2LUSA

Nmr structure of carcinoscorpius rotundicauda thioredoxin related protein 16 and its role in regulating transcription factor nf-kb activity
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
143
structure length
143
Chain Sequence
MEFIQGIKLVKKNRCEVNANEALKDKDIIGFYFSAHWCPPCRGFTPILADMYSELVDDSAPFEIIFVSSDRSEDDMFQYMMESHGDWLAIPYRSGPASNVTAKYGITGIPALVIVKKDGTLISMNGRGEVQSLGPRAFQNWAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxion
publication title NMR structure of Carcinoscorpius rotundicauda thioredoxin-related protein 16 and its role in regulating transcription factor NF-kB activity.
pubmed doi rcsb
source organism Carcinoscorpius rotundicauda
total genus 25
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2012-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13905 Thioredoxin_8 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2lusA00
1TKDB 3UARA 2X8HA 4TXOB 4XS6A 2H1BA 2C3NA 4EDYA 3FW2A 3LYKA 4KB3A 1X5CA 2VAFA 2NTOA 5JCGA 4ZBBA 3J7Yk 1WPIA 1MEKA 4AJ7A 4DEJA 5HR3A 3D6IA 2MMNA 4ZL9A 3RBTA 5F07A 2REMA 2YV9A 2VCQA 2I81A 4K1FA 1R7HA 1YF0A 4O5RA 1TK8B 3J7Yb 2GGTA 5IMVA 3N5OA 3F3RA 2CT6A 5IMDA 3HY2A 5CP1A 3D21A 2IMKA 2LRNA 4OWYA 2WZ9A 1NHOA 1XIYA 5CREA 3EMPA 3M9KA 1BQ7A 3CTGA 2JADA 3LXTA 3QFAC 1SYRA 1O8WA 3I43A 3EMXA 4V1Ap 4F82A 4GQCA 3UVTA 3CRUA 3GFKA 4NWYA 4H86A 2F51A 2B1LA 3F4SA 2ZNMA 3GURA 5D73A 1SD8A 4MF5A 2ES7A 1YQ1A 2IPAA 4ZIJA 4X43A 1M0UA 1B4PA 4V2LA 1GUHA 4EVMA 4EE0A 3TRQA 4MPGA 3ME7A 2E0QA 3L0HA 3C71A 2PU9C 4AF2A 4BPYA 5DQYA 2YANA 5DJLA 5GAPD 3QD9A 1SL1B 4YAVA 3LGCA 1EOHA 1XPVA 1SENA 2DSAA 3TKSA 1M9BA 3KM6A 4L5LA 1OC3A 4ZBAA 4MCUA 2HNLA 1K0OA 1GTIA 4E8HA 1SKRB 1V9WA 2WS2A 4K7OA 1ZMAA 5KN3A 1Z7RA 3EWLA 4WF4A 4WBJA 3WGEA 2MMZA 2EIQA 4E8EA 2JL4A 2GDRA 5D9TA 1AC1A 3WT2A 2EIRA 1JZRA 1YEXA 2YNXA 1GSSA 4ISDA 1Q98A 3GN3A 3GA4A 4NHZA 1TOFA 4GWRA 1GSYA 1ML6A 4HJ2A 3LXZA 4IBPA 2JZRA 4WF5A 2H1AA 3M9JA 1XVWA 3EE2A 2GT5A 4WR4A 