2P0GA

Crystal structure of selenoprotein w-related protein from vibrio cholerae. northeast structural genomics target vcr75
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
78
structure length
78
Chain Sequence
KAQIEIYYCRQCNWMLRSAWLSQELLHTFSEEIEYVALHPDTGGRFEIFCNGVQIWERKQEGGFPEAKVLKQRVRDLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Selenoprotein W-related protein
publication title Crystal structure of Selenoprotein W-related protein from Vibrio cholerae.
rcsb
source organism Vibrio cholerae
total genus 22
structure length 78
sequence length 78
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10262 Rdx Rdx family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2p0gA00
3DMLA 4Q5FA 3TJBA 4K7NA 4DEJA 2REMA 5A4WA 1F3BA 4L8EA 3ZMLA 3ZLPA 1TI3A 3HZ8A 2LTKA 5B7CA 3WGDA 1SK1A 17GSA 3MSZA 5B8BA 2C4JA 4FH8A 14GSA 4PQIA 1AQVA 2LQQA 4N30A 6GSTA 4HU7A 1ZZYA 1GTAA 3CRTA 4WBRD 4EL1A 1C72A 1XW5A 3FZ9A 1PSQA 2DIZA 2IFQB 4MPFA 5AN1A 1QQ2A 4NWYA 1F3AA 3WT1A 5HFKA 2WDUA 4TR3A 4MF5A 3G7IA 1OE7A 2X64A 2HT9A 2GDRA 2O89A 2L5LA 2A2SA 2IFQA 2YNXA 1Y25A 1GSSA 2E7PA 5IPHA 4IJIA 1GUMA 1Y6EA 2QGVA 3LXZA 3DGQA 1GSEA 4EE0A 1PKWA 5IMZA 2YANA 5CRDA 5DVBA 3KTBA 2BMXA 2R6KA 3IK9A 5DALB 5EY6A 4POKA 2LJRA 3LEFA 3RDWA 3H4KA 3FHKA 5B6NA 4ULXA 1EZKA 2DJKA 1A8LA 4TR4A 5DALA 4KSOA 3TUEA 1XWAA 1F2EA 2H19A 3PINA 4MDCA 2DMMA 2WZ9A 3CRUA 5E4WA 1A2JA 3EURA 4KDXA 3FYGA 1OKTA 1GSDA 2YJ7A 2VD0A 5HR0A 1TDIA 4MMMA 4XS1A 2IJYA 1J9BA 4WKWA 2LEGA 4ECIA 5IMDA 4MZWA 3HKRA 2EIOA 2FLSA 3FR6A 1JFUA 2FA8A 4JRRA 3RHCA 2R4VA 3KMNA 1PA3A 1R4WA 2YWIA 4X43A 4AGSA 1QFNA 2HRNA 3KH9A 2JZSA 2ON5A 2LRNA 3R2QA 4OD7A 4ZXGA 4Q5QA 3VWXA 5ECOB 1WRYA 5FHIA 4NV5A 3A3TA 2HRFA 4X1UA 2HSHA 3GNJA 1PD21 5DJLA 5DBQA 2H70A 1GSYA 3TKPA 4ZB9A 5J5NA 4JR6A 1WPIA 3LYPA 3GHAA 3QMXA 4PQ1A 4F03A 3KP9A 1QXHA 2VL2C 2B5YA 2EIRA 2H74A 5ENUA 5JWOB 3VLNA 2IMEA 3H93A 2M46A 5ECPB 3EWLA 4TVEA 1K0NA 1XFLA 2P5RA 1ON4A 3DKSA 2ZCTA 1B9YC 2QSIA 3GRXA 2O87A 5GAND 3A2XA 2OBKA 1TRVA 4ZL7A 1AC1A 1EV9A 4O5RA 3HYPA 3LJRA 3K8NA 1EEMA 1XW9A 1BYEA 1HYUA 3IOSA 1O7UA 3HVSA 4E8EA 3IRAA 3L9UA 4JEDA 2MMOA 3ZVJA 5ECHB 2KP2A 2OKAA 2H76A 2H6YA 5ECLB 2WGRA 4DSSB 4HZ4A 2YCDA 3EINA 5GAPD 5ELAA 3J7Yk 1HD2A 4YQMA 3VI5A 2LV3A 2VAFA 4DSSA 2R2JA 3G7JA 3F6DA 2BTOT 1KNGA 2FGXA 1EGOA 3PR8A 2AAWA 2DIYA 5ELGA 4DVCA 4ID0A 1MD4A 2YZHA 3TJGA 3VK9A 1SK2A 3UVTA 3ZMKA 2OADA 1F6MC 3G7YA 4POLA 2YWOA 2V32A 2WFCA 1EGRA 4LA1A 1EEJA 4KGIA 2I3YA 2F8AA 5D9WA 2C0EA 5D96A 2H6ZA 3VWWA 2PERA 1YKCA 4TRXA 3UOMA 1FAAA 4ML6A 3QDNA 4HS1A 2V1MA 1SJZA 3EU4A 5CREA 1WWJA 1RW1A 1PMTA 2MMAA 4TN8A 3LXTA 5CP1A 3IR4A 1JLVA 2CVBA 1X9MB 1AQXA 1ERUA 4J56E 1TXXA 2C3NA 2P31A 2OJLA 4NAXA 1IYHA 3HY2A 3KH7A 2ES7A 3F6FA 1ZCPA 1CQGA 1X5CA 3TKSA 2OACA 4IQAA 4HQZA 2IIYA 2RUEA 4N0ZA 3GIXA 2H73A 4KNDA 5CO3A 4O32A 4ZL8A 1UC7A 2MMNA 3UJ1A 4XCSA 1ILOA 1PX6A 2FY6A 3VURA 4TW5A 4HDEA 1OVNA 3US3A 2E2MA 4F2IA 3DIEA 2C8UA 1DUGA 4RUVA 1JZWA 1JZRA 2V6KA 4OCFA 3E0UA 4MABA 4TR1B 2LNSA 2CA8A 1USBA 2A2RA 1S3CA 2R3XA 3HZ4A 2X99A 1YKAA 2PWJA 1PRXA 2YV7A 3IDVA 4TR1A 1OC3A 3GA4A 4NXIA 1I5GA 4V2NA 2PUKC 1XVQA 1UA5A 3UBLA 1VF1A 1OC9B 1OKDA 4K7IA 5HR2A 2NVLA 2I9HA 2X8CA 4HJMA 4GSNA 3P8WA 1O85A 3TJKA 3I69A 5IMVA 2PU9C 1HQOA 1R5AA 4MZCA 3M9JA 1OC9A 1HNAA 2QC7A 1G0TA 1EWXA 3HA9A 4ECJA 1FOVA 1SYXA 4GWRA 4XRDA 4PNFA 1WOUA 1Z6NA 4OO4A 5JCWA 1GLPA 2O7KA 1V9WA 5LD0A 1THOA 19GSA 2GSTA 3I43A 4F82A 1QGVA 5KN1A 3A5WA 3J7Yb 5ECSA 4PXOA 4FYUA 4DSRA 11GSA 1DE2A 1ERVA 1GLQA 4YAPA 5D9VA 1ZYQB 5J41A 3Q19A 1ACVA 1T4ZA 5G1KA 4O7HA 4I2UA 3KJYA 2DSAA 4HOJA 1EOHA 20GSA 3UMAA 1Q98A 5KN2A 1G7EA 2AV4A 3GYKA 3DXBA 3ED3A 4QQ7A 1PL2A 2H01A 3I9V2 2VL9A 5H5SA 5AISA 1SJ6A 1NSWA 1LJRA 5GSSA 2GQMA 2OE0A 3ZFLA 1SJIA 4J2FA 4MJAA 3TJJA 3H1NA 1OE8A 4N11A 3FKFA 1A23A 4Q5NA 5CRGA 4KCAA 1T3BA 3F9UA 3CXGA 1V57A 4AJ7A 2GZZA 1XOAA 2AYTA 1TP9A 4IQ1A 2M80A 3FZAA 4K9ZA 4JBBA 3GX8A 2H1AA 3L9SA 2VCXA 4K6XA 4D73B 3IV4A 3ZL5A 3G9BA 3C71A 3FW2A 5ECMB 4MJBA 4WEYA 4OFTA 4HU9A 3BJ5A 2C0DA 4ECBA 4D73A 3E3EA 2GQKA 3CYNA 4KA0A 3ZRDA 2I81A 1B4QA 4GXZA 3BD2A 3KMOA 1U3AA 2B5XA 2HYXA 3UIWA 1NHYA 2C80A 1M2AA 3ZYWA 2M72A 1J0FA 1YF0A 3P2AA 2RLIA 4TR0A 1GH2A 1K3YA 1ABAA 1G7OA 1YEXA 2D2ZA 2LJAA 1XXUA 4WR5A 5DCHA 2B7KA 4ZB6A 2JACA 5IIZA 2B1KA 3QD9A 1GWCA 4KB3A 3FY7A 4EUYA 2YV9A 2VCQA 3KXOA 4Q5RA 4BWQA 1PL1A 3DD3A 1YQ1A 1ZOFA 1PGTA 1LBKA 3W8JA 1A2MA 3UAPA 3C1SA 2GSSA 1THXA 1V98A 1OC8A 1S3DA 3NIVA 4NHZA 3KGKA 2A4VA 3HHVA 3EMPA 5A5KA 5D93A 4ZBDA 2XBQA 1BQ7A 5G5EA 4YQVA 1UN2A 3GV1A 1TU7A 5IMFA 1R26A 4YQUA 5HFIA 2I1UA 1KTEA 2MBSA 2CVKA 1ML6A 1JZOA 1HNBA 3LWAA 3Q74A 5KN3A 1MDIA 2GLRA 2WRTA 3ERFA 3L0HA 4WBJA 3RBTA 1O81A 1GRXA 5IMCA 3APQA 4GF0A 1YJ6A 3GFKA 4F9ZA 2YPMA 5F0GA 1XWGA 3TOUA 2FNOA 3C8EA 2MYGA 1XW6A 4HEA2 1XPVA 3PH9A 5ECKB 1QUWA 1SD8A 3H79A 1GL8A 2CAIA 5B8AA 4ZL9A 2LSTA 2OBIA 2H8LA 3EU3A 2ZUPA 3QAVA 1JHBA 5F05A 4EXJA 5JWQB 3N9JA 4TKYA 5A4UA 3WYWA 2XHFA 4HQSA 5EPFA 5G2ZA 3ZITA 1VGLA 5IO0A 3WT2A 1AUCA 1F37A 2B6MA 3DVWA 4BVYA 3ERGA 3QCPA 3IC4A 3V1WA 1ERTA 4WR4A 1Q4JA 2G0FA 5F07A 2H0GA 4WF5A 1ZGNA 1FVJA 1URMA 1SL1B 4EC0A 6GSXA 5G1LA 2PVQA 3Q18A 2LQOA 4V2MA 3PGTA 4TOPA 3C7MA 6GSWA 3APOA 4OMVA 2IMFA 4IS0A 2JSZA 5ECRB 2H0IA 2VLTA 4BPYA 3LFLA 5AGYA 3LQ7A 1GSUA 2VOCA 2YP6A 3ERWA 3TOTA 3NOFA 1A2LA 1MD3A 2GSQA 4ECCA 1YF1A 5IM9A 3IE3A 5DAKB 1ZL9A 2VLVA 4QL9A 2DC5A 1DSBA 5DAKA 2IN3A 3CSIA 1NHOA 2TRCP 5ECQB 5B6MA 4XRAA 3S9FA 2R5GA 1Z7PA 3WGXA 1OYJA 5HR1A 4IW9A 3U5RE 1DBYA 2RM6A 2WULA 3GH6A 2C3QA 3EYTA 5KN0A 2IMKA 5DQYA 5CRWA 1R5PA 4HJ2A 1M7TA 2H71A 2VCVA 1J08A 1BX9A 1U88A 2H1GA 1O6JA 2WB9A 4LMWA 5JCUA 3L4NA 3H8QA 4I6XA 2QKEA 5FT3A 1K0BA 3FZ5A 4GQFA 2HFDA 4BA7A 3E9JB 3APSA 4XTSA 2K18A 2DJ1A 1M9AA 4EVMA 4JE1A 1SL0B 1PQNA 2WJUA 4YH2A 1EV4A 3F0IA 3FR3A 4ZILA 2NDOA 5J4UA 3CBUA 2DBCA 3GKKA 2JSYA 4WF4A 1S3AA 3DYRA 2PGTA 1XOBA 2AB6A 1KBNA 2GZYA 3ISOA 3TCOA 2CT6A 1T8EB 2VL3A 3FK8A 3GMFA 1JLWA 3TB2A 3F3RA 3KD0A 4TXOB 4MP4A 1E6BA 4QL7A 2B5EA 2VCZA 3A2WA 4G19A 2H75A 2HI7A 3UEMA 5GSTA 3EVIA 1YZXA 2JL4A 4TXOA 2WS2A 4Z7XA 4GCIA 1G6WA 3GL5A 4KAEA 5D9XA 3FEUA 1A0RP 4EO3A 4X0XA 2VL2A 3L78A 1U3IA 2I4AA 1SKWB 3M1GA 1VF3A 3IAM2 4E8HA 2GVPA 2O8VB 4IVFA 4PUAA 2DLXA 3C1RA 2IMIA 3KIJA 3IK7A 4EDZA 2B1LA 2L6DA 1A24A 2PN8A 3RPPA 3JCML 8GSSA 4KE3A 1F9MA 5F06A 3ZTLA 3DWVA 1B48A 4L0UA 3W6GA 1NM3A 5CRHA 4L0WA 3BCKA 1SU9A 1HNCA 2KHPA 1O73A 3HXSA 3P90A 4G9HA 2HZEB 2AJQB 1PKZA 1FW1A 1FB0A 3GKMA 3MDKA 2CX4A 4I97A 2H72A 2PPTA 4L5OA 2FCHA 4MF7A 3KM6A 3D4MA 1SYRA 2HZEA 1M99A 2R37A 3KZQA 5F8BA 1K0DA 4K8MA 1GUKA 2H1BA 2L6CA 4WETA 3ME7A 4PX1A 16GSA 5HFGA 5CNWA 1FG4A 3QFBC 1M9BA 4KH7A 2C0GA 1K3LA 2L59A 2B3SA 2VM2A 2GZPA 1X9WB 2H66A 2VM1A 3UL3A 2RIIA 3HDCA 1Z7RA 2XBIA 1H4OA 3D21A 1TJDA 3GKNA 5G30A 3O3TA 1CQHA 1QMVA 1O8XA 1Z3EA 1H75A 3CTFA 1V58A 1Z5YE 4I5QA 3TKQA 1FVKA 1SENA 2JZTA 5H5RA 1FB6A 3GN3A 2H0HA 4NPBA 2CZ3A 3QAWA 3CMIA 6GSSA 22GSA 4EF0A 3VWUA 1ZMAA 1B4PA 4ACSA 1RK4A 3IXRA 4V2LA 2FWEA 4IBPA 1MDKA 2VD1A 3IBHA 4IKHA 1GSQA 1O8WA 3TKSE 5C04A 4OWYA 4AJ8A 2X8GA 2IPAA 1GTIA 4LL1B 5IOXA 2YOIA 3F4SA 4L5LA 3SWLA 1EP7A 1TU8A 3AY8A 3KEBA 4RI7A 4RQRA 1R7HA 1XWKA 3U6VA 1AW9A 4XIHA 4ZBAA 2P5QA 1VRSD 3GURA 1SKRB 3M0FA 2F9SA 3W8SA 3VPQA 2DJ0A 1OAZA 18GSA 2V6OA 4F0CA 2VO4A 4LMVA 1K0AA 1BAYA 3F4TA 4IELA 2JU5A 1A8YA 2TRXA 1WE0A 1T4YA 3GKXA 3KTLA 4MZBA 1B8XA 2NPBA 2OE1A 4MF6A 3GSSA 5DDLA 4I8BA 3CTGA 1ERWA 4P3YB 2VCWA 3KCMA 1GUHA 3TDGA 4N0VA 4PUFC 3VPTA 7GSSA 4KSMA 4K2DA 2ON7A 2X8HA 2CV4A 5D73A 4I2TA 4ZB8A 1XWBA 3TRQA 1XCCA 4GLTA 3TRXA 3BBYA 3IPZA 1YY7A 4J57E 2L5OA 3ZREA 4F0BA 5D8IA 5GZZB 1XIYA 2CAQA 3GX0A 6GSUA 1K0OA 3MAKA 4JR4A 4CW9A 5C00A 3TKSC 2H1DA 1FHEA 2GT5A 2LUSA 5E59A 2HNLA 4G2EA 1M0UA 4NHWA 5IOWA 2N5AA 1N8JA 3BCIA 2FWFA 3GSTA 1WIKA 5EL8A 2KP1A 1TRSA 2L4QA 2LS5A 4EDYA 1WMJA 1K0MA 3KP8A 3CSJA 1MDJA 1TRWA 1I9DA 1E2YA 1GULA 1XVWA 2EC4A 1TK0B 1XZOA 2E0QA 2GT6A 5DJMA 4KDYA 4GRFA 2J23A 2JADA 3F8UA 2KOKA 4LL4B 4NMUA 3QPMA 2AHEA 5JCGA 3HVXA 1PN9A 5CAXA 3HD5A 3QAGA 1Z6MA 3IHQA 3LGCA 4TXVA 2XC2A 5AIXA 4OO5A 5CYYA 4MPGA 4DSQA 2MBTA 2V41A 4GSSA 5D9TA 5LNKe 2CX3A 2P0GA 2XPDA 4IGJA 4MLYA 5ECIB 2PBJA 4IN0A 4XHMA 1YEPA 1WJKA 1GNWA 1MEKA 1W89A 2NTOA 1NW2A 2N5BA 3N5OA 2GSRA 4FO5A 3GTUB 5FWGA 4IP1A 2K8VA 3RPNA 1TK8B 2PMTA 3DVXA 3DRNA 2L4CA 2VIMA 5IMAA 2C3TA 1K3OA 4ZIJA 3GTUA 2H6XA 1UVZA 4AJ6A 4POBA 1U87A 2ALBA 2VLUA 3D22A 1X9SB 1T00A 1V40A 1TW9A 3QFAC 5J3RA 4K1FA 1A0FA 4POMA 2DJJA 12GSA 4FIWA 4OFNA 3RHBA 4RI6A 2G2QA 2YWNA 4OFMA 2L57A 2VUPA 13GSA 2E2GA 2OE3A 10GSA 4K0GA 1XBSA 4NV2A 5INYA 1SL2B 2J9HA 4GTUA 3HCZA 5KEJA 2LKUA 1SD9A 2HXKA 9GSSA 3HJMA 2KUCA 3HVVA 1SKSB 3M8NA 1TOFA 4WXTA 3F3QA 2F51A 5JWRB 3LORA 4BWSA 1KEBA 3MWHA 2FWGA 4HZ2A 3D6IA 5A4VA 4MA9A 3RAZA 2LJKA 1PX7A 1M2DA 4ISDA 3D0ZA 4HUAA 4CHSA 4JZQA 1U6TA 4KDUA 1K0CA 2DJ2A 2V2GA 3A2VA 5L71A 5COHA 2K8SA 2FA4A 3WD6A 2PVOC 2BJXA 3HJPA 5IQYA 4H86A 2Z9SA 1AIUA 1EOGA 1RQMA 1BEDA 4FYCA 2NBSA 3QOUA 2YZUA 5ID2B 2HE3A 3OR5A 1ST9A 2K6VA 4KUNA 4PGTA 5G31A 4FYBA 3LG6A 2ZNMA 4BVXA 1BJXA 3NZNA 2YWMA 2IMDA 3UARA 4AF2A 5ID2A 1LU4A 2OA7A 1X5EA 1X5DA 4OCEA 2AUVA 4KCEA 3I6AA 4MH3A 1EP8A 4MJEA 3D5JA 3P7XA 4XS4B 4MH2A 3O6TA 1X0RA 1AXDA 3ME8A 2VCTA 3BOAA 1MTCA 1ZYEA 1DE1A 4MJCA 2DMLA 2GGTA 3FR9A 3TRPA 3ZIVA 5J9BA 4XS4A 2F8FA 1JZDA 1GSFA 3MNGA 4RQXA 3F63A 2CVDA 3D4TA 3DEXA 1GNEA 3WGEA 2HLSA 6GSYA 5LCZA 3L9VA 4MCUA 1B9XC 2XPEA 5AIVA 3CSHA 4PQHA 3UBKA 4O92A 1TRUA 4IHUA 1TI1A 3F4RA 4KW6A 2JZRA 4V1Ap 2EIQA 2C1YA 1Z9HA 3GL3A 3VFIA 6GSVA 2TIRA 2LRTA 1TTZA 1YDKA 4HI7A 5EVOA 5J9CA 5H5QA 2MZCA 3M9KA 4PNGA 1GTUA 1AQWA 1FO5A 2RM5A 4MK3A 3FZ4A 4K7OA 2H30A 4ML1A 4CDOA 3ZVJD 3IA1A 5IO2A 1WP0A 1TKDB 3TJFA 3ZIJA 1VF2A 3M3MA 1T1VA 2CZ2A 4LLRA 2IL3A 2YN1A 4PURA 2FUG2 5DQSA 1V2AA 1W4VA 2HSYA 2WCIA 5G5FA 3TGZA 3QR6A 5ECNB 2LRCA 2GTUA 4BL7A 4XS6A 1XWCA 2FHEA 2B7JA 4KX4A 2KLXA 1SK0A 3C73A 1TK5B 4GQCA 1GTBA 2C0FA 2GS3A 2K9FA 3UVHA 1GP1A 3ZFBA 4EKZA 2O85A 2DJ3A 4V1Ag 2GQLA 4ZBBA 4IP6A 2MMZA 3LYKA 2IWTA 3LSZA 1N2AA 3Q6OA 5DCGA 2FWHA 3HJOA 1BG5A 2RUFA 2FD3A 1T7PB 1QK8A 2F3MA 5ABRA 5IPGA 3O76A 3TKRA 4IJ3A 4YAVA 3VWVA 1AAZA 3FRCA 3SBCA 3EC3A 1M2BA 3EE2A 4ILFA 4GSTA 3ZZXA 1G6YA 1VF4A 5HQPA 3GH9A 5HR3A 2N5FA 2HZFA 4JU5A 2LNTA 2YJHA 4N10A 3VI7A 3EMXA 3GUSA 1IYIA 4G10A 4K0NA 2CQ9A 3IAS2
