1QMV A;  4IKH A;  3Q74 A;  1X9W B;  2YJH A;  3GNJ A;  3LG6 A;  3VWU A;  3KTB A;  5CRE A;  3HY2 A;  4CW9 A;  4PNF A;  4MZB A;  2WJU A;  1MEK A;  5DJL A;  3ZIV A;  5DBQ A;  2LUS A;  1G6Y A;  1RK4 A;  1MD3 A;  4HQZ A;  2DIZ A;  4OFM A;  1YZX A;  2X8C A;  1S3C A;  4IHU A;  1TW9 A;  3O6T A;  3HJP A;  1B8X A;  3ZLP A;  2MBT A;  3IK7 A;  3FW2 A;  2C0G A;  5J3R A;  2GZZ A;  2YNX A;  2C3Q A;  4FIW A;  1PQN A;  5B8B A;  6GSV A;  3Q19 A;  1Y25 A;  1GSD A;  4PNG A;  4RQX A;  5FHI A;  1WIK A;  2B3S A;  2ZCT A;  5AIX A;  3ZTL A;  3DKS A;  2FA8 A;  3MNG A;  3PR8 A;  4AJ7 A;  4POB A;  3A3T A;  4EDY A;  1TK8 B;  3ZRE A;  2NVL A;  4QL7 A;  2FCH A;  4JR4 A;  2FD3 A;  2IFQ A;  2YWI A;  4F82 A;  4I97 A;  3G7J A;  1AC1 A;  1GTU A;  2YWM A;  1R4W A;  3VUR A;  1FAA A;  4HI7 A;  1ILO A;  3L9U A;  2PN8 A;  2HI7 A;  3GH6 A;  1FW1 A;  1V9W A;  1TRU A;  4ZBA A;  3G7Y A;  2DJ2 A;  3TRP A;  1A2L A;  4IN0 A;  4EDZ A;  1B9X C;  1M2B A;  1U6T A;  5DQY A;  3GYK A;  4LL1 B;  4PGT A;  2TRX A;  4IGJ A;  2IWT A;  5F0G A;  1PKW A;  3GX8 A;  1YEX A;  3VWX A;  5COH A;  10GS A;  4PXO A;  4WBR D;  4BWQ A;  2OE0 A;  5B6M A;  1GH2 A;  2WGR A;  5IPG A;  2EIQ A;  3ME7 A;  1OC9 B;  1ML6 A;  3LOR A;  1WWJ A;  3M3M A;  3G7I A;  4ZL9 A;  2K6V A;  1YDK A;  1NM3 A;  3QFA C;  5G31 A;  2DJ1 A;  3ED3 A;  4POK A;  2L6C A;  4XIH A;  2LRN A;  3L4N A;  2D2Z A;  1ERV A;  4O5R A;  6GSX A;  1JHB A;  3TJJ A;  3QPM A;  4KUN A;  3KP8 A;  2YZH A;  3IA1 A;  5JWO B;  3UEM A;  4WR4 A;  1XWG A;  1UVZ A;  2GLR A;  2H19 A;  3MSZ A;  1ZYE A;  4K1F A;  6GST A;  3RHC A;  4PQH A;  2YCD A;  1AAZ A;  4BVX A;  1OE8 A;  7GSS A;  2OBI A;  4HS1 A;  2IMI A;  2VO4 A;  4ZB6 A;  6GSU A;  3ZRD A;  1PX6 A;  3LXT A;  2GVP A;  4LLR A;  2AUV A;  1J9B A;  3VFI A;  4TR0 A;  4TKY A;  3C1S A;  1QGV A;  18GS A;  4K7N A;  2C1Y A;  5HR1 A;  3ERF A;  1X9S B;  2JSY A;  1AUC A;  2EIR A;  1F2E A;  2ZNM A;  1GSE A;  3DGQ A;  2IMF A;  3EU4 A;  4Q5R A;  2WRT A;  3IOS A;  4ZXG A;  2DMM A;  3HVS A;  2HZF A;  2B1K A;  5ELG A;  3GUR A;  1SK2 A;  2K8S A;  5DAL B;  4ILF A;  1OVN A;  4L0U A;  1VF4 A;  2N5B A;  2GDR A;  2B7J A;  4NV2 A;  3KM6 A;  2CT6 A;  1TK5 B;  1GSQ A;  4K7I A;  4XCS A;  1URM A;  2VLT A;  2A2R A;  5F8B A;  1ZOF A;  3DVX A;  5B6N A;  1IYI A;  2E0Q A;  5A5K A;  1Z6M A;  1FB6 A;  1XOB A;  4IS0 A;  2HYX A;  1MTC A;  3G9B A;  2Z9S A;  4XS1 A;  3TKP A;  3IK9 A;  3FEU A;  2H6X A;  3E3E A;  20GS A;  5IQY A;  2AYT A;  1Q98 A;  5AIS A;  2YWN A;  1N2A A;  1GUH A;  3TB2 A;  3F8U A;  4ZIL A;  1W4V A;  5HFI A;  2YAN A;  2GQM A;  1TRW A;  1ZYQ B;  2O8V B;  1BED A;  2P0G A;  3SWL A;  5G30 A;  2DJJ A;  1V40 A;  3KGK A;  3WT1 A;  2DIY A;  1TRV A;  2RM6 A;  2V6O A;  2B1L A;  1TK0 B;  3FR3 A;  4OMV A;  1TRS A;  3GFK A;  1GRX A;  5KN2 A;  1B9Y C;  4PUF C;  3FKF A;  1VGL A;  1SD8 A;  2LJR A;  4IVF A;  1THO A;  5H5Q A;  5HFG A;  2HNL A;  2DBC A;  4BL7 A;  4K2D A;  2V2G A;  2H72 A;  3ZMK A;  3IE3 A;  3TOU A;  3S9F A;  2LJK A;  5IO0 A;  4J2F A;  2NBS A;  4TXO B;  2J23 A;  1GSS A;  3M9J A;  5IOX A;  4JU5 A;  4MAB A;  1JFU A;  1NW2 A;  1SJI A;  3IPZ A;  2GSS A;  3GSS A;  1HYU A;  3FY7 A;  3F4T A;  1FVJ A;  3GKX A;  1J0F A;  1OAZ A;  2LTK A;  2C4J A;  1JLV A;  4YAP A;  2DML A;  1K0D A;  4GSN A;  2DSA A;  2AJQ B;  4EE0 A;  4TR1 B;  2ALB A;  2GT6 A;  3D5J A;  3ZVJ A;  5INY A;  2NPB A;  4O92 A;  5GSS A;  1PKZ A;  1XW6 A;  3HKR A;  2BMX A;  4WBJ A;  2RUE A;  3VWW A;  1OKT A;  1XVQ A;  2FUG 2;  2WB9 A;  3DD3 A;  2EIO A;  1F6M C;  2C0F A;  5F06 A;  3F6F A;  3GN3 A;  1KTE A;  1XWB A;  2JAC A;  3ZZX A;  2LRT A;  4IJ3 A;  3UBK A;  3F9U A;  4KB3 A;  2YZU A;  4WKW A;  2P31 A;  3EIN A;  3WD6 A;  3IRA A;  4X43 A;  4YH2 A;  4AJ8 A;  4O7H A;  2L4C A;  5ID2 B;  3CXG A;  2VLV A;  4OFT A;  5D73 A;  4OCF A;  4IW9 A;  4TW5 A;  4K0N A;  4NHZ A;  4MPF A;  4ECJ A;  2VCV A;  2CVB A;  1NHO A;  1BYE A;  4HOJ A;  5D9V A;  5D9W A;  5DAK A;  1EGR A;  2H0I A;  5B8A A;  5GAN D;  3GTU A;  4F03 A;  4MPG A;  4NPB A;  2OJL A;  4HU9 A;  3KCM A;  4TXV A;  3HZ4 A;  4K0G A;  5EVO A;  4QQ7 A;  4ACS A;  2FWE A;  2HT9 A;  3D21 A;  1XWK A;  2M80 A;  4FYU A;  2X99 A;  3CBU A;  4YAV A;  4O32 A;  1SL2 B;  3QAW A;  1SL1 B;  1R7H A;  4IP6 A;  4G9H A;  4XHM A;  1M2D A;  5CNW A;  1TKD B;  3WT2 A;  3FZ9 A;  3ERW A;  4HQS A;  1XVW A;  3UAR A;  1HQO A;  3C7M A;  1A0R P;  2YJ7 A;  3TJK A;  1M0U A;  4MH3 A;  4AF2 A;  3HDC A;  1E6B A;  1GLQ A;  1XPV A;  4GXZ A;  3RPN A;  3LYP A;  1VF3 A;  2LQO A;  1PL2 A;  2OE1 A;  1A2M A;  3FR9 A;  2TRC P;  5CRD A;  3N5O A;  3EYT A;  1X5C A;  2HRF A;  2RM5 A;  5KEJ A;  2I9H A;  1EGO A;  1ERT A;  2C3T A;  3ZIJ A;  3PIN A;  1G7O A;  5LD0 A;  1EP8 A;  3CRU A;  1Q4J A;  3QR6 A;  5G1L A;  1XXU A;  3KD0 A;  1HNC A;  4IQA A;  2JU5 A;  4F0C A;  1QFN A;  4D73 B;  1RQM A;  4MA9 A;  3LWA A;  3H1N A;  2M72 A;  1O85 A;  1USB A;  4EF0 A;  2WUL A;  1Z6N A;  2XC2 A;  3C73 A;  2BJX A;  1ZZY A;  2P5R A;  5J9C A;  1Z9H A;  4EL1 A;  4V2M A;  5ECI B;  1XCC A;  3CMI A;  3UVH A;  2NTO A;  4MK3 A;  3L9S A;  2EC4 A;  1ACV A;  1TU7 A;  2C8U A;  2CAI A;  1G7E A;  3VLN A;  4G10 A;  4MMM A;  2CVD A;  2H73 A;  1T4Z A;  3FZA A;  1THX A;  