4MH3A 2QKEA 1H4OA 2GS3A 4KUNA 3APOA 2R2JA 3DEXA 2WFCA 1A8YA 1BAYA 2DIYA 5L71A 3QMXA 3DIEA 4FYBA 5ECHB 1ZYQB 18GSA 2GQMA 3HJOA 2PVOC 4EL1A 4YQUA 2J9HA 3GTUB 1DUGA 1W4VA 1T4YA 1VRSD 3DYRA 4KE3A 4MZWA 3ED3A 3TOUA 1THXA 3VLNA 6GSXA 5ECPB 5JCUA 4OFMA 2NVLA 2CVKA 2YN1A 4V1Ag 4MZCA 3ZITA 3QPMA 4ID0A 1A0FA 1AAZA 2L57A 2K8SA 2JSYA 3I69A 4QL7A 5FHIA 4CDOA 4WR5A 1EGRA 4ZB9A 3UJ1A 4BWSA 2P5QA 3DD3A 1SKSB 1XWKA 5IMCA 4MJCA 1GTAA 1F2EA 3W8SA 2D2ZA 2XC2A 5LCZA 2VCXA 4ACSA 4K7IA 3UOMA 4WBRD 3VPTA 2VD1A 1AQVA 5A5KA 4MF6A 4RQRA 3UBKA 1NW2A 2NPBA 4L0UA 2CAIA 6GSWA 4ZBDA 1F3BA 1FVJA 1A8LA 4LMVA 4DVCA 1OC8A 3G9BA 3TCOA 1WWJA 6GSUA 2VL2C 3FZAA 3D22A 2H1DA 2F3MA 2H74A 5GAND 2CV4A 4YH2A 5A4UA 2OBIA 2H70A 3F4RA 2CVBA 2K18A 4CW9A 2BMXA 2TRCP 2KHPA 3Q19A 1X9MB 4Q5FA 2HFDA 4OFTA 3TJJA 3RPNA 5CRGA 5B7CA 4BL7A 2HLSA 4GCIA 5LNKe 1TRVA 3UEMA 3ZZXA 3UL3A 4F03A 1EOGA 3EVIA 2PGTA 3IE3A 4RUVA 3P7XA 2MBTA 1N2AA 1TU7A 2H0GA 3ZVJA 2M72A 2N5AA 3FR9A 2R5GA 20GSA 2LQQA 6GSTA 4N0ZA 3HD5A 5IM9A 3DRNA 1MD3A 4XS4B 4PUFC 3GUSA 3VK9A 3N9JA 2YWOA 3KTLA 2DMMA 5EVOA 3BJ5A 3GHAA 3LJRA 1ABAA 3HA9A 1UA5A 2CAQA 1OC9B 1PD21 3M8NA 2PMTA 4TKYA 2DJJA 4ZB6A 3QR6A 4J57E 1EV4A 4K2DA 4LMWA 3GKNA 4JRRA 3Q18A 5F06A 1Q4JA 3UBLA 5CYYA 3OR5A 1VF4A 1RQMA 2YWIA 2VCTA 3FYGA 3ERFA 5HR2A 2FD3A 2DJKA 2I3YA 1BEDA 5LD0A 3VPQA 2VLUA 1Z3EA 1R4WA 5IMFA 4IQAA 1PL2A 2YZHA 3A2VA 1JZDA 2MMOA 3CMIA 4TXOA 3TB2A 4MMMA 3MWHA 2VIMA 5G30A 3FEUA 1JLWA 5IMAA 2KP2A 5J41A 1C72A 4V2MA 4XRAA 5DCHA 3M3MA 1AUCA 2PUKC 2IMIA 4F2IA 4Z7XA 3ERWA 1UC7A 3GH6A 5CO3A 3F9UA 3ZFLA 1K3YA 2CVDA 4HS1A 4GXZA 1M99A 3TKSC 5JCWA 3CXGA 1THOA 3TJFA 4D73B 2O87A 1PQNA 2L6DA 5J3RA 4KCEA 4ULXA 5B6NA 2AHEA 4KDUA 5FT3A 3IHQA 1A23A 1JZWA 4ZL7A 5B8AA 1FG4A 1U6TA 5AISA 3KGKA 1V58A 4WXTA 4GSSA 4KDYA 2G2QA 4PUAA 2H73A 4ECJA 3ZTLA 3GRXA 5EL8A 2PPTA 3NZNA 5IIZA 3TGZA 4JU5A 1XWAA 3CRTA 1FB6A 1XW9A 3QOUA 2PERA 1Y25A 5CNWA 3GX8A 2GSSA 1FHEA 3PH9A 1PX7A 3JCML 1ZOFA 