chains in the Genus database with same CATH superfamily
3DMLA 4Q5FA 3TJBA 4K7NA 4DEJA 2REMA 5A4WA 1F3BA 4L8EA 3ZMLA 3ZLPA 1TI3A 3HZ8A 2LTKA 5B7CA 3WGDA 1SK1A 17GSA 3MSZA 5B8BA 2C4JA 4FH8A 14GSA 4PQIA 1AQVA 2LQQA 4N30A 6GSTA 4HU7A 1ZZYA 1GTAA 3CRTA 4WBRD 4EL1A 1C72A 1XW5A 3FZ9A 1PSQA 2DIZA 2IFQB 4MPFA 5AN1A 1QQ2A 4NWYA 1F3AA 3WT1A 5HFKA 2WDUA 4TR3A 4MF5A 3G7IA 1OE7A 2X64A 2HT9A 2GDRA 2O89A 2L5LA 2A2SA 2IFQA 4HSCX 2YNXA 1Y25A 1GSSA 4A5PA 2E7PA 5IPHA 4IJIA 1GUMA 1Y6EA 2QGVA 3LXZA 3DGQA 1GSEA 4EE0A 1PKWA 5IMZA 2YANA 5CRDA 5DVBA 3KTBA 2BMXA 2R6KA 3IK9A 5DALB 5EY6A 4POKA 2LJRA 3LEFA 3RDWA 3H4KA 3FHKA 5B6NA 4ULXA 1EZKA 2DJKA 1A8LA 4TR4A 5DALA 4KSOA 3TUEA 1XWAA 1F2EA 2H19A 3PINA 4MDCA 2DMMA 2WZ9A 3CRUA 5E4WA 1A2JA 3EURA 4KDXA 2HSMA 3FYGA 4BIKA 1OKTA 1GSDA 2YJ7A 2VD0A 5HR0A 1TDIA 4MMMA 4XS1A 2IJYA 1J9BA 4WKWA 2LEGA 4ECIA 2R0PA 5IMDA 4MZWA 3HKRA 2EIOA 2FLSA 3FR6A 1JFUA 2FA8A 4JRRA 3RHCA 2R4VA 3KMNA 1PA3A 1R4WA 2YWIA 4X43A 4AGSA 1QFNA 2HRNA 3KH9A 2JZSA 2ON5A 2LRNA 3R2QA 4OD7A 4ZXGA 4Q5QA 3VWXA 5ECOB 1WRYA 5FHIA 4CY8A 4NV5A 3A3TA 2HRFA 4X1UA 2HSHA 3GNJA 1PD21 5DJLA 5DBQA 2H70A 1GSYA 3TKPA 4ZB9A 5J5NA 4JR6A 1WPIA 3LYPA 3GHAA 3QMXA 4PQ1A 4F03A 5KOXA 3KP9A 1QXHA 2VL2C 2B5YA 2EIRA 2H74A 5ENUA 5JWOB 3VLNA 2IMEA 3H93A 2M46A 5ECPB 3EWLA 4TVEA 1K0NA 1XFLA 2P5RA 1ON4A 3DKSA 2ZCTA 1B9YC 2QSIA 3GRXA 2O87A 1XG8A 5GAND 3A2XA 2OBKA 1TRVA 4ZL7A 1AC1A 1EV9A 4O5RA 3HYPA 3LJRA 3K8NA 1EEMA 1XW9A 1BYEA 1HYUA 3IOSA 1O7UA 3HVSA 4E8EA 3IRAA 3L9UA 4JEDA 2MMOA 3ZVJA 5ECHB 2KP2A 2OKAA 2H76A 2H6YA 5ECLB 2WGRA 4DSSB 4HZ4A 2YCDA 3EINA 4FQUA 5GAPD 5ELAA 3J7Yk 1HD2A 4YQMA 3VI5A 2LV3A 2VAFA 4DSSA 2R2JA 3G7JA 3F6DA 2BTOT 1KNGA 2FGXA 1EGOA 3PR8A 2AAWA 2DIYA 5ELGA 4DVCA 4ID0A 1MD4A 2YZHA 2A4HA 3TJGA 3VK9A 1SK2A 3UVTA 3ZMKA 2OADA 2QA2A 1F6MC 3G7YA 4POLA 2YWOA 2V32A 4KF9A 2WFCA 1EGRA 4LA1A 1EEJA 4KGIA 2I3YA 2F8AA 5D9WA 2C0EA 5D96A 2H6ZA 3VWWA 2PERA 1YKCA 4TRXA 3UOMA 1FAAA 4ML6A 3QDNA 4HS1A 2V1MA 1SJZA 3EU4A 5CREA 1WWJA 1RW1A 1PMTA 2MMAA 4TN8A 3LXTA 5CP1A 3IR4A 1JLVA 2CVBA 1X9MB 1AQXA 1ERUA 4J56E 1TXXA 2C3NA 2P31A 2OJLA 4NAXA 1IYHA 3HY2A 3KH7A 2ES7A 3F6FA 1ZCPA 1CQGA 1X5CA 3TKSA 2OACA 4IQAA 4HQZA 2IIYA 2RUEA 4N0ZA 3GIXA 2H73A 4KNDA 5CO3A 4O32A 4ZL8A 1UC7A 2MMNA 3UJ1A 4XCSA 1ILOA 3MYDA 1PX6A 2FY6A 3VURA 4TW5A 4HDEA 1OVNA 3US3A 2E2MA 4F2IA 3DIEA 2C8UA 1DUGA 4RUVA 1JZWA 1JZRA 2V6KA 4OCFA 3E0UA 4MABA 4TR1B 5KOWA 2LNSA 2CA8A 1USBA 2A2RA 1S3CA 2R3XA 3HZ4A 2X99A 1YKAA 2PWJA 1PRXA 2YV7A 3IDVA 4TR1A 1OC3A 3GA4A 4NXIA 1I5GA 4V2NA 2PUKC 1XVQA 1UA5A 3UBLA 1VF1A 1OC9B 1OKDA 4K7IA 5HR2A 2NVLA 4PTSA 2I9HA 2X8CA 4HJMA 4GSNA 3P8WA 1O85A 3TJKA 3I69A 5IMVA 2PU9C 1HQOA 1R5AA 4MZCA 3M9JA 1OC9A 1HNAA 2QC7A 1G0TA 1EWXA 3HA9A 4ECJA 1FOVA 1SYXA 4GWRA 4XRDA 4PNFA 1WOUA 1Z6NA 4OO4A 5JCWA 1GLPA 2O7KA 1V9WA 5LD0A 1THOA 19GSA 2GSTA 3I43A 4F82A 1QGVA 5KN1A 3A5WA 3J7Yb 5ECSA 4PXOA 4FYUA 4DSRA 11GSA 1DE2A 1ERVA 1GLQA 4YAPA 5D9VA 1ZYQB 5J41A 3Q19A 1ACVA 1T4ZA 5G1KA 4O7HA 4I2UA 3KJYA 2DSAA 4HOJA 1EOHA 20GSA 3UMAA 1Q98A 5KN2A 1G7EA 2AV4A 3GYKA 3DXBA 3ED3A 4QQ7A 1PL2A 2H01A 3I9V2 2VL9A 5H5SA 3LW9A 5AISA 1SJ6A 1NSWA 1LJRA 5GSSA 2GQMA 2HRKA 2OE0A 3ZFLA 1SJIA 4J2FA 4MJAA 3TJJA 3H1NA 1OE8A 4N11A 3FKFA 1A23A 4Q5NA 5CRGA 4KCAA 1T3BA 3F9UA 3CXGA 1V57A 5BRTA 4AJ7A 4CY6A 2GZZA 1XOAA 2AYTA 1TP9A 4IQ1A 2M80A 3FZAA 4K9ZA 4JBBA 3GX8A 2H1AA 3L9SA 2VCXA 4K6XA 2UZ8A 4D73B 3IV4A 3ZL5A 3G9BA 3C71A 3FW2A 5ECMB 4MJBA 4WEYA 4OFTA 4HU9A 3BJ5A 2C0DA 4ECBA 4D73A 3E3EA 2GQKA 3CYNA 4KA0A 3ZRDA 2I81A 1B4QA 4GXZA 3BD2A 3KMOA 1U3AA 2B5XA 2HYXA 3UIWA 4K2XA 1NHYA 2C80A 1M2AA 3ZYWA 2M72A 1J0FA 1YF0A 3P2AA 2RLIA 4TR0A 1GH2A 1K3YA 1ABAA 1G7OA 1YEXA 1ZYPA 2D2ZA 2LJAA 1XXUA 4WR5A 5DCHA 2B7KA 4ZB6A 2JACA 5IIZA 2B1KA 3QD9A 1GWCA 4KB3A 3FY7A 4EUYA 2YV9A 2VCQA 3KXOA 4Q5RA 4BWQA 1PL1A 3DD3A 1YQ1A 1ZOFA 1PGTA 1LBKA 3W8JA 1A2MA 3UAPA 3C1SA 2GSSA 1THXA 1V98A 1OC8A 1S3DA 3NIVA 4NHZA 3KGKA 2A4VA 3HHVA 3EMPA 5A5KA 5D93A 4ZBDA 2XBQA 1BQ7A 5G5EA 4YQVA 1UN2A 3GV1A 1TU7A 5IMFA 1R26A 4YQUA 5HFIA 2I1UA 1KTEA 2MBSA 2CVKA 1ML6A 1JZOA 1HNBA 3LWAA 3Q74A 5KN3A 1MDIA 2GLRA 4Z2TA 2WRTA 3ERFA 3L0HA 4WBJA 3RBTA 1O81A 1GRXA 5IMCA 3APQA 4GF0A 1YJ6A 3GFKA 4F9ZA 2YPMA 5F0GA 1XWGA 3TOUA 2FNOA 3C8EA 2MYGA 1XW6A 4ICYA 4HEA2 1XPVA 3PH9A 5ECKB 1QUWA 1SD8A 3H79A 1GL8A 2CAIA 5B8AA 4ZL9A 2LSTA 2OBIA 2H8LA 3EU3A 2ZUPA 3QAVA 1JHBA 5F05A 4YKGA 4EXJA 5JWQB 4BVYB 3N9JA 4TKYA 5A4UA 3WYWA 2XHFA 4HQSA 5EPFA 5G2ZA 3ZITA 1VGLA 5IO0A 3WT2A 1AUCA 1F37A 2B6MA 4G0IA 3DVWA 4BVYA 3ERGA 3QCPA 3IC4A 3V1WA 1ERTA 4WR4A 1Q4JA 2G0FA 5F07A 2H0GA 4WF5A 1ZGNA 1FVJA 1URMA 1SL1B 4EC0A 6GSXA 5G1LA 2PVQA 3Q18A 2LQOA 4V2MA 3PGTA 4TOPA 4O5QA 3C7MA 6GSWA 4Z2UA 3APOA 4OMVA 2IMFA 4IS0A 1PN0A 2JSZA 5ECRB 2H0IA 2VLTA 4BPYA 3LFLA 5AGYA 1PFOA 3LQ7A 1GSUA 2VOCA 2YP6A 3ERWA 3TOTA 3NOFA 1A2LA 1MD3A 2GSQA 4ECCA 1YF1A 5IM9A 3IE3A 5DAKB 1ZL9A 2VLVA 4QL9A 2DC5A 1DSBA 5DAKA 2IN3A 3CSIA 2R0CA 1NHOA 2TRCP 5ECQB 5B6MA 4XRAA 3S9FA 2R5GA 1Z7PA 3WGXA 1OYJA 5HR1A 4IW9A 3U5RE 1DBYA 2RM6A 2WULA 3GH6A 3R3EA 2C3QA 3EYTA 5KN0A 2IMKA 5DQYA 5CRWA 1R5PA 4HJ2A 1M7TA 2H71A 2VCVA 1J08A 1BX9A 1U88A 2H1GA 1O6JA 2WB9A 4LMWA 5JCUA 3L4NA 3H8QA 4I6XA 2QKEA 5FT3A 1K0BA 3FZ5A 4GQFA 2HFDA 4BA7A 3E9JB 3APSA 4XTSA 2K18A 2DJ1A 1M9AA 4EVMA 4JE1A 1SL0B 1PQNA 2WJUA 4YH2A 1EV4A 3F0IA 3FR3A 4ZILA 4EIQA 2NDOA 5J4UA 3CBUA 2DBCA 3GKKA 2JSYA 4WF4A 1S3AA 3DYRA 2PGTA 1XOBA 2AB6A 1KBNA 2GZYA 3ISOA 3TCOA 2CT6A 1T8EB 2VL3A 3FK8A 3GMFA 1JLWA 3TB2A 3F3RA 3KD0A 4TXOB 4MP4A 1E6BA 4QL7A 2B5EA 2VCZA 3A2WA 4G19A 2H75A 2HI7A 3UEMA 5GSTA 4X4JA 3EVIA 3PPUA 1YZXA 2JL4A 4TXOA 2WS2A 4Z7XA 4GCIA 3HVNA 1G6WA 3GL5A 4KAEA 5D9XA 3FEUA 1A0RP 4EO3A 4X0XA 2VL2A 3L78A 1U3IA 2I4AA 1SKWB 3M1GA 1VF3A 3IAM2 4E8HA 4G0LA 2GVPA 2O8VB 4IVFA 4PUAA 2DLXA 3C1RA 3IC8A 4MNNA 2IMIA 3KIJA 3IK7A 4EDZA 2B1LA 2L6DA 1A24A 2PN8A 3RPPA 3JCML 8GSSA 4USSA 4KE3A 1F9MA 5F06A 3ZTLA 3DWVA 1B48A 4L0UA 3W6GA 5BMUA 1NM3A 5CRHA 2DKIA 4L0WA 3BCKA 1SU9A 1HNCA 2KHPA 1O73A 3HXSA 3P90A 4G9HA 2HZEB 2AJQB 1PKZA 1FW1A 1FB0A 3GKMA 3MDKA 2CX4A 4I97A 2H72A 2PPTA 4L5OA 2FCHA 4MF7A 3KM6A 3D4MA 1SYRA 2HZEA 1M99A 2R37A 3KZQA 5F8BA 1K0DA 4K8MA 1GUKA 2H1BA 2L6CA 4WETA 3ME7A 4PX1A 16GSA 5HFGA 5CNWA 1FG4A 3QFBC 1M9BA 4KH7A 2C0GA 1K3LA 2L59A 2B3SA 2VM2A 2GZPA 1X9WB 2H66A 2VM1A 3UL3A 2RIIA 3HDCA 1Z7RA 2XBIA 1H4OA 1M3IA 3D21A 1TJDA 3CQFA 3GKNA 5G30A 3O3TA 1CQHA 1QMVA 1O8XA 1Z3EA 1H75A 3CTFA 1V58A 1Z5YE 4I5QA 3TKQA 1FVKA 1SENA 2JZTA 5H5RA 1FB6A 3GN3A 2H0HA 4NPBA 2CZ3A 3QAWA 3CMIA 6GSSA 22GSA 1S3RA 4EF0A 3VWUA 1ZMAA 1B4PA 4ACSA 2X4AA 1RK4A 4O5UA 3IXRA 4V2LA 2FWEA 4IBPA 1MDKA 2VD1A 3IBHA 4IKHA 1GSQA 1O8WA 3TKSE 5C04A 4OWYA 4AJ8A 2X8GA 2IPAA 1GTIA 4LL1B 5IOXA 2YOIA 3F4SA 4L5LA 3SWLA 1EP7A 1TU8A 3AY8A 3KEBA 4RI7A 4RQRA 1R7HA 1XWKA 3U6VA 1AW9A 4XIHA 4ZBAA 2P5QA 1VRSD 3GURA 1SKRB 3M0FA 2F9SA 3W8SA 3VPQA 2DJ0A 1OAZA 18GSA 2V6OA 4F0CA 2VO4A 4LMVA 1K0AA 1BAYA 2A2PA 3F4TA 4IELA 2JU5A 1A8YA 2TRXA 1WE0A 1ZYNA 1T4YA 3GKXA 3KTLA 4MZBA 4Z2RA 1B8XA 2NPBA 2OE1A 4MF6A 3GSSA 5DDLA 4I8BA 3CTGA 1ERWA 4P3YB 2VCWA 3KCMA 1GUHA 3TDGA 4N0VA 4PUFC 3VPTA 7GSSA 4KSMA 4K2DA 2ON7A 2X8HA 2CV4A 5D73A 4I2TA 4ZB8A 1XWBA 3TRQA 1XCCA 4G0KA 4GLTA 3TRXA 3BBYA 3IPZA 1YY7A 4J57E 2L5OA 3ZREA 4F0BA 5D8IA 5GZZB 1XIYA 2CAQA 3GX0A 6GSUA 1K0OA 3MAKA 4JR4A 4CW9A 5C00A 3TKSC 2H1DA 1FHEA 2GT5A 2LUSA 5E59A 2HNLA 4G2EA 1M0UA 4NHWA 5IOWA 2N5AA 1N8JA 3BCIA 2FWFA 3GSTA 1WIKA 5EL8A 2KP1A 1TRSA 2L4QA 2LS5A 4EDYA 1WMJA 1K0MA 3KP8A 3CSJA 1MDJA 1TRWA 1I9DA 1E2YA 1GULA 1XVWA 2EC4A 1TK0B 1XZOA 2E0QA 2GT6A 5DJMA 4KDYA 2R0GA 4GRFA 2J23A 2JADA 3F8UA 2KOKA 4LL4B 4NMUA 3QPMA 2AHEA 5JCGA 3HVXA 1PN9A 5CAXA 3HD5A 3QAGA 1Z6MA 3IHQA 3LGCA 4TXVA 2XC2A 5AIXA 4OO5A 5CYYA 4MPGA 4DSQA 4EIPA 2MBTA 2V41A 4GSSA 2QA1A 5D9TA 2CX3A 2P0GA 5LNKe 2XPDA 4IGJA 4MLYA 5ECIB 2PBJA 4IN0A 4XHMA 1YEPA 1WJKA 1GNWA 1MEKA 1W89A 2NTOA 1NW2A 2N5BA 3N5OA 2GSRA 4FO5A 3GTUB 5FWGA 4IP1A 2K8VA 3RPNA 1TK8B 2PMTA 3DVXA 2X49A 3DRNA 2L4CA 2VIMA 5IMAA 2C3TA 1K3OA 4ZIJA 3GTUA 2H6XA 1UVZA 4AJ6A 4POBA 1U87A 2ALBA 2VLUA 3D22A 1X9SB 1T00A 1V40A 1TW9A 3QFAC 5J3RA 4K1FA 1A0FA 4POMA 2DJJA 12GSA 4FIWA 4OFNA 3RHBA 4RI6A 2G2QA 2YWNA 4OFMA 2L57A 2VUPA 13GSA 2E2GA 2OE3A 10GSA 4K0GA 1XBSA 4NV2A 5INYA 1SL2B 3MIXA 2J9HA 4GTUA 3HCZA 1FOHA 5KEJA 2LKUA 1SD9A 2HXKA 9GSSA 3HJMA 2KUCA 3A5IA 3HVVA 1SKSB 3M8NA 1TOFA 4YKFA 4WXTA 3F3QA 2F51A 5JWRB 3LORA 4BWSA 1KEBA 