3TKQA

Crystal structure of full-length human peroxiredoxin 4 with mixed conformation
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
191
structure length
191
Chain Sequence
SKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxiredoxin-4
publication title Structural insights into the peroxidase activity and inactivation of human peroxiredoxin 4
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 61
structure length 191
sequence length 191
chains with identical sequence B, C, D, E
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2011-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3tkqA00
1OVNA 2YJ7A 5F06A 3H1NA 5KEJA 4XRAA 2L4QA 3M0FA 2OE1A 3QD9A 5ECHB 2B7JA 2C3TA 4FYBA 2DJ0A 2VD0A 3OR5A 5JWOB 3RAZA 4MPFA 3EE2A 1O81A 3DEXA 3M9JA 3GTUA 2OE3A 1THOA 2A4VA 1NHYA 1SK0A 3DVWA 3ZREA 4XIHA 3CMIA 3GH9A 2CA8A 4MJAA 4X43A 2H1BA 1FVKA 1HQOA 3BOAA 4TR3A 1MDIA 3I69A 1ERVA 2L6DA 3QCPA 4LL1B 1TK0B 1GSYA 4ISDA 5DAKB 3KD0A 4IP1A 1N2AA 2VL3A 3EURA 3E3EA 3KCMA 1WRYA 4PNGA 4EC0A 3KTBA 5JCGA 2C80A 1O6JA 1M0UA 3HA9A 1VF3A 3SWLA 2H75A 2WZ9A 2YN1A 4HI7A 4ACSA 3N9JA 4LL4B 1HNAA 4TR1A 3GKXA 3HKRA 3ZRDA 4K0GA 2ZCTA 3ERGA 2H72A 3VWVA 1X5CA 1XOAA 3LWAA 1MD4A 4TR4A 1XVWA 2C0FA 3NZNA 3P90A 3RHCA 2O8VB 3KTLA 3PR8A 4FYCA 3Q19A 3LG6A 2CVBA 2WFCA 2KHPA 4P3YB 1EV4A 4EUYA 1T3BA 2L57A 3EU3A 1U6TA 1WP0A 4ECIA 3HVXA 5ENUA 1OC9B 1SENA 3IDVA 4KDUA 4IS0A 4KB3A 4N30A 2VCZA 2IWTA 2WB9A 4GQCA 1ZMAA 4GWRA 2H8LA 1SKRB 1GTUA 1AQWA 2H73A 2LNSA 4EF0A 1K0AA 1T00A 5LCZA 2L6CA 4J56E 1Y6EA 4XRDA 3QOUA 1X9MB 4L8EA 3GX8A 3TRPA 1XWBA 2QC7A 2OBIA 2H0HA 2OE0A 2XPDA 4LLRA 1OAZA 2K6VA 5KN3A 3SBCA 2CAIA 5IMVA 2JZSA 5IMZA 1OE8A 1V57A 5J4UA 3ZVJD 4ZILA 1ST9A 4K7OA 4I6XA 1WPIA 2M46A 1PN9A 4O7HA 1T8EB 3IV4A 3GTUB 5A4UA 4GSNA 1SL0B 3KIJA 3VLNA 2LRTA 4LA1A 2P5QA 1PL2A 2GSTA 5J5NA 1GH2A 4K9ZA 4MF5A 2ALBA 3O76A 1QQ2A 1WOUA 5EPFA 5HFGA 3TCOA 9GSSA 5ELGA 3TRQA 5H5RA 5B8BA 1XBSA 2CX3A 2VD1A 3FW2A 2EIRA 1K0DA 4L0UA 1WE0A 2FD3A 3FZAA 3H79A 4GLTA 2FCHA 3QPMA 1B4QA 3WT2A 2OBKA 4KCEA 2A2SA 3MDKA 1NW2A 1Z6NA 3WD6A 1EOHA 3C8EA 1LJRA 2X8GA 4K7NA 2HI7A 1NHOA 2V6OA 2L5LA 5AGYA 4GSTA 1H75A 1SK1A 1PQNA 1TU7A 3N5OA 2VCWA 18GSA 2R2JA 4NV5A 3TOTA 3LORA 2LJRA 2DMLA 2LKUA 5E59A 1YDKA 2K18A 4WBRD 1ERTA 1ON4A 1X0RA 4XS1A 4KGIA 4ECCA 1K0OA 4KW6A 2MYGA 4XS6A 5G30A 1V98A 5HFKA 2R3XA 5FWGA 2XHFA 3UAPA 4OFMA 4ZBAA 5CYYA 1X5DA 3UL3A 2RM6A 2YNXA 3F3QA 2ES7A 2M80A 3IRAA 3P7XA 5LNKe 3FK8A 1Z3EA 1PRXA 1XOBA 1EEMA 4MF6A 2CAQA 5IO0A 2JL4A 4ULXA 1TW9A 3VK9A 3TKPA 5AISA 4ZBDA 3CSHA 3ZITA 2H0IA 2FWEA 2PVQA 2PERA 3UBLA 4WR5A 2PGTA 3GIXA 2Z9SA 1SD9A 1TU8A 2R4VA 5D9WA 20GSA 1GWCA 2VL2C 2N5FA 1XCCA 1ACVA 5FHIA 3TDGA 1YQ1A 4NAXA 1B9YC 1GRXA 1SL1B 4EO3A 1PKZA 4X1UA 3F4SA 2IPAA 2GZPA 2VCVA 3GSTA 3C1RA 1F3AA 1ZL9A 1O73A 2NPBA 1SD8A 3D4MA 5G5EA 3UVHA 2R6KA 3ISOA 2H0GA 1K0NA 4ILFA 5GZZB 3D21A 2MBTA 2YV9A 3FYGA 3GNJA 2I3YA 3C71A 5AN1A 4YQVA 4IGJA 1RW1A 1XW6A 3FRCA 4DSQA 5ELAA 1GSQA 3VWXA 1Q4JA 2N5BA 2KOKA 1X9SB 2FWFA 1ZCPA 1XWKA 1WMJA 4Z7XA 2QGVA 1EZKA 2GZZA 4MP4A 3VWUA 5GAND 2GQLA 1TOFA 3I43A 4HOJA 1F2EA 3IC4A 3TJGA 2H19A 1LBKA 3QAWA 3A2VA 4MLYA 1ABAA 5CRHA 4AF2A 3G9BA 3TKSE 2H1DA 2OA7A 6GSUA 2DBCA 5F05A 3F6DA 2R5GA 3TJKA 3TRXA 4JR4A 3KGKA 4EKZA 2V41A 5J9BA 3ZMKA 2H6YA 2XBQA 3HYPA 4ZBBA 2AYTA 3FR9A 3W8SA 1IYIA 1R5PA 4HEA2 3GKKA 2H6XA 3F8UA 2DJ2A 3BD2A 5G5FA 2GQMA 3E0UA 3ZYWA 2CZ3A 1SYXA 2C3QA 3CBUA 4ZL7A 5J9CA 1AUCA 4PNFA 1URMA 4AJ6A 3CRUA 5A5KA 2MMOA 1YZXA 1BEDA 3IAS2 4DSRA 1V58A 4MMMA 1GUHA 1PKWA 2F8AA 5IQYA 1O85A 1TI3A 4XTSA 2JSZA 5ECQB 4ZB6A 4OD7A 2CX4A 2NVLA 3ZL5A 3GN3A 3HZ8A 4MA9A 2O87A 2RIIA 1QK8A 4RI6A 4KAEA 2FA4A 2H6ZA 3E9JB 1Z9HA 5C04A 2GVPA 4ECJA 3M1GA 4HDEA 5ECNB 5E4WA 2B7KA 3D22A 3IXRA 5IO2A 1Y25A 5COHA 2PWJA 1HD2A 3TJBA 1TDIA 3BBYA 4RQXA 2IMIA 1R7HA 4OFTA 8GSSA 2IIYA 1F37A 5ID2B 3HY2A 3MAKA 4E8HA 5D8IA 1JFUA 4MABA 5ECPB 5A4VA 4POKA 6GSWA 2F3MA 4CHSA 4ZL8A 2G0FA 2VUPA 1F3BA 3JCML 1YF1A 4TXOA 1I9DA 5D9VA 2YOIA 4EDYA 2KP1A 3KZQA 4AJ8A 1CQGA 3HXSA 1A0FA 3ZLPA 5EL8A 3LYKA 3W6GA 1YKAA 4V2NA 1B4PA 1A23A 5ECOB 1OC3A 4PQHA 5B6MA 1AQVA 4TVEA 1GUKA 2FHEA 4JR6A 4XCSA 2IMDA 5INYA 2XC2A 1SYRA 5IIZA 3FZ5A 5F8BA 1GLQA 3RDWA 2CT6A 2P0GA 3KP8A 1XIYA 1ZGNA 2WCIA 4K1FA 1BAYA 4YAVA 1V2AA 3QDNA 4L5LA 4CW9A 4PURA 1A8YA 1OC8A 5JCWA 4ZXGA 4KNDA 1UC7A 4KCAA 2B1KA 1SKSB 2HFDA 3DGQA 1GSFA 1QGVA 3HJMA 1H4OA 1PL1A 4IKHA 4POLA 1DUGA 5D93A 1XW5A 1U87A 3APQA 3G7IA 4JE1A 3ME8A 2I4AA 3HJPA 2DMMA 2LQQA 3DIEA 2HRNA 3HD5A 1THXA 2P5RA 3IR4A 1TRUA 1XXUA 1FOVA 5DDLA 1Z7RA 1AIUA 1C72A 1M2AA 4NPBA 1VRSD 1A8LA 4N0ZA 1B8XA 3MSZA 3TOUA 5IPGA 1TI1A 4HZ4A 2JACA 2LJAA 3F4RA 3HCZA 3CYNA 1PX7A 1OKTA 2ZNMA 2HNLA 1R5AA 4HUAA 5B6NA 4NWYA 2KUCA 4TN8A 2B1LA 5JCUA 2TRXA 3Q18A 5J41A 2LS5A 2B5YA 3W8JA 2VIMA 5ECRB 2E2GA 1G0TA 1W4VA 5DQYA 1JLVA 3FHKA 1OYJA 2IFQA 4G19A 5D9TA 2PVOC 2OACA 1TTZA 4MDCA 2CQ9A 3ERWA 4ML6A 1K0BA 1F9MA 4TXOB 1GSEA 4HQSA 2HT9A 3L9VA 1G6YA 2HLSA 3F4TA 2IMKA 3GMFA 1GP1A 2V2GA 3LGCA 5IMDA 3ZIJA 2LJKA 2FA8A 4DSSA 2E0QA 2D2ZA 3CTGA 1ERUA 4BWSA 5DVBA 3IK7A 1G7EA 1K0CA 2MBSA 2C3NA 3LQ7A 4PGTA 1KNGA 5DQSA 2YP6A 4PUAA 2BTOT 2E2MA 1KTEA 2LRCA 5FT3A 4AGSA 1M7TA 4IVFA 3TKSC 13GSA 3GRXA 2V32A 2O7KA 2B5XA 3MNGA 1M9BA 3NIVA 1UN2A 3WGXA 5CNWA 2AAWA 3A3TA 5DALA 4TR1B 4V2LA 3WYWA 4BL7A 14GSA 1WWJA 2GT5A 1VF1A 2V1MA 1EP8A 1XWGA 5KN2A 4I2UA 1O8WA 2ON5A 5JWRB 5B8AA 3FKFA 4WEYA 4Q5QA 4LMVA 4POMA 2HRFA 3TJJA 3F63A 4GF0A 1ERWA 2ON7A 1UVZA 3GURA 1VF4A 1WJKA 3CTFA 2C0GA 1EOGA 3M9KA 5GSTA 2L5OA 5DJLA 3RPNA 5F07A 1ML6A 3VPTA 3UEMA 1AW9A 19GSA 2H76A 5DCGA 3VPQA 4TR0A 3GA4A 2VLUA 4F0CA 4QL7A 3UARA 3ZIVA 4ECBA 5IMAA 5C00A 2VAFA 1PGTA 2AV4A 3IPZA 2TIRA 1YKCA 1TK8B 3DRNA 3D6IA 3DXBA 1RK4A 1CQHA 3U6VA 3LJRA 2DJKA 2IFQB 2M72A 5H5SA 2DIZA 4KA0A 1OKDA 2K9FA 3FEUA 3D0ZA 2FWGA 1ZOFA 2VOCA 3FR6A 1DBYA 2AJQB 3DD3A 3L9UA 2RLIA 4F2IA 4IP6A 4HS1A 1VF2A 4MPGA 2B3SA 5IOXA 1QFNA 5DCHA 1E6BA 1I5GA 4X0XA 3G7YA 4HQZA 4BVXA 2HZEA 3TKSA 5HR1A 2X99A 2CVKA 1K3OA 3HZ4A 4JU5A 3BCKA 2E7PA 4XS4A 2HYXA 1XWAA 4YAPA 2X8HA 4IW9A 2IJYA 1UA5A 3DVXA 1AAZA 2WS2A 5EY6A 4J57E 5ECLB 3US3A 1AQXA 2G2QA 2LTKA 1BQ7A 2NBSA 5KN0A 5L71A 3CRTA 1G6WA 4IJIA 1M9AA 2GS3A 2PPTA 1AC1A 5ECKB 3GX0A 2REMA 4IBPA 5D73A 2CVDA 4F82A 4XHMA 3GL5A 5GSSA 1BYEA 2LRNA 3CSIA 1EV9A 3TGZA 3I9V2 2GSRA 1Z6MA 4BPYA 5DBQA 3RBTA 3ZVJA 1GSDA 3RHBA 3ZTLA 3KP9A 2VCXA 2K8VA 4Q5NA 2N5AA 3LSZA 4QQ7A 1FO5A 5DAKA 4V1Ag 5G1LA 3GYKA 1MD3A 2HSYA 2VLVA 5CRWA 2KP2A 2LEGA 3IOSA 3HJOA 6GSTA 5LD0A 3GV1A 1A2JA 3TKQA 1FG4A 5HR0A 10GSA 2FLSA 4F0BA 3GKMA 1GTAA 2H1GA 1B9XC 3APOA 2RM5A 5ECSA 1BJXA 4K8MA 4O92A 4OCFA 3ZMLA 4D73A 1HYUA 4PQ1A 3FZ9A 3K8NA 5CP1A 2VL2A 4PUFC 2J23A 1SJ6A 4L0WA 4EVMA 1V40A 5HR3A 1TRWA 3TKRA 4FYUA 3F6FA 4WF5A 4N0VA 3G7JA 4NHZA 3KH9A 2ZUPA 3EWLA 4MK3A 4KE3A 1OC9A 1N8JA 3H4KA 3IBHA 4L5OA 4NHWA 2AHEA 2F9SA 2GQKA 3A5WA 3HHVA 4OO4A 5D96A 2V6KA 1VGLA 1YEPA 5A4WA 3L0HA 5JWQB 3F0IA 3H8QA 3Q6OA 3O6TA 4XS4B 2VL9A 1T1VA 4WKWA 3HVSA 1FW1A 2JU5A 5CRGA 3C73A 1TKDB 22GSA 2HE3A 2EIOA 3TUEA 2YV7A 1SU9A 2LUSA 2AB6A 1S3AA 1JZWA 1M2DA 1EWXA 2H1AA 1A0RP 3PINA 4IHUA 2RUFA 4PXOA 3P2AA 3IE3A 3UMAA 4G10A 1M2BA 2GGTA 3QMXA 2JADA 1EGRA 4EE0A 1GTIA 3KMNA 4IQAA 1T4YA 2X8CA 4I5QA 3LXZA 2DJJA 2YJHA 2JSYA 4ID0A 1A24A 5HR2A 2MMZA 2HZFA 4MJEA 2MMNA 1RQMA 3F9UA 4IJ3A 4HU9A 11GSA 2WDUA 4KDXA 1S3CA 4WF4A 2WULA 3IK9A 4G2EA 1T7PB 1JHBA 1DE2A 1R4WA 1JLWA 4OMVA 1LU4A 3GUSA 3O3TA 2BJXA 3C7MA 1Z5YE 2DSAA 1GUMA 1XWCA 4WXTA 4EDZA 3QR6A 2P31A 3M3MA 4G9HA 2IMEA 5J3RA 4MZWA 3BCIA 3HDCA 3DKSA 2CZ2A 3GSSA 5IOWA 4OO5A 4MJBA 3FR3A 3EC3A 3VI7A 3KMOA 4OFNA 2LV3A 2C4JA 4HU7A 3GL3A 1K3LA 4D73B 1OE7A 1KEBA 4TKYA 1NSWA 4TW5A 2DLXA 5HQPA 1FB6A 2C8UA 2VLTA 2H01A 2PU9C 1GTBA 2OADA 4IELA 4GRFA 3CXGA 2LSTA 5D9XA 4BA7A 4BVYA 2GDRA 3KXOA 4YH2A 5CO3A 2HXKA 3M8NA 4YQUA 2XBIA 5AIXA 1QMVA 3VWWA 1S3DA 3UVTA 2H70A 2NTOA 1E2YA 2GZYA 4K6XA 1JZOA 1XPVA 2B6MA 2IN3A 2WRTA 4RQRA 2OKAA 3QFBC 1GULA 1QUWA 2CV4A 4KSOA 3EMPA 2PMTA 1KBNA 1YY7A 4N10A 4KH7A 4Q5FA 4EXJA 2FWHA 3ZFBA 1TP9A 5H5QA 1F6MC 4GXZA 3UJ1A 1A2MA 1J08A 1T4ZA 2JZRA 1G7OA 3R2QA 1PMTA 4O32A 1XW9A 3FY7A 2WGRA 3APSA 1ZZYA 3WGDA 2QSIA 1FVJA 3EVIA 4GCIA 3GHAA 4LMWA 3F3RA 4QL9A 1V9WA 4E8EA 2BMXA 2L59A 3KM6A 1FAAA 4V2MA 4V1Ap 3GH6A 2L4CA 3LYPA 4MH3A 4PQIA 4O5RA 1FHEA 4HJMA 1ZYEA 3U5RE 4RI7A 1WIKA 2YCDA 4WETA 2I1UA 3QAGA 3EU4A 2YZUA 1X5EA 1MEKA 4JRRA 4FH8A 4IN0A 3ZFLA 5IMFA 2FNOA 12GSA 1GLPA 6GSXA 3ME7A 1SL2B 2PBJA 4GQFA 3GKNA 3LEFA 2EC4A 2H66A 2A2RA 4TOPA 2YPMA 4J2FA 4OCEA 3Q74A 1SJIA 4IQ1A 2VO4A 3WT1A 1TXXA 2MMAA 5IM9A 1XVQA 2H74A 2RUEA 4YQMA 1TK5B 4HJ2A 4MF7A 1ILOA 4EL1A 5CAXA 5ECIB 17GSA 4HZ2A 3H93A 1U88A 1PSQA 3TJFA 2JZTA 3NOFA 2I9HA 2IL3A 2FUG2 4KDYA 2X64A 2IMFA 3IA1A 4JEDA 2YWIA 5F0GA 2C1YA 1X9WB 3TB2A 2GSSA 4ZIJA 3DMLA 2OJLA 5IPHA 2YANA 4Q5RA 4AJ7A 1USBA 3P8WA 5B7CA 2PUKC 3DYRA 3A2WA 1SJZA 1MDJA 4F9ZA 2H30A 1BG5A 2YWOA 3GFKA 4FIWA 3L9SA 3A2XA 1NM3A 4F03A 2F8FA 4TXVA 1HNCA 1XFLA 5KN1A 1MTCA 5CRDA 3C1SA 3RPPA 1ZYQB 16GSA 2TRCP 4I8BA 5DJMA 3DWVA 3ERFA 5G2ZA 4DSSB 2DJ3A 1QXHA 4ML1A 3LFLA 3V1WA 1PA3A 3VURA 2GLRA 1GL8A 4I97A 4JBBA 2DIYA 4MCUA 2YWMA 3EMXA 6GSYA 3ED3A 2C0EA 4DEJA 3WGEA 2VCTA 1Q98A 4RUVA 1SKWB 7GSSA 2DC5A 2B5EA 2XPEA 5ID2A 2MZCA 5ABRA 1DE1A 2I81A 5DALB 1GNEA 1K0MA 4BWQA 1PD21 4NXIA 5ECMB 1U3AA 4K2DA 3QAVA 5HFIA 2O89A 3IHQA 2F51A 4NMUA 3S9FA 5G31A 1IYHA 2K8SA 4MZCA 4MH2A 3EYTA 2VM2A 4KX4A 1EP7A 2KLXA 3LXTA 6GSSA 3KH7A 2FY6A 2DJ1A 2VM1A 1EEJA 4PX1A 3MWHA 3UOMA 3ZZXA 1U3IA 2H71A 2J9HA 1GSSA 2YZHA 3IAM2 2LQOA 4GSSA 4WBJA 1HNBA 4WR4A 1GSUA 1XZOA 2GSQA 1MDKA 1PX6A 3VI5A 2YWNA 1Z7PA 4ZB9A 4H86A 6GSVA 1YJ6A 2O85A 3UBKA 4NV2A 1B48A 3UIWA 4MJCA 2PN8A 1AXDA 3L78A 1TRSA 1K3YA 2LNTA 3D4TA 3L4NA 4K7IA 2EIQA 4N11A 5GAPD 1TJDA 4MZBA 1YEXA 1TRVA 4JZQA 4ZB8A 2QKEA 3D5JA 3FZ4A 5AIVA 4DVCA 1O7UA 3VFIA 4TRXA 5CREA 4ZL9A 1YF0A 3BJ5A 3KEBA 1R26A 4KUNA 1JZDA 1GNWA 1A2LA 3PGTA 1O8XA 1J9BA 1SK2A 2NDOA 4POBA 2WJUA 3CSJA 3J7Yk 1W89A 4CDOA 2FGXA 1BX9A 2HZEB 3KJYA 3EINA 2VCQA 4OWYA 3AY8A 2AUVA 1EGOA 5EVOA 2R37A 5G1KA 4I2TA 2HSHA 4GTUA 1J0FA 1DSBA 1JZRA 2GTUA 2GT6A 1M99A 2C0DA 3PH9A 1FB0A 4K0NA 3J7Yb 3HVVA 5IMCA 3QFAC 4KSMA 4FO5A 3I6AA