4KNDA 2YJ7A 2B5EA 3TKSE 4IKHA 3IAS2 1GSQA 4FIWA 3QCPA 5IOXA 4BWQA 2JU5A 3ZVJD 5JWOB 2K8VA 1TXXA 2H8LA 3FY7A 4OFNA 2IWTA 1FB0A 1X0RA 4JR6A 2H76A 3DVXA 4EDZA 2KLXA 1BJXA 3TKQA 1NHYA 1F6MC 4F0BA 2VM2A 2VCWA 2HI7A 4MLYA 4JE1A 4JZQA 1U88A 1WIKA 2FWFA 2M80A 2LJKA 1FVKA 4XCSA 5KN2A 3FKFA 4POLA 3SWLA 11GSA 3VURA 4HOJA 4IELA 2MYGA 4N30A 4HEA2 1OKTA 1S3AA 4KAEA 2H6XA 3IDVA 1TI1A 3PINA 1M2DA 3C1SA 4GRFA 2DJ2A 1GSEA 2AB6A 1PKWA 2VLVA 4PX1A 2C8UA 3KXOA 1DSBA 1TTZA 3A5WA 2KP1A 2WB9A 5J9BA 3ZMKA 3ZFBA 4ECCA 5J9CA 5IMZA 3LEFA 2DIZA 5DALA 3KTBA 3TRXA 2C4JA 2GQKA 5IO2A 3KP9A 3DWVA 4NXIA 1ZGNA 2NDOA 1K0AA 4Q5RA 1GRXA 4DSSB 5ENUA 3US3A 2VO4A 1YKAA 2C0EA 3QAVA 3FZ5A 4MABA 4POBA 4TR0A 4AGSA 2TIRA 3WGXA 4MF7A 2C0GA 2LUSA 3M1GA 4X1UA 2KOKA 3VI5A 1SJ6A 3GL5A 3G7IA 4I97A 1GULA 4FH8A 1EP8A 2VOCA 2E7PA 2OKAA 3H93A 4EUYA 4EF0A 1GNWA 1B9XC 4POKA 4DSQA 4BVXA 3UVHA 3DGQA 3GTUA 2JSZA 2LV3A 1CQHA 2B3SA 1F3AA 5ECOB 5EPFA 3FR6A 4HDEA 5G5FA 2YCDA 1GTUA 3GL3A 1G0TA 2K6VA 4IGJA 3K8NA 1B8XA 2OE1A 3F3QA 4KGIA 5DALB 2RM5A 2FWEA 3RPPA 2B5YA 1M2BA 2FUG2 3L9VA 3FZ4A 6GSYA 2NBSA 2H0IA 2C80A 2F8FA 3APQA 3Q74A 5JWQB 4KDXA 1A2MA 1AXDA 3GKKA 3HVVA 2HXKA 2LNSA 5EY6A 2VUPA 2ZCTA 3HYPA 1X9WB 1K0DA 2FNOA 1S3DA 2MBSA 1E2YA 2ALBA 2DJ0A 1YKCA 5D8IA 3IV4A 2V6KA 14GSA 4IJ3A 5IPHA 2H71A 4KH7A 1BX9A 2GTUA 5D9WA 3VWUA 2BTOT 1SD9A 1WRYA 2YWMA 1HNBA 4JBBA 1SK1A 4YAPA 4MK3A 2I1UA 2HZEB 2WULA 5FWGA 2O85A 3ZL5A 2V41A 5KEJA 1YZXA 3L9SA 4GF0A 5IO0A 3W6GA 4TRXA 1TU8A 5HFGA 5ECKB 1XWBA 2H01A 2M46A 1O7UA 2YJHA 4PURA 1ILOA 1PL1A 1X5DA 3TJGA 3O6TA 2IMFA 3RHCA 5HQPA 2OACA 2WRTA 3RDWA 2X8CA 5H5RA 2HSHA 4XHMA 3AY8A 1V98A 3IBHA 2XPEA 4KCAA 4J56E 1RK4A 1F9MA 5DVBA 1PX6A 1XFLA 2PN8A 1AIUA 2IMEA 4NPBA 2E2MA 1GUMA 2LJRA 2KUCA 3GSTA 3O3TA 4PNFA 1AQXA 4MJEA 3KP8A 3UMAA 3TDGA 1TRUA 3DMLA 1TRWA 5E59A 1GNEA 4QL9A 1QUWA 1RW1A 3ZLPA 1R5AA 1CQGA 1EWXA 19GSA 4MDCA 3F6DA 2GLRA 1MTCA 3H1NA 4XS4A 3ME8A 10GSA 1PMTA 1K0CA 2FY6A 