3MWHA 2FWGA 4HZ2A 3D6IA 5A4VA 4MA9A 3RAZA 2LJKA 1PX7A 1M2DA 4ISDA 3D0ZA 4HUAA 4CHSA 4JZQA 1U6TA 3IHGA 4KDUA 1K0CA 2DJ2A 2V2GA 3A2VA 5L71A 5COHA 2K8SA 2FA4A 3WD6A 2PVOC 2BJXA 3HJPA 5IQYA 4H86A 1M3JA 2Z9SA 1AIUA 1EOGA 1RQMA 1BEDA 4BVXB 4FYCA 2NBSA 3QOUA 2YZUA 5ID2B 2HE3A 3OR5A 1ST9A 2K6VA 4KUNA 4PGTA 5G31A 4FYBA 3LG6A 2ZNMA 4BVXA 1BJXA 3NZNA 2YWMA 2IMDA 3UARA 4AF2A 5ID2A 1LU4A 2OA7A 1X5EA 1X5DA 4OCEA 2AUVA 4KCEA 3I6AA 4MH3A 1EP8A 4MJEA 3D5JA 3P7XA 4XS4B 4MH2A 3O6TA 1X0RA 1AXDA 3ME8A 2VCTA 3BOAA 4K5SA 1MTCA 1ZYEA 1DE1A 4MJCA 2DMLA 2GGTA 3FR9A 3TRPA 3ZIVA 5J9BA 4XS4A 2F8FA 1JZDA 1GSFA 3MNGA 4RQXA 3F63A 2CVDA 3D4TA 3DEXA 1GNEA 3WGEA 2HLSA 6GSYA 5LCZA 3L9VA 4MCUA 1B9XC 2XPEA 5AIVA 3CSHA 4PQHA 3UBKA 4O92A 1TRUA 4IHUA 1TI1A 3F4RA 4KW6A 4K5RA 2JZRA 4V1Ap 3FMWA 2EIQA 2C1YA 1Z9HA 3GL3A 3VFIA 6GSVA 2TIRA 2LRTA 1TTZA 1YDKA 4HI7A 5EVOA 5J9CA 5H5QA 2MZCA 3M9KA 4PNGA 1GTUA 1AQWA 1FO5A 2RM5A 4MK3A 3FZ4A 4K7OA 2H30A 4ML1A 4CDOA 3ZVJD 3IA1A 5IO2A 1WP0A 1TKDB 3TJFA 3ZIJA 4BL7B 1VF2A 3M3MA 1T1VA 2CZ2A 4LLRA 2IL3A 2YN1A 4PURA 2FUG2 5DQSA 1V2AA 1W4VA 2HSYA 2WCIA 5G5FA 3TGZA 3QR6A 5ECNB 2LRCA 2GTUA 4BL7A 4XS6A 1XWCA 2FHEA 2B7JA 4KX4A 2KLXA 1SK0A 3C73A 1TK5B 4GQCA 1GTBA 2C0FA 2GS3A 2K9FA 3UVHA 1GP1A 3ZFBA 4EKZA 2O85A 2DJ3A 4V1Ag 2GQLA 4ZBBA 4IP6A 2MMZA 3LYKA 2IWTA 3LSZA 1N2AA 3Q6OA 2DKHA 5DCGA 2FWHA 3HJOA 1BG5A 2RUFA 2FD3A 1T7PB 1QK8A 2F3MA 2HRAA 5ABRA 5IPGA 3O76A 3TKRA 4IJ3A 4YAVA 3VWVA 1AAZA 3FRCA 3SBCA 3EC3A 1M2BA 3EE2A 4ILFA 4GSTA 3ZZXA 1G6YA 1VF4A 5HQPA 3GH9A 5HR3A 2N5FA 2HZFA 4JU5A 2LNTA 2YJHA 4N10A 3VI7A 3EMXA 3GUSA 1IYIA 4G10A 4K0NA 3EPTA 2CQ9A 3IAS2
chains in the Genus database with same CATH topology
3DMLA 4Q5FA 3TJBA 4K7NA 4DEJA 2REMA 5A4WA 1F3BA 4L8EA 3ZMLA 3ZLPA 1TI3A 3HZ8A 2LTKA 5B7CA 3WGDA 1SK1A 17GSA 3MSZA 5B8BA 2C4JA 4FH8A 14GSA 4PQIA 1AQVA 2LQQA 4N30A 6GSTA 4HU7A 1ZZYA 1GTAA 3CRTA 4WBRD 4EL1A 1C72A 1XW5A 3FZ9A 1PSQA 2DIZA 2IFQB 4MPFA 5AN1A 1QQ2A 4NWYA 1F3AA 3WT1A 5HFKA 2WDUA 4TR3A 4MF5A 3G7IA 1OE7A 2X64A 2HT9A 2GDRA 2O89A 2L5LA 2A2SA 2IFQA 2YNXA 1Y25A 1GSSA 4A5PA 2E7PA 5IPHA 4IJIA 1GUMA 1Y6EA 2QGVA 3LXZA 3DGQA 1GSEA 4EE0A 1PKWA 5IMZA 2YANA 5CRDA 5DVBA 3KTBA 2BMXA 2R6KA 3IK9A 5DALB 5EY6A 4POKA 2LJRA 3LEFA 3RDWA 3H4KA 3FHKA 5B6NA 4ULXA 1EZKA 2DJKA 1A8LA 4TR4A 5DALA 4KSOA 3TUEA 1XWAA 1F2EA 2H19A 3PINA 4MDCA 2DMMA 2WZ9A 3CRUA 5E4WA 1A2JA 3EURA 4KDXA 2HSMA 3FYGA 1OKTA 1GSDA 2YJ7A 2VD0A 5HR0A 1TDIA 4MMMA 4XS1A 2IJYA 1J9BA 4WKWA 2LEGA 4ECIA 2R0PA 5IMDA 4MZWA 3HKRA 2EIOA 2FLSA 3FR6A 1JFUA 2FA8A 4JRRA 3RHCA 2R4VA 3KMNA 1PA3A 1R4WA 2YWIA 4X43A 4AGSA 1QFNA 2HRNA 3KH9A 2JZSA 2ON5A 2LRNA 3R2QA 4OD7A 4ZXGA 4Q5QA 3VWXA 5ECOB 1WRYA 5FHIA 4CY8A 4NV5A 3A3TA 2HRFA 4X1UA 2HSHA 3GNJA 1PD21 5DJLA 5DBQA 2H70A 1GSYA 3TKPA 4ZB9A 5J5NA 4JR6A 1WPIA 3LYPA 3GHAA 3QMXA 4PQ1A 4F03A 5KOXA 3KP9A 1QXHA 2VL2C 2B5YA 2EIRA 2H74A 5ENUA 5JWOB 3VLNA 2IMEA 3H93A 2M46A 5ECPB 3EWLA 4TVEA 1K0NA 1XFLA 2P5RA 1ON4A 3DKSA 2ZCTA 1B9YC 2QSIA 3GRXA 2O87A 5GAND 3A2XA 2OBKA 1TRVA 4ZL7A 1AC1A 1EV9A 4O5RA 3HYPA 3LJRA 3K8NA 1EEMA 1XW9A 1BYEA 1HYUA 3IOSA 1O7UA 3HVSA 4E8EA 3IRAA 3L9UA 4JEDA 2MMOA 3ZVJA 5ECHB 2KP2A 2OKAA 2H76A 2H6YA 5ECLB 2WGRA 4DSSB 4HZ4A 2YCDA 3EINA 4FQUA 5GAPD 5ELAA 3J7Yk 1HD2A 4YQMA 3VI5A 2LV3A 2VAFA 4DSSA 2R2JA 3G7JA 3F6DA 2BTOT 1KNGA 2FGXA 1EGOA 3PR8A 2AAWA 2DIYA 5ELGA 4DVCA 4ID0A 1MD4A 2YZHA 2A4HA 3TJGA 3VK9A 1SK2A 3UVTA 3ZMKA 2OADA 2QA2A 1F6MC 3G7YA 4POLA 2YWOA 2V32A 4KF9A 2WFCA 1EGRA 4LA1A 1EEJA 4KGIA 2I3YA 2F8AA 5D9WA 2C0EA 5D96A 2H6ZA 3VWWA 2PERA 1YKCA 4TRXA 3UOMA 1FAAA 4ML6A 3QDNA 4HS1A 2V1MA 1SJZA 3EU4A 5CREA 1WWJA 1RW1A 1PMTA 2MMAA 4TN8A 3LXTA 5CP1A 3IR4A 1JLVA 2CVBA 1X9MB 1AQXA 1ERUA 4J56E 1TXXA 2C3NA 2P31A 2OJLA 4NAXA 1IYHA 3HY2A 3KH7A 2ES7A 3F6FA 1ZCPA 1CQGA 1X5CA 3TKSA 2OACA 4IQAA 4HQZA 2IIYA 2RUEA 4N0ZA 3GIXA 2H73A 4KNDA 5CO3A 4O32A 4ZL8A 1UC7A 2MMNA 3UJ1A 4XCSA 1ILOA 3MYDA 1PX6A 2FY6A 3VURA 4TW5A 4HDEA 1OVNA 3US3A 2E2MA 4F2IA 3DIEA 2C8UA 1DUGA 4RUVA 1JZWA 1JZRA 2V6KA 4OCFA 3E0UA 4MABA 4TR1B 5KOWA 2LNSA 2CA8A 1USBA 2A2RA 1S3CA 2R3XA 3HZ4A 2X99A 1YKAA 2PWJA 1PRXA 2YV7A 3IDVA 4TR1A 1OC3A 3GA4A 4NXIA 1I5GA 4V2NA 2PUKC 1XVQA 1UA5A 3UBLA 1VF1A 1OC9B 1OKDA 4K7IA 5HR2A 2NVLA 4PTSA 2I9HA 2X8CA 4HJMA 4GSNA 3P8WA 1O85A 3TJKA 3I69A 5IMVA 2PU9C 1HQOA 1R5AA 4MZCA 3M9JA 1OC9A 1HNAA 2QC7A 1G0TA 1EWXA 3HA9A 4ECJA 1FOVA 1SYXA 4GWRA 4XRDA 4PNFA 1WOUA 1Z6NA 4OO4A 5JCWA 1GLPA 2O7KA 1V9WA 5LD0A 1THOA 19GSA 2GSTA 3I43A 4F82A 1QGVA 5KN1A 3A5WA 3J7Yb 5ECSA 4PXOA 4FYUA 4DSRA 11GSA 1DE2A 1ERVA 1GLQA 4YAPA 5D9VA 1ZYQB 5J41A 3Q19A 1ACVA 1T4ZA 5G1KA 4O7HA 4I2UA 3KJYA 2DSAA 4HOJA 1EOHA 20GSA 3UMAA 1Q98A 5KN2A 1G7EA 2AV4A 3GYKA 3DXBA 3ED3A 4QQ7A 1PL2A 2H01A 3I9V2 2VL9A 5H5SA 3LW9A 5AISA 1SJ6A 1NSWA 1LJRA 5GSSA 2GQMA 2HRKA 2OE0A 3ZFLA 1SJIA 4J2FA 4MJAA 3TJJA 3H1NA 1OE8A 4N11A 3FKFA 1A23A 4Q5NA 5CRGA 4KCAA 1T3BA 3F9UA 3CXGA 1V57A 5BRTA 4AJ7A 4CY6A 2GZZA 1XOAA 2AYTA 1TP9A 4IQ1A 2M80A 3FZAA 4K9ZA 4JBBA 3GX8A 2H1AA 3L9SA 2VCXA 4K6XA 2UZ8A 4D73B 3IV4A 3ZL5A 3G9BA 3C71A 3FW2A 5ECMB 4MJBA 4WEYA 4OFTA 4HU9A 3BJ5A 2C0DA 4ECBA 4D73A 3E3EA 2GQKA 3CYNA 4KA0A 3ZRDA 2I81A 1B4QA 4GXZA 3BD2A 3KMOA 1U3AA 2B5XA 2HYXA 3UIWA 4K2XA 1NHYA 2C80A 1M2AA 3ZYWA 2M72A 1J0FA 1YF0A 3P2AA 2RLIA 4TR0A 1GH2A 1K3YA 1ABAA 1G7OA 1YEXA 1ZYPA 2D2ZA 2LJAA 1XXUA 4WR5A 5DCHA 2B7KA 4ZB6A 2JACA 5IIZA 2B1KA 3QD9A 1GWCA 4KB3A 3FY7A 4EUYA 2YV9A 2VCQA 3KXOA 4Q5RA 4BWQA 1PL1A 3DD3A 1YQ1A 1ZOFA 1PGTA 1LBKA 3W8JA 1A2MA 3UAPA 3C1SA 2GSSA 1THXA 1V98A 1OC8A 1S3DA 3NIVA 4NHZA 3KGKA 2A4VA 3HHVA 3EMPA 5A5KA 5D93A 4ZBDA 2XBQA 1BQ7A 5G5EA 4YQVA 1UN2A 3GV1A 1TU7A 5IMFA 1R26A 4YQUA 5HFIA 2I1UA 1KTEA 2MBSA 2CVKA 1ML6A 1JZOA 1HNBA 3LWAA 3Q74A 5KN3A 1MDIA 2GLRA 4Z2TA 2WRTA 3ERFA 3L0HA 4WBJA 3RBTA 1O81A 1GRXA 5IMCA 3APQA 4GF0A 1YJ6A 3GFKA 4F9ZA 2YPMA 5F0GA 1XWGA 3TOUA 2FNOA 3C8EA 2MYGA 1XW6A 4ICYA 4HEA2 1XPVA 3PH9A 5ECKB 1QUWA 1SD8A 3H79A 1GL8A 2CAIA 5B8AA 4ZL9A 2LSTA 2OBIA 2H8LA 3EU3A 2ZUPA 3QAVA 1JHBA 5F05A 4YKGA 4EXJA 5JWQB 4BVYB 3N9JA 4TKYA 5A4UA 3WYWA 2XHFA 4HQSA 5EPFA 5G2ZA 3ZITA 1VGLA 5IO0A 3WT2A 1AUCA 1F37A 2B6MA 4G0IA 3DVWA 4BVYA 3ERGA 3QCPA 3IC4A 3V1WA 1ERTA 4WR4A 1Q4JA 2G0FA 5F07A 2H0GA 4WF5A 1ZGNA 1FVJA 1URMA 1SL1B 4EC0A 6GSXA 5G1LA 2PVQA 3Q18A 2LQOA 4V2MA 3PGTA 4TOPA 4O5QA 3C7MA 6GSWA 4Z2UA 3APOA 4OMVA 2IMFA 4IS0A 1PN0A 2JSZA 5ECRB 2H0IA 2VLTA 4BPYA 3LFLA 5AGYA 3LQ7A 1GSUA 2VOCA 2YP6A 3ERWA 3TOTA 3NOFA 1A2LA 1MD3A 2GSQA 4ECCA 1YF1A 5IM9A 3IE3A 5DAKB 1ZL9A 2VLVA 4QL9A 2DC5A 1DSBA 5DAKA 2IN3A 3CSIA 2R0CA 1NHOA 2TRCP 5ECQB 5B6MA 4XRAA 3S9FA 2R5GA 1Z7PA 3WGXA 1OYJA 5HR1A 4IW9A 3U5RE 1DBYA 2RM6A 2WULA 3GH6A 3R3EA 2C3QA 3EYTA 5KN0A 2IMKA 5DQYA 5CRWA 1R5PA 4HJ2A 1M7TA 2H71A 2VCVA 1J08A 1BX9A 1U88A 2H1GA 1O6JA 2WB9A 4LMWA 5JCUA 3L4NA 3H8QA 4I6XA 2QKEA 5FT3A 1K0BA 3FZ5A 4GQFA 2HFDA 4BA7A 3E9JB 3APSA 4XTSA 2K18A 2DJ1A 1M9AA 4EVMA 4JE1A 1SL0B 1PQNA 2WJUA 4YH2A 1EV4A 3F0IA 3FR3A 4ZILA 4EIQA 2NDOA 5J4UA 3CBUA 2DBCA 3GKKA 2JSYA 4WF4A 1S3AA 3DYRA 2PGTA 1XOBA 2AB6A 1KBNA 2GZYA 3ISOA 3TCOA 2CT6A 1T8EB 2VL3A 3FK8A 3GMFA 1JLWA 3TB2A 3F3RA 3KD0A 4TXOB 4MP4A 1E6BA 4QL7A 2B5EA 2VCZA 3A2WA 4G19A 2H75A 2HI7A 3UEMA 5GSTA 4X4JA 3EVIA 3PPUA 1YZXA 2JL4A 4TXOA 2WS2A 4Z7XA 4GCIA 1G6WA 3GL5A 4KAEA 5D9XA 3FEUA 1A0RP 4EO3A 4X0XA 2VL2A 3L78A 1U3IA 2I4AA 1SKWB 3M1GA 1VF3A 3IAM2 4E8HA 4G0LA 2GVPA 2O8VB 4IVFA 4PUAA 2DLXA 3C1RA 3IC8A 4MNNA 2IMIA 3KIJA 3IK7A 4EDZA 2B1LA 2L6DA 1A24A 2PN8A 3RPPA 3JCML 8GSSA 4USSA 4KE3A 1F9MA 5F06A 3ZTLA 3DWVA 1B48A 4L0UA 3W6GA 5BMUA 1NM3A 5CRHA 2DKIA 4L0WA 3BCKA 1SU9A 1HNCA 2KHPA 1O73A 3HXSA 3P90A 4G9HA 2HZEB 2AJQB 1PKZA 1FW1A 1FB0A 3GKMA 3MDKA 2CX4A 4I97A 2H72A 2PPTA 4L5OA 2FCHA 4MF7A 3KM6A 3D4MA 1SYRA 2HZEA 1M99A 2R37A 3KZQA 5F8BA 1K0DA 4K8MA 1GUKA 2H1BA 2L6CA 4WETA 3ME7A 4PX1A 16GSA 5HFGA 5CNWA 1FG4A 3QFBC 1M9BA 4KH7A 2C0GA 1K3LA 2L59A 2B3SA 2VM2A 2GZPA 1X9WB 2H66A 2VM1A 3UL3A 2RIIA 3HDCA 1Z7RA 2XBIA 1H4OA 3D21A 1TJDA 3GKNA 5G30A 3O3TA 1CQHA 1QMVA 1O8XA 1Z3EA 1H75A 3CTFA 1V58A 1Z5YE 4I5QA 3TKQA 1FVKA 1SENA 2JZTA 5H5RA 1FB6A 3GN3A 2H0HA 4NPBA 2CZ3A 3QAWA 3CMIA 6GSSA 22GSA 4EF0A 3VWUA 1ZMAA 1B4PA 4ACSA 2X4AA 1RK4A 4O5UA 3IXRA 4V2LA 2FWEA 4IBPA 1MDKA 2VD1A 3IBHA 4IKHA 1GSQA 1O8WA 3TKSE 5C04A 4OWYA 4AJ8A 2X8GA 2IPAA 1GTIA 4LL1B 5IOXA 2YOIA 3F4SA 4L5LA 3SWLA 1EP7A 1TU8A 3AY8A 3KEBA 4RI7A 4RQRA 1R7HA 1XWKA 3U6VA 1AW9A 4XIHA 4ZBAA 2P5QA 1VRSD 3GURA 1SKRB 3M0FA 2F9SA 3W8SA 3VPQA 2DJ0A 1OAZA 18GSA 2V6OA 4F0CA 2VO4A 4LMVA 1K0AA 1BAYA 2A2PA 3F4TA 4IELA 2JU5A 1A8YA 2TRXA 1WE0A 1ZYNA 1T4YA 3GKXA 3KTLA 4MZBA 4Z2RA 1B8XA 2NPBA 2OE1A 4MF6A 3GSSA 5DDLA 4I8BA 3CTGA 1ERWA 4P3YB 2VCWA 3KCMA 1GUHA 3TDGA 4N0VA 4PUFC 3VPTA 7GSSA 4KSMA 4K2DA 2ON7A 2X8HA 2CV4A 5D73A 4I2TA 4ZB8A 1XWBA 3TRQA 1XCCA 4G0KA 4GLTA 3TRXA 3BBYA 3IPZA 1YY7A 4J57E 2L5OA 3ZREA 4F0BA 5D8IA 5GZZB 1XIYA 2CAQA 3GX0A 6GSUA 1K0OA 3MAKA 4JR4A 4CW9A 5C00A 3TKSC 2H1DA 1FHEA 2GT5A 2LUSA 5E59A 2HNLA 4G2EA 1M0UA 4NHWA 5IOWA 2N5AA 1N8JA 3BCIA 2FWFA 3GSTA 1WIKA 5EL8A 2KP1A 1TRSA 2L4QA 2LS5A 4EDYA 1WMJA 1K0MA 3KP8A 3CSJA 1MDJA 1TRWA 1I9DA 1E2YA 1GULA 1XVWA 2EC4A 1TK0B 1XZOA 2E0QA 2GT6A 5DJMA 4KDYA 2R0GA 4GRFA 2J23A 2JADA 3F8UA 2KOKA 4LL4B 4NMUA 3QPMA 2AHEA 5JCGA 3HVXA 1PN9A 5CAXA 3HD5A 3QAGA 1Z6MA 3IHQA 3LGCA 4TXVA 2XC2A 5AIXA 4OO5A 5CYYA 4MPGA 4DSQA 4EIPA 2MBTA 2V41A 