3TKQA

Crystal structure of full-length human peroxiredoxin 4 with mixed conformation
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
191
structure length
191
Chain Sequence
SKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Peroxiredoxin-4
publication title Structural insights into the peroxidase activity and inactivation of human peroxiredoxin 4
pubmed doi rcsb
source organism Homo sapiens
total genus 61
structure length 191
sequence length 191
chains with identical sequence B, C, D, E
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2011-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3tkqA00
18GSA 1A24A 2GSSA 1WPIA 1TRVA 5A4UA 3G7IA 1IYHA 3IAS2 4BL7A 3WT2A 2H8LA 5FT3A 1XPVA 5DCGA 3ERWA 2C3NA 2HZEB 3TKQA 2PUKC 3L0HA 4OO4A 1ERWA 2L5OA 3QDNA 2VL2A 4WKWA 2LKUA 2A2RA 3NZNA 4YQVA 3IR4A 2RM6A 2FWFA 4K0GA 1VRSD 4KE3A 5ENUA 1T7PB 3VLNA 1R5PA 1YZXA 4K8MA 4PQHA 1OE7A 2DIYA 5KEJA 1X9WB 2B1KA 1K0BA 1KBNA 1AQVA 1PKWA 1XFLA 1GWCA 2GT6A 5KN2A 4I6XA 4MJEA 5IOXA 1X0RA 3WD6A 5DQSA 3H79A 2VCTA 2GZZA 2H6XA 1UA5A 1N2AA 3GKXA 4PXOA 2OE0A 3GKKA 3ZREA 3JCML 2OADA 3QMXA 3GL5A 5CRWA 1A8LA 3TUEA 3VPTA 2R5GA 1B8XA 12GSA 1GLQA 3KTLA 3DVWA 5GAND 1XWBA 3EMXA 2Z9SA 2FGXA 17GSA 4XRDA 2LJRA 4FIWA 4LMVA 3SWLA 5GAPD 2CA8A 2GS3A 2YOIA 1TI1A 1R7HA 2B5XA 1GUKA 3GV1A 2VD0A 3LXZA 3DIEA 1SJ6A 4PQIA 4WETA 1PA3A 1QQ2A 4O7HA 3KCMA 2LJKA 2LSTA 4P3YB 2P31A 3DD3A 2GQLA 3ERFA 3LYKA 4N0ZA 3UOMA 3DWVA 3GTUB 4BWSA 1K0MA 5IOWA 2KLXA 1ZZYA 4MZBA 1EEMA 1BYEA 2C8UA 1O81A 1TRUA 1WP0A 2IMDA 3UBKA 4MPFA 4HQSA 4WBRD 5B6NA 2I9HA 4OCFA 3W8JA 3D4MA 1JZDA 1T8EB 4LL1B 2C3TA 4O5RA 4HZ4A 5IMZA 4MH3A 3D4TA 5HR2A 2C0GA 2XBIA 1B4QA 5J41A 3WGDA 5A4WA 1AQXA 1G7EA 4KSMA 3BOAA 2H1BA 1CQGA 2AHEA 3ZTLA 5L71A 4GXZA 3LSZA 2VL9A 3EINA 4L8EA 2CVBA 1OYJA 3FK8A 1UN2A 1M9AA 4K7IA 3I69A 1DSBA 5IMFA 3GRXA 1YEXA 2QC7A 3IE3A 5A5KA 4YH2A 3HA9A 3FEUA 3GA4A 1AAZA 1QMVA 1XW9A 1B48A 3ISOA 1XBSA 4FYUA 1V98A 2B3SA 1GTBA 4DVCA 1EOHA 4MABA 4MK3A 3FR9A 1UVZA 1FAAA 1GUMA 4RQRA 3VWVA 4HQZA 4K9ZA 4ECJA 4G2EA 2LEGA 2VLTA 4X1UA 5DALB 1F37A 3KM6A 1GSFA 1WWJA 4JRRA 3N9JA 2C4JA 3ERGA 3QFBC 3Q74A 3HVVA 13GSA 2GQMA 3TRPA 2RLIA 3LG6A 1YEPA 1TKDB 2PU9C 3ZIJA 4ZXGA 2NPBA 4MF5A 2R6KA 3M3MA 4K6XA 4OCEA 5ECKB 3ZMLA 3H1NA 3DMLA 2H70A 2YCDA 5IO2A 4K0NA 5DAKA 4AF2A 4NPBA 2KUCA 1FHEA 5JCWA 3HCZA 2AAWA 2LS5A 3UAPA 3FR3A 4Q5NA 4POBA 1U6TA 4BPYA 4WEYA 2RIIA 4MF7A 3KMNA 1ERUA 4POLA 3S9FA 5HFIA 2KHPA 1OAZA 4ZB6A 2GSRA 4JR4A 5J9CA 1EOGA 2H71A 2HSYA 3GL3A 3WYWA 1SD9A 2X8HA 1SKSB 4L5OA 2O7KA 1URMA 4IBPA 3F4RA 1R4WA 1K0OA 2O87A 1OC9A 1XOAA 4IHUA 4NAXA 1BX9A 2YJHA 4IP1A 4ZBAA 4F0BA 4IP6A 5C04A 2C0EA 3DVXA 4XCSA 2JL4A 2KOKA 1X5CA 5AIXA 2E2GA 4OMVA 4YAVA 2LRNA 1ZMAA 2OKAA 3FY7A 2NTOA 4NHZA 1T3BA 5G5EA 2GGTA 5KN3A 1M2AA 2LRCA 1U3AA 4JE1A 5IO0A 3TGZA 2NVLA 3ZZXA 5CO3A 1TU7A 1Z9HA 1TU8A 2VM2A 1JLWA 4I8BA 1G6WA 3VWXA 2WDUA 4OFTA 1XVWA 1X5DA 2G2QA 1O8XA 1YY7A 2ZNMA 4IS0A 1JZOA 3G9BA 4GLTA 3UIWA 4IJ3A 3TOUA 3GX8A 3BCIA 2R4VA 3BJ5A 4EL1A 1O7UA 1GSEA 3APQA 3QOUA 3IA1A 4V2NA 6GSXA 1HD2A 2QGVA 2MBSA 1K0AA 2HFDA 4TN8A 2RM5A 3K8NA 1THOA 2OE3A 5HQPA 5EPFA 1U3IA 2GZPA 4BWQA 3CRTA 3RBTA 2HRFA 2OBIA 5FHIA 3PGTA 2GVPA 4HOJA 3O6TA 4IVFA 1SL0B 3VI5A 1YF0A 2P5QA 3HHVA 3FZ4A 3F0IA 1GSQA 1F3BA 2REMA 5E4WA 1CQHA 2JU5A 2I81A 2K18A 2LQOA 3VWWA 1Y25A 2EIOA 3A5WA 3A2VA 2J23A 3EC3A 1SD8A 2VL3A 2WFCA 16GSA 3L9UA 1WIKA 1TOFA 1FB6A 2AB6A 2R37A 4GTUA 2L6CA 1R5AA 4RI7A 5D73A 6GSVA 4WF4A 1EWXA 1UC7A 4ZILA 3TKSA 4K7NA 5FWGA 1WRYA 1TJDA 1VF3A 4AGSA 1PMTA 2YWNA 4MF6A 4E8HA 3PR8A 3UEMA 3KZQA 4NV2A 2FD3A 2CV4A 1XWKA 2CZ3A 2EIRA 2JACA 1GTUA 3F6DA 3EU4A 3P8WA 3O3TA 4IELA 2HZFA 2CAIA 2MYGA 3IDVA 4AJ6A 4EC0A 1K0CA 1FB0A 2IWTA 1H75A 3P7XA 2R3XA 3RHCA 4G9HA 3D0ZA 1A2LA 1ZOFA 1GSDA 3EYTA 1VF1A 5H5SA 4O32A 1SENA 3QAWA 1EP8A 1SK1A 4QL7A 2MBTA 5AISA 4ZL7A 1VF4A 2VCQA 2H66A 3ZYWA 3DRNA 3HXSA 5IMAA 2I4AA 4DSSA 2XPDA 2B6MA 3F4TA 5IMDA 5AGYA 5D9WA 4DEJA 1TK0B 2XBQA 4MA9A 2B5EA 3U5RE 4H86A 2H74A 1YKCA 1NSWA 2VCWA 10GSA 2WB9A 2FCHA 1AUCA 4G10A 7GSSA 2K8SA 1MEKA 2YV7A 2DSAA 2DLXA 4L0WA 4MP4A 2VLUA 4HZ2A 4IN0A 3V1WA 3LXTA 2VLVA 3TOTA 2YWIA 2WULA 5KN1A 2FWGA 5F05A 4WR5A 2HSHA 5DAKB 4YAPA 1Z6MA 1A0FA 1GTAA 4TRXA 2V41A 4PNFA 3HDCA 4GQCA 1H4OA 4MPGA 4ML6A 1QFNA 4YQUA 1WE0A 2GZYA 2VUPA 1SJIA 4WXTA 5IPGA 2RUFA 2PBJA 5J5NA 5CRDA 2RUEA 1XW6A 1Y6EA 5IMCA 4WBJA 20GSA 3D22A 5H5QA 2DJ0A 2H0HA 1I9DA 4ACSA 1Z5YE 4J57E 2N5FA 5F8BA 4KDUA 1EV9A 4IW9A 2P5RA 3WGEA 2VOCA 4G19A 2IL3A 1ZGNA 2B7KA 4LA1A 1FG4A 2JADA 4OO5A 3KJYA 4KCEA 3IBHA 1M9BA 3TJKA 4XIHA 3GFKA 5G1KA 4OWYA 1WMJA 3KIJA 1AIUA 3ZITA 4J2FA 2VAFA 3UBLA 4BVYA 1A0RP 4F0CA 4TKYA 4V1Ap 1E6BA 3ED3A 3KEBA 1E2YA 3GSSA 4N11A 2JSYA 2AYTA 2DJJA 2VCVA 2PERA 3IC4A 4ULXA 2V6KA 2N5AA 2IMKA 1SU9A 1ZYQB 1GNEA 3QCPA 5ECPB 5D9XA 5D9TA 1GP1A 2DJ2A 3GHAA 2XPEA 1LJRA 3VI7A 1ZYEA 3U6VA 4HU7A 2FA8A 3I43A 1LU4A 3M1GA 1BAYA 1TK5B 8GSSA 3LJRA 1ML6A 1ST9A 1GSUA 2HLSA 1XWGA 3F8UA 4GF0A 4GRFA 1A23A 3QFAC 1ACVA 2B7JA 2CT6A 1S3CA 3NOFA 2IJYA 1TRSA 4F03A 14GSA 2V1MA 2CQ9A 1GTIA 5ECLB 2NBSA 1MD3A 2A4VA 2CAQA 5H5RA 2PPTA 3VK9A 3FRCA 2O89A 1OVNA 2H1GA 4ZBBA 4GCIA 5HR1A 2F51A 4KDXA 1M2DA 1TK8B 2MZCA 4IJIA 3F6FA 2H1AA 3LWAA 1TXXA 4IGJA 2DJ3A 5B6MA 1JFUA 4XRAA 2E2MA 2X99A 1PL2A 5B8AA 4TR1B 2OE1A 2GSTA 3H8QA 1A2JA 2LUSA 2VL2C 2AV4A 4PURA 3FZ5A 5GSTA 2WGRA 3GX0A 2FHEA 2MMOA 3IAM2 1TI3A 3KGKA 4K2DA 2WJUA 4IQ1A 2M80A 3CSHA 4K1FA 3EE2A 4N0VA 2AJQB 1LBKA 4IKHA 2MMNA 2C1YA 4KAEA 2V2GA 1FO5A 5ECMB 5D9VA 2AUVA 1OC8A 1T1VA 4TXOA 2PWJA 3L4NA 2WZ9A 2YNXA 3L9VA 3D6IA 1O8WA 3C71A 1KEBA 4X43A 2MMZA 3BBYA 5AIVA 1XXUA 2L59A 1M0UA 2WCIA 4PNGA 2LV3A 1X5EA 2ON5A 3ZLPA 2VD1A 1TW9A 1M99A 2DMMA 4D73A 3IOSA 3TJBA 2JSZA 4ZL8A 2E7PA 1PGTA 1MTCA 2PMTA 2VCXA 2H01A 2N5BA 3GIXA 2FWHA 2DMLA 4N10A 4ML1A 3UVTA 2X8GA 3HVSA 4POMA 4Q5RA 1X9SB 3GURA 3A2XA 5EVOA 5JWOB 4HJ2A 2O8VB 2C0FA 2HYXA 1PRXA 3NIVA 1Z6NA 4YQMA 1FW1A 2IMIA 22GSA 4ZBDA 3CMIA 3ZMKA 2IMEA 3C7MA 4HS1A 1YF1A 2L6DA 3TKSE 1F2EA 1VGLA 1OC3A 4L0UA 1SJZA 3KXOA 4HEA2 4ECIA 3R2QA 4DSSB 1OE8A 5DJMA 2DBCA 3L9SA 3TKRA 2H0IA 1IYIA 5G30A 1MDJA 4OFNA 1JZRA 4ID0A 2DIZA 3IK7A 2OBKA 1KTEA 5ELAA 3IK9A 3A2WA 3WT1A 4HUAA 1G6YA 4TR0A 3FW2A 4X0XA 3VFIA 5DCHA 2IPAA 1NM3A 3DXBA 4I97A 4EVMA 2H72A 2IN3A 3SBCA 2B5YA 5G2ZA 1BEDA 2PGTA 3GYKA 4CW9A 5JWQB 3ME8A 4KUNA 4MDCA 3DYRA 3VURA 2G0FA 1FVJA 5ELGA 1K0DA 3CSIA 4FH8A 4FYBA 1DBYA 3HYPA 2H19A 3RHBA 3FHKA 3M0FA 1R26A 5HFGA 4PX1A 3GNJA 1SYXA 5CNWA 3L78A 4JR6A 4F9ZA 3M8NA 3UMAA 5J4UA 1V40A 3HZ4A 4E8EA 4OFMA 4BA7A 2ZUPA 3CSJA 2HXKA 5IM9A 3HJOA 3KH7A 2EC4A 5E59A 1X9MB 5F07A 4KX4A 3J7Yb 3OR5A 1J0FA 1ZCPA 4PGTA 4AJ8A 6GSUA 4KGIA 5JCUA 2JZSA 1WOUA 3VWUA 2GSQA 3F63A 1O85A 1GULA 4NXIA 1F3AA 2LRTA 3HVXA 4KA0A 2H76A 1BG5A 3BCKA 3HY2A 1XOBA 2X64A 1SYRA 2TRXA 2V32A 3O76A 2ES7A 5ECHB 4F2IA 3Q19A 3TJGA 4CDOA 2BMXA 3LEFA 4KB3A 5D8IA 2X8CA 2OA7A 4MH2A 1ILOA 2YZHA 3MDKA 3TJJA 2L5LA 1GL8A 2HI7A 5B7CA 4PQ1A 1S3DA 1T4ZA 5JCGA 3PH9A 2CZ2A 1T4YA 3F3RA 3KP8A 1I5GA 2HE3A 2H30A 1ERVA 3PINA 1B4PA 1WJKA 1AW9A 5ECNB 4HI7A 2MMAA 3CBUA 4OD7A 3F4SA 1Q4JA 4FO5A 3HZ8A 4XS4A 2KP2A 1M7TA 1XIYA 2LNSA 1KNGA 3P90A 2V6OA 1GNWA 5G31A 4EE0A 3HJMA 3TDGA 2FLSA 4KH7A 2FNOA 1JLVA 2L4QA 1K3LA 1RW1A 4MLYA 5KN0A 4GSNA 1SK0A 4TOPA 1ABAA 3RPPA 2EIQA 4F82A 1DE2A 3EMPA 1SKWB 4WF5A 3GSTA 4EKZA 1XWCA 1PX6A 2H6YA 4TXOB 4ZIJA 4HJMA 3W8SA 3KTBA 4POKA 1PSQA 2VCZA 4I2TA 3ZL5A 4KDYA 1EV4A 1BJXA 2FWEA 1FVKA 1U88A 1QK8A 5ID2A 3D5JA 5COHA 4BVXA 1EEJA 2LTKA 1XVQA 5ECSA 5J3RA 5DVBA 4D73B 3C1SA 1V2AA 3MSZA 5CRGA 1OC9B 4XTSA 5IPHA 5LNKe 2TIRA 4N30A 1YDKA 3A3TA 3CTFA 2IFQA 1W89A 11GSA 3MAKA 4NV5A 1ERTA 1YQ1A 2C3QA 3GH6A 3CYNA 1NW2A 5G1LA 2OJLA 2FA4A 5ECIB 1W4VA 3TJFA 4JU5A 4EO3A 3KD0A 1GSSA 2D2ZA 3M9KA 3ZIVA 2YZUA 3TKPA 2H0GA 2M72A 1TDIA 2GTUA 1O73A 6GSSA 2DC5A 3QR6A 4ZB8A 1A8YA 4EF0A 3TKSC 2FUG2 2C0DA 2K6VA 1HNCA 4MMMA 2OACA 4XS1A 2L4CA 4ZB9A 1PX7A 4TR3A 3TB2A 5AN1A 4TW5A 4V2LA 1G7OA 5JWRB 1TP9A 1USBA 3TRXA 4NWYA 3FYGA 5LCZA 3APOA 4CHSA 4NHWA 2H73A 2KP1A 3I9V2 1NHOA 2F3MA 5D96A 2NDOA 5DQYA 4RQXA 1G0TA 4I2UA 3QAGA 3W6GA 3DGQA 1MDKA 1K0NA 2K9FA 2PVOC 2YP6A 1DUGA 4KNDA 2HZEA 1BQ7A 3ZVJA 1B9XC 5CP1A 2XC2A 2H75A 2YWMA 1RQMA 3IPZA 5EY6A 2L57A 2BTOT 2LNTA 4TR4A 1JZWA 3IV4A 5EL8A 9GSSA 19GSA 1N8JA 1T00A 3P2AA 2ON7A 1OKTA 4QL9A 3KH9A 2IMFA 3I6AA 2CVKA 2QKEA 2O85A 1HNBA 1XWAA 2YJ7A 5CAXA 1XW5A 5GZZB 2H1DA 3J7Yk 1QXHA 5G5FA 1J9BA 3LQ7A 3G7JA 2A2SA 3IRAA 3ZFLA 6GSTA 1EZKA 2LJAA 3AY8A 3E3EA 2JZRA 3TCOA 2DJKA 3E0UA 4GWRA 1PKZA 1SKRB 4XHMA 3VPQA 1V58A 3RAZA 2CX4A 1Z3EA 3GUSA 1GSYA 4KSOA 1GLPA 1S3AA 2R2JA 1O6JA 4GSSA 5A4VA 1SL1B 3H93A 1A2MA 2I1UA 1TRWA 2TRCP 2PVQA 2I3YA 1FOVA 3KMOA 2VM1A 3IXRA 2F9SA 3WGXA 3EU3A 3FZAA 3HJPA 3UARA 5LD0A 3GTUA 1XZOA 3HKRA 5ECOB 2ALBA 3KP9A 6GSYA 4XS6A 2H6ZA 3E9JB 1XCCA 3ZFBA 3QD9A 4MZCA 4EUYA 4HDEA 1F6MC 4RI6A 4HU9A 3D21A 1C72A 2B1LA 4MJBA 2F8AA 1SL2B 3Q6OA 2WRTA 5CREA 3FKFA 3LYPA 5IIZA 2PN8A 3UVHA 2C80A 3MNGA 5DDLA 4MJCA 4RUVA 4EDZA 5CYYA 2YV9A 3C73A 1AQWA 4MZWA 1TTZA 1DE1A 3LORA 1PQNA 3FR6A 3UJ1A 3EURA 4Z7XA 4GQFA 2VIMA 4Q5FA 1OKDA 3F3QA 5GSSA 3GH9A 3TRQA 2CVDA 1THXA 2HT9A 5C00A 4EXJA 1GUHA 4XS4B 1U87A 1GH2A 3C1RA 3G7YA 4KW6A 1EGOA 3APSA 1B9YC 3QAVA 2YANA 4PUAA 3H4KA 4TXVA 2E0QA 4ECCA 3GKNA 2HNLA 2LQQA 3M9JA 2VO4A 3EVIA 3BD2A 2P0GA 5CRHA 1JHBA 2YN1A 1HNAA 2K8VA 3GN3A 4DSRA 4JBBA 4MCUA 1M2BA 3US3A 5ABRA 1HYUA 5DALA 3DKSA 1Z7RA 3F9UA 4J56E 5DBQA 4ISDA 1PD21 1AC1A 1V57A 3FZ9A 5F06A 1QGVA 4TR1A 1Z7PA 3ZRDA 1V9WA 5INYA 2CX3A 4LMWA 3RDWA 1J08A 4ILFA 4JEDA 1EP7A 3CRUA 4MJAA 1MDIA 5ID2B 5ECRB 5IMVA 1ON4A 3CTGA 5F0GA 2BJXA 3HD5A 1PL1A 2HRNA 1YJ6A 3ZVJD 3C8EA 1Q98A 4PUFC 3UL3A 3Q18A 5HR3A 2ZCTA 4GSTA 2IFQB 2GT5A 1QUWA 3IHQA 2FY6A 1MD4A 2J9HA 3QPMA 4I5QA 4LLRA 5J9BA 3GKMA 5DJLA 1VF2A 3MWHA 4TVEA 1AXDA 3LFLA 5HFKA 4AJ7A 4ZL9A 3LGCA 4NMUA 2GQKA 4FYCA 1K3OA 5IQYA 2F8FA 2GLRA 2YWOA 1GRXA 3DEXA 4V1Ag 1SK2A 2YPMA 3N5OA 4LL4B 2QSIA 4O92A 6GSWA 2M46A 4EDYA 4QQ7A 2IIYA 5D93A 1RK4A 1F9MA 2JZTA 4KCAA 3ME7A 5HR0A 4DSQA 1EGRA 4IQAA 1NHYA 3RPNA 5ECQB 1K3YA 4V2MA 4WR4A 5B8BA 2WS2A 2XHFA 1ZL9A 4Q5QA 2DJ1A 1PN9A 3CXGA 1HQOA 1YKAA 4JZQA 4K7OA 4L5LA 3EWLA 2GDRA 3GMFA 4ECBA