2R3X A;  2KLX A;  1OC9 A;  3Q18 A;  14GS A;  1BJX A;  4OO5 A;  4L0W A;  4LMV A;  3N9J A;  3TRX A;  1XWA A;  4JR6 A;  4NAX A;  2R2J A;  5ABR A;  3HA9 A;  1I5G A;  3L78 A;  1V98 A;  3F3Q A;  3R2Q A;  4EVM A;  1Z3E A;  3KH9 A;  3FRC A;  4ZL7 A;  1GTI A;  3GRX A;  1HNA A;  4TR3 A;  1Y6E A;  2VL9 A;  2HFD A;  2XBQ A;  1N8J A;  3D6I A;  1A23 A;  1XBS A;  1K0B A;  5IM9 A;  3TKR A;  2XPD A;  2CZ2 A;  3I69 A;  2AV4 A;  5ECO B;  2IFQ B;  1LBK A;  4CHS A;  3CRT A;  2V41 A;  2JZR A;  4BA7 A;  3UJ1 A;  3GHA A;  2F51 A;  4K8M A;  1ST9 A;  2CQ9 A;  2FA4 A;  4GF0 A;  1OE7 A;  2YN1 A;  4KDX A;  3GL5 A;  4YQV A;  1K3Y A;  5IOW A;  1K0M A;  4I2T A;  4HEA 2;  4GRF A;  1EEJ A;  3CSH A;  2LST A;  3QMX A;  2PVO C;  2VCT A;  4TVE A;  2N5F A;  1PX7 A;  1VF2 A;  2VL3 A;  5IPH A;  5KN3 A;  2C0E A;  4N0Z A;  1ON4 A;  3GMF A;  4G2E A;  6GSS A;  5KN0 A;  1QUW A;  4YQU A;  4MF7 A;  1SD9 A;  2VM1 A;  3F4R A;  4GCI A;  4MZW A;  3KIJ A;  2H1G A;  5CRG A;  4V2L A;  4G19 A;  1JZR A;  2QSI A;  2JL4 A;  3EWL A;  4LMW A;  4IEL A;  2WS2 A;  1BAY A;  5EL8 A;  1H4O A;  1JZD A;  2ON7 A;  3Q6O A;  5ECN B;  2DJ3 A;  2JZS A;  3EMP A;  3LJR A;  3J7Y k;  1V57 A;  4GQC A;  1GSU A;  5DVB A;  3BOA A;  3VK9 A;  2L4Q A;  6GSW A;  5IMV A;  4WET A;  1F3A A;  2FLS A;  2WZ9 A;  1PL1 A;  4LA1 A;  5D93 A;  5IMD A;  3FZ4 A;  1DUG A;  3F3R A;  1T8E B;  2HSY A;  3W8J A;  1U88 A;  4DSS A;  2V1M A;  5HR3 A;  4AJ6 A;  1X5E A;  3ZIT A;  2H01 A;  2H8L A;  4X0X A;  1GL8 A;  4HDE A;  2GTU A;  1PMT A;  4RUV A;  2OAC A;  2TIR A;  5C00 A;  2H30 A;  4XS4 B;  5D96 A;  5IMA A;  3EC3 A;  3ZFL A;  1MD4 A;  5DDL A;  4NXI A;  3DXB A;  3WGD A;  1VF1 A;  3W6G A;  3ISO A;  4YQM A;  5HQP A;  4XRA A;  4OD7 A;  4ZB9 A;  2RUF A;  1GSF A;  2VCZ A;  4TXO A;  3P90 A;  4KGI A;  4ZBD A;  1O8X A;  4LL4 B;  4ZIJ A;  3P8W A;  4HZ2 A;  4TRX A;  3EVI A;  3M8N A;  2KOK A;  2HLS A;  1GUM A;  5D9X A;  2F8A A;  3J7Y b;  4GQF A;  2GT5 A;  2H1A A;  2LRC A;  1BX9 A;  4V2N A;  1G6W A;  3H4K A;  1YY7 A;  3NZN A;  5B7C A;  1PN9 A;  3EE2 A;  2A4V A;  2JAD A;  1O8W A;  4I5Q A;  1DSB A;  2IME A;  5IIZ A;  3F0I A;  1WOU A;  2F8F A;  2VOC A;  2P5Q A;  1TI3 A;  2H74 A;  3APS A;  5DQS A;  19GS A;  2MBS A;  3QOU A;  2R4V A;  2IIY A;  2FY6 A;  4XTS A;  1PD2 1;  5IMC A;  1C72 A;  1MDK A;  2IN3 A;  2CX3 A;  4WF4 A;  1KNG A;  4Q5N A;  4L5O A;  2MMO A;  1J08 A;  2R5G A;  2O87 A;  4GLT A;  3IXR A;  2GSR A;  2H6Y A;  1DBY A;  3RPP A;  2KP2 A;  1RW1 A;  3BBY A;  2QKE A;  4GWR A;  3LQ7 A;  1B4Q A;  2YV7 A;  2KP1 A;  1YF0 A;  2MZC A;  1XZO A;  1W89 A;  3WYW A;  5JCG A;  3ZML A;  3GUS A;  2LV3 A;  4X1U A;  4MJE A;  2M46 A;  1YJ6 A;  2K8V A;  4FH8 A;  3MWH A;  3CTG A;  4EKZ A;  5JCW A;  1SEN A;  2HZE B;  3U6V A;  1BG5 A;  2J9H A;  5AN1 A;  4FO5 A;  2X64 A;  1OYJ A;  1YQ1 A;  3IC4 A;  4MH2 A;  3P7X A;  2GQK A;  2WFC A;  5G5F A;  3EUR A;  3GA4 A;  4PQ1 A;  2K18 A;  1QK8 A;  4KW6 A;  1XIY A;  3FK8 A;  3D4T A;  3TDG A;  1SYR A;  4GTU A;  1AIU A;  2L59 A;  5ECQ B;  2NDO A;  3IAS 2;  3PGT A;  3LEF A;  5ECK B;  4MZC A;  1TOF A;  2H6Z A;  5AIV A;  3UAP A;  5DCH A;  2V6K A;  2PWJ A;  3LFL A;  4WF5 A;  3O3T A;  4N11 A;  1DE2 A;  1T00 A;  2IMK A;  3U5R E;  3A2W A;  3OR5 A;  3LYK A;  3D22 A;  2OE3 A;  2B5X A;  2C80 A;  4ML1 A;  3RBT A;  5E59 A;  2VUP A;  4WXT A;  2LNT A;  1OKD A;  4KH7 A;  2GQL A;  4MF6 A;  4V1A p;  1SKR B;  2VL2 C;  4I6X A;  1WRY A;  1LU4 A;  2YWO A;  4KDU A;  4L8E A;  1WPI A;  1TP9 A;  5GZZ B;  5HFK A;  3ZVJ D;  1GSY A;  2ZUP A;  3IBH A;  1SKW B;  2XHF A;  3BJ5 A;  1V2A A;  2IPA A;  3HJO A;  4PQI A;  1XFL A;  1M9B A;  1PRX A;  4E8H A;  1AXD A;  2H70 A;  4KA0 A;  5E4W A;  3BCI A;  2RLI A;  2OAD A;  3FZ5 A;  4MLY A;  4OO4 A;  2JZT A;  2KHP A;  1GUL A;  1BQ7 A;  3RAZ A;  3NOF A;  2GZY A;  3KTL A;  3QAV A;  4J57 E;  5ECR B;  2CAQ A;  4F9Z A;  2F3M A;  4IQ1 A;  2CZ3 A;  1EOH A;  4TN8 A;  4NWY A;  2FWH A;  2XPE A;  3TKS C;  4GSS A;  3I43 A;  3UBL A;  1JLW A;  1O73 A;  5DAK B;  1M99 A;  2VCQ A;  3GTU B;  5GAP D;  4Q5Q A;  4TR4 A;  4MJC A;  1PSQ A;  1K3O A;  1CQH A;  2PUK C;  3HZ8 A;  2LS5 A;  2I4A A;  2PER A;  5JCU A;  3A2X A;  3RDW A;  1WP0 A;  1S3A A;  2B6M A;  3VI5 A;  1HNB A;  1MDI A;  5CRH A;  2FNO A;  1ABA A;  1YKC A;  3CTF A;  4FYB A;  4K9Z A;  4ID0 A;  17GS A;  1FVK A;  2REM A;  3GKM A;  2H76 A;  1TTZ A;  2I1U A;  2B5E A;  2PMT A;  1IYH A;  1GNW A;  1FOV A;  4HU7 A;  4JBB A;  1F37 A;  1JZO A;  4HZ4 A;  1SKS B;  1F3B A;  1LJR A;  2C0D A;  3CYN A;  3DEX A;  4OCE A;  4PUA A;  3VPT A;  2H75 A;  2FHE A;  4KDY A;  3KJY A;  5G5E A;  3GL3 A;  3VWV A;  2R6K A;  1XW5 A;  2YPM A;  1M7T A;  1PA3 A;  1T4Y A;  1A2J A;  4QL9 A;  4JRR A;  5L71 A;  3GV1 A;  4EUY A;  1WJK A;  3MAK A;  5CO3 A;  3C71 A;  3TJF A;  1CQG A;  13GS A;  3UVT A;  2VIM A;  1B4P A;  1HD2 A;  2O7K A;  1NSW A;  3D0Z A;  4JZQ A;  2E7P A;  5ECP B;  3TJG A;  1SJ6 A;  4N30 A;  4IJI A;  1S3D A;  2VD1 A;  1AQX A;  2OBK A;  1TXX A;  1SK0 A;  4KND A;  1M2A A;  1R5P A;  1AQV A;  2FWG A;  5JWQ B;  2C3N A;  1U87 A;  5ENU A;  1EV9 A;  4RI6 A;  1XOA A;  5J5N A;  1MDJ A;  1QQ2 A;  2AHE A;  5JWR B;  4ML6 A;  2VD0 A;  4N10 A;  4WEY A;  1EV4 