4GSSA 2QA1A 5D9TA 2CX3A 2P0GA 5LNKe 2XPDA 4IGJA 4MLYA 5ECIB 2PBJA 4IN0A 4XHMA 1YEPA 1WJKA 1GNWA 1MEKA 1W89A 2NTOA 1NW2A 2N5BA 3N5OA 2GSRA 4FO5A 3GTUB 5FWGA 4IP1A 2K8VA 3RPNA 1TK8B 2PMTA 3DVXA 2X49A 3DRNA 2L4CA 2VIMA 5IMAA 2C3TA 1K3OA 4ZIJA 3GTUA 2H6XA 1UVZA 4AJ6A 4POBA 1U87A 2ALBA 2VLUA 3D22A 1X9SB 1T00A 1V40A 1TW9A 3QFAC 5J3RA 4K1FA 1A0FA 4POMA 2DJJA 12GSA 4FIWA 4OFNA 3RHBA 4RI6A 2G2QA 2YWNA 4OFMA 2L57A 2VUPA 13GSA 2E2GA 2OE3A 10GSA 4K0GA 1XBSA 4NV2A 5INYA 1SL2B 3MIXA 2J9HA 4GTUA 3HCZA 1FOHA 5KEJA 2LKUA 1SD9A 2HXKA 9GSSA 3HJMA 2KUCA 3A5IA 3HVVA 1SKSB 3M8NA 1TOFA 4YKFA 4WXTA 3F3QA 2F51A 5JWRB 3LORA 4BWSA 1KEBA 3MWHA 2FWGA 4HZ2A 3D6IA 5A4VA 4MA9A 3RAZA 2LJKA 1PX7A 1M2DA 4ISDA 3D0ZA 4HUAA 4CHSA 4JZQA 1U6TA 3IHGA 4KDUA 1K0CA 2DJ2A 2V2GA 3A2VA 5L71A 5COHA 2K8SA 2FA4A 3WD6A 2PVOC 2BJXA 3HJPA 5IQYA 4H86A 2Z9SA 1AIUA 1EOGA 1RQMA 1BEDA 4BVXB 4FYCA 2NBSA 3QOUA 2YZUA 5ID2B 2HE3A 3OR5A 1ST9A 2K6VA 4KUNA 4PGTA 5G31A 4FYBA 3LG6A 2ZNMA 4BVXA 1BJXA 3NZNA 2YWMA 2IMDA 3UARA 4AF2A 5ID2A 1LU4A 2OA7A 1X5EA 1X5DA 4OCEA 2AUVA 4KCEA 3I6AA 4MH3A 1EP8A 4MJEA 3D5JA 3P7XA 4XS4B 4MH2A 3O6TA 1X0RA 1AXDA 3ME8A 2VCTA 3BOAA 4K5SA 1MTCA 1ZYEA 1DE1A 4MJCA 2DMLA 2GGTA 3FR9A 3TRPA 3ZIVA 5J9BA 4XS4A 2F8FA 1JZDA 1GSFA 3MNGA 4RQXA 3F63A 2CVDA 3D4TA 3DEXA 1GNEA 3WGEA 2HLSA 6GSYA 5LCZA 3L9VA 4MCUA 1B9XC 2XPEA 5AIVA 3CSHA 4PQHA 3UBKA 4O92A 1TRUA 4IHUA 1TI1A 3F4RA 4KW6A 4K5RA 2JZRA 4V1Ap 3FMWA 2EIQA 2C1YA 1Z9HA 3GL3A 3VFIA 6GSVA 2TIRA 2LRTA 1TTZA 1YDKA 4HI7A 5EVOA 5J9CA 5H5QA 2MZCA 3M9KA 4PNGA 1GTUA 1AQWA 1FO5A 2RM5A 4MK3A 3FZ4A 4K7OA 2H30A 4ML1A 4CDOA 3ZVJD 3IA1A 5IO2A 1WP0A 1TKDB 3TJFA 3ZIJA 4BL7B 1VF2A 3M3MA 1T1VA 2CZ2A 4LLRA 2IL3A 2YN1A 4PURA 2FUG2 5DQSA 1V2AA 1W4VA 2HSYA 2WCIA 5G5FA 3TGZA 3QR6A 5ECNB 2LRCA 2GTUA 4BL7A 4XS6A 1XWCA 2FHEA 2B7JA 4KX4A 2KLXA 1SK0A 3C73A 1TK5B 4GQCA 1GTBA 2C0FA 2GS3A 2K9FA 3UVHA 1GP1A 3ZFBA 4EKZA 2O85A 2DJ3A 4V1Ag 2GQLA 4ZBBA 4IP6A 2MMZA 3LYKA 2IWTA 3LSZA 1N2AA 3Q6OA 2DKHA 5DCGA 2FWHA 3HJOA 1BG5A 2RUFA 2FD3A 1T7PB 1QK8A 2F3MA 2HRAA 5ABRA 5IPGA 3O76A 3TKRA 4IJ3A 4YAVA 3VWVA 1AAZA 3FRCA 3SBCA 3EC3A 1M2BA 3EE2A 4ILFA 4GSTA 3ZZXA 1G6YA 1VF4A 5HQPA 3GH9A 5HR3A 2N5FA 2HZFA 4JU5A 2LNTA 2YJHA 4N10A 3VI7A 3EMXA 3GUSA 1IYIA 4G10A 4K0NA 3EPTA 2CQ9A 3IAS2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DML A;  4Q5F A;  3TJB A;  4K7N A;  4DEJ A;  2REM A;  5A4W A;  1F3B A;  4L8E A;  3ZML A;  3ZLP A;  1TI3 A;  3HZ8 A;  2LTK A;  5B7C A;  3WGD A;  1SK1 A;  17GS A;  3MSZ A;  5B8B A;  2C4J A;  4FH8 A;  14GS A;  4PQI A;  1AQV A;  2LQQ A;  4N30 A;  6GST A;  4HU7 A;  1ZZY A;  1GTA A;  3CRT A;  4WBR D;  4EL1 A;  1C72 A;  1XW5 A;  3FZ9 A;  1PSQ A;  2DIZ A;  2IFQ B;  4MPF A;  5AN1 A;  1QQ2 A;  4NWY A;  1F3A A;  3WT1 A;  5HFK A;  2WDU A;  4TR3 A;  4MF5 A;  3G7I A;  1OE7 A;  2X64 A;  2HT9 A;  2GDR A;  2O89 A;  2L5L A;  2A2S A;  2IFQ A;  2YNX A;  1Y25 A;  1GSS A;  2E7P A;  5IPH A;  4IJI A;  1GUM A;  1Y6E A;  2QGV A;  3LXZ A;  3DGQ A;  1GSE A;  4EE0 A;  1PKW A;  5IMZ A;  2YAN A;  5CRD A;  5DVB A;  3KTB A;  2BMX A;  2R6K A;  3IK9 A;  5DAL B;  5EY6 A;  4POK A;  2LJR A;  3LEF A;  3RDW A;  3H4K A;  3FHK A;  5B6N A;  4ULX A;  1EZK A;  2DJK A;  1A8L A;  4TR4 A;  5DAL A;  4KSO A;  3TUE A;  1XWA A;  1F2E A;  2H19 A;  3PIN A;  4MDC A;  2DMM A;  2WZ9 A;  3CRU A;  5E4W A;  1A2J A;  3EUR A;  4KDX A;  3FYG A;  1OKT A;  1GSD A;  2YJ7 A;  2VD0 A;  5HR0 A;  1TDI A;  4MMM A;  4XS1 A;  2IJY A;  1J9B A;  4WKW A;  2LEG A;  4ECI A;  5IMD A;  4MZW A;  3HKR A;  2EIO A;  2FLS A;  3FR6 A;  1JFU A;  2FA8 A;  4JRR A;  3RHC A;  2R4V A;  3KMN A;  1PA3 A;  1R4W A;  2YWI A;  4X43 A;  4AGS A;  1QFN A;  2HRN A;  3KH9 A;  2JZS A;  2ON5 A;  2LRN A;  3R2Q A;  4OD7 A;  4ZXG A;  4Q5Q A;  3VWX A;  5ECO B;  1WRY A;  5FHI A;  4NV5 A;  3A3T A;  2HRF A;  4X1U A;  2HSH A;  3GNJ A;  1PD2 1;  5DJL A;  5DBQ A;  2H70 A;  1GSY A;  3TKP A;  4ZB9 A;  5J5N A;  4JR6 A;  1WPI A;  3LYP A;  3GHA A;  3QMX A;  4PQ1 A;  4F03 A;  3KP9 A;  1QXH A;  2VL2 C;  2B5Y A;  2EIR A;  2H74 A;  5ENU A;  5JWO B;  3VLN A;  2IME A;  3H93 A;  2M46 A;  5ECP B;  3EWL A;  4TVE A;  1K0N A;  1XFL A;  2P5R A;  1ON4 A;  3DKS A;  2ZCT A;  1B9Y C;  2QSI A;  3GRX A;  2O87 A;  5GAN D;  3A2X A;  2OBK A;  1TRV A;  4ZL7 A;  1AC1 A;  1EV9 A;  4O5R A;  3HYP A;  3LJR A;  3K8N A;  1EEM A;  1XW9 A;  1BYE A;  1HYU A;  3IOS A;  1O7U A;  3HVS A;  4E8E A;  3IRA A;  3L9U A;  4JED A;  2MMO A;  3ZVJ A;  5ECH B;  2KP2 A;  2OKA A;  2H76 A;  2H6Y A;  5ECL B;  2WGR A;  4DSS B;  4HZ4 A;  2YCD A;  3EIN A;  5GAP D;  5ELA A;  3J7Y k;  1HD2 A;  4YQM A;  3VI5 A;  2LV3 A;  2VAF A;  4DSS A;  2R2J A;  3G7J A;  3F6D A;  2BTO T;  1KNG A;  2FGX A;  1EGO A;  3PR8 A;  2AAW A;  2DIY A;  5ELG A;  4DVC A;  4ID0 A;  1MD4 A;  2YZH A;  3TJG A;  3VK9 A;  1SK2 A;  3UVT A;  3ZMK A;  2OAD A;  1F6M C;  3G7Y A;  4POL A;  2YWO A;  2V32 A;  2WFC A;  1EGR A;  4LA1 A;  1EEJ A;  4KGI A;  2I3Y A;  2F8A A;  5D9W A;  2C0E A;  5D96 A;  2H6Z A;  3VWW A;  2PER A;  1YKC A;  4TRX A;  3UOM A;  1FAA A;  4ML6 A;  3QDN A;  4HS1 A;  2V1M A;  1SJZ A;  3EU4 A;  5CRE A;  1WWJ A;  1RW1 A;  1PMT A;  2MMA A;  4TN8 A;  3LXT A;  5CP1 A;  3IR4 A;  1JLV A;  2CVB A;  1X9M B;  1AQX A;  1ERU A;  4J56 E;  1TXX A;  2C3N A;  2P31 A;  2OJL A;  4NAX A;  1IYH A;  3HY2 A;  3KH7 A;  2ES7 A;  3F6F A;  1ZCP A;  1CQG A;  1X5C A;  3TKS A;  2OAC A;  4IQA A;  4HQZ A;  2IIY A;  2RUE A;  4N0Z A;  3GIX A;  2H73 A;  4KND A;  5CO3 A;  4O32 A;  4ZL8 A;  1UC7 A;  2MMN A;  3UJ1 A;  4XCS A;  1ILO A;  1PX6 A;  2FY6 A;  3VUR A;  4TW5 A;  4HDE A;  1OVN A;  3US3 A;  2E2M A;  4F2I A;  3DIE A;  2C8U A;  1DUG A;  4RUV A;  1JZW A;  1JZR A;  2V6K A;  4OCF A;  3E0U A;  4MAB A;  4TR1 B;  2LNS A;  2CA8 A;  1USB A;  2A2R A;  1S3C A;  2R3X A;  3HZ4 A;  2X99 A;  1YKA A;  2PWJ A;  1PRX A;  2YV7 A;  3IDV A;  4TR1 A;  1OC3 A;  3GA4 A;  4NXI A;  1I5G A;  4V2N A;  2PUK C;  1XVQ A;  1UA5 A;  3UBL A;  1VF1 A;  1OC9 B;  1OKD A;  4K7I A;  5HR2 A;  2NVL A;  2I9H A;  2X8C A;  4HJM A;  4GSN A;  3P8W A;  1O85 A;  3TJK A;  3I69 A;  5IMV A;  2PU9 C;  1HQO A;  1R5A A;  4MZC A;  3M9J A;  1OC9 A;  1HNA A;  2QC7 A;  1G0T A;  1EWX A;  3HA9 A;  4ECJ A;  1FOV A;  1SYX A;  4GWR A;  4XRD A;  4PNF A;  1WOU A;  1Z6N A;  4OO4 A;  5JCW A;  1GLP A;  2O7K A;  1V9W A;  5LD0 A;  1THO A;  19GS A;  2GST A;  3I43 A;  4F82 A;  1QGV A;  5KN1 A;  3A5W A;  3J7Y b;  5ECS A;  4PXO A;  4FYU A;  4DSR A;  11GS A;  1DE2 A;  1ERV A;  1GLQ A;  4YAP A;  5D9V A;  1ZYQ B;  5J41 A;  3Q19 A;  1ACV A;  1T4Z A;  5G1K A;  4O7H A;  4I2U A;  3KJY A;  2DSA A;  4HOJ A;  1EOH A;  20GS A;  3UMA A;  1Q98 A;  5KN2 A;  1G7E A;  2AV4 A;  3GYK A;  3DXB A;  3ED3 A;  4QQ7 A;  1PL2 A;  2H01 A;  3I9V 2;  2VL9 A;  5H5S A;  5AIS A;  1SJ6 A;  1NSW A;  1LJR A;  5GSS A;  2GQM A;  2OE0 A;  3ZFL A;  1SJI A;  4J2F A;  4MJA A;  3TJJ A;  3H1N A;  1OE8 A;  4N11 A;  3FKF A;  1A23 A;  4Q5N A;  5CRG A;  4KCA A;  1T3B A;  3F9U A;  3CXG A;  1V57 A;  4AJ7 A;  2GZZ A;  1XOA A;  2AYT A;  1TP9 A;  4IQ1 A;  2M80 A;  3FZA A;  4K9Z A;  4JBB A;  3GX8 A;  2H1A A;  3L9S A;  2VCX A;  4K6X A;  4D73 B;  3IV4 A;  3ZL5 A;  3G9B A;  3C71 A;  3FW2 A;  5ECM B;  4MJB A;  4WEY A;  4OFT A;  4HU9 A;  3BJ5 A;  2C0D A;  4ECB A;  4D73 A;  3E3E A;  2GQK A;  3CYN A;  4KA0 A;  3ZRD A;  2I81 A;  1B4Q A;  4GXZ A;  3BD2 A;  3KMO A;  1U3A A;  2B5X A;  2HYX A;  3UIW A;  1NHY A;  2C80 A;  1M2A A;  3ZYW A;  2M72 A;  1J0F A;  1YF0 A;  3P2A A;  2RLI A;  4TR0 A;  1GH2 A;  1K3Y A;  1ABA A;  1G7O A;  1YEX A;  2D2Z A;  2LJA A;  1XXU A;  4WR5 A;  5DCH A;  2B7K A;  4ZB6 A;  2JAC A;  5IIZ A;  2B1K A;  3QD9 A;  1GWC A;  4KB3 A;  3FY7 A;  4EUY A;  2YV9 A;  2VCQ A;  3KXO A;  4Q5R A;  4BWQ A;  1PL1 A;  3DD3 A;  1YQ1 A;  1ZOF A;  1PGT A;  1LBK A;  3W8J A;  1A2M A;  3UAP A;  3C1S A;  2GSS A;  1THX A;  1V98 A;  1OC8 A;  1S3D A;  3NIV A;  4NHZ A;  3KGK A;  2A4V A;  3HHV A;  3EMP A;  5A5K A;  5D93 A;  4ZBD A;  2XBQ A;  1BQ7 A;  5G5E A;  4YQV A;  1UN2 A;  3GV1 A;  1TU7 A;  5IMF A;  1R26 A;  4YQU A;  5HFI A;  2I1U A;  1KTE A;  2MBS A;  2CVK A;  1ML6 A;  1JZO A;  1HNB A;  3LWA A;  3Q74 A;  5KN3 A;  1MDI A;  2GLR A;  2WRT A;  3ERF A;  3L0H A;  4WBJ A;  3RBT A;  1O81 A;  1GRX A;  5IMC A;  3APQ A;  4GF0 A;  1YJ6 A;  3GFK A;  4F9Z A;  2YPM A;  5F0G A;  1XWG A;  3TOU A;  2FNO A;  3C8E A;  2MYG A;  1XW6 A;  4HEA 2;  1XPV A;  3PH9 A;  5ECK B;  1QUW A;  1SD8 A;  3H79 A;  1GL8 A;  2CAI A;  5B8A A;  4ZL9 A;  2LST A;  2OBI A;  2H8L A;  3EU3 A;  2ZUP A;  3QAV A;  1JHB A;  5F05 A;  4EXJ A;  5JWQ B;  3N9J A;  4TKY A;  5A4U A;  3WYW A;  2XHF A;  4HQS A;  5EPF A;  5G2Z A;  3ZIT A;  1VGL A;  5IO0 A;  3WT2 A;  1AUC A;  1F37 A;  2B6M A;  3DVW A;  4BVY A;  3ERG A;  3QCP A;  3IC4 A;  3V1W A;  1ERT A;  4WR4 A;  1Q4J A;  2G0F A;  5F07 A;  2H0G A;  4WF5 A;  1ZGN A;  1FVJ A;  1URM A;  1SL1 B;  4EC0 A;  6GSX A;  5G1L A;  2PVQ A;  3Q18 A;  2LQO A;  4V2M A;  3PGT A;  4TOP A;  3C7M A;  6GSW A;  3APO A;  4OMV A;  2IMF A;  4IS0 A;  2JSZ A;  5ECR B;  2H0I A;  2VLT A;  4BPY A;  3LFL A;  5AGY A;  3LQ7 A;  1GSU A;  2VOC A;  2YP6 A;  3ERW A;  3TOT A;  3NOF A;  1A2L A;  1MD3 A;  2GSQ A;  4ECC A;  1YF1 A;  5IM9 A;  3IE3 A;  5DAK B;  1ZL9 A;  2VLV A;  4QL9 A;  2DC5 A;  1DSB A;  5DAK A;  2IN3 A;  