chains in the Genus database with same CATH superfamily
18GSA 1A24A 2GSSA 1WPIA 1TRVA 5A4UA 3G7IA 1IYHA 3IAS2 4BL7A 3WT2A 2H8LA 5FT3A 1XPVA 5DCGA 3ERWA 2C3NA 2HZEB 3TKQA 2PUKC 3L0HA 4OO4A 1ERWA 2L5OA 3QDNA 2VL2A 4WKWA 2LKUA 2A2RA 3NZNA 4YQVA 4YKGA 3IR4A 2RM6A 2FWFA 4K0GA 1VRSD 4KE3A 5ENUA 1T7PB 3VLNA 1R5PA 4KF9A 1YZXA 4K8MA 4PQHA 1OE7A 2DIYA 5KEJA 1X9WB 2B1KA 1K0BA 1KBNA 1AQVA 1PKWA 1XFLA 4A5PA 1GWCA 2GT6A 5KN2A 4I6XA 4MJEA 5IOXA 1X0RA 3WD6A 5DQSA 3H79A 2VCTA 2GZZA 2H6XA 1UA5A 1N2AA 3GKXA 4PXOA 2OE0A 3GKKA 3ZREA 3JCML 2OADA 3QMXA 3GL5A 5CRWA 1A8LA 3TUEA 3VPTA 2R5GA 1B8XA 12GSA 1GLQA 3KTLA 3DVWA 5GAND 1XWBA 3EMXA 2Z9SA 2FGXA 17GSA 4K5SA 4XRDA 2LJRA 4FIWA 4LMVA 3SWLA 5GAPD 2CA8A 2GS3A 2YOIA 1TI1A 1R7HA 2B5XA 1GUKA 3GV1A 2VD0A 3LXZA 3DIEA 1SJ6A 4PQIA 4WETA 1PA3A 1QQ2A 5KOXA 4O7HA 3KCMA 2LJKA 2LSTA 4P3YB 2P31A 3DD3A 2GQLA 5BMUA 3ERFA 3LYKA 4N0ZA 3UOMA 3DWVA 3GTUB 4BWSA 1K0MA 5IOWA 2KLXA 3LW9A 1ZZYA 4MZBA 1EEMA 1BYEA 2C8UA 1O81A 1TRUA 1WP0A 2IMDA 3UBKA 4MPFA 4HQSA 4WBRD 5B6NA 2I9HA 4OCFA 3W8JA 3D4MA 1JZDA 1T8EB 4LL1B 2C3TA 4O5RA 2R0PA 4HZ4A 5IMZA 4MH3A 3D4TA 5HR2A 2C0GA 2XBIA 1B4QA 5J41A 3WGDA 5A4WA 1AQXA 1G7EA 4KSMA 3BOAA 2H1BA 1CQGA 2AHEA 3ZTLA 5L71A 4GXZA 3LSZA 2VL9A 3EINA 4L8EA 2CVBA 1OYJA 3FK8A 1UN2A 5BRTA 1M9AA 4K7IA 3I69A 1DSBA 5IMFA 3GRXA 1YEXA 2QC7A 3IE3A 5A5KA 4YH2A 3HA9A 3FEUA 3GA4A 1AAZA 1QMVA 1XW9A 1B48A 3ISOA 1XBSA 4FYUA 1V98A 2B3SA 1GTBA 4DVCA 1EOHA 4MABA 4MK3A 3FR9A 1UVZA 1FAAA 1GUMA 4RQRA 3VWVA 4HQZA 4K9ZA 4ECJA 4G2EA 2LEGA 2VLTA 4X1UA 5DALB 1F37A 3KM6A 1GSFA 1WWJA 4JRRA 2X49A 3N9JA 2C4JA 3ERGA 3QFBC 3Q74A 3HVVA 13GSA 2GQMA 3TRPA 2RLIA 3LG6A 1YEPA 1TKDB 2PU9C 3ZIJA 4ZXGA 2NPBA 4MF5A 2R6KA 3M3MA 4K6XA 4OCEA 5ECKB 3ZMLA 3H1NA 3DMLA 2H70A 2YCDA 5IO2A 4K0NA 5DAKA 4AF2A 4NPBA 2KUCA 1FHEA 5JCWA 3HCZA 2AAWA 2LS5A 3UAPA 3FR3A 4Q5NA 4POBA 1U6TA 4BPYA 4WEYA 2RIIA 3CQFA 4MF7A 3KMNA 1ERUA 4POLA 3S9FA 5HFIA 2KHPA 1OAZA 4ZB6A 2GSRA 4JR4A 5J9CA 1EOGA 2H71A 2HSYA 3GL3A 3WYWA 1SD9A 2X8HA 1SKSB 4L5OA 2O7KA 1URMA 4IBPA 3F4RA 1R4WA 1K0OA 2O87A 1OC9A 1XOAA 4IHUA 4NAXA 1BX9A 2YJHA 4IP1A 4ZBAA 4F0BA 4IP6A 5C04A 2C0EA 3DVXA 4XCSA 2JL4A 2KOKA 1X5CA 5AIXA 2E2GA 4OMVA 4YAVA 2LRNA 1ZMAA 2OKAA 3FY7A 2NTOA 4NHZA 1T3BA 3PPUA 5G5EA 2GGTA 5KN3A 1M2AA 2LRCA 1U3AA 4JE1A 5IO0A 3TGZA 2NVLA 3ZZXA 5CO3A 1TU7A 1Z9HA 1TU8A 2VM2A 1JLWA 4I8BA 1G6WA 3VWXA 2WDUA 4OFTA 1XVWA 1X5DA 2G2QA 1O8XA 1YY7A 2ZNMA 4IS0A 1JZOA 3G9BA 4GLTA 3UIWA 4IJ3A 3TOUA 3GX8A 3BCIA 2R4VA 3BJ5A 4EL1A 1O7UA 1GSEA 3APQA 3QOUA 3IA1A 4V2NA 6GSXA 1HD2A 2QGVA 2MBSA 1K0AA 2HFDA 3MYDA 4TN8A 4O5QA 2HSMA 2RM5A 3K8NA 1THOA 2OE3A 5HQPA 5EPFA 1U3IA 2GZPA 4BWQA 3CRTA 2HRKA 3RBTA 2HRFA 2OBIA 5FHIA 3PGTA 2GVPA 4HOJA 3O6TA 4IVFA 1SL0B 3VI5A 1YF0A 2P5QA 3HHVA 1ZYPA 3FZ4A 3F0IA 1GSQA 3HVNA 1F3BA 2REMA 5E4WA 1CQHA 2JU5A 2I81A 2K18A 2LQOA 3VWWA 1Y25A 2EIOA 3A5WA 3A2VA 2J23A 4ICYA 3EC3A 1SD8A 2VL3A 2WFCA 16GSA 3L9UA 1WIKA 1TOFA 1FB6A 2AB6A 2R37A 4GTUA 2L6CA 1R5AA 4RI7A 5D73A 6GSVA 4WF4A 1EWXA 4K2XA 1UC7A 4ZILA 3TKSA 4K7NA 5FWGA 1WRYA 1TJDA 1VF3A 4AGSA 4BIKA 1PMTA 2YWNA 4MF6A 4E8HA 3PR8A 3UEMA 3KZQA 4NV2A 2FD3A 2CV4A 1XWKA 2CZ3A 2EIRA 2JACA 1GTUA 3F6DA 3EU4A 3P8WA 3O3TA 4IELA 2HZFA 2CAIA 2MYGA 3IDVA 4AJ6A 4EC0A 4FQUA 1K0CA 1FB0A 2IWTA 1H75A 3P7XA 2R3XA 3RHCA 4G9HA 3D0ZA 1A2LA 1ZOFA 1GSDA 3EYTA 1VF1A 5H5SA 4O32A 1SENA 3QAWA 1EP8A 1SK1A 4QL7A 2MBTA 5AISA 4ZL7A 1VF4A 2VCQA 2H66A 4MNNA 3ZYWA 3DRNA 3HXSA 5IMAA 2I4AA 4DSSA 2XPDA 2B6MA 3F4TA 5IMDA 5AGYA 2A4HA 5D9WA 4DEJA 1TK0B 2XBQA 4MA9A 2B5EA 4O5UA 3U5RE 4H86A 4Z2TA 2H74A 1YKCA 1NSWA 2VCWA 10GSA 2WB9A 2FCHA 1AUCA 4G10A 7GSSA 2K8SA 1MEKA 2YV7A 2DSAA 2DLXA 4L0WA 4MP4A 2VLUA 4HZ2A 4IN0A 3V1WA 3LXTA 2VLVA 3TOTA 2YWIA 2WULA 5KN1A 2FWGA 5F05A 4WR5A 2HSHA 5DAKB 4YAPA 1Z6MA 1A0FA 1GTAA 4TRXA 2V41A 4PNFA 3HDCA 4GQCA 1H4OA 4MPGA 4ML6A 1QFNA 4YQUA 1WE0A 2GZYA 2VUPA 1SJIA 4WXTA 5IPGA 2RUFA 2PBJA 5J5NA 5CRDA 2RUEA 1XW6A 1Y6EA 5IMCA 4WBJA 20GSA 3D22A 5H5QA 2DJ0A 2H0HA 1I9DA 4ACSA 1Z5YE 4J57E 2N5FA 5F8BA 4KDUA 1EV9A 4IW9A 2P5RA 3WGEA 2VOCA 4G19A 2IL3A 1ZGNA 2B7KA 4LA1A 1FG4A 2JADA 4OO5A 3KJYA 4KCEA 3IBHA 1M9BA 3TJKA 4XIHA 3GFKA 5G1KA 4OWYA 1WMJA 3KIJA 1AIUA 3ZITA 4J2FA 2VAFA 3UBLA 4BVYA 1A0RP 4F0CA 4TKYA 4V1Ap 1E6BA 3ED3A 3KEBA 1E2YA 3GSSA 4N11A 2JSYA 2AYTA 2DJJA 2VCVA 2PERA 3IC4A 4ULXA 2V6KA 2N5AA 2IMKA 1SU9A 1ZYQB 1GNEA 3QCPA 5ECPB 5D9XA 5D9TA 1GP1A 3IHGA 2DJ2A 3GHAA 2XPEA 1LJRA 3VI7A 1ZYEA 3U6VA 4HU7A 2FA8A 3I43A 1LU4A 3M1GA 1BAYA 1TK5B 8GSSA 3LJRA 1ML6A 1ST9A 1GSUA 3EPTA 2HLSA 1XWGA 3F8UA 4GF0A 4GRFA 2DKHA 4K5RA 1A23A 3QFAC 1ACVA 2B7JA 2CT6A 1S3CA 3NOFA 2IJYA 1TRSA 4F03A 14GSA 2V1MA 2CQ9A 1GTIA 2NBSA 5ECLB 1MD3A 2A4VA 2CAQA 5H5RA 2PPTA 3VK9A 3FRCA 2O89A 1OVNA 2H1GA 4ZBBA 4GCIA 5HR1A 2F51A 4KDXA 1M2DA 1TK8B 2MZCA 4IJIA 3F6FA 2H1AA 3LWAA 1TXXA 4IGJA 2DJ3A 5B6MA 5KOWA 1JFUA 4XRAA 2E2MA 2X99A 1PL2A 5B8AA 4TR1B 2OE1A 2GSTA 3H8QA 1A2JA 2LUSA 2VL2C 2AV4A 4PURA 3FZ5A 5GSTA 2WGRA 3GX0A 2FHEA 2MMOA 3IAM2 1TI3A 3KGKA 4K2DA 2WJUA 4IQ1A 2M80A 3CSHA 4K1FA 3EE2A 4N0VA 2AJQB 1LBKA 4IKHA 2MMNA 2C1YA 4KAEA 2V2GA 1FO5A 2AUVA 5D9VA 5ECMB 3MIXA 1OC8A 1T1VA 4TXOA 1XG8A 2PWJA 3L4NA 2WZ9A 2YNXA 3L9VA 3D6IA 1O8WA 3C71A 1KEBA 4X43A 2MMZA 3BBYA 2R0GA 5AIVA 4Z2UA 1XXUA 2L59A 1M0UA 2WCIA 4PNGA 2LV3A 1X5EA 2ON5A 3ZLPA 2VD1A 1TW9A 1M99A 2DMMA 4D73A 3IOSA 3TJBA 2JSZA 4ZL8A 2E7PA 4CY6A 1PGTA 1MTCA 2PMTA 2VCXA 2H01A 2N5BA 3GIXA 2FWHA 2DMLA 4N10A 4ML1A 3UVTA 2X8GA 3HVSA 4POMA 4Q5RA 1X9SB 3GURA 3A2XA 5EVOA 5JWOB 2X4AA 4HJ2A 2O8VB 2C0FA 2HYXA 1PRXA 3NIVA 4BL7B 1Z6NA 2A2PA 4YQMA 1FW1A 2IMIA 22GSA 4ZBDA 3CMIA 3ZMKA 2IMEA 3C7MA 4HS1A 1YF1A 2L6DA 3TKSE 2DKIA 1F2EA 1VGLA 1OC3A 4L0UA 1SJZA 3KXOA 4HEA2 4ECIA 3R2QA 4DSSB 1OE8A 5DJMA 2DBCA 3L9SA 3TKRA 2H0IA 1IYIA 5G30A 1MDJA 4OFNA 1JZRA 4ID0A 2DIZA 3IK7A 2OBKA 1KTEA 5ELAA 3IK9A 3A2WA 3WT1A 4HUAA 1PN0A 1G6YA 4TR0A 3FW2A 4X0XA 3VFIA 5DCHA 2IPAA 1NM3A 3DXBA 4I97A 4EVMA 2H72A 2IN3A 3SBCA 2B5YA 5G2ZA 3IC8A 1BEDA 2PGTA 3GYKA 4CW9A 5JWQB 3ME8A 4KUNA 4MDCA 3DYRA 3VURA 2G0FA 3A5IA 1FVJA 5ELGA 1K0DA 3CSIA 4FH8A 4FYBA 1DBYA 3HYPA 2H19A 3RHBA 3FHKA 3M0FA 1R26A 5HFGA 4PX1A 3GNJA 1SYXA 5CNWA 3L78A 4JR6A 4F9ZA 3M8NA 2HRAA 3UMAA 5J4UA 1V40A 3HZ4A 4E8EA 4OFMA 4BA7A 2ZUPA 3CSJA 4Z2RA 2HXKA 5IM9A 3HJOA 3KH7A 2EC4A 5E59A 1X9MB 5F07A 4KX4A 3J7Yb 4BVYB 3OR5A 1J0FA 1ZCPA 4PGTA 4AJ8A 6GSUA 4KGIA 5JCUA 2JZSA 1WOUA 3VWUA 2GSQA 3F63A 2QA1A 1O85A 1GULA 4NXIA 1F3AA 2LRTA 3HVXA 4KA0A 2H76A 1BG5A 3BCKA 3HY2A 1XOBA 2X64A 1SYRA 2TRXA 2V32A 3O76A 2ES7A 5ECHB 4F2IA 3Q19A 3TJGA 4CDOA 2BMXA 3LEFA 4KB3A 5D8IA 2X8CA 2OA7A 3FMWA 4G0IA 4MH2A 1ILOA 2QA2A 2YZHA 3MDKA 3TJJA 2L5LA 1GL8A 2HI7A 5B7CA 4PQ1A 1S3DA 1T4ZA 5JCGA 3PH9A 2CZ2A 1T4YA 3F3RA 3KP8A 1I5GA 2HE3A 2H30A 1ERVA 3PINA 1B4PA 1WJKA 1AW9A 5ECNB 4HI7A 2MMAA 3CBUA 4OD7A 3F4SA 1Q4JA 4FO5A 3HZ8A 4XS4A 2KP2A 1M7TA 1XIYA 2LNSA 1KNGA 3P90A 2V6OA 1GNWA 5G31A 4EE0A 3HJMA 3TDGA 1M3JA 1S3RA 2FLSA 4KH7A 2FNOA 1JLVA 2L4QA 1K3LA 1RW1A 4MLYA 5KN0A 4GSNA 1SK0A 4TOPA 1ABAA 3RPPA 2EIQA 4F82A 1DE2A 3EMPA 1SKWB 4WF5A 3GSTA 4EKZA 1XWCA 1PX6A 2H6YA 4TXOB 4ZIJA 4HJMA 3W8SA 3KTBA 4POKA 1PSQA 2VCZA 4I2TA 3ZL5A 4KDYA 1EV4A 1BJXA 2FWEA 1FVKA 1U88A 1QK8A 5ID2A 3D5JA 5COHA 4BVXA 1EEJA 2LTKA 1XVQA 5ECSA 5J3RA 5DVBA 4D73B 3C1SA 1V2AA 3MSZA 5CRGA 1OC9B 4XTSA 5IPHA 5LNKe 2TIRA 4N30A 1YDKA 3A3TA 3CTFA 2IFQA 1W89A 11GSA 3MAKA 4NV5A 1ERTA 1YQ1A 2C3QA 3GH6A 3CYNA 1NW2A 5G1LA 2OJLA 2FA4A 5ECIB 1W4VA 3TJFA 4JU5A 4EO3A 3KD0A 1GSSA 1M3IA 2D2ZA 3M9KA 3ZIVA 2YZUA 4EIQA 3TKPA 2H0GA 2M72A 1TDIA 2GTUA 1O73A 6GSSA 2DC5A 3QR6A 4ZB8A 1A8YA 4EF0A 3TKSC 2FUG2 2C0DA 2K6VA 1HNCA 4MMMA 2OACA 4XS1A 2L4CA 4ZB9A 1PX7A 4TR3A 3TB2A 5AN1A 4TW5A 4V2LA 1G7OA 5JWRB 1TP9A 1USBA 3TRXA 4NWYA 3FYGA 5LCZA 3APOA 3R3EA 4CHSA 4NHWA 2H73A 2KP1A 3I9V2 1NHOA 2F3MA 5D96A 2NDOA 5DQYA 4RQXA 1G0TA 4I2UA 3QAGA 3W6GA 3DGQA 1MDKA 1K0NA 2K9FA 2PVOC 2YP6A 1DUGA 4KNDA 2HZEA 1BQ7A 3ZVJA 1B9XC 5CP1A 2XC2A 2H75A 2YWMA 1RQMA 3IPZA 5EY6A 2L57A 2BTOT 2LNTA 4TR4A 1JZWA 3IV4A 4HSCX 5EL8A 9GSSA 19GSA 1N8JA 1T00A 3P2AA 2ON7A 1OKTA 4QL9A 4USSA 3KH9A 2IMFA 3I6AA 2CVKA 2QKEA 2O85A 1HNBA 1XWAA 2YJ7A 5CAXA 1XW5A 5GZZB 2H1DA 3J7Yk 1QXHA 5G5FA 1J9BA 3LQ7A 3G7JA 2A2SA 3IRAA 3ZFLA 6GSTA 1EZKA 2LJAA 3AY8A 3E3EA 2JZRA 3TCOA 2DJKA 3E0UA 4GWRA 1PKZA 1SKRB 4XHMA 3VPQA 1V58A 3RAZA 2CX4A 1Z3EA 4G0KA 3GUSA 1GSYA 4KSOA 1GLPA 1S3AA 2R2JA 1O6JA 4GSSA 5A4VA 1SL1B 3H93A 1A2MA 2I1UA 1TRWA 2TRCP 2PVQA 2I3YA 4X4JA 