2FGXA

Solution nmr structure of protein ne2328 from nitrosomonas europaea. northeast structural genomics consortium target net3.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
85
structure length
85
Chain Sequence
MNNQVEPRKLVVYGREGCHLCEEMIASLRVLQKKSWFELEVINIDGNEHLTRLYNDRVPVLFAVNEDKELCHYFLDSDVIGAYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords putative thioredoxin
publication title Solution NMR Structure of Nitrosomonas Europaea Hypothetical Protein Ne2328: Northeast Structural Genomics Consortium Target NeT3
rcsb
source organism Nitrosomonas europaea
total genus 18
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2005-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05768 DUF836 Glutaredoxin-like domain (DUF836)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2fgxA00
3RHBA 2MMOA 3HHVA 3ZIVA 1SKSB 3KH9A 4FIWA 2AYTA 3ME8A 1ERUA 2F8AA 3BCKA 4GTUA 2HNLA 1YEXA 1HQOA 1SYRA 4L5LA 4PQ1A 2MBTA 4FH8A 2VCVA 4MDCA 1TK0B 3UL3A 1PRXA 1AAZA 4J2FA 3RPNA 8GSSA 1I9DA 2PVOC 4MF6A 4FYUA 2WJUA 3BCIA 1DUGA 4ECJA 1OC9A 2KP1A 1XW6A 3UOMA 1O7UA 3DXBA 4GSNA 2WZ9A 4TN8A 2WS2A 3FW2A 4KDXA 3DWVA 1XXUA 3F9UA 2DJKA 1E2YA 2NVLA 5IIZA 1TK5B 2LJKA 2X8GA 1KEBA 1GTUA 3E0UA 4MZBA 4POLA 1URMA 3HJMA 4MJAA 2GQMA 3UBKA 1Z3EA 2A4VA 2P31A 3H4KA 2N5FA 1V57A 2PUKC 1V98A 2J9HA 4I2TA 2CZ3A 4NHWA 3ZRDA 5DQSA 3FK8A 5L71A 3PH9A 1TXXA 1T3BA 4TOPA 1OE7A 4ZILA 4TXOB 1O8WA 2OADA 2H6ZA 5JCGA 4V1Ag 3K8NA 1M2BA 5EL8A 2YWOA 1J9BA 2GTUA 4D73B 5GAPD 3TRQA 3FY7A 5G2ZA 2GS3A 1U6TA 3IA1A 3EYTA 4TVEA 3IK7A 1M9BA 1SK2A 1XW5A 4X1UA 3DVXA 2YWNA 3D4TA 4TRXA 3ZFLA 1BEDA 3FR3A 2YV9A 3JCML 3TUEA 1DSBA 2IWTA 6GSYA 4WBRD 2WGRA 1ZZYA 4HI7A 3FEUA 3KGKA 3QPMA 4PNFA 2IMIA 1HNCA 1H75A 5AIVA 1PA3A 5HR2A 4OCFA 5H5SA 4PGTA 1M9AA 4PNGA 2TRXA 1YKAA 1AXDA 3LGCA 4JEDA 2XC2A 3MAKA 2OE1A 3W8SA 4TR3A 2VD0A 3TGZA 3NOFA 2DC5A 1EGRA 3CTFA 4XS4A 5AGYA 4GXZA 4J56E 1SYXA 1Z7PA 2VL9A 4CW9A 1UVZA 2YPMA 2ALBA 3F6FA 2IPAA 2KOKA 5FT3A 5DAKB 1PX7A 3LWAA 2VIMA 4WR5A 4IVFA 2BMXA 3FZ9A 2VM2A 1DE1A 4AJ8A 18GSA 3ISOA 5CRWA 14GSA 2VL2C 1LJRA 1HNBA 2AB6A 1LU4A 2WDUA 3I43A 4BWSA 1X9MB 4TXOA 4LL1B 2HLSA 1R5AA 2K18A 4G9HA 4LMWA 4KW6A 1X5DA 2JL4A 2DJ3A 3GMFA 2JSYA 4D73A 2P5QA 3SWLA 5IO2A 1TKDB 2HT9A 4CHSA 3DD3A 5HR1A 1XIYA 6GSVA 4KGIA 2GSTA 4FYCA 3GV1A 1ZL9A 2CX3A 1QMVA 2VAFA 1EOHA 3KH7A 2CVBA 2LNSA 4HZ4A 3D4MA 1OC8A 3EVIA 2YZUA 1R4WA 4ULXA 2GZYA 2H73A 2M80A 1FHEA 5G5FA 12GSA 4MLYA 4XTSA 5ELGA 5HFGA 5IMCA 1A2MA 1JZWA 3U6VA 3KM6A 3TKQA 4GSSA 1ILOA 2YNXA 2RUFA 1S3DA 3GUSA 4MA9A 4GLTA 3EMPA 3M8NA 3KZQA 2FWFA 3G7YA 2LSTA 2MYGA 4HU9A 2EC4A 1B48A 4ECIA 3GTUA 5IOXA 2V32A 5J4UA 3O6TA 5B6MA 3C7MA 2H75A 1YF1A 1PL2A 3UMAA 5B8AA 2WCIA 4OWYA 4GQFA 3CBUA 3ZVJD 4KCAA 2QKEA 4O32A 3GSTA 2IIYA 5CNWA 2BTOT 4MF7A 5DAKA 1F6MC 4EDZA 2VCXA 4GQCA 4BVXA 1NHYA 4XCSA 4ZL9A 3VWXA 1UN2A 3IPZA 1KTEA 1XWBA 3ERFA 3OR5A 4GF0A 2H19A 4HS1A 4RUVA 3IHQA 1OE8A 1F9MA 4KDYA 5C04A 4IQ1A 1U88A 4WETA 1A24A 3HCZA 3F3RA 4TR1B 3NIVA 2C3NA 5IOWA 4NXIA 4K7IA 4HUAA 2P0GA 5CRDA 3R2QA 4JR4A 4NPBA 4GWRA 2L4CA 1FW1A 2FWHA 1ZGNA 4IBPA 5C00A 4X0XA 4DSQA 1OKTA 1JLWA 1TRUA 3GH9A 4JU5A 1LBKA 3FHKA 5GSTA 4MF5A 5B8BA 3A3TA 3KP8A 1MTCA 3KTLA 4J57E 4N0ZA 4O7HA 2LJAA 4IELA 3VLNA 4PUAA 4POKA 4ECBA 2C8UA 2LS5A 2WB9A 3LFLA 2FY6A 2VLTA 2XBIA 1U3IA 3F63A 3M9JA 3TJBA 2YOIA 2C0EA 4HEA2 1TRSA 2VO4A 2V6OA 2MMNA 1AQWA 2HXKA 1FOVA 5CRHA 5FHIA 5IMDA 1GUHA 4DEJA 4KSMA 2LRNA 5ECIB 2DJ2A 4KH7A 1EOGA 3QR6A 4IN0A 5H5QA 1TRWA 2H0IA 3MNGA 4TKYA 6GSWA 1SU9A 1K0OA 2NBSA 4ISDA 2GSQA 1TTZA 3ZTLA 2YP6A 3KIJA 4IJIA 3AY8A 1TJDA 1GSSA 1F3BA 5JWQB 3LXZA 3HA9A 2NPBA 2R4VA 2CAQA 3LJRA 3DMLA 2CX4A 2HRNA 4ACSA 1SD9A 4NMUA 3PR8A 3PGTA 3L4NA 1SJIA 3GSSA 1F2EA 4XRDA 2P5RA 4FO5A 1GRXA 2IFQB 1O8XA 4TR4A 2K8VA 3O76A 4TR1A 4AGSA 3GRXA 3H1NA 2AUVA 1ZMAA 5H5RA 2REMA 4AJ6A 2O7KA 5KN0A 4L8EA 1GUKA 1THOA 16GSA 4FYBA 3FRCA 5DVBA 4MJEA 4EO3A 4KCEA 1E6BA 1FB6A 2OE0A 4IJ3A 2C0GA 3BOAA 3P2AA 3GH6A 2AJQB 2HSHA 3RBTA 2FCHA 2L5LA 4HU7A 2RM5A 3TKSE 4HQZA 1A23A 1T8EB 1B9YC 4ZB6A 1TW9A 2R2JA 1K3LA 1JFUA 1X5CA 3I9V2 2A2SA 1Y25A 4IS0A 1XW9A 1EWXA 4V2MA 1CQGA 4BA7A 4ILFA 4XHMA 1MD3A 3LQ7A 5CRGA 1KNGA 3QOUA 5AISA 2PPTA 1WOUA 2I81A 2PMTA 2HFDA 4BWQA 4MPFA 4Q5NA 1AQXA 4WF5A 3ZYWA 1QGVA 1QFNA 2G0FA 2GT5A 4LA1A 3BBYA 5EY6A 4N10A 5A4VA 11GSA 2GDRA 3J7Yk 4IP6A 4KA0A 2LNTA 1ERWA 3IBHA 4JRRA 2E2GA 3H93A 3PINA 4O92A 2IFQA 1EV9A 5G1LA 1Z6MA 1M2DA 3BD2A 3G7JA 4AF2A 2KHPA 1SKWB 3L9VA 1VF2A 3QAWA 3QFBC 1K0MA 3F6DA 3WGDA 1K3YA 3N5OA 2KUCA 4I5QA 3M0FA 5F05A 4TXVA 4L0WA 4HDEA 2MZCA 2WRTA 4RQRA 1Z9HA 2PWJA 3FR9A 3VWVA 3QAGA 4IHUA 2DLXA 3CXGA 2B5EA 3HJPA 1VGLA 2C0DA 1BG5A 5D9WA 3EURA 4N11A 5A4WA 2VUPA 3HY2A 2H66A 4AJ7A 1FG4A 2HSYA 2VL2A 3LEFA 3L9SA 2HZEB 3QFAC 5ECRB 19GSA 2L59A 2PGTA 4F2IA 2JACA 3W6GA 4OFNA 3KMNA 1XOAA 4I2UA 4NV2A 4I6XA 4I8BA 2RM6A 1Z6NA 1VF1A 3A2XA 5ECKB 5KEJA 3FYGA 4ZL7A 1F3AA 4KX4A 2YN1A 2JU5A 2F9SA 3NZNA 2CZ2A 3E9JB 2GZZA 4ID0A 1HNAA 2JSZA 5DJLA 3IAM2 2VOCA 3L9UA 2V2GA 4MJBA 4LMVA 2YWIA 4XRAA 4YAVA 1SJ6A 2AHEA 4IP1A 2F3MA 1R7HA 7GSSA 4QL9A 2FA8A 4N30A 2E2MA 2IMFA 4ZB8A 2ZCTA 2H70A 3I6AA 3KCMA 1O81A 2EIRA 6GSSA 1DBYA 1USBA 4HQSA 1A8LA 3TKPA 2C3TA 3VK9A 4JR6A 3TJJA 5ECLB 4KDUA 4MABA 2FUG2 3LG6A 4HJ2A 2GSRA 4K1FA 5HFKA 4K0GA 4GSTA 3GURA 2FNOA 3KEBA 1N8JA 1A2LA 4LLRA 3VURA 3GN3A 1NHOA 3UIWA 1SKRB 2B7JA 1TI3A 2I9HA 4DSRA 4YQMA 4PX1A 4F82A 1V2AA 3GX8A 1TRVA 4IW9A 4K0NA 4Z7XA 3HXSA 4RI7A 4PQIA 2HZEA 1PMTA 3F8UA 1QK8A 2H74A 20GSA 1I5GA 2YZHA 3D6IA 2M72A 5B7CA 1PD21 4K7NA 5ABRA 2LQOA 3DEXA 1MDJA 1GL8A 2LJRA 3WT1A 5FWGA 2GLRA 3RPPA 3DRNA 3IV4A 2H1BA 4WKWA 2JZTA 1PL1A 3E3EA 2ZNMA 4JBBA 2F8FA 4ECCA 2DIYA 1M0UA 3BJ5A 3VPTA 1WJKA 5DALB 1GUMA 3FR6A 5DDLA 1GNEA 1N2AA 2VM1A 3ED3A 4YQUA 5LD0A 3GL5A 2VCWA 2BJXA 5AIXA 3VI7A 2FWEA 4OO5A 1XWGA 3GKKA 2H01A 2E0QA 1B9XC 5IMAA 2O85A 2I1UA 4TW5A 1K0CA 5CO3A 2B1KA 2K8SA 4OMVA 4L5OA 1K0DA 2NDOA 2YJHA 4O5RA 5B6NA 5ENUA 4POBA 1QUWA 1YF0A 2L6CA 3C71A 3LSZA 4NWYA 1YZXA 5F06A 3TDGA 1VF4A 4PXOA 2IMEA 2CAIA 2H0GA 3HKRA 3G7IA 1AIUA 1RQMA 2LV3A 1S3CA 2DJ1A 2CVDA 2JZSA 1YJ6A 4GRFA 3US3A 4KAEA 1PKWA 4CDOA 3M9KA 1G0TA 5ECHB 2PVQA 2KLXA 3P8WA 4K8MA 1W4VA 1O73A 1TU7A 3UJ1A 1XZOA 5HR0A 1EEMA 2CA8A 2GZPA 5JCUA 2H1GA 2LEGA 1HD2A 2FGXA 2PN8A 2R3XA 3CTGA 3Q18A 4MZWA 1SENA 4RQXA 3DVWA 3H79A 4NHZA 2L6DA 5F0GA 2R37A 2VLUA 2YJ7A 4WBJA 2H1DA 5A4UA 3ZMLA 3TRPA 1ABAA 1GNWA 3KJYA 2OJLA 1AUCA 3ME7A 2F51A 4WEYA 2DMLA 1YKCA 3EU3A 4OFMA 3P7XA 4DVCA 2H76A 5A5KA 2VLVA 1ERVA 3GKMA 2DMMA 3HJOA 1ST9A 3F4SA 4I97A 3KMOA 4NAXA 3IR4A 1M7TA 4ML6A 4EVMA 3N9JA 4NV5A 3TJKA 9GSSA 4F0CA 4YAPA 3RDWA 3Q74A 2VCZA 10GSA 2IN3A 2GQLA 3HD5A 5HR3A 1OKDA 2IL3A 5HQPA 3WYWA 1EP8A 2HE3A 1Z7RA 2CT6A 5DJMA 1J0FA 1Y6EA 1UA5A 5IMVA 1CQHA 1SL1B 1EGOA 5ELAA 4BPYA 4EC0A 4K2DA 3MDKA 3TKSC 2L57A 3F4TA 1MD4A 2PBJA 2ES7A 4YH2A 3GIXA 1NM3A 1S3AA 3DYRA 1WE0A 3LORA 1A8YA 2H6XA 6GSTA 1SD8A 2LKUA 5G31A 2HI7A 1TDIA 2CV4A 3ZIJA 3G9BA 2AV4A 2B3SA 2LRCA 2MBSA 3L0HA 5KN1A 5HFIA 3HDCA 1BYEA 1W89A 3CSJA 1ZOFA 3UVHA 2OBKA 1YDKA 3ZREA 5JWRB 5LNKe 5D9XA 3MSZA 1GTBA 2PERA 1OVNA 1G6WA 2X64A 4PQHA 1EV4A 1T7PB 2H0HA 1A0FA 3TOTA 3QDNA 4HOJA 1YY7A 2AAWA 5CYYA 2B7KA 4EUYA 1GSFA 3WT2A 2HYXA 4MH3A 1TP9A 4E8EA 1M2AA 4ML1A 5COHA 2LUSA 1R5PA 1X5EA 2CQ9A 4JE1A 4BVYA 1Q98A 2O8VB 2OKAA 3C73A 5J41A 3ZVJA 4V1Ap 2MMAA 3CSHA 2K6VA 2DJ0A 2LRTA 3Q6OA 2A2RA 3ERGA 1GP1A 2VCQA 3GKXA 1AW9A 2OE3A 1T4ZA 2I3YA 5D8IA 3F4RA 3UEMA 1PSQA 1NW2A 3WGEA 4DSSB 4MPGA 4MMMA 3CMIA 2GQKA 1FAAA 2OACA 4N0VA 1GH2A 5J9CA 4XS6A 5ECPB 1WRYA 4MH2A 3GYKA 1XWCA 1EZKA 3UARA 5J9BA 1JHBA 4HZ2A 3CSIA 2XPDA 1B8XA 1O85A 2OA7A 1U3AA 4EE0A 1X9SB 3FZ4A 1YQ1A 2WFCA 3V1WA 3QMXA 1GSEA 5INYA 3M3MA 1OC3A 3RHCA 5F8BA 2GT6A 4K6XA 4MZCA 2N5AA 4XS4B 2H8LA 1ERTA 3LYPA 1G7OA 4OD7A 5ECNB 4KSOA 2OBIA 5ID2B 2B5YA 3FZAA 1Q4JA 1TU8A 3EWLA 2XBQA 4ZXGA 2QC7A 2H1AA 5D9VA 3ZL5A 2R5GA 3P90A 3QAVA 2FWGA 2PU9C 4KB3A 3IDVA 3LYKA 3GFKA 3CYNA 1J08A 3VFIA 1IYIA 2YCDA 4EL1A 3Q19A 1ZYEA 4E8HA 2RUEA 4G2EA 4OO4A 2QSIA 2DSAA 3FZ5A 1BJXA 5IMFA 4MK3A 4MJCA 1GLQA 1B4QA 3IXRA 4K9ZA 4XIHA 22GSA 4BL7A 4P3YB 5KN2A 3EU4A 5AN1A 3C1SA 4DSSA 4XS1A 5IM9A 1FB0A 2C0FA 2I4AA 3W8JA 3EINA 4Q5RA 3D0ZA 3C8EA 5IPGA 4ZBBA 1XFLA 3CRTA 3KXOA 1UC7A 4OCEA 1SL0B 1VRSD 1FVKA 2DIZA 2H72A 1RW1A 1JLVA 2IMKA 6GSXA 2QGVA 2V41A 3L78A 3WD6A 3GTUB 5CAXA 1MDIA 4PUFC 3QD9A 5G30A 4OFTA 3GHAA 2X99A 2N5BA 2K9FA 3FKFA 3WGXA 1HYUA 2B6MA 2H6YA 3VI5A 1GSUA 3HYPA 3UBLA 2V1MA 3ERWA 5ID2A 2LQQA 2XPEA 2Z9SA 5G1KA 13GSA 4KUNA 5E59A 1GSQA 1ZCPA 1X9WB 3IRAA 1H4OA 1TK8B 3GL3A 4EDYA 5D9TA 2FD3A 1MEKA 3APOA 4PURA 3DIEA 5EPFA 3MWHA 5GAND 3IOSA 3TJGA 2EIOA 4H86A 3UVTA 2JZRA 1BAYA 2L4QA 1XOBA 3TJFA 1BQ7A 2FA4A 1JZRA 4MCUA 1XBSA 4ZL8A 1XVWA 2KP2A 5ECOB 2O87A 1C72A 1GTIA 2XHFA 4QL7A 4ZBDA 3LXTA 2YV7A 1BX9A 4LL4B 1EEJA 17GSA 5ECSA 3ZMKA 1WMJA 4L0UA 3TRXA 1PN9A 3GA4A 3VWUA 3IE3A 3APQA 3IC4A 1V40A 1VF3A 1F37A 1V58A 4F9ZA 1XPVA 3RAZA 4WR4A 5D73A 4KNDA 2H30A 5JCWA 3F3QA 5DQYA 2ON7A 5DCHA 1OYJA 3TCOA 1YEPA 2DBCA 2D2ZA 1ML6A 1QXHA 2C1YA 5J3RA 3D5JA 1O6JA 1PQNA 4F03A 1SJZA 1JZDA 1TOFA 5IQYA 4ZBAA 1PX6A 3H8QA 1A0RP 3M1GA 3D22A 1GLPA 2O89A 3TOUA 2E7PA 5E4WA 2H71A 1FO5A 1V9WA 3J7Yb 1MDKA 5GSSA 1A2JA 3GKNA 3QCPA 2X8CA 4MP4A 5F07A 1QQ2A 2V6KA 4IQAA 3IAS2 3HVVA 3F0IA 3A2WA 2L5OA 1THXA 1FVJA 3TKSA 1PGTA 4RI6A 4ZB9A 1WPIA 4F0BA 1G6YA 1T00A 2RIIA 3VWWA 2IMDA 5DALA 3A2VA 4WXTA 5JWOB 4KE3A 1XWKA 2VD1A 1M99A 1AC1A 1GSYA 2C80A 3APSA 3EMXA 1G7EA 2LTKA 1SL2B 4V2LA 2FHEA 3HVSA 2HRFA 2CVKA 1TI1A 2X8HA 5GZZB 3O3TA 1ACVA 2YANA 1T4YA 4G19A 3U5RE 3ZFBA 3HZ8A 3KD0A 5IPHA 5DCGA 4TR0A 2B5XA 4EF0A 1XWAA 1KBNA 2VCTA 4V2NA 1JZOA 4QQ7A 3KP9A 1GSDA 1AQVA 1K0BA 1Z5YE 5CREA 3ZLPA 1GTAA 3HVXA 3VPQA 2YWMA 5IO0A 5ECMB 1K3OA 1WWJA 2B1LA 1X0RA 1GWCA 1ZYQB 4WF4A 4JZQA 5G5EA 2IJYA 3S9FA 1WP0A 2R6KA 2FLSA 5IMZA 4ZIJA 1DE2A 4G10A 2ON5A 1OAZA 4POMA 1SK1A 5KN3A 5D96A 5DBQA 2NTOA 3KTBA 5CP1A 1U87A 3EC3A 4Q5QA 3TB2A 4IKHA 1OC9B 2ZUPA 4GCIA 1RK4A 2HZFA 3ZZXA 1IYHA 1GULA 2RLIA 1NSWA 3SBCA 1B4PA 2C4JA 5J5NA 4K7OA 1EP7A 2GSSA 3A5WA 3HZ4A 3ZITA 3GNJA 1XVQA 5LCZA 2MMZA 3GX0A 2J23A 2DJJA 3UAPA 1T1VA 3I69A 6GSUA 5ECQB 2TRCP 1PKZA 4EKZA 2JADA 5D93A 2C3QA 1K0NA 3EE2A 1R26A 2M46A 1WIKA 3CRUA 4EXJA 1ON4A 1XCCA 1SK0A 2VL3A 2EIQA 3DKSA 4IGJA 3DGQA 2G2QA 2TIRA 1K0AA 4HJMA 2GGTA 2WULA 4Q5FA 3C1RA 3TKRA 2GVPA 4X43A 3D21A 3IK9A 5EVOA 4YQVA