A;  1SK1 A;  5KN1 A;  5A4U A;  3D4M A;  1TI1 A;  9GSS A;  4PX1 A;  2H0G A;  1XW9 A;  4WR5 A;  4ZB8 A;  2GZP A;  2L6D A;  5EY6 A;  5ECM B;  3P2A A;  4ISD A;  3M1G A;  3LXZ A;  3VI7 A;  2I81 A;  1YF1 A;  4JED A;  4MCU A;  4ECI A;  4MJB A;  1K3L A;  1OC8 A;  1A24 A;  5HR2 A;  3KXO A;  2O85 A;  4ZL8 A;  4AGS A;  3LGC A;  4HJ2 A;  2YV9 A;  1E2Y A;  1V58 A;  1SL0 B;  3M0F A;  6GSY A;  2HRN A;  3F63 A;  5DCG A;  3I6A A;  4KCA A;  1SU9 A;  4XS6 A;  3HYP A;  3KP9 A;  3TGZ A;  3APQ A;  5HR0 A;  3IAM 2;  4GST A;  3LSZ A;  3GST A;  2V32 A;  3V1W A;  1NHY A;  2LJA A;  5DAL A;  5A4W A;  3GX0 A;  1DE1 A;  4KSO A;  5EPF A;  3TRQ A;  2L5L A;  1X0R A;  3H93 A;  3EMX A;  4RI7 A;  2E2M A;  1B48 A;  4J56 E;  1T7P B;  2JSZ A;  5J41 A;  5H5S A;  1FB0 A;  3JCM L;  4Q5F A;  2RII A;  4OWY A;  2N5A A;  3RHB A;  2OKA A;  3QDN A;  2WDU A;  1FO5 A;  1A0F A;  1OC3 A;  1GTA A;  3TCO A;  2PPT A;  4HUA A;  3FR6 A;  4FYC A;  1ERU A;  3UL3 A;  4BVY A;  3H8Q A;  3HVX A;  4POL A;  4NV5 A;  3BD2 A;  3GKK A;  2LQQ A;  5ELA A;  1FG4 A;  2YOI A;  4XS4 A;  3GH9 A;  3DML A;  1Z5Y E;  1O6J A;  2MMA A;  4DVC A;  1TDI A;  3ZFB A;  2PVQ A;  3HHV A;  2PU9 C;  4CDO A;  2XBI A;  2F9S A;  3W8S A;  3TOT A;  1UC7 A;  3H79 A;  4I8B A;  2DJK A;  3L9V A;  1G0T A;  1WMJ A;  5F07 A;  1H75 A;  3C1R A; 
#chains in the Genus database with same CATH topology
 4MDC A;  4BWS A;  1SYX A;  4BIK A;  3KEB A;  3SBC A;  3QD9 A;  2VCW A;  3APO A;  1QXH A;  3DVW A;  1R26 A;  2I3Y A;  2VCX A;  3ME8 A;  1GP1 A;  5ECL B;  5LCZ A;  3FYG A;  2IJY A;  2CX4 A;  5IMZ A;  3UMA A;  3UOM A;  4TOP A;  3HJM A;  4KSM A;  2CA8 A;  3TKS E;  1A8Y A;  3HCZ A;  5IO2 A;  3UIW A;  1Z7P A;  4OFN A;  2R37 A;  4L5L A;  5AGY A;  3M9K A;  22GS A;  4O5Q A;  1Z7R A;  2IMD A;  3I9V 2;  3NIV A;  3DIE A;  3TKQ A;  3GKN A;  3US3 A;  2PGT A;  16GS A;  3E0U A;  2MMN A;  3TJB A;  2K9F A;  5CP1 A;  2AAW A;  5J9B A;  2VM2 A;  8GSS A;  2IL3 A;  2H1B A;  5CYY A;  2QC7 A;  4DSS B;  1K0C A;  1M9A A;  2AB6 A;  1O81 A;  3PH9 A;  1F9M A;  1EWX A;  3L0H A;  5G2Z A;  4I2U A;  4TR1 A;  4ECB A;  3GIX A;  2B7K A;  1A8L A;  3BCK A;  4ZBB A;  4K5R A;  1O7U A;  2HE3 A;  2DKI A;  2VLU A;  1K0A A;  5F05 A;  3CSI A;  2LNS A;  1FHE A;  1VRS D;  2HZE A;  4P3Y B;  5FWG A;  11GS A;  2ON5 A;  2R0C A;  3ZYW A;  2HRK A;  2L5O A;  2DLX A;  1EZK A;  1K0N A;  1ZCP A;  4EXJ A;  3F4S A;  4IBP A;  5J4U A;  2DKH A;  2L57 A;  4RQR A;  1GTB A;  3DYR A;  2X8H A;  2YP6 A;  1EOG A;  4PUR A;  3QAG A;  3DRN A;  2O89 A;  5ID2 A;  3MDK A;  2KUC A;  2MMZ A;  4MP4 A;  5A4V A;  4USS A;  4BL7 B;  12GS A;  4EC0 A;  3IR4 A;  3EU3 A;  1U3A A;  5CAX A;  4XRD A;  3DWV A;  1R5A A;  2DC5 A;  2FGX A;  3IC8 A;  3HXS A;  4KE3 A;  5D9T A;  2PBJ A;  4E8E A;  3QCP A;  2G2Q A;  3WGE A;  1X9M B;  1GLP A;  4H86 A;  2MYG A;  1ZMA A;  1AQW A;  1GNE A;  1K0O A;  1TJD A;  3O76 A;  2B5Y A;  1GWC A;  2QGV A;  1YEP A;  3CSJ A;  4POM A;  2GSQ A;  3A2V A;  1YKA A;  2WCI A;  5IMF A;  3HVV A;  4NMU A;  4N0V A;  4MJA A;  4DEJ A;  3ERG A;  5LNK e;  2QA1 A;  3TUE A;  4K6X A;  3K8N A;  4V1A g;  4KCE A;  4MF5 A;  3IHQ A;  2CVK A;  2HRA A;  2HSH A;  4ECC A;  1ZGN A;  3KZQ A;  4PTS A;  3ZL5 A;  1XWC A;  4DSR A;  2ES7 A;  1T1V A;  1WE0 A;  5D8I A;  3WGX A;  3FMW A;  4ULX A;  1AW9 A;  4EO3 A;  5H5R A;  4HJM A;  2GST A;  5FT3 A;  3IDV A;  5ECS A;  4F2I A;  4BPY A;  2OA7 A;  5CRW A;  1ZL9 A;  5GST A;  5C04 A;  4NHW A;  2CV4 A;  3IV4 A;  2VAF A;  3A5W A;  2H71 A;  2H1D A;  1U3I A;  2FWF A;  1ERW A;  1TU8 A;  2VL2 A;  1UA5 A;  4F0B A;  4KAE A;  4JE1 A;  1JZW A;  1T3B A;  2GS3 A;  2G0F A;  3C8E A;  2LKU A;  2X8G A;  2DJ0 A;  3QFB C;  2LEG A;  4Z7X A;  1EP7 A;  1UN2 A;  4DSQ A;  3IHG A;  2GGT A;  4D73 A;  4G0L A;  1PGT A;  3HD5 A;  3KMN A;  2H0H A;  3KH7 A;  3AY8 A;  3F6D A;  3KMO A;  2H66 A;  1KEB A;  5G1K A;  5ECH B;  3VPQ A;  4K7O A;  5DJM A;  1X5D A;  3TKS A;  1KBN A;  2BTO T;  4KX4 A;  2HSM A;  2E2G A;  1SJZ A;  2A2S A;  2HXK A;  3E9J B;  3FHK A;  1GUK A;  1EEM A;  1I9D A;  4IP1 A;  1QMV A;  4IKH A;  3Q74 A;  1X9W B;  2YJH A;  3GNJ A;  3LG6 A;  3VWU A;  3KTB A;  5CRE A;  3HY2 A;  4CW9 A;  4PNF A;  4MZB A;  3EPT A;  2WJU A;  1MEK A;  5DJL A;  3ZIV A;  5DBQ A;  2LUS A;  1G6Y A;  1RK4 A;  1MD3 A;  4HQZ A;  2DIZ A;  4OFM A;  1YZX A;  2X8C A;  1S3C A;  4IHU A;  1TW9 A;  3O6T A;  3HJP A;  1B8X A;  3ZLP A;  2MBT A;  3IK7 A;  3FW2 A;  2C0G A;  5J3R A;  2GZZ A;  2YNX A;  2C3Q A;  4FIW A;  1PQN A;  5B8B A;  6GSV A;  3Q19 A;  1Y25 A;  1GSD A;  4PNG A;  4RQX A;  5FHI A;  1WIK A;  2B3S A;  2ZCT A;  5AIX A;  3ZTL A;  3DKS A;  2FA8 A;  3MNG A;  3PR8 A;  3PPU A;  4AJ7 A;  4POB A;  3A3T A;  4EDY A;  1TK8 B;  3ZRE A;  2NVL A;  4QL7 A;  2FCH A;  4JR4 A;  2FD3 A;  2IFQ A;  2YWI A;  4F82 A;  4I97 A;  3G7J A;  3MYD A;  1AC1 A;  1S3R A;  1GTU A;  2YWM A;  1R4W A;  3VUR A;  1FAA A;  4HI7 A;  1ILO A;  3L9U A;  2PN8 A;  2HI7 A;  3GH6 A;  1FW1 A;  1V9W A;  1TRU A;  4ZBA A;  3G7Y A;  2DJ2 A;  3TRP A;  1A2L A;  4IN0 A;  4EDZ A;  1B9X C;  1M2B A;  1U6T A;  5DQY A;  3GYK A;  4LL1 B;  4PGT A;  2TRX A;  2X4A A;  4IGJ A;  2IWT A;  5F0G A;  1PKW A;  3GX8 A;  1YEX A;  3VWX A;  5COH A;  10GS