1FOVA 3KMOA 2VM1A 3IXRA 2F9SA 3WGXA 3EU3A 3FZAA 3HJPA 3UARA 5LD0A 3GTUA 1XZOA 3HKRA 5ECOB 2ALBA 3KP9A 6GSYA 1FOHA 4XS6A 2H6ZA 3E9JB 1XCCA 3ZFBA 3QD9A 4MZCA 4EUYA 4HDEA 1F6MC 4RI6A 4HU9A 3D21A 1ZYNA 1C72A 2B1LA 4MJBA 2F8AA 1SL2B 3Q6OA 2WRTA 5CREA 3FKFA 3LYPA 4YKFA 5IIZA 2PN8A 3UVHA 2C80A 3MNGA 5DDLA 4MJCA 4RUVA 4EDZA 5CYYA 2YV9A 3C73A 1AQWA 4MZWA 1TTZA 1DE1A 3LORA 1PQNA 3FR6A 3UJ1A 3EURA 4Z7XA 4GQFA 2VIMA 4Q5FA 1OKDA 3F3QA 5GSSA 3GH9A 3TRQA 2CVDA 1THXA 2HT9A 5C00A 4EXJA 1GUHA 4G0LA 4XS4B 1U87A 1GH2A 3C1RA 3G7YA 4KW6A 1EGOA 1PFOA 3APSA 1B9YC 3QAVA 2YANA 4PUAA 2R0CA 3H4KA 4TXVA 2E0QA 4ECCA 3GKNA 2HNLA 2LQQA 3M9JA 2VO4A 3EVIA 3BD2A 2P0GA 5CRHA 1JHBA 2YN1A 1HNAA 2K8VA 3GN3A 4DSRA 4JBBA 4MCUA 1M2BA 3US3A 5ABRA 1HYUA 5DALA 3DKSA 1Z7RA 3F9UA 4J56E 5DBQA 4ISDA 1PD21 1AC1A 1V57A 3FZ9A 5F06A 1QGVA 4TR1A 1Z7PA 3ZRDA 1V9WA 5INYA 2CX3A 4LMWA 3RDWA 4PTSA 1J08A 4CY8A 4ILFA 4EIPA 4JEDA 1EP7A 3CRUA 4MJAA 1MDIA 5ID2B 5ECRB 5IMVA 1ON4A 4BVXB 3CTGA 5F0GA 2BJXA 3HD5A 1PL1A 2HRNA 1YJ6A 3ZVJD 3C8EA 1Q98A 4PUFC 3UL3A 3Q18A 5HR3A 2ZCTA 4GSTA 2IFQB 2GT5A 1QUWA 3IHQA 2FY6A 1MD4A 2J9HA 3QPMA 4I5QA 4LLRA 5J9BA 3GKMA 5DJLA 1VF2A 3MWHA 4TVEA 1AXDA 3LFLA 5HFKA 4AJ7A 4ZL9A 3LGCA 4NMUA 2GQKA 4FYCA 1K3OA 5IQYA 2F8FA 2GLRA 2YWOA 1GRXA 3DEXA 4V1Ag 1SK2A 2YPMA 3N5OA 4LL4B 2QSIA 4O92A 6GSWA 2M46A 4EDYA 4QQ7A 2IIYA 5D93A 1RK4A 1F9MA 2JZTA 4KCAA 3ME7A 5HR0A 4DSQA 1EGRA 4IQAA 1NHYA 3RPNA 5ECQB 1K3YA 4V2MA 4WR4A 5B8BA 2WS2A 2XHFA 1ZL9A 4Q5QA 2DJ1A 1PN9A 3CXGA 1HQOA 1YKAA 4JZQA 4K7OA 4L5LA 2UZ8A 3EWLA 2GDRA 3GMFA 4ECBA
chains in the Genus database with same CATH topology
18GSA 1A24A 2GSSA 1WPIA 1TRVA 5A4UA 3G7IA 1IYHA 3IAS2 4BL7A 3WT2A 2H8LA 5FT3A 1XPVA 5DCGA 3ERWA 2C3NA 2HZEB 3TKQA 2PUKC 3L0HA 4OO4A 1ERWA 2L5OA 3QDNA 2VL2A 4WKWA 2LKUA 2A2RA 3NZNA 4YQVA 4YKGA 3IR4A 2RM6A 2FWFA 4K0GA 1VRSD 4KE3A 5ENUA 1T7PB 3VLNA 1R5PA 4KF9A 1YZXA 4K8MA 4PQHA 1OE7A 2DIYA 5KEJA 1X9WB 2B1KA 1K0BA 1KBNA 1AQVA 1PKWA 1XFLA 4A5PA 1GWCA 2GT6A 5KN2A 4I6XA 4MJEA 5IOXA 1X0RA 3WD6A 5DQSA 3H79A 2VCTA 2GZZA 2H6XA 1UA5A 1N2AA 3GKXA 4PXOA 2OE0A 3GKKA 3ZREA 3JCML 2OADA 3QMXA 3GL5A 5CRWA 1A8LA 3TUEA 3VPTA 2R5GA 1B8XA 12GSA 1GLQA 3KTLA 3DVWA 5GAND 1XWBA 3EMXA 2Z9SA 2FGXA 17GSA 4K5SA 4XRDA 2LJRA 4FIWA 4LMVA 3SWLA 5GAPD 2CA8A 2GS3A 2YOIA 1TI1A 1R7HA 2B5XA 1GUKA 3GV1A 2VD0A 3LXZA 3DIEA 1SJ6A 4PQIA 4WETA 1PA3A 1QQ2A 5KOXA 4O7HA 3KCMA 2LJKA 2LSTA 4P3YB 2P31A 3DD3A 2GQLA 5BMUA 3ERFA 3LYKA 4N0ZA 3UOMA 3DWVA 3GTUB 4BWSA 1K0MA 5IOWA 2KLXA 3LW9A 1ZZYA 4MZBA 1EEMA 1BYEA 2C8UA 1O81A 1TRUA 1WP0A 2IMDA 3UBKA 4MPFA 4HQSA 4WBRD 5B6NA 2I9HA 4OCFA 3W8JA 3D4MA 1JZDA 1T8EB 4LL1B 2C3TA 4O5RA 2R0PA 4HZ4A 5IMZA 4MH3A 3D4TA 5HR2A 2C0GA 2XBIA 1B4QA 5J41A 3WGDA 5A4WA 1AQXA 1G7EA 4KSMA 3BOAA 2H1BA 1CQGA 2AHEA 3ZTLA 5L71A 4GXZA 3LSZA 2VL9A 3EINA 4L8EA 2CVBA 1OYJA 3FK8A 1UN2A 5BRTA 1M9AA 4K7IA 3I69A 1DSBA 5IMFA 3GRXA 1YEXA 2QC7A 3IE3A 5A5KA 4YH2A 3HA9A 3FEUA 3GA4A 1AAZA 1QMVA 1XW9A 1B48A 3ISOA 1XBSA 4FYUA 1V98A 2B3SA 1GTBA 4DVCA 1EOHA 4MABA 4MK3A 3FR9A 1UVZA 1FAAA 1GUMA 4RQRA 3VWVA 4HQZA 4K9ZA 4ECJA 4G2EA 2LEGA 2VLTA 4X1UA 5DALB 1F37A 3KM6A 1GSFA 1WWJA 4JRRA 2X49A 3N9JA 2C4JA 3ERGA 3QFBC 3Q74A 3HVVA 13GSA 2GQMA 3TRPA 2RLIA 3LG6A 1YEPA 1TKDB 2PU9C 3ZIJA 4ZXGA 2NPBA 4MF5A 2R6KA 3M3MA 4K6XA 4OCEA 5ECKB 3ZMLA 3H1NA 3DMLA 2H70A 2YCDA 5IO2A 4K0NA 5DAKA 4AF2A 4NPBA 2KUCA 1FHEA 5JCWA 3HCZA 2AAWA 2LS5A 3UAPA 3FR3A 4Q5NA 4POBA 1U6TA 4BPYA 4WEYA 2RIIA 4MF7A 3KMNA 1ERUA 4POLA 3S9FA 5HFIA 2KHPA 1OAZA 4ZB6A 2GSRA 4JR4A 5J9CA 1EOGA 2H71A 2HSYA 3GL3A 3WYWA 1SD9A 2X8HA 1SKSB 4L5OA 2O7KA 1URMA 4IBPA 3F4RA 1R4WA 1K0OA 2O87A 1OC9A 1XOAA 4IHUA 4NAXA 1BX9A 2YJHA 4IP1A 4ZBAA 4F0BA 4IP6A 5C04A 2C0EA 3DVXA 4XCSA 2JL4A 2KOKA 1X5CA 5AIXA 2E2GA 4OMVA 4YAVA 2LRNA 1ZMAA 2OKAA 3FY7A 2NTOA 4NHZA 1T3BA 3PPUA 5G5EA 2GGTA 5KN3A 1M2AA 2LRCA 1U3AA 4JE1A 5IO0A 3TGZA 2NVLA 3ZZXA 5CO3A 1TU7A 1Z9HA 1TU8A 2VM2A 1JLWA 4I8BA 1G6WA 3VWXA 2WDUA 4OFTA 1XVWA 1X5DA 2G2QA 1O8XA 1YY7A 2ZNMA 4IS0A 1JZOA 3G9BA 4GLTA 3UIWA 4IJ3A 3TOUA 3GX8A 3BCIA 2R4VA 3BJ5A 4EL1A 1O7UA 1GSEA 3APQA 3QOUA 3IA1A 4V2NA 6GSXA 1HD2A 2QGVA 2MBSA 1K0AA 2HFDA 3MYDA 4TN8A 4O5QA 2HSMA 2RM5A 3K8NA 1THOA 2OE3A 5HQPA 5EPFA 1U3IA 2GZPA 4BWQA 3CRTA 2HRKA 3RBTA 2HRFA 2OBIA 5FHIA 3PGTA 2GVPA 4HOJA 3O6TA 4IVFA 1SL0B 3VI5A 1YF0A 2P5QA 3HHVA 1ZYPA 3FZ4A 3F0IA 1GSQA 1F3BA 2REMA 5E4WA 1CQHA 2JU5A 2I81A 2K18A 2LQOA 3VWWA 1Y25A 2EIOA 3A5WA 3A2VA 2J23A 4ICYA 3EC3A 1SD8A 2VL3A 2WFCA 16GSA 3L9UA 1WIKA 1TOFA 1FB6A 2AB6A 2R37A 4GTUA 2L6CA 1R5AA 4RI7A 5D73A 6GSVA 4WF4A 1EWXA 4K2XA 1UC7A 4ZILA 3TKSA 4K7NA 5FWGA 1WRYA 1TJDA 1VF3A 4AGSA 1PMTA 2YWNA 4MF6A 4E8HA 3PR8A 3UEMA 3KZQA 4NV2A 2FD3A 2CV4A 1XWKA 2CZ3A 2EIRA 2JACA 1GTUA 3F6DA 3EU4A 3P8WA 3O3TA 4IELA 2HZFA 2CAIA 2MYGA 3IDVA 4AJ6A 4EC0A 4FQUA 1K0CA 1FB0A 2IWTA 1H75A 3P7XA 2R3XA 3RHCA 4G9HA 3D0ZA 1A2LA 1ZOFA 1GSDA 3EYTA 1VF1A 5H5SA 4O32A 1SENA 3QAWA 1EP8A 1SK1A 4QL7A 2MBTA 5AISA 4ZL7A 1VF4A 2VCQA 2H66A 4MNNA 3ZYWA 3DRNA 3HXSA 5IMAA 2I4AA 4DSSA 2XPDA 2B6MA 3F4TA 5IMDA 5AGYA 2A4HA 5D9WA 4DEJA 1TK0B 2XBQA 4MA9A 2B5EA 4O5UA 3U5RE 4H86A 4Z2TA 2H74A 1YKCA 1NSWA 2VCWA 10GSA 2WB9A 2FCHA 1AUCA 4G10A 7GSSA 2K8SA 1MEKA 2YV7A 2DSAA 2DLXA 4L0WA 4MP4A 2VLUA 4HZ2A 4IN0A 3V1WA 3LXTA 2VLVA 3TOTA 2YWIA 2WULA 5KN1A 2FWGA 5F05A 4WR5A 2HSHA 5DAKB 4YAPA 1Z6MA 1A0FA 1GTAA 4TRXA 2V41A 4PNFA 3HDCA 4GQCA 1H4OA 4MPGA 4ML6A 1QFNA 4YQUA 1WE0A 2GZYA 2VUPA 1SJIA 4WXTA 5IPGA 2RUFA 2PBJA 5J5NA 5CRDA 2RUEA 1XW6A 1Y6EA 5IMCA 4WBJA 20GSA 3D22A 5H5QA 2DJ0A 2H0HA 1I9DA 4ACSA 1Z5YE 4J57E 2N5FA 5F8BA 4KDUA 1EV9A 4IW9A 2P5RA 3WGEA 2VOCA 4G19A 2IL3A 1ZGNA 2B7KA 4LA1A 1FG4A 2JADA 4OO5A 3KJYA 4KCEA 3IBHA 1M9BA 3TJKA 4XIHA 3GFKA 5G1KA 4OWYA 1WMJA 3KIJA 1AIUA 3ZITA 4J2FA 2VAFA 3UBLA 4BVYA 1A0RP 4F0CA 4TKYA 4V1Ap 1E6BA 3ED3A 3KEBA 1E2YA 3GSSA 4N11A 2JSYA 2AYTA 2DJJA 2VCVA 2PERA 3IC4A 4ULXA 2V6KA 2N5AA 2IMKA 1SU9A 1ZYQB 1GNEA 3QCPA 5ECPB 5D9XA 5D9TA 1GP1A 3IHGA 2DJ2A 3GHAA 2XPEA 1LJRA 3VI7A 1ZYEA 3U6VA 4HU7A 2FA8A 3I43A 1LU4A 3M1GA 1BAYA 1TK5B 8GSSA 3LJRA 1ML6A 1ST9A 1GSUA 3EPTA 2HLSA 1XWGA 3F8UA 4GF0A 4GRFA 2DKHA 4K5RA 1A23A 3QFAC 1ACVA 2B7JA 2CT6A 1S3CA 3NOFA 2IJYA 1TRSA 4F03A 14GSA 2V1MA 2CQ9A 1GTIA 2NBSA 5ECLB 1MD3A 2A4VA 2CAQA 5H5RA 2PPTA 3VK9A 3FRCA 2O89A 1OVNA 2H1GA 4ZBBA 4GCIA 5HR1A 2F51A 4KDXA 1M2DA 1TK8B 2MZCA 4IJIA 3F6FA 2H1AA 3LWAA 1TXXA 4IGJA 2DJ3A 5B6MA 5KOWA 1JFUA 4XRAA 2E2MA 2X99A 1PL2A 5B8AA 4TR1B 2OE1A 2GSTA 3H8QA 1A2JA 2LUSA 2VL2C 2AV4A 4PURA 3FZ5A 5GSTA 2WGRA 3GX0A 2FHEA 2MMOA 3IAM2 1TI3A 3KGKA 4K2DA 2WJUA 4IQ1A 2M80A 3CSHA 4K1FA 3EE2A 4N0VA 2AJQB 1LBKA 4IKHA 2MMNA 2C1YA 4KAEA 2V2GA 1FO5A 2AUVA 5D9VA 5ECMB 3MIXA 1OC8A 1T1VA 4TXOA 2PWJA 3L4NA 2WZ9A 2YNXA 3L9VA 3D6IA 1O8WA 3C71A 1KEBA 4X43A 2MMZA 3BBYA 2R0GA 5AIVA 4Z2UA 1XXUA 2L59A 1M0UA 2WCIA 4PNGA 2LV3A 1X5EA 2ON5A 3ZLPA 2VD1A 1TW9A 1M99A 2DMMA 4D73A 3IOSA 3TJBA 2JSZA 4ZL8A 2E7PA 4CY6A 1PGTA 1MTCA 2PMTA 2VCXA 2H01A 2N5BA 3GIXA 2FWHA 2DMLA 4N10A 4ML1A 3UVTA 2X8GA 3HVSA 4POMA 4Q5RA 1X9SB 3GURA 3A2XA 5EVOA 5JWOB 2X4AA 4HJ2A 2O8VB 2C0FA 2HYXA 1PRXA 3NIVA 4BL7B 1Z6NA 2A2PA 4YQMA 1FW1A 2IMIA 22GSA 4ZBDA 3CMIA 3ZMKA 2IMEA 3C7MA 4HS1A 1YF1A 2L6DA 3TKSE 2DKIA 1F2EA 1VGLA 1OC3A 4L0UA 1SJZA 3KXOA 4HEA2 4ECIA 3R2QA 4DSSB 1OE8A 5DJMA 2DBCA 3L9SA 3TKRA 2H0IA 1IYIA 5G30A 1MDJA 4OFNA 1JZRA 4ID0A 2DIZA 3IK7A 2OBKA 1KTEA 5ELAA 3IK9A 3A2WA 3WT1A 4HUAA 1PN0A 1G6YA 4TR0A 3FW2A 4X0XA 3VFIA 5DCHA 2IPAA 1NM3A 3DXBA 4I97A 4EVMA 2H72A 2IN3A 3SBCA 2B5YA 5G2ZA 3IC8A 1BEDA 2PGTA 3GYKA 4CW9A 5JWQB 3ME8A 4KUNA 4MDCA 3DYRA 3VURA 2G0FA 3A5IA 1FVJA 5ELGA 1K0DA 3CSIA 4FH8A 4FYBA 1DBYA 3HYPA 2H19A 3RHBA 3FHKA 3M0FA 1R26A 5HFGA 4PX1A 3GNJA 1SYXA 5CNWA 3L78A 4JR6A 4F9ZA 3M8NA 2HRAA 3UMAA 5J4UA 1V40A 3HZ4A 4E8EA 4OFMA 4BA7A 2ZUPA 3CSJA 4Z2RA 2HXKA 5IM9A 3HJOA 3KH7A 2EC4A 5E59A 1X9MB 5F07A 4KX4A 3J7Yb 4BVYB 3OR5A 1J0FA 1ZCPA 4PGTA 4AJ8A 6GSUA 4KGIA 5JCUA 2JZSA 1WOUA 3VWUA 2GSQA 3F63A 2QA1A 1O85A 1GULA 4NXIA 1F3AA 2LRTA 3HVXA 4KA0A 2H76A 1BG5A 3BCKA 3HY2A 1XOBA 2X64A 1SYRA 2TRXA 2V32A 3O76A 2ES7A 5ECHB 4F2IA 3Q19A 3TJGA 4CDOA 2BMXA 3LEFA 4KB3A 5D8IA 2X8CA 2OA7A 3FMWA 4G0IA 4MH2A 1ILOA 2QA2A 2YZHA 3MDKA 3TJJA 2L5LA 1GL8A 2HI7A 5B7CA 4PQ1A 1S3DA 1T4ZA 5JCGA 3PH9A 2CZ2A 1T4YA 3F3RA 3KP8A 1I5GA 2HE3A 2H30A 1ERVA 3PINA 1B4PA 1WJKA 1AW9A 5ECNB 4HI7A 2MMAA 3CBUA 4OD7A 3F4SA 1Q4JA 4FO5A 3HZ8A 4XS4A 2KP2A 1M7TA 1XIYA 2LNSA 1KNGA 3P90A 2V6OA 1GNWA 5G31A 4EE0A 3HJMA 3TDGA 2FLSA 4KH7A 2FNOA 1JLVA 2L4QA 1K3LA 1RW1A 4MLYA 5KN0A 4GSNA 1SK0A 4TOPA 1ABAA 3RPPA 2EIQA 4F82A 1DE2A 3EMPA 1SKWB 4WF5A 3GSTA 4EKZA 1XWCA 1PX6A 2H6YA 4TXOB 4ZIJA 4HJMA 3W8SA 3KTBA 4POKA 1PSQA 2VCZA 4I2TA 3ZL5A 4KDYA 1EV4A 1BJXA 2FWEA 1FVKA 1U88A 1QK8A 5ID2A 3D5JA 5COHA 4BVXA 1EEJA 2LTKA 1XVQA 5ECSA 5J3RA 5DVBA 4D73B 3C1SA 1V2AA 3MSZA 5CRGA 1OC9B 4XTSA 5IPHA 5LNKe 2TIRA 4N30A 1YDKA 3A3TA 3CTFA 2IFQA 1W89A 11GSA 3MAKA 4NV5A 1ERTA 1YQ1A 2C3QA 3GH6A 3CYNA 1NW2A 5G1LA 2OJLA 2FA4A 5ECIB 1W4VA 3TJFA 4JU5A 4EO3A 3KD0A 1GSSA 2D2ZA 3M9KA 3ZIVA 2YZUA 4EIQA 3TKPA 2H0GA 2M72A 1TDIA 2GTUA 1O73A 6GSSA 2DC5A 3QR6A 4ZB8A 1A8YA 4EF0A 3TKSC 2FUG2 2C0DA 2K6VA 1HNCA 4MMMA 2OACA 4XS1A 2L4CA 4ZB9A 1PX7A 4TR3A 3TB2A 5AN1A 4TW5A 4V2LA 1G7OA 5JWRB 1TP9A 1USBA 3TRXA 4NWYA 3FYGA 5LCZA 3APOA 3R3EA 4CHSA 4NHWA 2H73A 2KP1A 