chains in the Genus database with same CATH superfamily
3RHBA 2MMOA 3HHVA 3ZIVA 1SKSB 3KH9A 4FIWA 2AYTA 3ME8A 1ERUA 2F8AA 3BCKA 4GTUA 2HNLA 1YEXA 1HQOA 1SYRA 4L5LA 4PQ1A 2MBTA 4FH8A 2VCVA 4MDCA 1TK0B 3UL3A 1PRXA 1AAZA 4J2FA 3RPNA 8GSSA 1I9DA 2PVOC 4PTSA 4MF6A 4FYUA 2WJUA 3BCIA 1DUGA 4ECJA 1OC9A 2KP1A 1XW6A 3UOMA 1O7UA 3DXBA 4GSNA 2WZ9A 4TN8A 2WS2A 3FW2A 4KDXA 3DWVA 1XXUA 3F9UA 2DJKA 1E2YA 2NVLA 5IIZA 1TK5B 2LJKA 2X8GA 1KEBA 1GTUA 3E0UA 4MZBA 4POLA 1URMA 3HJMA 4MJAA 2GQMA 3UBKA 1Z3EA 2QA1A 2A4VA 2P31A 3H4KA 2N5FA 1V57A 2PUKC 1V98A 2J9HA 3MIXA 4I2TA 2CZ3A 4NHWA 3ZRDA 5DQSA 3FK8A 4Z2UA 5L71A 4MNNA 3PH9A 1TXXA 1T3BA 4TOPA 1OE7A 4ZILA 4TXOB 1O8WA 2OADA 1M3IA 2H6ZA 5JCGA 4V1Ag 2A2PA 4Z2TA 3K8NA 1M2BA 5EL8A 2YWOA 1J9BA 2GTUA 4D73B 4USSA 5GAPD 3TRQA 4G0KA 3FY7A 5G2ZA 2GS3A 1U6TA 3IA1A 3EYTA 4TVEA 3IK7A 1M9BA 1SK2A 1XW5A 4X1UA 3DVXA 2YWNA 3D4TA 4TRXA 3ZFLA 1BEDA 3PPUA 3FR3A 2YV9A 3JCML 3TUEA 1DSBA 2IWTA 6GSYA 4WBRD 2WGRA 1ZZYA 4HI7A 3FEUA 3KGKA 3QPMA 4PNFA 2IMIA 1HNCA 1H75A 5AIVA 1PA3A 5HR2A 4OCFA 5H5SA 4PGTA 1M9AA 3IHGA 4PNGA 2TRXA 1YKAA 1AXDA 3LGCA 4JEDA 2XC2A 3MAKA 2OE1A 3W8SA 4TR3A 2VD0A 3TGZA 3NOFA 2DC5A 1EGRA 3CTFA 4XS4A 5AGYA 4GXZA 4J56E 1SYXA 1Z7PA 2UZ8A 2VL9A 4CW9A 1UVZA 2YPMA 2ALBA 3F6FA 2IPAA 2KOKA 5FT3A 5DAKB 1PX7A 3LWAA 4BVXB 2VIMA 4WR5A 4IVFA 2BMXA 3FZ9A 2VM2A 1DE1A 4AJ8A 18GSA 3ISOA 5CRWA 14GSA 2VL2C 1LJRA 1HNBA 2AB6A 1LU4A 3MYDA 2WDUA 3I43A 4BWSA 1X9MB 4TXOA 4LL1B 2HLSA 1R5AA 2K18A 4G9HA 4LMWA 4KW6A 1X5DA 2JL4A 2DJ3A 3GMFA 2JSYA 4D73A 2P5QA 3SWLA 5IO2A 1TKDB 2HT9A 4CHSA 3DD3A 5HR1A 1XIYA 6GSVA 4KGIA 2GSTA 4FYCA 3GV1A 1ZL9A 2CX3A 1QMVA 2VAFA 1EOHA 3KH7A 2CVBA 2LNSA 4HZ4A 3D4MA 1OC8A 3EVIA 2YZUA 1R4WA 4ULXA 2GZYA 2H73A 2M80A 1FHEA 5G5FA 12GSA 4MLYA 4XTSA 5ELGA 5HFGA 5IMCA 1A2MA 1JZWA 3U6VA 3KM6A 3TKQA 4GSSA 1ILOA 2YNXA 2RUFA 1S3DA 3GUSA 4MA9A 4GLTA 3EMPA 3M8NA 3KZQA 2FWFA 3G7YA 2LSTA 2MYGA 4HU9A 2EC4A 1B48A 4ECIA 3GTUA 5IOXA 2V32A 5J4UA 3O6TA 5B6MA 3C7MA 2H75A 1YF1A 1PL2A 3UMAA 5B8AA 2WCIA 4OWYA 4GQFA 3CBUA 3ZVJD 4KCAA 2QKEA 4O32A 3GSTA 2IIYA 5CNWA 2BTOT 4MF7A 5DAKA 1F6MC 4EDZA 2VCXA 4GQCA 4BVXA 1NHYA 4XCSA 4ZL9A 3VWXA 1UN2A 3IPZA 1KTEA 1XWBA 3ERFA 3OR5A 4GF0A 2H19A 4HS1A 4RUVA 3IHQA 1OE8A 1F9MA 4KDYA 5C04A 4IQ1A 1U88A 4WETA 1A24A 3HCZA 3F3RA 4TR1B 3NIVA 2C3NA 5IOWA 4NXIA 4K7IA 4HUAA 2P0GA 5CRDA 3R2QA 4JR4A 4NPBA 4GWRA 2L4CA 1FW1A 2A4HA 2FWHA 1ZGNA 4IBPA 5C00A 4X0XA 4DSQA 1OKTA 1JLWA 1TRUA 3GH9A 4JU5A 1LBKA 3FHKA 5GSTA 4MF5A 5B8BA 3A3TA 3KP8A 1MTCA 3KTLA 4J57E 4N0ZA 4O7HA 2LJAA 4IELA 3VLNA 4PUAA 4POKA 4ECBA 2C8UA 2HRAA 2LS5A 2WB9A 3LFLA 2FY6A 2VLTA 2XBIA 1U3IA 3F63A 3M9JA 3TJBA 2YOIA 2C0EA 4HEA2 1TRSA 2VO4A 2V6OA 2MMNA 1AQWA 2HXKA 1FOVA 5CRHA 5FHIA 5IMDA 1GUHA 4DEJA 4KSMA 2LRNA 5ECIB 2DJ2A 4KH7A 1EOGA 3QR6A 4IN0A 5H5QA 1TRWA 2H0IA 3MNGA 4TKYA 6GSWA 1SU9A 1K0OA 2NBSA 4ISDA 2GSQA 4YKFA 1TTZA 3ZTLA 2YP6A 3KIJA 4IJIA 3AY8A 1TJDA 1GSSA 1F3BA 5JWQB 4BVYB 3LXZA 3HA9A 2NPBA 2R4VA 2CAQA 3LJRA 3DMLA 2CX4A 2HRNA 4ACSA 1SD9A 4NMUA 3PR8A 3PGTA 3L4NA 1SJIA 3GSSA 1F2EA 4XRDA 2P5RA 4FO5A 1GRXA 2IFQB 1O8XA 4TR4A 2K8VA 3O76A 4TR1A 4AGSA 3GRXA 3H1NA 2AUVA 1ZMAA 5H5RA 2REMA 4AJ6A 2O7KA 5KN0A 4L8EA 1GUKA 1THOA 16GSA 4FYBA 3FRCA 5DVBA 4MJEA 4EO3A 4KCEA 1E6BA 1FB6A 2OE0A 4IJ3A 2C0GA 3BOAA 3P2AA 3GH6A 2AJQB 2HSHA 2QA2A 3RBTA 2FCHA 2L5LA 4HU7A 2RM5A 3TKSE 4HQZA 1A23A 1T8EB 1B9YC 4ZB6A 1TW9A 2R2JA 1K3LA 1JFUA 1X5CA 3I9V2 2A2SA 1Y25A 4IS0A 1XW9A 1EWXA 4V2MA 1CQGA 4BA7A 4ILFA 4XHMA 1MD3A 3LQ7A 5CRGA 1KNGA 3QOUA 5AISA 2PPTA 1WOUA 2I81A 2PMTA 2HFDA 4BWQA 4MPFA 4Q5NA 4YKGA 1AQXA 4WF5A 3ZYWA 1QGVA 1QFNA 2G0FA 2GT5A 4LA1A 3BBYA 5EY6A 3FMWA 4N10A 5A4VA 11GSA 2GDRA 3J7Yk 4IP6A 4KA0A 2LNTA 1ERWA 3IBHA 4JRRA 2E2GA 3H93A 3PINA 4O92A 2IFQA 1EV9A 5G1LA 4CY8A 1Z6MA 1M2DA 3BD2A 4HSCX 3G7JA 4AF2A 2KHPA 1SKWB 1M3JA 3L9VA 3LW9A 3CQFA 1VF2A 3QAWA 3QFBC 1K0MA 3F6DA 3WGDA 1K3YA 3N5OA 2KUCA 4I5QA 3M0FA 5F05A 4TXVA 4L0WA 4HDEA 2MZCA 2WRTA 4RQRA 1Z9HA 2PWJA 3FR9A 3VWVA 3QAGA 4IHUA 4BIKA 2DLXA 3CXGA 2B5EA 3HJPA 1VGLA 2C0DA 1BG5A 5D9WA 3EURA 4N11A 5A4WA 2VUPA 3HY2A 2H66A 4AJ7A 1FG4A 2HSYA 2VL2A 3LEFA 3L9SA 2HZEB 3QFAC 5ECRB 19GSA 2L59A 2PGTA 4F2IA 2JACA 4EIQA 3W6GA 4OFNA 3KMNA 1XOAA 4I2UA 4NV2A 4I6XA 4I8BA 2RM6A 1Z6NA 1VF1A 3A2XA 5ECKB 5KEJA 3FYGA 4ZL7A 1F3AA 4KX4A 2YN1A 2JU5A 2F9SA 3NZNA 2CZ2A 3E9JB 2GZZA 4ID0A 1HNAA 2JSZA 5DJLA 3IAM2 2VOCA 3L9UA 2V2GA 4MJBA 4LMVA 2YWIA 4XRAA 4YAVA 1SJ6A 2AHEA 4IP1A 2F3MA 1R7HA 7GSSA 4QL9A 2FA8A 4N30A 2E2MA 2IMFA 4ZB8A 2ZCTA 2H70A 3I6AA 3KCMA 1O81A 2EIRA 6GSSA 1DBYA 1USBA 4HQSA 1A8LA 3TKPA 2DKHA 2C3TA 3VK9A 4JR6A 3TJJA 5ECLB 4KDUA 4MABA 2FUG2 1ZYNA 3LG6A 4HJ2A 2GSRA 4K1FA 5HFKA 4K0GA 4GSTA 3GURA 2FNOA 3KEBA 1N8JA 1A2LA 4X4JA 1FOHA 4LLRA 3VURA 3GN3A 1NHOA 3UIWA 3A5IA 1SKRB 2B7JA 1TI3A 2I9HA 4DSRA 4YQMA 4PX1A 4F82A 1V2AA 5KOXA 3GX8A 1TRVA 4IW9A 4K0NA 4Z7XA 3HXSA 4RI7A 4PQIA 2HZEA 1PMTA 3F8UA 1QK8A 2H74A 20GSA 1I5GA 2YZHA 3D6IA 2M72A 5B7CA 1PD21 4K7NA 5ABRA 2LQOA 3DEXA 1MDJA 2R0GA 1GL8A 2LJRA 3WT1A 5FWGA 2GLRA 3RPPA 3DRNA 3IV4A 2H1BA 4WKWA 2JZTA 1PL1A 3E3EA 2ZNMA 4JBBA 2F8FA 4ECCA 2DIYA 1M0UA 3BJ5A 3VPTA 1WJKA 5DALB 1GUMA 3FR6A 5DDLA 1GNEA 1N2AA 4KF9A 2VM1A 3ED3A 4YQUA 5LD0A 3GL5A 2VCWA 2BJXA 5AIXA 3VI7A 2FWEA 4OO5A 1XWGA 3GKKA 2H01A 2E0QA 1B9XC 5IMAA 2O85A 2I1UA 4TW5A 1K0CA 5CO3A 2B1KA 2K8SA 4OMVA 4L5OA 1K0DA 2NDOA 2YJHA 4O5RA 5B6NA 5ENUA 4POBA 1QUWA 1YF0A 2L6CA 3C71A 3LSZA 4NWYA 1YZXA 5F06A 3TDGA 1VF4A 4PXOA 2IMEA 2CAIA 2H0GA 3HKRA 3G7IA 1AIUA 1RQMA 2LV3A 1S3CA 2DJ1A 2CVDA 2HRKA 2JZSA 1YJ6A 4GRFA 3US3A 4KAEA 1PKWA 4CDOA 3M9KA 1G0TA 5ECHB 2PVQA 2KLXA 3P8WA 4K8MA 1W4VA 1O73A 1TU7A 3UJ1A 1XZOA 5HR0A 1EEMA 2CA8A 2GZPA 5JCUA 2H1GA 2LEGA 1HD2A 2FGXA 4K2XA 2PN8A 2R3XA 3CTGA 3Q18A 4ICYA 4MZWA 1SENA 4RQXA 3DVWA 3H79A 4NHZA 2L6DA 5F0GA 2R37A 2VLUA 2YJ7A 4WBJA 2H1DA 5A4UA 3ZMLA 3TRPA 1ABAA 1GNWA 3HVNA 2OJLA 3KJYA 1AUCA 3ME7A 2F51A 4WEYA 2DMLA 1YKCA 3EU3A 4OFMA 3P7XA 4DVCA 2H76A 5A5KA 2VLVA 1ERVA 3GKMA 2DMMA 3HJOA 1ST9A 3F4SA 4I97A 3KMOA 4NAXA 3IR4A 1M7TA 4ML6A 4EVMA 3N9JA 4NV5A 3TJKA 9GSSA 4F0CA 4YAPA 3RDWA 3Q74A 2VCZA 10GSA 2IN3A 2GQLA 3HD5A 5HR3A 1OKDA 2IL3A 5HQPA 3WYWA 1EP8A 2HE3A 1Z7RA 2CT6A 5DJMA 1J0FA 1Y6EA 1UA5A 5IMVA 1CQHA 1SL1B 1EGOA 5ELAA 4BPYA 4EC0A 4K2DA 3MDKA 3TKSC 2L57A 3F4TA 1MD4A 2PBJA 2ES7A 4YH2A 3GIXA 1NM3A 1S3AA 3DYRA 1WE0A 3LORA 1A8YA 2H6XA 6GSTA 1SD8A 2LKUA 5G31A 2HI7A 1TDIA 1PN0A 2CV4A 3ZIJA 3G9BA 2AV4A 2B3SA 2LRCA 2MBSA 3L0HA 5KN1A 5HFIA 3HDCA 1BYEA 1W89A 3CSJA 1ZOFA 3UVHA 2OBKA 1YDKA 3ZREA 5JWRB 5LNKe 5D9XA 4A5PA 3MSZA 1GTBA 2PERA 1OVNA 1G6WA 2X64A 4PQHA 1EV4A 2X49A 1T7PB 2H0HA 1A0FA 3TOTA 3QDNA 4HOJA 1YY7A 2AAWA 5CYYA 2B7KA 4EUYA 1GSFA 3WT2A 2HYXA 4MH3A 1TP9A 4E8EA 1M2AA 4ML1A 5COHA 2LUSA 1R5PA 1X5EA 2CQ9A 4JE1A 4BVYA 1Q98A 2O8VB 2OKAA 3C73A 5J41A 3ZVJA 4V1Ap 2MMAA 1XG8A 3CSHA 2K6VA 2DJ0A 2LRTA 3Q6OA 2A2RA 3ERGA 1GP1A 2VCQA 3GKXA 1AW9A 2OE3A 1T4ZA 2I3YA 5D8IA 3F4RA 3UEMA 4BL7B 1PSQA 1NW2A 3WGEA 4DSSB 4MPGA 4MMMA 3CMIA 2GQKA 1FAAA 2OACA 4N0VA 1GH2A 5J9CA 4XS6A 5ECPB 1WRYA 4MH2A 3GYKA 1XWCA 4K5RA 1EZKA 3UARA 5J9BA 1JHBA 4HZ2A 3CSIA 4O5QA 2XPDA 1B8XA 1O85A 2OA7A 1U3AA 4EE0A 1X9SB 3FZ4A 1YQ1A 2WFCA 3V1WA 3QMXA 1GSEA 5INYA 3M3MA 1OC3A 3RHCA 5F8BA 2R0CA 2GT6A 4K6XA 4MZCA 2N5AA 4XS4B 2H8LA 1ERTA 3LYPA 1G7OA 2DKIA 4OD7A 5ECNB 4KSOA 2OBIA 5ID2B 2B5YA 3FZAA 4FQUA 1Q4JA 1TU8A 2HSMA 3EWLA 2XBQA 4ZXGA 2QC7A 2H1AA 5D9VA 3ZL5A 2R5GA 3P90A 3QAVA 2FWGA 2PU9C 4KB3A 3IDVA 3LYKA 3GFKA 3CYNA 1J08A 3VFIA 1IYIA 2YCDA 4EL1A 3Q19A 1ZYEA 4E8HA 2RUEA 4G2EA 1ZYPA 4OO4A 2QSIA 2DSAA 3FZ5A 1BJXA 5IMFA 4Z2RA 4MK3A 4MJCA 1GLQA 1B4QA 3IXRA 5KOWA 4K9ZA 4XIHA 22GSA 4BL7A 4P3YB 5KN2A 3EU4A 5AN1A 3C1SA 4DSSA 4XS1A 5IM9A 1FB0A 2C0FA 2I4AA 1PFOA 3W8JA 3EINA 4Q5RA 3D0ZA 4O5UA 3C8EA 5IPGA 4ZBBA 1XFLA 3CRTA 3KXOA 1UC7A 4OCEA 1SL0B 1VRSD 1FVKA 2DIZA 2H72A 1RW1A 1JLVA 2IMKA 6GSXA 2QGVA 2V41A 3L78A 3WD6A 3GTUB 5CAXA 1MDIA 4PUFC 3QD9A 5G30A 4OFTA 3GHAA 2X99A 2N5BA 2K9FA 3FKFA 3WGXA 1HYUA 2B6MA 4EIPA 2H6YA 3VI5A 1GSUA 3HYPA 3UBLA 2V1MA 3ERWA 5ID2A 2LQQA 2XPEA 2Z9SA 5G1KA 13GSA 4KUNA 5E59A 1GSQA 1ZCPA 1X9WB 3IRAA 1H4OA 1TK8B 3GL3A 4EDYA 5D9TA 2R0PA 2FD3A 1MEKA 3APOA 5BRTA 4PURA 3DIEA 5EPFA 3MWHA 5GAND 3IOSA 3TJGA 2EIOA 4H86A 3UVTA 2JZRA 1BAYA 2L4QA 1XOBA 3TJFA 1BQ7A 2FA4A 1JZRA 