A;  4PXO A;  4WBR D;  4BWQ A;  2OE0 A;  5B6M A;  1GH2 A;  2WGR A;  5IPG A;  2EIQ A;  3ME7 A;  1OC9 B;  1ML6 A;  3LOR A;  1WWJ A;  3M3M A;  3G7I A;  4ZL9 A;  2K6V A;  1YDK A;  1NM3 A;  3QFA C;  5G31 A;  2DJ1 A;  3ED3 A;  4POK A;  2L6C A;  4XIH A;  2LRN A;  3L4N A;  2D2Z A;  1ERV A;  4O5R A;  6GSX A;  1JHB A;  3TJJ A;  3QPM A;  4KUN A;  3KP8 A;  2YZH A;  4G0K A;  3IA1 A;  5JWO B;  3UEM A;  4Z2T A;  4WR4 A;  1XWG A;  1UVZ A;  2GLR A;  2H19 A;  3MSZ A;  1ZYE A;  4K1F A;  6GST A;  3RHC A;  4PQH A;  2YCD A;  1AAZ A;  4BVX A;  1OE8 A;  7GSS A;  2OBI A;  4HS1 A;  2IMI A;  2VO4 A;  4ZB6 A;  6GSU A;  3ZRD A;  1PX6 A;  3LXT A;  2GVP A;  4LLR A;  2AUV A;  1J9B A;  3VFI A;  4TR0 A;  4TKY A;  3C1S A;  1QGV A;  18GS A;  4K7N A;  2C1Y A;  5HR1 A;  3ERF A;  1X9S B;  2JSY A;  1AUC A;  2EIR A;  1F2E A;  2ZNM A;  1GSE A;  3DGQ A;  2IMF A;  4O5U A;  3EU4 A;  4Q5R A;  2WRT A;  3IOS A;  4ZXG A;  2DMM A;  3HVS A;  2HZF A;  2B1K A;  5ELG A;  3GUR A;  1SK2 A;  2K8S A;  5DAL B;  4ILF A;  1OVN A;  4L0U A;  4CY8 A;  4MNN A;  1VF4 A;  2N5B A;  2GDR A;  2B7J A;  4NV2 A;  3KM6 A;  2CT6 A;  1TK5 B;  1GSQ A;  4K7I A;  4XCS A;  1URM A;  2VLT A;  2A2R A;  5F8B A;  1ZOF A;  3DVX A;  5B6N A;  1IYI A;  2E0Q A;  5A5K A;  1Z6M A;  1FB6 A;  1XOB A;  4IS0 A;  2HYX A;  1MTC A;  3G9B A;  4HSC X;  4BVY B;  2Z9S A;  4XS1 A;  3TKP A;  3IK9 A;  3FEU A;  2H6X A;  3E3E A;  20GS A;  4A5P A;  2AYT A;  5IQY A;  1Q98 A;  5AIS A;  2YWN A;  1N2A A;  1GUH A;  3TB2 A;  3F8U A;  4ZIL A;  1W4V A;  5HFI A;  2YAN A;  2GQM A;  1TRW A;  1ZYQ B;  2O8V B;  1BED A;  2P0G A;  3SWL A;  5G30 A;  2DJJ A;  1V40 A;  3KGK A;  3WT1 A;  2DIY A;  1TRV A;  2RM6 A;  2V6O A;  2B1L A;  4CY6 A;  1TK0 B;  3FR3 A;  4OMV A;  1TRS A;  3GFK A;  1GRX A;  5KN2 A;  1B9Y C;  4PUF C;  3FKF A;  1VGL A;  1SD8 A;  2LJR A;  4IVF A;  1THO A;  5H5Q A;  5HFG A;  2HNL A;  2DBC A;  4BL7 A;  4K2D A;  2V2G A;  2H72 A;  3ZMK A;  3IE3 A;  3TOU A;  3S9F A;  2LJK A;  5IO0 A;  4J2F A;  2NBS A;  4TXO B;  2J23 A;  1GSS A;  3M9J A;  5IOX A;  4JU5 A;  4MAB A;  1JFU A;  1NW2 A;  1SJI A;  3IPZ A;  2GSS A;  3GSS A;  1HYU A;  3FY7 A;  3F4T A;  1FVJ A;  3GKX A;  1J0F A;  1OAZ A;  2LTK A;  2C4J A;  1JLV A;  4YAP A;  2DML A;  1K0D A;  4GSN A;  2DSA A;  2AJQ B;  4EE0 A;  4TR1 B;  2ALB A;  2GT6 A;  3D5J A;  3ZVJ A;  5INY A;  2NPB A;  4O92 A;  5GSS A;  1PKZ A;  1XW6 A;  3HKR A;  2BMX A;  4WBJ A;  2RUE A;  3VWW A;  1OKT A;  1XVQ A;  2FUG 2;  2WB9 A;  3DD3 A;  2EIO A;  1F6M C;  2C0F A;  5F06 A;  3F6F A;  3GN3 A;  1KTE A;  1XWB A;  2JAC A;  3ZZX A;  2LRT A;  4IJ3 A;  3UBK A;  3F9U A;  4KB3 A;  2YZU A;  4WKW A;  2P31 A;  3EIN A;  3WD6 A;  3IRA A;  4X43 A;  1M3J A;  4YH2 A;  4AJ8 A;  4O7H A;  4X4J A;  2L4C A;  5ID2 B;  3CXG A;  2VLV A;  4OFT A;  5D73 A;  4OCF A;  4IW9 A;  4TW5 A;  4K0N A;  4NHZ A;  4MPF A;  4ECJ A;  2VCV A;  2CVB A;  1NHO A;  1BYE A;  4HOJ A;  5D9V A;  5D9W A;  5DAK A;  1EGR A;  2H0I A;  5B8A A;  5GAN D;  3GTU A;  4F03 A;  4MPG A;  4NPB A;  2OJL A;  4HU9 A;  3KCM A;  4TXV A;  3HZ4 A;  4K0G A;  5EVO A;  4QQ7 A;  4ACS A;  2FWE A;  2HT9 A;  4K2X A;  3D21 A;  1XWK A;  2M80 A;  4FYU A;  2X99 A;  3CBU A;  4YAV A;  4O32 A;  1SL2 B;  3QAW A;  1SL1 B;  1R7H A;  4IP6 A;  4G9H A;  1M3I A;  4XHM A;  1M2D A;  5CNW A;  1TKD B;  3WT2 A;  3FZ9 A;  3ERW A;  4HQS A;  1XVW A;  4YKF A;  3UAR A;  1HQO A;  3C7M A;  1A0R P;  2YJ7 A;  3TJK A;  1M0U A;  4MH3 A;  4AF2 A;  3HDC A;  1E6B A;  1GLQ A;  1XPV A;  4GXZ A;  3RPN A;  3LYP A;  1VF3 A;  2LQO A;  1PL2 A;  2OE1 A;  1A2M A;  3FR9 A;  2TRC P;  5CRD A;  3N5O A;  3EYT A;  1X5C A;  2HRF A;  2RM5 A;  5KEJ A;  2I9H A;  5KOX A;  1EGO A;  1ERT A;  2C3T A;  3ZIJ A;  3PIN A;  1G7O A;  5LD0 A;  1EP8 A;  3CRU A;  1Q4J A;  3QR6 A;  5G1L A;  1XXU A;  3KD0 A;  1HNC A;  4IQA A;  2JU5 A;  4F0C A;  1QFN A;  4D73 B;  1RQM A;  4MA9 A;  3LWA A;  3H1N A;  2M72 A;  1O85 A;  1USB A;  4EF0 A;  2WUL A;  1Z6N A;  2XC2 A;  3C73 A;  2BJX A;  1ZZY A;  2P5R A;  5J9C A;  1Z9H A;  4EL1 A;  4V2M A;  5ECI B;  1XCC A;  3CMI A;  3UVH A;  2NTO A;  4MK3 A;  3L9S A;  2EC4 A;  1ACV A;  1TU7 A;  2C8U A;  2CAI A;  1G7E A;  3A5I A;  3VLN A;  4G10 A;  3MIX A;  4MMM A;  2CVD A;  2QA2 A;  2H73 A;  2UZ8 A;  1T4Z A;  3FZA A;  1THX A;  2R3X A;  2KLX A;  1OC9 A;  3Q18 A;  14GS A;  1BJX A;  4OO5 A;  4L0W A;  4LMV A;  3N9J A;  3TRX A;  1XWA A;  4JR6 A;  4NAX A;  2R2J A;  5ABR A;  3HA9 A;  1I5G A;  3L78 A;  1V98 A;  3F3Q A;  3R2Q A;  4EVM A;  1Z3E A;  3KH9 A;  3FRC A;  4ZL7 A;  1ZYP A;  2A4H A;  1GTI A;  3GRX A;  1HNA A;  4TR3 A;  1Y6E A;  2VL9 A;  2HFD A;  2XBQ A;  1N8J A;  3D6I A;  1A23 A;  1XBS A;  1K0B A;  5IM9 A;  3TKR A;  2XPD A;  2CZ2 A;  3I69 A;  2AV4 A;  5ECO B;  2IFQ B;  1LBK A;  4CHS A;  3CRT A;  2V41 A;  2JZR A;  4BA7 A;  3UJ1 A;  3GHA A;  2F51 A;  4K8M A;  1ST9 A;  2CQ9 A;  2FA4 A;  4GF0 A;  1OE7 A;  2YN1 A;  4KDX A;  3GL5 A;  4YQV A;  1K3Y A;  5IOW A;  1K0M A;  4I2T A;  4HEA 2;  4GRF A;  1EEJ A;  3CSH A;  2LST A;  3QMX A;  2PVO C;  2VCT A;  4TVE A;  2N5F A;  1PX7 A;  1VF2 A;  2VL3 A;  5IPH A;  5KN3 A;  2C0E A;  4N0Z A;  1ON4 A;  3GMF A;  4G2E A;  6GSS A;  5KN0 A;  4Z2R A;  1QUW A;  4YQU