3I9V2 1NHOA 2F3MA 5D96A 2NDOA 5DQYA 4RQXA 1G0TA 4I2UA 3QAGA 3W6GA 3DGQA 1MDKA 1K0NA 2K9FA 2PVOC 2YP6A 1DUGA 4KNDA 2HZEA 1BQ7A 3ZVJA 1B9XC 5CP1A 2XC2A 2H75A 2YWMA 1RQMA 3IPZA 5EY6A 2L57A 2BTOT 2LNTA 4TR4A 1JZWA 3IV4A 5EL8A 9GSSA 19GSA 1N8JA 1T00A 3P2AA 2ON7A 1OKTA 4QL9A 4USSA 3KH9A 2IMFA 3I6AA 2CVKA 2QKEA 2O85A 1HNBA 1XWAA 2YJ7A 5CAXA 1XW5A 5GZZB 2H1DA 3J7Yk 1QXHA 5G5FA 1J9BA 3LQ7A 3G7JA 2A2SA 3IRAA 3ZFLA 6GSTA 1EZKA 2LJAA 3AY8A 3E3EA 2JZRA 3TCOA 2DJKA 3E0UA 4GWRA 1PKZA 1SKRB 4XHMA 3VPQA 1V58A 3RAZA 2CX4A 1Z3EA 4G0KA 3GUSA 1GSYA 4KSOA 1GLPA 1S3AA 2R2JA 1O6JA 4GSSA 5A4VA 1SL1B 3H93A 1A2MA 2I1UA 1TRWA 2TRCP 2PVQA 2I3YA 4X4JA 1FOVA 3KMOA 2VM1A 3IXRA 2F9SA 3WGXA 3EU3A 3FZAA 3HJPA 3UARA 5LD0A 3GTUA 1XZOA 3HKRA 5ECOB 2ALBA 3KP9A 6GSYA 1FOHA 4XS6A 2H6ZA 3E9JB 1XCCA 3ZFBA 3QD9A 4MZCA 4EUYA 4HDEA 1F6MC 4RI6A 4HU9A 3D21A 1ZYNA 1C72A 2B1LA 4MJBA 2F8AA 1SL2B 3Q6OA 2WRTA 5CREA 3FKFA 3LYPA 4YKFA 5IIZA 2PN8A 3UVHA 2C80A 3MNGA 5DDLA 4MJCA 4RUVA 4EDZA 5CYYA 2YV9A 3C73A 1AQWA 4MZWA 1TTZA 1DE1A 3LORA 1PQNA 3FR6A 3UJ1A 3EURA 4Z7XA 4GQFA 2VIMA 4Q5FA 1OKDA 3F3QA 5GSSA 3GH9A 3TRQA 2CVDA 1THXA 2HT9A 5C00A 4EXJA 1GUHA 4G0LA 4XS4B 1U87A 1GH2A 3C1RA 3G7YA 4KW6A 1EGOA 3APSA 1B9YC 3QAVA 2YANA 4PUAA 2R0CA 3H4KA 4TXVA 2E0QA 4ECCA 3GKNA 2HNLA 2LQQA 3M9JA 2VO4A 3EVIA 3BD2A 2P0GA 5CRHA 1JHBA 2YN1A 1HNAA 2K8VA 3GN3A 4DSRA 4JBBA 4MCUA 1M2BA 3US3A 5ABRA 1HYUA 5DALA 3DKSA 1Z7RA 3F9UA 4J56E 5DBQA 4ISDA 1PD21 1AC1A 1V57A 3FZ9A 5F06A 1QGVA 4TR1A 1Z7PA 3ZRDA 1V9WA 5INYA 2CX3A 4LMWA 3RDWA 4PTSA 1J08A 4CY8A 4ILFA 4EIPA 4JEDA 1EP7A 3CRUA 4MJAA 1MDIA 5ID2B 5ECRB 5IMVA 1ON4A 4BVXB 3CTGA 5F0GA 2BJXA 3HD5A 1PL1A 2HRNA 1YJ6A 3ZVJD 3C8EA 1Q98A 4PUFC 3UL3A 3Q18A 5HR3A 2ZCTA 4GSTA 2IFQB 2GT5A 1QUWA 3IHQA 2FY6A 1MD4A 2J9HA 3QPMA 4I5QA 4LLRA 5J9BA 3GKMA 5DJLA 1VF2A 3MWHA 4TVEA 1AXDA 3LFLA 5HFKA 4AJ7A 4ZL9A 3LGCA 4NMUA 2GQKA 4FYCA 1K3OA 5IQYA 2F8FA 2GLRA 2YWOA 1GRXA 3DEXA 4V1Ag 1SK2A 2YPMA 3N5OA 4LL4B 2QSIA 4O92A 6GSWA 2M46A 4EDYA 4QQ7A 2IIYA 5D93A 1RK4A 1F9MA 2JZTA 4KCAA 3ME7A 5HR0A 4DSQA 1EGRA 4IQAA 1NHYA 3RPNA 5ECQB 1K3YA 4V2MA 4WR4A 5B8BA 2WS2A 2XHFA 1ZL9A 4Q5QA 2DJ1A 1PN9A 3CXGA 1HQOA 1YKAA 4JZQA 4K7OA 4L5LA 2UZ8A 3EWLA 2GDRA 3GMFA 4ECBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 18GS A;  1A24 A;  2GSS A;  1WPI A;  1TRV A;  5A4U A;  3G7I A;  1IYH A;  3IAS 2;  4BL7 A;  3WT2 A;  2H8L A;  5FT3 A;  1XPV A;  5DCG A;  3ERW A;  2C3N A;  2HZE B;  3TKQ A;  2PUK C;  3L0H A;  4OO4 A;  1ERW A;  2L5O A;  3QDN A;  2VL2 A;  4WKW A;  2LKU A;  2A2R A;  3NZN A;  4YQV A;  3IR4 A;  2RM6 A;  2FWF A;  4K0G A;  1VRS D;  4KE3 A;  5ENU A;  1T7P B;  3VLN A;  1R5P A;  1YZX A;  4K8M A;  4PQH A;  1OE7 A;  2DIY A;  5KEJ A;  1X9W B;  2B1K A;  1K0B A;  1KBN A;  1AQV A;  1PKW A;  1XFL A;  1GWC A;  2GT6 A;  5KN2 A;  4I6X A;  4MJE A;  5IOX A;  1X0R A;  3WD6 A;  5DQS A;  3H79 A;  2VCT A;  2GZZ A;  2H6X A;  1UA5 A;  1N2A A;  3GKX A;  4PXO A;  2OE0 A;  3GKK A;  3ZRE A;  3JCM L;  2OAD A;  3QMX A;  3GL5 A;  5CRW A;  1A8L A;  3TUE A;  3VPT A;  2R5G A;  1B8X A;  12GS A;  1GLQ A;  3KTL A;  3DVW A;  5GAN D;  1XWB A;  3EMX A;  2Z9S A;  2FGX A;  17GS A;  4XRD A;  2LJR A;  4FIW A;  4LMV A;  3SWL A;  5GAP D;  2CA8 A;  2GS3 A;  2YOI A;  1TI1 A;  1R7H A;  2B5X A;  1GUK A;  3GV1 A;  2VD0 A;  3LXZ A;  3DIE A;  1SJ6 A;  4PQI A;  4WET A;  1PA3 A;  1QQ2 A;  4O7H A;  3KCM A;  2LJK A;  2LST A;  4P3Y B;  2P31 A;  3DD3 A;  2GQL A;  3ERF A;  3LYK A;  4N0Z A;  3UOM A;  3DWV A;  3GTU B;  4BWS A;  1K0M A;  5IOW A;  2KLX A;  1ZZY A;  4MZB A;  1EEM A;  1BYE A;  2C8U A;  1O81 A;  1TRU A;  1WP0 A;  2IMD A;  3UBK A;  4MPF A;  4HQS A;  4WBR D;  5B6N A;  2I9H A;  4OCF A;  3W8J A;  3D4M A;  1JZD A;  1T8E B;  4LL1 B;  2C3T A;  4O5R A;  4HZ4 A;  5IMZ A;  4MH3 A;  3D4T A;  5HR2 A;  2C0G A;  2XBI A;  1B4Q A;  5J41 A;  3WGD A;  5A4W A;  1AQX A;  1G7E A;  4KSM A;  3BOA A;  2H1B A;  1CQG A;  2AHE A;  3ZTL A;  5L71 A;  4GXZ A;  3LSZ A;  2VL9 A;  3EIN A;  4L8E A;  2CVB A;  1OYJ A;  3FK8 A;  1UN2 A;  1M9A A;  4K7I A;  3I69 A;  1DSB A;  5IMF A;  3GRX A;  1YEX A;  2QC7 A;  3IE3 A;  5A5K A;  4YH2 A;  3HA9 A;  3FEU A;  3GA4 A;  1AAZ A;  1QMV A;  1XW9 A;  1B48 A;  3ISO A;  1XBS A;  4FYU A;  1V98 A;  2B3S A;  1GTB A;  4DVC A;  1EOH A;  4MAB A;  4MK3 A;  3FR9 A;  1UVZ A;  1FAA A;  1GUM A;  4RQR A;  3VWV A;  4HQZ A;  4K9Z A;  4ECJ A;  4G2E A;  2LEG A;  2VLT A;  4X1U A;  5DAL B;  1F37 A;  3KM6 A;  1GSF A;  1WWJ A;  4JRR A;  3N9J A;  2C4J A;  3ERG A;  3QFB C;  3Q74 A;  3HVV A;  13GS A;  2GQM A;  3TRP A;  2RLI A;  3LG6 A;  1YEP A;  1TKD B;  2PU9 C;  3ZIJ A;  4ZXG A;  2NPB A;  4MF5 A;  2R6K A;  3M3M A;  4K6X A;  4OCE A;  5ECK B;  3ZML A;  3H1N A;  3DML A;  2H70 A;  2YCD A;  5IO2 A;  4K0N A;  5DAK A;  4AF2 A;  4NPB A;  2KUC A;  1FHE A;  5JCW A;  3HCZ A;  2AAW A;  2LS5 A;  3UAP A;  3FR3 A;  4Q5N A;  4POB A;  1U6T A;  4BPY A;  4WEY A;  2RII A;  4MF7 A;  3KMN A;  1ERU A;  4POL A;  3S9F A;  5HFI A;  2KHP A;  1OAZ A;  4ZB6 A;  2GSR A;  4JR4 A;  5J9C A;  1EOG A;  2H71 A;  2HSY A;  3GL3 A;  3WYW A;  1SD9 A;  2X8H A;  1SKS B;  4L5O A;  2O7K A;  1URM A;  4IBP A;  3F4R A;  1R4W A;  1K0O A;  2O87 A;  1OC9 A;  1XOA A;  4IHU A;  4NAX A;  1BX9 A;  2YJH A;  4IP1 A;  4ZBA A;  4F0B A;  4IP6 A;  5C04 A;  2C0E A;  3DVX A;  4XCS A;  2JL4 A;  2KOK A;  1X5C A;  5AIX A;  2E2G A;  4OMV A;  4YAV A;  2LRN A;  1ZMA A;  2OKA A;  3FY7 A;  2NTO A;  4NHZ A;  1T3B A;  5G5E A;  2GGT A;  5KN3 A;  1M2A A;  2LRC A;  1U3A A;  4JE1 A;  5IO0 A;  3TGZ A;  2NVL A;  3ZZX A;  5CO3 A;  1TU7 A;  1Z9H A;  1TU8 A;  2VM2 A;  1JLW A;  4I8B A;  1G6W A;  3VWX A;  2WDU A;  4OFT A;  1XVW A;  1X5D A;  2G2Q A;  1O8X A;  1YY7 A;  2ZNM A;  4IS0 A;  1JZO A;  3G9B A;  4GLT A;  3UIW A;  4IJ3 A;  3TOU A;  3GX8 A;  3BCI A;  2R4V A;  3BJ5 A;  4EL1 A;  1O7U A;  1GSE A;  3APQ A;  3QOU A;  3IA1 A;  4V2N A;  6GSX A;  1HD2 A;  2QGV A;  2MBS A;  1K0A A;  2HFD A;  4TN8 A;  2RM5 A;  3K8N A;  1THO A;  2OE3 A;  5HQP A;  5EPF A;  1U3I A;  2GZP A;  4BWQ A;  3CRT A;  3RBT A;  2HRF A;  2OBI A;  5FHI A;  3PGT A;  2GVP A;  4HOJ A;  3O6T A;  4IVF A;  1SL0 B;  3VI5 A;  1YF0 A;  2P5Q A;  3HHV A;  3FZ4 A;  3F0I A;  1GSQ A;  1F3B A;  2REM A;  5E4W A;  1CQH A;  2JU5 A;  2I81 A;  2K18 A;  2LQO A;  3VWW A;  1Y25 A;  2EIO A;  3A5W A;  3A2V A;  2J23 A;  3EC3 A;  1SD8 A;  2VL3 A;  2WFC A;  16GS A;  3L9U A;  1WIK A;  1TOF A;  1FB6 A;  2AB6 A;  2R37 A;  4GTU A;  2L6C A;  1R5A A;  4RI7 A;  5D73 A;  6GSV A;  4WF4 A;  1EWX A;  1UC7 A;  4ZIL A;  3TKS A;  4K7N A;  5FWG A;  1WRY A;  1TJD A;  1VF3 A;  4AGS A;  1PMT A;  2YWN A;  4MF6 A;  4E8H A;  3PR8 A;  3UEM A;  3KZQ A;  4NV2 A;  2FD3 A;  2CV4 A;  1XWK A;  2CZ3 A;  2EIR A;  2JAC A;  1GTU A;  3F6D A;  3EU4 A;  3P8W A;  3O3T A;  4IEL A;  2HZF A;  2CAI A;  2MYG A;  3IDV A;  4AJ6 A;  4EC0 A;  1K0C A;  1FB0 A;  2IWT A;  1H75 A;  3P7X A;  2R3X A;  3RHC A;  4G9H A;  3D0Z A;  1A2L A;  1ZOF A;  1GSD A;  3EYT A;  1VF1 A;  5H5S A;  4O32 A;  1SEN A;  3QAW A;  1EP8 A;  1SK1 A;  4QL7 A;  2MBT A;  5AIS A;  4ZL7 A;  1VF4 A;  2VCQ A;  2H66 A;  3ZYW A;  3DRN A;  3HXS A;  5IMA A;  2I4A A;  4DSS A;  2XPD A;  2B6M A;  3F4T A;  5IMD A;  5AGY A;  5D9W A;  4DEJ A;  1TK0 B;  2XBQ A;  4MA9 A;  2B5E A;  3U5R E;  4H86 A;  2H74 A;  1YKC A;  1NSW A;  2VCW A;  10GS A;  2WB9 A;  2FCH A;  1AUC A;  4G10 A;  7GSS A;  2K8S A;  1MEK A;  2YV7 A;  2DSA A;  2DLX A;  4L0W A;  4MP4 A;  2VLU A;  4HZ2 A;  4IN0 A;  3V1W A;  3LXT A;  2VLV A;  3TOT A;  2YWI A;  2WUL A;  5KN1 A;  2FWG A;  5F05 A;  4WR5 A;  2HSH A;  5DAK B;  4YAP A;  1Z6M A;  1A0F A;  1GTA A;  4TRX A;  2V41 A;  4PNF A;  3HDC A;  4GQC A;  1H4O A;  4MPG A;  4ML6 A;  1QFN A;  4YQU A;  1WE0 A;  2GZY A;  2VUP A;  1SJI A;  4WXT A;  5IPG A;  2RUF A;  2PBJ A;  5J5N A;  5CRD A;  2RUE A;  1XW6 A;  1Y6E A;  5IMC A;  4WBJ A;  20GS A;  3D22 A;  5H5Q A;  2DJ0 A;  2H0H A;  1I9D A;  4ACS A;  1Z5Y E;  4J57 E;  2N5F A;  5F8B A;  4KDU A;  1EV9 A;  4IW9 A;  2P5R A;  3WGE A;  2VOC A;  4G19 A;  2IL3 A;  1ZGN A;  2B7K A;  4LA1 A;  1FG4 A;  2JAD A;  4OO5 A;  3KJY A;  4KCE A;  3IBH A;  1M9B A;  3TJK A;  4XIH A;  3GFK A;  5G1K A;  4OWY A;  1WMJ A;  3KIJ A;  1AIU A;  3ZIT A;  4J2F A;  2VAF A;  3UBL A;  4BVY A;  1A0R P;  4F0C A;  4TKY A;  4V1A p;  1E6B A;  3ED3 A;  3KEB A;  1E2Y A;  3GSS A;  4N11 A;  2JSY A;  2AYT A;  2DJJ A;  2VCV A;  2PER A;  3IC4 A;  4ULX A;  2V6K A;  2N5A A;  2IMK A;  1SU9 A;  1ZYQ B;  1GNE A;  3QCP A;  5ECP B;  5D9X A;  5D9T A;  1GP1 A;  2DJ2 A;  3GHA A;  2XPE A;  1LJR A;  3VI7 A;  1ZYE A;  3U6V A;  4HU7 A;  2FA8 A;  3I43 A;  1LU4 A;  3M1G A;  1BAY A;  1TK5 B;  8GSS A;  3LJR A;  1ML6 A;  1ST9 A;  1GSU A;  2HLS A;  1XWG A;  3F8U A;  4GF0 A;  4GRF A;  1A23 A;  3QFA C;  1ACV A;  2B7J A;  2CT6 A;  1S3C A;  3NOF A;  2IJY A;  1TRS A;  4F03 A;  14GS A;  2V1M A;  2CQ9 A;  1GTI A;  5ECL B;  2NBS A;  1MD3 A;  2A4V A;  2CAQ A;  5H5R A;  2PPT A;  3VK9 A;  3FRC A;  2O89 A;  1OVN A;  2H1G A;  4ZBB A;  4GCI A;  5HR1 A;  2F51 A;  4KDX A;  1M2D A;  1TK8 B;  2MZC A;  4IJI A;  3F6F A;  2H1A A;  3LWA A;  1TXX A;  4IGJ A;  2DJ3 A;  5B6M A;  1JFU A;  4XRA A;  2E2M A;  2X99 A;  1PL2 A;  5B8A A;  4TR1 B;  2OE1 A;  2GST A;  3H8Q A;  1A2J A;  2LUS A;  2VL2 C;  2AV4 A;  