chains in the Genus database with same CATH superfamily
1OVNA 2YJ7A 5F06A 3H1NA 2X4AA 5KEJA 4XRAA 2L4QA 3M0FA 2OE1A 3QD9A 5BMUA 5ECHB 2B7JA 2C3TA 4FYBA 2DJ0A 2VD0A 3OR5A 5JWOB 3RAZA 4MPFA 3EE2A 1O81A 3DEXA 3M9JA 3GTUA 2OE3A 1THOA 2A4VA 1NHYA 1SK0A 3DVWA 3ZREA 4XIHA 3CMIA 3GH9A 2CA8A 4MJAA 4X43A 2H1BA 1FVKA 1HQOA 3BOAA 4TR3A 1MDIA 3I69A 1ERVA 2L6DA 3QCPA 4LL1B 1TK0B 1GSYA 4ISDA 5DAKB 3KD0A 4IP1A 1N2AA 2VL3A 3EURA 3E3EA 3KCMA 1WRYA 4PNGA 4EC0A 3KTBA 5JCGA 2C80A 1O6JA 1M0UA 3HA9A 1VF3A 3SWLA 2H75A 2WZ9A 2YN1A 4HI7A 4ACSA 3N9JA 4LL4B 1HNAA 4TR1A 3GKXA 3HKRA 3ZRDA 4K0GA 2ZCTA 3ERGA 2H72A 3VWVA 1PN0A 1X5CA 1XOAA 3LWAA 1MD4A 2QA1A 4TR4A 1XVWA 2C0FA 3NZNA 3P90A 3RHCA 2O8VB 3KTLA 3PR8A 4FYCA 3Q19A 3LG6A 2CVBA 2WFCA 2KHPA 4P3YB 1EV4A 4EUYA 1T3BA 2L57A 2R0PA 4ICYA 3EU3A 1U6TA 1WP0A 4ECIA 4KF9A 3HVXA 5ENUA 1OC9B 1SENA 3IDVA 4KDUA 4IS0A 4KB3A 4N30A 2VCZA 3CQFA 3EPTA 2IWTA 2WB9A 4GQCA 1ZMAA 4GWRA 2H8LA 1SKRB 1GTUA 1AQWA 2H73A 2LNSA 4EF0A 1K0AA 1T00A 5LCZA 2L6CA 4J56E 1Y6EA 4XRDA 3QOUA 1X9MB 4L8EA 3GX8A 3TRPA 1XWBA 2QC7A 2OBIA 2H0HA 2OE0A 2XPDA 4LLRA 1OAZA 2K6VA 5KN3A 3SBCA 2CAIA 4HSCX 5IMVA 2JZSA 5IMZA 1OE8A 1V57A 5J4UA 3ZVJD 4ZILA 1ST9A 4K7OA 4I6XA 1WPIA 2M46A 1PN9A 4O7HA 1T8EB 3IV4A 3GTUB 5A4UA 3HVNA 4GSNA 1SL0B 3KIJA 3VLNA 2LRTA 4LA1A 2P5QA 1PL2A 2GSTA 5J5NA 1GH2A 4K9ZA 3A5IA 4MF5A 2ALBA 3O76A 1QQ2A 1WOUA 5EPFA 1XG8A 5HFGA 3TCOA 9GSSA 5ELGA 3TRQA 5H5RA 5B8BA 1XBSA 2CX3A 2VD1A 3FW2A 2EIRA 1K0DA 4L0UA 1WE0A 2FD3A 3FZAA 1S3RA 3H79A 4GLTA 4CY6A 2FCHA 3QPMA 1B4QA 3WT2A 2OBKA 4KCEA 2A2SA 3MDKA 1NW2A 1Z6NA 3WD6A 1EOHA 3C8EA 1LJRA 2X8GA 4K7NA 2HI7A 1NHOA 4Z2UA 2V6OA 2L5LA 5AGYA 4GSTA 1H75A 1SK1A 1PQNA 1TU7A 3N5OA 2VCWA 18GSA 2R2JA 4NV5A 3TOTA 3LORA 2LJRA 2DMLA 2LKUA 5E59A 1YDKA 2K18A 4WBRD 1ERTA 1ON4A 1X0RA 4XS1A 4KGIA 4ECCA 1K0OA 4KW6A 2MYGA 4XS6A 5G30A 1V98A 5HFKA 2R3XA 5FWGA 2XHFA 3UAPA 3R3EA 4OFMA 4ZBAA 2X49A 5CYYA 1X5DA 3UL3A 2RM6A 2YNXA 3F3QA 2ES7A 4EIQA 2M80A 3IRAA 3P7XA 5LNKe 3FK8A 1Z3EA 1PRXA 1XOBA 2R0CA 1EEMA 4MF6A 2CAQA 5IO0A 2JL4A 4ULXA 1TW9A 3VK9A 3TKPA 5AISA 4ZBDA 1M3IA 3CSHA 3ZITA 2H0IA 2FWEA 2PVQA 2PERA 3UBLA 4WR5A 2PGTA 3GIXA 2Z9SA 1SD9A 1TU8A 2R4VA 5D9WA 20GSA 1GWCA 2VL2C 2N5FA 1XCCA 1ACVA 5FHIA 3TDGA 1YQ1A 2A2PA 4NAXA 1B9YC 1GRXA 1SL1B 4EO3A 1PKZA 4X1UA 3F4SA 2IPAA 2GZPA 2VCVA 3GSTA 3C1RA 1F3AA 1ZL9A 1O73A 2NPBA 1SD8A 3D4MA 5G5EA 3UVHA 2R6KA 3ISOA 2H0GA 1K0NA 4ILFA 5GZZB 3D21A 4O5QA 2MBTA 2YV9A 3FYGA 3GNJA 2I3YA 3C71A 5AN1A 4YQVA 4IGJA 1RW1A 1XW6A 3FRCA 4DSQA 5ELAA 1GSQA 3VWXA 1Q4JA 2N5BA 2KOKA 1X9SB 2FWFA 4K5SA 1ZCPA 1XWKA 1WMJA 4Z7XA 2QGVA 1EZKA 2GZZA 4MP4A 3VWUA 5GAND 2GQLA 1TOFA 3I43A 4HOJA 1F2EA 3IC4A 3TJGA 2H19A 1LBKA 3QAWA 3A2VA 4MLYA 1ABAA 5CRHA 4AF2A 3G9BA 3TKSE 2H1DA 2OA7A 6GSUA 3MIXA 2DBCA 5F05A 3F6DA 2R5GA 3TJKA 3TRXA 4JR4A 3KGKA 4EKZA 2V41A 5J9BA 3ZMKA 2H6YA 2XBQA 3HYPA 4ZBBA 2AYTA 3FR9A 3W8SA 3IC8A 1IYIA 1R5PA 4HEA2 3GKKA 2H6XA 3F8UA 2DJ2A 3BD2A 5G5FA 2GQMA 3E0UA 3ZYWA 2CZ3A 1SYXA 2C3QA 3CBUA 3PPUA 4ZL7A 5J9CA 1AUCA 4PNFA 1URMA 4AJ6A 3CRUA 5A5KA 2MMOA 1YZXA 1BEDA 3IAS2 4DSRA 1V58A 4MMMA 1GUHA 1PKWA 2F8AA 5IQYA 1O85A 1TI3A 4XTSA 2JSZA 5ECQB 4ZB6A 4OD7A 2CX4A 2NVLA 3ZL5A 3GN3A 3HZ8A 4MA9A 2HRAA 2O87A 2RIIA 1QK8A 4RI6A 4KAEA 3MYDA 2FA4A 2H6ZA 3E9JB 1Z9HA 5C04A 2GVPA 4ECJA 3M1GA 4HDEA 5ECNB 5E4WA 2B7KA 3D22A 3IXRA 5IO2A 1Y25A 5COHA 2PWJA 1HD2A 3TJBA 1TDIA 3BBYA 4RQXA 2IMIA 1R7HA 4OFTA 8GSSA 2IIYA 1F37A 5ID2B 3HY2A 3MAKA 4E8HA 5D8IA 1JFUA 4MABA 5ECPB 5A4VA 4POKA 6GSWA 2F3MA 4Z2TA 4CHSA 4ZL8A 2G0FA 2VUPA 1F3BA 3JCML 1YF1A 4TXOA 1I9DA 5D9VA 2YOIA 4EDYA 2KP1A 3KZQA 4AJ8A 1CQGA 3HXSA 1A0FA 3ZLPA 5EL8A 3LYKA 3W6GA 1YKAA 4V2NA 1B4PA 1A23A 5ECOB 1OC3A 4PQHA 5B6MA 1AQVA 4TVEA 1GUKA 2FHEA 4JR6A 4XCSA 2IMDA 5INYA 2XC2A 1SYRA 4O5UA 5IIZA 3FZ5A 5F8BA 1GLQA 3RDWA 2CT6A 2P0GA 3KP8A 1XIYA 1ZGNA 2WCIA 4K1FA 1BAYA 4YAVA 1V2AA 3QDNA 4L5LA 4CW9A 4PURA 1A8YA 1OC8A 5JCWA 4ZXGA 4KNDA 1UC7A 4KCAA 2B1KA 1SKSB 2HFDA 3DGQA 1GSFA 1QGVA 3HJMA 1H4OA 1PL1A 4IKHA 4POLA 1DUGA 5D93A 1XW5A 1U87A 3APQA 3G7IA 4JE1A 3ME8A 2I4AA 3HJPA 2DMMA 2LQQA 3DIEA 2DKHA 2HRNA 3HD5A 1THXA 2P5RA 3IR4A 1TRUA 1XXUA 1FOVA 5DDLA 1Z7RA 1AIUA 1C72A 1M2AA 4NPBA 1VRSD 1A8LA 4N0ZA 1B8XA 3MSZA 3TOUA 5IPGA 4PTSA 1TI1A 4HZ4A 2JACA 2LJAA 3F4RA 3HCZA 3CYNA 1PX7A 1OKTA 2ZNMA 2HNLA 1R5AA 4HUAA 5B6NA 4NWYA 2KUCA 4TN8A 2B1LA 5JCUA 2TRXA 3Q18A 5J41A 2LS5A 2B5YA 3W8JA 2VIMA 5ECRB 2E2GA 1G0TA 1W4VA 5DQYA 1JLVA 3FHKA 1OYJA 2IFQA 4G19A 5D9TA 2PVOC 2OACA 1TTZA 4MDCA 2CQ9A 3ERWA 4ML6A 1K0BA 1F9MA 4TXOB 1GSEA 4HQSA 2HT9A 3L9VA 1G6YA 2HLSA 3F4TA 2IMKA 4G0KA 3GMFA 1GP1A 2V2GA 3LGCA 5IMDA 3ZIJA 2LJKA 2FA8A 4DSSA 2E0QA 2D2ZA 3CTGA 1ERUA 4BWSA 5DVBA 3IK7A 1G7EA 1K0CA 2MBSA 2C3NA 3LQ7A 4PGTA 1KNGA 5DQSA 2YP6A 4PUAA 3FMWA 2BTOT 2E2MA 1KTEA 2LRCA 5FT3A 4AGSA 1M7TA 4IVFA 3TKSC 13GSA 3GRXA 2V32A 4G0LA 2O7KA 2B5XA 3MNGA 1M9BA 3NIVA 1UN2A 3WGXA 5CNWA 2AAWA 3A3TA 5DALA 4TR1B 4V2LA 4CY8A 3WYWA 4BL7A 14GSA 4BIKA 1WWJA 2GT5A 1VF1A 2V1MA 1EP8A 3IHGA 1XWGA 5KN2A 4I2UA 1O8WA 2ON5A 5JWRB 5B8AA 3FKFA 4WEYA 4Q5QA 4LMVA 4POMA 2HRFA 3TJJA 3F63A 4GF0A 1ERWA 2ON7A 1UVZA 3GURA 1VF4A 1WJKA 3CTFA 2C0GA 1EOGA 3M9KA 5GSTA 2L5OA 5DJLA 3RPNA 5F07A 1ML6A 3VPTA 3UEMA 1AW9A 4YKGA 19GSA 2H76A 5DCGA 3VPQA 4TR0A 3GA4A 2VLUA 4F0CA 4QL7A 3UARA 1ZYNA 3ZIVA 4ECBA 5IMAA 5C00A 2VAFA 1PGTA 2AV4A 3IPZA 2TIRA 1YKCA 1TK8B 3DRNA 3D6IA 3DXBA 1RK4A 1CQHA 3U6VA 3LJRA 2DJKA 2IFQB 2M72A 5H5SA 2DIZA 2HSMA 4KA0A 1OKDA 2K9FA 2UZ8A 3FEUA 3D0ZA 2FWGA 1ZOFA 2VOCA 3FR6A 1DBYA 5BRTA 2AJQB 3DD3A 3L9UA 2RLIA 4F2IA 4IP6A 4HS1A 1FOHA 1VF2A 4MPGA 2B3SA 5IOXA 1QFNA 5DCHA 1E6BA 1I5GA 4X0XA 3G7YA 4HQZA 4BVXA 2HZEA 3TKSA 5HR1A 2X99A 4FQUA 2CVKA 1K3OA 3HZ4A 4JU5A 3BCKA 2E7PA 4XS4A 2HYXA 4K5RA 1XWAA 4YAPA 2X8HA 4IW9A 2IJYA 1UA5A 3DVXA 1AAZA 2WS2A 5EY6A 5KOXA 4J57E 5ECLB 3US3A 1AQXA 2G2QA 2LTKA 1BQ7A 2NBSA 5KN0A 5L71A 3CRTA 1G6WA 4IJIA 1M9AA 2GS3A 2PPTA 1AC1A 5ECKB 3GX0A 2REMA 4IBPA 5D73A 2CVDA 4F82A 4XHMA 1M3JA 3GL5A 5GSSA 1BYEA 2LRNA 2QA2A 3CSIA 1EV9A 3TGZA 3I9V2 1PFOA 2GSRA 1Z6MA 4BPYA 5KOWA 5DBQA 3RBTA 3ZVJA 1GSDA 3RHBA 3ZTLA 3KP9A 2VCXA 2K8VA 4Q5NA 4USSA 2N5AA 3LSZA 4QQ7A 1FO5A 5DAKA 4V1Ag 5G1LA 3GYKA 1MD3A 2HSYA 2VLVA 5CRWA 2KP2A 2LEGA 3IOSA 3HJOA 6GSTA 5LD0A 4YKFA 3GV1A 1A2JA 3TKQA 1FG4A 5HR0A 10GSA 2FLSA 4F0BA 3GKMA 1GTAA 2H1GA 1B9XC 3APOA 2RM5A 5ECSA 1BJXA 4K8MA 4O92A 4OCFA 3ZMLA 1ZYPA 4D73A 1HYUA 2R0GA 3FZ9A 4PQ1A 3K8NA 5CP1A 2VL2A 4PUFC 2J23A 1SJ6A 4L0WA 4EVMA 1V40A 5HR3A 1TRWA 3TKRA 4FYUA 3F6FA 4WF5A 4N0VA 3G7JA 4NHZA 3KH9A 2ZUPA 3EWLA 4MK3A 4KE3A 1OC9A 1N8JA 3H4KA 4BVXB 3IBHA 4L5OA 4NHWA 2AHEA 2F9SA 2GQKA 3A5WA 3HHVA 4OO4A 5D96A 2V6KA 1VGLA 1YEPA 4X4JA 5A4WA 3L0HA 5JWQB 3F0IA 3H8QA 3Q6OA 3O6TA 4XS4B 2VL9A 1T1VA 4WKWA 3HVSA 1FW1A 2JU5A 5CRGA 3C73A 1TKDB 22GSA 2HE3A 2EIOA 3TUEA 2YV7A 1SU9A 2LUSA 2AB6A 1S3AA 1JZWA 1M2DA 1EWXA 2H1AA 1A0RP 3PINA 4IHUA 2RUFA 4PXOA 3P2AA 3IE3A 3UMAA 4G10A 1M2BA 2GGTA 3QMXA 2JADA 1EGRA 4EE0A 1GTIA 3KMNA 4IQAA 1T4YA 2X8CA 4I5QA 3LXZA 4K2XA 2DJJA 2YJHA 2JSYA 4ID0A 1A24A 5HR2A 2MMZA 2HZFA 4MJEA 2MMNA 1RQMA 3F9UA 4IJ3A 4HU9A 11GSA 2WDUA 4KDXA 1S3CA 4WF4A 2WULA 3IK9A 4G2EA 1T7PB 1JHBA 1DE2A 1R4WA 1JLWA 4OMVA 1LU4A 3GUSA 3O3TA 2BJXA 3C7MA 1Z5YE 2DSAA 1GUMA 1XWCA 4WXTA 4EDZA 3QR6A 2P31A 3M3MA 4G9HA 2IMEA 5J3RA 4MZWA 3BCIA 3HDCA 3DKSA 2CZ2A 3GSSA 5IOWA 4OO5A 4MJBA 3FR3A 3EC3A 3VI7A 3KMOA 4OFNA 2LV3A 2C4JA 4HU7A 3GL3A 1K3LA 4D73B 1OE7A 1KEBA 4TKYA 1NSWA 4TW5A 2DLXA 5HQPA 1FB6A 2C8UA 2VLTA 2H01A 2PU9C 1GTBA 2OADA 2A4HA 4IELA 4GRFA 3CXGA 2LSTA 5D9XA 4BA7A 4BVYA 2GDRA 3KXOA 4YH2A 5CO3A 2HXKA 3M8NA 4YQUA 2XBIA 5AIXA 1QMVA 3VWWA 1S3DA 3UVTA 2H70A 2NTOA 1E2YA 2GZYA 4K6XA 1JZOA 1XPVA 2B6MA 2IN3A 2WRTA 4RQRA 2OKAA 3QFBC 1GULA 1QUWA 2CV4A 4KSOA 3EMPA 2PMTA 1KBNA 3LW9A 1YY7A 4N10A 4KH7A 4Q5FA 4EXJA 2FWHA 3ZFBA 1TP9A 5H5QA 1F6MC 4GXZA 3UJ1A 1A2MA 1J08A 1T4ZA 2JZRA 2DKIA 1G7OA 3R2QA 1PMTA 4O32A 4A5PA 1XW9A 3FY7A 2WGRA 3APSA 1ZZYA 3WGDA 2QSIA 1FVJA 3EVIA 4GCIA 3GHAA 4LMWA 3F3RA 4QL9A 1V9WA 4E8EA 2BMXA 2L59A 3KM6A 1FAAA 4V2MA 4V1Ap 3GH6A 2L4CA 3LYPA 4Z2RA 4MH3A 4PQIA 4O5RA 1FHEA 4HJMA 1ZYEA 3U5RE 4RI7A 1WIKA 2YCDA 4WETA 2I1UA 3QAGA 3EU4A 2YZUA 1X5EA 1MEKA 4JRRA 4FH8A 4IN0A 3ZFLA 5IMFA 2FNOA 12GSA 1GLPA 6GSXA 3ME7A 1SL2B 2PBJA 4GQFA 3GKNA 3LEFA 2EC4A 2H66A 2A2RA 4TOPA 2YPMA 4J2FA 4OCEA 3Q74A 1SJIA 4IQ1A 2VO4A 3WT1A 1TXXA 2MMAA 5IM9A 1XVQA 2H74A 2RUEA 4YQMA 1TK5B 4HJ2A 4EIPA 4MF7A 1ILOA 4EL1A 5CAXA 