A;  4MF7 A;  1SD9 A;  2VM1 A;  3F4R A;  4GCI A;  4MZW A;  3KIJ A;  2H1G A;  5CRG A;  4V2L A;  4G19 A;  1JZR A;  2QSI A;  2JL4 A;  3EWL A;  4LMW A;  3LW9 A;  4IEL A;  2WS2 A;  1BAY A;  5EL8 A;  1H4O A;  1JZD A;  2ON7 A;  3Q6O A;  5ECN B;  2DJ3 A;  2JZS A;  3EMP A;  3LJR A;  3J7Y k;  1V57 A;  4GQC A;  1GSU A;  5DVB A;  3BOA A;  3VK9 A;  2L4Q A;  6GSW A;  5IMV A;  4WET A;  4FQU A;  1F3A A;  2FLS A;  2WZ9 A;  1PL1 A;  4LA1 A;  5D93 A;  5IMD A;  3FZ4 A;  1DUG A;  3F3R A;  1T8E B;  1FOH A;  2HSY A;  3W8J A;  1U88 A;  4DSS A;  2V1M A;  5HR3 A;  4AJ6 A;  1X5E A;  3ZIT A;  2H01 A;  2H8L A;  4X0X A;  1GL8 A;  4HDE A;  2GTU A;  1PMT A;  4RUV A;  1PN0 A;  2OAC A;  2TIR A;  5C00 A;  2H30 A;  4XS4 B;  5D96 A;  5IMA A;  3EC3 A;  3ZFL A;  4EIQ A;  1MD4 A;  5DDL A;  2X49 A;  4NXI A;  3DXB A;  3WGD A;  1VF1 A;  3W6G A;  3ISO A;  4YQM A;  5HQP A;  4XRA A;  4OD7 A;  4ZB9 A;  2RUF A;  1GSF A;  2VCZ A;  4TXO A;  3P90 A;  4KGI A;  4ZBD A;  1O8X A;  4LL4 B;  4ZIJ A;  4K5S A;  3P8W A;  4HZ2 A;  4TRX A;  3EVI A;  3M8N A;  2KOK A;  2HLS A;  1GUM A;  5D9X A;  2F8A A;  3J7Y b;  4GQF A;  2GT5 A;  2H1A A;  2LRC A;  1BX9 A;  4V2N A;  1G6W A;  3H4K A;  1YY7 A;  3NZN A;  5B7C A;  1PN9 A;  3EE2 A;  2A4V A;  2JAD A;  1O8W A;  4I5Q A;  1DSB A;  2IME A;  4EIP A;  5IIZ A;  3F0I A;  1WOU A;  2F8F A;  2VOC A;  2P5Q A;  1TI3 A;  2H74 A;  3APS A;  5DQS A;  19GS A;  2MBS A;  3QOU A;  2R4V A;  2IIY A;  2FY6 A;  4XTS A;  1PD2 1;  5IMC A;  1C72 A;  1MDK A;  2IN3 A;  2CX3 A;  4WF4 A;  1KNG A;  4Q5N A;  4YKG A;  4L5O A;  2MMO A;  1J08 A;  2R5G A;  4G0I A;  2O87 A;  4GLT A;  3IXR A;  4KF9 A;  2GSR A;  2H6Y A;  1DBY A;  3RPP A;  2KP2 A;  1RW1 A;  3BBY A;  2QKE A;  4GWR A;  3LQ7 A;  1B4Q A;  2YV7 A;  2KP1 A;  1YF0 A;  2MZC A;  1XZO A;  1W89 A;  3WYW A;  5BRT A;  5JCG A;  3ZML A;  3GUS A;  2LV3 A;  4X1U A;  4MJE A;  2M46 A;  1YJ6 A;  2K8V A;  4FH8 A;  3MWH A;  3CTG A;  4EKZ A;  5JCW A;  1SEN A;  2HZE B;  3U6V A;  1BG5 A;  2J9H A;  5AN1 A;  4FO5 A;  2X64 A;  1OYJ A;  1YQ1 A;  3IC4 A;  4MH2 A;  3P7X A;  2GQK A;  2WFC A;  5G5F A;  3EUR A;  3GA4 A;  4PQ1 A;  2K18 A;  1QK8 A;  4KW6 A;  1XIY A;  1PFO A;  3FK8 A;  3D4T A;  3TDG A;  1SYR A;  4GTU A;  1AIU A;  2L59 A;  5ECQ B;  2NDO A;  3IAS 2;  3PGT A;  3LEF A;  5ECK B;  4MZC A;  1TOF A;  2H6Z A;  5AIV A;  3UAP A;  5DCH A;  2V6K A;  2PWJ A;  3LFL A;  4WF5 A;  3O3T A;  4N11 A;  1DE2 A;  1T00 A;  2IMK A;  3U5R E;  3A2W A;  3OR5 A;  3LYK A;  3D22 A;  2OE3 A;  2B5X A;  2C80 A;  4ML1 A;  3RBT A;  5E59 A;  2VUP A;  4WXT A;  2LNT A;  1OKD A;  4KH7 A;  2GQL A;  4MF6 A;  4V1A p;  1SKR B;  2VL2 C;  4I6X A;  1WRY A;  1LU4 A;  2YWO A;  4KDU A;  4L8E A;  5KOW A;  1WPI A;  1TP9 A;  5GZZ B;  5HFK A;  3ZVJ D;  1GSY A;  2ZUP A;  3IBH A;  1SKW B;  2XHF A;  3BJ5 A;  1V2A A;  2IPA A;  3HJO A;  4PQI A;  1XFL A;  1M9B A;  1PRX A;  4E8H A;  1AXD A;  1XG8 A;  2H70 A;  4KA0 A;  5E4W A;  3BCI A;  2RLI A;  2OAD A;  3FZ5 A;  4MLY A;  4OO4 A;  2R0P A;  2JZT A;  2KHP A;  1GUL A;  1BQ7 A;  3RAZ A;  3CQF A;  3NOF A;  2GZY A;  3KTL A;  3QAV A;  4J57 E;  5ECR B;  2CAQ A;  4F9Z A;  2F3M A;  4IQ1 A;  2CZ3 A;  1EOH A;  4TN8 A;  4NWY A;  2FWH A;  2XPE A;  3TKS C;  4GSS A;  3I43 A;  3UBL A;  1JLW A;  1O73 A;  5DAK B;  1M99 A;  2VCQ A;  3GTU B;  5GAP D;  4Q5Q A;  4TR4 A;  4MJC A;  1PSQ A;  1K3O A;  1CQH A;  2PUK C;  3HZ8 A;  2LS5 A;  2I4A A;  2PER A;  5JCU A;  3A2X A;  3RDW A;  1WP0 A;  1S3A A;  2B6M A;  3VI5 A;  1HNB A;  1MDI A;  5CRH A;  2FNO A;  1ABA A;  1YKC A;  3CTF A;  4FYB A;  4K9Z A;  4ID0 A;  17GS A;  1FVK A;  2REM A;  3GKM A;  2H76 A;  1TTZ A;  2I1U A;  2B5E A;  2PMT A;  1IYH A;  1GNW A;  1FOV A;  4HU7 A;  4JBB A;  1F37 A;  1JZO A;  4HZ4 A;  1SKS B;  1F3B A;  1LJR A;  2C0D A;  3CYN A;  3DEX A;  4OCE A;  4PUA A;  3VPT A;  2H75 A;  2FHE A;  4KDY A;  3KJY A;  5G5E A;  3GL3 A;  3VWV A;  2R6K A;  1XW5 A;  2YPM A;  1M7T A;  1PA3 A;  1T4Y A;  1A2J A;  4QL9 A;  4JRR A;  5L71 A;  3GV1 A;  4EUY A;  1WJK A;  3MAK A;  5CO3 A;  3C71 A;  3TJF A;  4Z2U A;  1CQG A;  13GS A;  3UVT A;  2VIM A;  1B4P A;  1HD2 A;  2O7K A;  1NSW A;  3D0Z A;  4JZQ A;  2E7P A;  5ECP B;  1ZYN A;  3TJG A;  1SJ6 A;  4N30 A;  4IJI A;  1S3D A;  2VD1 A;  1AQX A;  2OBK A;  1TXX A;  1SK0 A;  4KND A;  1M2A A;  1R5P A;  1AQV A;  2FWG A;  5JWQ B;  2C3N A;  1U87 A;  5ENU A;  1EV9 A;  4RI6 A;  1XOA A;  5J5N A;  1MDJ A;  1QQ2 A;  2AHE A;  5JWR B;  4ML6 A;  2A2P A;  2VD0 A;  4N10 A;  4WEY A;  1EV4 A;  1SK1 A;  5KN1 A;  5A4U A;  3D4M A;  1TI1 A;  9GSS A;  4PX1 A;  2H0G A;  1XW9 A;  4WR5 A;  4ZB8 A;  2GZP A;  2L6D A;  5BMU A;  5EY6 A;  5ECM B;  3P2A A;  4ISD A;  3M1G A;  3LXZ A;  3VI7 A;  2I81 A;  1YF1 A;  4JED A;  4MCU A;  4ECI A;  4MJB A;  1K3L A;  1OC8 A;  1A24 A;  5HR2 A;  3KXO A;  2O85 A;  4ZL8 A;  4AGS A;  3LGC A;  4HJ2 A;  2YV9 A;  1E2Y A;  1V58 A;  1SL0 B;  3M0F A;  6GSY A;  2HRN A;  3F63 A;  5DCG A;  3I6A A;  4KCA A;  1SU9 A;  4XS6 A;  3HYP A;  3KP9 A;  3TGZ A;  3APQ A;  5HR0 A;  3IAM 2;  4GST A;  3LSZ A;  3GST A;  2V32 A;  3V1W A;  1NHY A;  2LJA A;  5DAL A;  5A4W A;  3GX0 A;  1DE1 A;  4KSO A;  5EPF A;  3TRQ A;  2L5L A;  1X0R A;  3H93 A;  3EMX A;  4RI7 A;  2E2M A;  1B48 A;  3R3E A;  4J56 E;  1T7P B;  2JSZ A;  5J41 A;  5H5S A;  1FB0 A;  3JCM L;  4Q5F A;  2RII A;  4OWY A;  2N5A A;  3RHB A;  2OKA A;  3QDN A;  2WDU A;  1FO5 A;  1A0F A;  1OC3 A;  1GTA A;  3TCO A;  2PPT A;  4HUA A;  3FR6 A;  4FYC A;  1ERU A;  3UL3 A;  4BVY A;  3H8Q A;  3HVX A;  4POL A;  4NV5 A;  3BD2 A;  3GKK A;  2LQQ A;  5ELA A;  1FG4 A;  2YOI A;  4XS4 A;  3GH9 A;  3DML A;  1Z5Y E;  1O6J A;  2MMA A;  4ICY A;  4DVC A;  2R0G A;  1TDI A;  3ZFB A;  2PVQ A;  3HHV A;  2PU9 C;  4BVX B;  4CDO A;  2XBI A;  2F9S A;  3W8S A;  3TOT A;  1UC7 A;  3HVN A;  3H79 A;  4I8B A;  2DJK A;  3L9V A;  1G0T A;  1WMJ A;  1H75 A;  5F07 A;  3C1R A; 