4PUR A;  3FZ5 A;  5GST A;  2WGR A;  3GX0 A;  2FHE A;  2MMO A;  3IAM 2;  1TI3 A;  3KGK A;  4K2D A;  2WJU A;  4IQ1 A;  2M80 A;  3CSH A;  4K1F A;  3EE2 A;  4N0V A;  2AJQ B;  1LBK A;  4IKH A;  2MMN A;  2C1Y A;  4KAE A;  2V2G A;  1FO5 A;  5ECM B;  5D9V A;  2AUV A;  1OC8 A;  1T1V A;  4TXO A;  2PWJ A;  3L4N A;  2WZ9 A;  2YNX A;  3L9V A;  3D6I A;  1O8W A;  3C71 A;  1KEB A;  4X43 A;  2MMZ A;  3BBY A;  5AIV A;  1XXU A;  2L59 A;  1M0U A;  2WCI A;  4PNG A;  2LV3 A;  1X5E A;  2ON5 A;  3ZLP A;  2VD1 A;  1TW9 A;  1M99 A;  2DMM A;  4D73 A;  3IOS A;  3TJB A;  2JSZ A;  4ZL8 A;  2E7P A;  1PGT A;  1MTC A;  2PMT A;  2VCX A;  2H01 A;  2N5B A;  3GIX A;  2FWH A;  2DML A;  4N10 A;  4ML1 A;  3UVT A;  2X8G A;  3HVS A;  4POM A;  4Q5R A;  1X9S B;  3GUR A;  3A2X A;  5EVO A;  5JWO B;  4HJ2 A;  2O8V B;  2C0F A;  2HYX A;  1PRX A;  3NIV A;  1Z6N A;  4YQM A;  1FW1 A;  2IMI A;  22GS A;  4ZBD A;  3CMI A;  3ZMK A;  2IME A;  3C7M A;  4HS1 A;  1YF1 A;  2L6D A;  3TKS E;  1F2E A;  1VGL A;  1OC3 A;  4L0U A;  1SJZ A;  3KXO A;  4HEA 2;  4ECI A;  3R2Q A;  4DSS B;  1OE8 A;  5DJM A;  2DBC A;  3L9S A;  3TKR A;  2H0I A;  1IYI A;  5G30 A;  1MDJ A;  4OFN A;  1JZR A;  4ID0 A;  2DIZ A;  3IK7 A;  2OBK A;  1KTE A;  5ELA A;  3IK9 A;  3A2W A;  3WT1 A;  4HUA A;  1G6Y A;  4TR0 A;  3FW2 A;  4X0X A;  3VFI A;  5DCH A;  2IPA A;  1NM3 A;  3DXB A;  4I97 A;  4EVM A;  2H72 A;  2IN3 A;  3SBC A;  2B5Y A;  5G2Z A;  1BED A;  2PGT A;  3GYK A;  4CW9 A;  5JWQ B;  3ME8 A;  4KUN A;  4MDC A;  3DYR A;  3VUR A;  2G0F A;  1FVJ A;  5ELG A;  1K0D A;  3CSI A;  4FH8 A;  4FYB A;  1DBY A;  3HYP A;  2H19 A;  3RHB A;  3FHK A;  3M0F A;  1R26 A;  5HFG A;  4PX1 A;  3GNJ A;  1SYX A;  5CNW A;  3L78 A;  4JR6 A;  4F9Z A;  3M8N A;  3UMA A;  5J4U A;  1V40 A;  3HZ4 A;  4E8E A;  4OFM A;  4BA7 A;  2ZUP A;  3CSJ A;  2HXK A;  5IM9 A;  3HJO A;  3KH7 A;  2EC4 A;  5E59 A;  1X9M B;  5F07 A;  4KX4 A;  3J7Y b;  3OR5 A;  1J0F A;  1ZCP A;  4PGT A;  4AJ8 A;  6GSU A;  4KGI A;  5JCU A;  2JZS A;  1WOU A;  3VWU A;  2GSQ A;  3F63 A;  1O85 A;  1GUL A;  4NXI A;  1F3A A;  2LRT A;  3HVX A;  4KA0 A;  2H76 A;  1BG5 A;  3BCK A;  3HY2 A;  1XOB A;  2X64 A;  1SYR A;  2TRX A;  2V32 A;  3O76 A;  2ES7 A;  5ECH B;  4F2I A;  3Q19 A;  3TJG A;  4CDO A;  2BMX A;  3LEF A;  4KB3 A;  5D8I A;  2X8C A;  2OA7 A;  4MH2 A;  1ILO A;  2YZH A;  3MDK A;  3TJJ A;  2L5L A;  1GL8 A;  2HI7 A;  5B7C A;  4PQ1 A;  1S3D A;  1T4Z A;  5JCG A;  3PH9 A;  2CZ2 A;  1T4Y A;  3F3R A;  3KP8 A;  1I5G A;  2HE3 A;  2H30 A;  1ERV A;  3PIN A;  1B4P A;  1WJK A;  1AW9 A;  5ECN B;  4HI7 A;  2MMA A;  3CBU A;  4OD7 A;  3F4S A;  1Q4J A;  4FO5 A;  3HZ8 A;  4XS4 A;  2KP2 A;  1M7T A;  1XIY A;  2LNS A;  1KNG A;  3P90 A;  2V6O A;  1GNW A;  5G31 A;  4EE0 A;  3HJM A;  3TDG A;  2FLS A;  4KH7 A;  2FNO A;  1JLV A;  2L4Q A;  1K3L A;  1RW1 A;  4MLY A;  5KN0 A;  4GSN A;  1SK0 A;  4TOP A;  1ABA A;  3RPP A;  2EIQ A;  4F82 A;  1DE2 A;  3EMP A;  1SKW B;  4WF5 A;  3GST A;  4EKZ A;  1XWC A;  1PX6 A;  2H6Y A;  4TXO B;  4ZIJ A;  4HJM A;  3W8S A;  3KTB A;  4POK A;  1PSQ A;  2VCZ A;  4I2T A;  3ZL5 A;  4KDY A;  1EV4 A;  1BJX A;  2FWE A;  1FVK A;  1U88 A;  1QK8 A;  5ID2 A;  3D5J A;  5COH A;  4BVX A;  1EEJ A;  2LTK A;  1XVQ A;  5ECS A;  5J3R A;  5DVB A;  4D73 B;  3C1S A;  1V2A A;  3MSZ A;  5CRG A;  1OC9 B;  4XTS A;  5IPH A;  5LNK e;  2TIR A;  4N30 A;  1YDK A;  3A3T A;  3CTF A;  2IFQ A;  1W89 A;  11GS A;  3MAK A;  4NV5 A;  1ERT A;  1YQ1 A;  2C3Q A;  3GH6 A;  3CYN A;  1NW2 A;  5G1L A;  2OJL A;  2FA4 A;  5ECI B;  1W4V A;  3TJF A;  4JU5 A;  4EO3 A;  3KD0 A;  1GSS A;  2D2Z A;  3M9K A;  3ZIV A;  2YZU A;  3TKP A;  2H0G A;  2M72 A;  1TDI A;  2GTU A;  1O73 A;  6GSS A;  2DC5 A;  3QR6 A;  4ZB8 A;  1A8Y A;  4EF0 A;  3TKS C;  2FUG 2;  2C0D A;  2K6V A;  1HNC A;  4MMM A;  2OAC A;  4XS1 A;  2L4C A;  4ZB9 A;  1PX7 A;  4TR3 A;  3TB2 A;  5AN1 A;  4TW5 A;  4V2L A;  1G7O A;  5JWR B;  1TP9 A;  1USB A;  3TRX A;  4NWY A;  3FYG A;  5LCZ A;  3APO A;  4CHS A;  4NHW A;  2H73 A;  2KP1 A;  3I9V 2;  1NHO A;  2F3M A;  5D96 A;  2NDO A;  5DQY A;  4RQX A;  1G0T A;  4I2U A;  3QAG A;  3W6G A;  3DGQ A;  1MDK A;  1K0N A;  2K9F A;  2PVO C;  2YP6 A;  1DUG A;  4KND A;  2HZE A;  1BQ7 A;  3ZVJ A;  1B9X C;  5CP1 A;  2XC2 A;  2H75 A;  2YWM A;  1RQM A;  3IPZ A;  5EY6 A;  2L57 A;  2BTO T;  2LNT A;  4TR4 A;  1JZW A;  3IV4 A;  5EL8 A;  9GSS A;  19GS A;  1N8J A;  1T00 A;  3P2A A;  2ON7 A;  1OKT A;  4QL9 A;  3KH9 A;  2IMF A;  3I6A A;  2CVK A;  2QKE A;  2O85 A;  1HNB A;  1XWA A;  2YJ7 A;  5CAX A;  1XW5 A;  5GZZ B;  2H1D A;  3J7Y k;  1QXH A;  5G5F A;  1J9B A;  3LQ7 A;  3G7J A;  2A2S A;  3IRA A;  3ZFL A;  6GST A;  1EZK A;  2LJA A;  3AY8 A;  3E3E A;  2JZR A;  3TCO A;  2DJK A;  3E0U A;  4GWR A;  1PKZ A;  1SKR B;  4XHM A;  3VPQ A;  1V58 A;  3RAZ A;  2CX4 A;  1Z3E A;  3GUS A;  1GSY A;  4KSO A;  1GLP A;  1S3A A;  2R2J A;  1O6J A;  4GSS A;  5A4V A;  1SL1 B;  3H93 A;  1A2M A;  2I1U A;  1TRW A;  2TRC P;  2PVQ A;  2I3Y A;  1FOV A;  3KMO A;  2VM1 A;  3IXR A;  2F9S A;  3WGX A;  3EU3 A;  3FZA A;  3HJP A;  3UAR A;  5LD0 A;  3GTU A;  1XZO A;  3HKR A;  5ECO B;  2ALB A;  3KP9 A;  6GSY A;  4XS6 A;  2H6Z A;  3E9J B;  1XCC A;  3ZFB A;  3QD9 A;  4MZC A;  4EUY A;  4HDE A;  1F6M C;  4RI6 A;  4HU9 A;  3D21 A;  1C72 A;  2B1L A;  4MJB A;  2F8A A;  1SL2 B;  3Q6O A;  2WRT A;  5CRE A;  3FKF A;  3LYP A;  5IIZ A;  2PN8 A;  3UVH A;  2C80 A;  3MNG A;  5DDL A;  4MJC A;  4RUV A;  4EDZ A;  5CYY A;  2YV9 A;  3C73 A;  1AQW A;  4MZW A;  1TTZ A;  1DE1 A;  3LOR A;  1PQN A;  3FR6 A;  3UJ1 A;  3EUR A;  4Z7X A;  4GQF A;  2VIM A;  4Q5F A;  1OKD A;  3F3Q A;  5GSS A;  3GH9 A;  3TRQ A;  2CVD A;  1THX A;  2HT9 A;  5C00 A;  4EXJ A;  1GUH A;  4XS4 B;  1U87 A;  1GH2 A;  3C1R A;  3G7Y A;  4KW6 A;  1EGO A;  3APS A;  1B9Y C;  3QAV A;  2YAN A;  4PUA A;  3H4K A;  4TXV A;  2E0Q A;  4ECC A;  3GKN A;  2HNL A;  2LQQ A;  3M9J A;  2VO4 A;  3EVI A;  3BD2 A;  2P0G A;  5CRH A;  1JHB A;  2YN1 A;  1HNA A;  2K8V A;  3GN3 A;  4DSR A;  4JBB A;  4MCU A;  1M2B A;  3US3 A;  5ABR A;  1HYU A;  5DAL A;  3DKS A;  1Z7R A;  3F9U A;  4J56 E;  5DBQ A;  4ISD A;  1PD2 1;  1AC1 A;  1V57 A;  3FZ9 A;  5F06 A;  1QGV A;  4TR1 A;  1Z7P A;  3ZRD A;  1V9W A;  5INY A;  2CX3 A;  4LMW A;  3RDW A;  1J08 A;  4ILF A;  4JED A;  1EP7 A;  3CRU A;  4MJA A;  1MDI A;  5ID2 B;  5ECR B;  5IMV A;  1ON4 A;  3CTG A;  5F0G A;  2BJX A;  3HD5 A;  1PL1 A;  2HRN A;  1YJ6 A;  3ZVJ D;  3C8E A;  1Q98 A;  4PUF C;  3UL3 A;  3Q18 A;  5HR3 A;  2ZCT A;  4GST A;  2IFQ B;  2GT5 A;  1QUW A;  3IHQ A;  2FY6 A;  1MD4 A;  2J9H A;  3QPM A;  4I5Q A;  4LLR A;  5J9B A;  3GKM A;  5DJL A;  1VF2 A;  3MWH A;  4TVE A;  1AXD A;  3LFL A;  5HFK A;  4AJ7 A;  4ZL9 A;  3LGC A;  4NMU A;  2GQK A;  4FYC A;  1K3O A;  5IQY A;  2F8F A;  2GLR A;  2YWO A;  1GRX A;  3DEX A;  4V1A g;  1SK2 A;  2YPM A;  3N5O A;  4LL4 B;  2QSI A;  4O92 A;  6GSW A;  2M46 A;  4EDY A;  4QQ7 A;  2IIY A;  5D93 A;  1RK4 A;  1F9M A;  2JZT A;  4KCA A;  3ME7 A;  5HR0 A;  4DSQ A;  1EGR A;  4IQA A;  1NHY A;  3RPN A;  5ECQ B;  1K3Y A;  4V2M A;  4WR4 A;  5B8B A;  2WS2 A;  2XHF A;  1ZL9 A;  4Q5Q A;  2DJ1 A;  1PN9 A;  3CXG A;  1HQO A;  1YKA A;  4JZQ A;  4K7O A;  4L5L A;  3EWL A;  2GDR A;  3GMF A;  4ECB A; 
#chains in the Genus database with same CATH topology
 18GS A;  1A24 A;  2GSS A;  1WPI A;  1TRV A;  5A4U A;  3G7I A;  1IYH A;  3IAS 2;  4BL7 A;  3WT2 A;  2H8L A;  5FT3 A;  1XPV A;  5DCG A;  3ERW A;  2C3N A;  2HZE B;  3TKQ A;  2PUK C;  3L0H A;  4OO4 A;  1ERW A;  2L5O A;  3QDN A;  2VL2 A;  4WKW A;  2LKU A;  2A2R A;  3NZN A;  4YQV A;  4YKG A;  3IR4 A;  2RM6 A;  2FWF A;  4K0G A;  1VRS D;  4KE3 A;  5ENU A;  1T7P B;  3VLN A;  1R5P A;  4KF9 A;  1YZX A;  4K8M A;  4PQH A;  1OE7 A;  2DIY A;  5KEJ A;  1X9W B;  2B1K A;  1K0B A;  1KBN A;  1AQV A;  1PKW A;  1XFL A;  4A5P A;  1GWC A;  2GT6 A;  5KN2 A;  4I6X A;  4MJE A;  5IOX A;  1X0R A;  3WD6 A;  5DQS A;  3H79 A;  2VCT A;  2GZZ A;  2H6X A;  1UA5 A;  1N2A A;  3GKX A;  4PXO A;  2OE0 A;  3GKK A;  3ZRE A;  3JCM L;  2OAD A;  3QMX A;  3GL5 A;  5CRW A;  1A8L A;  3TUE A;  3VPT A;  2R5G A;  1B8X A;  12GS A;  1GLQ A;  3KTL A;  3DVW A;  5GAN D;  1XWB A;  3EMX A;  2Z9S A;  2FGX A;  17GS A;  4K5S A;  4XRD A;  2LJR A;  4FIW A;  4LMV A;  3SWL A;  5GAP D;  2CA8 A;  2GS3 A;  2YOI A;  1TI1 A;  1R7H A;  2B5X A;  1GUK A;  3GV1 A;  2VD0 A;  3LXZ A;  3DIE A;  1SJ6 A;  4PQI A;  4WET A;  1PA3 A;  1QQ2 A;  5KOX A;  4O7H A;  3KCM A;  2LJK A;  2LST A;  4P3Y B;  2P31 A;  3DD3 A;  2GQL A;  5BMU A;  3ERF A;  3LYK A;  4N0Z A;  3UOM A;  3DWV A;  3GTU B;  4BWS A;  1K0M A;  5IOW A;  2KLX A;  3LW9 A;  1ZZY A;  4MZB A;  1EEM A;  1BYE A;  2C8U A;  1O81 A;  1TRU A;  1WP0 A;  2IMD A;  3UBK A;  4MPF A;  4HQS A;  4WBR D;  5B6N A;  2I9H A;  4OCF A;  3W8J A;  3D4M A;  1JZD A;  1T8E B;  4LL1 B;  2C3T A;  4O5R A;  2R0P A;  4HZ4 A;  5IMZ A;  4MH3 A;  3D4T A;  5HR2 A;  2C0G A;  2XBI A;  1B4Q A;  5J41 A;  3WGD A;  5A4W A;  1AQX A;  1G7E A;  4KSM A;  3BOA A;  2H1B A;  1CQG A;  2AHE A;  3ZTL A;  5L71 A;  4GXZ A;  3LSZ A;  2VL9 A;  3EIN A;  4L8E A;  2CVB A;  1OYJ A;  3FK8 A;  1UN2 A;  5BRT A;  1M9A A;  4K7I A;  3I69 A;  1DSB A;  5IMF A;  3GRX A;  1YEX A;  2QC7 A;  3IE3 A;  5A5K A;  4YH2 A;  3HA9 A;  3FEU A;  3GA4 A;  1AAZ A;  