3L78A 1LU4A 1WOUA 2A4VA 5ELAA 1XW5A 4NHWA 5ECMB 1GWCA 3IK9A 4J2FA 4L8EA 3ZIJA 4HI7A 4NV2A 4OMVA 4O7HA 2RM6A 1OC9A 1FO5A 4EO3A 1LJRA 1I9DA 4IJIA 4MA9A 1AQWA 3P8WA 4HQSA 4F0CA 2IN3A 3H4KA 3D0ZA 2X8GA 4NV5A 4K0NA 2CZ3A 2YZUA 1GUKA 5AIXA 1U3IA 5KN0A 3KMNA 4OO4A 3L9UA 3HDCA 5F8BA 2P0GA 4MP4A 3M0FA 3P90A 2XBQA 5GSSA 1T00A 2VL3A 1FOVA 5GSTA 2YPMA 4O32A 4TR1B 4ECIA 1IYHA 1EP7A 12GSA 1E6BA 3GIXA 2LTKA 1DE1A 3FRCA 4TR4A 1WMJA 22GSA 2GZYA 1Z7PA 1TP9A 2IMDA 1B4QA 5D96A 1DBYA 1G6WA 3IA1A 4P3YB 3D4MA 3TRPA 3FZ9A 4TOPA 3QDNA 2OA7A 2O7KA 4OCFA 1QXHA 3GNJA 3CSJA 5C04A 1EEJA 3GV1A 1KBNA 5G1KA 1X5EA 3GH9A 1G7EA 2J23A 1XOAA 3CSIA 4D73A 2B1KA 4IP1A 5J5NA 3WGDA 2H72A 3LFLA 3A2WA 1OE7A 2YP6A 5AGYA 4X0XA 2XBIA 5D9XA 3ZREA 1ERUA 2DJ3A 5CRDA 4L0WA 1HD2A 4TW5A 4OD7A 3ZIVA 4JEDA 4YQVA 1SJZA 3LG6A 1G7OA 1G6YA 1HYUA 3EURA 1A2JA 3HKRA 3IRAA 2LRCA 2GSTA 1XWCA 3I9V2 16GSA 2VCVA 2LEGA 1XCCA 4PQ1A 3F63A 1DE2A 4IW9A 4WETA 1VF1A 2V2GA 1QQ2A 6GSSA 2HYXA 9GSSA 5IQYA 1TDIA 7GSSA 3VWVA 1GLPA 2WJUA 1ERWA 4KA0A 4HJMA 1HQOA 3HXSA 1OAZA 1YDKA 3LORA 1PSQA 2GZPA 1F37A 2CZ2A 3BOAA 4MJBA 2H1GA 3DXBA 3MAKA 4Q5NA 3S9FA 3ZMLA 3ERGA 2K9FA 4HZ4A 1ERTA 3MNGA 3UAPA 8GSSA 3TUEA 4IHUA 5J4UA 4IS0A 5DAKB 1YF1A 2L5LA 2OE3A 5DJMA 2FGXA 1O81A 4XIHA 4HU7A 2DBCA 4G19A 1T3BA 5AIVA 3PR8A 3IK7A 3GKMA 1YY7A 3L4NA 4MPFA 2H6YA 5CRHA 2VL9A 5D93A 1JHBA 2ZUPA 3LYPA 2X99A 1PGTA 4LL1B 1TK5B 1R26A 4MZBA 4WEYA 2LRTA 5KN1A 1XBSA 5HFIA 1WE0A 3TJBA 1SJIA 4EKZA 3KMOA 2F8AA 1WP0A 2HT9A 1XW6A 4O92A 3GYKA 1O73A 1QMVA 1GSFA 2FCHA 4V2NA 5ECIB 4F9ZA 4DSSA 2YOIA 1K0NA 2FLSA 4ML1A 2GT6A 4DSRA 2FWGA 3KZQA 2MMAA 5HFKA 1M7TA 4AJ6A 3G7YA 4HQZA 1GH2A 4TXVA 1WJKA 3F0IA 3SBCA 5ID2A 1FW1A 1HNAA 2DC5A 4ECBA 5GZZB 5C00A 1H75A 1Z5YE 1J08A 2VLTA 13GSA 3C8EA 1T7PB 3TKPA 1OKDA 4RI6A 1VGLA 1TJDA 5JWRB 2L4QA 2DLXA 1UN2A 2LQOA 4BVYA 2P31A 1SKWB 2FHEA 3BCIA 4LL4B 1NSWA 4IVFA 2OJLA 4KW6A 2XHFA 2WCIA 1KNGA 3DKSA 1GTBA 4G2EA 3VWWA 3HZ8A 1K3OA 2CA8A 