#chains in the Genus database with same CATH homology
 4MDC A;  4BWS A;  1SYX A;  3KEB A;  3SBC A;  3QD9 A;  2VCW A;  3APO A;  1QXH A;  3DVW A;  1R26 A;  2I3Y A;  2VCX A;  3ME8 A;  1GP1 A;  5ECL B;  5LCZ A;  3FYG A;  2IJY A;  2CX4 A;  5IMZ A;  3UMA A;  3UOM A;  4TOP A;  3HJM A;  4KSM A;  2CA8 A;  3TKS E;  1A8Y A;  3HCZ A;  5IO2 A;  3UIW A;  1Z7P A;  4OFN A;  2R37 A;  4L5L A;  5AGY A;  3M9K A;  22GS A;  4O5Q A;  1Z7R A;  2IMD A;  3I9V 2;  3NIV A;  3DIE A;  3TKQ A;  3GKN A;  3US3 A;  2PGT A;  16GS A;  3E0U A;  2MMN A;  3TJB A;  2K9F A;  5CP1 A;  2AAW A;  5J9B A;  2VM2 A;  8GSS A;  2IL3 A;  2H1B A;  5CYY A;  2QC7 A;  4DSS B;  1K0C A;  1M9A A;  2AB6 A;  1O81 A;  3PH9 A;  1F9M A;  1EWX A;  3L0H A;  5G2Z A;  4I2U A;  4TR1 A;  4ECB A;  3GIX A;  2B7K A;  1A8L A;  3BCK A;  4ZBB A;  4K5R A;  1O7U A;  2HE3 A;  2DKI A;  2VLU A;  1K0A A;  5F05 A;  3CSI A;  2LNS A;  1FHE A;  1VRS D;  2HZE A;  4P3Y B;  5FWG A;  11GS A;  2ON5 A;  2R0C A;  3ZYW A;  2HRK A;  2L5O A;  2DLX A;  1EZK A;  1K0N A;  1ZCP A;  4EXJ A;  3F4S A;  4IBP A;  5J4U A;  2DKH A;  2L57 A;  4RQR A;  1GTB A;  3DYR A;  2X8H A;  2YP6 A;  1EOG A;  4PUR A;  3QAG A;  3DRN A;  2O89 A;  5ID2 A;  3MDK A;  2KUC A;  2MMZ A;  4MP4 A;  5A4V A;  4USS A;  4BL7 B;  12GS A;  4EC0 A;  3IR4 A;  3EU3 A;  1U3A A;  5CAX A;  4XRD A;  3DWV A;  1R5A A;  2DC5 A;  2FGX A;  3IC8 A;  3HXS A;  4KE3 A;  5D9T A;  2PBJ A;  4E8E A;  3QCP A;  2G2Q A;  3WGE A;  1X9M B;  1GLP A;  4H86 A;  2MYG A;  1ZMA A;  1AQW A;  1GNE A;  1K0O A;  1TJD A;  3O76 A;  2B5Y A;  1GWC A;  2QGV A;  1YEP A;  3CSJ A;  4POM A;  2GSQ A;  3A2V A;  1YKA A;  2WCI A;  5IMF A;  3HVV A;  4NMU A;  4N0V A;  4MJA A;  4DEJ A;  3ERG A;  5LNK e;  2QA1 A;  3TUE A;  4K6X A;  3K8N A;  4V1A g;  4KCE A;  4MF5 A;  3IHQ A;  2CVK A;  2HRA A;  2HSH A;  4ECC A;  1ZGN A;  3KZQ A;  4PTS A;  3ZL5 A;  1XWC A;  4DSR A;  2ES7 A;  1T1V A;  1WE0 A;  5D8I A;  3WGX A;  3FMW A;  4ULX A;  1AW9 A;  4EO3 A;  5H5R A;  4HJM A;  2GST A;  5FT3 A;  3IDV A;  5ECS A;  4F2I A;  4BPY A;  2OA7 A;  5CRW A;  1ZL9 A;  5GST A;  5C04 A;  4NHW A;  2CV4 A;  3IV4 A;  2VAF A;  3A5W A;  2H71 A;  2H1D A;  1U3I A;  2FWF A;  1ERW A;  1TU8 A;  2VL2 A;  1UA5 A;  4F0B A;  4KAE A;  4JE1 A;  1JZW A;  1T3B A;  2GS3 A;  2G0F A;  3C8E A;  2LKU A;  2X8G A;  2DJ0 A;  3QFB C;  2LEG A;  4Z7X A;  1EP7 A;  1UN2 A;  4DSQ A;  3IHG A;  2GGT A;  4D73 A;  4G0L A;  1PGT A;  3HD5 A;  3KMN A;  2H0H A;  3KH7 A;  3AY8 A;  3F6D A;  3KMO A;  2H66 A;  1KEB A;  5G1K A;  5ECH B;  3VPQ A;  4K7O A;  5DJM A;  1X5D A;  3TKS A;  1KBN A;  2BTO T;  4KX4 A;  2HSM A;  2E2G A;  1SJZ A;  2A2S A;  2HXK A;  3E9J B;  3FHK A;  1GUK A;  1EEM A;  1I9D A;  4IP1 A;  1QMV A;  4IKH A;  3Q74 A;  1X9W B;  2YJH A;  3GNJ A;  3LG6 A;  3VWU A;  3KTB A;  5CRE A;  3HY2 A;  4CW9 A;  4PNF A;  4MZB A;  3EPT A;  2WJU A;  1MEK A;  5DJL A;  3ZIV A;  5DBQ A;  2LUS A;  1G6Y A;  1RK4 A;  1MD3 A;  4HQZ A;  2DIZ A;  4OFM A;  1YZX A;  2X8C A;  1S3C A;  4IHU A;  1TW9 A;  3O6T A;  3HJP A;  1B8X A;  3ZLP A;  2MBT A;  3IK7 A;  3FW2 A;  2C0G A;  5J3R A;  2GZZ A;  2YNX A;  2C3Q A;  4FIW A;  1PQN A;  5B8B A;  6GSV A;  3Q19 A;  1Y25 A;  1GSD A;  4PNG A;  4RQX A;  5FHI A;  1WIK A;  2B3S A;  2ZCT A;  5AIX A;  3ZTL A;  3DKS A;  2FA8 A;  3MNG A;  3PR8 A;  3PPU A;  4AJ7 A;  4POB A;  3A3T A;  4EDY A;  1TK8 B;  3ZRE A;  2NVL A;  4QL7 A;  2FCH A;  4JR4 A;  2FD3 A;  2IFQ A;  2YWI A;  4F82 A;  4I97 A;  3G7J A;  3MYD A;  1AC1 A;  1GTU A;  2YWM A;  1R4W A;  3VUR A;  1FAA A;  4HI7 A;  1ILO A;  3L9U A;  2PN8 A;  2HI7 A;  3GH6 A;  1FW1 A;  1V9W A;  1TRU A;  4ZBA A;  3G7Y A;  2DJ2 A;  3TRP A;  1A2L A;  4IN0 A;  4EDZ A;  1B9X C;  1M2B A;  1U6T A;  5DQY A;  3GYK A;  4LL1 B;  4PGT A;  2TRX A;  2X4A A;  4IGJ A;  2IWT A;  5F0G A;  1PKW A;  3GX8 A;  1YEX A;  3VWX A;  5COH A;  10GS A;  4PXO A;  4WBR D;  4BWQ A;  2OE0 A;  5B6M A;  1GH2 A;  2WGR A;  5IPG A;  2EIQ A;  3ME7 A;  1OC9 B;  1ML6 A;  3LOR A;  1WWJ A;  3M3M A;  3G7I A;  4ZL9 A;  2K6V A;  1YDK A;  1NM3 A;  3QFA C;  5G31 A;  2DJ1 A;  3ED3 A;  4POK A;  2L6C A;  4XIH A;  2LRN A;  3L4N A;  2D2Z A;  1ERV A;  4O5R A;  6GSX A;  1JHB A;  3TJJ A;  3QPM A;  4KUN A;  3KP8 A;  2YZH A;  4G0K A;  3IA1 A;  5JWO B;  3UEM A;  4Z2T A;  4WR4 A;  1XWG A;  1UVZ A;  2GLR A;  2H19 A;  3MSZ A;  1ZYE A;  4K1F A;  6GST A;  3RHC A;  4PQH A;  2YCD A;  1AAZ A;  4BVX A;  1OE8 A;  7GSS A;  2OBI A;  4HS1 A;  2IMI A;  2VO4 A;  4ZB6 A;  6GSU A;  3ZRD A;  1PX6 A;  3LXT A;  2GVP A;  