1QMV A;  1XW9 A;  1B48 A;  3ISO A;  1XBS A;  4FYU A;  1V98 A;  2B3S A;  1GTB A;  4DVC A;  1EOH A;  4MAB A;  4MK3 A;  3FR9 A;  1UVZ A;  1FAA A;  1GUM A;  4RQR A;  3VWV A;  4HQZ A;  4K9Z A;  4ECJ A;  4G2E A;  2LEG A;  2VLT A;  4X1U A;  5DAL B;  1F37 A;  3KM6 A;  1GSF A;  1WWJ A;  4JRR A;  2X49 A;  3N9J A;  2C4J A;  3ERG A;  3QFB C;  3Q74 A;  3HVV A;  13GS A;  2GQM A;  3TRP A;  2RLI A;  3LG6 A;  1YEP A;  1TKD B;  2PU9 C;  3ZIJ A;  4ZXG A;  2NPB A;  4MF5 A;  2R6K A;  3M3M A;  4K6X A;  4OCE A;  5ECK B;  3ZML A;  3H1N A;  3DML A;  2H70 A;  2YCD A;  5IO2 A;  4K0N A;  5DAK A;  4AF2 A;  4NPB A;  2KUC A;  1FHE A;  5JCW A;  3HCZ A;  2AAW A;  2LS5 A;  3UAP A;  3FR3 A;  4Q5N A;  4POB A;  1U6T A;  4BPY A;  4WEY A;  2RII A;  3CQF A;  4MF7 A;  3KMN A;  1ERU A;  4POL A;  3S9F A;  5HFI A;  2KHP A;  1OAZ A;  4ZB6 A;  2GSR A;  4JR4 A;  5J9C A;  1EOG A;  2H71 A;  2HSY A;  3GL3 A;  3WYW A;  1SD9 A;  2X8H A;  1SKS B;  4L5O A;  2O7K A;  1URM A;  4IBP A;  3F4R A;  1R4W A;  1K0O A;  2O87 A;  1OC9 A;  1XOA A;  4IHU A;  4NAX A;  1BX9 A;  2YJH A;  4IP1 A;  4ZBA A;  4F0B A;  4IP6 A;  5C04 A;  2C0E A;  3DVX A;  4XCS A;  2JL4 A;  2KOK A;  1X5C A;  5AIX A;  2E2G A;  4OMV A;  4YAV A;  2LRN A;  1ZMA A;  2OKA A;  3FY7 A;  2NTO A;  4NHZ A;  1T3B A;  3PPU A;  5G5E A;  2GGT A;  5KN3 A;  1M2A A;  2LRC A;  1U3A A;  4JE1 A;  5IO0 A;  3TGZ A;  2NVL A;  3ZZX A;  5CO3 A;  1TU7 A;  1Z9H A;  1TU8 A;  2VM2 A;  1JLW A;  4I8B A;  1G6W A;  3VWX A;  2WDU A;  4OFT A;  1XVW A;  1X5D A;  2G2Q A;  1O8X A;  1YY7 A;  2ZNM A;  4IS0 A;  1JZO A;  3G9B A;  4GLT A;  3UIW A;  4IJ3 A;  3TOU A;  3GX8 A;  3BCI A;  2R4V A;  3BJ5 A;  4EL1 A;  1O7U A;  1GSE A;  3APQ A;  3QOU A;  3IA1 A;  4V2N A;  6GSX A;  1HD2 A;  2QGV A;  2MBS A;  1K0A A;  2HFD A;  3MYD A;  4TN8 A;  4O5Q A;  2HSM A;  2RM5 A;  3K8N A;  1THO A;  2OE3 A;  5HQP A;  5EPF A;  1U3I A;  2GZP A;  4BWQ A;  3CRT A;  2HRK A;  3RBT A;  2HRF A;  2OBI A;  5FHI A;  3PGT A;  2GVP A;  4HOJ A;  3O6T A;  4IVF A;  1SL0 B;  3VI5 A;  1YF0 A;  2P5Q A;  3HHV A;  1ZYP A;  3FZ4 A;  3F0I A;  1GSQ A;  3HVN A;  1F3B A;  2REM A;  5E4W A;  1CQH A;  2JU5 A;  2I81 A;  2K18 A;  2LQO A;  3VWW A;  1Y25 A;  2EIO A;  3A5W A;  3A2V A;  2J23 A;  4ICY A;  3EC3 A;  1SD8 A;  2VL3 A;  2WFC A;  16GS A;  3L9U A;  1WIK A;  1TOF A;  1FB6 A;  2AB6 A;  2R37 A;  4GTU A;  2L6C A;  1R5A A;  4RI7 A;  5D73 A;  6GSV A;  4WF4 A;  1EWX A;  4K2X A;  1UC7 A;  4ZIL A;  3TKS A;  4K7N A;  5FWG A;  1WRY A;  1TJD A;  1VF3 A;  4AGS A;  4BIK A;  1PMT A;  2YWN A;  4MF6 A;  4E8H A;  3PR8 A;  3UEM A;  3KZQ A;  4NV2 A;  2FD3 A;  2CV4 A;  1XWK A;  2CZ3 A;  2EIR A;  2JAC A;  1GTU A;  3F6D A;  3EU4 A;  3P8W A;  3O3T A;  4IEL A;  2HZF A;  2CAI A;  2MYG A;  3IDV A;  4AJ6 A;  4EC0 A;  4FQU A;  1K0C A;  1FB0 A;  2IWT A;  1H75 A;  3P7X A;  2R3X A;  3RHC A;  4G9H A;  3D0Z A;  1A2L A;  1ZOF A;  1GSD A;  3EYT A;  1VF1 A;  5H5S A;  4O32 A;  1SEN A;  3QAW A;  1EP8 A;  1SK1 A;  4QL7 A;  2MBT A;  5AIS A;  4ZL7 A;  1VF4 A;  2VCQ A;  2H66 A;  4MNN A;  3ZYW A;  3DRN A;  3HXS A;  5IMA A;  2I4A A;  4DSS A;  2XPD A;  2B6M A;  3F4T A;  5IMD A;  5AGY A;  2A4H A;  5D9W A;  4DEJ A;  1TK0 B;  2XBQ A;  4MA9 A;  2B5E A;  4O5U A;  3U5R E;  4H86 A;  4Z2T A;  2H74 A;  1YKC A;  1NSW A;  2VCW A;  10GS A;  2WB9 A;  2FCH A;  1AUC A;  4G10 A;  7GSS A;  2K8S A;  1MEK A;  2YV7 A;  2DSA A;  2DLX A;  4L0W A;  4MP4 A;  2VLU A;  4HZ2 A;  4IN0 A;  3V1W A;  3LXT A;  2VLV A;  3TOT A;  2YWI A;  2WUL A;  5KN1 A;  2FWG A;  5F05 A;  4WR5 A;  2HSH A;  5DAK B;  4YAP A;  1Z6M A;  1A0F A;  1GTA A;  4TRX A;  2V41 A;  4PNF A;  3HDC A;  4GQC A;  1H4O A;  4MPG A;  4ML6 A;  1QFN A;  4YQU A;  1WE0 A;  2GZY A;  2VUP A;  1SJI A;  4WXT A;  5IPG A;  2RUF A;  2PBJ A;  5J5N A;  5CRD A;  2RUE A;  1XW6 A;  1Y6E A;  5IMC A;  4WBJ A;  20GS A;  3D22 A;  5H5Q A;  2DJ0 A;  2H0H A;  1I9D A;  4ACS A;  1Z5Y E;  4J57 E;  2N5F A;  5F8B A;  4KDU A;  1EV9 A;  4IW9 A;  2P5R A;  3WGE A;  2VOC A;  4G19 A;  2IL3 A;  1ZGN A;  2B7K A;  4LA1 A;  1FG4 A;  2JAD A;  4OO5 A;  3KJY A;  4KCE A;  3IBH A;  1M9B A;  3TJK A;  4XIH A;  3GFK A;  5G1K A;  4OWY A;  1WMJ A;  3KIJ A;  1AIU A;  3ZIT A;  4J2F A;  2VAF A;  3UBL A;  4BVY A;  1A0R P;  4F0C A;  4TKY A;  4V1A p;  1E6B A;  3ED3 A;  3KEB A;  1E2Y A;  3GSS A;  4N11 A;  2JSY A;  2AYT A;  2DJJ A;  2VCV A;  2PER A;  3IC4 A;  4ULX A;  2V6K A;  2N5A A;  2IMK A;  1SU9 A;  1ZYQ B;  1GNE A;  3QCP A;  5ECP B;  5D9X A;  5D9T A;  1GP1 A;  3IHG A;  2DJ2 A;  3GHA A;  2XPE A;  1LJR A;  3VI7 A;  1ZYE A;  3U6V A;  4HU7 A;  2FA8 A;  3I43 A;  1LU4 A;  3M1G A;  1BAY A;  1TK5 B;  8GSS A;  3LJR A;  1ML6 A;  1ST9 A;  1GSU A;  3EPT A;  2HLS A;  1XWG A;  3F8U A;  4GF0 A;  4GRF A;  2DKH A;  4K5R A;  1A23 A;  3QFA C;  1ACV A;  2B7J A;  2CT6 A;  1S3C A;  3NOF A;  2IJY A;  1TRS A;  4F03 A;  14GS A;  2V1M A;  2CQ9 A;  1GTI A;  2NBS A;  5ECL B;  1MD3 A;  2A4V A;  2CAQ A;  5H5R A;  2PPT A;  3VK9 A;  3FRC A;  2O89 A;  1OVN A;  2H1G A;  4ZBB A;  4GCI A;  5HR1 A;  2F51 A;  4KDX A;  1M2D A;  1TK8 B;  2MZC A;  4IJI A;  3F6F A;  2H1A A;  3LWA A;  1TXX A;  4IGJ A;  2DJ3 A;  5B6M A;  5KOW A;  1JFU A;  4XRA A;  2E2M A;  2X99 A;  1PL2 A;  5B8A A;  4TR1 B;  2OE1 A;  2GST A;  3H8Q A;  1A2J A;  2LUS A;  2VL2 C;  2AV4 A;  4PUR A;  3FZ5 A;  5GST A;  2WGR A;  3GX0 A;  2FHE A;  2MMO A;  3IAM 2;  1TI3 A;  3KGK A;  4K2D A;  2WJU A;  4IQ1 A;  2M80 A;  3CSH A;  4K1F A;  3EE2 A;  4N0V A;  2AJQ B;  1LBK A;  4IKH A;  2MMN A;  2C1Y A;  4KAE A;  2V2G A;  1FO5 A;  2AUV A;  5D9V A;  5ECM B;  3MIX A;  1OC8 A;  1T1V A;  4TXO A;  1XG8 A;  2PWJ A;  3L4N A;  2WZ9 A;  2YNX A;  3L9V A;  3D6I A;  1O8W A;  3C71 A;  1KEB A;  4X43 A;  2MMZ A;  3BBY A;  2R0G A;  5AIV A;  4Z2U A;  1XXU A;  2L59 A;  1M0U A;  2WCI A;  4PNG A;  2LV3 A;  1X5E A;  2ON5 A;  3ZLP A;  2VD1 A;  1TW9 A;  1M99 A;  2DMM A;  4D73 A;  3IOS A;  3TJB A;  2JSZ A;  4ZL8 A;  2E7P A;  4CY6 A;  1PGT A;  1MTC A;  2PMT A;  2VCX A;  2H01 A;  2N5B A;  3GIX A;  2FWH A;  2DML A;  4N10 A;  4ML1 A;  3UVT A;  2X8G A;  3HVS A;  4POM A;  4Q5R A;  1X9S B;  3GUR A;  3A2X A;  5EVO A;  5JWO B;  2X4A A;  4HJ2 A;  2O8V B;  2C0F A;  2HYX A;  1PRX A;  3NIV A;  4BL7 B;  1Z6N A;  2A2P A;  4YQM A;  1FW1 A;  2IMI A;  22GS A;  4ZBD A;  3CMI A;  3ZMK A;  2IME A;  3C7M A;  4HS1 A;  1YF1 A;  2L6D A;  3TKS E;  2DKI A;  1F2E A;  1VGL A;  1OC3 A;  4L0U A;  1SJZ A;  3KXO A;  4HEA 2;  4ECI A;  3R2Q A;  4DSS B;  1OE8 A;  5DJM A;  2DBC A;  3L9S A;  3TKR A;  2H0I A;  1IYI A;  5G30 A;  1MDJ A;  4OFN A;  1JZR A;  4ID0 A;  2DIZ A;  3IK7 A;  2OBK A;  1KTE A;  5ELA A;  3IK9 A;  3A2W A;  3WT1 A;  4HUA A;  1PN0 A;  1G6Y A;  4TR0 A;  3FW2 A;  4X0X A;  3VFI A;  5DCH A;  2IPA A;  1NM3 A;  3DXB A;  4I97 A;  4EVM A;  2H72 A;  2IN3 A;  3SBC A;  2B5Y A;  5G2Z A;  3IC8 A;  1BED A;  2PGT A;  3GYK A;  4CW9 A;  5JWQ B;  3ME8 A;  4KUN A;  4MDC A;  3DYR A;  3VUR A;  2G0F A;  3A5I A;  1FVJ A;  5ELG A;  1K0D A;  3CSI A;  4FH8 A;  4FYB A;  1DBY A;  3HYP A;  2H19 A;  3RHB A;  3FHK A;  3M0F A;  1R26 A;  5HFG A;  4PX1 A;  3GNJ A;  1SYX A;  5CNW A;  3L78 A;  4JR6 A;  4F9Z A;  3M8N A;  2HRA A;  3UMA A;  5J4U A;  1V40 A;  3HZ4 A;  4E8E A;  4OFM A;  4BA7 A;  2ZUP A;  3CSJ A;  4Z2R A;  2HXK A;  5IM9 A;  3HJO A;  3KH7 A;  2EC4 A;  5E59 A;  1X9M B;  5F07 A;  4KX4 A;  3J7Y b;  4BVY B;  3OR5 A;  1J0F A;  1ZCP A;  4PGT A;  4AJ8 A;  6GSU A;  4KGI A;  5JCU A;  2JZS A;  1WOU A;  3VWU A;  2GSQ A;  3F63 A;  2QA1 A;  1O85 A;  1GUL A;  4NXI A;  1F3A A;  2LRT A;  3HVX A;  4KA0 A;  2H76 A;  1BG5 A;  3BCK A;  3HY2 A;  1XOB A;  2X64 A;  1SYR A;  2TRX A;  2V32 A;  3O76 A;  2ES7 A;  5ECH B;  4F2I A;  3Q19 A;  3TJG A;  4CDO A;  2BMX A;  3LEF A;  4KB3 A;  5D8I A;  2X8C A;  2OA7 A;  3FMW A;  4G0I A;  4MH2 A;  1ILO A;  2QA2 A;  2YZH A;  3MDK A;  3TJJ A;  2L5L A;  1GL8 A;  2HI7 A;  5B7C A;  4PQ1 A;  1S3D A;  1T4Z A;  5JCG A;  3PH9 A;  2CZ2 A;  1T4Y A;  3F3R A;  3KP8 A;  1I5G A;  2HE3 A;  2H30 A;  1ERV A;  3PIN A;  1B4P A;  1WJK A;  1AW9 A;  5ECN B;  4HI7 A;  2MMA A;  3CBU A;  4OD7 A;  3F4S A;  1Q4J A;  4FO5 A;  3HZ8 A;  4XS4 A;  2KP2 A;  1M7T A;  1XIY A;  2LNS A;  1KNG A;  3P90 A;  2V6O A;  1GNW A;  5G31 A;  4EE0 A;  3HJM A;  3TDG A;  1M3J A;  1S3R A;  2FLS A;  4KH7 A;  2FNO A;  1JLV A;  2L4Q A;  1K3L A;  1RW1 A;  4MLY A;  5KN0 A;  4GSN A;  1SK0 A;  4TOP A;  1ABA A;  3RPP A;  2EIQ A;  4F82 A;  1DE2 A;  3EMP A;  1SKW B;  4WF5 A;  3GST A;  4EKZ A;  1XWC A;  1PX6 A;  2H6Y A;  4TXO B;  4ZIJ A;  4HJM A;  3W8S A;  3KTB A;  4POK A;  1PSQ A;  2VCZ A;  4I2T A;  3ZL5 A;  4KDY A;  1EV4 A;  1BJX A;  2FWE A;  1FVK A;  1U88 A;  1QK8 A;  5ID2 A;  3D5J A;  5COH A;  4BVX A;  1EEJ A;  2LTK A;  1XVQ A;  5ECS A;  5J3R A;  5DVB A;  4D73 B;  3C1S A;  1V2A A;  3MSZ A;  5CRG A;  1OC9 B;  4XTS A;  5IPH A;  5LNK e;  2TIR A;  4N30 A;  1YDK A;  3A3T A;  3CTF A;  2IFQ A;  1W89 A;  11GS A;  3MAK A;  4NV5 A;  1ERT A;  1YQ1 A;  2C3Q A;  3GH6 A;  3CYN A;  1NW2 A;  5G1L A;  2OJL A;  2FA4 A;  5ECI B;  1W4V A;  3TJF A;  4JU5 A;  4EO3 A;  3KD0 A;  1GSS A;  1M3I A;  2D2Z A;  3M9K A;  3ZIV A;  2YZU A;  4EIQ A;  3TKP A;  2H0G A;  2M72 A;  1TDI A;  2GTU A;  1O73 A;  6GSS A;  2DC5 A;  3QR6 A;  4ZB8 A;  1A8Y A;  4EF0 A;  3TKS C;  