4MCUA 1XBSA 4ZL8A 1XVWA 2KP2A 5ECOB 2O87A 1C72A 1GTIA 4G0IA 2XHFA 4QL7A 4ZBDA 3LXTA 2YV7A 4CY6A 1BX9A 4LL4B 1EEJA 17GSA 5ECSA 3ZMKA 1WMJA 4L0UA 3TRXA 1PN9A 3GA4A 3VWUA 3IE3A 3APQA 3R3EA 3IC4A 1V40A 1VF3A 1F37A 1V58A 4F9ZA 1XPVA 3RAZA 4WR4A 5D73A 4KNDA 2H30A 5JCWA 3F3QA 5DQYA 2ON7A 5DCHA 1OYJA 3TCOA 1YEPA 2DBCA 2D2ZA 1ML6A 1QXHA 2C1YA 5J3RA 3D5JA 1O6JA 1PQNA 4F03A 1SJZA 1JZDA 1TOFA 5IQYA 4ZBAA 1PX6A 3H8QA 1A0RP 3M1GA 3D22A 1GLPA 2O89A 3TOUA 2E7PA 5E4WA 2H71A 1FO5A 1V9WA 3J7Yb 1MDKA 5GSSA 1A2JA 3GKNA 3QCPA 2X8CA 4MP4A 5F07A 1QQ2A 2V6KA 4IQAA 3IAS2 3HVVA 3F0IA 3A2WA 2L5OA 1THXA 1FVJA 3TKSA 1PGTA 4RI6A 3IC8A 4ZB9A 1WPIA 4F0BA 1G6YA 1T00A 2RIIA 3VWWA 2IMDA 5DALA 3A2VA 4WXTA 5JWOB 4KE3A 1XWKA 2VD1A 1M99A 1AC1A 1GSYA 2C80A 3APSA 3EMXA 1G7EA 2LTKA 1SL2B 4V2LA 2FHEA 3HVSA 2HRFA 2CVKA 1TI1A 2X8HA 5GZZB 3O3TA 1ACVA 2YANA 1T4YA 4G19A 3U5RE 3ZFBA 3HZ8A 3KD0A 5IPHA 5DCGA 4TR0A 2B5XA 4EF0A 1XWAA 1KBNA 2VCTA 4V2NA 1JZOA 4QQ7A 3KP9A 1GSDA 4G0LA 1AQVA 1K0BA 1Z5YE 5CREA 3ZLPA 1GTAA 3HVXA 3VPQA 2YWMA 5IO0A 5ECMB 1K3OA 1WWJA 2B1LA 1X0RA 1GWCA 3EPTA 4WF4A 1ZYQB 4JZQA 5G5EA 2IJYA 3S9FA 1WP0A 2R6KA 2FLSA 5IMZA 4ZIJA 1DE2A 4G10A 2ON5A 1OAZA 4POMA 1SK1A 5KN3A 5D96A 5DBQA 2NTOA 3KTBA 5CP1A 1U87A 5BMUA 3EC3A 4Q5QA 3TB2A 4IKHA 1OC9B 2ZUPA 4GCIA 1RK4A 2HZFA 3ZZXA 1IYHA 1GULA 2RLIA 1NSWA 3SBCA 1B4PA 2C4JA 5J5NA 4K7OA 1EP7A 2GSSA 3A5WA 3HZ4A 3ZITA 3GNJA 1XVQA 5LCZA 2MMZA 3GX0A 2J23A 2DJJA 3UAPA 1T1VA 3I69A 6GSUA 5ECQB 2TRCP 1PKZA 4EKZA 2JADA 5D93A 2C3QA 1K0NA 3EE2A 1R26A 2M46A 1WIKA 2X4AA 4K5SA 3CRUA 4EXJA 1ON4A 1XCCA 1SK0A 2VL3A 2EIQA 4IGJA 3DKSA 3DGQA 1S3RA 2G2QA 2TIRA 1K0AA 4HJMA 2GGTA 2WULA 4Q5FA 3C1RA 3TKRA 2GVPA 4X43A 3D21A 3IK9A 5EVOA 4YQVA
chains in the Genus database with same CATH topology
3RHBA 2MMOA 3HHVA 3ZIVA 1SKSB 3KH9A 4FIWA 2AYTA 3ME8A 1ERUA 2F8AA 3BCKA 4GTUA 2HNLA 1YEXA 1HQOA 1SYRA 4L5LA 4PQ1A 2MBTA 4FH8A 2VCVA 4MDCA 1TK0B 3UL3A 1PRXA 1AAZA 4J2FA 3RPNA 8GSSA 1I9DA 2PVOC 4PTSA 4MF6A 4FYUA 2WJUA 3BCIA 1DUGA 4ECJA 1OC9A 2KP1A 1XW6A 3UOMA 1O7UA 3DXBA 4GSNA 2WZ9A 4TN8A 2WS2A 3FW2A 4KDXA 3DWVA 1XXUA 3F9UA 2DJKA 1E2YA 2NVLA 5IIZA 1TK5B 2LJKA 2X8GA 1KEBA 1GTUA 3E0UA 4MZBA 4POLA 1URMA 3HJMA 4MJAA 2GQMA 3UBKA 1Z3EA 2QA1A 2A4VA 2P31A 3H4KA 2N5FA 1V57A 2PUKC 1V98A 2J9HA 3MIXA 4I2TA 2CZ3A 4NHWA 3ZRDA 5DQSA 3FK8A 4Z2UA 5L71A 4MNNA 3PH9A 1TXXA 1T3BA 4TOPA 1OE7A 4ZILA 4TXOB 1O8WA 2OADA 2H6ZA 5JCGA 4V1Ag 2A2PA 4Z2TA 3K8NA 1M2BA 5EL8A 2YWOA 1J9BA 2GTUA 4D73B 4USSA 5GAPD 3TRQA 4G0KA 3FY7A 5G2ZA 2GS3A 1U6TA 3IA1A 3EYTA 4TVEA 3IK7A 1M9BA 1SK2A 1XW5A 4X1UA 3DVXA 2YWNA 3D4TA 4TRXA 3ZFLA 1BEDA 3PPUA 3FR3A 2YV9A 3JCML 3TUEA 1DSBA 2IWTA 6GSYA 4WBRD 2WGRA 1ZZYA 4HI7A 3FEUA 3KGKA 3QPMA 4PNFA 2IMIA 1HNCA 1H75A 5AIVA 1PA3A 5HR2A 4OCFA 5H5SA 4PGTA 1M9AA 3IHGA 4PNGA 2TRXA 1YKAA 1AXDA 3LGCA 4JEDA 2XC2A 3MAKA 2OE1A 3W8SA 4TR3A 2VD0A 3TGZA 3NOFA 2DC5A 1EGRA 3CTFA 4XS4A 5AGYA 4GXZA 4J56E 1SYXA 1Z7PA 2UZ8A 2VL9A 4CW9A 1UVZA 2YPMA 2ALBA 3F6FA 2IPAA 2KOKA 5FT3A 5DAKB 1PX7A 3LWAA 4BVXB 2VIMA 4WR5A 4IVFA 2BMXA 3FZ9A 2VM2A 1DE1A 4AJ8A 18GSA 3ISOA 5CRWA 14GSA 2VL2C 1LJRA 1HNBA 2AB6A 1LU4A 3MYDA 2WDUA 3I43A 4BWSA 1X9MB 4TXOA 4LL1B 2HLSA 1R5AA 2K18A 4G9HA 4LMWA 4KW6A 1X5DA 2JL4A 2DJ3A 3GMFA 2JSYA 4D73A 2P5QA 3SWLA 5IO2A 1TKDB 2HT9A 4CHSA 3DD3A 5HR1A 1XIYA 6GSVA 4KGIA 2GSTA 4FYCA 3GV1A 1ZL9A 2CX3A 1QMVA 2VAFA 1EOHA 3KH7A 2CVBA 2LNSA 4HZ4A 3D4MA 1OC8A 3EVIA 2YZUA 1R4WA 4ULXA 2GZYA 2H73A 2M80A 1FHEA 5G5FA 12GSA 4MLYA 4XTSA 5ELGA 5HFGA 5IMCA 1A2MA 1JZWA 3U6VA 3KM6A 3TKQA 4GSSA 1ILOA 2YNXA 2RUFA 1S3DA 3GUSA 4MA9A 4GLTA 3EMPA 3M8NA 3KZQA 2FWFA 3G7YA 2LSTA 2MYGA 4HU9A 2EC4A 1B48A 4ECIA 3GTUA 5IOXA 2V32A 5J4UA 3O6TA 5B6MA 3C7MA 2H75A 1YF1A 1PL2A 3UMAA 5B8AA 2WCIA 4OWYA 4GQFA 3CBUA 3ZVJD 4KCAA 2QKEA 4O32A 3GSTA 2IIYA 5CNWA 2BTOT 4MF7A 5DAKA 1F6MC 4EDZA 2VCXA 4GQCA 4BVXA 1NHYA 4XCSA 4ZL9A 3VWXA 1UN2A 3IPZA 1KTEA 1XWBA 3ERFA 3OR5A 4GF0A 2H19A 4HS1A 4RUVA 3IHQA 1OE8A 1F9MA 4KDYA 5C04A 4IQ1A 1U88A 4WETA 1A24A 3HCZA 3F3RA 4TR1B 3NIVA 2C3NA 5IOWA 4NXIA 4K7IA 4HUAA 2P0GA 5CRDA 3R2QA 4JR4A 4NPBA 4GWRA 2L4CA 1FW1A 2A4HA 2FWHA 1ZGNA 4IBPA 5C00A 4X0XA 4DSQA 1OKTA 1JLWA 1TRUA 3GH9A 4JU5A 1LBKA 3FHKA 5GSTA 4MF5A 5B8BA 3A3TA 3KP8A 1MTCA 3KTLA 4J57E 4N0ZA 4O7HA 2LJAA 4IELA 3VLNA 4PUAA 4POKA 4ECBA 2C8UA 2HRAA 2LS5A 2WB9A 3LFLA 2FY6A 2VLTA 2XBIA 1U3IA 3F63A 3M9JA 3TJBA 2YOIA 2C0EA 4HEA2 1TRSA 2VO4A 2V6OA 2MMNA 1AQWA 2HXKA 1FOVA 5CRHA 5FHIA 5IMDA 1GUHA 4DEJA 4KSMA 2LRNA 5ECIB 2DJ2A 4KH7A 1EOGA 3QR6A 4IN0A 5H5QA 1TRWA 2H0IA 3MNGA 4TKYA 6GSWA 1SU9A 1K0OA 2NBSA 4ISDA 2GSQA 4YKFA 1TTZA 3ZTLA 2YP6A 3KIJA 4IJIA 3AY8A 1TJDA 1GSSA 1F3BA 5JWQB 4BVYB 3LXZA 3HA9A 2NPBA 2R4VA 2CAQA 3LJRA 3DMLA 2CX4A 2HRNA 4ACSA 1SD9A 4NMUA 3PR8A 3PGTA 3L4NA 1SJIA 3GSSA 1F2EA 4XRDA 2P5RA 4FO5A 1GRXA 2IFQB 1O8XA 4TR4A 2K8VA 3O76A 4TR1A 4AGSA 3GRXA 3H1NA 2AUVA 1ZMAA 5H5RA 2REMA 4AJ6A 2O7KA 5KN0A 4L8EA 1GUKA 1THOA 16GSA 4FYBA 3FRCA 5DVBA 4MJEA 4EO3A 4KCEA 1E6BA 1FB6A 2OE0A 4IJ3A 2C0GA 3BOAA 3P2AA 3GH6A 2AJQB 2HSHA 2QA2A 3RBTA 2FCHA 2L5LA 4HU7A 2RM5A 3TKSE 4HQZA 1A23A 1T8EB 1B9YC 4ZB6A 1TW9A 2R2JA 1K3LA 1JFUA 1X5CA 3I9V2 2A2SA 1Y25A 4IS0A 1XW9A 1EWXA 4V2MA 1CQGA 4BA7A 4ILFA 4XHMA 1MD3A 3LQ7A 5CRGA 1KNGA 3QOUA 5AISA 2PPTA 1WOUA 2I81A 2PMTA 2HFDA 4BWQA 4MPFA 4Q5NA 4YKGA 1AQXA 4WF5A 3ZYWA 1QGVA 1QFNA 2G0FA 2GT5A 4LA1A 3BBYA 5EY6A 3FMWA 4N10A 5A4VA 11GSA 2GDRA 3J7Yk 4IP6A 4KA0A 2LNTA 1ERWA 3IBHA 4JRRA 2E2GA 3H93A 3PINA 4O92A 2IFQA 1EV9A 5G1LA 4CY8A 1Z6MA 1M2DA 3BD2A 3G7JA 4AF2A 2KHPA 1SKWB 3L9VA 3LW9A 1VF2A 3QAWA 3QFBC 1K0MA 3F6DA 3WGDA 1K3YA 3N5OA 2KUCA 4I5QA 3M0FA 5F05A 4TXVA 4L0WA 4HDEA 2MZCA 2WRTA 4RQRA 1Z9HA 2PWJA 3FR9A 3VWVA 3QAGA 4IHUA 2DLXA 3CXGA 2B5EA 3HJPA 1VGLA 2C0DA 1BG5A 5D9WA 3EURA 4N11A 5A4WA 2VUPA 3HY2A 2H66A 4AJ7A 1FG4A 2HSYA 2VL2A 3LEFA 3L9SA 2HZEB 3QFAC 5ECRB 19GSA 2L59A 2PGTA 4F2IA 2JACA 4EIQA 3W6GA 4OFNA 3KMNA 1XOAA 4I2UA 4NV2A 4I6XA 4I8BA 2RM6A 1Z6NA 1VF1A 3A2XA 5ECKB 5KEJA 3FYGA 4ZL7A 1F3AA 4KX4A 2YN1A 2JU5A 2F9SA 3NZNA 2CZ2A 3E9JB 2GZZA 4ID0A 1HNAA 2JSZA 5DJLA 3IAM2 2VOCA 3L9UA 2V2GA 4MJBA 4LMVA 2YWIA 4XRAA 4YAVA 1SJ6A 2AHEA 4IP1A 2F3MA 1R7HA 7GSSA 4QL9A 2FA8A 4N30A 2E2MA 2IMFA 4ZB8A 2ZCTA 2H70A 3I6AA 3KCMA 1O81A 2EIRA 6GSSA 1DBYA 1USBA 4HQSA 1A8LA 3TKPA 2DKHA 2C3TA 3VK9A 4JR6A 3TJJA 5ECLB 4KDUA 4MABA 2FUG2 1ZYNA 3LG6A 4HJ2A 2GSRA 4K1FA 5HFKA 4K0GA 4GSTA 3GURA 2FNOA 3KEBA 1N8JA 1A2LA 4X4JA 1FOHA 4LLRA 3VURA 3GN3A 1NHOA 3UIWA 3A5IA 1SKRB 2B7JA 1TI3A 2I9HA 4DSRA 4YQMA 4PX1A 4F82A 1V2AA 5KOXA 3GX8A 1TRVA 4IW9A 4K0NA 4Z7XA 3HXSA 4RI7A 4PQIA 2HZEA 1PMTA 3F8UA 1QK8A 2H74A 20GSA 1I5GA 2YZHA 3D6IA 2M72A 5B7CA 1PD21 4K7NA 5ABRA 2LQOA 3DEXA 1MDJA 2R0GA 1GL8A 2LJRA 3WT1A 5FWGA 2GLRA 3RPPA 3DRNA 3IV4A 2H1BA 4WKWA 2JZTA 1PL1A 3E3EA 2ZNMA 4JBBA 2F8FA 4ECCA 2DIYA 1M0UA 3BJ5A 3VPTA 1WJKA 5DALB 1GUMA 3FR6A 5DDLA 1GNEA 1N2AA 4KF9A 2VM1A 3ED3A 4YQUA 5LD0A 3GL5A 2VCWA 2BJXA 5AIXA 3VI7A 2FWEA 4OO5A 1XWGA 3GKKA 2H01A 2E0QA 1B9XC 5IMAA 2O85A 2I1UA 4TW5A 1K0CA 5CO3A 2B1KA 2K8SA 4OMVA 4L5OA 1K0DA 2NDOA 2YJHA 4O5RA 5B6NA 5ENUA 4POBA 1QUWA 1YF0A 2L6CA 3C71A 3LSZA 4NWYA 1YZXA 5F06A 3TDGA 1VF4A 4PXOA 2IMEA 2CAIA 2H0GA 3HKRA 3G7IA 1AIUA 1RQMA 2LV3A 1S3CA 2DJ1A 2CVDA 2HRKA 2JZSA 1YJ6A 4GRFA 3US3A 4KAEA 1PKWA 4CDOA 3M9KA 1G0TA 5ECHB 2PVQA 2KLXA 3P8WA 4K8MA 1W4VA 1O73A 1TU7A 3UJ1A 1XZOA 5HR0A 1EEMA 2CA8A 2GZPA 5JCUA 2H1GA 2LEGA 1HD2A 2FGXA 4K2XA 2PN8A 2R3XA 3CTGA 3Q18A 4ICYA 4MZWA 1SENA 4RQXA 3DVWA 3H79A 4NHZA 2L6DA 5F0GA 2R37A 2VLUA 2YJ7A 4WBJA 2H1DA 5A4UA 3ZMLA 3TRPA 1ABAA 1GNWA 3KJYA 2OJLA 1AUCA 3ME7A 2F51A 4WEYA 2DMLA 1YKCA 3EU3A 4OFMA 3P7XA 4DVCA 2H76A 5A5KA 2VLVA 1ERVA 3GKMA 2DMMA 3HJOA 1ST9A 3F4SA 4I97A 3KMOA 4NAXA 3IR4A 1M7TA 4ML6A 4EVMA 3N9JA 4NV5A 3TJKA 9GSSA 4F0CA 4YAPA 3RDWA 3Q74A 2VCZA 10GSA 2IN3A 2GQLA 3HD5A 5HR3A 1OKDA 2IL3A 5HQPA 3WYWA 1EP8A 2HE3A 1Z7RA 2CT6A 5DJMA 1J0FA 1Y6EA 1UA5A 5IMVA 1CQHA 1SL1B 1EGOA 5ELAA 4BPYA 4EC0A 4K2DA 3MDKA 3TKSC 2L57A 3F4TA 1MD4A 2PBJA 2ES7A 4YH2A 3GIXA 1NM3A 1S3AA 3DYRA 1WE0A 3LORA 1A8YA 2H6XA 6GSTA 1SD8A 2LKUA 5G31A 2HI7A 1TDIA 1PN0A 2CV4A 3ZIJA 3G9BA 2AV4A 2B3SA 2LRCA 2MBSA 3L0HA 5KN1A 5HFIA 3HDCA 1BYEA 1W89A 3CSJA 1ZOFA 3UVHA 2OBKA 1YDKA 3ZREA 5JWRB 5LNKe 5D9XA 4A5PA 3MSZA 1GTBA 2PERA 1OVNA 1G6WA 2X64A 4PQHA 1EV4A 2X49A 1T7PB 2H0HA 1A0FA 3TOTA 3QDNA 4HOJA 1YY7A 2AAWA 5CYYA 2B7KA 4EUYA 1GSFA 3WT2A 2HYXA 4MH3A 1TP9A 4E8EA 1M2AA 4ML1A 5COHA 2LUSA 1R5PA 1X5EA 2CQ9A 4JE1A 4BVYA 1Q98A 2O8VB 2OKAA 3C73A 5J41A 3ZVJA 4V1Ap 2MMAA 3CSHA 2K6VA 2DJ0A 2LRTA 3Q6OA 2A2RA 3ERGA 1GP1A 2VCQA 3GKXA 1AW9A 2OE3A 1T4ZA 2I3YA 5D8IA 3F4RA 3UEMA 4BL7B 1PSQA 1NW2A 3WGEA 4DSSB 4MPGA 4MMMA 3CMIA 2GQKA 1FAAA 2OACA 4N0VA 1GH2A 5J9CA 4XS6A 5ECPB 1WRYA 4MH2A 3GYKA 1XWCA 4K5RA 1EZKA 3UARA 5J9BA 1JHBA 4HZ2A 3CSIA 4O5QA 2XPDA 1B8XA 1O85A 2OA7A 1U3AA 4EE0A 1X9SB 3FZ4A 1YQ1A 2WFCA 3V1WA 3QMXA 1GSEA 5INYA 3M3MA 1OC3A 3RHCA 5F8BA 2R0CA 2GT6A 4K6XA 4MZCA 2N5AA 4XS4B 2H8LA 1ERTA 3LYPA 1G7OA 2DKIA 4OD7A 5ECNB 4KSOA 2OBIA 5ID2B 2B5YA 3FZAA 4FQUA 1Q4JA 1TU8A 2HSMA 3EWLA 2XBQA 4ZXGA 2QC7A 2H1AA 5D9VA 3ZL5A 2R5GA 3P90A 3QAVA 2FWGA 2PU9C 4KB3A 3IDVA 3LYKA 3GFKA 3CYNA 1J08A 3VFIA 1IYIA 2YCDA 4EL1A 3Q19A 1ZYEA 4E8HA 2RUEA 4G2EA 1ZYPA 4OO4A 2QSIA 2DSAA 3FZ5A 1BJXA 5IMFA 4Z2RA 4MK3A 4MJCA 1GLQA 1B4QA 3IXRA 5KOWA 4K9ZA 4XIHA 22GSA 4BL7A 