3CSI A;  1NHO A;  2TRC P;  5ECQ B;  5B6M A;  4XRA A;  3S9F A;  2R5G A;  1Z7P A;  3WGX A;  1OYJ A;  5HR1 A;  4IW9 A;  3U5R E;  1DBY A;  2RM6 A;  2WUL A;  3GH6 A;  2C3Q A;  3EYT A;  5KN0 A;  2IMK A;  5DQY A;  5CRW A;  1R5P A;  4HJ2 A;  1M7T A;  2H71 A;  2VCV A;  1J08 A;  1BX9 A;  1U88 A;  2H1G A;  1O6J A;  2WB9 A;  4LMW A;  5JCU A;  3L4N A;  3H8Q A;  4I6X A;  2QKE A;  5FT3 A;  1K0B A;  3FZ5 A;  4GQF A;  2HFD A;  4BA7 A;  3E9J B;  3APS A;  4XTS A;  2K18 A;  2DJ1 A;  1M9A A;  4EVM A;  4JE1 A;  1SL0 B;  1PQN A;  2WJU A;  4YH2 A;  1EV4 A;  3F0I A;  3FR3 A;  4ZIL A;  2NDO A;  5J4U A;  3CBU A;  2DBC A;  3GKK A;  2JSY A;  4WF4 A;  1S3A A;  3DYR A;  2PGT A;  1XOB A;  2AB6 A;  1KBN A;  2GZY A;  3ISO A;  3TCO A;  2CT6 A;  1T8E B;  2VL3 A;  3FK8 A;  3GMF A;  1JLW A;  3TB2 A;  3F3R A;  3KD0 A;  4TXO B;  4MP4 A;  1E6B A;  4QL7 A;  2B5E A;  2VCZ A;  3A2W A;  4G19 A;  2H75 A;  2HI7 A;  3UEM A;  5GST A;  3EVI A;  1YZX A;  2JL4 A;  4TXO A;  2WS2 A;  4Z7X A;  4GCI A;  1G6W A;  3GL5 A;  4KAE A;  5D9X A;  3FEU A;  1A0R P;  4EO3 A;  4X0X A;  2VL2 A;  3L78 A;  1U3I A;  2I4A A;  1SKW B;  3M1G A;  1VF3 A;  3IAM 2;  4E8H A;  2GVP A;  2O8V B;  4IVF A;  4PUA A;  2DLX A;  3C1R A;  2IMI A;  3KIJ A;  3IK7 A;  4EDZ A;  2B1L A;  2L6D A;  1A24 A;  2PN8 A;  3RPP A;  3JCM L;  8GSS A;  4KE3 A;  1F9M A;  5F06 A;  3ZTL A;  3DWV A;  1B48 A;  4L0U A;  3W6G A;  1NM3 A;  5CRH A;  4L0W A;  3BCK A;  1SU9 A;  1HNC A;  2KHP A;  1O73 A;  3HXS A;  3P90 A;  4G9H A;  2HZE B;  2AJQ B;  1PKZ A;  1FW1 A;  1FB0 A;  3GKM A;  3MDK A;  2CX4 A;  4I97 A;  2H72 A;  2PPT A;  4L5O A;  2FCH A;  4MF7 A;  3KM6 A;  3D4M A;  1SYR A;  2HZE A;  1M99 A;  2R37 A;  3KZQ A;  5F8B A;  1K0D A;  4K8M A;  1GUK A;  2H1B A;  2L6C A;  4WET A;  3ME7 A;  4PX1 A;  16GS A;  5HFG A;  5CNW A;  1FG4 A;  3QFB C;  1M9B A;  4KH7 A;  2C0G A;  1K3L A;  2L59 A;  2B3S A;  2VM2 A;  2GZP A;  1X9W B;  2H66 A;  2VM1 A;  3UL3 A;  2RII A;  3HDC A;  1Z7R A;  2XBI A;  1H4O A;  3D21 A;  1TJD A;  3GKN A;  5G30 A;  3O3T A;  1CQH A;  1QMV A;  1O8X A;  1Z3E A;  1H75 A;  3CTF A;  1V58 A;  1Z5Y E;  4I5Q A;  3TKQ A;  1FVK A;  1SEN A;  2JZT A;  5H5R A;  1FB6 A;  3GN3 A;  2H0H A;  4NPB A;  2CZ3 A;  3QAW A;  3CMI A;  6GSS A;  22GS A;  4EF0 A;  3VWU A;  1ZMA A;  1B4P A;  4ACS A;  1RK4 A;  3IXR A;  4V2L A;  2FWE A;  4IBP A;  1MDK A;  2VD1 A;  3IBH A;  4IKH A;  1GSQ A;  1O8W A;  3TKS E;  5C04 A;  4OWY A;  4AJ8 A;  2X8G A;  2IPA A;  1GTI A;  4LL1 B;  5IOX A;  2YOI A;  3F4S A;  4L5L A;  3SWL A;  1EP7 A;  1TU8 A;  3AY8 A;  3KEB A;  4RI7 A;  4RQR A;  1R7H A;  1XWK A;  3U6V A;  1AW9 A;  4XIH A;  4ZBA A;  2P5Q A;  1VRS D;  3GUR A;  1SKR B;  3M0F A;  2F9S A;  3W8S A;  3VPQ A;  2DJ0 A;  1OAZ A;  18GS A;  2V6O A;  4F0C A;  2VO4 A;  4LMV A;  1K0A A;  1BAY A;  3F4T A;  4IEL A;  2JU5 A;  1A8Y A;  2TRX A;  1WE0 A;  1T4Y A;  3GKX A;  3KTL A;  4MZB A;  1B8X A;  2NPB A;  2OE1 A;  4MF6 A;  3GSS A;  5DDL A;  4I8B A;  3CTG A;  1ERW A;  4P3Y B;  2VCW A;  3KCM A;  1GUH A;  3TDG A;  4N0V A;  4PUF C;  3VPT A;  7GSS A;  4KSM A;  4K2D A;  2ON7 A;  2X8H A;  2CV4 A;  5D73 A;  4I2T A;  4ZB8 A;  1XWB A;  3TRQ A;  1XCC A;  4GLT A;  3TRX A;  3BBY A;  3IPZ A;  1YY7 A;  4J57 E;  2L5O A;  3ZRE A;  4F0B A;  5D8I A;  5GZZ B;  1XIY A;  2CAQ A;  3GX0 A;  6GSU A;  1K0O A;  3MAK A;  4JR4 A;  4CW9 A;  5C00 A;  3TKS C;  2H1D A;  1FHE A;  2GT5 A;  2LUS A;  5E59 A;  2HNL A;  4G2E A;  1M0U A;  4NHW A;  5IOW A;  2N5A A;  1N8J A;  3BCI A;  2FWF A;  3GST A;  1WIK A;  5EL8 A;  2KP1 A;  1TRS A;  2L4Q A;  2LS5 A;  4EDY A;  1WMJ A;  1K0M A;  3KP8 A;  3CSJ A;  1MDJ A;  1TRW A;  1I9D A;  1E2Y A;  1GUL A;  1XVW A;  2EC4 A;  1TK0 B;  1XZO A;  2E0Q A;  2GT6 A;  5DJM A;  4KDY A;  4GRF A;  2J23 A;  2JAD A;  3F8U A;  2KOK A;  4LL4 B;  4NMU A;  3QPM A;  2AHE A;  5JCG A;  3HVX A;  1PN9 A;  5CAX A;  3HD5 A;  3QAG A;  1Z6M A;  3IHQ A;  3LGC A;  4TXV A;  2XC2 A;  5AIX A;  4OO5 A;  5CYY A;  4MPG A;  4DSQ A;  2MBT A;  2V41 A;  4GSS A;  5D9T A;  5LNK e;  2CX3 A;  2P0G A;  2XPD A;  4IGJ A;  4MLY A;  5ECI B;  2PBJ A;  4IN0 A;  4XHM A;  1YEP A;  1WJK A;  1GNW A;  1MEK A;  1W89 A;  2NTO A;  1NW2 A;  2N5B A;  3N5O A;  2GSR A;  4FO5 A;  3GTU B;  5FWG A;  4IP1 A;  2K8V A;  3RPN A;  1TK8 B;  2PMT A;  3DVX A;  3DRN A;  2L4C A;  2VIM A;  5IMA A;  2C3T A;  1K3O A;  4ZIJ A;  3GTU A;  2H6X A;  1UVZ A;  4AJ6 A;  4POB A;  1U87 A;  2ALB A;  2VLU A;  3D22 A;  1X9S B;  1T00 A;  1V40 A;  1TW9 A;  3QFA C;  5J3R A;  4K1F A;  1A0F A;  4POM A;  2DJJ A;  12GS A;  4FIW A;  4OFN A;  3RHB A;  4RI6 A;  2G2Q A;  2YWN A;  4OFM A;  2L57 A;  2VUP A;  13GS A;  2E2G A;  2OE3 A;  10GS A;  4K0G A;  1XBS A;  4NV2 A;  5INY A;  1SL2 B;  2J9H A;  4GTU A;  3HCZ A;  5KEJ A;  2LKU A;  1SD9 A;  2HXK A;  9GSS A;  3HJM A;  2KUC A;  3HVV A;  1SKS B;  3M8N A;  1TOF A;  4WXT A;  3F3Q A;  2F51 A;  5JWR B;  3LOR A;  4BWS A;  1KEB A;  3MWH A;  2FWG A;  4HZ2 A;  3D6I A;  5A4V A;  4MA9 A;  3RAZ A;  2LJK A;  1PX7 A;  1M2D A;  4ISD A;  3D0Z A;  4HUA A;  4CHS A;  4JZQ A;  1U6T A;  4KDU A;  1K0C A;  2DJ2 A;  2V2G A;  3A2V A;  5L71 A;  5COH A;  2K8S A;  2FA4 A;  3WD6 A;  2PVO C;  2BJX A;  3HJP A;  5IQY A;  4H86 A;  2Z9S A;  1AIU A;  1EOG A;  1RQM A;  1BED A;  4FYC A;  2NBS A;  3QOU A;  2YZU A;  5ID2 B;  2HE3 A;  3OR5 A;  1ST9 A;  2K6V A;  4KUN A;  4PGT A;  5G31 A;  4FYB A;  3LG6 A;  2ZNM A;  4BVX A;  1BJX A;  3NZN A;  2YWM A;  2IMD A;  3UAR A;  4AF2 A;  5ID2 A;  1LU4 A;  2OA7 A;  1X5E A;  1X5D A;  4OCE A;  2AUV A;  4KCE A;  3I6A A;  4MH3 A;  1EP8 A;  4MJE A;  3D5J A;  3P7X A;  4XS4 B;  4MH2 A;  3O6T A;  1X0R A;  1AXD A;  3ME8 A;  2VCT A;  3BOA A;  1MTC A;  1ZYE A;  1DE1 A;  4MJC A;  2DML A;  2GGT A;  3FR9 A;  3TRP A;  3ZIV A;  5J9B A;  4XS4 A;  2F8F A;  1JZD A;  1GSF A;  3MNG A;  4RQX A;  3F63 A;  2CVD A;  3D4T A;  3DEX A;  1GNE A;  3WGE A;  2HLS A;  6GSY A;  5LCZ A;  3L9V A;  4MCU A;  1B9X C;  2XPE A;  5AIV A;  3CSH A;  4PQH A;  3UBK A;  4O92 A;  1TRU A;  4IHU A;  1TI1 A;  3F4R A;  4KW6 A;  2JZR A;  4V1A p;  2EIQ A;  2C1Y A;  1Z9H A;  3GL3 A;  3VFI A;  6GSV A;  2TIR A;  2LRT A;  1TTZ A;  1YDK A;  4HI7 A;  5EVO A;  5J9C A;  5H5Q A;  2MZC A;  3M9K A;  4PNG A;  1GTU A;  1AQW A;  1FO5 A;  2RM5 A;  4MK3 A;  3FZ4 A;  4K7O A;  2H30 A;  4ML1 A;  4CDO A;  3ZVJ D;  3IA1 A;  5IO2 A;  1WP0 A;  1TKD B;  3TJF A;  3ZIJ A;  1VF2 A;  3M3M A;  1T1V A;  2CZ2 A;  4LLR A;  2IL3 A;  2YN1 A;  4PUR A;  2FUG 2;  5DQS A;  1V2A A;  1W4V A;  2HSY A;  2WCI A;  5G5F A;  3TGZ A;  3QR6 A;  5ECN B;  2LRC A;  2GTU A;  4BL7 A;  4XS6 A;  1XWC A;  2FHE A;  2B7J A;  4KX4 A;  2KLX A;  1SK0 A;  3C73 A;  1TK5 B;  4GQC A;  1GTB A;  2C0F A;  2GS3 A;  2K9F A;  3UVH A;  1GP1 A;  3ZFB A;  4EKZ A;  2O85 A;  2DJ3 A;  4V1A g;  2GQL A;  4ZBB A;  4IP6 A;  2MMZ A;  3LYK A;  2IWT A;  3LSZ A;  1N2A A;  3Q6O A;  5DCG A;  2FWH A;  3HJO A;  1BG5 A;  2RUF A;  2FD3 A;  1T7P B;  1QK8 A;  2F3M A;  5ABR A;  5IPG A;  3O76 A;  3TKR A;  4IJ3 A;  4YAV A;  3VWV A;  1AAZ A;  3FRC A;  3SBC A;  3EC3 A;  1M2B A;  3EE2 A;  4ILF A;  4GST A;  3ZZX A;  1G6Y A;  1VF4 A;  5HQP A;  3GH9 A;  5HR3 A;  2N5F A;  2HZF A;  4JU5 A;  2LNT A;  2YJH A;  4N10 A;  3VI7 A;  3EMX A;  3GUS A;  1IYI A;  4G10 A;  4K0N A;  2CQ9 A;  3IAS 2; 
#chains in the Genus database with same CATH topology
 3DML A;  4Q5F A;  3TJB A;  4K7N A;  4DEJ A;  2REM A;  5A4W A;  1F3B A;  4L8E A;  3ZML A;  3ZLP A;  1TI3 A;  3HZ8 A;  2LTK A;  5B7C A;  3WGD A;  1SK1 A;  17GS A;  3MSZ A;  5B8B A;  2C4J A;  4FH8 A;  14GS A;  4PQI A;  1AQV A;  2LQQ A;  4N30 A;  6GST A;  4HU7 A;  1ZZY A;  1GTA A;  3CRT A;  4WBR D;  4EL1 A;  1C72 A;  1XW5 A;  3FZ9 A;  1PSQ A;  2DIZ A;  2IFQ B;  4MPF A;  5AN1 A;  1QQ2 A;  4NWY A;  1F3A A;  3WT1 A;  5HFK A;  2WDU A;  4TR3 A;  4MF5 A;  3G7I A;  1OE7 A;  2X64 A;  2HT9 A;  2GDR A;  2O89 A;  2L5L A;  2A2S A;  2IFQ A;  4HSC X;  2YNX A;  1Y25 A;  1GSS A;  4A5P A;  2E7P A;  5IPH A;  4IJI A;  1GUM A;  1Y6E A;  2QGV A;  3LXZ A;  3DGQ A;  1GSE A;  4EE0 A;  1PKW A;  5IMZ A;  2YAN A;  5CRD A;  5DVB A;  3KTB A;  2BMX A;  2R6K A;  3IK9 A;  5DAL B;  5EY6 A;  4POK A;  2LJR A;  3LEF A;  3RDW A;  3H4K A;  3FHK A;  5B6N A;  4ULX A;  1EZK A;  2DJK A;  1A8L A;  4TR4 A;  5DAL A;  4KSO A;  3TUE A;  1XWA A;  1F2E A;  2H19 A;  3PIN A;  4MDC A;  2DMM A;  2WZ9 A;  3CRU A;  5E4W A;  1A2J A;  3EUR A;  4KDX A;  2HSM A;  3FYG A;  4BIK A;  1OKT A;  1GSD A;  2YJ7 A;  2VD0 A;  5HR0 A;  1TDI A;  4MMM A;  4XS1 A;  2IJY A;  1J9B A;  4WKW A;  2LEG A;  4ECI A;  2R0P A;  5IMD A;  4MZW A;  3HKR A;  2EIO A;  2FLS A;  3FR6 A;  1JFU A;  2FA8 A;  4JRR A;  3RHC A;  2R4V A;  3KMN A;  1PA3 A;  1R4W A;  2YWI A;  4X43 A;  4AGS A;  1QFN A;  2HRN A;  3KH9 A;  2JZS A;  2ON5 A;  2LRN A;  3R2Q A;  4OD7 A;  4ZXG A;  4Q5Q A;  3VWX A;  5ECO B;  1WRY A;  5FHI A;  4CY8 A;  4NV5 A;  3A3T A;  2HRF A;  4X1U A;  2HSH A;  3GNJ A;  1PD2 1;  5DJL A;  5DBQ A;  2H70 A;  1GSY A;  3TKP A;  4ZB9 A;  5J5N A;  4JR6 A;  1WPI A;  3LYP A;  3GHA A;  3QMX A;  4PQ1 A;  4F03 A;  5KOX A;  3KP9 A;  1QXH A;  2VL2 C;  2B5Y A;  2EIR A;  2H74 A;  5ENU A;  5JWO B;  3VLN A;  2IME A;  3H93 A;  2M46 A;  5ECP B;  3EWL A;  4TVE A;  1K0N A;  1XFL A;  2P5R A;  1ON4 A;  3DKS A;  2ZCT A;  1B9Y C;  2QSI A;  3GRX A;  