4LLR A;  2AUV A;  1J9B A;  3VFI A;  4TR0 A;  4TKY A;  3C1S A;  1QGV A;  18GS A;  4K7N A;  2C1Y A;  5HR1 A;  3ERF A;  1X9S B;  2JSY A;  1AUC A;  2EIR A;  1F2E A;  2ZNM A;  1GSE A;  3DGQ A;  2IMF A;  4O5U A;  3EU4 A;  4Q5R A;  2WRT A;  3IOS A;  4ZXG A;  2DMM A;  3HVS A;  2HZF A;  2B1K A;  5ELG A;  3GUR A;  1SK2 A;  2K8S A;  5DAL B;  4ILF A;  1OVN A;  4L0U A;  4CY8 A;  4MNN A;  1VF4 A;  2N5B A;  2GDR A;  2B7J A;  4NV2 A;  3KM6 A;  2CT6 A;  1TK5 B;  1GSQ A;  4K7I A;  4XCS A;  1URM A;  2VLT A;  2A2R A;  5F8B A;  1ZOF A;  3DVX A;  5B6N A;  1IYI A;  2E0Q A;  5A5K A;  1Z6M A;  1FB6 A;  1XOB A;  4IS0 A;  2HYX A;  1MTC A;  3G9B A;  4BVY B;  2Z9S A;  4XS1 A;  3TKP A;  3IK9 A;  3FEU A;  2H6X A;  3E3E A;  20GS A;  4A5P A;  2AYT A;  5IQY A;  1Q98 A;  5AIS A;  2YWN A;  1N2A A;  1GUH A;  3TB2 A;  3F8U A;  4ZIL A;  1W4V A;  5HFI A;  2YAN A;  2GQM A;  1TRW A;  1ZYQ B;  2O8V B;  1BED A;  2P0G A;  3SWL A;  5G30 A;  2DJJ A;  1V40 A;  3KGK A;  3WT1 A;  2DIY A;  1TRV A;  2RM6 A;  2V6O A;  2B1L A;  4CY6 A;  1TK0 B;  3FR3 A;  4OMV A;  1TRS A;  3GFK A;  1GRX A;  5KN2 A;  1B9Y C;  4PUF C;  3FKF A;  1VGL A;  1SD8 A;  2LJR A;  4IVF A;  1THO A;  5H5Q A;  5HFG A;  2HNL A;  2DBC A;  4BL7 A;  4K2D A;  2V2G A;  2H72 A;  3ZMK A;  3IE3 A;  3TOU A;  3S9F A;  2LJK A;  5IO0 A;  4J2F A;  2NBS A;  4TXO B;  2J23 A;  1GSS A;  3M9J A;  5IOX A;  4JU5 A;  4MAB A;  1JFU A;  1NW2 A;  1SJI A;  3IPZ A;  2GSS A;  3GSS A;  1HYU A;  3FY7 A;  3F4T A;  1FVJ A;  3GKX A;  1J0F A;  1OAZ A;  2LTK A;  2C4J A;  1JLV A;  4YAP A;  2DML A;  1K0D A;  4GSN A;  2DSA A;  2AJQ B;  4EE0 A;  4TR1 B;  2ALB A;  2GT6 A;  3D5J A;  3ZVJ A;  5INY A;  2NPB A;  4O92 A;  5GSS A;  1PKZ A;  1XW6 A;  3HKR A;  2BMX A;  4WBJ A;  2RUE A;  3VWW A;  1OKT A;  1XVQ A;  2FUG 2;  2WB9 A;  3DD3 A;  2EIO A;  1F6M C;  2C0F A;  5F06 A;  3F6F A;  3GN3 A;  1KTE A;  1XWB A;  2JAC A;  3ZZX A;  2LRT A;  4IJ3 A;  3UBK A;  3F9U A;  4KB3 A;  2YZU A;  4WKW A;  2P31 A;  3EIN A;  3WD6 A;  3IRA A;  4X43 A;  4YH2 A;  4AJ8 A;  4O7H A;  4X4J A;  2L4C A;  5ID2 B;  3CXG A;  2VLV A;  4OFT A;  5D73 A;  4OCF A;  4IW9 A;  4TW5 A;  4K0N A;  4NHZ A;  4MPF A;  4ECJ A;  2VCV A;  2CVB A;  1NHO A;  1BYE A;  4HOJ A;  5D9V A;  5D9W A;  5DAK A;  1EGR A;  2H0I A;  5B8A A;  5GAN D;  3GTU A;  4F03 A;  4MPG A;  4NPB A;  2OJL A;  4HU9 A;  3KCM A;  4TXV A;  3HZ4 A;  4K0G A;  5EVO A;  4QQ7 A;  4ACS A;  2FWE A;  2HT9 A;  4K2X A;  3D21 A;  1XWK A;  2M80 A;  4FYU A;  2X99 A;  3CBU A;  4YAV A;  4O32 A;  1SL2 B;  3QAW A;  1SL1 B;  1R7H A;  4IP6 A;  4G9H A;  4XHM A;  1M2D A;  5CNW A;  1TKD B;  3WT2 A;  3FZ9 A;  3ERW A;  4HQS A;  1XVW A;  4YKF A;  3UAR A;  1HQO A;  3C7M A;  1A0R P;  2YJ7 A;  3TJK A;  1M0U A;  4MH3 A;  4AF2 A;  3HDC A;  1E6B A;  1GLQ A;  1XPV A;  4GXZ A;  3RPN A;  3LYP A;  1VF3 A;  2LQO A;  1PL2 A;  2OE1 A;  1A2M A;  3FR9 A;  2TRC P;  5CRD A;  3N5O A;  3EYT A;  1X5C A;  2HRF A;  2RM5 A;  5KEJ A;  2I9H A;  5KOX A;  1EGO A;  1ERT A;  2C3T A;  3ZIJ A;  3PIN A;  1G7O A;  5LD0 A;  1EP8 A;  3CRU A;  1Q4J A;  3QR6 A;  5G1L A;  1XXU A;  3KD0 A;  1HNC A;  4IQA A;  2JU5 A;  4F0C A;  1QFN A;  4D73 B;  1RQM A;  4MA9 A;  3LWA A;  3H1N A;  2M72 A;  1O85 A;  1USB A;  4EF0 A;  2WUL A;  1Z6N A;  2XC2 A;  3C73 A;  2BJX A;  1ZZY A;  2P5R A;  5J9C A;  1Z9H A;  4EL1 A;  4V2M A;  5ECI B;  1XCC A;  3CMI A;  3UVH A;  2NTO A;  4MK3 A;  3L9S A;  2EC4 A;  1ACV A;  1TU7 A;  2C8U A;  2CAI A;  1G7E A;  3A5I A;  3VLN A;  4G10 A;  3MIX A;  4MMM A;  2CVD A;  2QA2 A;  2H73 A;  2UZ8 A;  1T4Z A;  3FZA A;  1THX A;  2R3X A;  2KLX A;  1OC9 A;  3Q18 A;  14GS A;  1BJX A;  4OO5 A;  4L0W A;  4LMV A;  3N9J A;  3TRX A;  1XWA A;  4JR6 A;  4NAX A;  2R2J A;  5ABR A;  3HA9 A;  1I5G A;  3L78 A;  1V98 A;  3F3Q A;  3R2Q A;  4EVM A;  1Z3E A;  3KH9 A;  3FRC A;  4ZL7 A;  1ZYP A;  2A4H A;  1GTI A;  3GRX A;  1HNA A;  4TR3 A;  1Y6E A;  2VL9 A;  2HFD A;  2XBQ A;  1N8J A;  3D6I A;  1A23 A;  1XBS A;  1K0B A;  5IM9 A;  3TKR A;  2XPD A;  2CZ2 A;  3I69 A;  2AV4 A;  5ECO B;  2IFQ B;  1LBK A;  4CHS A;  3CRT A;  2V41 A;  2JZR A;  4BA7 A;  3UJ1 A;  3GHA A;  2F51 A;  4K8M A;  1ST9 A;  2CQ9 A;  2FA4 A;  4GF0 A;  1OE7 A;  2YN1 A;  4KDX A;  3GL5 A;  4YQV A;  1K3Y A;  5IOW A;  1K0M A;  4I2T A;  4HEA 2;  4GRF A;  1EEJ A;  3CSH A;  2LST A;  3QMX A;  2PVO C;  2VCT A;  4TVE A;  2N5F A;  1PX7 A;  1VF2 A;  2VL3 A;  5IPH A;  5KN3 A;  2C0E A;  4N0Z A;  1ON4 A;  3GMF A;  4G2E A;  6GSS A;  5KN0 A;  4Z2R A;  1QUW A;  4YQU A;  4MF7 A;  1SD9 A;  2VM1 A;  3F4R A;  4GCI A;  4MZW A;  3KIJ A;  2H1G A;  5CRG A;  4V2L A;  4G19 A;  1JZR A;  2QSI A;  2JL4 A;  3EWL A;  4LMW A;  3LW9 A;  4IEL A;  2WS2 A;  1BAY A;  5EL8 A;  1H4O A;  1JZD A;  2ON7 A;  3Q6O A;  5ECN B;  2DJ3 A;  2JZS A;  3EMP A;  3LJR A;  3J7Y k;  1V57 A;  4GQC A;  1GSU A;  5DVB A;  3BOA A;  3VK9 A;  2L4Q A;  6GSW A;  5IMV A;  4WET A;  4FQU A;  1F3A A;  2FLS A;  2WZ9 A;  1PL1 A;  4LA1 A;  5D93 A;  5IMD A;  3FZ4 A;  1DUG A;  3F3R A;  1T8E B;  1FOH A;  2HSY A;  3W8J A;  1U88 A;  4DSS A;  2V1M A;  5HR3 A;  4AJ6 A;  1X5E A;  3ZIT A;  2H01 A;  2H8L A;  4X0X A;  1GL8 A;  4HDE A;  2GTU A;  1PMT A;  4RUV A;  1PN0 A;  2OAC A;  