5ECIB 17GSA 4HZ2A 3H93A 4BVYB 1U88A 1PSQA 3TJFA 2JZTA 3NOFA 2I9HA 2IL3A 2FUG2 4KDYA 2X64A 2IMFA 3IA1A 4JEDA 2YWIA 5F0GA 2C1YA 1X9WB 3TB2A 2GSSA 4ZIJA 3DMLA 2OJLA 5IPHA 2YANA 4Q5RA 4AJ7A 1USBA 3P8WA 5B7CA 2PUKC 3DYRA 3A2WA 1SJZA 1MDJA 4F9ZA 2H30A 1BG5A 2YWOA 3GFKA 4FIWA 3L9SA 3A2XA 1NM3A 4F03A 2F8FA 4TXVA 1HNCA 1XFLA 5KN1A 1MTCA 5CRDA 3C1SA 3RPPA 1ZYQB 16GSA 2TRCP 4I8BA 5DJMA 3DWVA 3ERFA 5G2ZA 4DSSB 2DJ3A 1QXHA 4ML1A 3LFLA 3V1WA 1PA3A 3VURA 2GLRA 1GL8A 4I97A 4JBBA 2DIYA 4MCUA 2YWMA 3EMXA 6GSYA 3ED3A 2C0EA 4DEJA 3WGEA 2VCTA 1Q98A 4RUVA 1SKWB 7GSSA 2DC5A 2B5EA 2XPEA 5ID2A 2MZCA 5ABRA 1DE1A 2I81A 5DALB 1GNEA 1K0MA 4BWQA 1PD21 4NXIA 5ECMB 1U3AA 4K2DA 3QAVA 5HFIA 4BL7B 2O89A 3IHQA 2F51A 4NMUA 3S9FA 5G31A 1IYHA 2K8SA 4MZCA 4MH2A 3EYTA 2VM2A 4KX4A 1EP7A 2KLXA 3LXTA 6GSSA 3KH7A 2FY6A 2DJ1A 2VM1A 1EEJA 4PX1A 3MWHA 3UOMA 3ZZXA 1U3IA 2H71A 2J9HA 1GSSA 2YZHA 3IAM2 2LQOA 4GSSA 4WBJA 1HNBA 4WR4A 1GSUA 1XZOA 2GSQA 1MDKA 1PX6A 3VI5A 2YWNA 1Z7PA 4ZB9A 4H86A 6GSVA 1YJ6A 2O85A 3UBKA 4NV2A 1B48A 3UIWA 4MJCA 2PN8A 1AXDA 3L78A 1TRSA 1K3YA 2LNTA 3D4TA 3L4NA 4K7IA 2EIQA 4N11A 5GAPD 1TJDA 4MZBA 1YEXA 1TRVA 4JZQA 4ZB8A 2QKEA 3D5JA 3FZ4A 5AIVA 4DVCA 1O7UA 3VFIA 4TRXA 5CREA 4ZL9A 1YF0A 3BJ5A 3KEBA 1R26A 4KUNA 1JZDA 1GNWA 1A2LA 3PGTA 1O8XA 1J9BA 1SK2A 2NDOA 2HRKA 4POBA 2WJUA 3CSJA 3J7Yk 1W89A 4CDOA 4MNNA 2FGXA 1BX9A 2HZEB 3KJYA 3EINA 2VCQA 4OWYA 3AY8A 2AUVA 1EGOA 5EVOA 2R37A 5G1KA 4I2TA 2HSHA 4GTUA 1J0FA 1DSBA 1JZRA 2GTUA 4G0IA 2GT6A 1M99A 2C0DA 3PH9A 1FB0A 4K0NA 3J7Yb 3HVVA 5IMCA 3QFAC 4KSMA 4FO5A 3I6AA
chains in the Genus database with same CATH topology
1OVNA 2YJ7A 5F06A 3H1NA 2X4AA 5KEJA 4XRAA 2L4QA 3M0FA 2OE1A 3QD9A 5BMUA 5ECHB 2B7JA 2C3TA 4FYBA 2DJ0A 2VD0A 3OR5A 5JWOB 3RAZA 4MPFA 3EE2A 1O81A 3DEXA 3M9JA 3GTUA 2OE3A 1THOA 2A4VA 1NHYA 1SK0A 3DVWA 3ZREA 4XIHA 3CMIA 3GH9A 2CA8A 4MJAA 4X43A 2H1BA 1FVKA 1HQOA 3BOAA 4TR3A 1MDIA 3I69A 1ERVA 2L6DA 3QCPA 4LL1B 1TK0B 1GSYA 4ISDA 5DAKB 3KD0A 4IP1A 1N2AA 2VL3A 3EURA 3E3EA 3KCMA 1WRYA 4PNGA 4EC0A 3KTBA 5JCGA 2C80A 1O6JA 1M0UA 3HA9A 1VF3A 3SWLA 2H75A 2WZ9A 2YN1A 4HI7A 4ACSA 3N9JA 4LL4B 1HNAA 4TR1A 3GKXA 3HKRA 3ZRDA 4K0GA 2ZCTA 3ERGA 2H72A 3VWVA 1PN0A 1X5CA 1XOAA 3LWAA 1MD4A 2QA1A 4TR4A 1XVWA 2C0FA 3NZNA 3P90A 3RHCA 2O8VB 3KTLA 3PR8A 4FYCA 3Q19A 3LG6A 2CVBA 2WFCA 2KHPA 4P3YB 1EV4A 4EUYA 1T3BA 2L57A 2R0PA 4ICYA 3EU3A 1U6TA 1WP0A 4ECIA 4KF9A 3HVXA 5ENUA 1OC9B 1SENA 3IDVA 4KDUA 4IS0A 4KB3A 4N30A 2VCZA 3EPTA 2IWTA 2WB9A 4GQCA 1ZMAA 4GWRA 2H8LA 1SKRB 1GTUA 1AQWA 2H73A 2LNSA 4EF0A 1K0AA 1T00A 5LCZA 2L6CA 4J56E 1Y6EA 4XRDA 3QOUA 1X9MB 4L8EA 3GX8A 3TRPA 1XWBA 2QC7A 2OBIA 2H0HA 2OE0A 2XPDA 4LLRA 1OAZA 2K6VA 5KN3A 3SBCA 2CAIA 5IMVA 2JZSA 5IMZA 1OE8A 1V57A 5J4UA 3ZVJD 4ZILA 1ST9A 4K7OA 4I6XA 1WPIA 2M46A 1PN9A 4O7HA 1T8EB 3IV4A 3GTUB 5A4UA 4GSNA 1SL0B 3KIJA 3VLNA 2LRTA 4LA1A 2P5QA 1PL2A 2GSTA 5J5NA 1GH2A 4K9ZA 3A5IA 4MF5A 2ALBA 3O76A 1QQ2A 1WOUA 5EPFA 5HFGA 3TCOA 9GSSA 5ELGA 3TRQA 5H5RA 5B8BA 1XBSA 2CX3A 2VD1A 3FW2A 2EIRA 1K0DA 4L0UA 1WE0A 2FD3A 3FZAA 3H79A 4GLTA 4CY6A 2FCHA 3QPMA 1B4QA 3WT2A 2OBKA 4KCEA 2A2SA 3MDKA 1NW2A 1Z6NA 3WD6A 1EOHA 3C8EA 1LJRA 2X8GA 4K7NA 2HI7A 1NHOA 4Z2UA 2V6OA 2L5LA 5AGYA 4GSTA 1H75A 1SK1A 1PQNA 1TU7A 3N5OA 2VCWA 18GSA 2R2JA 4NV5A 3TOTA 3LORA 2LJRA 2DMLA 2LKUA 5E59A 1YDKA 2K18A 4WBRD 1ERTA 1ON4A 1X0RA 4XS1A 4KGIA 4ECCA 1K0OA 4KW6A 2MYGA 4XS6A 5G30A 1V98A 5HFKA 2R3XA 5FWGA 2XHFA 3UAPA 3R3EA 4OFMA 4ZBAA 2X49A 5CYYA 1X5DA 3UL3A 2RM6A 2YNXA 3F3QA 2ES7A 4EIQA 2M80A 3IRAA 3P7XA 5LNKe 3FK8A 1Z3EA 1PRXA 1XOBA 2R0CA 1EEMA 4MF6A 2CAQA 5IO0A 2JL4A 4ULXA 1TW9A 3VK9A 3TKPA 5AISA 4ZBDA 3CSHA 3ZITA 2H0IA 2FWEA 2PVQA 2PERA 3UBLA 4WR5A 2PGTA 3GIXA 2Z9SA 1SD9A 1TU8A 2R4VA 5D9WA 20GSA 1GWCA 2VL2C 2N5FA 1XCCA 1ACVA 5FHIA 3TDGA 1YQ1A 2A2PA 4NAXA 1B9YC 1GRXA 1SL1B 4EO3A 1PKZA 4X1UA 3F4SA 2IPAA 2GZPA 2VCVA 3GSTA 3C1RA 1F3AA 1ZL9A 1O73A 2NPBA 1SD8A 3D4MA 5G5EA 3UVHA 2R6KA 3ISOA 2H0GA 1K0NA 4ILFA 5GZZB 3D21A 4O5QA 2MBTA 2YV9A 3FYGA 3GNJA 2I3YA 3C71A 5AN1A 4YQVA 4IGJA 1RW1A 1XW6A 3FRCA 4DSQA 5ELAA 1GSQA 3VWXA 1Q4JA 2N5BA 2KOKA 1X9SB 2FWFA 4K5SA 1ZCPA 1XWKA 1WMJA 4Z7XA 2QGVA 1EZKA 2GZZA 4MP4A 3VWUA 5GAND 2GQLA 1TOFA 3I43A 4HOJA 1F2EA 3IC4A 3TJGA 2H19A 1LBKA 3QAWA 3A2VA 4MLYA 1ABAA 5CRHA 4AF2A 3G9BA 3TKSE 2H1DA 2OA7A 6GSUA 3MIXA 2DBCA 5F05A 3F6DA 2R5GA 3TJKA 3TRXA 4JR4A 3KGKA 4EKZA 2V41A 5J9BA 3ZMKA 2H6YA 2XBQA 3HYPA 4ZBBA 2AYTA 3FR9A 3W8SA 3IC8A 1IYIA 1R5PA 4HEA2 3GKKA 2H6XA 3F8UA 2DJ2A 3BD2A 5G5FA 2GQMA 3E0UA 3ZYWA 2CZ3A 1SYXA 2C3QA 3CBUA 3PPUA 4ZL7A 5J9CA 1AUCA 4PNFA 1URMA 4AJ6A 3CRUA 5A5KA 2MMOA 1YZXA 1BEDA 3IAS2 4DSRA 1V58A 4MMMA 1GUHA 1PKWA 2F8AA 5IQYA 1O85A 1TI3A 4XTSA 2JSZA 5ECQB 4ZB6A 4OD7A 2CX4A 2NVLA 3ZL5A 3GN3A 3HZ8A 4MA9A 2HRAA 2O87A 2RIIA 1QK8A 4RI6A 4KAEA 3MYDA 2FA4A 2H6ZA 3E9JB 1Z9HA 5C04A 2GVPA 4ECJA 3M1GA 4HDEA 5ECNB 5E4WA 2B7KA 3D22A 3IXRA 5IO2A 1Y25A 5COHA 2PWJA 1HD2A 3TJBA 1TDIA 3BBYA 4RQXA 2IMIA 1R7HA 4OFTA 8GSSA 2IIYA 1F37A 5ID2B 3HY2A 3MAKA 4E8HA 5D8IA 1JFUA 4MABA 5ECPB 5A4VA 4POKA 6GSWA 2F3MA 4Z2TA 4CHSA 4ZL8A 2G0FA 2VUPA 1F3BA 3JCML 1YF1A 4TXOA 1I9DA 5D9VA 2YOIA 4EDYA 2KP1A 3KZQA 4AJ8A 1CQGA 3HXSA 1A0FA 3ZLPA 5EL8A 3LYKA 3W6GA 1YKAA 4V2NA 1B4PA 1A23A 5ECOB 1OC3A 4PQHA 5B6MA 1AQVA 4TVEA 1GUKA 2FHEA 4JR6A 4XCSA 2IMDA 5INYA 2XC2A 1SYRA 4O5UA 5IIZA 3FZ5A 5F8BA 1GLQA 3RDWA 2CT6A 2P0GA 3KP8A 1XIYA 1ZGNA 2WCIA 4K1FA 1BAYA 4YAVA 1V2AA 3QDNA 4L5LA 4CW9A 4PURA 1A8YA 1OC8A 5JCWA 4ZXGA 4KNDA 1UC7A 4KCAA 2B1KA 1SKSB 2HFDA 3DGQA 1GSFA 1QGVA 3HJMA 1H4OA 1PL1A 4IKHA 4POLA 1DUGA 5D93A 1XW5A 1U87A 3APQA 3G7IA 4JE1A 3ME8A 2I4AA 3HJPA 2DMMA 2LQQA 3DIEA 2DKHA 2HRNA 3HD5A 1THXA 2P5RA 3IR4A 1TRUA 1XXUA 1FOVA 5DDLA 1Z7RA 1AIUA 1C72A 1M2AA 4NPBA 1VRSD 1A8LA 4N0ZA 1B8XA 3MSZA 3TOUA 5IPGA 4PTSA 1TI1A 4HZ4A 2JACA 2LJAA 3F4RA 3HCZA 3CYNA 1PX7A 1OKTA 2ZNMA 2HNLA 1R5AA 4HUAA 5B6NA 4NWYA 2KUCA 4TN8A 2B1LA 5JCUA 2TRXA 3Q18A 5J41A 2LS5A 2B5YA 3W8JA 2VIMA 5ECRB 2E2GA 1G0TA 1W4VA 5DQYA 1JLVA 3FHKA 1OYJA 2IFQA 4G19A 5D9TA 2PVOC 2OACA 1TTZA 4MDCA 2CQ9A 3ERWA 4ML6A 1K0BA 1F9MA 4TXOB 1GSEA 4HQSA 2HT9A 3L9VA 1G6YA 2HLSA 3F4TA 2IMKA 4G0KA 3GMFA 1GP1A 2V2GA 3LGCA 5IMDA 3ZIJA 2LJKA 2FA8A 4DSSA 2E0QA 2D2ZA 3CTGA 1ERUA 4BWSA 5DVBA 3IK7A 1G7EA 1K0CA 2MBSA 2C3NA 3LQ7A 4PGTA 1KNGA 5DQSA 2YP6A 4PUAA 3FMWA 2BTOT 2E2MA 1KTEA 2LRCA 5FT3A 4AGSA 1M7TA 4IVFA 3TKSC 13GSA 3GRXA 2V32A 4G0LA 2O7KA 2B5XA 3MNGA 1M9BA 3NIVA 1UN2A 3WGXA 5CNWA 2AAWA 3A3TA 5DALA 4TR1B 4V2LA 4CY8A 3WYWA 4BL7A 14GSA 1WWJA 2GT5A 1VF1A 2V1MA 1EP8A 3IHGA 1XWGA 5KN2A 4I2UA 1O8WA 2ON5A 5JWRB 5B8AA 3FKFA 4WEYA 4Q5QA 4LMVA 4POMA 2HRFA 3TJJA 3F63A 4GF0A 1ERWA 2ON7A 1UVZA 3GURA 1VF4A 1WJKA 3CTFA 2C0GA 1EOGA 3M9KA 5GSTA 2L5OA 5DJLA 3RPNA 5F07A 1ML6A 3VPTA 3UEMA 1AW9A 4YKGA 19GSA 2H76A 5DCGA 3VPQA 4TR0A 3GA4A 2VLUA 4F0CA 4QL7A 3UARA 1ZYNA 3ZIVA 4ECBA 5IMAA 5C00A 2VAFA 1PGTA 2AV4A 3IPZA 2TIRA 1YKCA 1TK8B 3DRNA 3D6IA 3DXBA 1RK4A 1CQHA 3U6VA 3LJRA 2DJKA 2IFQB 2M72A 5H5SA 2DIZA 2HSMA 4KA0A 1OKDA 2K9FA 2UZ8A 3FEUA 3D0ZA 2FWGA 1ZOFA 2VOCA 3FR6A 1DBYA 5BRTA 2AJQB 3DD3A 3L9UA 2RLIA 4F2IA 4IP6A 4HS1A 1FOHA 1VF2A 4MPGA 2B3SA 5IOXA 1QFNA 5DCHA 1E6BA 1I5GA 4X0XA 3G7YA 4HQZA 4BVXA 2HZEA 3TKSA 5HR1A 2X99A 4FQUA 2CVKA 1K3OA 3HZ4A 4JU5A 3BCKA 2E7PA 4XS4A 2HYXA 4K5RA 1XWAA 4YAPA 2X8HA 4IW9A 2IJYA 1UA5A 3DVXA 1AAZA 2WS2A 5EY6A 5KOXA 4J57E 5ECLB 3US3A 1AQXA 2G2QA 2LTKA 1BQ7A 2NBSA 5KN0A 5L71A 3CRTA 1G6WA 4IJIA 1M9AA 2GS3A 2PPTA 1AC1A 5ECKB 3GX0A 2REMA 4IBPA 5D73A 2CVDA 4F82A 4XHMA 3GL5A 5GSSA 1BYEA 2LRNA 2QA2A 3CSIA 1EV9A 3TGZA 3I9V2 2GSRA 1Z6MA 4BPYA 5KOWA 5DBQA 3RBTA 3ZVJA 1GSDA 3RHBA 3ZTLA 3KP9A 2VCXA 2K8VA 4Q5NA 4USSA 2N5AA 3LSZA 4QQ7A 1FO5A 5DAKA 4V1Ag 5G1LA 3GYKA 1MD3A 2HSYA 2VLVA 5CRWA 2KP2A 2LEGA 3IOSA 3HJOA 6GSTA 5LD0A 4YKFA 3GV1A 1A2JA 3TKQA 1FG4A 5HR0A 10GSA 2FLSA 4F0BA 3GKMA 1GTAA 2H1GA 1B9XC 3APOA 2RM5A 5ECSA 1BJXA 4K8MA 4O92A 4OCFA 3ZMLA 1ZYPA 4D73A 1HYUA 2R0GA 3FZ9A 4PQ1A 3K8NA 5CP1A 2VL2A 4PUFC 2J23A 1SJ6A 4L0WA 4EVMA 1V40A 5HR3A 1TRWA 3TKRA 4FYUA 3F6FA 4WF5A 4N0VA 3G7JA 4NHZA 3KH9A 2ZUPA 3EWLA 4MK3A 4KE3A 1OC9A 1N8JA 3H4KA 4BVXB 3IBHA 4L5OA 4NHWA 2AHEA 2F9SA 2GQKA 3A5WA 3HHVA 4OO4A 5D96A 2V6KA 1VGLA 1YEPA 4X4JA 5A4WA 3L0HA 5JWQB 3F0IA 3H8QA 3Q6OA 3O6TA 4XS4B 2VL9A 1T1VA 4WKWA 3HVSA 1FW1A 2JU5A 5CRGA 3C73A 1TKDB 22GSA 2HE3A 2EIOA 3TUEA 2YV7A 1SU9A 2LUSA 2AB6A 1S3AA 1JZWA 1M2DA 1EWXA 2H1AA 1A0RP 3PINA 4IHUA 2RUFA 4PXOA 3P2AA 3IE3A 3UMAA 4G10A 1M2BA 2GGTA 3QMXA 2JADA 1EGRA 4EE0A 1GTIA 3KMNA 4IQAA 1T4YA 2X8CA 4I5QA 3LXZA 4K2XA 2DJJA 2YJHA 2JSYA 4ID0A 1A24A 5HR2A 2MMZA 2HZFA 4MJEA 2MMNA 1RQMA 3F9UA 4IJ3A 4HU9A 11GSA 2WDUA 4KDXA 1S3CA 4WF4A 2WULA 3IK9A 4G2EA 1T7PB 1JHBA 1DE2A 1R4WA 1JLWA 4OMVA 1LU4A 3GUSA 3O3TA 2BJXA 3C7MA 1Z5YE 2DSAA 1GUMA 1XWCA 4WXTA 4EDZA 3QR6A 2P31A 3M3MA 4G9HA 2IMEA 5J3RA 4MZWA 3BCIA 3HDCA 3DKSA 2CZ2A 3GSSA 5IOWA 4OO5A 4MJBA 3FR3A 3EC3A 3VI7A 3KMOA 4OFNA 2LV3A 2C4JA 4HU7A 3GL3A 1K3LA 4D73B 1OE7A 1KEBA 4TKYA 1NSWA 4TW5A 2DLXA 5HQPA 1FB6A 2C8UA 2VLTA 2H01A 2PU9C 1GTBA 2OADA 2A4HA 4IELA 4GRFA 3CXGA 2LSTA 5D9XA 4BA7A 4BVYA 2GDRA 3KXOA 4YH2A 5CO3A 2HXKA 3M8NA 4YQUA 2XBIA 5AIXA 1QMVA 3VWWA 1S3DA 3UVTA 2H70A 2NTOA 1E2YA 2GZYA 4K6XA 1JZOA 1XPVA 2B6MA 2IN3A 2WRTA 4RQRA 2OKAA 3QFBC 1GULA 1QUWA 2CV4A 4KSOA 3EMPA 2PMTA 1KBNA 3LW9A 1YY7A 4N10A 4KH7A 