2O87 A;  1XG8 A;  5GAN D;  3A2X A;  2OBK A;  1TRV A;  4ZL7 A;  1AC1 A;  1EV9 A;  4O5R A;  3HYP A;  3LJR A;  3K8N A;  1EEM A;  1XW9 A;  1BYE A;  1HYU A;  3IOS A;  1O7U A;  3HVS A;  4E8E A;  3IRA A;  3L9U A;  4JED A;  2MMO A;  3ZVJ A;  5ECH B;  2KP2 A;  2OKA A;  2H76 A;  2H6Y A;  5ECL B;  2WGR A;  4DSS B;  4HZ4 A;  2YCD A;  3EIN A;  4FQU A;  5GAP D;  5ELA A;  3J7Y k;  1HD2 A;  4YQM A;  3VI5 A;  2LV3 A;  2VAF A;  4DSS A;  2R2J A;  3G7J A;  3F6D A;  2BTO T;  1KNG A;  2FGX A;  1EGO A;  3PR8 A;  2AAW A;  2DIY A;  5ELG A;  4DVC A;  4ID0 A;  1MD4 A;  2YZH A;  2A4H A;  3TJG A;  3VK9 A;  1SK2 A;  3UVT A;  3ZMK A;  2OAD A;  2QA2 A;  1F6M C;  3G7Y A;  4POL A;  2YWO A;  2V32 A;  4KF9 A;  2WFC A;  1EGR A;  4LA1 A;  1EEJ A;  4KGI A;  2I3Y A;  2F8A A;  5D9W A;  2C0E A;  5D96 A;  2H6Z A;  3VWW A;  2PER A;  1YKC A;  4TRX A;  3UOM A;  1FAA A;  4ML6 A;  3QDN A;  4HS1 A;  2V1M A;  1SJZ A;  3EU4 A;  5CRE A;  1WWJ A;  1RW1 A;  1PMT A;  2MMA A;  4TN8 A;  3LXT A;  5CP1 A;  3IR4 A;  1JLV A;  2CVB A;  1X9M B;  1AQX A;  1ERU A;  4J56 E;  1TXX A;  2C3N A;  2P31 A;  2OJL A;  4NAX A;  1IYH A;  3HY2 A;  3KH7 A;  2ES7 A;  3F6F A;  1ZCP A;  1CQG A;  1X5C A;  3TKS A;  2OAC A;  4IQA A;  4HQZ A;  2IIY A;  2RUE A;  4N0Z A;  3GIX A;  2H73 A;  4KND A;  5CO3 A;  4O32 A;  4ZL8 A;  1UC7 A;  2MMN A;  3UJ1 A;  4XCS A;  1ILO A;  3MYD A;  1PX6 A;  2FY6 A;  3VUR A;  4TW5 A;  4HDE A;  1OVN A;  3US3 A;  2E2M A;  4F2I A;  3DIE A;  2C8U A;  1DUG A;  4RUV A;  1JZW A;  1JZR A;  2V6K A;  4OCF A;  3E0U A;  4MAB A;  4TR1 B;  5KOW A;  2LNS A;  2CA8 A;  1USB A;  2A2R A;  1S3C A;  2R3X A;  3HZ4 A;  2X99 A;  1YKA A;  2PWJ A;  1PRX A;  2YV7 A;  3IDV A;  4TR1 A;  1OC3 A;  3GA4 A;  4NXI A;  1I5G A;  4V2N A;  2PUK C;  1XVQ A;  1UA5 A;  3UBL A;  1VF1 A;  1OC9 B;  1OKD A;  4K7I A;  5HR2 A;  2NVL A;  4PTS A;  2I9H A;  2X8C A;  4HJM A;  4GSN A;  3P8W A;  1O85 A;  3TJK A;  3I69 A;  5IMV A;  2PU9 C;  1HQO A;  1R5A A;  4MZC A;  3M9J A;  1OC9 A;  1HNA A;  2QC7 A;  1G0T A;  1EWX A;  3HA9 A;  4ECJ A;  1FOV A;  1SYX A;  4GWR A;  4XRD A;  4PNF A;  1WOU A;  1Z6N A;  4OO4 A;  5JCW A;  1GLP A;  2O7K A;  1V9W A;  5LD0 A;  1THO A;  19GS A;  2GST A;  3I43 A;  4F82 A;  1QGV A;  5KN1 A;  3A5W A;  3J7Y b;  5ECS A;  4PXO A;  4FYU A;  4DSR A;  11GS A;  1DE2 A;  1ERV A;  1GLQ A;  4YAP A;  5D9V A;  1ZYQ B;  5J41 A;  3Q19 A;  1ACV A;  1T4Z A;  5G1K A;  4O7H A;  4I2U A;  3KJY A;  2DSA A;  4HOJ A;  1EOH A;  20GS A;  3UMA A;  1Q98 A;  5KN2 A;  1G7E A;  2AV4 A;  3GYK A;  3DXB A;  3ED3 A;  4QQ7 A;  1PL2 A;  2H01 A;  3I9V 2;  2VL9 A;  5H5S A;  3LW9 A;  5AIS A;  1SJ6 A;  1NSW A;  1LJR A;  5GSS A;  2GQM A;  2HRK A;  2OE0 A;  3ZFL A;  1SJI A;  4J2F A;  4MJA A;  3TJJ A;  3H1N A;  1OE8 A;  4N11 A;  3FKF A;  1A23 A;  4Q5N A;  5CRG A;  4KCA A;  1T3B A;  3F9U A;  3CXG A;  1V57 A;  5BRT A;  4AJ7 A;  4CY6 A;  2GZZ A;  1XOA A;  2AYT A;  1TP9 A;  4IQ1 A;  2M80 A;  3FZA A;  4K9Z A;  4JBB A;  3GX8 A;  2H1A A;  3L9S A;  2VCX A;  4K6X A;  2UZ8 A;  4D73 B;  3IV4 A;  3ZL5 A;  3G9B A;  3C71 A;  3FW2 A;  5ECM B;  4MJB A;  4WEY A;  4OFT A;  4HU9 A;  3BJ5 A;  2C0D A;  4ECB A;  4D73 A;  3E3E A;  2GQK A;  3CYN A;  4KA0 A;  3ZRD A;  2I81 A;  1B4Q A;  4GXZ A;  3BD2 A;  3KMO A;  1U3A A;  2B5X A;  2HYX A;  3UIW A;  4K2X A;  1NHY A;  2C80 A;  1M2A A;  3ZYW A;  2M72 A;  1J0F A;  1YF0 A;  3P2A A;  2RLI A;  4TR0 A;  1GH2 A;  1K3Y A;  1ABA A;  1G7O A;  1YEX A;  1ZYP A;  2D2Z A;  2LJA A;  1XXU A;  4WR5 A;  5DCH A;  2B7K A;  4ZB6 A;  2JAC A;  5IIZ A;  2B1K A;  3QD9 A;  1GWC A;  4KB3 A;  3FY7 A;  4EUY A;  2YV9 A;  2VCQ A;  3KXO A;  4Q5R A;  4BWQ A;  1PL1 A;  3DD3 A;  1YQ1 A;  1ZOF A;  1PGT A;  1LBK A;  3W8J A;  1A2M A;  3UAP A;  3C1S A;  2GSS A;  1THX A;  1V98 A;  1OC8 A;  1S3D A;  3NIV A;  4NHZ A;  3KGK A;  2A4V A;  3HHV A;  3EMP A;  5A5K A;  5D93 A;  4ZBD A;  2XBQ A;  1BQ7 A;  5G5E A;  4YQV A;  1UN2 A;  3GV1 A;  1TU7 A;  5IMF A;  1R26 A;  4YQU A;  5HFI A;  2I1U A;  1KTE A;  2MBS A;  2CVK A;  1ML6 A;  1JZO A;  1HNB A;  3LWA A;  3Q74 A;  5KN3 A;  1MDI A;  2GLR A;  4Z2T A;  2WRT A;  3ERF A;  3L0H A;  4WBJ A;  3RBT A;  1O81 A;  1GRX A;  5IMC A;  3APQ A;  4GF0 A;  1YJ6 A;  3GFK A;  4F9Z A;  2YPM A;  5F0G A;  1XWG A;  3TOU A;  2FNO A;  3C8E A;  2MYG A;  1XW6 A;  4ICY A;  4HEA 2;  1XPV A;  3PH9 A;  5ECK B;  1QUW A;  1SD8 A;  3H79 A;  1GL8 A;  2CAI A;  5B8A A;  4ZL9 A;  2LST A;  2OBI A;  2H8L A;  3EU3 A;  2ZUP A;  3QAV A;  1JHB A;  5F05 A;  4YKG A;  4EXJ A;  5JWQ B;  4BVY B;  3N9J A;  4TKY A;  5A4U A;  3WYW A;  2XHF A;  4HQS A;  5EPF A;  5G2Z A;  3ZIT A;  1VGL A;  5IO0 A;  3WT2 A;  1AUC A;  1F37 A;  2B6M A;  4G0I A;  3DVW A;  4BVY A;  3ERG A;  3QCP A;  3IC4 A;  3V1W A;  1ERT A;  4WR4 A;  1Q4J A;  2G0F A;  5F07 A;  2H0G A;  4WF5 A;  1ZGN A;  1FVJ A;  1URM A;  1SL1 B;  4EC0 A;  6GSX A;  5G1L A;  2PVQ A;  3Q18 A;  2LQO A;  4V2M A;  3PGT A;  4TOP A;  4O5Q A;  3C7M A;  6GSW A;  4Z2U A;  3APO A;  4OMV A;  2IMF A;  4IS0 A;  1PN0 A;  2JSZ A;  5ECR B;  2H0I A;  2VLT A;  4BPY A;  3LFL A;  5AGY A;  1PFO A;  3LQ7 A;  1GSU A;  2VOC A;  2YP6 A;  3ERW A;  3TOT A;  3NOF A;  1A2L A;  1MD3 A;  2GSQ A;  4ECC A;  1YF1 A;  5IM9 A;  3IE3 A;  5DAK B;  1ZL9 A;  2VLV A;  4QL9 A;  2DC5 A;  1DSB A;  5DAK A;  2IN3 A;  3CSI A;  2R0C A;  1NHO A;  2TRC P;  5ECQ B;  5B6M A;  4XRA A;  3S9F A;  2R5G A;  1Z7P A;  3WGX A;  1OYJ A;  5HR1 A;  4IW9 A;  3U5R E;  1DBY A;  2RM6 A;  2WUL A;  3GH6 A;  3R3E A;  2C3Q A;  3EYT A;  5KN0 A;  2IMK A;  5DQY A;  5CRW A;  1R5P A;  4HJ2 A;  1M7T A;  2H71 A;  2VCV A;  1J08 A;  1BX9 A;  1U88 A;  2H1G A;  1O6J A;  2WB9 A;  4LMW A;  5JCU A;  3L4N A;  3H8Q A;  4I6X A;  2QKE A;  5FT3 A;  1K0B A;  3FZ5 A;  4GQF A;  2HFD A;  4BA7 A;  3E9J B;  3APS A;  4XTS A;  2K18 A;  2DJ1 A;  1M9A A;  4EVM A;  4JE1 A;  1SL0 B;  1PQN A;  2WJU A;  4YH2 A;  1EV4 A;  3F0I A;  3FR3 A;  4ZIL A;  4EIQ A;  2NDO A;  5J4U A;  3CBU A;  2DBC A;  3GKK A;  2JSY A;  4WF4 A;  1S3A A;  3DYR A;  2PGT A;  1XOB A;  2AB6 A;  1KBN A;  2GZY A;  3ISO A;  3TCO A;  2CT6 A;  1T8E B;  2VL3 A;  3FK8 A;  3GMF A;  1JLW A;  3TB2 A;  3F3R A;  3KD0 A;  4TXO B;  4MP4 A;  1E6B A;  4QL7 A;  2B5E A;  2VCZ A;  3A2W A;  4G19 A;  2H75 A;  2HI7 A;  3UEM A;  5GST A;  4X4J A;  3EVI A;  3PPU A;  1YZX A;  2JL4 A;  4TXO A;  2WS2 A;  4Z7X A;  4GCI A;  3HVN A;  1G6W A;  3GL5 A;  4KAE A;  5D9X A;  3FEU A;  1A0R P;  4EO3 A;  4X0X A;  2VL2 A;  3L78 A;  1U3I A;  2I4A A;  1SKW B;  3M1G A;  1VF3 A;  3IAM 2;  4E8H A;  4G0L A;  2GVP A;  2O8V B;  4IVF A;  4PUA A;  2DLX A;  3C1R A;  3IC8 A;  4MNN A;  2IMI A;  3KIJ A;  3IK7 A;  4EDZ A;  2B1L A;  2L6D A;  1A24 A;  2PN8 A;  3RPP A;  3JCM L;  8GSS A;  4USS A;  4KE3 A;  1F9M A;  5F06 A;  3ZTL A;  3DWV A;  1B48 A;  4L0U A;  3W6G A;  5BMU A;  1NM3 A;  5CRH A;  2DKI A;  4L0W A;  3BCK A;  1SU9 A;  1HNC A;  2KHP A;  1O73 A;  3HXS A;  3P90 A;  4G9H A;  2HZE B;  2AJQ B;  1PKZ A;  1FW1 A;  1FB0 A;  3GKM A;  3MDK A;  2CX4 A;  4I97 A;  2H72 A;  2PPT A;  4L5O A;  2FCH A;  4MF7 A;  3KM6 A;  3D4M A;  1SYR A;  2HZE A;  1M99 A;  2R37 A;  3KZQ A;  5F8B A;  1K0D A;  4K8M A;  1GUK A;  2H1B A;  2L6C A;  4WET A;  3ME7 A;  4PX1 A;  16GS A;  5HFG A;  5CNW A;  1FG4 A;  3QFB C;  1M9B A;  4KH7 A;  2C0G A;  1K3L A;  2L59 A;  2B3S A;  2VM2 A;  2GZP A;  1X9W B;  2H66 A;  2VM1 A;  3UL3 A;  2RII A;  3HDC A;  1Z7R A;  2XBI A;  1H4O A;  1M3I A;  3D21 A;  1TJD A;  3CQF A;  3GKN A;  5G30 A;  3O3T A;  1CQH A;  1QMV A;  1O8X A;  1Z3E A;  1H75 A;  3CTF A;  1V58 A;  1Z5Y E;  4I5Q A;  3TKQ A;  1FVK A;  1SEN A;  2JZT A;  5H5R A;  1FB6 A;  3GN3 A;  2H0H A;  4NPB A;  2CZ3 A;  3QAW A;  3CMI A;  6GSS A;  22GS A;  1S3R A;  4EF0 A;  3VWU A;  1ZMA A;  1B4P A;  4ACS A;  2X4A A;  1RK4 A;  4O5U A;  3IXR A;  4V2L A;  2FWE A;  4IBP A;  1MDK A;  2VD1 A;  3IBH A;  4IKH A;  1GSQ A;  1O8W A;  3TKS E;  5C04 A;  4OWY A;  4AJ8 A;  2X8G A;  2IPA A;  1GTI A;  4LL1 B;  5IOX A;  2YOI A;  3F4S A;  4L5L A;  3SWL A;  1EP7 A;  1TU8 A;  3AY8 A;  3KEB A;  4RI7 A;  4RQR A;  1R7H A;  1XWK A;  3U6V A;  1AW9 A;  4XIH A;  4ZBA A;  2P5Q A;  1VRS D;  3GUR A;  1SKR B;  3M0F A;  2F9S A;  3W8S A;  3VPQ A;  2DJ0 A;  1OAZ A;  18GS A;  2V6O A;  4F0C A;  2VO4 A;  4LMV A;  1K0A A;  1BAY A;  2A2P A;  3F4T A;  4IEL A;  2JU5 A;  1A8Y A;  2TRX A;  1WE0 A;  1ZYN A;  1T4Y A;  3GKX A;  3KTL A;  4MZB A;  4Z2R A;  1B8X A;  2NPB A;  2OE1 A;  4MF6 A;  3GSS A;  5DDL A;  4I8B A;  3CTG A;  1ERW A;  4P3Y B;  2VCW A;  3KCM A;  1GUH A;  3TDG A;  4N0V A;  4PUF C;  3VPT A;  7GSS A;  4KSM A;  4K2D A;  2ON7 A;  2X8H A;  2CV4 A;  5D73 A;  4I2T A;  4ZB8 A;  1XWB A;  3TRQ A;  1XCC A;  4G0K A;  4GLT A;  3TRX A;  3BBY A;  3IPZ A;  1YY7 A;  4J57 E;  2L5O A;  3ZRE A;  4F0B A;  5D8I A;  5GZZ B;  1XIY A;  2CAQ A;  3GX0 A;  6GSU A;  1K0O A;  3MAK A;  4JR4 A;  4CW9 A;  5C00 A;  3TKS C;  2H1D A;  1FHE A;  2GT5 A;  2LUS A;  5E59 A;  2HNL A;  4G2E A;  1M0U A;  4NHW A;  5IOW A;  2N5A A;  1N8J A;  3BCI A;  2FWF A;  3GST A;  1WIK A;  5EL8 A;  2KP1 A;  1TRS A;  2L4Q A;  2LS5 A;  4EDY A;  1WMJ A;  1K0M A;  3KP8 A;  3CSJ A;  1MDJ A;  1TRW A;  1I9D A;  1E2Y A;  1GUL A;  1XVW A;  2EC4 A;  1TK0 B;  1XZO A;  2E0Q A;  2GT6 A;  5DJM A;  4KDY A;  2R0G A;  4GRF A;  2J23 A;  2JAD A;  3F8U A;  