4P3YB 5KN2A 3EU4A 5AN1A 3C1SA 4DSSA 4XS1A 5IM9A 1FB0A 2C0FA 2I4AA 3W8JA 3EINA 4Q5RA 3D0ZA 4O5UA 3C8EA 5IPGA 4ZBBA 1XFLA 3CRTA 3KXOA 1UC7A 4OCEA 1SL0B 1VRSD 1FVKA 2DIZA 2H72A 1RW1A 1JLVA 2IMKA 6GSXA 2QGVA 2V41A 3L78A 3WD6A 3GTUB 5CAXA 1MDIA 4PUFC 3QD9A 5G30A 4OFTA 3GHAA 2X99A 2N5BA 2K9FA 3FKFA 3WGXA 1HYUA 2B6MA 4EIPA 2H6YA 3VI5A 1GSUA 3HYPA 3UBLA 2V1MA 3ERWA 5ID2A 2LQQA 2XPEA 2Z9SA 5G1KA 13GSA 4KUNA 5E59A 1GSQA 1ZCPA 1X9WB 3IRAA 1H4OA 1TK8B 3GL3A 4EDYA 5D9TA 2R0PA 2FD3A 1MEKA 3APOA 5BRTA 4PURA 3DIEA 5EPFA 3MWHA 5GAND 3IOSA 3TJGA 2EIOA 4H86A 3UVTA 2JZRA 1BAYA 2L4QA 1XOBA 3TJFA 1BQ7A 2FA4A 1JZRA 4MCUA 1XBSA 4ZL8A 1XVWA 2KP2A 5ECOB 2O87A 1C72A 1GTIA 4G0IA 2XHFA 4QL7A 4ZBDA 3LXTA 2YV7A 4CY6A 1BX9A 4LL4B 1EEJA 17GSA 5ECSA 3ZMKA 1WMJA 4L0UA 3TRXA 1PN9A 3GA4A 3VWUA 3IE3A 3APQA 3R3EA 3IC4A 1V40A 1VF3A 1F37A 1V58A 4F9ZA 1XPVA 3RAZA 4WR4A 5D73A 4KNDA 2H30A 5JCWA 3F3QA 5DQYA 2ON7A 5DCHA 1OYJA 3TCOA 1YEPA 2DBCA 2D2ZA 1ML6A 1QXHA 2C1YA 5J3RA 3D5JA 1O6JA 1PQNA 4F03A 1SJZA 1JZDA 1TOFA 5IQYA 4ZBAA 1PX6A 3H8QA 1A0RP 3M1GA 3D22A 1GLPA 2O89A 3TOUA 2E7PA 5E4WA 2H71A 1FO5A 1V9WA 3J7Yb 1MDKA 5GSSA 1A2JA 3GKNA 3QCPA 2X8CA 4MP4A 5F07A 1QQ2A 2V6KA 4IQAA 3IAS2 3HVVA 3F0IA 3A2WA 2L5OA 1THXA 1FVJA 3TKSA 1PGTA 4RI6A 3IC8A 4ZB9A 1WPIA 4F0BA 1G6YA 1T00A 2RIIA 3VWWA 2IMDA 5DALA 3A2VA 4WXTA 5JWOB 4KE3A 1XWKA 2VD1A 1M99A 1AC1A 1GSYA 2C80A 3APSA 3EMXA 1G7EA 2LTKA 1SL2B 4V2LA 2FHEA 3HVSA 2HRFA 2CVKA 1TI1A 2X8HA 5GZZB 3O3TA 1ACVA 2YANA 1T4YA 4G19A 3U5RE 3ZFBA 3HZ8A 3KD0A 5IPHA 5DCGA 4TR0A 2B5XA 4EF0A 1XWAA 1KBNA 2VCTA 4V2NA 1JZOA 4QQ7A 3KP9A 1GSDA 4G0LA 1AQVA 1K0BA 1Z5YE 5CREA 3ZLPA 1GTAA 3HVXA 3VPQA 2YWMA 5IO0A 5ECMB 1K3OA 1WWJA 2B1LA 1X0RA 1GWCA 3EPTA 4WF4A 1ZYQB 4JZQA 5G5EA 2IJYA 3S9FA 1WP0A 2R6KA 2FLSA 5IMZA 4ZIJA 1DE2A 4G10A 2ON5A 1OAZA 4POMA 1SK1A 5KN3A 5D96A 5DBQA 2NTOA 3KTBA 5CP1A 1U87A 5BMUA 3EC3A 4Q5QA 3TB2A 4IKHA 1OC9B 2ZUPA 4GCIA 1RK4A 2HZFA 3ZZXA 1IYHA 1GULA 2RLIA 1NSWA 3SBCA 1B4PA 2C4JA 5J5NA 4K7OA 1EP7A 2GSSA 3A5WA 3HZ4A 3ZITA 3GNJA 1XVQA 5LCZA 2MMZA 3GX0A 2J23A 2DJJA 3UAPA 1T1VA 3I69A 6GSUA 5ECQB 2TRCP 1PKZA 4EKZA 2JADA 5D93A 2C3QA 1K0NA 3EE2A 1R26A 2M46A 1WIKA 2X4AA 4K5SA 3CRUA 4EXJA 1ON4A 1XCCA 1SK0A 2VL3A 2EIQA 3DKSA 4IGJA 3DGQA 2G2QA 2TIRA 1K0AA 4HJMA 2GGTA 2WULA 4Q5FA 3C1RA 3TKRA 2GVPA 4X43A 3D21A 3IK9A 5EVOA 4YQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RHB A;  2MMO A;  3HHV A;  3ZIV A;  1SKS B;  3KH9 A;  4FIW A;  2AYT A;  3ME8 A;  1ERU A;  2F8A A;  3BCK A;  4GTU A;  2HNL A;  1YEX A;  1HQO A;  1SYR A;  4L5L A;  4PQ1 A;  2MBT A;  4FH8 A;  2VCV A;  4MDC A;  1TK0 B;  3UL3 A;  1PRX A;  1AAZ A;  4J2F A;  3RPN A;  8GSS A;  1I9D A;  2PVO C;  4MF6 A;  4FYU A;  2WJU A;  3BCI A;  1DUG A;  4ECJ A;  1OC9 A;  2KP1 A;  1XW6 A;  3UOM A;  1O7U A;  3DXB A;  4GSN A;  2WZ9 A;  4TN8 A;  2WS2 A;  3FW2 A;  4KDX A;  3DWV A;  1XXU A;  3F9U A;  2DJK A;  1E2Y A;  2NVL A;  5IIZ A;  1TK5 B;  2LJK A;  2X8G A;  1KEB A;  1GTU A;  3E0U A;  4MZB A;  4POL A;  1URM A;  3HJM A;  4MJA A;  2GQM A;  3UBK A;  1Z3E A;  2A4V A;  2P31 A;  3H4K A;  2N5F A;  1V57 A;  2PUK C;  1V98 A;  2J9H A;  4I2T A;  2CZ3 A;  4NHW A;  3ZRD A;  5DQS A;  3FK8 A;  5L71 A;  3PH9 A;  1TXX A;  1T3B A;  4TOP A;  1OE7 A;  4ZIL A;  4TXO B;  1O8W A;  2OAD A;  2H6Z A;  5JCG A;  4V1A g;  3K8N A;  1M2B A;  5EL8 A;  2YWO A;  1J9B A;  2GTU A;  4D73 B;  5GAP D;  3TRQ A;  3FY7 A;  5G2Z A;  2GS3 A;  1U6T A;  3IA1 A;  3EYT A;  4TVE A;  3IK7 A;  1M9B A;  1SK2 A;  1XW5 A;  4X1U A;  3DVX A;  2YWN A;  3D4T A;  4TRX A;  3ZFL A;  1BED A;  3FR3 A;  2YV9 A;  3JCM L;  3TUE A;  1DSB A;  2IWT A;  6GSY A;  4WBR D;  2WGR A;  1ZZY A;  4HI7 A;  3FEU A;  3KGK A;  3QPM A;  4PNF A;  2IMI A;  1HNC A;  1H75 A;  5AIV A;  1PA3 A;  5HR2 A;  4OCF A;  5H5S A;  4PGT A;  1M9A A;  4PNG A;  2TRX A;  1YKA A;  1AXD A;  3LGC A;  4JED A;  2XC2 A;  3MAK A;  2OE1 A;  3W8S A;  4TR3 A;  2VD0 A;  3TGZ A;  3NOF A;  2DC5 A;  1EGR A;  3CTF A;  4XS4 A;  5AGY A;  4GXZ A;  4J56 E;  1SYX A;  1Z7P A;  2VL9 A;  4CW9 A;  1UVZ A;  2YPM A;  2ALB A;  3F6F A;  2IPA A;  2KOK A;  5FT3 A;  5DAK B;  1PX7 A;  3LWA A;  2VIM A;  4WR5 A;  4IVF A;  2BMX A;  3FZ9 A;  2VM2 A;  1DE1 A;  4AJ8 A;  18GS A;  3ISO A;  5CRW A;  14GS A;  2VL2 C;  1LJR A;  1HNB A;  2AB6 A;  1LU4 A;  2WDU A;  3I43 A;  4BWS A;  1X9M B;  4TXO A;  4LL1 B;  2HLS A;  1R5A A;  2K18 A;  4G9H A;  4LMW A;  4KW6 A;  1X5D A;  2JL4 A;  2DJ3 A;  3GMF A;  2JSY A;  4D73 A;  2P5Q A;  3SWL A;  5IO2 A;  1TKD B;  2HT9 A;  4CHS A;  3DD3 A;  5HR1 A;  1XIY A;  6GSV A;  4KGI A;  2GST A;  4FYC A;  3GV1 A;  1ZL9 A;  2CX3 A;  1QMV A;  2VAF A;  1EOH A;  3KH7 A;  2CVB A;  2LNS A;  4HZ4 A;  3D4M A;  1OC8 A;  3EVI A;  2YZU A;  1R4W A;  4ULX A;  2GZY A;  2H73 A;  2M80 A;  1FHE A;  5G5F A;  12GS A;  4MLY A;  4XTS A;  5ELG A;  5HFG A;  5IMC A;  1A2M A;  1JZW A;  3U6V A;  3KM6 A;  3TKQ A;  4GSS A;  1ILO A;  2YNX A;  2RUF A;  1S3D A;  3GUS A;  4MA9 A;  4GLT A;  3EMP A;  3M8N A;  3KZQ A;  2FWF A;  3G7Y A;  2LST A;  2MYG A;  4HU9 A;  2EC4 A;  1B48 A;  4ECI A;  3GTU A;  5IOX A;  2V32 A;  5J4U A;  3O6T A;  5B6M A;  3C7M A;  2H75 A;  1YF1 A;  1PL2 A;  3UMA A;  5B8A A;  2WCI A;  4OWY A;  4GQF A;  3CBU A;  3ZVJ D;  4KCA A;  2QKE A;  4O32 A;  3GST A;  2IIY A;  5CNW A;  2BTO T;  4MF7 A;  5DAK A;  1F6M C;  4EDZ A;  2VCX A;  4GQC A;  4BVX A;  1NHY A;  4XCS A;  4ZL9 A;  3VWX A;  1UN2 A;  3IPZ A;  1KTE A;  1XWB A;  3ERF A;  3OR5 A;  4GF0 A;  2H19 A;  4HS1 A;  4RUV A;  3IHQ A;  1OE8 A;  1F9M A;  4KDY A;  5C04 A;  4IQ1 A;  1U88 A;  4WET A;  1A24 A;  3HCZ A;  3F3R A;  4TR1 B;  3NIV A;  2C3N A;  5IOW A;  4NXI A;  4K7I A;  4HUA A;  2P0G A;  5CRD A;  3R2Q A;  4JR4 A;  4NPB A;  4GWR A;  2L4C A;  1FW1 A;  2FWH A;  1ZGN A;  4IBP A;  5C00 A;  4X0X A;  4DSQ A;  1OKT A;  1JLW A;  1TRU A;  3GH9 A;  4JU5 A;  1LBK A;  3FHK A;  5GST A;  4MF5 A;  5B8B A;  3A3T A;  3KP8 A;  1MTC A;  3KTL A;  4J57 E;  4N0Z A;  4O7H A;  2LJA A;  4IEL A;  3VLN A;  4PUA A;  4POK A;  4ECB A;  2C8U A;  2LS5 A;  2WB9 A;  3LFL A;  2FY6 A;  2VLT A;  2XBI A;  1U3I A;  3F63 A;  3M9J A;  3TJB A;  2YOI A;  2C0E A;  4HEA 2;  1TRS A;  2VO4 A;  2V6O A;  2MMN A;  1AQW A;  2HXK A;  1FOV A;  5CRH A;  5FHI A;  5IMD A;  1GUH A;  4DEJ A;  4KSM A;  2LRN A;  5ECI B;  2DJ2 A;  4KH7 A;  1EOG A;  3QR6 A;  4IN0 A;  5H5Q A;  1TRW A;  2H0I A;  3MNG A;  4TKY A;  6GSW A;  1SU9 A;  1K0O A;  2NBS A;  4ISD A;  2GSQ A;  1TTZ A;  3ZTL A;  2YP6 A;  3KIJ A;  4IJI A;  3AY8 A;  1TJD A;  1GSS A;  1F3B A;  5JWQ B;  3LXZ A;  3HA9 A;  2NPB A;  2R4V A;  2CAQ A;  3LJR A;  3DML A;  2CX4 A;  2HRN A;  4ACS A;  1SD9 A;  4NMU A;  3PR8 A;  3PGT A;  3L4N A;  1SJI A;  3GSS A;  1F2E A;  4XRD A;  2P5R A;  4FO5 A;  1GRX A;  2IFQ B;  1O8X A;  4TR4 A;  2K8V A;  3O76 A;  4TR1 A;  4AGS A;  3GRX A;  3H1N A;  2AUV A;  1ZMA A;  5H5R A;  2REM A;  4AJ6 A;  2O7K A;  5KN0 A;  4L8E A;  1GUK A;  1THO A;  16GS A;  4FYB A;  3FRC A;  5DVB A;  4MJE A;  4EO3 A;  4KCE A;  1E6B A;  1FB6 A;  2OE0 A;  4IJ3 A;  2C0G A;  3BOA A;  3P2A A;  3GH6 A;  2AJQ B;  2HSH A;  3RBT A;  2FCH A;  2L5L A;  4HU7 A;  2RM5 A;  3TKS E;  4HQZ A;  1A23 A;  1T8E B;  1B9Y C;  4ZB6 A;  1TW9 A;  2R2J A;  1K3L A;  1JFU A;  1X5C A;  3I9V 2;  2A2S A;  1Y25 A;  4IS0 A;  1XW9 A;  1EWX A;  4V2M A;  1CQG A;  4BA7 A;  4ILF A;  4XHM A;  1MD3 A;  3LQ7 A;  5CRG A;  1KNG A;  3QOU A;  5AIS A;  2PPT A;  1WOU A;  2I81 A;  2PMT A;  2HFD A;  4BWQ A;  4MPF A;  4Q5N A;  1AQX A;  4WF5 A;  3ZYW A;  1QGV A;  1QFN A;  2G0F A;  2GT5 A;  4LA1 A;  3BBY A;  5EY6 A;  4N10 A;  5A4V A;  11GS A;  2GDR A;  3J7Y k;  4IP6 A;  4KA0 A;  2LNT A;  1ERW A;  3IBH A;  4JRR A;  2E2G A;  3H93 A;  3PIN A;  4O92 A;  2IFQ A;  1EV9 A;  5G1L A;  1Z6M A;  1M2D A;  3BD2 A;  3G7J A;  4AF2 A;  2KHP A;  1SKW B;  3L9V A;  1VF2 A;  3QAW A;  3QFB C;  1K0M A;  3F6D A;  3WGD A;  1K3Y A;  3N5O A;  2KUC A;  4I5Q A;  3M0F A;  5F05 A;  4TXV A;  4L0W A;  4HDE A;  2MZC A;  2WRT A;  4RQR A;  1Z9H A;  2PWJ A;  3FR9 A;  3VWV A;  3QAG A;  4IHU A;  2DLX A;  3CXG A;  2B5E A;  3HJP A;  1VGL A;  2C0D A;  1BG5 A;  5D9W A;  3EUR A;  4N11 A;  5A4W A;  2VUP A;  3HY2 A;  2H66 A;  4AJ7 A;  1FG4 A;  2HSY A;  2VL2 A;  3LEF A;  3L9S A;  2HZE B;  3QFA C;  5ECR B;  19GS A;  2L59 A;  2PGT A;  4F2I A;  2JAC A;  3W6G A;  4OFN A;  3KMN A;  1XOA A;  4I2U A;  4NV2 A;  4I6X A;  4I8B A;  2RM6 A;  1Z6N A;  1VF1 A;  3A2X A;  5ECK B;  5KEJ A;  3FYG A;  4ZL7 A;  1F3A A;  4KX4 A;  2YN1 A;  2JU5 A;  2F9S A;  3NZN A;  2CZ2 A;  3E9J B;  2GZZ A;  4ID0 A;  1HNA A;  2JSZ A;  5DJL A;  3IAM 2;  2VOC A;  3L9U A;  2V2G A;  4MJB A;  4LMV A;  2YWI A;  4XRA A;  4YAV A;  1SJ6 A;  2AHE A;  4IP1 A;  2F3M A;  1R7H A;  7GSS A;  4QL9 A;  2FA8 A;  4N30 A;  2E2M A;  2IMF A;  4ZB8 A;  2ZCT A;  2H70 A;  3I6A A;  3KCM A;  1O81 A;  2EIR A;  6GSS A;  1DBY A;  1USB A;  4HQS A;  1A8L A;  3TKP A;  2C3T A;  3VK9 A;  4JR6 A;  3TJJ A;  5ECL B;  4KDU A;  4MAB A;  2FUG 2;  3LG6 A;  4HJ2 A;  2GSR A;  4K1F A;  5HFK A;  4K0G A;  4GST A;  3GUR A;  2FNO A;  3KEB A;  1N8J A;  1A2L A;  4LLR A;  3VUR A;  3GN3 A;  1NHO A;  3UIW A;  1SKR B;  2B7J A;  1TI3 A;  2I9H A;  4DSR A;  4YQM A;  4PX1 A;  4F82 A;  1V2A A;  3GX8 A;  1TRV A;  4IW9 A;  4K0N A;  4Z7X A;  3HXS A;  4RI7 A;  4PQI A;  2HZE A;  