1BYEA 5HR1A 5DCGA 3U5RE 4RI7A 1GSDA 1Y6EA 2OADA 3RAZA 1ZCPA 1MD4A 3O76A 5ID2B 2RUFA 3VWXA 3EU3A 5ABRA 3BD2A 1AW9A 4L5OA 4PXOA 1QGVA 2AV4A 3WT1A 1T1VA 4FO5A 2HRNA 2HZEA 2B5XA 2C1YA 5COHA 1O8XA 4OO5A 2RIIA 3KH7A 3C73A 2R37A 1B48A 4PGTA 3NIVA 3NOFA 1ACVA 2GZZA 1GL8A 2I9HA 3FHKA 5DDLA 1PA3A 3HVSA 1B9YC 3KJYA 1URMA 2A2SA 1PRXA 2TRXA 1SYXA 4NMUA 2BJXA 1K0BA 1XOBA 2C0DA 2ON7A 1Z6MA 2C3QA 5ECSA 4G10A 3TJKA 5DQSA 3APSA 1SK0A 3IOSA 3P2AA 2QSIA 3U6VA 2QGVA 2G0FA 2PWJA 5HR0A 1XZOA 4JR4A 2VCZA 4XS1A 5ECLB 1YEPA 2R4VA 5G2ZA 3E0UA 1A0RP 1ST9A 1TK0B 4G9HA 3ZYWA 5IPGA 1HNCA 2CX3A 3R2QA 1J9BA 3IR4A 1V2AA 1EV9A 1EEMA 2N5FA 4TR3A 2H66A 1OYJA 2ON5A 1LBKA 1VF2A 1A24A 1O6JA 4N10A 4XRDA 4K6XA 1EZKA 4ZILA 3TKRA 2HE3A 2O8VB 3KIJA 2HRFA 2H0HA 1EGOA 3GMFA 2DMLA 4K7NA 2WGRA 2N5BA 4YQMA 3LSZA 1TRSA 4GSNA 1USBA 4OCEA 3C1RA 3GX0A 4EXJA 2GQLA 3LQ7A 3ISOA 4GTUA 4RQXA 2YV7A 4I2UA 3BCKA 3WYWA 2B6MA 3A3TA 4MJAA 1JLVA 1S3CA 3BBYA 1IYIA 1SU9A 1GP1A 4TR1A 2AUVA 2R3XA 2F9SA 2HZFA 1ZYEA 3EINA 4K8MA 5D9VA 4AJ8A 1I5GA 3IPZA 5ECQB 4N11A 1OE8A 1FAAA 1R5PA 3C7MA 2QC7A 3E3EA 2VM1A 5IOWA 1U87A 4KSOA 3GSSA 4XTSA 4POMA 4K0GA 3I6AA 3F4TA 1K3LA 2LS5A 5H5SA 3PGTA 3HCZA 1M9AA 4I5QA 5ECNB 5F05A 3ZRDA 3EC3A 1Z6NA 1BG5A 2H75A 3TOTA 4ZXGA 2O89A 2V32A 3IC4A 1Z9HA 3F6FA 1NM3A 4BA7A 1JFUA 2AAWA 1GSUA 2H6ZA 2JACA 4KX4A 5G31A 3KH9A 2PVQA 1MDKA 3V1WA 2C3TA 1XVQA 4HZ2A 4GQFA 3KEBA 4GSTA 4ZL8A 3CBUA 1GLQA 3EYTA 2IFQA 4Q5QA 3FR3A 3G7JA 2RUEA 2LNTA 4IP6A 5B8BA 2EC4A 1O85A 3HJPA 4I8BA 3DVWA 3E9JB 4I2TA 4ILFA 2MZCA 2A2RA 2H30A 3D5JA 4PQIA 3MSZA 2LKUA 4HU9A 2L6CA 4I6XA 17GSA 2DJ1A 1PKZA 4ZB8A 6GSVA 2IL3A 1T8EB 1XWGA 3H8QA 3IAM2 4PQHA 1A2LA 2H19A 2LJAA 2IJYA 1J0FA 1MDIA 3VI7A 3QAWA 4QQ7A 2R6KA 1JZOA 1PN9A 3GKXA 1K0MA 2E2GA 2FA8A 1MDJA 2GSRA 5ECRB 3QFBC 1X9SB 2LSTA 5DBQA 2JZTA 2YWNA 3LWAA 2EIOA 5DAKA 3H79A 4PNGA 3WD6A 2HSYA 2V1MA 1V40A 3KCMA 1W89A 3QAGA 5AN1A 4LA1A 1V57A 2IFQB 2GVPA 4GLTA 5INYA 2CX4A 1ERVA 