2KOK A;  4LL4 B;  4NMU A;  3QPM A;  2AHE A;  5JCG A;  3HVX A;  1PN9 A;  5CAX A;  3HD5 A;  3QAG A;  1Z6M A;  3IHQ A;  3LGC A;  4TXV A;  2XC2 A;  5AIX A;  4OO5 A;  5CYY A;  4MPG A;  4DSQ A;  4EIP A;  2MBT A;  2V41 A;  4GSS A;  2QA1 A;  5D9T A;  2CX3 A;  2P0G A;  5LNK e;  2XPD A;  4IGJ A;  4MLY A;  5ECI B;  2PBJ A;  4IN0 A;  4XHM A;  1YEP A;  1WJK A;  1GNW A;  1MEK A;  1W89 A;  2NTO A;  1NW2 A;  2N5B A;  3N5O A;  2GSR A;  4FO5 A;  3GTU B;  5FWG A;  4IP1 A;  2K8V A;  3RPN A;  1TK8 B;  2PMT A;  3DVX A;  2X49 A;  3DRN A;  2L4C A;  2VIM A;  5IMA A;  2C3T A;  1K3O A;  4ZIJ A;  3GTU A;  2H6X A;  1UVZ A;  4AJ6 A;  4POB A;  1U87 A;  2ALB A;  2VLU A;  3D22 A;  1X9S B;  1T00 A;  1V40 A;  1TW9 A;  3QFA C;  5J3R A;  4K1F A;  1A0F A;  4POM A;  2DJJ A;  12GS A;  4FIW A;  4OFN A;  3RHB A;  4RI6 A;  2G2Q A;  2YWN A;  4OFM A;  2L57 A;  2VUP A;  13GS A;  2E2G A;  2OE3 A;  10GS A;  4K0G A;  1XBS A;  4NV2 A;  5INY A;  1SL2 B;  3MIX A;  2J9H A;  4GTU A;  3HCZ A;  1FOH A;  5KEJ A;  2LKU A;  1SD9 A;  2HXK A;  9GSS A;  3HJM A;  2KUC A;  3A5I A;  3HVV A;  1SKS B;  3M8N A;  1TOF A;  4YKF A;  4WXT A;  3F3Q A;  2F51 A;  5JWR B;  3LOR A;  4BWS A;  1KEB A;  3MWH A;  2FWG A;  4HZ2 A;  3D6I A;  5A4V A;  4MA9 A;  3RAZ A;  2LJK A;  1PX7 A;  1M2D A;  4ISD A;  3D0Z A;  4HUA A;  4CHS A;  4JZQ A;  1U6T A;  3IHG A;  4KDU A;  1K0C A;  2DJ2 A;  2V2G A;  3A2V A;  5L71 A;  5COH A;  2K8S A;  2FA4 A;  3WD6 A;  2PVO C;  2BJX A;  3HJP A;  5IQY A;  4H86 A;  1M3J A;  2Z9S A;  1AIU A;  1EOG A;  1RQM A;  1BED A;  4BVX B;  4FYC A;  2NBS A;  3QOU A;  2YZU A;  5ID2 B;  2HE3 A;  3OR5 A;  1ST9 A;  2K6V A;  4KUN A;  4PGT A;  5G31 A;  4FYB A;  3LG6 A;  2ZNM A;  4BVX A;  1BJX A;  3NZN A;  2YWM A;  2IMD A;  3UAR A;  4AF2 A;  5ID2 A;  1LU4 A;  2OA7 A;  1X5E A;  1X5D A;  4OCE A;  2AUV A;  4KCE A;  3I6A A;  4MH3 A;  1EP8 A;  4MJE A;  3D5J A;  3P7X A;  4XS4 B;  4MH2 A;  3O6T A;  1X0R A;  1AXD A;  3ME8 A;  2VCT A;  3BOA A;  4K5S A;  1MTC A;  1ZYE A;  1DE1 A;  4MJC A;  2DML A;  2GGT A;  3FR9 A;  3TRP A;  3ZIV A;  5J9B A;  4XS4 A;  2F8F A;  1JZD A;  1GSF A;  3MNG A;  4RQX A;  3F63 A;  2CVD A;  3D4T A;  3DEX A;  1GNE A;  3WGE A;  2HLS A;  6GSY A;  5LCZ A;  3L9V A;  4MCU A;  1B9X C;  2XPE A;  5AIV A;  3CSH A;  4PQH A;  3UBK A;  4O92 A;  1TRU A;  4IHU A;  1TI1 A;  3F4R A;  4KW6 A;  4K5R A;  2JZR A;  4V1A p;  3FMW A;  2EIQ A;  2C1Y A;  1Z9H A;  3GL3 A;  3VFI A;  6GSV A;  2TIR A;  2LRT A;  1TTZ A;  1YDK A;  4HI7 A;  5EVO A;  5J9C A;  5H5Q A;  2MZC A;  3M9K A;  4PNG A;  1GTU A;  1AQW A;  1FO5 A;  2RM5 A;  4MK3 A;  3FZ4 A;  4K7O A;  2H30 A;  4ML1 A;  4CDO A;  3ZVJ D;  3IA1 A;  5IO2 A;  1WP0 A;  1TKD B;  3TJF A;  3ZIJ A;  4BL7 B;  1VF2 A;  3M3M A;  1T1V A;  2CZ2 A;  4LLR A;  2IL3 A;  2YN1 A;  4PUR A;  2FUG 2;  5DQS A;  1V2A A;  1W4V A;  2HSY A;  2WCI A;  5G5F A;  3TGZ A;  3QR6 A;  5ECN B;  2LRC A;  2GTU A;  4BL7 A;  4XS6 A;  1XWC A;  2FHE A;  2B7J A;  4KX4 A;  2KLX A;  1SK0 A;  3C73 A;  1TK5 B;  4GQC A;  1GTB A;  2C0F A;  2GS3 A;  2K9F A;  3UVH A;  1GP1 A;  3ZFB A;  4EKZ A;  2O85 A;  2DJ3 A;  4V1A g;  2GQL A;  4ZBB A;  4IP6 A;  2MMZ A;  3LYK A;  2IWT A;  3LSZ A;  1N2A A;  3Q6O A;  2DKH A;  5DCG A;  2FWH A;  3HJO A;  1BG5 A;  2RUF A;  2FD3 A;  1T7P B;  1QK8 A;  2F3M A;  2HRA A;  5ABR A;  5IPG A;  3O76 A;  3TKR A;  4IJ3 A;  4YAV A;  3VWV A;  1AAZ A;  3FRC A;  3SBC A;  3EC3 A;  1M2B A;  3EE2 A;  4ILF A;  4GST A;  3ZZX A;  1G6Y A;  1VF4 A;  5HQP A;  3GH9 A;  5HR3 A;  2N5F A;  2HZF A;  4JU5 A;  2LNT A;  2YJH A;  4N10 A;  3VI7 A;  3EMX A;  3GUS A;  1IYI A;  4G10 A;  4K0N A;  3EPT A;  2CQ9 A;  3IAS 2; 
#chains in the Genus database with same CATH homology
 3DML A;  4Q5F A;  3TJB A;  4K7N A;  4DEJ A;  2REM A;  5A4W A;  1F3B A;  4L8E A;  3ZML A;  3ZLP A;  1TI3 A;  3HZ8 A;  2LTK A;  5B7C A;  3WGD A;  1SK1 A;  17GS A;  3MSZ A;  5B8B A;  2C4J A;  4FH8 A;  14GS A;  4PQI A;  1AQV A;  2LQQ A;  4N30 A;  6GST A;  4HU7 A;  1ZZY A;  1GTA A;  3CRT A;  4WBR D;  4EL1 A;  1C72 A;  1XW5 A;  3FZ9 A;  1PSQ A;  2DIZ A;  2IFQ B;  4MPF A;  5AN1 A;  1QQ2 A;  4NWY A;  1F3A A;  3WT1 A;  5HFK A;  2WDU A;  4TR3 A;  4MF5 A;  3G7I A;  1OE7 A;  2X64 A;  2HT9 A;  2GDR A;  2O89 A;  2L5L A;  2A2S A;  2IFQ A;  2YNX A;  1Y25 A;  1GSS A;  4A5P A;  2E7P A;  5IPH A;  4IJI A;  1GUM A;  1Y6E A;  2QGV A;  3LXZ A;  3DGQ A;  1GSE A;  4EE0 A;  1PKW A;  5IMZ A;  2YAN A;  5CRD A;  5DVB A;  3KTB A;  2BMX A;  2R6K A;  3IK9 A;  5DAL B;  5EY6 A;  4POK A;  2LJR A;  3LEF A;  3RDW A;  3H4K A;  3FHK A;  5B6N A;  4ULX A;  1EZK A;  2DJK A;  1A8L A;  4TR4 A;  5DAL A;  4KSO A;  3TUE A;  1XWA A;  1F2E A;  2H19 A;  3PIN A;  4MDC A;  2DMM A;  2WZ9 A;  3CRU A;  5E4W A;  1A2J A;  3EUR A;  4KDX A;  2HSM A;  3FYG A;  1OKT A;  1GSD A;  2YJ7 A;  2VD0 A;  5HR0 A;  1TDI A;  4MMM A;  4XS1 A;  2IJY A;  1J9B A;  4WKW A;  2LEG A;  4ECI A;  2R0P A;  5IMD A;  4MZW A;  3HKR A;  2EIO A;  2FLS A;  3FR6 A;  1JFU A;  2FA8 A;  4JRR A;  3RHC A;  2R4V A;  3KMN A;  1PA3 A;  1R4W A;  2YWI A;  4X43 A;  4AGS A;  1QFN A;  2HRN A;  3KH9 A;  2JZS A;  2ON5 A;  2LRN A;  3R2Q A;  4OD7 A;  4ZXG A;  4Q5Q A;  3VWX A;  5ECO B;  1WRY A;  5FHI A;  4CY8 A;  4NV5 A;  3A3T A;  2HRF A;  4X1U A;  2HSH A;  3GNJ A;  1PD2 1;  5DJL A;  5DBQ A;  2H70 A;  1GSY A;  3TKP A;  4ZB9 A;  5J5N A;  4JR6 A;  1WPI A;  3LYP A;  3GHA A;  3QMX A;  4PQ1 A;  4F03 A;  5KOX A;  3KP9 A;  1QXH A;  2VL2 C;  2B5Y A;  2EIR A;  2H74 A;  5ENU A;  5JWO B;  3VLN A;  2IME A;  3H93 A;  2M46 A;  5ECP B;  3EWL A;  4TVE A;  1K0N A;  1XFL A;  2P5R A;  1ON4 A;  3DKS A;  2ZCT A;  1B9Y C;  2QSI A;  3GRX A;  2O87 A;  5GAN D;  3A2X A;  2OBK A;  1TRV A;  4ZL7 A;  1AC1 A;  1EV9 A;  4O5R A;  3HYP A;  3LJR A;  3K8N A;  1EEM A;  1XW9 A;  1BYE A;  1HYU A;  3IOS A;  1O7U A;  3HVS A;  4E8E A;  3IRA A;  3L9U A;  4JED A;  2MMO A;  3ZVJ A;  5ECH B;  2KP2 A;  2OKA A;  2H76 A;  2H6Y A;  5ECL B;  2WGR A;  4DSS B;  4HZ4 A;  2YCD A;  3EIN A;  4FQU A;  5GAP D;  5ELA A;  3J7Y k;  1HD2 A;  4YQM A;  3VI5 A;  2LV3 A;  2VAF A;  4DSS A;  2R2J A;  3G7J A;  3F6D A;  2BTO T;  1KNG A;  2FGX A;  1EGO A;  3PR8 A;  2AAW A;  2DIY A;  5ELG A;  4DVC A;  4ID0 A;  1MD4 A;  2YZH A;  2A4H A;  3TJG A;  3VK9 A;  1SK2 A;  3UVT A;  3ZMK A;  2OAD A;  2QA2 A;  1F6M C;  3G7Y A;  4POL A;  2YWO A;  2V32 A;  4KF9 A;  2WFC A;  1EGR A;  4LA1 A;  1EEJ A;  4KGI A;  2I3Y A;  2F8A A;  5D9W A;  2C0E A;  5D96 A;  2H6Z A;  3VWW A;  2PER A;  1YKC A;  4TRX A;  3UOM A;  1FAA A;  4ML6 A;  3QDN A;  4HS1 A;  2V1M A;  1SJZ A;  3EU4 A;  5CRE A;  1WWJ A;  1RW1 A;  1PMT A;  2MMA A;  4TN8 A;  3LXT A;  5CP1 A;  3IR4 A;  1JLV A;  2CVB A;  1X9M B;  1AQX A;  1ERU A;  4J56 E;  1TXX A;  2C3N A;  2P31 A;  2OJL A;  4NAX A;  1IYH A;  3HY2 A;  3KH7 A;  2ES7 A;  3F6F A;  1ZCP A;  1CQG A;  1X5C A;  3TKS A;  2OAC A;  4IQA A;  4HQZ A;  2IIY A;  2RUE A;  4N0Z A;  3GIX A;  2H73 A;  4KND A;  5CO3 A;  4O32 A;  4ZL8 A;  1UC7 A;  2MMN A;  3UJ1 A;  4XCS A;  1ILO A;  3MYD A;  1PX6 A;  2FY6 A;  3VUR A;  4TW5 A;  4HDE A;  1OVN A;  3US3 A;  2E2M A;  4F2I A;  3DIE A;  2C8U A;  1DUG A;  4RUV A;  1JZW A;  1JZR A;  2V6K A;  4OCF A;  3E0U A;  4MAB A;  4TR1 B;  5KOW A;  2LNS A;  2CA8 A;  1USB A;  2A2R A;  1S3C A;  2R3X A;  3HZ4 A;  2X99 A;  1YKA A;  2PWJ A;  1PRX A;  2YV7 A;  3IDV A;  4TR1 A;  1OC3 A;  3GA4 A;  4NXI A;  1I5G A;  4V2N A;  2PUK C;  1XVQ A;  1UA5 A;  3UBL A;  1VF1 A;  1OC9 B;  1OKD A;  4K7I A;  5HR2 A;  2NVL A;  4PTS A;  2I9H A;  2X8C A;  4HJM A;  4GSN A;  3P8W A;  1O85 A;  3TJK A;  3I69 A;  5IMV A;  2PU9 C;  1HQO A;  1R5A A;  4MZC A;  3M9J A;  1OC9 A;  1HNA A;  2QC7 A;  1G0T A;  1EWX A;  3HA9 A;  4ECJ A;  1FOV A;  1SYX A;  4GWR A;  4XRD A;  4PNF A;  1WOU A;  1Z6N A;  4OO4 A;  5JCW A;  1GLP A;  2O7K A;  1V9W A;  5LD0 A;  1THO A;  19GS A;  2GST A;  3I43 A;  4F82 A;  1QGV A;  5KN1 A;  3A5W A;  3J7Y b;  5ECS A;  4PXO A;  4FYU A;  4DSR A;  11GS A;  1DE2 A;  1ERV A;  1GLQ A;  4YAP A;  5D9V A;  1ZYQ B;  5J41 A;  3Q19 A;  1ACV A;  1T4Z A;  5G1K A;  4O7H A;  4I2U A;  3KJY A;  2DSA A;  4HOJ A;  1EOH A;  20GS A;  3UMA A;  1Q98 A;  5KN2 A;  1G7E A;  2AV4 A;  3GYK A;  3DXB A;  3ED3 A;  4QQ7 A;  1PL2 A;  2H01 A;  3I9V 2;  2VL9 A;  5H5S A;  3LW9 A;  5AIS A;  1SJ6 A;  1NSW A;  1LJR A;  5GSS A;  2GQM A;  2HRK A;  2OE0 A;  3ZFL A;  1SJI A;  4J2F A;  4MJA A;  3TJJ A;  3H1N A;  1OE8 A;  4N11 A;  3FKF A;  1A23 A;  4Q5N A;  5CRG A;  4KCA A;  1T3B A;  3F9U A;  3CXG A;  1V57 A;  5BRT A;  4AJ7 A;  4CY6 A;  2GZZ A;  1XOA A;  2AYT A;  1TP9 A;  4IQ1 A;  2M80 A;  3FZA A;  4K9Z A;  4JBB A;  3GX8 A;  2H1A A;  3L9S A;  2VCX A;  4K6X A;  2UZ8 A;  4D73 B;  3IV4 A;  3ZL5 A;  3G9B A;  3C71 A;  3FW2 A;  5ECM B;  4MJB A;  4WEY A;  4OFT A;  4HU9 A;  3BJ5 A;  2C0D A;  4ECB A;  4D73 A;  3E3E A;  2GQK A;  3CYN A;  4KA0 A;  3ZRD A;  2I81 A;  1B4Q A;  4GXZ A;  3BD2 A;  3KMO A;  1U3A A;  2B5X A;  2HYX A;  3UIW A;  4K2X A;  1NHY A;  2C80 A;  1M2A A;  3ZYW A;  2M72 A;  1J0F A;  1YF0 A;  3P2A A;  2RLI A;  4TR0 A;  1GH2 A;  1K3Y A;  1ABA A;  1G7O A;  1YEX A;  1ZYP A;  2D2Z A;  2LJA A;  1XXU A;  4WR5 A;  5DCH A;  2B7K A;  4ZB6 A;  2JAC A;  5IIZ A;  2B1K A;  3QD9 A;  1GWC A;  4KB3 A;  3FY7 A;  4EUY A;  2YV9 A;  2VCQ A;  3KXO A;  4Q5R A;  4BWQ A;  