2TIR A;  5C00 A;  2H30 A;  4XS4 B;  5D96 A;  5IMA A;  3EC3 A;  3ZFL A;  4EIQ A;  1MD4 A;  5DDL A;  2X49 A;  4NXI A;  3DXB A;  3WGD A;  1VF1 A;  3W6G A;  3ISO A;  4YQM A;  5HQP A;  4XRA A;  4OD7 A;  4ZB9 A;  2RUF A;  1GSF A;  2VCZ A;  4TXO A;  3P90 A;  4KGI A;  4ZBD A;  1O8X A;  4LL4 B;  4ZIJ A;  4K5S A;  3P8W A;  4HZ2 A;  4TRX A;  3EVI A;  3M8N A;  2KOK A;  2HLS A;  1GUM A;  5D9X A;  2F8A A;  3J7Y b;  4GQF A;  2GT5 A;  2H1A A;  2LRC A;  1BX9 A;  4V2N A;  1G6W A;  3H4K A;  1YY7 A;  3NZN A;  5B7C A;  1PN9 A;  3EE2 A;  2A4V A;  2JAD A;  1O8W A;  4I5Q A;  1DSB A;  2IME A;  4EIP A;  5IIZ A;  3F0I A;  1WOU A;  2F8F A;  2VOC A;  2P5Q A;  1TI3 A;  2H74 A;  3APS A;  5DQS A;  19GS A;  2MBS A;  3QOU A;  2R4V A;  2IIY A;  2FY6 A;  4XTS A;  1PD2 1;  5IMC A;  1C72 A;  1MDK A;  2IN3 A;  2CX3 A;  4WF4 A;  1KNG A;  4Q5N A;  4YKG A;  4L5O A;  2MMO A;  1J08 A;  2R5G A;  4G0I A;  2O87 A;  4GLT A;  3IXR A;  4KF9 A;  2GSR A;  2H6Y A;  1DBY A;  3RPP A;  2KP2 A;  1RW1 A;  3BBY A;  2QKE A;  4GWR A;  3LQ7 A;  1B4Q A;  2YV7 A;  2KP1 A;  1YF0 A;  2MZC A;  1XZO A;  1W89 A;  3WYW A;  5BRT A;  5JCG A;  3ZML A;  3GUS A;  2LV3 A;  4X1U A;  4MJE A;  2M46 A;  1YJ6 A;  2K8V A;  4FH8 A;  3MWH A;  3CTG A;  4EKZ A;  5JCW A;  1SEN A;  2HZE B;  3U6V A;  1BG5 A;  2J9H A;  5AN1 A;  4FO5 A;  2X64 A;  1OYJ A;  1YQ1 A;  3IC4 A;  4MH2 A;  3P7X A;  2GQK A;  2WFC A;  5G5F A;  3EUR A;  3GA4 A;  4PQ1 A;  2K18 A;  1QK8 A;  4KW6 A;  1XIY A;  3FK8 A;  3D4T A;  3TDG A;  1SYR A;  4GTU A;  1AIU A;  2L59 A;  5ECQ B;  2NDO A;  3IAS 2;  3PGT A;  3LEF A;  5ECK B;  4MZC A;  1TOF A;  2H6Z A;  5AIV A;  3UAP A;  5DCH A;  2V6K A;  2PWJ A;  3LFL A;  4WF5 A;  3O3T A;  4N11 A;  1DE2 A;  1T00 A;  2IMK A;  3U5R E;  3A2W A;  3OR5 A;  3LYK A;  3D22 A;  2OE3 A;  2B5X A;  2C80 A;  4ML1 A;  3RBT A;  5E59 A;  2VUP A;  4WXT A;  2LNT A;  1OKD A;  4KH7 A;  2GQL A;  4MF6 A;  4V1A p;  1SKR B;  2VL2 C;  4I6X A;  1WRY A;  1LU4 A;  2YWO A;  4KDU A;  4L8E A;  5KOW A;  1WPI A;  1TP9 A;  5GZZ B;  5HFK A;  3ZVJ D;  1GSY A;  2ZUP A;  3IBH A;  1SKW B;  2XHF A;  3BJ5 A;  1V2A A;  2IPA A;  3HJO A;  4PQI A;  1XFL A;  1M9B A;  1PRX A;  4E8H A;  1AXD A;  2H70 A;  4KA0 A;  5E4W A;  3BCI A;  2RLI A;  2OAD A;  3FZ5 A;  4MLY A;  4OO4 A;  2R0P A;  2JZT A;  2KHP A;  1GUL A;  1BQ7 A;  3RAZ A;  3NOF A;  2GZY A;  3KTL A;  3QAV A;  4J57 E;  5ECR B;  2CAQ A;  4F9Z A;  2F3M A;  4IQ1 A;  2CZ3 A;  1EOH A;  4TN8 A;  4NWY A;  2FWH A;  2XPE A;  3TKS C;  4GSS A;  3I43 A;  3UBL A;  1JLW A;  1O73 A;  5DAK B;  1M99 A;  2VCQ A;  3GTU B;  5GAP D;  4Q5Q A;  4TR4 A;  4MJC A;  1PSQ A;  1K3O A;  1CQH A;  2PUK C;  3HZ8 A;  2LS5 A;  2I4A A;  2PER A;  5JCU A;  3A2X A;  3RDW A;  1WP0 A;  1S3A A;  2B6M A;  3VI5 A;  1HNB A;  1MDI A;  5CRH A;  2FNO A;  1ABA A;  1YKC A;  3CTF A;  4FYB A;  4K9Z A;  4ID0 A;  17GS A;  1FVK A;  2REM A;  3GKM A;  2H76 A;  1TTZ A;  2I1U A;  2B5E A;  2PMT A;  1IYH A;  1GNW A;  1FOV A;  4HU7 A;  4JBB A;  1F37 A;  1JZO A;  4HZ4 A;  1SKS B;  1F3B A;  1LJR A;  2C0D A;  3CYN A;  3DEX A;  4OCE A;  4PUA A;  3VPT A;  2H75 A;  2FHE A;  4KDY A;  3KJY A;  5G5E A;  3GL3 A;  3VWV A;  2R6K A;  1XW5 A;  2YPM A;  1M7T A;  1PA3 A;  1T4Y A;  1A2J A;  4QL9 A;  4JRR A;  5L71 A;  3GV1 A;  4EUY A;  1WJK A;  3MAK A;  5CO3 A;  3C71 A;  3TJF A;  4Z2U A;  1CQG A;  13GS A;  3UVT A;  2VIM A;  1B4P A;  1HD2 A;  2O7K A;  1NSW A;  3D0Z A;  4JZQ A;  2E7P A;  5ECP B;  1ZYN A;  3TJG A;  1SJ6 A;  4N30 A;  4IJI A;  1S3D A;  2VD1 A;  1AQX A;  2OBK A;  1TXX A;  1SK0 A;  4KND A;  1M2A A;  1R5P A;  1AQV A;  2FWG A;  5JWQ B;  2C3N A;  1U87 A;  5ENU A;  1EV9 A;  4RI6 A;  1XOA A;  5J5N A;  1MDJ A;  1QQ2 A;  2AHE A;  5JWR B;  4ML6 A;  2A2P A;  2VD0 A;  4N10 A;  4WEY A;  1EV4 A;  1SK1 A;  5KN1 A;  5A4U A;  3D4M A;  1TI1 A;  9GSS A;  4PX1 A;  2H0G A;  1XW9 A;  4WR5 A;  4ZB8 A;  2GZP A;  2L6D A;  5BMU A;  5EY6 A;  5ECM B;  3P2A A;  4ISD A;  3M1G A;  3LXZ A;  3VI7 A;  2I81 A;  1YF1 A;  4JED A;  4MCU A;  4ECI A;  4MJB A;  1K3L A;  1OC8 A;  1A24 A;  5HR2 A;  3KXO A;  2O85 A;  4ZL8 A;  4AGS A;  3LGC A;  4HJ2 A;  2YV9 A;  1E2Y A;  1V58 A;  1SL0 B;  3M0F A;  6GSY A;  2HRN A;  3F63 A;  5DCG A;  3I6A A;  4KCA A;  1SU9 A;  4XS6 A;  3HYP A;  3KP9 A;  3TGZ A;  3APQ A;  5HR0 A;  3IAM 2;  4GST A;  3LSZ A;  3GST A;  2V32 A;  3V1W A;  1NHY A;  2LJA A;  5DAL A;  5A4W A;  3GX0 A;  1DE1 A;  4KSO A;  5EPF A;  3TRQ A;  2L5L A;  1X0R A;  3H93 A;  3EMX A;  4RI7 A;  2E2M A;  1B48 A;  3R3E A;  4J56 E;  1T7P B;  2JSZ A;  5J41 A;  5H5S A;  1FB0 A;  3JCM L;  4Q5F A;  2RII A;  4OWY A;  2N5A A;  3RHB A;  2OKA A;  3QDN A;  2WDU A;  1FO5 A;  1A0F A;  1OC3 A;  1GTA A;  3TCO A;  2PPT A;  4HUA A;  3FR6 A;  4FYC A;  1ERU A;  3UL3 A;  4BVY A;  3H8Q A;  3HVX A;  4POL A;  4NV5 A;  3BD2 A;  3GKK A;  2LQQ A;  5ELA A;  1FG4 A;  2YOI A;  4XS4 A;  3GH9 A;  3DML A;  1Z5Y E;  1O6J A;  2MMA A;  4ICY A;  4DVC A;  2R0G A;  1TDI A;  3ZFB A;  2PVQ A;  3HHV A;  2PU9 C;  4BVX B;  4CDO A;  2XBI A;  2F9S A;  3W8S A;  3TOT A;  1UC7 A;  3H79 A;  4I8B A;  2DJK A;  3L9V A;  1G0T A;  1WMJ A;  1H75 A;  5F07 A;  3C1R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...