2L5OA 1ZL9A 4IQ1A 3CTFA 3HVXA 2AJQB 4KSMA 2L4CA 4K9ZA 4TVEA 1SL2B 5E4WA 4HUAA 1KTEA 4LLRA 5F0GA 3IXRA 4CHSA 2VD0A 4FYCA 2PBJA 3FK8A 3HJMA 2I4AA 2FWHA 3D4TA 2OBKA 5H5QA 2FA4A 2AYTA 2RLIA 5A4WA 3W8JA 4NAXA 1OVNA 1UVZA 2P5RA 3UIWA 5CRWA 3CYNA 1XXUA 3HHVA 1QK8A 2L59A 1QFNA 2Z9SA 4IN0A 3EU4A 4EC0A 2B7KA 2VL2A 4WKWA 5B6MA 3Q6OA 1ZZYA 3KD0A 4ML6A 2V6OA 3HZ4A 1N8JA 3CSHA 5ELGA 3A2XA 2IIYA 1YJ6A 3F8UA 4N0VA 1U3AA 1SL0B 5G1LA 1ON4A 2XPDA 1T4ZA 4FYUA 3RHBA 3MDKA 2C0FA 2B7JA 1M2AA 1KEBA 2JZSA 2WDUA 4TN8A 5A4VA 1SK2A 1TW9A 2CQ9A 3VFIA 2X64A 2GSQA 5CAXA 1TI3A 1VF3A 5G5EA 2OE0A 4MH2A
chains in the Genus database with same CATH superfamily
1TKDB 3UARA 2X8HA 4TXOB 4XS6A 2H1BA 2C3NA 4EDYA 3FW2A 2QA1A 3LYKA 4KB3A 1X5CA 2VAFA 2NTOA 5JCGA 4ZBBA 3J7Yk 1WPIA 1MEKA 3CQFA 4AJ7A 4DEJA 5HR3A 3D6IA 2MMNA 4ZL9A 3RBTA 5F07A 2REMA 2YV9A 2VCQA 2I81A 4K1FA 1R7HA 1YF0A 4O5RA 1TK8B 3J7Yb 2GGTA 4K2XA 5IMVA 3N5OA 3F3RA 2CT6A 5IMDA 3HY2A 5CP1A 3D21A 2IMKA 2LRNA 4OWYA 2WZ9A 1NHOA 1XIYA 5CREA 3EMPA 3M9KA 1BQ7A 3CTGA 2JADA 3LXTA 3QFAC 1SYRA 1O8WA 3I43A 3EMXA 4V1Ap 4F82A 4GQCA 3UVTA 3CRUA 3GFKA 4NWYA 4H86A 2F51A 2B1LA 3F4SA 2ZNMA 3GURA 5D73A 1SD8A 4MF5A 2ES7A 3R3EA 1YQ1A 2IPAA 4ZIJA 4X43A 4CY8A 1M0UA 1B4PA 4V2LA 1GUHA 4EVMA 4EE0A 3TRQA 4MPGA 3ME7A 2E0QA 3L0HA 3C71A 2PU9C 4AF2A 1PN0A 4BPYA 4Z2UA 2X4AA 5DQYA 2YANA 5DJLA 5GAPD 3QD9A 1SL1B 4YAVA 3LGCA 4G0KA 1EOHA 1XPVA 1SENA 2DSAA 3TKSA 1M9BA 3KM6A 4L5LA 1OC3A 2R0PA 4ZBAA 4MCUA 2HNLA 1K0OA 1GTIA 4E8HA 1SKRB 1V9WA 2WS2A 4K7OA 1ZMAA 5KN3A 1Z7RA 3EWLA 4WF4A 4WBJA 3WGEA 2MMZA 2EIQA 4E8EA 2JL4A 2GDRA 5D9TA 1AC1A 3WT2A 2EIRA 1JZRA 1S3RA 1YEXA 2YNXA 1GSSA 4ISDA 1Q98A 3GN3A 3GA4A 4NHZA 1TOFA 4GWRA 1GSYA 1ML6A 4HJ2A 3LXZA 4IBPA 2JZRA 4WF5A 2H1AA 3M9JA 1XVWA 3EE2A 2GT5A 4WR4A 4MH3A 2QKEA 1H4OA 2GS3A 4KUNA 3APOA 2R2JA 3DEXA 2WFCA 1A8YA 1BAYA 2DIYA 5L71A 3QMXA 3DIEA 4FYBA 5ECHB 1ZYQB 18GSA 2GQMA 3HJOA 4BVXB 2PVOC 2HSMA 4EL1A 4YQUA 2J9HA 3GTUB 