1PMT A;  3F8U A;  1QK8 A;  2H74 A;  20GS A;  1I5G A;  2YZH A;  3D6I A;  2M72 A;  5B7C A;  1PD2 1;  4K7N A;  5ABR A;  2LQO A;  3DEX A;  1MDJ A;  1GL8 A;  2LJR A;  3WT1 A;  5FWG A;  2GLR A;  3RPP A;  3DRN A;  3IV4 A;  2H1B A;  4WKW A;  2JZT A;  1PL1 A;  3E3E A;  2ZNM A;  4JBB A;  2F8F A;  4ECC A;  2DIY A;  1M0U A;  3BJ5 A;  3VPT A;  1WJK A;  5DAL B;  1GUM A;  3FR6 A;  5DDL A;  1GNE A;  1N2A A;  2VM1 A;  3ED3 A;  4YQU A;  5LD0 A;  3GL5 A;  2VCW A;  2BJX A;  5AIX A;  3VI7 A;  2FWE A;  4OO5 A;  1XWG A;  3GKK A;  2H01 A;  2E0Q A;  1B9X C;  5IMA A;  2O85 A;  2I1U A;  4TW5 A;  1K0C A;  5CO3 A;  2B1K A;  2K8S A;  4OMV A;  4L5O A;  1K0D A;  2NDO A;  2YJH A;  4O5R A;  5B6N A;  5ENU A;  4POB A;  1QUW A;  1YF0 A;  2L6C A;  3C71 A;  3LSZ A;  4NWY A;  1YZX A;  5F06 A;  3TDG A;  1VF4 A;  4PXO A;  2IME A;  2CAI A;  2H0G A;  3HKR A;  3G7I A;  1AIU A;  1RQM A;  2LV3 A;  1S3C A;  2DJ1 A;  2CVD A;  2JZS A;  1YJ6 A;  4GRF A;  3US3 A;  4KAE A;  1PKW A;  4CDO A;  3M9K A;  1G0T A;  5ECH B;  2PVQ A;  2KLX A;  3P8W A;  4K8M A;  1W4V A;  1O73 A;  1TU7 A;  3UJ1 A;  1XZO A;  5HR0 A;  1EEM A;  2CA8 A;  2GZP A;  5JCU A;  2H1G A;  2LEG A;  1HD2 A;  2FGX A;  2PN8 A;  2R3X A;  3CTG A;  3Q18 A;  4MZW A;  1SEN A;  4RQX A;  3DVW A;  3H79 A;  4NHZ A;  2L6D A;  5F0G A;  2R37 A;  2VLU A;  2YJ7 A;  4WBJ A;  2H1D A;  5A4U A;  3ZML A;  3TRP A;  1ABA A;  1GNW A;  3KJY A;  2OJL A;  1AUC A;  3ME7 A;  2F51 A;  4WEY A;  2DML A;  1YKC A;  3EU3 A;  4OFM A;  3P7X A;  4DVC A;  2H76 A;  5A5K A;  2VLV A;  1ERV A;  3GKM A;  2DMM A;  3HJO A;  1ST9 A;  3F4S A;  4I97 A;  3KMO A;  4NAX A;  3IR4 A;  1M7T A;  4ML6 A;  4EVM A;  3N9J A;  4NV5 A;  3TJK A;  9GSS A;  4F0C A;  4YAP A;  3RDW A;  3Q74 A;  2VCZ A;  10GS A;  2IN3 A;  2GQL A;  3HD5 A;  5HR3 A;  1OKD A;  2IL3 A;  5HQP A;  3WYW A;  1EP8 A;  2HE3 A;  1Z7R A;  2CT6 A;  5DJM A;  1J0F A;  1Y6E A;  1UA5 A;  5IMV A;  1CQH A;  1SL1 B;  1EGO A;  5ELA A;  4BPY A;  4EC0 A;  4K2D A;  3MDK A;  3TKS C;  2L57 A;  3F4T A;  1MD4 A;  2PBJ A;  2ES7 A;  4YH2 A;  3GIX A;  1NM3 A;  1S3A A;  3DYR A;  1WE0 A;  3LOR A;  1A8Y A;  2H6X A;  6GST A;  1SD8 A;  2LKU A;  5G31 A;  2HI7 A;  1TDI A;  2CV4 A;  3ZIJ A;  3G9B A;  2AV4 A;  2B3S A;  2LRC A;  2MBS A;  3L0H A;  5KN1 A;  5HFI A;  3HDC A;  1BYE A;  1W89 A;  3CSJ A;  1ZOF A;  3UVH A;  2OBK A;  1YDK A;  3ZRE A;  5JWR B;  5LNK e;  5D9X A;  3MSZ A;  1GTB A;  2PER A;  1OVN A;  1G6W A;  2X64 A;  4PQH A;  1EV4 A;  1T7P B;  2H0H A;  1A0F A;  3TOT A;  3QDN A;  4HOJ A;  1YY7 A;  2AAW A;  5CYY A;  2B7K A;  4EUY A;  1GSF A;  3WT2 A;  2HYX A;  4MH3 A;  1TP9 A;  4E8E A;  1M2A A;  4ML1 A;  5COH A;  2LUS A;  1R5P A;  1X5E A;  2CQ9 A;  4JE1 A;  4BVY A;  1Q98 A;  2O8V B;  2OKA A;  3C73 A;  5J41 A;  3ZVJ A;  4V1A p;  2MMA A;  3CSH A;  2K6V A;  2DJ0 A;  2LRT A;  3Q6O A;  2A2R A;  3ERG A;  1GP1 A;  2VCQ A;  3GKX A;  1AW9 A;  2OE3 A;  1T4Z A;  2I3Y A;  5D8I A;  3F4R A;  3UEM A;  1PSQ A;  1NW2 A;  3WGE A;  4DSS B;  4MPG A;  4MMM A;  3CMI A;  2GQK A;  1FAA A;  2OAC A;  4N0V A;  1GH2 A;  5J9C A;  4XS6 A;  5ECP B;  1WRY A;  4MH2 A;  3GYK A;  1XWC A;  1EZK A;  3UAR A;  5J9B A;  1JHB A;  4HZ2 A;  3CSI A;  2XPD A;  1B8X A;  1O85 A;  2OA7 A;  1U3A A;  4EE0 A;  1X9S B;  3FZ4 A;  1YQ1 A;  2WFC A;  3V1W A;  3QMX A;  1GSE A;  5INY A;  3M3M A;  1OC3 A;  3RHC A;  5F8B A;  2GT6 A;  4K6X A;  4MZC A;  2N5A A;  4XS4 B;  2H8L A;  1ERT A;  3LYP A;  1G7O A;  4OD7 A;  5ECN B;  4KSO A;  2OBI A;  5ID2 B;  2B5Y A;  3FZA A;  1Q4J A;  1TU8 A;  3EWL A;  2XBQ A;  4ZXG A;  2QC7 A;  2H1A A;  5D9V A;  3ZL5 A;  2R5G A;  3P90 A;  3QAV A;  2FWG A;  2PU9 C;  4KB3 A;  3IDV A;  3LYK A;  3GFK A;  3CYN A;  1J08 A;  3VFI A;  1IYI A;  2YCD A;  4EL1 A;  3Q19 A;  1ZYE A;  4E8H A;  2RUE A;  4G2E A;  4OO4 A;  2QSI A;  2DSA A;  3FZ5 A;  1BJX A;  5IMF A;  4MK3 A;  4MJC A;  1GLQ A;  1B4Q A;  3IXR A;  4K9Z A;  4XIH A;  22GS A;  4BL7 A;  4P3Y B;  5KN2 A;  3EU4 A;  5AN1 A;  3C1S A;  4DSS A;  4XS1 A;  5IM9 A;  1FB0 A;  2C0F A;  2I4A A;  3W8J A;  3EIN A;  4Q5R A;  3D0Z A;  3C8E A;  5IPG A;  4ZBB A;  1XFL A;  3CRT A;  3KXO A;  1UC7 A;  4OCE A;  1SL0 B;  1VRS D;  1FVK A;  2DIZ A;  2H72 A;  1RW1 A;  1JLV A;  2IMK A;  6GSX A;  2QGV A;  2V41 A;  3L78 A;  3WD6 A;  3GTU B;  5CAX A;  1MDI A;  4PUF C;  3QD9 A;  5G30 A;  4OFT A;  3GHA A;  2X99 A;  2N5B A;  2K9F A;  3FKF A;  3WGX A;  1HYU A;  2B6M A;  2H6Y A;  3VI5 A;  1GSU A;  3HYP A;  3UBL A;  2V1M A;  3ERW A;  5ID2 A;  2LQQ A;  2XPE A;  2Z9S A;  5G1K A;  13GS A;  4KUN A;  5E59 A;  1GSQ A;  1ZCP A;  1X9W B;  3IRA A;  1H4O A;  1TK8 B;  3GL3 A;  4EDY A;  5D9T A;  2FD3 A;  1MEK A;  3APO A;  4PUR A;  3DIE A;  5EPF A;  3MWH A;  5GAN D;  3IOS A;  3TJG A;  2EIO A;  4H86 A;  3UVT A;  2JZR A;  1BAY A;  2L4Q A;  1XOB A;  3TJF A;  1BQ7 A;  2FA4 A;  1JZR A;  4MCU A;  1XBS A;  4ZL8 A;  1XVW A;  2KP2 A;  5ECO B;  2O87 A;  1C72 A;  1GTI A;  2XHF A;  4QL7 A;  4ZBD A;  3LXT A;  2YV7 A;  1BX9 A;  4LL4 B;  1EEJ A;  17GS A;  5ECS A;  3ZMK A;  1WMJ A;  4L0U A;  3TRX A;  1PN9 A;  3GA4 A;  3VWU A;  3IE3 A;  3APQ A;  3IC4 A;  1V40 A;  1VF3 A;  1F37 A;  1V58 A;  4F9Z A;  1XPV A;  3RAZ A;  4WR4 A;  5D73 A;  4KND A;  2H30 A;  5JCW A;  3F3Q A;  5DQY A;  2ON7 A;  5DCH A;  1OYJ A;  3TCO A;  1YEP A;  2DBC A;  2D2Z A;  1ML6 A;  1QXH A;  2C1Y A;  5J3R A;  3D5J A;  1O6J A;  1PQN A;  4F03 A;  1SJZ A;  1JZD A;  1TOF A;  5IQY A;  4ZBA A;  1PX6 A;  3H8Q A;  1A0R P;  3M1G A;  3D22 A;  1GLP A;  2O89 A;  3TOU A;  2E7P A;  5E4W A;  2H71 A;  1FO5 A;  1V9W A;  3J7Y b;  1MDK A;  5GSS A;  1A2J A;  3GKN A;  3QCP A;  2X8C A;  4MP4 A;  5F07 A;  1QQ2 A;  2V6K A;  4IQA A;  3IAS 2;  3HVV A;  3F0I A;  3A2W A;  2L5O A;  1THX A;  1FVJ A;  3TKS A;  1PGT A;  4RI6 A;  4ZB9 A;  1WPI A;  4F0B A;  1G6Y A;  1T00 A;  2RII A;  3VWW A;  2IMD A;  5DAL A;  3A2V A;  4WXT A;  5JWO B;  4KE3 A;  1XWK A;  2VD1 A;  1M99 A;  1AC1 A;  1GSY A;  2C80 A;  3APS A;  3EMX A;  1G7E A;  2LTK A;  1SL2 B;  4V2L A;  2FHE A;  3HVS A;  2HRF A;  2CVK A;  1TI1 A;  2X8H A;  5GZZ B;  3O3T A;  1ACV A;  2YAN A;  1T4Y A;  4G19 A;  3U5R E;  3ZFB A;  3HZ8 A;  3KD0 A;  5IPH A;  5DCG A;  4TR0 A;  2B5X A;  4EF0 A;  1XWA A;  1KBN A;  2VCT A;  4V2N A;  1JZO A;  4QQ7 A;  3KP9 A;  1GSD A;  1AQV A;  1K0B A;  1Z5Y E;  5CRE A;  3ZLP A;  1GTA A;  3HVX A;  3VPQ A;  2YWM A;  5IO0 A;  5ECM B;  1K3O A;  1WWJ A;  2B1L A;  1X0R A;  1GWC A;  1ZYQ B;  4WF4 A;  4JZQ A;  5G5E A;  2IJY A;  3S9F A;  1WP0 A;  2R6K A;  2FLS A;  5IMZ A;  4ZIJ A;  1DE2 A;  4G10 A;  2ON5 A;  1OAZ A;  4POM A;  1SK1 A;  5KN3 A;  5D96 A;  5DBQ A;  2NTO A;  3KTB A;  5CP1 A;  1U87 A;  3EC3 A;  4Q5Q A;  3TB2 A;  4IKH A;  1OC9 B;  2ZUP A;  4GCI A;  1RK4 A;  2HZF A;  3ZZX A;  1IYH A;  1GUL A;  2RLI A;  1NSW A;  3SBC A;  1B4P A;  2C4J A;  5J5N A;  4K7O A;  1EP7 A;  2GSS A;  3A5W A;  3HZ4 A;  3ZIT A;  3GNJ A;  1XVQ A;  5LCZ A;  2MMZ A;  3GX0 A;  2J23 A;  2DJJ A;  3UAP A;  1T1V A;  3I69 A;  6GSU A;  5ECQ B;  2TRC P;  1PKZ A;  4EKZ A;  2JAD A;  5D93 A;  2C3Q A;  1K0N A;  3EE2 A;  1R26 A;  2M46 A;  1WIK A;  3CRU A;  4EXJ A;  1ON4 A;  1XCC A;  1SK0 A;  2VL3 A;  2EIQ A;  3DKS A;  4IGJ A;  3DGQ A;  2G2Q A;  2TIR A;  1K0A A;  4HJM A;  2GGT A;  2WUL A;  4Q5F A;  3C1R A;  3TKR A;  2GVP A;  4X43 A;  3D21 A;  3IK9 A;  5EVO A;  4YQV A; 
#chains in the Genus database with same CATH topology
 3RHB A;  2MMO A;  3HHV A;  3ZIV A;  1SKS B;  3KH9 A;  4FIW A;  2AYT A;  3ME8 A;  1ERU A;  2F8A A;  3BCK A;  4GTU A;  2HNL A;  1YEX A;  1HQO A;  1SYR A;  4L5L A;  4PQ1 A;  2MBT A;  4FH8 A;  2VCV A;  4MDC A;  1TK0 B;  3UL3 A;  1PRX A;  1AAZ A;  4J2F A;  3RPN A;  8GSS A;  1I9D A;  2PVO C;  4PTS A;  4MF6 A;  4FYU A;  2WJU A;  3BCI A;  1DUG A;  4ECJ A;  1OC9 A;  2KP1 A;  1XW6 A;  3UOM A;  1O7U A;  3DXB A;  4GSN A;  2WZ9 A;  4TN8 A;  2WS2 A;  3FW2 A;  4KDX A;  3DWV A;  1XXU A;  3F9U A;  2DJK A;  1E2Y A;  2NVL A;  5IIZ A;  1TK5 B;  2LJK A;  2X8G A;  1KEB A;  1GTU A;  3E0U A;  4MZB A;  4POL A;  1URM A;  3HJM A;  4MJA A;  2GQM A;  3UBK A;  1Z3E A;  2QA1 A;  2A4V A;  2P31 A;  3H4K A;  2N5F A;  1V57 A;  2PUK C;  1V98 A;  2J9H A;  3MIX A;  4I2T A;  2CZ3 A;  4NHW A;  3ZRD A;  5DQS A;  3FK8 A;  4Z2U A;  5L71 A;  4MNN A;  3PH9 A;  1TXX A;  1T3B A;  4TOP A;  1OE7 A;  4ZIL A;  4TXO B;  1O8W A;  2OAD A;  1M3I A;  2H6Z A;  5JCG A;  4V1A g;  2A2P A;  4Z2T A;  3K8N A;  1M2B A;  5EL8 A;  2YWO A;  1J9B A;  2GTU A;  4D73 B;  4USS A;  5GAP D;  3TRQ A;  4G0K A;  3FY7 A;  5G2Z A;  2GS3 A;  1U6T A;  3IA1 A;  3EYT A;  4TVE A;  3IK7 A;  1M9B A;  1SK2 A;  1XW5 A;  4X1U A;  3DVX A;  2YWN A;  3D4T A;  4TRX A;  3ZFL A;  1BED A;  3PPU A;  3FR3 A;  2YV9 A;  3JCM L;  3TUE A;  1DSB A;  2IWT A;  6GSY A;  4WBR D;  2WGR A;  1ZZY A;  4HI7 A;  3FEU A;  3KGK A;  3QPM A;  4PNF A;  2IMI A;  1HNC A;  1H75 A;  5AIV A;  1PA3 A;  5HR2 A;  4OCF A;  5H5S A;  4PGT A;  1M9A A;  3IHG A;  4PNG A;  2TRX A;  1YKA A;  1AXD A;  3LGC A;  4JED A;  2XC2 A;  3MAK A;  2OE1 A;  3W8S A;  4TR3 A;  2VD0 A;  3TGZ A;  3NOF A;  2DC5 A;  1EGR A;  3CTF A;  4XS4 A;  5AGY A;  4GXZ A;  4J56 E;  1SYX A;  1Z7P A;  2UZ8 A;  2VL9 A;  4CW9 A;  1UVZ A;  2YPM A;  2ALB A;  3F6F A;  2IPA A;  2KOK A;  5FT3 A;  5DAK B;  1PX7 A;  3LWA A;  4BVX B;  2VIM A;  4WR5 A;  4IVF A;  2BMX