4Q5FA 4EXJA 2FWHA 3ZFBA 1TP9A 5H5QA 1F6MC 4GXZA 3UJ1A 1A2MA 1J08A 1T4ZA 2JZRA 2DKIA 1G7OA 3R2QA 1PMTA 4O32A 4A5PA 1XW9A 3FY7A 2WGRA 3APSA 1ZZYA 3WGDA 2QSIA 1FVJA 3EVIA 4GCIA 3GHAA 4LMWA 3F3RA 4QL9A 1V9WA 4E8EA 2BMXA 2L59A 3KM6A 1FAAA 4V2MA 4V1Ap 3GH6A 2L4CA 3LYPA 4Z2RA 4MH3A 4PQIA 4O5RA 1FHEA 4HJMA 1ZYEA 3U5RE 4RI7A 1WIKA 2YCDA 4WETA 2I1UA 3QAGA 3EU4A 2YZUA 1X5EA 1MEKA 4JRRA 4FH8A 4IN0A 3ZFLA 5IMFA 2FNOA 12GSA 1GLPA 6GSXA 3ME7A 1SL2B 2PBJA 4GQFA 3GKNA 3LEFA 2EC4A 2H66A 2A2RA 4TOPA 2YPMA 4J2FA 4OCEA 3Q74A 1SJIA 4IQ1A 2VO4A 3WT1A 1TXXA 2MMAA 5IM9A 1XVQA 2H74A 2RUEA 4YQMA 1TK5B 4HJ2A 4EIPA 4MF7A 1ILOA 4EL1A 5CAXA 5ECIB 17GSA 4HZ2A 3H93A 4BVYB 1U88A 1PSQA 3TJFA 2JZTA 3NOFA 2I9HA 2IL3A 2FUG2 4KDYA 2X64A 2IMFA 3IA1A 4JEDA 2YWIA 5F0GA 2C1YA 1X9WB 3TB2A 2GSSA 4ZIJA 3DMLA 2OJLA 5IPHA 2YANA 4Q5RA 4AJ7A 1USBA 3P8WA 5B7CA 2PUKC 3DYRA 3A2WA 1SJZA 1MDJA 4F9ZA 2H30A 1BG5A 2YWOA 3GFKA 4FIWA 3L9SA 3A2XA 1NM3A 4F03A 2F8FA 4TXVA 1HNCA 1XFLA 5KN1A 1MTCA 5CRDA 3C1SA 3RPPA 1ZYQB 16GSA 2TRCP 4I8BA 5DJMA 3DWVA 3ERFA 5G2ZA 4DSSB 2DJ3A 1QXHA 4ML1A 3LFLA 3V1WA 1PA3A 3VURA 2GLRA 1GL8A 4I97A 4JBBA 2DIYA 4MCUA 2YWMA 3EMXA 6GSYA 3ED3A 2C0EA 4DEJA 3WGEA 2VCTA 1Q98A 4RUVA 1SKWB 7GSSA 2DC5A 2B5EA 2XPEA 5ID2A 2MZCA 5ABRA 1DE1A 2I81A 5DALB 1GNEA 1K0MA 4BWQA 1PD21 4NXIA 5ECMB 1U3AA 4K2DA 3QAVA 5HFIA 4BL7B 2O89A 3IHQA 2F51A 4NMUA 3S9FA 5G31A 1IYHA 2K8SA 4MZCA 4MH2A 3EYTA 2VM2A 4KX4A 1EP7A 2KLXA 3LXTA 6GSSA 3KH7A 2FY6A 2DJ1A 2VM1A 1EEJA 4PX1A 3MWHA 3UOMA 3ZZXA 1U3IA 2H71A 2J9HA 1GSSA 2YZHA 3IAM2 2LQOA 4GSSA 4WBJA 1HNBA 4WR4A 1GSUA 1XZOA 2GSQA 1MDKA 1PX6A 3VI5A 2YWNA 1Z7PA 4ZB9A 4H86A 6GSVA 1YJ6A 2O85A 3UBKA 4NV2A 1B48A 3UIWA 4MJCA 2PN8A 1AXDA 3L78A 1TRSA 1K3YA 2LNTA 3D4TA 3L4NA 4K7IA 2EIQA 4N11A 5GAPD 1TJDA 4MZBA 1YEXA 1TRVA 4JZQA 4ZB8A 2QKEA 3D5JA 3FZ4A 5AIVA 4DVCA 1O7UA 3VFIA 4TRXA 5CREA 4ZL9A 1YF0A 3BJ5A 3KEBA 1R26A 4KUNA 1JZDA 1GNWA 1A2LA 3PGTA 1O8XA 1J9BA 1SK2A 2NDOA 2HRKA 4POBA 2WJUA 3CSJA 3J7Yk 1W89A 4CDOA 4MNNA 2FGXA 1BX9A 2HZEB 3KJYA 3EINA 2VCQA 4OWYA 3AY8A 2AUVA 1EGOA 5EVOA 2R37A 5G1KA 4I2TA 2HSHA 4GTUA 1J0FA 1DSBA 1JZRA 2GTUA 4G0IA 2GT6A 1M99A 2C0DA 3PH9A 1FB0A 4K0NA 3J7Yb 3HVVA 5IMCA 3QFAC 4KSMA 4FO5A 3I6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OVN A;  2YJ7 A;  5F06 A;  3H1N A;  5KEJ A;  4XRA A;  2L4Q A;  3M0F A;  2OE1 A;  3QD9 A;  5ECH B;  2B7J A;  2C3T A;  4FYB A;  2DJ0 A;  2VD0 A;  3OR5 A;  5JWO B;  3RAZ A;  4MPF A;  3EE2 A;  1O81 A;  3DEX A;  3M9J A;  3GTU A;  2OE3 A;  1THO A;  2A4V A;  1NHY A;  1SK0 A;  3DVW A;  3ZRE A;  4XIH A;  3CMI A;  3GH9 A;  2CA8 A;  4MJA A;  4X43 A;  2H1B A;  1FVK A;  1HQO A;  3BOA A;  4TR3 A;  1MDI A;  3I69 A;  1ERV A;  2L6D A;  3QCP A;  4LL1 B;  1TK0 B;  1GSY A;  4ISD A;  5DAK B;  3KD0 A;  4IP1 A;  1N2A A;  2VL3 A;  3EUR A;  3E3E A;  3KCM A;  1WRY A;  4PNG A;  4EC0 A;  3KTB A;  5JCG A;  2C80 A;  1O6J A;  1M0U A;  3HA9 A;  1VF3 A;  3SWL A;  2H75 A;  2WZ9 A;  2YN1 A;  4HI7 A;  4ACS A;  3N9J A;  4LL4 B;  1HNA A;  4TR1 A;  3GKX A;  3HKR A;  3ZRD A;  4K0G A;  2ZCT A;  3ERG A;  2H72 A;  3VWV A;  1X5C A;  1XOA A;  3LWA A;  1MD4 A;  4TR4 A;  1XVW A;  2C0F A;  3NZN A;  3P90 A;  3RHC A;  2O8V B;  3KTL A;  3PR8 A;  4FYC A;  3Q19 A;  3LG6 A;  2CVB A;  2WFC A;  2KHP A;  4P3Y B;  1EV4 A;  4EUY A;  1T3B A;  2L57 A;  3EU3 A;  1U6T A;  1WP0 A;  4ECI A;  3HVX A;  5ENU A;  1OC9 B;  1SEN A;  3IDV A;  4KDU A;  4IS0 A;  4KB3 A;  4N30 A;  2VCZ A;  2IWT A;  2WB9 A;  4GQC A;  1ZMA A;  4GWR A;  2H8L A;  1SKR B;  1GTU A;  1AQW A;  2H73 A;  2LNS A;  4EF0 A;  1K0A A;  1T00 A;  5LCZ A;  2L6C A;  4J56 E;  1Y6E A;  4XRD A;  3QOU A;  1X9M B;  4L8E A;  3GX8 A;  3TRP A;  1XWB A;  2QC7 A;  2OBI A;  2H0H A;  2OE0 A;  2XPD A;  4LLR A;  1OAZ A;  2K6V A;  5KN3 A;  3SBC A;  2CAI A;  5IMV A;  2JZS A;  5IMZ A;  1OE8 A;  1V57 A;  5J4U A;  3ZVJ D;  4ZIL A;  1ST9 A;  4K7O A;  4I6X A;  1WPI A;  2M46 A;  1PN9 A;  4O7H A;  1T8E B;  3IV4 A;  3GTU B;  5A4U A;  4GSN A;  1SL0 B;  3KIJ A;  3VLN A;  2LRT A;  4LA1 A;  2P5Q A;  1PL2 A;  2GST A;  5J5N A;  1GH2 A;  4K9Z A;  4MF5 A;  2ALB A;  3O76 A;  1QQ2 A;  1WOU A;  5EPF A;  5HFG A;  3TCO A;  9GSS A;  5ELG A;  3TRQ A;  5H5R A;  5B8B A;  1XBS A;  2CX3 A;  2VD1 A;  3FW2 A;  2EIR A;  1K0D A;  4L0U A;  1WE0 A;  2FD3 A;  3FZA A;  3H79 A;  4GLT A;  2FCH A;  3QPM A;  1B4Q A;  3WT2 A;  2OBK A;  4KCE A;  2A2S A;  3MDK A;  1NW2 A;  1Z6N A;  3WD6 A;  1EOH A;  3C8E A;  1LJR A;  2X8G A;  4K7N A;  2HI7 A;  1NHO A;  2V6O A;  2L5L A;  5AGY A;  4GST A;  1H75 A;  1SK1 A;  1PQN A;  1TU7 A;  3N5O A;  2VCW A;  18GS A;  2R2J A;  4NV5 A;  3TOT A;  3LOR A;  2LJR A;  2DML A;  2LKU A;  5E59 A;  1YDK A;  2K18 A;  4WBR D;  1ERT A;  1ON4 A;  1X0R A;  4XS1 A;  4KGI A;  4ECC A;  1K0O A;  4KW6 A;  2MYG A;  4XS6 A;  5G30 A;  1V98 A;  5HFK A;  2R3X A;  5FWG A;  2XHF A;  3UAP A;  4OFM A;  4ZBA A;  5CYY A;  1X5D A;  3UL3 A;  2RM6 A;  2YNX A;  3F3Q A;  2ES7 A;  2M80 A;  3IRA A;  3P7X A;  5LNK e;  3FK8 A;  1Z3E A;  1PRX A;  1XOB A;  1EEM A;  4MF6 A;  2CAQ A;  5IO0 A;  2JL4 A;  4ULX A;  1TW9 A;  3VK9 A;  3TKP A;  5AIS A;  4ZBD A;  3CSH A;  3ZIT A;  2H0I A;  2FWE A;  2PVQ A;  2PER A;  3UBL A;  4WR5 A;  2PGT A;  3GIX A;  2Z9S A;  1SD9 A;  1TU8 A;  2R4V A;  5D9W A;  20GS A;  1GWC A;  2VL2 C;  2N5F A;  1XCC A;  1ACV A;  5FHI A;  3TDG A;  1YQ1 A;  4NAX A;  1B9Y C;  1GRX A;  1SL1 B;  4EO3 A;  1PKZ A;  4X1U A;  3F4S A;  2IPA A;  2GZP A;  2VCV A;  3GST A;  3C1R A;  1F3A A;  1ZL9 A;  1O73 A;  2NPB A;  1SD8 A;  3D4M A;  5G5E A;  3UVH A;  2R6K A;  3ISO A;  2H0G A;  1K0N A;  4ILF A;  5GZZ B;  3D21 A;  2MBT A;  2YV9 A;  3FYG A;  3GNJ A;  2I3Y A;  3C71 A;  5AN1 A;  4YQV A;  4IGJ A;  1RW1 A;  1XW6 A;  3FRC A;  4DSQ A;  5ELA A;  1GSQ A;  3VWX A;  1Q4J A;  2N5B A;  2KOK A;  1X9S B;  2FWF A;  1ZCP A;  1XWK A;  1WMJ A;  4Z7X A;  2QGV A;  1EZK A;  2GZZ A;  4MP4 A;  3VWU A;  5GAN D;  2GQL A;  1TOF A;  3I43 A;  4HOJ A;  1F2E A;  3IC4 A;  3TJG A;  2H19 A;  1LBK A;  3QAW A;  3A2V A;  4MLY A;  1ABA A;  5CRH A;  4AF2 A;  3G9B A;  3TKS E;  2H1D A;  2OA7 A;  6GSU A;  2DBC A;  5F05 A;  3F6D A;  2R5G A;  3TJK A;  3TRX A;  4JR4 A;  3KGK A;  4EKZ A;  2V41 A;  5J9B A;  3ZMK A;  2H6Y A;  2XBQ A;  3HYP A;  4ZBB A;  2AYT A;  3FR9 A;  3W8S A;  1IYI A;  1R5P A;  4HEA 2;  3GKK A;  2H6X A;  3F8U A;  2DJ2 A;  3BD2 A;  5G5F A;  2GQM A;  3E0U A;  3ZYW A;  2CZ3 A;  1SYX A;  2C3Q A;  3CBU A;  4ZL7 A;  5J9C A;  1AUC A;  4PNF A;  1URM A;  4AJ6 A;  3CRU A;  5A5K A;  2MMO A;  1YZX A;  1BED A;  3IAS 2;  4DSR A;  1V58 A;  4MMM A;  1GUH A;  1PKW A;  2F8A A;  5IQY A;  1O85 A;  1TI3 A;  4XTS A;  2JSZ A;  5ECQ B;  4ZB6 A;  4OD7 A;  2CX4 A;  2NVL A;  3ZL5 A;  3GN3 A;  3HZ8 A;  4MA9 A;  2O87 A;  2RII A;  1QK8 A;  4RI6 A;  4KAE A;  2FA4 A;  2H6Z A;  3E9J B;  1Z9H A;  5C04 A;  2GVP A;  4ECJ A;  3M1G A;  4HDE A;  5ECN B;  5E4W A;  2B7K A;  3D22 A;  3IXR A;  5IO2 A;  1Y25 A;  5COH A;  2PWJ A;  1HD2 A;  3TJB A;  1TDI A;  3BBY A;  4RQX A;  2IMI A;  1R7H A;  4OFT A;  8GSS A;  2IIY A;  1F37 A;  5ID2 B;  3HY2 A;  3MAK A;  4E8H A;  5D8I A;  1JFU A;  4MAB A;  5ECP B;  5A4V A;  4POK A;  6GSW A;  2F3M A;  4CHS A;  4ZL8 A;  2G0F A;  2VUP A;  1F3B A;  3JCM L;  1YF1 A;  4TXO A;  1I9D A;  5D9V A;  2YOI A;  4EDY A;  2KP1 A;  3KZQ A;  4AJ8 A;  1CQG A;  3HXS A;  1A0F A;  3ZLP A;  5EL8 A;  3LYK A;  3W6G A;  1YKA A;  4V2N A;  1B4P A;  1A23 A;  5ECO B;  1OC3 A;  4PQH A;  5B6M A;  1AQV A;  4TVE A;  1GUK A;  2FHE A;  4JR6 A;  4XCS A;  2IMD A;  5INY A;  2XC2 A;  1SYR A;  5IIZ A;  3FZ5 A;  5F8B A;  1GLQ A;  3RDW A;  2CT6 A;  2P0G A;  3KP8 A;  1XIY A;  1ZGN A;  2WCI A;  4K1F A;  1BAY A;  4YAV A;  1V2A A;  3QDN A;  4L5L A;  4CW9 A;  4PUR A;  1A8Y A;  1OC8 A;  5JCW A;  4ZXG A;  4KND A;  1UC7 A;  4KCA A;  2B1K A;  1SKS B;  2HFD A;  3DGQ A;  1GSF A;  1QGV A;  3HJM A;  1H4O A;  1PL1 A;  4IKH A;  4POL A;  1DUG A;  5D93 A;  1XW5 A;  1U87 A;  3APQ A;  3G7I A;  4JE1 A;  3ME8 A;  2I4A A;  3HJP A;  2DMM A;  2LQQ A;  3DIE A;  2HRN A;  3HD5 A;  1THX A;  2P5R A;  3IR4 A;  1TRU A;  1XXU A;  1FOV A;  5DDL A;  1Z7R A;  1AIU A;  1C72 A;  1M2A A;  4NPB A;  1VRS D;  1A8L A;  4N0Z A;  1B8X A;  3MSZ A;  3TOU A;  5IPG A;  1TI1 A;  4HZ4 A;  2JAC A;  2LJA A;  3F4R A;  3HCZ A;  3CYN A;  1PX7 A;  1OKT A;  2ZNM A;  2HNL A;  1R5A A;  4HUA A;  5B6N A;  4NWY A;  2KUC A;  4TN8 A;  2B1L A;  5JCU A;  2TRX A;  3Q18 A;  5J41 A;  2LS5 A;  2B5Y A;  3W8J A;  2VIM A;  5ECR B;  2E2G A;  1G0T A;  1W4V A;  5DQY A;  1JLV A;  3FHK A;  1OYJ A;  2IFQ A;  4G19 A;  5D9T A;  2PVO C;  2OAC A;  1TTZ A;  4MDC A;  2CQ9 A;  3ERW A;  4ML6 A;  1K0B A;  1F9M A;  4TXO B;  1GSE A;  4HQS A;  2HT9 A;  3L9V A;  1G6Y A;  2HLS A;  3F4T A;  2IMK A;  3GMF A;  1GP1 A;  2V2G A;  3LGC A;  5IMD A;  3ZIJ A;  2LJK A;  2FA8 A;  4DSS A;  2E0Q A;  2D2Z A;  3CTG A;  1ERU A;  4BWS A;  5DVB A;  3IK7 A;  1G7E A;  1K0C A;  2MBS A;  2C3N A;  3LQ7 A;  4PGT A;  1KNG A;  5DQS A;  2YP6 A;  4PUA A;  2BTO T;  2E2M A;  1KTE A;  2LRC A;  5FT3 A;  4AGS A;  1M7T A;  4IVF A;  3TKS C;  13GS A;  3GRX A;  2V32 A;  2O7K A;  2B5X A;  3MNG A;  1M9B A;  3NIV A;  1UN2 A;  3WGX A;  5CNW A;  2AAW A;  3A3T A;  5DAL A;  4TR1 B;  4V2L A;  3WYW A;  4BL7 A;  14GS A;  1WWJ A;  2GT5 A;  1VF1 