2A2PA 1DUGA 1W4VA 1T4YA 1VRSD 3DYRA 4KE3A 4MZWA 3ED3A 3TOUA 1THXA 3VLNA 6GSXA 5ECPB 5JCUA 4OFMA 2NVLA 2CVKA 2YN1A 4V1Ag 4MZCA 3ZITA 3QPMA 4ID0A 1A0FA 1AAZA 2L57A 2K8SA 2JSYA 3I69A 4QL7A 5FHIA 4CDOA 4WR5A 1EGRA 4ZB9A 3UJ1A 4BWSA 2P5QA 3DD3A 1SKSB 1XWKA 5IMCA 4MJCA 3MIXA 1GTAA 1F2EA 3W8SA 2D2ZA 4USSA 2XC2A 5LCZA 2VCXA 4ACSA 4K7IA 5KOWA 3UOMA 4WBRD 3VPTA 2VD1A 1AQVA 5A5KA 4MF6A 4RQRA 3UBKA 1NW2A 2NPBA 4L0UA 2CAIA 6GSWA 4ZBDA 1F3BA 1FVJA 1A8LA 4LMVA 4DVCA 1OC8A 3G9BA 3TCOA 1WWJA 6GSUA 2VL2C 3FZAA 3D22A 2H1DA 2F3MA 2H74A 5GAND 2CV4A 4YH2A 5A4UA 2OBIA 2H70A 3F4RA 2CVBA 2K18A 4CW9A 2BMXA 2TRCP 2KHPA 3Q19A 1X9MB 4Q5FA 2HFDA 4OFTA 3TJJA 3RPNA 5CRGA 5B7CA 4BL7A 2HLSA 4GCIA 5LNKe 1TRVA 3UEMA 3ZZXA 3UL3A 4F03A 1EOGA 3EVIA 2PGTA 3IE3A 4RUVA 3P7XA 2MBTA 1N2AA 1TU7A 2H0GA 3ZVJA 2M72A 2N5AA 3FR9A 2R5GA 2A4HA 20GSA 2LQQA 6GSTA 4N0ZA 3HD5A 5IM9A 3DRNA 1MD3A 4XS4B 4PUFC 3GUSA 3VK9A 3N9JA 2YWOA 3KTLA 5BMUA 2DMMA 5EVOA 3BJ5A 3GHAA 3LJRA 1ABAA 3HA9A 1UA5A 2CAQA 1OC9B 1PD21 3M8NA 2PMTA 4TKYA 2DJJA 4ZB6A 3QR6A 4J57E 1EV4A 4K2DA 4LMWA 3GKNA 4JRRA 3Q18A 5F06A 4X4JA 1Q4JA 3UBLA 5CYYA 3OR5A 1VF4A 1RQMA 4MNNA 2YWIA 2VCTA 3FYGA 3ERFA 5HR2A 2FD3A 2DJKA 2I3YA 1BEDA 5LD0A 3VPQA 2VLUA 1Z3EA 1R4WA 5IMFA 4IQAA 1PL2A 2YZHA 3A2VA 1JZDA 2MMOA 3CMIA 4TXOA 3TB2A 4MMMA 3MWHA 2VIMA 5G30A 3FEUA 1JLWA 5IMAA 2KP2A 5J41A 1C72A 4V2MA 4XRAA 5DCHA 3M3MA 1AUCA 2PUKC 2IMIA 4F2IA 4Z7XA 3ERWA 1UC7A 3GH6A 5CO3A 3F9UA 3ZFLA 1K3YA 2CVDA 4HS1A 4GXZA 1M99A 3TKSC 5JCWA 3CXGA 1THOA 3TJFA 4D73B 2O87A 1PQNA 2L6DA 5J3RA 4KCEA 1M3JA 4ULXA 5B6NA 2AHEA 4KDUA 5FT3A 3IHQA 1A23A 1JZWA 4ZL7A 5B8AA 1PFOA 1FG4A 1U6TA 5AISA 1ZYPA 3KGKA 1V58A 4WXTA 4GSSA 4KDYA 2G2QA 4PUAA 2H73A 4ECJA 3ZTLA 3GRXA 5EL8A 2PPTA 3NZNA 5IIZA 3TGZA 4JU5A 3IC8A 1XWAA 3CRTA 1FB6A 1XW9A 3QOUA 2PERA 1Y25A 5CNWA 3GX8A 2GSSA 1FHEA 3PH9A 1PX7A 3JCML 1ZOFA 4KNDA 2YJ7A 2B5EA 4K5SA 3TKSE 4IKHA 3IAS2 1GSQA 4FIWA 3QCPA 5IOXA 4BWQA 2JU5A 3ZVJD 