A;  3FZ9 A;  2VM2 A;  1DE1 A;  4AJ8 A;  18GS A;  3ISO A;  5CRW A;  14GS A;  2VL2 C;  1LJR A;  1HNB A;  2AB6 A;  1LU4 A;  3MYD A;  2WDU A;  3I43 A;  4BWS A;  1X9M B;  4TXO A;  4LL1 B;  2HLS A;  1R5A A;  2K18 A;  4G9H A;  4LMW A;  4KW6 A;  1X5D A;  2JL4 A;  2DJ3 A;  3GMF A;  2JSY A;  4D73 A;  2P5Q A;  3SWL A;  5IO2 A;  1TKD B;  2HT9 A;  4CHS A;  3DD3 A;  5HR1 A;  1XIY A;  6GSV A;  4KGI A;  2GST A;  4FYC A;  3GV1 A;  1ZL9 A;  2CX3 A;  1QMV A;  2VAF A;  1EOH A;  3KH7 A;  2CVB A;  2LNS A;  4HZ4 A;  3D4M A;  1OC8 A;  3EVI A;  2YZU A;  1R4W A;  4ULX A;  2GZY A;  2H73 A;  2M80 A;  1FHE A;  5G5F A;  12GS A;  4MLY A;  4XTS A;  5ELG A;  5HFG A;  5IMC A;  1A2M A;  1JZW A;  3U6V A;  3KM6 A;  3TKQ A;  4GSS A;  1ILO A;  2YNX A;  2RUF A;  1S3D A;  3GUS A;  4MA9 A;  4GLT A;  3EMP A;  3M8N A;  3KZQ A;  2FWF A;  3G7Y A;  2LST A;  2MYG A;  4HU9 A;  2EC4 A;  1B48 A;  4ECI A;  3GTU A;  5IOX A;  2V32 A;  5J4U A;  3O6T A;  5B6M A;  3C7M A;  2H75 A;  1YF1 A;  1PL2 A;  3UMA A;  5B8A A;  2WCI A;  4OWY A;  4GQF A;  3CBU A;  3ZVJ D;  4KCA A;  2QKE A;  4O32 A;  3GST A;  2IIY A;  5CNW A;  2BTO T;  4MF7 A;  5DAK A;  1F6M C;  4EDZ A;  2VCX A;  4GQC A;  4BVX A;  1NHY A;  4XCS A;  4ZL9 A;  3VWX A;  1UN2 A;  3IPZ A;  1KTE A;  1XWB A;  3ERF A;  3OR5 A;  4GF0 A;  2H19 A;  4HS1 A;  4RUV A;  3IHQ A;  1OE8 A;  1F9M A;  4KDY A;  5C04 A;  4IQ1 A;  1U88 A;  4WET A;  1A24 A;  3HCZ A;  3F3R A;  4TR1 B;  3NIV A;  2C3N A;  5IOW A;  4NXI A;  4K7I A;  4HUA A;  2P0G A;  5CRD A;  3R2Q A;  4JR4 A;  4NPB A;  4GWR A;  2L4C A;  1FW1 A;  2A4H A;  2FWH A;  1ZGN A;  4IBP A;  5C00 A;  4X0X A;  4DSQ A;  1OKT A;  1JLW A;  1TRU A;  3GH9 A;  4JU5 A;  1LBK A;  3FHK A;  5GST A;  4MF5 A;  5B8B A;  3A3T A;  3KP8 A;  1MTC A;  3KTL A;  4J57 E;  4N0Z A;  4O7H A;  2LJA A;  4IEL A;  3VLN A;  4PUA A;  4POK A;  4ECB A;  2C8U A;  2HRA A;  2LS5 A;  2WB9 A;  3LFL A;  2FY6 A;  2VLT A;  2XBI A;  1U3I A;  3F63 A;  3M9J A;  3TJB A;  2YOI A;  2C0E A;  4HEA 2;  1TRS A;  2VO4 A;  2V6O A;  2MMN A;  1AQW A;  2HXK A;  1FOV A;  5CRH A;  5FHI A;  5IMD A;  1GUH A;  4DEJ A;  4KSM A;  2LRN A;  5ECI B;  2DJ2 A;  4KH7 A;  1EOG A;  3QR6 A;  4IN0 A;  5H5Q A;  1TRW A;  2H0I A;  3MNG A;  4TKY A;  6GSW A;  1SU9 A;  1K0O A;  2NBS A;  4ISD A;  2GSQ A;  4YKF A;  1TTZ A;  3ZTL A;  2YP6 A;  3KIJ A;  4IJI A;  3AY8 A;  1TJD A;  1GSS A;  1F3B A;  5JWQ B;  4BVY B;  3LXZ A;  3HA9 A;  2NPB A;  2R4V A;  2CAQ A;  3LJR A;  3DML A;  2CX4 A;  2HRN A;  4ACS A;  1SD9 A;  4NMU A;  3PR8 A;  3PGT A;  3L4N A;  1SJI A;  3GSS A;  1F2E A;  4XRD A;  2P5R A;  4FO5 A;  1GRX A;  2IFQ B;  1O8X A;  4TR4 A;  2K8V A;  3O76 A;  4TR1 A;  4AGS A;  3GRX A;  3H1N A;  2AUV A;  1ZMA A;  5H5R A;  2REM A;  4AJ6 A;  2O7K A;  5KN0 A;  4L8E A;  1GUK A;  1THO A;  16GS A;  4FYB A;  3FRC A;  5DVB A;  4MJE A;  4EO3 A;  4KCE A;  1E6B A;  1FB6 A;  2OE0 A;  4IJ3 A;  2C0G A;  3BOA A;  3P2A A;  3GH6 A;  2AJQ B;  2HSH A;  2QA2 A;  3RBT A;  2FCH A;  2L5L A;  4HU7 A;  2RM5 A;  3TKS E;  4HQZ A;  1A23 A;  1T8E B;  1B9Y C;  4ZB6 A;  1TW9 A;  2R2J A;  1K3L A;  1JFU A;  1X5C A;  3I9V 2;  2A2S A;  1Y25 A;  4IS0 A;  1XW9 A;  1EWX A;  4V2M A;  1CQG A;  4BA7 A;  4ILF A;  4XHM A;  1MD3 A;  3LQ7 A;  5CRG A;  1KNG A;  3QOU A;  5AIS A;  2PPT A;  1WOU A;  2I81 A;  2PMT A;  2HFD A;  4BWQ A;  4MPF A;  4Q5N A;  4YKG A;  1AQX A;  4WF5 A;  3ZYW A;  1QGV A;  1QFN A;  2G0F A;  2GT5 A;  4LA1 A;  3BBY A;  5EY6 A;  3FMW A;  4N10 A;  5A4V A;  11GS A;  2GDR A;  3J7Y k;  4IP6 A;  4KA0 A;  2LNT A;  1ERW A;  3IBH A;  4JRR A;  2E2G A;  3H93 A;  3PIN A;  4O92 A;  2IFQ A;  1EV9 A;  5G1L A;  4CY8 A;  1Z6M A;  1M2D A;  3BD2 A;  4HSC X;  3G7J A;  4AF2 A;  2KHP A;  1SKW B;  1M3J A;  3L9V A;  3LW9 A;  3CQF A;  1VF2 A;  3QAW A;  3QFB C;  1K0M A;  3F6D A;  3WGD A;  1K3Y A;  3N5O A;  2KUC A;  4I5Q A;  3M0F A;  5F05 A;  4TXV A;  4L0W A;  4HDE A;  2MZC A;  2WRT A;  4RQR A;  1Z9H A;  2PWJ A;  3FR9 A;  3VWV A;  3QAG A;  4IHU A;  4BIK A;  2DLX A;  3CXG A;  2B5E A;  3HJP A;  1VGL A;  2C0D A;  1BG5 A;  5D9W A;  3EUR A;  4N11 A;  5A4W A;  2VUP A;  3HY2 A;  2H66 A;  4AJ7 A;  1FG4 A;  2HSY A;  2VL2 A;  3LEF A;  3L9S A;  2HZE B;  3QFA C;  5ECR B;  19GS A;  2L59 A;  2PGT A;  4F2I A;  2JAC A;  4EIQ A;  3W6G A;  4OFN A;  3KMN A;  1XOA A;  4I2U A;  4NV2 A;  4I6X A;  4I8B A;  2RM6 A;  1Z6N A;  1VF1 A;  3A2X A;  5ECK B;  5KEJ A;  3FYG A;  4ZL7 A;  1F3A A;  4KX4 A;  2YN1 A;  2JU5 A;  2F9S A;  3NZN A;  2CZ2 A;  3E9J B;  2GZZ A;  4ID0 A;  1HNA A;  2JSZ A;  5DJL A;  3IAM 2;  2VOC A;  3L9U A;  2V2G A;  4MJB A;  4LMV A;  2YWI A;  4XRA A;  4YAV A;  1SJ6 A;  2AHE A;  4IP1 A;  2F3M A;  1R7H A;  7GSS A;  4QL9 A;  2FA8 A;  4N30 A;  2E2M A;  2IMF A;  4ZB8 A;  2ZCT A;  2H70 A;  3I6A A;  3KCM A;  1O81 A;  2EIR A;  6GSS A;  1DBY A;  1USB A;  4HQS A;  1A8L A;  3TKP A;  2DKH A;  2C3T A;  3VK9 A;  4JR6 A;  3TJJ A;  5ECL B;  4KDU A;  4MAB A;  2FUG 2;  1ZYN A;  3LG6 A;  4HJ2 A;  2GSR A;  4K1F A;  5HFK A;  4K0G A;  4GST A;  3GUR A;  2FNO A;  3KEB A;  1N8J A;  1A2L A;  4X4J A;  1FOH A;  4LLR A;  3VUR A;  3GN3 A;  1NHO A;  3UIW A;  3A5I A;  1SKR B;  2B7J A;  1TI3 A;  2I9H A;  4DSR A;  4YQM A;  4PX1 A;  4F82 A;  1V2A A;  5KOX A;  3GX8 A;  1TRV A;  4IW9 A;  4K0N A;  4Z7X A;  3HXS A;  4RI7 A;  4PQI A;  2HZE A;  1PMT A;  3F8U A;  1QK8 A;  2H74 A;  20GS A;  1I5G A;  2YZH A;  3D6I A;  2M72 A;  5B7C A;  1PD2 1;  4K7N A;  5ABR A;  2LQO A;  3DEX A;  1MDJ A;  2R0G A;  1GL8 A;  2LJR A;  3WT1 A;  5FWG A;  2GLR A;  3RPP A;  3DRN A;  3IV4 A;  2H1B A;  4WKW A;  2JZT A;  1PL1 A;  3E3E A;  2ZNM A;  4JBB A;  2F8F A;  4ECC A;  2DIY A;  1M0U A;  3BJ5 A;  3VPT A;  1WJK A;  5DAL B;  1GUM A;  3FR6 A;  5DDL A;  1GNE A;  1N2A A;  4KF9 A;  2VM1 A;  3ED3 A;  4YQU A;  5LD0 A;  3GL5 A;  2VCW A;  2BJX A;  5AIX A;  3VI7 A;  2FWE A;  4OO5 A;  1XWG A;  3GKK A;  2H01 A;  2E0Q A;  1B9X C;  5IMA A;  2O85 A;  2I1U A;  4TW5 A;  1K0C A;  5CO3 A;  2B1K A;  2K8S A;  4OMV A;  4L5O A;  1K0D A;  2NDO A;  2YJH A;  4O5R A;  5B6N A;  5ENU A;  4POB A;  1QUW A;  1YF0 A;  2L6C A;  3C71 A;  3LSZ A;  4NWY A;  1YZX A;  5F06 A;  3TDG A;  1VF4 A;  4PXO A;  2IME A;  2CAI A;  2H0G A;  3HKR A;  3G7I A;  1AIU A;  1RQM A;  2LV3 A;  1S3C A;  2DJ1 A;  2CVD A;  2HRK A;  2JZS A;  1YJ6 A;  4GRF A;  3US3 A;  4KAE A;  1PKW A;  4CDO A;  3M9K A;  1G0T A;  5ECH B;  2PVQ A;  2KLX A;  3P8W A;  4K8M A;  1W4V A;  1O73 A;  1TU7 A;  3UJ1 A;  1XZO A;  5HR0 A;  1EEM A;  2CA8 A;  2GZP A;  5JCU A;  2H1G A;  2LEG A;  1HD2 A;  2FGX A;  4K2X A;  2PN8 A;  2R3X A;  3CTG A;  3Q18 A;  4ICY A;  4MZW A;  1SEN A;  4RQX A;  3DVW A;  3H79 A;  4NHZ A;  2L6D A;  5F0G A;  2R37 A;  2VLU A;  2YJ7 A;  4WBJ A;  2H1D A;  5A4U A;  3ZML A;  3TRP A;  1ABA A;  1GNW A;  3HVN A;  2OJL A;  3KJY A;  1AUC A;  3ME7 A;  2F51 A;  4WEY A;  2DML A;  1YKC A;  3EU3 A;  4OFM A;  3P7X A;  4DVC A;  2H76 A;  5A5K A;  2VLV A;  1ERV A;  3GKM A;  2DMM A;  3HJO A;  1ST9 A;  3F4S A;  4I97 A;  3KMO A;  4NAX A;  3IR4 A;  1M7T A;  4ML6 A;  4EVM A;  3N9J A;  4NV5 A;  3TJK A;  9GSS A;  4F0C A;  4YAP A;  3RDW A;  3Q74 A;  2VCZ A;  10GS A;  2IN3 A;  2GQL A;  3HD5 A;  5HR3 A;  1OKD A;  2IL3 A;  5HQP A;  3WYW A;  1EP8 A;  2HE3 A;  1Z7R A;  2CT6 A;  5DJM A;  1J0F A;  1Y6E A;  1UA5 A;  5IMV A;  1CQH A;  1SL1 B;  1EGO A;  5ELA A;  4BPY A;  4EC0 A;  4K2D A;  3MDK A;  3TKS C;  2L57 A;  3F4T A;  1MD4 A;  2PBJ A;  2ES7 A;  4YH2 A;  3GIX A;  1NM3 A;  1S3A A;  3DYR A;  1WE0 A;  3LOR A;  1A8Y A;  2H6X A;  6GST A;  1SD8 A;  2LKU A;  5G31 A;  2HI7 A;  1TDI A;  1PN0 A;  2CV4 A;  3ZIJ A;  3G9B A;  2AV4 A;  2B3S A;  2LRC A;  2MBS A;  3L0H A;  5KN1 A;  5HFI A;  3HDC A;  1BYE A;  1W89 A;  3CSJ A;  1ZOF A;  3UVH A;  2OBK A;  1YDK A;  3ZRE A;  5JWR B;  5LNK e;  5D9X A;  4A5P A;  3MSZ A;  1GTB A;  2PER A;  1OVN A;  1G6W A;  2X64 A;  4PQH A;  1EV4 A;  2X49 A;  1T7P B;  2H0H A;  1A0F A;  3TOT A;  3QDN A;  4HOJ A;  1YY7 A;  2AAW A;  5CYY A;  2B7K A;  4EUY A;  1GSF A;  3WT2 A;  2HYX A;  4MH3 A;  1TP9 A;  4E8E A;  1M2A A;  4ML1 A;  5COH A;  2LUS A;  1R5P A;  1X5E A;  2CQ9 A;  4JE1 A;  4BVY A;  1Q98 A;  2O8V B;  2OKA A;  3C73 A;  5J41 A;  3ZVJ A;  4V1A p;  2MMA A;  1XG8 A;  3CSH A;  2K6V A;  2DJ0 A;  2LRT A;  3Q6O A;  2A2R A;  3ERG A;  1GP1 A;  2VCQ A;  3GKX A;  1AW9 A;  2OE3 A;  1T4Z A;  2I3Y A;  5D8I A;  3F4R A;  3UEM A;  4BL7 B;  1PSQ A;  1NW2 A;  3WGE A;  4DSS B;  4MPG A;  4MMM A;  3CMI A;  2GQK A;  1FAA A;  2OAC A;  4N0V A;  1GH2 A;  5J9C A;  4XS6 A;  5ECP B;  1WRY A;  4MH2 A;  3GYK A;  1XWC A;  4K5R A;  1EZK A;  3UAR A;  5J9B A;  1JHB A;  4HZ2 A;  3CSI A;  4O5Q A;  2XPD A;  1B8X A;  1O85 A;  2OA7 A;  1U3A A;  4EE0 A;  1X9S B;  3FZ4 A;  1YQ1 A;  2WFC A;  3V1W A;  3QMX A;  1GSE A;  5INY A;  3M3M A;  1OC3 A;  3RHC A;  5F8B A;  2R0C A;  2GT6 A;  4K6X A;  4MZC A;  2N5A A;  4XS4 B;  2H8L A;  1ERT A;  3LYP A;  1G7O A;  2DKI A;  4OD7 A;  5ECN B;  4KSO A;  2OBI A;  5ID2 B;  2B5Y A;  3FZA A;  4FQU A;  1Q4J A;  1TU8 A;  2HSM A;  3EWL A;  2XBQ A;  4ZXG A;  2QC7 A;  2H1A A;  5D9V A;  3ZL5 A;  2R5G A;  3P90 A;  3QAV A;  2FWG A;  2PU9 C;  4KB3 A;  3IDV A;  3LYK A;  3GFK A;  3CYN A;  1J08 A;  3VFI A;  1IYI A;  2YCD A;  4EL1 A;  3Q19 A;  1ZYE A;  4E8H A;  2RUE A;  4G2E A;  1ZYP A;  4OO4 A;  2QSI A;  