A;  2V1M A;  1EP8 A;  1XWG A;  5KN2 A;  4I2U A;  1O8W A;  2ON5 A;  5JWR B;  5B8A A;  3FKF A;  4WEY A;  4Q5Q A;  4LMV A;  4POM A;  2HRF A;  3TJJ A;  3F63 A;  4GF0 A;  1ERW A;  2ON7 A;  1UVZ A;  3GUR A;  1VF4 A;  1WJK A;  3CTF A;  2C0G A;  1EOG A;  3M9K A;  5GST A;  2L5O A;  5DJL A;  3RPN A;  5F07 A;  1ML6 A;  3VPT A;  3UEM A;  1AW9 A;  19GS A;  2H76 A;  5DCG A;  3VPQ A;  4TR0 A;  3GA4 A;  2VLU A;  4F0C A;  4QL7 A;  3UAR A;  3ZIV A;  4ECB A;  5IMA A;  5C00 A;  2VAF A;  1PGT A;  2AV4 A;  3IPZ A;  2TIR A;  1YKC A;  1TK8 B;  3DRN A;  3D6I A;  3DXB A;  1RK4 A;  1CQH A;  3U6V A;  3LJR A;  2DJK A;  2IFQ B;  2M72 A;  5H5S A;  2DIZ A;  4KA0 A;  1OKD A;  2K9F A;  3FEU A;  3D0Z A;  2FWG A;  1ZOF A;  2VOC A;  3FR6 A;  1DBY A;  2AJQ B;  3DD3 A;  3L9U A;  2RLI A;  4F2I A;  4IP6 A;  4HS1 A;  1VF2 A;  4MPG A;  2B3S A;  5IOX A;  1QFN A;  5DCH A;  1E6B A;  1I5G A;  4X0X A;  3G7Y A;  4HQZ A;  4BVX A;  2HZE A;  3TKS A;  5HR1 A;  2X99 A;  2CVK A;  1K3O A;  3HZ4 A;  4JU5 A;  3BCK A;  2E7P A;  4XS4 A;  2HYX A;  1XWA A;  4YAP A;  2X8H A;  4IW9 A;  2IJY A;  1UA5 A;  3DVX A;  1AAZ A;  2WS2 A;  5EY6 A;  4J57 E;  5ECL B;  3US3 A;  1AQX A;  2G2Q A;  2LTK A;  1BQ7 A;  2NBS A;  5KN0 A;  5L71 A;  3CRT A;  1G6W A;  4IJI A;  1M9A A;  2GS3 A;  2PPT A;  1AC1 A;  5ECK B;  3GX0 A;  2REM A;  4IBP A;  5D73 A;  2CVD A;  4F82 A;  4XHM A;  3GL5 A;  5GSS A;  1BYE A;  2LRN A;  3CSI A;  1EV9 A;  3TGZ A;  3I9V 2;  2GSR A;  1Z6M A;  4BPY A;  5DBQ A;  3RBT A;  3ZVJ A;  1GSD A;  3RHB A;  3ZTL A;  3KP9 A;  2VCX A;  2K8V A;  4Q5N A;  2N5A A;  3LSZ A;  4QQ7 A;  1FO5 A;  5DAK A;  4V1A g;  5G1L A;  3GYK A;  1MD3 A;  2HSY A;  2VLV A;  5CRW A;  2KP2 A;  2LEG A;  3IOS A;  3HJO A;  6GST A;  5LD0 A;  3GV1 A;  1A2J A;  3TKQ A;  1FG4 A;  5HR0 A;  10GS A;  2FLS A;  4F0B A;  3GKM A;  1GTA A;  2H1G A;  1B9X C;  3APO A;  2RM5 A;  5ECS A;  1BJX A;  4K8M A;  4O92 A;  4OCF A;  3ZML A;  4D73 A;  1HYU A;  4PQ1 A;  3FZ9 A;  3K8N A;  5CP1 A;  2VL2 A;  4PUF C;  2J23 A;  1SJ6 A;  4L0W A;  4EVM A;  1V40 A;  5HR3 A;  1TRW A;  3TKR A;  4FYU A;  3F6F A;  4WF5 A;  4N0V A;  3G7J A;  4NHZ A;  3KH9 A;  2ZUP A;  3EWL A;  4MK3 A;  4KE3 A;  1OC9 A;  1N8J A;  3H4K A;  3IBH A;  4L5O A;  4NHW A;  2AHE A;  2F9S A;  2GQK A;  3A5W A;  3HHV A;  4OO4 A;  5D96 A;  2V6K A;  1VGL A;  1YEP A;  5A4W A;  3L0H A;  5JWQ B;  3F0I A;  3H8Q A;  3Q6O A;  3O6T A;  4XS4 B;  2VL9 A;  1T1V A;  4WKW A;  3HVS A;  1FW1 A;  2JU5 A;  5CRG A;  3C73 A;  1TKD B;  22GS A;  2HE3 A;  2EIO A;  3TUE A;  2YV7 A;  1SU9 A;  2LUS A;  2AB6 A;  1S3A A;  1JZW A;  1M2D A;  1EWX A;  2H1A A;  1A0R P;  3PIN A;  4IHU A;  2RUF A;  4PXO A;  3P2A A;  3IE3 A;  3UMA A;  4G10 A;  1M2B A;  2GGT A;  3QMX A;  2JAD A;  1EGR A;  4EE0 A;  1GTI A;  3KMN A;  4IQA A;  1T4Y A;  2X8C A;  4I5Q A;  3LXZ A;  2DJJ A;  2YJH A;  2JSY A;  4ID0 A;  1A24 A;  5HR2 A;  2MMZ A;  2HZF A;  4MJE A;  2MMN A;  1RQM A;  3F9U A;  4IJ3 A;  4HU9 A;  11GS A;  2WDU A;  4KDX A;  1S3C A;  4WF4 A;  2WUL A;  3IK9 A;  4G2E A;  1T7P B;  1JHB A;  1DE2 A;  1R4W A;  1JLW A;  4OMV A;  1LU4 A;  3GUS A;  3O3T A;  2BJX A;  3C7M A;  1Z5Y E;  2DSA A;  1GUM A;  1XWC A;  4WXT A;  4EDZ A;  3QR6 A;  2P31 A;  3M3M A;  4G9H A;  2IME A;  5J3R A;  4MZW A;  3BCI A;  3HDC A;  3DKS A;  2CZ2 A;  3GSS A;  5IOW A;  4OO5 A;  4MJB A;  3FR3 A;  3EC3 A;  3VI7 A;  3KMO A;  4OFN A;  2LV3 A;  2C4J A;  4HU7 A;  3GL3 A;  1K3L A;  4D73 B;  1OE7 A;  1KEB A;  4TKY A;  1NSW A;  4TW5 A;  2DLX A;  5HQP A;  1FB6 A;  2C8U A;  2VLT A;  2H01 A;  2PU9 C;  1GTB A;  2OAD A;  4IEL A;  4GRF A;  3CXG A;  2LST A;  5D9X A;  4BA7 A;  4BVY A;  2GDR A;  3KXO A;  4YH2 A;  5CO3 A;  2HXK A;  3M8N A;  4YQU A;  2XBI A;  5AIX A;  1QMV A;  3VWW A;  1S3D A;  3UVT A;  2H70 A;  2NTO A;  1E2Y A;  2GZY A;  4K6X A;  1JZO A;  1XPV A;  2B6M A;  2IN3 A;  2WRT A;  4RQR A;  2OKA A;  3QFB C;  1GUL A;  1QUW A;  2CV4 A;  4KSO A;  3EMP A;  2PMT A;  1KBN A;  1YY7 A;  4N10 A;  4KH7 A;  4Q5F A;  4EXJ A;  2FWH A;  3ZFB A;  1TP9 A;  5H5Q A;  1F6M C;  4GXZ A;  3UJ1 A;  1A2M A;  1J08 A;  1T4Z A;  2JZR A;  1G7O A;  3R2Q A;  1PMT A;  4O32 A;  1XW9 A;  3FY7 A;  2WGR A;  3APS A;  1ZZY A;  3WGD A;  2QSI A;  1FVJ A;  3EVI A;  4GCI A;  3GHA A;  4LMW A;  3F3R A;  4QL9 A;  1V9W A;  4E8E A;  2BMX A;  2L59 A;  3KM6 A;  1FAA A;  4V2M A;  4V1A p;  3GH6 A;  2L4C A;  3LYP A;  4MH3 A;  4PQI A;  4O5R A;  1FHE A;  4HJM A;  1ZYE A;  3U5R E;  4RI7 A;  1WIK A;  2YCD A;  4WET A;  2I1U A;  3QAG A;  3EU4 A;  2YZU A;  1X5E A;  1MEK A;  4JRR A;  4FH8 A;  4IN0 A;  3ZFL A;  5IMF A;  2FNO A;  12GS A;  1GLP A;  6GSX A;  3ME7 A;  1SL2 B;  2PBJ A;  4GQF A;  3GKN A;  3LEF A;  2EC4 A;  2H66 A;  2A2R A;  4TOP A;  2YPM A;  4J2F A;  4OCE A;  3Q74 A;  1SJI A;  4IQ1 A;  2VO4 A;  3WT1 A;  1TXX A;  2MMA A;  5IM9 A;  1XVQ A;  2H74 A;  2RUE A;  4YQM A;  1TK5 B;  4HJ2 A;  4MF7 A;  1ILO A;  4EL1 A;  5CAX A;  5ECI B;  17GS A;  4HZ2 A;  3H93 A;  1U88 A;  1PSQ A;  3TJF A;  2JZT A;  3NOF A;  2I9H A;  2IL3 A;  2FUG 2;  4KDY A;  2X64 A;  2IMF A;  3IA1 A;  4JED A;  2YWI A;  5F0G A;  2C1Y A;  1X9W B;  3TB2 A;  2GSS A;  4ZIJ A;  3DML A;  2OJL A;  5IPH A;  2YAN A;  4Q5R A;  4AJ7 A;  1USB A;  3P8W A;  5B7C A;  2PUK C;  3DYR A;  3A2W A;  1SJZ A;  1MDJ A;  4F9Z A;  2H30 A;  1BG5 A;  2YWO A;  3GFK A;  4FIW A;  3L9S A;  3A2X A;  1NM3 A;  4F03 A;  2F8F A;  4TXV A;  1HNC A;  1XFL A;  5KN1 A;  1MTC A;  5CRD A;  3C1S A;  3RPP A;  1ZYQ B;  16GS A;  2TRC P;  4I8B A;  5DJM A;  3DWV A;  3ERF A;  5G2Z A;  4DSS B;  2DJ3 A;  1QXH A;  4ML1 A;  3LFL A;  3V1W A;  1PA3 A;  3VUR A;  2GLR A;  1GL8 A;  4I97 A;  4JBB A;  2DIY A;  4MCU A;  2YWM A;  3EMX A;  6GSY A;  3ED3 A;  2C0E A;  4DEJ A;  3WGE A;  2VCT A;  1Q98 A;  4RUV A;  1SKW B;  7GSS A;  2DC5 A;  2B5E A;  2XPE A;  5ID2 A;  2MZC A;  5ABR A;  1DE1 A;  2I81 A;  5DAL B;  1GNE A;  1K0M A;  4BWQ A;  1PD2 1;  4NXI A;  5ECM B;  1U3A A;  4K2D A;  3QAV A;  5HFI A;  2O89 A;  3IHQ A;  2F51 A;  4NMU A;  3S9F A;  5G31 A;  1IYH A;  2K8S A;  4MZC A;  4MH2 A;  3EYT A;  2VM2 A;  4KX4 A;  1EP7 A;  2KLX A;  3LXT A;  6GSS A;  3KH7 A;  2FY6 A;  2DJ1 A;  2VM1 A;  1EEJ A;  4PX1 A;  3MWH A;  3UOM A;  3ZZX A;  1U3I A;  2H71 A;  2J9H A;  1GSS A;  2YZH A;  3IAM 2;  2LQO A;  4GSS A;  4WBJ A;  1HNB A;  4WR4 A;  1GSU A;  1XZO A;  2GSQ A;  1MDK A;  1PX6 A;  3VI5 A;  2YWN A;  1Z7P A;  4ZB9 A;  4H86 A;  6GSV A;  1YJ6 A;  2O85 A;  3UBK A;  4NV2 A;  1B48 A;  3UIW A;  4MJC A;  2PN8 A;  1AXD A;  3L78 A;  1TRS A;  1K3Y A;  2LNT A;  3D4T A;  3L4N A;  4K7I A;  2EIQ A;  4N11 A;  5GAP D;  1TJD A;  4MZB A;  1YEX A;  1TRV A;  4JZQ A;  4ZB8 A;  2QKE A;  3D5J A;  3FZ4 A;  5AIV A;  4DVC A;  1O7U A;  3VFI A;  4TRX A;  5CRE A;  4ZL9 A;  1YF0 A;  3BJ5 A;  3KEB A;  1R26 A;  4KUN A;  1JZD A;  1GNW A;  1A2L A;  3PGT A;  1O8X A;  1J9B A;  1SK2 A;  2NDO A;  4POB A;  2WJU A;  3CSJ A;  3J7Y k;  1W89 A;  4CDO A;  2FGX A;  1BX9 A;  2HZE B;  3KJY A;  3EIN A;  2VCQ A;  4OWY A;  3AY8 A;  2AUV A;  1EGO A;  5EVO A;  2R37 A;  5G1K A;  4I2T A;  2HSH A;  4GTU A;  1J0F A;  1DSB A;  1JZR A;  2GTU A;  2GT6 A;  1M99 A;  2C0D A;  3PH9 A;  1FB0 A;  4K0N A;  3J7Y b;  3HVV A;  5IMC A;  3QFA C;  4KSM A;  4FO5 A;  3I6A A; 
#chains in the Genus database with same CATH topology
 1OVN A;  2YJ7 A;  5F06 A;  3H1N A;  2X4A A;  5KEJ A;  4XRA A;  2L4Q A;  3M0F A;  2OE1 A;  3QD9 A;  5BMU A;  5ECH B;  2B7J A;  2C3T A;  4FYB A;  2DJ0 A;  2VD0 A;  3OR5 A;  5JWO B;  3RAZ A;  4MPF A;  3EE2 A;  1O81 A;  3DEX A;  3M9J A;  3GTU A;  2OE3 A;  1THO A;  2A4V A;  1NHY A;  1SK0 A;  3DVW A;  3ZRE A;  4XIH A;  3CMI A;  3GH9 A;  2CA8 A;  4MJA A;  4X43 A;  2H1B A;  1FVK A;  1HQO A;  3BOA A;  4TR3 A;  1MDI A;  3I69 A;  1ERV A;  2L6D A;  3QCP A;  4LL1 B;  1TK0 B;  1GSY A;  4ISD A;  5DAK B;  3KD0 A;  4IP1 A;  1N2A A;  2VL3 A;  3EUR A;  3E3E A;  3KCM A;  1WRY A;  4PNG A;  4EC0 A;  3KTB A;  5JCG A;  2C80 A;  1O6J A;  1M0U A;  3HA9 A;  1VF3 A;  3SWL A;  2H75 A;  2WZ9 A;  2YN1 A;  4HI7 A;  4ACS A;  3N9J A;  4LL4 B;  1HNA A;  4TR1 A;  3GKX A;  3HKR A;  3ZRD A;  4K0G A;  2ZCT A;  3ERG A;  2H72 A;  3VWV A;  1PN0 A;  1X5C A;  1XOA A;  3LWA A;  1MD4 A;  2QA1 A;  4TR4 A;  1XVW A;  2C0F A;  3NZN A;  3P90 A;  3RHC A;  2O8V B;  3KTL A;  3PR8 A;  4FYC A;  3Q19 A;  3LG6 A;  2CVB A;  2WFC A;  2KHP A;  4P3Y B;  1EV4 A;  4EUY A;  1T3B A;  2L57 A;  2R0P A;  4ICY A;  3EU3 A;  1U6T A;  1WP0 A;  4ECI A;  4KF9 A;  3HVX A;  5ENU A;  1OC9 B;  1SEN A;  3IDV A;  4KDU A;  4IS0 A;  4KB3 A;  4N30 A;  2VCZ A;  3CQF A;  3EPT A;  2IWT A;  2WB9 A;  4GQC A;  1ZMA A;  4GWR A;  2H8L A;  1SKR B;  1GTU A;  1AQW A;  2H73 A;  2LNS A;  4EF0 A;  1K0A A;  1T00 A;  5LCZ A;  2L6C A;  4J56 E;  1Y6E A;  4XRD A;  3QOU A;  1X9M B;  4L8E A;  3GX8 A;  3TRP A;  1XWB A;  2QC7 A;  2OBI A;  2H0H A;  2OE0 A;  2XPD A;  4LLR A;  1OAZ A;  2K6V A;  5KN3 A;  3SBC A;  2CAI A;  4HSC X;  5IMV A;  2JZS A;  5IMZ A;  1OE8 A;  1V57 A;  5J4U A;  3ZVJ D;  4ZIL A;  1ST9 A;  4K7O A;  4I6X A;  1WPI A;  2M46 A;  1PN9 A;  4O7H A;  1T8E B;  3IV4 A;  3GTU B;  5A4U A;  3HVN A;  4GSN A;  1SL0 B;  3KIJ A;  3VLN A;  2LRT A;  4LA1 A;  2P5Q A;  1PL2 A;  2GST A;  5J5N A;  1GH2 A;  4K9Z A;  3A5I A;  4MF5 A;  2ALB A;  3O76 A;  1QQ2 A;  1WOU A;  5EPF