2FUG 2;  2C0D A;  2K6V A;  1HNC A;  4MMM A;  2OAC A;  4XS1 A;  2L4C A;  4ZB9 A;  1PX7 A;  4TR3 A;  3TB2 A;  5AN1 A;  4TW5 A;  4V2L A;  1G7O A;  5JWR B;  1TP9 A;  1USB A;  3TRX A;  4NWY A;  3FYG A;  5LCZ A;  3APO A;  3R3E A;  4CHS A;  4NHW A;  2H73 A;  2KP1 A;  3I9V 2;  1NHO A;  2F3M A;  5D96 A;  2NDO A;  5DQY A;  4RQX A;  1G0T A;  4I2U A;  3QAG A;  3W6G A;  3DGQ A;  1MDK A;  1K0N A;  2K9F A;  2PVO C;  2YP6 A;  1DUG A;  4KND A;  2HZE A;  1BQ7 A;  3ZVJ A;  1B9X C;  5CP1 A;  2XC2 A;  2H75 A;  2YWM A;  1RQM A;  3IPZ A;  5EY6 A;  2L57 A;  2BTO T;  2LNT A;  4TR4 A;  1JZW A;  3IV4 A;  4HSC X;  5EL8 A;  9GSS A;  19GS A;  1N8J A;  1T00 A;  3P2A A;  2ON7 A;  1OKT A;  4QL9 A;  4USS A;  3KH9 A;  2IMF A;  3I6A A;  2CVK A;  2QKE A;  2O85 A;  1HNB A;  1XWA A;  2YJ7 A;  5CAX A;  1XW5 A;  5GZZ B;  2H1D A;  3J7Y k;  1QXH A;  5G5F A;  1J9B A;  3LQ7 A;  3G7J A;  2A2S A;  3IRA A;  3ZFL A;  6GST A;  1EZK A;  2LJA A;  3AY8 A;  3E3E A;  2JZR A;  3TCO A;  2DJK A;  3E0U A;  4GWR A;  1PKZ A;  1SKR B;  4XHM A;  3VPQ A;  1V58 A;  3RAZ A;  2CX4 A;  1Z3E A;  4G0K A;  3GUS A;  1GSY A;  4KSO A;  1GLP A;  1S3A A;  2R2J A;  1O6J A;  4GSS A;  5A4V A;  1SL1 B;  3H93 A;  1A2M A;  2I1U A;  1TRW A;  2TRC P;  2PVQ A;  2I3Y A;  4X4J A;  1FOV A;  3KMO A;  2VM1 A;  3IXR A;  2F9S A;  3WGX A;  3EU3 A;  3FZA A;  3HJP A;  3UAR A;  5LD0 A;  3GTU A;  1XZO A;  3HKR A;  5ECO B;  2ALB A;  3KP9 A;  6GSY A;  1FOH A;  4XS6 A;  2H6Z A;  3E9J B;  1XCC A;  3ZFB A;  3QD9 A;  4MZC A;  4EUY A;  4HDE A;  1F6M C;  4RI6 A;  4HU9 A;  3D21 A;  1ZYN A;  1C72 A;  2B1L A;  4MJB A;  2F8A A;  1SL2 B;  3Q6O A;  2WRT A;  5CRE A;  3FKF A;  3LYP A;  4YKF A;  5IIZ A;  2PN8 A;  3UVH A;  2C80 A;  3MNG A;  5DDL A;  4MJC A;  4RUV A;  4EDZ A;  5CYY A;  2YV9 A;  3C73 A;  1AQW A;  4MZW A;  1TTZ A;  1DE1 A;  3LOR A;  1PQN A;  3FR6 A;  3UJ1 A;  3EUR A;  4Z7X A;  4GQF A;  2VIM A;  4Q5F A;  1OKD A;  3F3Q A;  5GSS A;  3GH9 A;  3TRQ A;  2CVD A;  1THX A;  2HT9 A;  5C00 A;  4EXJ A;  1GUH A;  4G0L A;  4XS4 B;  1U87 A;  1GH2 A;  3C1R A;  3G7Y A;  4KW6 A;  1EGO A;  1PFO A;  3APS A;  1B9Y C;  3QAV A;  2YAN A;  4PUA A;  2R0C A;  3H4K A;  4TXV A;  2E0Q A;  4ECC A;  3GKN A;  2HNL A;  2LQQ A;  3M9J A;  2VO4 A;  3EVI A;  3BD2 A;  2P0G A;  5CRH A;  1JHB A;  2YN1 A;  1HNA A;  2K8V A;  3GN3 A;  4DSR A;  4JBB A;  4MCU A;  1M2B A;  3US3 A;  5ABR A;  1HYU A;  5DAL A;  3DKS A;  1Z7R A;  3F9U A;  4J56 E;  5DBQ A;  4ISD A;  1PD2 1;  1AC1 A;  1V57 A;  3FZ9 A;  5F06 A;  1QGV A;  4TR1 A;  1Z7P A;  3ZRD A;  1V9W A;  5INY A;  2CX3 A;  4LMW A;  3RDW A;  4PTS A;  1J08 A;  4CY8 A;  4ILF A;  4EIP A;  4JED A;  1EP7 A;  3CRU A;  4MJA A;  1MDI A;  5ID2 B;  5ECR B;  5IMV A;  1ON4 A;  4BVX B;  3CTG A;  5F0G A;  2BJX A;  3HD5 A;  1PL1 A;  2HRN A;  1YJ6 A;  3ZVJ D;  3C8E A;  1Q98 A;  4PUF C;  3UL3 A;  3Q18 A;  5HR3 A;  2ZCT A;  4GST A;  2IFQ B;  2GT5 A;  1QUW A;  3IHQ A;  2FY6 A;  1MD4 A;  2J9H A;  3QPM A;  4I5Q A;  4LLR A;  5J9B A;  3GKM A;  5DJL A;  1VF2 A;  3MWH A;  4TVE A;  1AXD A;  3LFL A;  5HFK A;  4AJ7 A;  4ZL9 A;  3LGC A;  4NMU A;  2GQK A;  4FYC A;  1K3O A;  5IQY A;  2F8F A;  2GLR A;  2YWO A;  1GRX A;  3DEX A;  4V1A g;  1SK2 A;  2YPM A;  3N5O A;  4LL4 B;  2QSI A;  4O92 A;  6GSW A;  2M46 A;  4EDY A;  4QQ7 A;  2IIY A;  5D93 A;  1RK4 A;  1F9M A;  2JZT A;  4KCA A;  3ME7 A;  5HR0 A;  4DSQ A;  1EGR A;  4IQA A;  1NHY A;  3RPN A;  5ECQ B;  1K3Y A;  4V2M A;  4WR4 A;  5B8B A;  2WS2 A;  2XHF A;  1ZL9 A;  4Q5Q A;  2DJ1 A;  1PN9 A;  3CXG A;  1HQO A;  1YKA A;  4JZQ A;  4K7O A;  4L5L A;  2UZ8 A;  3EWL A;  2GDR A;  3GMF A;  4ECB A; 
#chains in the Genus database with same CATH homology
 18GS A;  1A24 A;  2GSS A;  1WPI A;  1TRV A;  5A4U A;  3G7I A;  1IYH A;  3IAS 2;  4BL7 A;  3WT2 A;  2H8L A;  5FT3 A;  1XPV A;  5DCG A;  3ERW A;  2C3N A;  2HZE B;  3TKQ A;  2PUK C;  3L0H A;  4OO4 A;  1ERW A;  2L5O A;  3QDN A;  2VL2 A;  4WKW A;  2LKU A;  2A2R A;  3NZN A;  4YQV A;  4YKG A;  3IR4 A;  2RM6 A;  2FWF A;  4K0G A;  1VRS D;  4KE3 A;  5ENU A;  1T7P B;  3VLN A;  1R5P A;  4KF9 A;  1YZX A;  4K8M A;  4PQH A;  1OE7 A;  2DIY A;  5KEJ A;  1X9W B;  2B1K A;  1K0B A;  1KBN A;  1AQV A;  1PKW A;  1XFL A;  4A5P A;  1GWC A;  2GT6 A;  5KN2 A;  4I6X A;  4MJE A;  5IOX A;  1X0R A;  3WD6 A;  5DQS A;  3H79 A;  2VCT A;  2GZZ A;  2H6X A;  1UA5 A;  1N2A A;  3GKX A;  4PXO A;  2OE0 A;  3GKK A;  3ZRE A;  3JCM L;  2OAD A;  3QMX A;  3GL5 A;  5CRW A;  1A8L A;  3TUE A;  3VPT A;  2R5G A;  1B8X A;  12GS A;  1GLQ A;  3KTL A;  3DVW A;  5GAN D;  1XWB A;  3EMX A;  2Z9S A;  2FGX A;  17GS A;  4K5S A;  4XRD A;  2LJR A;  4FIW A;  4LMV A;  3SWL A;  5GAP D;  2CA8 A;  2GS3 A;  2YOI A;  1TI1 A;  1R7H A;  2B5X A;  1GUK A;  3GV1 A;  2VD0 A;  3LXZ A;  3DIE A;  1SJ6 A;  4PQI A;  4WET A;  1PA3 A;  1QQ2 A;  5KOX A;  4O7H A;  3KCM A;  2LJK A;  2LST A;  4P3Y B;  2P31 A;  3DD3 A;  2GQL A;  5BMU A;  3ERF A;  3LYK A;  4N0Z A;  3UOM A;  3DWV A;  3GTU B;  4BWS A;  1K0M A;  5IOW A;  2KLX A;  3LW9 A;  1ZZY A;  4MZB A;  1EEM A;  1BYE A;  2C8U A;  1O81 A;  1TRU A;  1WP0 A;  2IMD A;  3UBK A;  4MPF A;  4HQS A;  4WBR D;  5B6N A;  2I9H A;  4OCF A;  3W8J A;  3D4M A;  1JZD A;  1T8E B;  4LL1 B;  2C3T A;  4O5R A;  2R0P A;  4HZ4 A;  5IMZ A;  4MH3 A;  3D4T A;  5HR2 A;  2C0G A;  2XBI A;  1B4Q A;  5J41 A;  3WGD A;  5A4W A;  1AQX A;  1G7E A;  4KSM A;  3BOA A;  2H1B A;  1CQG A;  2AHE A;  3ZTL A;  5L71 A;  4GXZ A;  3LSZ A;  2VL9 A;  3EIN A;  4L8E A;  2CVB A;  1OYJ A;  3FK8 A;  1UN2 A;  5BRT A;  1M9A A;  4K7I A;  3I69 A;  1DSB A;  5IMF A;  3GRX A;  1YEX A;  2QC7 A;  3IE3 A;  5A5K A;  4YH2 A;  3HA9 A;  3FEU A;  3GA4 A;  1AAZ A;  1QMV A;  1XW9 A;  1B48 A;  3ISO A;  1XBS A;  4FYU A;  1V98 A;  2B3S A;  1GTB A;  4DVC A;  1EOH A;  4MAB A;  4MK3 A;  3FR9 A;  1UVZ A;  1FAA A;  1GUM A;  4RQR A;  3VWV A;  4HQZ A;  4K9Z A;  4ECJ A;  4G2E A;  2LEG A;  2VLT A;  4X1U A;  5DAL B;  1F37 A;  3KM6 A;  1GSF A;  1WWJ A;  4JRR A;  2X49 A;  3N9J A;  2C4J A;  3ERG A;  3QFB C;  3Q74 A;  3HVV A;  13GS A;  2GQM A;  3TRP A;  2RLI A;  3LG6 A;  1YEP A;  1TKD B;  2PU9 C;  3ZIJ A;  4ZXG A;  2NPB A;  4MF5 A;  2R6K A;  3M3M A;  4K6X A;  4OCE A;  5ECK B;  3ZML A;  3H1N A;  3DML A;  2H70 A;  2YCD A;  5IO2 A;  4K0N A;  5DAK A;  4AF2 A;  4NPB A;  2KUC A;  1FHE A;  5JCW A;  3HCZ A;  2AAW A;  2LS5 A;  3UAP A;  3FR3 A;  4Q5N A;  4POB A;  1U6T A;  4BPY A;  4WEY A;  2RII A;  4MF7 A;  3KMN A;  1ERU A;  4POL A;  3S9F A;  5HFI A;  2KHP A;  1OAZ A;  4ZB6 A;  2GSR A;  4JR4 A;  5J9C A;  1EOG A;  2H71 A;  2HSY A;  3GL3 A;  3WYW A;  1SD9 A;  2X8H A;  1SKS B;  4L5O A;  2O7K A;  1URM A;  4IBP A;  3F4R A;  1R4W A;  1K0O A;  2O87 A;  1OC9 A;  1XOA A;  4IHU A;  4NAX A;  1BX9 A;  2YJH A;  4IP1 A;  4ZBA A;  4F0B A;  4IP6 A;  5C04 A;  2C0E A;  3DVX A;  4XCS A;  2JL4 A;  2KOK A;  1X5C A;  5AIX A;  2E2G A;  4OMV A;  4YAV A;  2LRN A;  1ZMA A;  2OKA A;  3FY7 A;  2NTO A;  4NHZ A;  1T3B A;  3PPU A;  5G5E A;  2GGT A;  5KN3 A;  1M2A A;  2LRC A;  1U3A A;  4JE1 A;  5IO0 A;  3TGZ A;  2NVL A;  3ZZX A;  5CO3 A;  1TU7 A;  1Z9H A;  1TU8 A;  2VM2 A;  1JLW A;  4I8B A;  1G6W A;  3VWX A;  2WDU A;  4OFT A;  1XVW A;  1X5D A;  2G2Q A;  1O8X A;  1YY7 A;  2ZNM A;  4IS0 A;  1JZO A;  3G9B A;  4GLT A;  3UIW A;  4IJ3 A;  3TOU A;  3GX8 A;  3BCI A;  2R4V A;  3BJ5 A;  4EL1 A;  1O7U A;  1GSE A;  3APQ A;  3QOU A;  3IA1 A;  4V2N A;  6GSX A;  1HD2 A;  2QGV A;  2MBS A;  1K0A A;  2HFD A;  3MYD A;  4TN8 A;  4O5Q A;  2HSM A;  2RM5 A;  3K8N A;  1THO A;  2OE3 A;  5HQP A;  5EPF A;  1U3I A;  2GZP A;  4BWQ A;  3CRT A;  2HRK A;  3RBT A;  2HRF A;  2OBI A;  5FHI A;  3PGT A;  2GVP A;  4HOJ A;  3O6T A;  4IVF A;  1SL0 B;  3VI5 A;  1YF0 A;  2P5Q A;  3HHV A;  1ZYP A;  3FZ4 A;  3F0I A;  1GSQ A;  1F3B A;  2REM A;  5E4W A;  1CQH A;  2JU5 A;  2I81 A;  2K18 A;  2LQO A;  3VWW A;  1Y25 A;  2EIO A;  3A5W A;  3A2V A;  2J23 A;  4ICY A;  3EC3 A;  1SD8 A;  2VL3 A;  2WFC A;  16GS A;  3L9U A;  1WIK A;  1TOF A;  1FB6 A;  2AB6 A;  2R37 A;  4GTU A;  2L6C A;  1R5A A;  4RI7 A;  5D73 A;  6GSV A;  4WF4 A;  1EWX A;  4K2X A;  1UC7 A;  4ZIL A;  3TKS A;  4K7N A;  5FWG A;  1WRY A;  1TJD A;  1VF3 A;  4AGS A;  1PMT A;  2YWN A;  4MF6 A;  4E8H A;  3PR8 A;  3UEM A;  3KZQ A;  4NV2 A;  2FD3 A;  2CV4 A;  1XWK A;  2CZ3 A;  2EIR A;  2JAC A;  1GTU A;  3F6D A;  3EU4 A;  3P8W A;  3O3T A;  4IEL A;  2HZF A;  2CAI A;  2MYG A;  3IDV A;  4AJ6 A;  4EC0 A;  4FQU A;  1K0C A;  1FB0 A;  2IWT A;  1H75 A;  3P7X A;  2R3X A;  3RHC A;  4G9H A;  3D0Z A;  1A2L A;  1ZOF A;  1GSD A;  3EYT A;  1VF1 A;  5H5S A;  4O32 A;  1SEN A;  3QAW A;  1EP8 A;  1SK1 A;  4QL7 A;  2MBT A;  5AIS A;  4ZL7 A;  1VF4 A;  2VCQ A;  2H66 A;  4MNN A;  3ZYW A;  3DRN A;  3HXS A;  5IMA A;  2I4A A;  4DSS A;  2XPD A;  2B6M A;  3F4T A;  5IMD A;  5AGY A;  2A4H A;  5D9W A;  4DEJ A;  1TK0 B;  2XBQ A;  4MA9 A;  2B5E A;  4O5U A;  3U5R E;  4H86 A;  4Z2T A;  2H74 A;  1YKC A;  1NSW A;  2VCW A;  10GS A;  2WB9 A;  2FCH A;  1AUC A;  4G10 A;  7GSS A;  2K8S A;  1MEK A;  2YV7 A;  2DSA A;  2DLX A;  4L0W A;  4MP4 A;  2VLU A;  4HZ2 A;  4IN0 A;  3V1W A;  3LXT A;  2VLV A;  3TOT A;  2YWI A;  2WUL A;  5KN1 A;  2FWG A;  5F05 A;  4WR5 A;  2HSH A;  5DAK B;  4YAP A;  1Z6M A;  1A0F A;  1GTA A;  4TRX A;  2V41 A;  4PNF