2DSA A;  3FZ5 A;  1BJX A;  5IMF A;  4Z2R A;  4MK3 A;  4MJC A;  1GLQ A;  1B4Q A;  3IXR A;  5KOW A;  4K9Z A;  4XIH A;  22GS A;  4BL7 A;  4P3Y B;  5KN2 A;  3EU4 A;  5AN1 A;  3C1S A;  4DSS A;  4XS1 A;  5IM9 A;  1FB0 A;  2C0F A;  2I4A A;  1PFO A;  3W8J A;  3EIN A;  4Q5R A;  3D0Z A;  4O5U A;  3C8E A;  5IPG A;  4ZBB A;  1XFL A;  3CRT A;  3KXO A;  1UC7 A;  4OCE A;  1SL0 B;  1VRS D;  1FVK A;  2DIZ A;  2H72 A;  1RW1 A;  1JLV A;  2IMK A;  6GSX A;  2QGV A;  2V41 A;  3L78 A;  3WD6 A;  3GTU B;  5CAX A;  1MDI A;  4PUF C;  3QD9 A;  5G30 A;  4OFT A;  3GHA A;  2X99 A;  2N5B A;  2K9F A;  3FKF A;  3WGX A;  1HYU A;  2B6M A;  4EIP A;  2H6Y A;  3VI5 A;  1GSU A;  3HYP A;  3UBL A;  2V1M A;  3ERW A;  5ID2 A;  2LQQ A;  2XPE A;  2Z9S A;  5G1K A;  13GS A;  4KUN A;  5E59 A;  1GSQ A;  1ZCP A;  1X9W B;  3IRA A;  1H4O A;  1TK8 B;  3GL3 A;  4EDY A;  5D9T A;  2R0P A;  2FD3 A;  1MEK A;  3APO A;  5BRT A;  4PUR A;  3DIE A;  5EPF A;  3MWH A;  5GAN D;  3IOS A;  3TJG A;  2EIO A;  4H86 A;  3UVT A;  2JZR A;  1BAY A;  2L4Q A;  1XOB A;  3TJF A;  1BQ7 A;  2FA4 A;  1JZR A;  4MCU A;  1XBS A;  4ZL8 A;  1XVW A;  2KP2 A;  5ECO B;  2O87 A;  1C72 A;  1GTI A;  4G0I A;  2XHF A;  4QL7 A;  4ZBD A;  3LXT A;  2YV7 A;  4CY6 A;  1BX9 A;  4LL4 B;  1EEJ A;  17GS A;  5ECS A;  3ZMK A;  1WMJ A;  4L0U A;  3TRX A;  1PN9 A;  3GA4 A;  3VWU A;  3IE3 A;  3APQ A;  3R3E A;  3IC4 A;  1V40 A;  1VF3 A;  1F37 A;  1V58 A;  4F9Z A;  1XPV A;  3RAZ A;  4WR4 A;  5D73 A;  4KND A;  2H30 A;  5JCW A;  3F3Q A;  5DQY A;  2ON7 A;  5DCH A;  1OYJ A;  3TCO A;  1YEP A;  2DBC A;  2D2Z A;  1ML6 A;  1QXH A;  2C1Y A;  5J3R A;  3D5J A;  1O6J A;  1PQN A;  4F03 A;  1SJZ A;  1JZD A;  1TOF A;  5IQY A;  4ZBA A;  1PX6 A;  3H8Q A;  1A0R P;  3M1G A;  3D22 A;  1GLP A;  2O89 A;  3TOU A;  2E7P A;  5E4W A;  2H71 A;  1FO5 A;  1V9W A;  3J7Y b;  1MDK A;  5GSS A;  1A2J A;  3GKN A;  3QCP A;  2X8C A;  4MP4 A;  5F07 A;  1QQ2 A;  2V6K A;  4IQA A;  3IAS 2;  3HVV A;  3F0I A;  3A2W A;  2L5O A;  1THX A;  1FVJ A;  3TKS A;  1PGT A;  4RI6 A;  3IC8 A;  4ZB9 A;  1WPI A;  4F0B A;  1G6Y A;  1T00 A;  2RII A;  3VWW A;  2IMD A;  5DAL A;  3A2V A;  4WXT A;  5JWO B;  4KE3 A;  1XWK A;  2VD1 A;  1M99 A;  1AC1 A;  1GSY A;  2C80 A;  3APS A;  3EMX A;  1G7E A;  2LTK A;  1SL2 B;  4V2L A;  2FHE A;  3HVS A;  2HRF A;  2CVK A;  1TI1 A;  2X8H A;  5GZZ B;  3O3T A;  1ACV A;  2YAN A;  1T4Y A;  4G19 A;  3U5R E;  3ZFB A;  3HZ8 A;  3KD0 A;  5IPH A;  5DCG A;  4TR0 A;  2B5X A;  4EF0 A;  1XWA A;  1KBN A;  2VCT A;  4V2N A;  1JZO A;  4QQ7 A;  3KP9 A;  1GSD A;  4G0L A;  1AQV A;  1K0B A;  1Z5Y E;  5CRE A;  3ZLP A;  1GTA A;  3HVX A;  3VPQ A;  2YWM A;  5IO0 A;  5ECM B;  1K3O A;  1WWJ A;  2B1L A;  1X0R A;  1GWC A;  3EPT A;  4WF4 A;  1ZYQ B;  4JZQ A;  5G5E A;  2IJY A;  3S9F A;  1WP0 A;  2R6K A;  2FLS A;  5IMZ A;  4ZIJ A;  1DE2 A;  4G10 A;  2ON5 A;  1OAZ A;  4POM A;  1SK1 A;  5KN3 A;  5D96 A;  5DBQ A;  2NTO A;  3KTB A;  5CP1 A;  1U87 A;  5BMU A;  3EC3 A;  4Q5Q A;  3TB2 A;  4IKH A;  1OC9 B;  2ZUP A;  4GCI A;  1RK4 A;  2HZF A;  3ZZX A;  1IYH A;  1GUL A;  2RLI A;  1NSW A;  3SBC A;  1B4P A;  2C4J A;  5J5N A;  4K7O A;  1EP7 A;  2GSS A;  3A5W A;  3HZ4 A;  3ZIT A;  3GNJ A;  1XVQ A;  5LCZ A;  2MMZ A;  3GX0 A;  2J23 A;  2DJJ A;  3UAP A;  1T1V A;  3I69 A;  6GSU A;  5ECQ B;  2TRC P;  1PKZ A;  4EKZ A;  2JAD A;  5D93 A;  2C3Q A;  1K0N A;  3EE2 A;  1R26 A;  2M46 A;  1WIK A;  2X4A A;  4K5S A;  3CRU A;  4EXJ A;  1ON4 A;  1XCC A;  1SK0 A;  2VL3 A;  2EIQ A;  4IGJ A;  3DKS A;  3DGQ A;  1S3R A;  2G2Q A;  2TIR A;  1K0A A;  4HJM A;  2GGT A;  2WUL A;  4Q5F A;  3C1R A;  3TKR A;  2GVP A;  4X43 A;  3D21 A;  3IK9 A;  5EVO A;  4YQV A; 
#chains in the Genus database with same CATH homology
 3RHB A;  2MMO A;  3HHV A;  3ZIV A;  1SKS B;  3KH9 A;  4FIW A;  2AYT A;  3ME8 A;  1ERU A;  2F8A A;  3BCK A;  4GTU A;  2HNL A;  1YEX A;  1HQO A;  1SYR A;  4L5L A;  4PQ1 A;  2MBT A;  4FH8 A;  2VCV A;  4MDC A;  1TK0 B;  3UL3 A;  1PRX A;  1AAZ A;  4J2F A;  3RPN A;  8GSS A;  1I9D A;  2PVO C;  4PTS A;  4MF6 A;  4FYU A;  2WJU A;  3BCI A;  1DUG A;  4ECJ A;  1OC9 A;  2KP1 A;  1XW6 A;  3UOM A;  1O7U A;  3DXB A;  4GSN A;  2WZ9 A;  4TN8 A;  2WS2 A;  3FW2 A;  4KDX A;  3DWV A;  1XXU A;  3F9U A;  2DJK A;  1E2Y A;  2NVL A;  5IIZ A;  1TK5 B;  2LJK A;  2X8G A;  1KEB A;  1GTU A;  3E0U A;  4MZB A;  4POL A;  1URM A;  3HJM A;  4MJA A;  2GQM A;  3UBK A;  1Z3E A;  2QA1 A;  2A4V A;  2P31 A;  3H4K A;  2N5F A;  1V57 A;  2PUK C;  1V98 A;  2J9H A;  3MIX A;  4I2T A;  2CZ3 A;  4NHW A;  3ZRD A;  5DQS A;  3FK8 A;  4Z2U A;  5L71 A;  4MNN A;  3PH9 A;  1TXX A;  1T3B A;  4TOP A;  1OE7 A;  4ZIL A;  4TXO B;  1O8W A;  2OAD A;  2H6Z A;  5JCG A;  4V1A g;  2A2P A;  4Z2T A;  3K8N A;  1M2B A;  5EL8 A;  2YWO A;  1J9B A;  2GTU A;  4D73 B;  4USS A;  5GAP D;  3TRQ A;  4G0K A;  3FY7 A;  5G2Z A;  2GS3 A;  1U6T A;  3IA1 A;  3EYT A;  4TVE A;  3IK7 A;  1M9B A;  1SK2 A;  1XW5 A;  4X1U A;  3DVX A;  2YWN A;  3D4T A;  4TRX A;  3ZFL A;  1BED A;  3PPU A;  3FR3 A;  2YV9 A;  3JCM L;  3TUE A;  1DSB A;  2IWT A;  6GSY A;  4WBR D;  2WGR A;  1ZZY A;  4HI7 A;  3FEU A;  3KGK A;  3QPM A;  4PNF A;  2IMI A;  1HNC A;  1H75 A;  5AIV A;  1PA3 A;  5HR2 A;  4OCF A;  5H5S A;  4PGT A;  1M9A A;  3IHG A;  4PNG A;  2TRX A;  1YKA A;  1AXD A;  3LGC A;  4JED A;  2XC2 A;  3MAK A;  2OE1 A;  3W8S A;  4TR3 A;  2VD0 A;  3TGZ A;  3NOF A;  2DC5 A;  1EGR A;  3CTF A;  4XS4 A;  5AGY A;  4GXZ A;  4J56 E;  1SYX A;  1Z7P A;  2UZ8 A;  2VL9 A;  4CW9 A;  1UVZ A;  2YPM A;  2ALB A;  3F6F A;  2IPA A;  2KOK A;  5FT3 A;  5DAK B;  1PX7 A;  3LWA A;  4BVX B;  2VIM A;  4WR5 A;  4IVF A;  2BMX A;  3FZ9 A;  2VM2 A;  1DE1 A;  4AJ8 A;  18GS A;  3ISO A;  5CRW A;  14GS A;  2VL2 C;  1LJR A;  1HNB A;  2AB6 A;  1LU4 A;  3MYD A;  2WDU A;  3I43 A;  4BWS A;  1X9M B;  4TXO A;  4LL1 B;  2HLS A;  1R5A A;  2K18 A;  4G9H A;  4LMW A;  4KW6 A;  1X5D A;  2JL4 A;  2DJ3 A;  3GMF A;  2JSY A;  4D73 A;  2P5Q A;  3SWL A;  5IO2 A;  1TKD B;  2HT9 A;  4CHS A;  3DD3 A;  5HR1 A;  1XIY A;  6GSV A;  4KGI A;  2GST A;  4FYC A;  3GV1 A;  1ZL9 A;  2CX3 A;  1QMV A;  2VAF A;  1EOH A;  3KH7 A;  2CVB A;  2LNS A;  4HZ4 A;  3D4M A;  1OC8 A;  3EVI A;  2YZU A;  1R4W A;  4ULX A;  2GZY A;  2H73 A;  2M80 A;  1FHE A;  5G5F A;  12GS A;  4MLY A;  4XTS A;  5ELG A;  5HFG A;  5IMC A;  1A2M A;  1JZW A;  3U6V A;  3KM6 A;  3TKQ A;  4GSS A;  1ILO A;  2YNX A;  2RUF A;  1S3D A;  3GUS A;  4MA9 A;  4GLT A;  3EMP A;  3M8N A;  3KZQ A;  2FWF A;  3G7Y A;  2LST A;  2MYG A;  4HU9 A;  2EC4 A;  1B48 A;  4ECI A;  3GTU A;  5IOX A;  2V32 A;  5J4U A;  3O6T A;  5B6M A;  3C7M A;  2H75 A;  1YF1 A;  1PL2 A;  3UMA A;  5B8A A;  2WCI A;  4OWY A;  4GQF A;  3CBU A;  3ZVJ D;  4KCA A;  2QKE A;  4O32 A;  3GST A;  2IIY A;  5CNW A;  2BTO T;  4MF7 A;  5DAK A;  1F6M C;  4EDZ A;  2VCX A;  4GQC A;  4BVX A;  1NHY A;  4XCS A;  4ZL9 A;  3VWX A;  1UN2 A;  3IPZ A;  1KTE A;  1XWB A;  3ERF A;  3OR5 A;  4GF0 A;  2H19 A;  4HS1 A;  4RUV A;  3IHQ A;  1OE8 A;  1F9M A;  4KDY A;  5C04 A;  4IQ1 A;  1U88 A;  4WET A;  1A24 A;  3HCZ A;  3F3R A;  4TR1 B;  3NIV A;  2C3N A;  5IOW A;  4NXI A;  4K7I A;  4HUA A;  2P0G A;  5CRD A;  3R2Q A;  4JR4 A;  4NPB A;  4GWR A;  2L4C A;  1FW1 A;  2A4H A;  2FWH A;  1ZGN A;  4IBP A;  5C00 A;  4X0X A;  4DSQ A;  1OKT A;  1JLW A;  1TRU A;  3GH9 A;  4JU5 A;  1LBK A;  3FHK A;  5GST A;  4MF5 A;  5B8B A;  3A3T A;  3KP8 A;  1MTC A;  3KTL A;  4J57 E;  4N0Z A;  4O7H A;  2LJA A;  4IEL A;  3VLN A;  4PUA A;  4POK A;  4ECB A;  2C8U A;  2HRA A;  2LS5 A;  2WB9 A;  3LFL A;  2FY6 A;  2VLT A;  2XBI A;  1U3I A;  3F63 A;  3M9J A;  3TJB A;  2YOI A;  2C0E A;  4HEA 2;  1TRS A;  2VO4 A;  2V6O A;  2MMN A;  1AQW A;  2HXK A;  1FOV A;  5CRH A;  5FHI A;  5IMD A;  1GUH A;  4DEJ A;  4KSM A;  2LRN A;  5ECI B;  2DJ2 A;  4KH7 A;  1EOG A;  3QR6 A;  4IN0 A;  5H5Q A;  1TRW A;  2H0I A;  3MNG A;  4TKY A;  6GSW A;  1SU9 A;  1K0O A;  2NBS A;  4ISD A;  2GSQ A;  4YKF A;  1TTZ A;  3ZTL A;  2YP6 A;  3KIJ A;  4IJI A;  3AY8 A;  1TJD A;  1GSS A;  1F3B A;  5JWQ B;  4BVY B;  3LXZ A;  3HA9 A;  2NPB A;  2R4V A;  2CAQ A;  3LJR A;  3DML A;  2CX4 A;  2HRN A;  4ACS A;  1SD9 A;  4NMU A;  3PR8 A;  3PGT A;  3L4N A;  1SJI A;  3GSS A;  1F2E A;  4XRD A;  2P5R A;  4FO5 A;  1GRX A;  2IFQ B;  1O8X A;  4TR4 A;  2K8V A;  3O76 A;  4TR1 A;  4AGS A;  3GRX A;  3H1N A;  2AUV A;  1ZMA A;  5H5R A;  2REM A;  4AJ6 A;  2O7K A;  5KN0 A;  4L8E A;  1GUK A;  1THO A;  16GS A;  4FYB A;  3FRC A;  5DVB A;  4MJE A;  4EO3 A;  4KCE A;  1E6B A;  1FB6 A;  2OE0 A;  4IJ3 A;  2C0G A;  3BOA A;  3P2A A;  3GH6 A;  2AJQ B;  2HSH A;  2QA2 A;  3RBT A;  2FCH A;  2L5L A;  4HU7 A;  2RM5 A;  3TKS E;  4HQZ A;  1A23 A;  1T8E B;  1B9Y C;  4ZB6 A;  1TW9 A;  2R2J A;  1K3L A;  1JFU A;  1X5C A;  3I9V 2;  2A2S A;  1Y25 A;  4IS0 A;  1XW9 A;  1EWX A;  4V2M A;  1CQG A;  4BA7 A;  4ILF A;  4XHM A;  1MD3 A;  3LQ7 A;  5CRG A;  1KNG A;  3QOU A;  5AIS A;  2PPT A;  1WOU A;  2I81 A;  2PMT A;  2HFD A;  4BWQ A;  4MPF A;  4Q5N A;  4YKG A;  1AQX A;  4WF5 A;  3ZYW A;  1QGV A;  1QFN A;  2G0F A;  2GT5 A;  4LA1 A;  3BBY A;  5EY6 A;  3FMW A;  4N10 A;  5A4V A;  11GS A;  2GDR A;  3J7Y k;  4IP6 A;  4KA0 A;  2LNT A;  1ERW A;  3IBH A;  4JRR A;  2E2G A;  3H93 A;  3PIN A;  4O92 A;  2IFQ A;  1EV9 A;  5G1L A;  4CY8 A;  1Z6M A;  