A;  1XG8 A;  5HFG A;  3TCO A;  9GSS A;  5ELG A;  3TRQ A;  5H5R A;  5B8B A;  1XBS A;  2CX3 A;  2VD1 A;  3FW2 A;  2EIR A;  1K0D A;  4L0U A;  1WE0 A;  2FD3 A;  3FZA A;  1S3R A;  3H79 A;  4GLT A;  4CY6 A;  2FCH A;  3QPM A;  1B4Q A;  3WT2 A;  2OBK A;  4KCE A;  2A2S A;  3MDK A;  1NW2 A;  1Z6N A;  3WD6 A;  1EOH A;  3C8E A;  1LJR A;  2X8G A;  4K7N A;  2HI7 A;  1NHO A;  4Z2U A;  2V6O A;  2L5L A;  5AGY A;  4GST A;  1H75 A;  1SK1 A;  1PQN A;  1TU7 A;  3N5O A;  2VCW A;  18GS A;  2R2J A;  4NV5 A;  3TOT A;  3LOR A;  2LJR A;  2DML A;  2LKU A;  5E59 A;  1YDK A;  2K18 A;  4WBR D;  1ERT A;  1ON4 A;  1X0R A;  4XS1 A;  4KGI A;  4ECC A;  1K0O A;  4KW6 A;  2MYG A;  4XS6 A;  5G30 A;  1V98 A;  5HFK A;  2R3X A;  5FWG A;  2XHF A;  3UAP A;  3R3E A;  4OFM A;  4ZBA A;  2X49 A;  5CYY A;  1X5D A;  3UL3 A;  2RM6 A;  2YNX A;  3F3Q A;  2ES7 A;  4EIQ A;  2M80 A;  3IRA A;  3P7X A;  5LNK e;  3FK8 A;  1Z3E A;  1PRX A;  1XOB A;  2R0C A;  1EEM A;  4MF6 A;  2CAQ A;  5IO0 A;  2JL4 A;  4ULX A;  1TW9 A;  3VK9 A;  3TKP A;  5AIS A;  4ZBD A;  1M3I A;  3CSH A;  3ZIT A;  2H0I A;  2FWE A;  2PVQ A;  2PER A;  3UBL A;  4WR5 A;  2PGT A;  3GIX A;  2Z9S A;  1SD9 A;  1TU8 A;  2R4V A;  5D9W A;  20GS A;  1GWC A;  2VL2 C;  2N5F A;  1XCC A;  1ACV A;  5FHI A;  3TDG A;  1YQ1 A;  2A2P A;  4NAX A;  1B9Y C;  1GRX A;  1SL1 B;  4EO3 A;  1PKZ A;  4X1U A;  3F4S A;  2IPA A;  2GZP A;  2VCV A;  3GST A;  3C1R A;  1F3A A;  1ZL9 A;  1O73 A;  2NPB A;  1SD8 A;  3D4M A;  5G5E A;  3UVH A;  2R6K A;  3ISO A;  2H0G A;  1K0N A;  4ILF A;  5GZZ B;  3D21 A;  4O5Q A;  2MBT A;  2YV9 A;  3FYG A;  3GNJ A;  2I3Y A;  3C71 A;  5AN1 A;  4YQV A;  4IGJ A;  1RW1 A;  1XW6 A;  3FRC A;  4DSQ A;  5ELA A;  1GSQ A;  3VWX A;  1Q4J A;  2N5B A;  2KOK A;  1X9S B;  2FWF A;  4K5S A;  1ZCP A;  1XWK A;  1WMJ A;  4Z7X A;  2QGV A;  1EZK A;  2GZZ A;  4MP4 A;  3VWU A;  5GAN D;  2GQL A;  1TOF A;  3I43 A;  4HOJ A;  1F2E A;  3IC4 A;  3TJG A;  2H19 A;  1LBK A;  3QAW A;  3A2V A;  4MLY A;  1ABA A;  5CRH A;  4AF2 A;  3G9B A;  3TKS E;  2H1D A;  2OA7 A;  6GSU A;  3MIX A;  2DBC A;  5F05 A;  3F6D A;  2R5G A;  3TJK A;  3TRX A;  4JR4 A;  3KGK A;  4EKZ A;  2V41 A;  5J9B A;  3ZMK A;  2H6Y A;  2XBQ A;  3HYP A;  4ZBB A;  2AYT A;  3FR9 A;  3W8S A;  3IC8 A;  1IYI A;  1R5P A;  4HEA 2;  3GKK A;  2H6X A;  3F8U A;  2DJ2 A;  3BD2 A;  5G5F A;  2GQM A;  3E0U A;  3ZYW A;  2CZ3 A;  1SYX A;  2C3Q A;  3CBU A;  3PPU A;  4ZL7 A;  5J9C A;  1AUC A;  4PNF A;  1URM A;  4AJ6 A;  3CRU A;  5A5K A;  2MMO A;  1YZX A;  1BED A;  3IAS 2;  4DSR A;  1V58 A;  4MMM A;  1GUH A;  1PKW A;  2F8A A;  5IQY A;  1O85 A;  1TI3 A;  4XTS A;  2JSZ A;  5ECQ B;  4ZB6 A;  4OD7 A;  2CX4 A;  2NVL A;  3ZL5 A;  3GN3 A;  3HZ8 A;  4MA9 A;  2HRA A;  2O87 A;  2RII A;  1QK8 A;  4RI6 A;  4KAE A;  3MYD A;  2FA4 A;  2H6Z A;  3E9J B;  1Z9H A;  5C04 A;  2GVP A;  4ECJ A;  3M1G A;  4HDE A;  5ECN B;  5E4W A;  2B7K A;  3D22 A;  3IXR A;  5IO2 A;  1Y25 A;  5COH A;  2PWJ A;  1HD2 A;  3TJB A;  1TDI A;  3BBY A;  4RQX A;  2IMI A;  1R7H A;  4OFT A;  8GSS A;  2IIY A;  1F37 A;  5ID2 B;  3HY2 A;  3MAK A;  4E8H A;  5D8I A;  1JFU A;  4MAB A;  5ECP B;  5A4V A;  4POK A;  6GSW A;  2F3M A;  4Z2T A;  4CHS A;  4ZL8 A;  2G0F A;  2VUP A;  1F3B A;  3JCM L;  1YF1 A;  4TXO A;  1I9D A;  5D9V A;  2YOI A;  4EDY A;  2KP1 A;  3KZQ A;  4AJ8 A;  1CQG A;  3HXS A;  1A0F A;  3ZLP A;  5EL8 A;  3LYK A;  3W6G A;  1YKA A;  4V2N A;  1B4P A;  1A23 A;  5ECO B;  1OC3 A;  4PQH A;  5B6M A;  1AQV A;  4TVE A;  1GUK A;  2FHE A;  4JR6 A;  4XCS A;  2IMD A;  5INY A;  2XC2 A;  1SYR A;  4O5U A;  5IIZ A;  3FZ5 A;  5F8B A;  1GLQ A;  3RDW A;  2CT6 A;  2P0G A;  3KP8 A;  1XIY A;  1ZGN A;  2WCI A;  4K1F A;  1BAY A;  4YAV A;  1V2A A;  3QDN A;  4L5L A;  4CW9 A;  4PUR A;  1A8Y A;  1OC8 A;  5JCW A;  4ZXG A;  4KND A;  1UC7 A;  4KCA A;  2B1K A;  1SKS B;  2HFD A;  3DGQ A;  1GSF A;  1QGV A;  3HJM A;  1H4O A;  1PL1 A;  4IKH A;  4POL A;  1DUG A;  5D93 A;  1XW5 A;  1U87 A;  3APQ A;  3G7I A;  4JE1 A;  3ME8 A;  2I4A A;  3HJP A;  2DMM A;  2LQQ A;  3DIE A;  2DKH A;  2HRN A;  3HD5 A;  1THX A;  2P5R A;  3IR4 A;  1TRU A;  1XXU A;  1FOV A;  5DDL A;  1Z7R A;  1AIU A;  1C72 A;  1M2A A;  4NPB A;  1VRS D;  1A8L A;  4N0Z A;  1B8X A;  3MSZ A;  3TOU A;  5IPG A;  4PTS A;  1TI1 A;  4HZ4 A;  2JAC A;  2LJA A;  3F4R A;  3HCZ A;  3CYN A;  1PX7 A;  1OKT A;  2ZNM A;  2HNL A;  1R5A A;  4HUA A;  5B6N A;  4NWY A;  2KUC A;  4TN8 A;  2B1L A;  5JCU A;  2TRX A;  3Q18 A;  5J41 A;  2LS5 A;  2B5Y A;  3W8J A;  2VIM A;  5ECR B;  2E2G A;  1G0T A;  1W4V A;  5DQY A;  1JLV A;  3FHK A;  1OYJ A;  2IFQ A;  4G19 A;  5D9T A;  2PVO C;  2OAC A;  1TTZ A;  4MDC A;  2CQ9 A;  3ERW A;  4ML6 A;  1K0B A;  1F9M A;  4TXO B;  1GSE A;  4HQS A;  2HT9 A;  3L9V A;  1G6Y A;  2HLS A;  3F4T A;  2IMK A;  4G0K A;  3GMF A;  1GP1 A;  2V2G A;  3LGC A;  5IMD A;  3ZIJ A;  2LJK A;  2FA8 A;  4DSS A;  2E0Q A;  2D2Z A;  3CTG A;  1ERU A;  4BWS A;  5DVB A;  3IK7 A;  1G7E A;  1K0C A;  2MBS A;  2C3N A;  3LQ7 A;  4PGT A;  1KNG A;  5DQS A;  2YP6 A;  4PUA A;  3FMW A;  2BTO T;  2E2M A;  1KTE A;  2LRC A;  5FT3 A;  4AGS A;  1M7T A;  4IVF A;  3TKS C;  13GS A;  3GRX A;  2V32 A;  4G0L A;  2O7K A;  2B5X A;  3MNG A;  1M9B A;  3NIV A;  1UN2 A;  3WGX A;  5CNW A;  2AAW A;  3A3T A;  5DAL A;  4TR1 B;  4V2L A;  4CY8 A;  3WYW A;  4BL7 A;  14GS A;  4BIK A;  1WWJ A;  2GT5 A;  1VF1 A;  2V1M A;  1EP8 A;  3IHG A;  1XWG A;  5KN2 A;  4I2U A;  1O8W A;  2ON5 A;  5JWR B;  5B8A A;  3FKF A;  4WEY A;  4Q5Q A;  4LMV A;  4POM A;  2HRF A;  3TJJ A;  3F63 A;  4GF0 A;  1ERW A;  2ON7 A;  1UVZ A;  3GUR A;  1VF4 A;  1WJK A;  3CTF A;  2C0G A;  1EOG A;  3M9K A;  5GST A;  2L5O A;  5DJL A;  3RPN A;  5F07 A;  1ML6 A;  3VPT A;  3UEM A;  1AW9 A;  4YKG A;  19GS A;  2H76 A;  5DCG A;  3VPQ A;  4TR0 A;  3GA4 A;  2VLU A;  4F0C A;  4QL7 A;  3UAR A;  1ZYN A;  3ZIV A;  4ECB A;  5IMA A;  5C00 A;  2VAF A;  1PGT A;  2AV4 A;  3IPZ A;  2TIR A;  1YKC A;  1TK8 B;  3DRN A;  3D6I A;  3DXB A;  1RK4 A;  1CQH A;  3U6V A;  3LJR A;  2DJK A;  2IFQ B;  2M72 A;  5H5S A;  2DIZ A;  2HSM A;  4KA0 A;  1OKD A;  2K9F A;  2UZ8 A;  3FEU A;  3D0Z A;  2FWG A;  1ZOF A;  2VOC A;  3FR6 A;  1DBY A;  5BRT A;  2AJQ B;  3DD3 A;  3L9U A;  2RLI A;  4F2I A;  4IP6 A;  4HS1 A;  1FOH A;  1VF2 A;  4MPG A;  2B3S A;  5IOX A;  1QFN A;  5DCH A;  1E6B A;  1I5G A;  4X0X A;  3G7Y A;  4HQZ A;  4BVX A;  2HZE A;  3TKS A;  5HR1 A;  2X99 A;  4FQU A;  2CVK A;  1K3O A;  3HZ4 A;  4JU5 A;  3BCK A;  2E7P A;  4XS4 A;  2HYX A;  4K5R A;  1XWA A;  4YAP A;  2X8H A;  4IW9 A;  2IJY A;  1UA5 A;  3DVX A;  1AAZ A;  2WS2 A;  5EY6 A;  5KOX A;  4J57 E;  5ECL B;  3US3 A;  1AQX A;  2G2Q A;  2LTK A;  1BQ7 A;  2NBS A;  5KN0 A;  5L71 A;  3CRT A;  1G6W A;  4IJI A;  1M9A A;  2GS3 A;  2PPT A;  1AC1 A;  5ECK B;  3GX0 A;  2REM A;  4IBP A;  5D73 A;  2CVD A;  4F82 A;  4XHM A;  1M3J A;  3GL5 A;  5GSS A;  1BYE A;  2LRN A;  2QA2 A;  3CSI A;  1EV9 A;  3TGZ A;  3I9V 2;  1PFO A;  2GSR A;  1Z6M A;  4BPY A;  5KOW A;  5DBQ A;  3RBT A;  3ZVJ A;  1GSD A;  3RHB A;  3ZTL A;  3KP9 A;  2VCX A;  2K8V A;  4Q5N A;  4USS A;  2N5A A;  3LSZ A;  4QQ7 A;  1FO5 A;  5DAK A;  4V1A g;  5G1L A;  3GYK A;  1MD3 A;  2HSY A;  2VLV A;  5CRW A;  2KP2 A;  2LEG A;  3IOS A;  3HJO A;  6GST A;  5LD0 A;  4YKF A;  3GV1 A;  1A2J A;  3TKQ A;  1FG4 A;  5HR0 A;  10GS A;  2FLS A;  4F0B A;  3GKM A;  1GTA A;  2H1G A;  1B9X C;  3APO A;  2RM5 A;  5ECS A;  1BJX A;  4K8M A;  4O92 A;  4OCF A;  3ZML A;  1ZYP A;  4D73 A;  1HYU A;  2R0G A;  3FZ9 A;  4PQ1 A;  3K8N A;  5CP1 A;  2VL2 A;  4PUF C;  2J23 A;  1SJ6 A;  4L0W A;  4EVM A;  1V40 A;  5HR3 A;  1TRW A;  3TKR A;  4FYU A;  3F6F A;  4WF5 A;  4N0V A;  3G7J A;  4NHZ A;  3KH9 A;  2ZUP A;  3EWL A;  4MK3 A;  4KE3 A;  1OC9 A;  1N8J A;  3H4K A;  4BVX B;  3IBH A;  4L5O A;  4NHW A;  2AHE A;  2F9S A;  2GQK A;  3A5W A;  3HHV A;  4OO4 A;  5D96 A;  2V6K A;  1VGL A;  1YEP A;  4X4J A;  5A4W A;  3L0H A;  5JWQ B;  3F0I A;  3H8Q A;  3Q6O A;  3O6T A;  4XS4 B;  2VL9 A;  1T1V A;  4WKW A;  3HVS A;  1FW1 A;  2JU5 A;  5CRG A;  3C73 A;  1TKD B;  22GS A;  2HE3 A;  2EIO A;  3TUE A;  2YV7 A;  1SU9 A;  2LUS A;  2AB6 A;  1S3A A;  1JZW A;  1M2D A;  1EWX A;  2H1A A;  1A0R P;  3PIN A;  4IHU A;  2RUF A;  4PXO A;  3P2A A;  3IE3 A;  3UMA A;  4G10 A;  1M2B A;  2GGT A;  3QMX A;  2JAD A;  1EGR A;  4EE0 A;  1GTI A;  3KMN A;  4IQA A;  1T4Y A;  2X8C A;  4I5Q A;  3LXZ A;  4K2X A;  2DJJ A;  2YJH A;  2JSY A;  4ID0 A;  1A24 A;  5HR2 A;  2MMZ A;  2HZF A;  4MJE A;  2MMN A;  1RQM A;  3F9U A;  4IJ3 A;  4HU9 A;  11GS A;  2WDU A;  4KDX A;  1S3C A;  4WF4 A;  2WUL A;  3IK9 A;  4G2E A;  1T7P B;  1JHB A;  1DE2 A;  1R4W A;  1JLW A;  4OMV A;  1LU4 A;  3GUS A;  3O3T A;  2BJX A;  3C7M A;  1Z5Y E;  2DSA A;  1GUM A;  1XWC A;  4WXT A;  4EDZ A;  3QR6 A;  2P31 A;  3M3M A;  4G9H A;  2IME A;  5J3R A;  4MZW A;  3BCI A;  3HDC A;  3DKS A;  2CZ2 A;  3GSS A;  5IOW A;  4OO5 A;  4MJB A;  3FR3 A;  3EC3 A;  3VI7 A;  3KMO A;  4OFN A;  2LV3 A;  2C4J A;  4HU7 A;  3GL3 A;  1K3L A;  4D73 B;  1OE7 A;  1KEB A;  4TKY A;  1NSW A;  4TW5 A;  2DLX A;  5HQP A;  1FB6 A;  2C8U A;  2VLT A;  2H01 A;  2PU9 C;  1GTB A;  2OAD A;  2A4H A;  4IEL A;  4GRF A;  3CXG A;  2LST A;  5D9X A;  4BA7 A;  4BVY A;  2GDR A;  3KXO A;  4YH2 A;  5CO3 A;  2HXK A;  