A;  3HDC A;  4GQC A;  1H4O A;  4MPG A;  4ML6 A;  1QFN A;  4YQU A;  1WE0 A;  2GZY A;  2VUP A;  1SJI A;  4WXT A;  5IPG A;  2RUF A;  2PBJ A;  5J5N A;  5CRD A;  2RUE A;  1XW6 A;  1Y6E A;  5IMC A;  4WBJ A;  20GS A;  3D22 A;  5H5Q A;  2DJ0 A;  2H0H A;  1I9D A;  4ACS A;  1Z5Y E;  4J57 E;  2N5F A;  5F8B A;  4KDU A;  1EV9 A;  4IW9 A;  2P5R A;  3WGE A;  2VOC A;  4G19 A;  2IL3 A;  1ZGN A;  2B7K A;  4LA1 A;  1FG4 A;  2JAD A;  4OO5 A;  3KJY A;  4KCE A;  3IBH A;  1M9B A;  3TJK A;  4XIH A;  3GFK A;  5G1K A;  4OWY A;  1WMJ A;  3KIJ A;  1AIU A;  3ZIT A;  4J2F A;  2VAF A;  3UBL A;  4BVY A;  1A0R P;  4F0C A;  4TKY A;  4V1A p;  1E6B A;  3ED3 A;  3KEB A;  1E2Y A;  3GSS A;  4N11 A;  2JSY A;  2AYT A;  2DJJ A;  2VCV A;  2PER A;  3IC4 A;  4ULX A;  2V6K A;  2N5A A;  2IMK A;  1SU9 A;  1ZYQ B;  1GNE A;  3QCP A;  5ECP B;  5D9X A;  5D9T A;  1GP1 A;  3IHG A;  2DJ2 A;  3GHA A;  2XPE A;  1LJR A;  3VI7 A;  1ZYE A;  3U6V A;  4HU7 A;  2FA8 A;  3I43 A;  1LU4 A;  3M1G A;  1BAY A;  1TK5 B;  8GSS A;  3LJR A;  1ML6 A;  1ST9 A;  1GSU A;  3EPT A;  2HLS A;  1XWG A;  3F8U A;  4GF0 A;  4GRF A;  2DKH A;  4K5R A;  1A23 A;  3QFA C;  1ACV A;  2B7J A;  2CT6 A;  1S3C A;  3NOF A;  2IJY A;  1TRS A;  4F03 A;  14GS A;  2V1M A;  2CQ9 A;  1GTI A;  2NBS A;  5ECL B;  1MD3 A;  2A4V A;  2CAQ A;  5H5R A;  2PPT A;  3VK9 A;  3FRC A;  2O89 A;  1OVN A;  2H1G A;  4ZBB A;  4GCI A;  5HR1 A;  2F51 A;  4KDX A;  1M2D A;  1TK8 B;  2MZC A;  4IJI A;  3F6F A;  2H1A A;  3LWA A;  1TXX A;  4IGJ A;  2DJ3 A;  5B6M A;  5KOW A;  1JFU A;  4XRA A;  2E2M A;  2X99 A;  1PL2 A;  5B8A A;  4TR1 B;  2OE1 A;  2GST A;  3H8Q A;  1A2J A;  2LUS A;  2VL2 C;  2AV4 A;  4PUR A;  3FZ5 A;  5GST A;  2WGR A;  3GX0 A;  2FHE A;  2MMO A;  3IAM 2;  1TI3 A;  3KGK A;  4K2D A;  2WJU A;  4IQ1 A;  2M80 A;  3CSH A;  4K1F A;  3EE2 A;  4N0V A;  2AJQ B;  1LBK A;  4IKH A;  2MMN A;  2C1Y A;  4KAE A;  2V2G A;  1FO5 A;  2AUV A;  5D9V A;  5ECM B;  3MIX A;  1OC8 A;  1T1V A;  4TXO A;  2PWJ A;  3L4N A;  2WZ9 A;  2YNX A;  3L9V A;  3D6I A;  1O8W A;  3C71 A;  1KEB A;  4X43 A;  2MMZ A;  3BBY A;  2R0G A;  5AIV A;  4Z2U A;  1XXU A;  2L59 A;  1M0U A;  2WCI A;  4PNG A;  2LV3 A;  1X5E A;  2ON5 A;  3ZLP A;  2VD1 A;  1TW9 A;  1M99 A;  2DMM A;  4D73 A;  3IOS A;  3TJB A;  2JSZ A;  4ZL8 A;  2E7P A;  4CY6 A;  1PGT A;  1MTC A;  2PMT A;  2VCX A;  2H01 A;  2N5B A;  3GIX A;  2FWH A;  2DML A;  4N10 A;  4ML1 A;  3UVT A;  2X8G A;  3HVS A;  4POM A;  4Q5R A;  1X9S B;  3GUR A;  3A2X A;  5EVO A;  5JWO B;  2X4A A;  4HJ2 A;  2O8V B;  2C0F A;  2HYX A;  1PRX A;  3NIV A;  4BL7 B;  1Z6N A;  2A2P A;  4YQM A;  1FW1 A;  2IMI A;  22GS A;  4ZBD A;  3CMI A;  3ZMK A;  2IME A;  3C7M A;  4HS1 A;  1YF1 A;  2L6D A;  3TKS E;  2DKI A;  1F2E A;  1VGL A;  1OC3 A;  4L0U A;  1SJZ A;  3KXO A;  4HEA 2;  4ECI A;  3R2Q A;  4DSS B;  1OE8 A;  5DJM A;  2DBC A;  3L9S A;  3TKR A;  2H0I A;  1IYI A;  5G30 A;  1MDJ A;  4OFN A;  1JZR A;  4ID0 A;  2DIZ A;  3IK7 A;  2OBK A;  1KTE A;  5ELA A;  3IK9 A;  3A2W A;  3WT1 A;  4HUA A;  1PN0 A;  1G6Y A;  4TR0 A;  3FW2 A;  4X0X A;  3VFI A;  5DCH A;  2IPA A;  1NM3 A;  3DXB A;  4I97 A;  4EVM A;  2H72 A;  2IN3 A;  3SBC A;  2B5Y A;  5G2Z A;  3IC8 A;  1BED A;  2PGT A;  3GYK A;  4CW9 A;  5JWQ B;  3ME8 A;  4KUN A;  4MDC A;  3DYR A;  3VUR A;  2G0F A;  3A5I A;  1FVJ A;  5ELG A;  1K0D A;  3CSI A;  4FH8 A;  4FYB A;  1DBY A;  3HYP A;  2H19 A;  3RHB A;  3FHK A;  3M0F A;  1R26 A;  5HFG A;  4PX1 A;  3GNJ A;  1SYX A;  5CNW A;  3L78 A;  4JR6 A;  4F9Z A;  3M8N A;  2HRA A;  3UMA A;  5J4U A;  1V40 A;  3HZ4 A;  4E8E A;  4OFM A;  4BA7 A;  2ZUP A;  3CSJ A;  4Z2R A;  2HXK A;  5IM9 A;  3HJO A;  3KH7 A;  2EC4 A;  5E59 A;  1X9M B;  5F07 A;  4KX4 A;  3J7Y b;  4BVY B;  3OR5 A;  1J0F A;  1ZCP A;  4PGT A;  4AJ8 A;  6GSU A;  4KGI A;  5JCU A;  2JZS A;  1WOU A;  3VWU A;  2GSQ A;  3F63 A;  2QA1 A;  1O85 A;  1GUL A;  4NXI A;  1F3A A;  2LRT A;  3HVX A;  4KA0 A;  2H76 A;  1BG5 A;  3BCK A;  3HY2 A;  1XOB A;  2X64 A;  1SYR A;  2TRX A;  2V32 A;  3O76 A;  2ES7 A;  5ECH B;  4F2I A;  3Q19 A;  3TJG A;  4CDO A;  2BMX A;  3LEF A;  4KB3 A;  5D8I A;  2X8C A;  2OA7 A;  3FMW A;  4G0I A;  4MH2 A;  1ILO A;  2QA2 A;  2YZH A;  3MDK A;  3TJJ A;  2L5L A;  1GL8 A;  2HI7 A;  5B7C A;  4PQ1 A;  1S3D A;  1T4Z A;  5JCG A;  3PH9 A;  2CZ2 A;  1T4Y A;  3F3R A;  3KP8 A;  1I5G A;  2HE3 A;  2H30 A;  1ERV A;  3PIN A;  1B4P A;  1WJK A;  1AW9 A;  5ECN B;  4HI7 A;  2MMA A;  3CBU A;  4OD7 A;  3F4S A;  1Q4J A;  4FO5 A;  3HZ8 A;  4XS4 A;  2KP2 A;  1M7T A;  1XIY A;  2LNS A;  1KNG A;  3P90 A;  2V6O A;  1GNW A;  5G31 A;  4EE0 A;  3HJM A;  3TDG A;  2FLS A;  4KH7 A;  2FNO A;  1JLV A;  2L4Q A;  1K3L A;  1RW1 A;  4MLY A;  5KN0 A;  4GSN A;  1SK0 A;  4TOP A;  1ABA A;  3RPP A;  2EIQ A;  4F82 A;  1DE2 A;  3EMP A;  1SKW B;  4WF5 A;  3GST A;  4EKZ A;  1XWC A;  1PX6 A;  2H6Y A;  4TXO B;  4ZIJ A;  4HJM A;  3W8S A;  3KTB A;  4POK A;  1PSQ A;  2VCZ A;  4I2T A;  3ZL5 A;  4KDY A;  1EV4 A;  1BJX A;  2FWE A;  1FVK A;  1U88 A;  1QK8 A;  5ID2 A;  3D5J A;  5COH A;  4BVX A;  1EEJ A;  2LTK A;  1XVQ A;  5ECS A;  5J3R A;  5DVB A;  4D73 B;  3C1S A;  1V2A A;  3MSZ A;  5CRG A;  1OC9 B;  4XTS A;  5IPH A;  5LNK e;  2TIR A;  4N30 A;  1YDK A;  3A3T A;  3CTF A;  2IFQ A;  1W89 A;  11GS A;  3MAK A;  4NV5 A;  1ERT A;  1YQ1 A;  2C3Q A;  3GH6 A;  3CYN A;  1NW2 A;  5G1L A;  2OJL A;  2FA4 A;  5ECI B;  1W4V A;  3TJF A;  4JU5 A;  4EO3 A;  3KD0 A;  1GSS A;  2D2Z A;  3M9K A;  3ZIV A;  2YZU A;  4EIQ A;  3TKP A;  2H0G A;  2M72 A;  1TDI A;  2GTU A;  1O73 A;  6GSS A;  2DC5 A;  3QR6 A;  4ZB8 A;  1A8Y A;  4EF0 A;  3TKS C;  2FUG 2;  2C0D A;  2K6V A;  1HNC A;  4MMM A;  2OAC A;  4XS1 A;  2L4C A;  4ZB9 A;  1PX7 A;  4TR3 A;  3TB2 A;  5AN1 A;  4TW5 A;  4V2L A;  1G7O A;  5JWR B;  1TP9 A;  1USB A;  3TRX A;  4NWY A;  3FYG A;  5LCZ A;  3APO A;  3R3E A;  4CHS A;  4NHW A;  2H73 A;  2KP1 A;  3I9V 2;  1NHO A;  2F3M A;  5D96 A;  2NDO A;  5DQY A;  4RQX A;  1G0T A;  4I2U A;  3QAG A;  3W6G A;  3DGQ A;  1MDK A;  1K0N A;  2K9F A;  2PVO C;  2YP6 A;  1DUG A;  4KND A;  2HZE A;  1BQ7 A;  3ZVJ A;  1B9X C;  5CP1 A;  2XC2 A;  2H75 A;  2YWM A;  1RQM A;  3IPZ A;  5EY6 A;  2L57 A;  2BTO T;  2LNT A;  4TR4 A;  1JZW A;  3IV4 A;  5EL8 A;  9GSS A;  19GS A;  1N8J A;  1T00 A;  3P2A A;  2ON7 A;  1OKT A;  4QL9 A;  4USS A;  3KH9 A;  2IMF A;  3I6A A;  2CVK A;  2QKE A;  2O85 A;  1HNB A;  1XWA A;  2YJ7 A;  5CAX A;  1XW5 A;  5GZZ B;  2H1D A;  3J7Y k;  1QXH A;  5G5F A;  1J9B A;  3LQ7 A;  3G7J A;  2A2S A;  3IRA A;  3ZFL A;  6GST A;  1EZK A;  2LJA A;  3AY8 A;  3E3E A;  2JZR A;  3TCO A;  2DJK A;  3E0U A;  4GWR A;  1PKZ A;  1SKR B;  4XHM A;  3VPQ A;  1V58 A;  3RAZ A;  2CX4 A;  1Z3E A;  4G0K A;  3GUS A;  1GSY A;  4KSO A;  1GLP A;  1S3A A;  2R2J A;  1O6J A;  4GSS A;  5A4V A;  1SL1 B;  3H93 A;  1A2M A;  2I1U A;  1TRW A;  2TRC P;  2PVQ A;  2I3Y A;  4X4J A;  1FOV A;  3KMO A;  2VM1 A;  3IXR A;  2F9S A;  3WGX A;  3EU3 A;  3FZA A;  3HJP A;  3UAR A;  5LD0 A;  3GTU A;  1XZO A;  3HKR A;  5ECO B;  2ALB A;  3KP9 A;  6GSY A;  1FOH A;  4XS6 A;  2H6Z A;  3E9J B;  1XCC A;  3ZFB A;  3QD9 A;  4MZC A;  4EUY A;  4HDE A;  1F6M C;  4RI6 A;  4HU9 A;  3D21 A;  1ZYN A;  1C72 A;  2B1L A;  4MJB A;  2F8A A;  1SL2 B;  3Q6O A;  2WRT A;  5CRE A;  3FKF A;  3LYP A;  4YKF A;  5IIZ A;  2PN8 A;  3UVH A;  2C80 A;  3MNG A;  5DDL A;  4MJC A;  4RUV A;  4EDZ A;  5CYY A;  2YV9 A;  3C73 A;  1AQW A;  4MZW A;  1TTZ A;  1DE1 A;  3LOR A;  1PQN A;  3FR6 A;  3UJ1 A;  3EUR A;  4Z7X A;  4GQF A;  2VIM A;  4Q5F A;  1OKD A;  3F3Q A;  5GSS A;  3GH9 A;  3TRQ A;  2CVD A;  1THX A;  2HT9 A;  5C00 A;  4EXJ A;  1GUH A;  4G0L A;  4XS4 B;  1U87 A;  1GH2 A;  3C1R A;  3G7Y A;  4KW6 A;  1EGO A;  3APS A;  1B9Y C;  3QAV A;  2YAN A;  4PUA A;  2R0C A;  3H4K A;  4TXV A;  2E0Q A;  4ECC A;  3GKN A;  2HNL A;  2LQQ A;  3M9J A;  2VO4 A;  3EVI A;  3BD2 A;  2P0G A;  5CRH A;  1JHB A;  2YN1 A;  1HNA A;  2K8V A;  3GN3 A;  4DSR A;  4JBB A;  4MCU A;  1M2B A;  3US3 A;  5ABR A;  1HYU A;  5DAL A;  3DKS A;  1Z7R A;  3F9U A;  4J56 E;  5DBQ A;  4ISD A;  1PD2 1;  1AC1 A;  1V57 A;  3FZ9 A;  5F06 A;  1QGV A;  4TR1 A;  1Z7P A;  3ZRD A;  1V9W A;  5INY A;  2CX3 A;  4LMW A;  3RDW A;  4PTS A;  1J08 A;  4CY8 A;  4ILF A;  4EIP A;  4JED A;  1EP7 A;  3CRU A;  4MJA A;  1MDI A;  5ID2 B;  5ECR B;  5IMV A;  1ON4 A;  4BVX B;  3CTG A;  5F0G A;  2BJX A;  3HD5 A;  1PL1 A;  2HRN A;  1YJ6 A;  3ZVJ D;  3C8E A;  1Q98 A;  4PUF C;  3UL3 A;  3Q18 A;  5HR3 A;  2ZCT A;  4GST A;  2IFQ B;  2GT5 A;  1QUW A;  3IHQ A;  2FY6 A;  1MD4 A;  2J9H A;  3QPM A;  4I5Q A;  4LLR A;  5J9B A;  3GKM A;  5DJL A;  1VF2 A;  3MWH A;  4TVE A;  1AXD A;  3LFL A;  5HFK A;  4AJ7 A;  4ZL9 A;  3LGC A;  4NMU A;  2GQK A;  4FYC A;  1K3O A;  5IQY A;  2F8F A;  2GLR A;  2YWO A;  1GRX A;  3DEX A;  4V1A g;  1SK2 A;  2YPM A;  3N5O A;  4LL4 B;  2QSI A;  4O92 A;  6GSW A;  2M46 A;  4EDY A;  4QQ7 A;  2IIY A;  5D93 A;  1RK4 A;  1F9M A;  2JZT A;  4KCA A;  3ME7 A;  5HR0 A;  4DSQ A;  1EGR A;  4IQA A;  1NHY A;  3RPN A;  5ECQ B;  1K3Y A;  4V2M A;  4WR4 A;  5B8B A;  2WS2 A;  2XHF A;  1ZL9 A;  4Q5Q A;  2DJ1 A;  1PN9 A;  3CXG A;  1HQO A;  1YKA A;  4JZQ A;  4K7O A;  4L5L A;  2UZ8 A;  3EWL A;  2GDR A;  3GMF A;  4ECB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...