1M2D A;  3BD2 A;  3G7J A;  4AF2 A;  2KHP A;  1SKW B;  3L9V A;  3LW9 A;  1VF2 A;  3QAW A;  3QFB C;  1K0M A;  3F6D A;  3WGD A;  1K3Y A;  3N5O A;  2KUC A;  4I5Q A;  3M0F A;  5F05 A;  4TXV A;  4L0W A;  4HDE A;  2MZC A;  2WRT A;  4RQR A;  1Z9H A;  2PWJ A;  3FR9 A;  3VWV A;  3QAG A;  4IHU A;  2DLX A;  3CXG A;  2B5E A;  3HJP A;  1VGL A;  2C0D A;  1BG5 A;  5D9W A;  3EUR A;  4N11 A;  5A4W A;  2VUP A;  3HY2 A;  2H66 A;  4AJ7 A;  1FG4 A;  2HSY A;  2VL2 A;  3LEF A;  3L9S A;  2HZE B;  3QFA C;  5ECR B;  19GS A;  2L59 A;  2PGT A;  4F2I A;  2JAC A;  4EIQ A;  3W6G A;  4OFN A;  3KMN A;  1XOA A;  4I2U A;  4NV2 A;  4I6X A;  4I8B A;  2RM6 A;  1Z6N A;  1VF1 A;  3A2X A;  5ECK B;  5KEJ A;  3FYG A;  4ZL7 A;  1F3A A;  4KX4 A;  2YN1 A;  2JU5 A;  2F9S A;  3NZN A;  2CZ2 A;  3E9J B;  2GZZ A;  4ID0 A;  1HNA A;  2JSZ A;  5DJL A;  3IAM 2;  2VOC A;  3L9U A;  2V2G A;  4MJB A;  4LMV A;  2YWI A;  4XRA A;  4YAV A;  1SJ6 A;  2AHE A;  4IP1 A;  2F3M A;  1R7H A;  7GSS A;  4QL9 A;  2FA8 A;  4N30 A;  2E2M A;  2IMF A;  4ZB8 A;  2ZCT A;  2H70 A;  3I6A A;  3KCM A;  1O81 A;  2EIR A;  6GSS A;  1DBY A;  1USB A;  4HQS A;  1A8L A;  3TKP A;  2DKH A;  2C3T A;  3VK9 A;  4JR6 A;  3TJJ A;  5ECL B;  4KDU A;  4MAB A;  2FUG 2;  1ZYN A;  3LG6 A;  4HJ2 A;  2GSR A;  4K1F A;  5HFK A;  4K0G A;  4GST A;  3GUR A;  2FNO A;  3KEB A;  1N8J A;  1A2L A;  4X4J A;  1FOH A;  4LLR A;  3VUR A;  3GN3 A;  1NHO A;  3UIW A;  3A5I A;  1SKR B;  2B7J A;  1TI3 A;  2I9H A;  4DSR A;  4YQM A;  4PX1 A;  4F82 A;  1V2A A;  5KOX A;  3GX8 A;  1TRV A;  4IW9 A;  4K0N A;  4Z7X A;  3HXS A;  4RI7 A;  4PQI A;  2HZE A;  1PMT A;  3F8U A;  1QK8 A;  2H74 A;  20GS A;  1I5G A;  2YZH A;  3D6I A;  2M72 A;  5B7C A;  1PD2 1;  4K7N A;  5ABR A;  2LQO A;  3DEX A;  1MDJ A;  2R0G A;  1GL8 A;  2LJR A;  3WT1 A;  5FWG A;  2GLR A;  3RPP A;  3DRN A;  3IV4 A;  2H1B A;  4WKW A;  2JZT A;  1PL1 A;  3E3E A;  2ZNM A;  4JBB A;  2F8F A;  4ECC A;  2DIY A;  1M0U A;  3BJ5 A;  3VPT A;  1WJK A;  5DAL B;  1GUM A;  3FR6 A;  5DDL A;  1GNE A;  1N2A A;  4KF9 A;  2VM1 A;  3ED3 A;  4YQU A;  5LD0 A;  3GL5 A;  2VCW A;  2BJX A;  5AIX A;  3VI7 A;  2FWE A;  4OO5 A;  1XWG A;  3GKK A;  2H01 A;  2E0Q A;  1B9X C;  5IMA A;  2O85 A;  2I1U A;  4TW5 A;  1K0C A;  5CO3 A;  2B1K A;  2K8S A;  4OMV A;  4L5O A;  1K0D A;  2NDO A;  2YJH A;  4O5R A;  5B6N A;  5ENU A;  4POB A;  1QUW A;  1YF0 A;  2L6C A;  3C71 A;  3LSZ A;  4NWY A;  1YZX A;  5F06 A;  3TDG A;  1VF4 A;  4PXO A;  2IME A;  2CAI A;  2H0G A;  3HKR A;  3G7I A;  1AIU A;  1RQM A;  2LV3 A;  1S3C A;  2DJ1 A;  2CVD A;  2HRK A;  2JZS A;  1YJ6 A;  4GRF A;  3US3 A;  4KAE A;  1PKW A;  4CDO A;  3M9K A;  1G0T A;  5ECH B;  2PVQ A;  2KLX A;  3P8W A;  4K8M A;  1W4V A;  1O73 A;  1TU7 A;  3UJ1 A;  1XZO A;  5HR0 A;  1EEM A;  2CA8 A;  2GZP A;  5JCU A;  2H1G A;  2LEG A;  1HD2 A;  2FGX A;  4K2X A;  2PN8 A;  2R3X A;  3CTG A;  3Q18 A;  4ICY A;  4MZW A;  1SEN A;  4RQX A;  3DVW A;  3H79 A;  4NHZ A;  2L6D A;  5F0G A;  2R37 A;  2VLU A;  2YJ7 A;  4WBJ A;  2H1D A;  5A4U A;  3ZML A;  3TRP A;  1ABA A;  1GNW A;  3KJY A;  2OJL A;  1AUC A;  3ME7 A;  2F51 A;  4WEY A;  2DML A;  1YKC A;  3EU3 A;  4OFM A;  3P7X A;  4DVC A;  2H76 A;  5A5K A;  2VLV A;  1ERV A;  3GKM A;  2DMM A;  3HJO A;  1ST9 A;  3F4S A;  4I97 A;  3KMO A;  4NAX A;  3IR4 A;  1M7T A;  4ML6 A;  4EVM A;  3N9J A;  4NV5 A;  3TJK A;  9GSS A;  4F0C A;  4YAP A;  3RDW A;  3Q74 A;  2VCZ A;  10GS A;  2IN3 A;  2GQL A;  3HD5 A;  5HR3 A;  1OKD A;  2IL3 A;  5HQP A;  3WYW A;  1EP8 A;  2HE3 A;  1Z7R A;  2CT6 A;  5DJM A;  1J0F A;  1Y6E A;  1UA5 A;  5IMV A;  1CQH A;  1SL1 B;  1EGO A;  5ELA A;  4BPY A;  4EC0 A;  4K2D A;  3MDK A;  3TKS C;  2L57 A;  3F4T A;  1MD4 A;  2PBJ A;  2ES7 A;  4YH2 A;  3GIX A;  1NM3 A;  1S3A A;  3DYR A;  1WE0 A;  3LOR A;  1A8Y A;  2H6X A;  6GST A;  1SD8 A;  2LKU A;  5G31 A;  2HI7 A;  1TDI A;  1PN0 A;  2CV4 A;  3ZIJ A;  3G9B A;  2AV4 A;  2B3S A;  2LRC A;  2MBS A;  3L0H A;  5KN1 A;  5HFI A;  3HDC A;  1BYE A;  1W89 A;  3CSJ A;  1ZOF A;  3UVH A;  2OBK A;  1YDK A;  3ZRE A;  5JWR B;  5LNK e;  5D9X A;  4A5P A;  3MSZ A;  1GTB A;  2PER A;  1OVN A;  1G6W A;  2X64 A;  4PQH A;  1EV4 A;  2X49 A;  1T7P B;  2H0H A;  1A0F A;  3TOT A;  3QDN A;  4HOJ A;  1YY7 A;  2AAW A;  5CYY A;  2B7K A;  4EUY A;  1GSF A;  3WT2 A;  2HYX A;  4MH3 A;  1TP9 A;  4E8E A;  1M2A A;  4ML1 A;  5COH A;  2LUS A;  1R5P A;  1X5E A;  2CQ9 A;  4JE1 A;  4BVY A;  1Q98 A;  2O8V B;  2OKA A;  3C73 A;  5J41 A;  3ZVJ A;  4V1A p;  2MMA A;  3CSH A;  2K6V A;  2DJ0 A;  2LRT A;  3Q6O A;  2A2R A;  3ERG A;  1GP1 A;  2VCQ A;  3GKX A;  1AW9 A;  2OE3 A;  1T4Z A;  2I3Y A;  5D8I A;  3F4R A;  3UEM A;  4BL7 B;  1PSQ A;  1NW2 A;  3WGE A;  4DSS B;  4MPG A;  4MMM A;  3CMI A;  2GQK A;  1FAA A;  2OAC A;  4N0V A;  1GH2 A;  5J9C A;  4XS6 A;  5ECP B;  1WRY A;  4MH2 A;  3GYK A;  1XWC A;  4K5R A;  1EZK A;  3UAR A;  5J9B A;  1JHB A;  4HZ2 A;  3CSI A;  4O5Q A;  2XPD A;  1B8X A;  1O85 A;  2OA7 A;  1U3A A;  4EE0 A;  1X9S B;  3FZ4 A;  1YQ1 A;  2WFC A;  3V1W A;  3QMX A;  1GSE A;  5INY A;  3M3M A;  1OC3 A;  3RHC A;  5F8B A;  2R0C A;  2GT6 A;  4K6X A;  4MZC A;  2N5A A;  4XS4 B;  2H8L A;  1ERT A;  3LYP A;  1G7O A;  2DKI A;  4OD7 A;  5ECN B;  4KSO A;  2OBI A;  5ID2 B;  2B5Y A;  3FZA A;  4FQU A;  1Q4J A;  1TU8 A;  2HSM A;  3EWL A;  2XBQ A;  4ZXG A;  2QC7 A;  2H1A A;  5D9V A;  3ZL5 A;  2R5G A;  3P90 A;  3QAV A;  2FWG A;  2PU9 C;  4KB3 A;  3IDV A;  3LYK A;  3GFK A;  3CYN A;  1J08 A;  3VFI A;  1IYI A;  2YCD A;  4EL1 A;  3Q19 A;  1ZYE A;  4E8H A;  2RUE A;  4G2E A;  1ZYP A;  4OO4 A;  2QSI A;  2DSA A;  3FZ5 A;  1BJX A;  5IMF A;  4Z2R A;  4MK3 A;  4MJC A;  1GLQ A;  1B4Q A;  3IXR A;  5KOW A;  4K9Z A;  4XIH A;  22GS A;  4BL7 A;  4P3Y B;  5KN2 A;  3EU4 A;  5AN1 A;  3C1S A;  4DSS A;  4XS1 A;  5IM9 A;  1FB0 A;  2C0F A;  2I4A A;  3W8J A;  3EIN A;  4Q5R A;  3D0Z A;  4O5U A;  3C8E A;  5IPG A;  4ZBB A;  1XFL A;  3CRT A;  3KXO A;  1UC7 A;  4OCE A;  1SL0 B;  1VRS D;  1FVK A;  2DIZ A;  2H72 A;  1RW1 A;  1JLV A;  2IMK A;  6GSX A;  2QGV A;  2V41 A;  3L78 A;  3WD6 A;  3GTU B;  5CAX A;  1MDI A;  4PUF C;  3QD9 A;  5G30 A;  4OFT A;  3GHA A;  2X99 A;  2N5B A;  2K9F A;  3FKF A;  3WGX A;  1HYU A;  2B6M A;  4EIP A;  2H6Y A;  3VI5 A;  1GSU A;  3HYP A;  3UBL A;  2V1M A;  3ERW A;  5ID2 A;  2LQQ A;  2XPE A;  2Z9S A;  5G1K A;  13GS A;  4KUN A;  5E59 A;  1GSQ A;  1ZCP A;  1X9W B;  3IRA A;  1H4O A;  1TK8 B;  3GL3 A;  4EDY A;  5D9T A;  2R0P A;  2FD3 A;  1MEK A;  3APO A;  5BRT A;  4PUR A;  3DIE A;  5EPF A;  3MWH A;  5GAN D;  3IOS A;  3TJG A;  2EIO A;  4H86 A;  3UVT A;  2JZR A;  1BAY A;  2L4Q A;  1XOB A;  3TJF A;  1BQ7 A;  2FA4 A;  1JZR A;  4MCU A;  1XBS A;  4ZL8 A;  1XVW A;  2KP2 A;  5ECO B;  2O87 A;  1C72 A;  1GTI A;  4G0I A;  2XHF A;  4QL7 A;  4ZBD A;  3LXT A;  2YV7 A;  4CY6 A;  1BX9 A;  4LL4 B;  1EEJ A;  17GS A;  5ECS A;  3ZMK A;  1WMJ A;  4L0U A;  3TRX A;  1PN9 A;  3GA4 A;  3VWU A;  3IE3 A;  3APQ A;  3R3E A;  3IC4 A;  1V40 A;  1VF3 A;  1F37 A;  1V58 A;  4F9Z A;  1XPV A;  3RAZ A;  4WR4 A;  5D73 A;  4KND A;  2H30 A;  5JCW A;  3F3Q A;  5DQY A;  2ON7 A;  5DCH A;  1OYJ A;  3TCO A;  1YEP A;  2DBC A;  2D2Z A;  1ML6 A;  1QXH A;  2C1Y A;  5J3R A;  3D5J A;  1O6J A;  1PQN A;  4F03 A;  1SJZ A;  1JZD A;  1TOF A;  5IQY A;  4ZBA A;  1PX6 A;  3H8Q A;  1A0R P;  3M1G A;  3D22 A;  1GLP A;  2O89 A;  3TOU A;  2E7P A;  5E4W A;  2H71 A;  1FO5 A;  1V9W A;  3J7Y b;  1MDK A;  5GSS A;  1A2J A;  3GKN A;  3QCP A;  2X8C A;  4MP4 A;  5F07 A;  1QQ2 A;  2V6K A;  4IQA A;  3IAS 2;  3HVV A;  3F0I A;  3A2W A;  2L5O A;  1THX A;  1FVJ A;  3TKS A;  1PGT A;  4RI6 A;  3IC8 A;  4ZB9 A;  1WPI A;  4F0B A;  1G6Y A;  1T00 A;  2RII A;  3VWW A;  2IMD A;  5DAL A;  3A2V A;  4WXT A;  5JWO B;  4KE3 A;  1XWK A;  2VD1 A;  1M99 A;  1AC1 A;  1GSY A;  2C80 A;  3APS A;  3EMX A;  1G7E A;  2LTK A;  1SL2 B;  4V2L A;  2FHE A;  3HVS A;  2HRF A;  2CVK A;  1TI1 A;  2X8H A;  5GZZ B;  3O3T A;  1ACV A;  2YAN A;  1T4Y A;  4G19 A;  3U5R E;  3ZFB A;  3HZ8 A;  3KD0 A;  5IPH A;  5DCG A;  4TR0 A;  2B5X A;  4EF0 A;  1XWA A;  1KBN A;  2VCT A;  4V2N A;  1JZO A;  4QQ7 A;  3KP9 A;  1GSD A;  4G0L A;  1AQV A;  1K0B A;  1Z5Y E;  5CRE A;  3ZLP A;  1GTA A;  3HVX A;  3VPQ A;  2YWM A;  5IO0 A;  5ECM B;  1K3O A;  1WWJ A;  2B1L A;  1X0R A;  1GWC A;  3EPT A;  4WF4 A;  1ZYQ B;  4JZQ A;  5G5E A;  2IJY A;  3S9F A;  1WP0 A;  2R6K A;  2FLS A;  5IMZ A;  4ZIJ A;  1DE2 A;  4G10 A;  2ON5 A;  1OAZ A;  4POM A;  1SK1 A;  5KN3 A;  5D96 A;  5DBQ A;  2NTO A;  3KTB A;  5CP1 A;  1U87 A;  5BMU A;  3EC3 A;  4Q5Q A;  3TB2 A;  4IKH A;  1OC9 B;  2ZUP A;  4GCI A;  1RK4 A;  2HZF A;  3ZZX A;  1IYH A;  1GUL A;  2RLI A;  1NSW A;  3SBC A;  1B4P A;  2C4J A;  5J5N A;  4K7O A;  1EP7 A;  2GSS A;  3A5W A;  3HZ4 A;  3ZIT A;  3GNJ A;  1XVQ A;  5LCZ A;  2MMZ A;  3GX0 A;  2J23 A;  2DJJ A;  3UAP A;  1T1V A;  3I69 A;  6GSU A;  5ECQ B;  2TRC P;  1PKZ A;  4EKZ A;  2JAD A;  5D93 A;  2C3Q A;  1K0N A;  3EE2 A;  1R26 A;  2M46 A;  1WIK A;  2X4A A;  4K5S A;  3CRU A;  4EXJ A;  1ON4 A;  1XCC A;  1SK0 A;  2VL3 A;  2EIQ A;  3DKS A;  4IGJ A;  3DGQ A;  2G2Q A;  2TIR A;  1K0A A;  4HJM A;  2GGT A;  2WUL A;  4Q5F A;  3C1R A;  3TKR A;  2GVP A;  4X43 A;  3D21 A;  3IK9 A;  5EVO A;  4YQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...