3M8N A;  4YQU A;  2XBI A;  5AIX A;  1QMV A;  3VWW A;  1S3D A;  3UVT A;  2H70 A;  2NTO A;  1E2Y A;  2GZY A;  4K6X A;  1JZO A;  1XPV A;  2B6M A;  2IN3 A;  2WRT A;  4RQR A;  2OKA A;  3QFB C;  1GUL A;  1QUW A;  2CV4 A;  4KSO A;  3EMP A;  2PMT A;  1KBN A;  3LW9 A;  1YY7 A;  4N10 A;  4KH7 A;  4Q5F A;  4EXJ A;  2FWH A;  3ZFB A;  1TP9 A;  5H5Q A;  1F6M C;  4GXZ A;  3UJ1 A;  1A2M A;  1J08 A;  1T4Z A;  2JZR A;  2DKI A;  1G7O A;  3R2Q A;  1PMT A;  4O32 A;  4A5P A;  1XW9 A;  3FY7 A;  2WGR A;  3APS A;  1ZZY A;  3WGD A;  2QSI A;  1FVJ A;  3EVI A;  4GCI A;  3GHA A;  4LMW A;  3F3R A;  4QL9 A;  1V9W A;  4E8E A;  2BMX A;  2L59 A;  3KM6 A;  1FAA A;  4V2M A;  4V1A p;  3GH6 A;  2L4C A;  3LYP A;  4Z2R A;  4MH3 A;  4PQI A;  4O5R A;  1FHE A;  4HJM A;  1ZYE A;  3U5R E;  4RI7 A;  1WIK A;  2YCD A;  4WET A;  2I1U A;  3QAG A;  3EU4 A;  2YZU A;  1X5E A;  1MEK A;  4JRR A;  4FH8 A;  4IN0 A;  3ZFL A;  5IMF A;  2FNO A;  12GS A;  1GLP A;  6GSX A;  3ME7 A;  1SL2 B;  2PBJ A;  4GQF A;  3GKN A;  3LEF A;  2EC4 A;  2H66 A;  2A2R A;  4TOP A;  2YPM A;  4J2F A;  4OCE A;  3Q74 A;  1SJI A;  4IQ1 A;  2VO4 A;  3WT1 A;  1TXX A;  2MMA A;  5IM9 A;  1XVQ A;  2H74 A;  2RUE A;  4YQM A;  1TK5 B;  4HJ2 A;  4EIP A;  4MF7 A;  1ILO A;  4EL1 A;  5CAX A;  5ECI B;  17GS A;  4HZ2 A;  3H93 A;  4BVY B;  1U88 A;  1PSQ A;  3TJF A;  2JZT A;  3NOF A;  2I9H A;  2IL3 A;  2FUG 2;  4KDY A;  2X64 A;  2IMF A;  3IA1 A;  4JED A;  2YWI A;  5F0G A;  2C1Y A;  1X9W B;  3TB2 A;  2GSS A;  4ZIJ A;  3DML A;  2OJL A;  5IPH A;  2YAN A;  4Q5R A;  4AJ7 A;  1USB A;  3P8W A;  5B7C A;  2PUK C;  3DYR A;  3A2W A;  1SJZ A;  1MDJ A;  4F9Z A;  2H30 A;  1BG5 A;  2YWO A;  3GFK A;  4FIW A;  3L9S A;  3A2X A;  1NM3 A;  4F03 A;  2F8F A;  4TXV A;  1HNC A;  1XFL A;  5KN1 A;  1MTC A;  5CRD A;  3C1S A;  3RPP A;  1ZYQ B;  16GS A;  2TRC P;  4I8B A;  5DJM A;  3DWV A;  3ERF A;  5G2Z A;  4DSS B;  2DJ3 A;  1QXH A;  4ML1 A;  3LFL A;  3V1W A;  1PA3 A;  3VUR A;  2GLR A;  1GL8 A;  4I97 A;  4JBB A;  2DIY A;  4MCU A;  2YWM A;  3EMX A;  6GSY A;  3ED3 A;  2C0E A;  4DEJ A;  3WGE A;  2VCT A;  1Q98 A;  4RUV A;  1SKW B;  7GSS A;  2DC5 A;  2B5E A;  2XPE A;  5ID2 A;  2MZC A;  5ABR A;  1DE1 A;  2I81 A;  5DAL B;  1GNE A;  1K0M A;  4BWQ A;  1PD2 1;  4NXI A;  5ECM B;  1U3A A;  4K2D A;  3QAV A;  5HFI A;  4BL7 B;  2O89 A;  3IHQ A;  2F51 A;  4NMU A;  3S9F A;  5G31 A;  1IYH A;  2K8S A;  4MZC A;  4MH2 A;  3EYT A;  2VM2 A;  4KX4 A;  1EP7 A;  2KLX A;  3LXT A;  6GSS A;  3KH7 A;  2FY6 A;  2DJ1 A;  2VM1 A;  1EEJ A;  4PX1 A;  3MWH A;  3UOM A;  3ZZX A;  1U3I A;  2H71 A;  2J9H A;  1GSS A;  2YZH A;  3IAM 2;  2LQO A;  4GSS A;  4WBJ A;  1HNB A;  4WR4 A;  1GSU A;  1XZO A;  2GSQ A;  1MDK A;  1PX6 A;  3VI5 A;  2YWN A;  1Z7P A;  4ZB9 A;  4H86 A;  6GSV A;  1YJ6 A;  2O85 A;  3UBK A;  4NV2 A;  1B48 A;  3UIW A;  4MJC A;  2PN8 A;  1AXD A;  3L78 A;  1TRS A;  1K3Y A;  2LNT A;  3D4T A;  3L4N A;  4K7I A;  2EIQ A;  4N11 A;  5GAP D;  1TJD A;  4MZB A;  1YEX A;  1TRV A;  4JZQ A;  4ZB8 A;  2QKE A;  3D5J A;  3FZ4 A;  5AIV A;  4DVC A;  1O7U A;  3VFI A;  4TRX A;  5CRE A;  4ZL9 A;  1YF0 A;  3BJ5 A;  3KEB A;  1R26 A;  4KUN A;  1JZD A;  1GNW A;  1A2L A;  3PGT A;  1O8X A;  1J9B A;  1SK2 A;  2NDO A;  2HRK A;  4POB A;  2WJU A;  3CSJ A;  3J7Y k;  1W89 A;  4CDO A;  4MNN A;  2FGX A;  1BX9 A;  2HZE B;  3KJY A;  3EIN A;  2VCQ A;  4OWY A;  3AY8 A;  2AUV A;  1EGO A;  5EVO A;  2R37 A;  5G1K A;  4I2T A;  2HSH A;  4GTU A;  1J0F A;  1DSB A;  1JZR A;  2GTU A;  4G0I A;  2GT6 A;  1M99 A;  2C0D A;  3PH9 A;  1FB0 A;  4K0N A;  3J7Y b;  3HVV A;  5IMC A;  3QFA C;  4KSM A;  4FO5 A;  3I6A A; 
#chains in the Genus database with same CATH homology
 1OVN A;  2YJ7 A;  5F06 A;  3H1N A;  2X4A A;  5KEJ A;  4XRA A;  2L4Q A;  3M0F A;  2OE1 A;  3QD9 A;  5BMU A;  5ECH B;  2B7J A;  2C3T A;  4FYB A;  2DJ0 A;  2VD0 A;  3OR5 A;  5JWO B;  3RAZ A;  4MPF A;  3EE2 A;  1O81 A;  3DEX A;  3M9J A;  3GTU A;  2OE3 A;  1THO A;  2A4V A;  1NHY A;  1SK0 A;  3DVW A;  3ZRE A;  4XIH A;  3CMI A;  3GH9 A;  2CA8 A;  4MJA A;  4X43 A;  2H1B A;  1FVK A;  1HQO A;  3BOA A;  4TR3 A;  1MDI A;  3I69 A;  1ERV A;  2L6D A;  3QCP A;  4LL1 B;  1TK0 B;  1GSY A;  4ISD A;  5DAK B;  3KD0 A;  4IP1 A;  1N2A A;  2VL3 A;  3EUR A;  3E3E A;  3KCM A;  1WRY A;  4PNG A;  4EC0 A;  3KTB A;  5JCG A;  2C80 A;  1O6J A;  1M0U A;  3HA9 A;  1VF3 A;  3SWL A;  2H75 A;  2WZ9 A;  2YN1 A;  4HI7 A;  4ACS A;  3N9J A;  4LL4 B;  1HNA A;  4TR1 A;  3GKX A;  3HKR A;  3ZRD A;  4K0G A;  2ZCT A;  3ERG A;  2H72 A;  3VWV A;  1PN0 A;  1X5C A;  1XOA A;  3LWA A;  1MD4 A;  2QA1 A;  4TR4 A;  1XVW A;  2C0F A;  3NZN A;  3P90 A;  3RHC A;  2O8V B;  3KTL A;  3PR8 A;  4FYC A;  3Q19 A;  3LG6 A;  2CVB A;  2WFC A;  2KHP A;  4P3Y B;  1EV4 A;  4EUY A;  1T3B A;  2L57 A;  2R0P A;  4ICY A;  3EU3 A;  1U6T A;  1WP0 A;  4ECI A;  4KF9 A;  3HVX A;  5ENU A;  1OC9 B;  1SEN A;  3IDV A;  4KDU A;  4IS0 A;  4KB3 A;  4N30 A;  2VCZ A;  3EPT A;  2IWT A;  2WB9 A;  4GQC A;  1ZMA A;  4GWR A;  2H8L A;  1SKR B;  1GTU A;  1AQW A;  2H73 A;  2LNS A;  4EF0 A;  1K0A A;  1T00 A;  5LCZ A;  2L6C A;  4J56 E;  1Y6E A;  4XRD A;  3QOU A;  1X9M B;  4L8E A;  3GX8 A;  3TRP A;  1XWB A;  2QC7 A;  2OBI A;  2H0H A;  2OE0 A;  2XPD A;  4LLR A;  1OAZ A;  2K6V A;  5KN3 A;  3SBC A;  2CAI A;  5IMV A;  2JZS A;  5IMZ A;  1OE8 A;  1V57 A;  5J4U A;  3ZVJ D;  4ZIL A;  1ST9 A;  4K7O A;  4I6X A;  1WPI A;  2M46 A;  1PN9 A;  4O7H A;  1T8E B;  3IV4 A;  3GTU B;  5A4U A;  4GSN A;  1SL0 B;  3KIJ A;  3VLN A;  2LRT A;  4LA1 A;  2P5Q A;  1PL2 A;  2GST A;  5J5N A;  1GH2 A;  4K9Z A;  3A5I A;  4MF5 A;  2ALB A;  3O76 A;  1QQ2 A;  1WOU A;  5EPF A;  5HFG A;  3TCO A;  9GSS A;  5ELG A;  3TRQ A;  5H5R A;  5B8B A;  1XBS A;  2CX3 A;  2VD1 A;  3FW2 A;  2EIR A;  1K0D A;  4L0U A;  1WE0 A;  2FD3 A;  3FZA A;  3H79 A;  4GLT A;  4CY6 A;  2FCH A;  3QPM A;  1B4Q A;  3WT2 A;  2OBK A;  4KCE A;  2A2S A;  3MDK A;  1NW2 A;  1Z6N A;  3WD6 A;  1EOH A;  3C8E A;  1LJR A;  2X8G A;  4K7N A;  2HI7 A;  1NHO A;  4Z2U A;  2V6O A;  2L5L A;  5AGY A;  4GST A;  1H75 A;  1SK1 A;  1PQN A;  1TU7 A;  3N5O A;  2VCW A;  18GS A;  2R2J A;  4NV5 A;  3TOT A;  3LOR A;  2LJR A;  2DML A;  2LKU A;  5E59 A;  1YDK A;  2K18 A;  4WBR D;  1ERT A;  1ON4 A;  1X0R A;  4XS1 A;  4KGI A;  4ECC A;  1K0O A;  4KW6 A;  2MYG A;  4XS6 A;  5G30 A;  1V98 A;  5HFK A;  2R3X A;  5FWG A;  2XHF A;  3UAP A;  3R3E A;  4OFM A;  4ZBA A;  2X49 A;  5CYY A;  1X5D A;  3UL3 A;  2RM6 A;  2YNX A;  3F3Q A;  2ES7 A;  4EIQ A;  2M80 A;  3IRA A;  3P7X A;  5LNK e;  3FK8 A;  1Z3E A;  1PRX A;  1XOB A;  2R0C A;  1EEM A;  4MF6 A;  2CAQ A;  5IO0 A;  2JL4 A;  4ULX A;  1TW9 A;  3VK9 A;  3TKP A;  5AIS A;  4ZBD A;  3CSH A;  3ZIT A;  2H0I A;  2FWE A;  2PVQ A;  2PER A;  3UBL A;  4WR5 A;  2PGT A;  3GIX A;  2Z9S A;  1SD9 A;  1TU8 A;  2R4V A;  5D9W A;  20GS A;  1GWC A;  2VL2 C;  2N5F A;  1XCC A;  1ACV A;  5FHI A;  3TDG A;  1YQ1 A;  2A2P A;  4NAX A;  1B9Y C;  1GRX A;  1SL1 B;  4EO3 A;  1PKZ A;  4X1U A;  3F4S A;  2IPA A;  2GZP A;  2VCV A;  3GST A;  3C1R A;  1F3A A;  1ZL9 A;  1O73 A;  2NPB A;  1SD8 A;  3D4M A;  5G5E A;  3UVH A;  2R6K A;  3ISO A;  2H0G A;  1K0N A;  4ILF A;  5GZZ B;  3D21 A;  4O5Q A;  2MBT A;  2YV9 A;  3FYG A;  3GNJ A;  2I3Y A;  3C71 A;  5AN1 A;  4YQV A;  4IGJ A;  1RW1 A;  1XW6 A;  3FRC A;  4DSQ A;  5ELA A;  1GSQ A;  3VWX A;  1Q4J A;  2N5B A;  2KOK A;  1X9S B;  2FWF A;  4K5S A;  1ZCP A;  1XWK A;  1WMJ A;  4Z7X A;  2QGV A;  1EZK A;  2GZZ A;  4MP4 A;  3VWU A;  5GAN D;  2GQL A;  1TOF A;  3I43 A;  4HOJ A;  1F2E A;  3IC4 A;  3TJG A;  2H19 A;  1LBK A;  3QAW A;  3A2V A;  4MLY A;  1ABA A;  5CRH A;  4AF2 A;  3G9B A;  3TKS E;  2H1D A;  2OA7 A;  6GSU A;  3MIX A;  2DBC A;  5F05 A;  3F6D A;  2R5G A;  3TJK A;  3TRX A;  4JR4 A;  3KGK A;  4EKZ A;  2V41 A;  5J9B A;  3ZMK A;  2H6Y A;  2XBQ A;  3HYP A;  4ZBB A;  2AYT A;  3FR9 A;  3W8S A;  3IC8 A;  1IYI A;  1R5P A;  4HEA 2;  3GKK A;  2H6X A;  3F8U A;  2DJ2 A;  3BD2 A;  5G5F A;  2GQM A;  3E0U A;  3ZYW A;  2CZ3 A;  1SYX A;  2C3Q A;  3CBU A;  3PPU A;  4ZL7 A;  5J9C A;  1AUC A;  4PNF A;  1URM A;  4AJ6 A;  3CRU A;  5A5K A;  2MMO A;  1YZX A;  1BED A;  3IAS 2;  4DSR A;  1V58 A;  4MMM A;  1GUH A;  1PKW A;  2F8A A;  5IQY A;  1O85 A;  1TI3 A;  4XTS A;  2JSZ A;  5ECQ B;  4ZB6 A;  4OD7 A;  2CX4 A;  2NVL A;  3ZL5 A;  3GN3 A;  3HZ8 A;  4MA9 A;  2HRA A;  2O87 A;  2RII A;  1QK8 A;  4RI6 A;  4KAE A;  3MYD A;  2FA4 A;  2H6Z A;  3E9J B;  1Z9H A;  5C04 A;  2GVP A;  4ECJ A;  3M1G A;  4HDE A;  5ECN B;  5E4W A;  2B7K A;  3D22 A;  3IXR A;  5IO2 A;  1Y25 A;  5COH A;  2PWJ A;  1HD2 A;  3TJB A;  1TDI A;  3BBY A;  4RQX A;  2IMI A;  1R7H A;  4OFT A;  8GSS A;  2IIY A;  1F37 A;  5ID2 B;  3HY2 A;  3MAK A;  4E8H A;  5D8I A;  1JFU A;  4MAB A;  5ECP B;  5A4V A;  4POK A;  6GSW A;  2F3M A;  4Z2T A;  4CHS A;  4ZL8 A;  2G0F A;  2VUP A;  1F3B A;  3JCM L;  1YF1 A;  4TXO A;  1I9D A;  5D9V A;  2YOI A;  4EDY A;  2KP1 A;  3KZQ A;  4AJ8 A;  1CQG A;  3HXS A;  1A0F A;  3ZLP A;  5EL8 A;  3LYK A;  3W6G A;  1YKA A;  4V2N A;  1B4P A;  1A23 A;  5ECO B;  1OC3 A;  4PQH A;  5B6M A;  1AQV A;  4TVE A;  1GUK A;  2FHE A;  4JR6 A;  4XCS A;  2IMD A;  5INY A;  2XC2 A;  1SYR A;  4O5U A;  5IIZ A;  3FZ5 A;  5F8B A;  1GLQ A;  3RDW A;  2CT6 A;  2P0G A;  3KP8 A;  