1PL1 A;  3DD3 A;  1YQ1 A;  1ZOF A;  1PGT A;  1LBK A;  3W8J A;  1A2M A;  3UAP A;  3C1S A;  2GSS A;  1THX A;  1V98 A;  1OC8 A;  1S3D A;  3NIV A;  4NHZ A;  3KGK A;  2A4V A;  3HHV A;  3EMP A;  5A5K A;  5D93 A;  4ZBD A;  2XBQ A;  1BQ7 A;  5G5E A;  4YQV A;  1UN2 A;  3GV1 A;  1TU7 A;  5IMF A;  1R26 A;  4YQU A;  5HFI A;  2I1U A;  1KTE A;  2MBS A;  2CVK A;  1ML6 A;  1JZO A;  1HNB A;  3LWA A;  3Q74 A;  5KN3 A;  1MDI A;  2GLR A;  4Z2T A;  2WRT A;  3ERF A;  3L0H A;  4WBJ A;  3RBT A;  1O81 A;  1GRX A;  5IMC A;  3APQ A;  4GF0 A;  1YJ6 A;  3GFK A;  4F9Z A;  2YPM A;  5F0G A;  1XWG A;  3TOU A;  2FNO A;  3C8E A;  2MYG A;  1XW6 A;  4ICY A;  4HEA 2;  1XPV A;  3PH9 A;  5ECK B;  1QUW A;  1SD8 A;  3H79 A;  1GL8 A;  2CAI A;  5B8A A;  4ZL9 A;  2LST A;  2OBI A;  2H8L A;  3EU3 A;  2ZUP A;  3QAV A;  1JHB A;  5F05 A;  4YKG A;  4EXJ A;  5JWQ B;  4BVY B;  3N9J A;  4TKY A;  5A4U A;  3WYW A;  2XHF A;  4HQS A;  5EPF A;  5G2Z A;  3ZIT A;  1VGL A;  5IO0 A;  3WT2 A;  1AUC A;  1F37 A;  2B6M A;  4G0I A;  3DVW A;  4BVY A;  3ERG A;  3QCP A;  3IC4 A;  3V1W A;  1ERT A;  4WR4 A;  1Q4J A;  2G0F A;  5F07 A;  2H0G A;  4WF5 A;  1ZGN A;  1FVJ A;  1URM A;  1SL1 B;  4EC0 A;  6GSX A;  5G1L A;  2PVQ A;  3Q18 A;  2LQO A;  4V2M A;  3PGT A;  4TOP A;  4O5Q A;  3C7M A;  6GSW A;  4Z2U A;  3APO A;  4OMV A;  2IMF A;  4IS0 A;  1PN0 A;  2JSZ A;  5ECR B;  2H0I A;  2VLT A;  4BPY A;  3LFL A;  5AGY A;  3LQ7 A;  1GSU A;  2VOC A;  2YP6 A;  3ERW A;  3TOT A;  3NOF A;  1A2L A;  1MD3 A;  2GSQ A;  4ECC A;  1YF1 A;  5IM9 A;  3IE3 A;  5DAK B;  1ZL9 A;  2VLV A;  4QL9 A;  2DC5 A;  1DSB A;  5DAK A;  2IN3 A;  3CSI A;  2R0C A;  1NHO A;  2TRC P;  5ECQ B;  5B6M A;  4XRA A;  3S9F A;  2R5G A;  1Z7P A;  3WGX A;  1OYJ A;  5HR1 A;  4IW9 A;  3U5R E;  1DBY A;  2RM6 A;  2WUL A;  3GH6 A;  3R3E A;  2C3Q A;  3EYT A;  5KN0 A;  2IMK A;  5DQY A;  5CRW A;  1R5P A;  4HJ2 A;  1M7T A;  2H71 A;  2VCV A;  1J08 A;  1BX9 A;  1U88 A;  2H1G A;  1O6J A;  2WB9 A;  4LMW A;  5JCU A;  3L4N A;  3H8Q A;  4I6X A;  2QKE A;  5FT3 A;  1K0B A;  3FZ5 A;  4GQF A;  2HFD A;  4BA7 A;  3E9J B;  3APS A;  4XTS A;  2K18 A;  2DJ1 A;  1M9A A;  4EVM A;  4JE1 A;  1SL0 B;  1PQN A;  2WJU A;  4YH2 A;  1EV4 A;  3F0I A;  3FR3 A;  4ZIL A;  4EIQ A;  2NDO A;  5J4U A;  3CBU A;  2DBC A;  3GKK A;  2JSY A;  4WF4 A;  1S3A A;  3DYR A;  2PGT A;  1XOB A;  2AB6 A;  1KBN A;  2GZY A;  3ISO A;  3TCO A;  2CT6 A;  1T8E B;  2VL3 A;  3FK8 A;  3GMF A;  1JLW A;  3TB2 A;  3F3R A;  3KD0 A;  4TXO B;  4MP4 A;  1E6B A;  4QL7 A;  2B5E A;  2VCZ A;  3A2W A;  4G19 A;  2H75 A;  2HI7 A;  3UEM A;  5GST A;  4X4J A;  3EVI A;  3PPU A;  1YZX A;  2JL4 A;  4TXO A;  2WS2 A;  4Z7X A;  4GCI A;  1G6W A;  3GL5 A;  4KAE A;  5D9X A;  3FEU A;  1A0R P;  4EO3 A;  4X0X A;  2VL2 A;  3L78 A;  1U3I A;  2I4A A;  1SKW B;  3M1G A;  1VF3 A;  3IAM 2;  4E8H A;  4G0L A;  2GVP A;  2O8V B;  4IVF A;  4PUA A;  2DLX A;  3C1R A;  3IC8 A;  4MNN A;  2IMI A;  3KIJ A;  3IK7 A;  4EDZ A;  2B1L A;  2L6D A;  1A24 A;  2PN8 A;  3RPP A;  3JCM L;  8GSS A;  4USS A;  4KE3 A;  1F9M A;  5F06 A;  3ZTL A;  3DWV A;  1B48 A;  4L0U A;  3W6G A;  5BMU A;  1NM3 A;  5CRH A;  2DKI A;  4L0W A;  3BCK A;  1SU9 A;  1HNC A;  2KHP A;  1O73 A;  3HXS A;  3P90 A;  4G9H A;  2HZE B;  2AJQ B;  1PKZ A;  1FW1 A;  1FB0 A;  3GKM A;  3MDK A;  2CX4 A;  4I97 A;  2H72 A;  2PPT A;  4L5O A;  2FCH A;  4MF7 A;  3KM6 A;  3D4M A;  1SYR A;  2HZE A;  1M99 A;  2R37 A;  3KZQ A;  5F8B A;  1K0D A;  4K8M A;  1GUK A;  2H1B A;  2L6C A;  4WET A;  3ME7 A;  4PX1 A;  16GS A;  5HFG A;  5CNW A;  1FG4 A;  3QFB C;  1M9B A;  4KH7 A;  2C0G A;  1K3L A;  2L59 A;  2B3S A;  2VM2 A;  2GZP A;  1X9W B;  2H66 A;  2VM1 A;  3UL3 A;  2RII A;  3HDC A;  1Z7R A;  2XBI A;  1H4O A;  3D21 A;  1TJD A;  3GKN A;  5G30 A;  3O3T A;  1CQH A;  1QMV A;  1O8X A;  1Z3E A;  1H75 A;  3CTF A;  1V58 A;  1Z5Y E;  4I5Q A;  3TKQ A;  1FVK A;  1SEN A;  2JZT A;  5H5R A;  1FB6 A;  3GN3 A;  2H0H A;  4NPB A;  2CZ3 A;  3QAW A;  3CMI A;  6GSS A;  22GS A;  4EF0 A;  3VWU A;  1ZMA A;  1B4P A;  4ACS A;  2X4A A;  1RK4 A;  4O5U A;  3IXR A;  4V2L A;  2FWE A;  4IBP A;  1MDK A;  2VD1 A;  3IBH A;  4IKH A;  1GSQ A;  1O8W A;  3TKS E;  5C04 A;  4OWY A;  4AJ8 A;  2X8G A;  2IPA A;  1GTI A;  4LL1 B;  5IOX A;  2YOI A;  3F4S A;  4L5L A;  3SWL A;  1EP7 A;  1TU8 A;  3AY8 A;  3KEB A;  4RI7 A;  4RQR A;  1R7H A;  1XWK A;  3U6V A;  1AW9 A;  4XIH A;  4ZBA A;  2P5Q A;  1VRS D;  3GUR A;  1SKR B;  3M0F A;  2F9S A;  3W8S A;  3VPQ A;  2DJ0 A;  1OAZ A;  18GS A;  2V6O A;  4F0C A;  2VO4 A;  4LMV A;  1K0A A;  1BAY A;  2A2P A;  3F4T A;  4IEL A;  2JU5 A;  1A8Y A;  2TRX A;  1WE0 A;  1ZYN A;  1T4Y A;  3GKX A;  3KTL A;  4MZB A;  4Z2R A;  1B8X A;  2NPB A;  2OE1 A;  4MF6 A;  3GSS A;  5DDL A;  4I8B A;  3CTG A;  1ERW A;  4P3Y B;  2VCW A;  3KCM A;  1GUH A;  3TDG A;  4N0V A;  4PUF C;  3VPT A;  7GSS A;  4KSM A;  4K2D A;  2ON7 A;  2X8H A;  2CV4 A;  5D73 A;  4I2T A;  4ZB8 A;  1XWB A;  3TRQ A;  1XCC A;  4G0K A;  4GLT A;  3TRX A;  3BBY A;  3IPZ A;  1YY7 A;  4J57 E;  2L5O A;  3ZRE A;  4F0B A;  5D8I A;  5GZZ B;  1XIY A;  2CAQ A;  3GX0 A;  6GSU A;  1K0O A;  3MAK A;  4JR4 A;  4CW9 A;  5C00 A;  3TKS C;  2H1D A;  1FHE A;  2GT5 A;  2LUS A;  5E59 A;  2HNL A;  4G2E A;  1M0U A;  4NHW A;  5IOW A;  2N5A A;  1N8J A;  3BCI A;  2FWF A;  3GST A;  1WIK A;  5EL8 A;  2KP1 A;  1TRS A;  2L4Q A;  2LS5 A;  4EDY A;  1WMJ A;  1K0M A;  3KP8 A;  3CSJ A;  1MDJ A;  1TRW A;  1I9D A;  1E2Y A;  1GUL A;  1XVW A;  2EC4 A;  1TK0 B;  1XZO A;  2E0Q A;  2GT6 A;  5DJM A;  4KDY A;  2R0G A;  4GRF A;  2J23 A;  2JAD A;  3F8U A;  2KOK A;  4LL4 B;  4NMU A;  3QPM A;  2AHE A;  5JCG A;  3HVX A;  1PN9 A;  5CAX A;  3HD5 A;  3QAG A;  1Z6M A;  3IHQ A;  3LGC A;  4TXV A;  2XC2 A;  5AIX A;  4OO5 A;  5CYY A;  4MPG A;  4DSQ A;  4EIP A;  2MBT A;  2V41 A;  4GSS A;  2QA1 A;  5D9T A;  2CX3 A;  2P0G A;  5LNK e;  2XPD A;  4IGJ A;  4MLY A;  5ECI B;  2PBJ A;  4IN0 A;  4XHM A;  1YEP A;  1WJK A;  1GNW A;  1MEK A;  1W89 A;  2NTO A;  1NW2 A;  2N5B A;  3N5O A;  2GSR A;  4FO5 A;  3GTU B;  5FWG A;  4IP1 A;  2K8V A;  3RPN A;  1TK8 B;  2PMT A;  3DVX A;  2X49 A;  3DRN A;  2L4C A;  2VIM A;  5IMA A;  2C3T A;  1K3O A;  4ZIJ A;  3GTU A;  2H6X A;  1UVZ A;  4AJ6 A;  4POB A;  1U87 A;  2ALB A;  2VLU A;  3D22 A;  1X9S B;  1T00 A;  1V40 A;  1TW9 A;  3QFA C;  5J3R A;  4K1F A;  1A0F A;  4POM A;  2DJJ A;  12GS A;  4FIW A;  4OFN A;  3RHB A;  4RI6 A;  2G2Q A;  2YWN A;  4OFM A;  2L57 A;  2VUP A;  13GS A;  2E2G A;  2OE3 A;  10GS A;  4K0G A;  1XBS A;  4NV2 A;  5INY A;  1SL2 B;  3MIX A;  2J9H A;  4GTU A;  3HCZ A;  1FOH A;  5KEJ A;  2LKU A;  1SD9 A;  2HXK A;  9GSS A;  3HJM A;  2KUC A;  3A5I A;  3HVV A;  1SKS B;  3M8N A;  1TOF A;  4YKF A;  4WXT A;  3F3Q A;  2F51 A;  5JWR B;  3LOR A;  4BWS A;  1KEB A;  3MWH A;  2FWG A;  4HZ2 A;  3D6I A;  5A4V A;  4MA9 A;  3RAZ A;  2LJK A;  1PX7 A;  1M2D A;  4ISD A;  3D0Z A;  4HUA A;  4CHS A;  4JZQ A;  1U6T A;  3IHG A;  4KDU A;  1K0C A;  2DJ2 A;  2V2G A;  3A2V A;  5L71 A;  5COH A;  2K8S A;  2FA4 A;  3WD6 A;  2PVO C;  2BJX A;  3HJP A;  5IQY A;  4H86 A;  2Z9S A;  1AIU A;  1EOG A;  1RQM A;  1BED A;  4BVX B;  4FYC A;  2NBS A;  3QOU A;  2YZU A;  5ID2 B;  2HE3 A;  3OR5 A;  1ST9 A;  2K6V A;  4KUN A;  4PGT A;  5G31 A;  4FYB A;  3LG6 A;  2ZNM A;  4BVX A;  1BJX A;  3NZN A;  2YWM A;  2IMD A;  3UAR A;  4AF2 A;  5ID2 A;  1LU4 A;  2OA7 A;  1X5E A;  1X5D A;  4OCE A;  2AUV A;  4KCE A;  3I6A A;  4MH3 A;  1EP8 A;  4MJE A;  3D5J A;  3P7X A;  4XS4 B;  4MH2 A;  3O6T A;  1X0R A;  1AXD A;  3ME8 A;  2VCT A;  3BOA A;  4K5S A;  1MTC A;  1ZYE A;  1DE1 A;  4MJC A;  2DML A;  2GGT A;  3FR9 A;  3TRP A;  3ZIV A;  5J9B A;  4XS4 A;  2F8F A;  1JZD A;  1GSF A;  3MNG A;  4RQX A;  3F63 A;  2CVD A;  3D4T A;  3DEX A;  1GNE A;  3WGE A;  2HLS A;  6GSY A;  5LCZ A;  3L9V A;  4MCU A;  1B9X C;  2XPE A;  5AIV A;  3CSH A;  4PQH A;  3UBK A;  4O92 A;  1TRU A;  4IHU A;  1TI1 A;  3F4R A;  4KW6 A;  4K5R A;  2JZR A;  4V1A p;  3FMW A;  2EIQ A;  2C1Y A;  1Z9H A;  3GL3 A;  3VFI A;  6GSV A;  2TIR A;  2LRT A;  1TTZ A;  1YDK A;  4HI7 A;  5EVO A;  5J9C A;  5H5Q A;  2MZC A;  3M9K A;  4PNG A;  1GTU A;  1AQW A;  1FO5 A;  2RM5 A;  4MK3 A;  3FZ4 A;  4K7O A;  2H30 A;  4ML1 A;  4CDO A;  3ZVJ D;  3IA1 A;  5IO2 A;  1WP0 A;  1TKD B;  3TJF A;  3ZIJ A;  4BL7 B;  1VF2 A;  3M3M A;  1T1V A;  2CZ2 A;  4LLR A;  2IL3 A;  2YN1 A;  4PUR A;  2FUG 2;  5DQS A;  1V2A A;  1W4V A;  2HSY A;  2WCI A;  5G5F A;  3TGZ A;  3QR6 A;  5ECN B;  2LRC A;  2GTU A;  4BL7 A;  4XS6 A;  1XWC A;  2FHE A;  2B7J A;  4KX4 A;  2KLX A;  1SK0 A;  3C73 A;  1TK5 B;  4GQC A;  1GTB A;  2C0F A;  2GS3 A;  2K9F A;  3UVH A;  1GP1 A;  3ZFB A;  4EKZ A;  2O85 A;  2DJ3 A;  4V1A g;  2GQL A;  4ZBB A;  4IP6 A;  2MMZ A;  3LYK A;  2IWT A;  3LSZ A;  1N2A A;  3Q6O A;  2DKH A;  5DCG A;  2FWH A;  3HJO A;  1BG5 A;  2RUF A;  2FD3 A;  1T7P B;  1QK8 A;  2F3M A;  2HRA A;  5ABR A;  5IPG A;  3O76 A;  3TKR A;  4IJ3 A;  4YAV A;  3VWV A;  1AAZ A;  3FRC A;  3SBC A;  3EC3 A;  1M2B A;  3EE2 A;  4ILF A;  4GST A;  3ZZX A;  1G6Y A;  1VF4 A;  5HQP A;  3GH9 A;  5HR3 A;  2N5F A;  2HZF A;  4JU5 A;  2LNT A;  2YJH A;  4N10 A;  3VI7 A;  3EMX A;  3GUS A;  1IYI A;  4G10 A;  4K0N A;  3EPT A;  2CQ9 A;  3IAS 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...