1XIY A;  1ZGN A;  2WCI A;  4K1F A;  1BAY A;  4YAV A;  1V2A A;  3QDN A;  4L5L A;  4CW9 A;  4PUR A;  1A8Y A;  1OC8 A;  5JCW A;  4ZXG A;  4KND A;  1UC7 A;  4KCA A;  2B1K A;  1SKS B;  2HFD A;  3DGQ A;  1GSF A;  1QGV A;  3HJM A;  1H4O A;  1PL1 A;  4IKH A;  4POL A;  1DUG A;  5D93 A;  1XW5 A;  1U87 A;  3APQ A;  3G7I A;  4JE1 A;  3ME8 A;  2I4A A;  3HJP A;  2DMM A;  2LQQ A;  3DIE A;  2DKH A;  2HRN A;  3HD5 A;  1THX A;  2P5R A;  3IR4 A;  1TRU A;  1XXU A;  1FOV A;  5DDL A;  1Z7R A;  1AIU A;  1C72 A;  1M2A A;  4NPB A;  1VRS D;  1A8L A;  4N0Z A;  1B8X A;  3MSZ A;  3TOU A;  5IPG A;  4PTS A;  1TI1 A;  4HZ4 A;  2JAC A;  2LJA A;  3F4R A;  3HCZ A;  3CYN A;  1PX7 A;  1OKT A;  2ZNM A;  2HNL A;  1R5A A;  4HUA A;  5B6N A;  4NWY A;  2KUC A;  4TN8 A;  2B1L A;  5JCU A;  2TRX A;  3Q18 A;  5J41 A;  2LS5 A;  2B5Y A;  3W8J A;  2VIM A;  5ECR B;  2E2G A;  1G0T A;  1W4V A;  5DQY A;  1JLV A;  3FHK A;  1OYJ A;  2IFQ A;  4G19 A;  5D9T A;  2PVO C;  2OAC A;  1TTZ A;  4MDC A;  2CQ9 A;  3ERW A;  4ML6 A;  1K0B A;  1F9M A;  4TXO B;  1GSE A;  4HQS A;  2HT9 A;  3L9V A;  1G6Y A;  2HLS A;  3F4T A;  2IMK A;  4G0K A;  3GMF A;  1GP1 A;  2V2G A;  3LGC A;  5IMD A;  3ZIJ A;  2LJK A;  2FA8 A;  4DSS A;  2E0Q A;  2D2Z A;  3CTG A;  1ERU A;  4BWS A;  5DVB A;  3IK7 A;  1G7E A;  1K0C A;  2MBS A;  2C3N A;  3LQ7 A;  4PGT A;  1KNG A;  5DQS A;  2YP6 A;  4PUA A;  3FMW A;  2BTO T;  2E2M A;  1KTE A;  2LRC A;  5FT3 A;  4AGS A;  1M7T A;  4IVF A;  3TKS C;  13GS A;  3GRX A;  2V32 A;  4G0L A;  2O7K A;  2B5X A;  3MNG A;  1M9B A;  3NIV A;  1UN2 A;  3WGX A;  5CNW A;  2AAW A;  3A3T A;  5DAL A;  4TR1 B;  4V2L A;  4CY8 A;  3WYW A;  4BL7 A;  14GS A;  1WWJ A;  2GT5 A;  1VF1 A;  2V1M A;  1EP8 A;  3IHG A;  1XWG A;  5KN2 A;  4I2U A;  1O8W A;  2ON5 A;  5JWR B;  5B8A A;  3FKF A;  4WEY A;  4Q5Q A;  4LMV A;  4POM A;  2HRF A;  3TJJ A;  3F63 A;  4GF0 A;  1ERW A;  2ON7 A;  1UVZ A;  3GUR A;  1VF4 A;  1WJK A;  3CTF A;  2C0G A;  1EOG A;  3M9K A;  5GST A;  2L5O A;  5DJL A;  3RPN A;  5F07 A;  1ML6 A;  3VPT A;  3UEM A;  1AW9 A;  4YKG A;  19GS A;  2H76 A;  5DCG A;  3VPQ A;  4TR0 A;  3GA4 A;  2VLU A;  4F0C A;  4QL7 A;  3UAR A;  1ZYN A;  3ZIV A;  4ECB A;  5IMA A;  5C00 A;  2VAF A;  1PGT A;  2AV4 A;  3IPZ A;  2TIR A;  1YKC A;  1TK8 B;  3DRN A;  3D6I A;  3DXB A;  1RK4 A;  1CQH A;  3U6V A;  3LJR A;  2DJK A;  2IFQ B;  2M72 A;  5H5S A;  2DIZ A;  2HSM A;  4KA0 A;  1OKD A;  2K9F A;  2UZ8 A;  3FEU A;  3D0Z A;  2FWG A;  1ZOF A;  2VOC A;  3FR6 A;  1DBY A;  5BRT A;  2AJQ B;  3DD3 A;  3L9U A;  2RLI A;  4F2I A;  4IP6 A;  4HS1 A;  1FOH A;  1VF2 A;  4MPG A;  2B3S A;  5IOX A;  1QFN A;  5DCH A;  1E6B A;  1I5G A;  4X0X A;  3G7Y A;  4HQZ A;  4BVX A;  2HZE A;  3TKS A;  5HR1 A;  2X99 A;  4FQU A;  2CVK A;  1K3O A;  3HZ4 A;  4JU5 A;  3BCK A;  2E7P A;  4XS4 A;  2HYX A;  4K5R A;  1XWA A;  4YAP A;  2X8H A;  4IW9 A;  2IJY A;  1UA5 A;  3DVX A;  1AAZ A;  2WS2 A;  5EY6 A;  5KOX A;  4J57 E;  5ECL B;  3US3 A;  1AQX A;  2G2Q A;  2LTK A;  1BQ7 A;  2NBS A;  5KN0 A;  5L71 A;  3CRT A;  1G6W A;  4IJI A;  1M9A A;  2GS3 A;  2PPT A;  1AC1 A;  5ECK B;  3GX0 A;  2REM A;  4IBP A;  5D73 A;  2CVD A;  4F82 A;  4XHM A;  3GL5 A;  5GSS A;  1BYE A;  2LRN A;  2QA2 A;  3CSI A;  1EV9 A;  3TGZ A;  3I9V 2;  2GSR A;  1Z6M A;  4BPY A;  5KOW A;  5DBQ A;  3RBT A;  3ZVJ A;  1GSD A;  3RHB A;  3ZTL A;  3KP9 A;  2VCX A;  2K8V A;  4Q5N A;  4USS A;  2N5A A;  3LSZ A;  4QQ7 A;  1FO5 A;  5DAK A;  4V1A g;  5G1L A;  3GYK A;  1MD3 A;  2HSY A;  2VLV A;  5CRW A;  2KP2 A;  2LEG A;  3IOS A;  3HJO A;  6GST A;  5LD0 A;  4YKF A;  3GV1 A;  1A2J A;  3TKQ A;  1FG4 A;  5HR0 A;  10GS A;  2FLS A;  4F0B A;  3GKM A;  1GTA A;  2H1G A;  1B9X C;  3APO A;  2RM5 A;  5ECS A;  1BJX A;  4K8M A;  4O92 A;  4OCF A;  3ZML A;  1ZYP A;  4D73 A;  1HYU A;  2R0G A;  3FZ9 A;  4PQ1 A;  3K8N A;  5CP1 A;  2VL2 A;  4PUF C;  2J23 A;  1SJ6 A;  4L0W A;  4EVM A;  1V40 A;  5HR3 A;  1TRW A;  3TKR A;  4FYU A;  3F6F A;  4WF5 A;  4N0V A;  3G7J A;  4NHZ A;  3KH9 A;  2ZUP A;  3EWL A;  4MK3 A;  4KE3 A;  1OC9 A;  1N8J A;  3H4K A;  4BVX B;  3IBH A;  4L5O A;  4NHW A;  2AHE A;  2F9S A;  2GQK A;  3A5W A;  3HHV A;  4OO4 A;  5D96 A;  2V6K A;  1VGL A;  1YEP A;  4X4J A;  5A4W A;  3L0H A;  5JWQ B;  3F0I A;  3H8Q A;  3Q6O A;  3O6T A;  4XS4 B;  2VL9 A;  1T1V A;  4WKW A;  3HVS A;  1FW1 A;  2JU5 A;  5CRG A;  3C73 A;  1TKD B;  22GS A;  2HE3 A;  2EIO A;  3TUE A;  2YV7 A;  1SU9 A;  2LUS A;  2AB6 A;  1S3A A;  1JZW A;  1M2D A;  1EWX A;  2H1A A;  1A0R P;  3PIN A;  4IHU A;  2RUF A;  4PXO A;  3P2A A;  3IE3 A;  3UMA A;  4G10 A;  1M2B A;  2GGT A;  3QMX A;  2JAD A;  1EGR A;  4EE0 A;  1GTI A;  3KMN A;  4IQA A;  1T4Y A;  2X8C A;  4I5Q A;  3LXZ A;  4K2X A;  2DJJ A;  2YJH A;  2JSY A;  4ID0 A;  1A24 A;  5HR2 A;  2MMZ A;  2HZF A;  4MJE A;  2MMN A;  1RQM A;  3F9U A;  4IJ3 A;  4HU9 A;  11GS A;  2WDU A;  4KDX A;  1S3C A;  4WF4 A;  2WUL A;  3IK9 A;  4G2E A;  1T7P B;  1JHB A;  1DE2 A;  1R4W A;  1JLW A;  4OMV A;  1LU4 A;  3GUS A;  3O3T A;  2BJX A;  3C7M A;  1Z5Y E;  2DSA A;  1GUM A;  1XWC A;  4WXT A;  4EDZ A;  3QR6 A;  2P31 A;  3M3M A;  4G9H A;  2IME A;  5J3R A;  4MZW A;  3BCI A;  3HDC A;  3DKS A;  2CZ2 A;  3GSS A;  5IOW A;  4OO5 A;  4MJB A;  3FR3 A;  3EC3 A;  3VI7 A;  3KMO A;  4OFN A;  2LV3 A;  2C4J A;  4HU7 A;  3GL3 A;  1K3L A;  4D73 B;  1OE7 A;  1KEB A;  4TKY A;  1NSW A;  4TW5 A;  2DLX A;  5HQP A;  1FB6 A;  2C8U A;  2VLT A;  2H01 A;  2PU9 C;  1GTB A;  2OAD A;  2A4H A;  4IEL A;  4GRF A;  3CXG A;  2LST A;  5D9X A;  4BA7 A;  4BVY A;  2GDR A;  3KXO A;  4YH2 A;  5CO3 A;  2HXK A;  3M8N A;  4YQU A;  2XBI A;  5AIX A;  1QMV A;  3VWW A;  1S3D A;  3UVT A;  2H70 A;  2NTO A;  1E2Y A;  2GZY A;  4K6X A;  1JZO A;  1XPV A;  2B6M A;  2IN3 A;  2WRT A;  4RQR A;  2OKA A;  3QFB C;  1GUL A;  1QUW A;  2CV4 A;  4KSO A;  3EMP A;  2PMT A;  1KBN A;  3LW9 A;  1YY7 A;  4N10 A;  4KH7 A;  4Q5F A;  4EXJ A;  2FWH A;  3ZFB A;  1TP9 A;  5H5Q A;  1F6M C;  4GXZ A;  3UJ1 A;  1A2M A;  1J08 A;  1T4Z A;  2JZR A;  2DKI A;  1G7O A;  3R2Q A;  1PMT A;  4O32 A;  4A5P A;  1XW9 A;  3FY7 A;  2WGR A;  3APS A;  1ZZY A;  3WGD A;  2QSI A;  1FVJ A;  3EVI A;  4GCI A;  3GHA A;  4LMW A;  3F3R A;  4QL9 A;  1V9W A;  4E8E A;  2BMX A;  2L59 A;  3KM6 A;  1FAA A;  4V2M A;  4V1A p;  3GH6 A;  2L4C A;  3LYP A;  4Z2R A;  4MH3 A;  4PQI A;  4O5R A;  1FHE A;  4HJM A;  1ZYE A;  3U5R E;  4RI7 A;  1WIK A;  2YCD A;  4WET A;  2I1U A;  3QAG A;  3EU4 A;  2YZU A;  1X5E A;  1MEK A;  4JRR A;  4FH8 A;  4IN0 A;  3ZFL A;  5IMF A;  2FNO A;  12GS A;  1GLP A;  6GSX A;  3ME7 A;  1SL2 B;  2PBJ A;  4GQF A;  3GKN A;  3LEF A;  2EC4 A;  2H66 A;  2A2R A;  4TOP A;  2YPM A;  4J2F A;  4OCE A;  3Q74 A;  1SJI A;  4IQ1 A;  2VO4 A;  3WT1 A;  1TXX A;  2MMA A;  5IM9 A;  1XVQ A;  2H74 A;  2RUE A;  4YQM A;  1TK5 B;  4HJ2 A;  4EIP A;  4MF7 A;  1ILO A;  4EL1 A;  5CAX A;  5ECI B;  17GS A;  4HZ2 A;  3H93 A;  4BVY B;  1U88 A;  1PSQ A;  3TJF A;  2JZT A;  3NOF A;  2I9H A;  2IL3 A;  2FUG 2;  4KDY A;  2X64 A;  2IMF A;  3IA1 A;  4JED A;  2YWI A;  5F0G A;  2C1Y A;  1X9W B;  3TB2 A;  2GSS A;  4ZIJ A;  3DML A;  2OJL A;  5IPH A;  2YAN A;  4Q5R A;  4AJ7 A;  1USB A;  3P8W A;  5B7C A;  2PUK C;  3DYR A;  3A2W A;  1SJZ A;  1MDJ A;  4F9Z A;  2H30 A;  1BG5 A;  2YWO A;  3GFK A;  4FIW A;  3L9S A;  3A2X A;  1NM3 A;  4F03 A;  2F8F A;  4TXV A;  1HNC A;  1XFL A;  5KN1 A;  1MTC A;  5CRD A;  3C1S A;  3RPP A;  1ZYQ B;  16GS A;  2TRC P;  4I8B A;  5DJM A;  3DWV A;  3ERF A;  5G2Z A;  4DSS B;  2DJ3 A;  1QXH A;  4ML1 A;  3LFL A;  3V1W A;  1PA3 A;  3VUR A;  2GLR A;  1GL8 A;  4I97 A;  4JBB A;  2DIY A;  4MCU A;  2YWM A;  3EMX A;  6GSY A;  3ED3 A;  2C0E A;  4DEJ A;  3WGE A;  2VCT A;  1Q98 A;  4RUV A;  1SKW B;  7GSS A;  2DC5 A;  2B5E A;  2XPE A;  5ID2 A;  2MZC A;  5ABR A;  1DE1 A;  2I81 A;  5DAL B;  1GNE A;  1K0M A;  4BWQ A;  1PD2 1;  4NXI A;  5ECM B;  1U3A A;  4K2D A;  3QAV A;  5HFI A;  4BL7 B;  2O89 A;  3IHQ A;  2F51 A;  4NMU A;  3S9F A;  5G31 A;  1IYH A;  2K8S A;  4MZC A;  4MH2 A;  3EYT A;  2VM2 A;  4KX4 A;  1EP7 A;  2KLX A;  3LXT A;  6GSS A;  3KH7 A;  2FY6 A;  2DJ1 A;  2VM1 A;  1EEJ A;  4PX1 A;  3MWH A;  3UOM A;  3ZZX A;  1U3I A;  2H71 A;  2J9H A;  1GSS A;  2YZH A;  3IAM 2;  2LQO A;  4GSS A;  4WBJ A;  1HNB A;  4WR4 A;  1GSU A;  1XZO A;  2GSQ A;  1MDK A;  1PX6 A;  3VI5 A;  2YWN A;  1Z7P A;  4ZB9 A;  4H86 A;  6GSV A;  1YJ6 A;  2O85 A;  3UBK A;  4NV2 A;  1B48 A;  3UIW A;  4MJC A;  2PN8 A;  1AXD A;  3L78 A;  1TRS A;  1K3Y A;  2LNT A;  3D4T A;  3L4N A;  4K7I A;  2EIQ A;  4N11 A;  5GAP D;  1TJD A;  4MZB A;  1YEX A;  1TRV A;  4JZQ A;  4ZB8 A;  2QKE A;  3D5J A;  3FZ4 A;  5AIV A;  4DVC A;  1O7U A;  3VFI A;  4TRX A;  5CRE A;  4ZL9 A;  1YF0 A;  3BJ5 A;  3KEB A;  1R26 A;  4KUN A;  1JZD A;  1GNW A;  1A2L A;  3PGT A;  1O8X A;  1J9B A;  1SK2 A;  2NDO A;  2HRK A;  4POB A;  2WJU A;  3CSJ A;  3J7Y k;  1W89 A;  4CDO A;  4MNN A;  2FGX A;  1BX9 A;  2HZE B;  3KJY A;  3EIN A;  2VCQ A;  4OWY A;  3AY8 A;  2AUV A;  1EGO A;  5EVO A;  2R37 A;  5G1K A;  4I2T A;  2HSH A;  4GTU A;  1J0F A;  1DSB A;  1JZR A;  2GTU A;  4G0I A;  2GT6 A;  1M99 A;  2C0D A;  3PH9 A;  1FB0 A;  4K0N A;  3J7Y b;  3HVV A;  5IMC A;  3QFA C;  4KSM A;  4FO5 A;  3I6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...