5JWOB 2K8VA 2QA2A 1TXXA 2H8LA 3FY7A 4OFNA 2IWTA 1FB0A 1X0RA 4JR6A 2H76A 3DVXA 4EDZA 2KLXA 1BJXA 3TKQA 1NHYA 1F6MC 4F0BA 2VM2A 2VCWA 2HI7A 4MLYA 4JE1A 4JZQA 1U88A 1WIKA 2FWFA 2M80A 2LJKA 1FVKA 4XCSA 5KN2A 3FKFA 4POLA 3SWLA 11GSA 3VURA 1FOHA 4HOJA 4IELA 2MYGA 4N30A 1XG8A 4HEA2 1OKTA 1S3AA 4KAEA 2H6XA 3IDVA 1TI1A 3PINA 1M2DA 3C1SA 4GRFA 2DJ2A 1GSEA 2AB6A 1PKWA 2VLVA 4PX1A 2C8UA 3KXOA 1DSBA 1TTZA 3EPTA 3A5WA 2KP1A 2WB9A 5J9BA 3ZMKA 3ZFBA 4ECCA 5J9CA 5IMZA 3LEFA 2DIZA 5DALA 3KTBA 2R0CA 3TRXA 2C4JA 2GQKA 5IO2A 3KP9A 3DWVA 4NXIA 1ZGNA 2NDOA 1K0AA 4Q5RA 1GRXA 4DSSB 5ENUA 3US3A 2VO4A 1YKAA 2C0EA 3QAVA 3FZ5A 4MABA 4POBA 4TR0A 4AGSA 2TIRA 3WGXA 4MF7A 4G0IA 2C0GA 2LUSA 3M1GA 4X1UA 2KOKA 3VI5A 1SJ6A 3GL5A 3G7IA 4I97A 1GULA 4FH8A 1EP8A 2VOCA 4A5PA 2E7PA 2OKAA 3H93A 4EUYA 4EF0A 1GNWA 1B9XC 4POKA 4DSQA 4BVXA 3UVHA 3DGQA 3GTUA 2JSZA 2LV3A 1CQHA 2B3SA 1F3AA 5ECOB 5EPFA 3FR6A 4HDEA 5G5FA 2YCDA 1GTUA 3GL3A 1G0TA 2K6VA 4IGJA 3K8NA 1B8XA 2OE1A 3F3QA 4KGIA 5DALB 2RM5A 4FQUA 2FWEA 3RPPA 2B5YA 4BVYB 1M2BA 2FUG2 3L9VA 3FZ4A 6GSYA 2NBSA 2H0IA 2C80A 2F8FA 3APQA 3Q74A 5JWQB 4KDXA 1A2MA 1AXDA 3GKKA 3HVVA 2HXKA 2LNSA 5EY6A 2VUPA 2ZCTA 3HYPA 1X9WB 1K0DA 2FNOA 1S3DA 2MBSA 1E2YA 2ALBA 2DJ0A 1YKCA 5D8IA 3IV4A 2V6KA 14GSA 4IJ3A 5IPHA 2H71A 4KH7A 1BX9A 2GTUA 5D9WA 3VWUA 2BTOT 1SD9A 1WRYA 2YWMA 1HNBA 4JBBA 1SK1A 4YAPA 4MK3A 2I1UA 2HZEB 2WULA 5FWGA 2O85A 3ZL5A 2V41A 5KEJA 1YZXA 3L9SA 4GF0A 5IO0A 3W6GA 4TRXA 1TU8A 5HFGA 5ECKB 1XWBA 2H01A 2M46A 1O7UA 3PPUA 2YJHA 4PURA 1ILOA 1PL1A 1X5DA 3TJGA 3O6TA 2IMFA 3RHCA 5HQPA 2OACA 2WRTA 3RDWA 2X8CA 5H5RA 2HSHA 4XHMA 3AY8A 1V98A 3IBHA 2XPEA 4KCAA 4J56E 1RK4A 2UZ8A 1M3IA 1F9MA 5DVBA 1PX6A 1XFLA 2PN8A 1AIUA 2IMEA 4NPBA 2E2MA 3MYDA 1GUMA 2LJRA 2KUCA 3GSTA 3O3TA 4PNFA 1AQXA 4MJEA 3KP8A 3UMAA 3TDGA 1TRUA 3DMLA 1TRWA 5E59A 1GNEA 4QL9A 1QUWA 1RW1A 3ZLPA 1R5AA 1CQGA 1EWXA 19GSA 4MDCA 3F6DA 2GLRA 1MTCA 3H1NA 4XS4A 3ME8A 10GSA 1PMTA 1K0CA 2FY6A 3L78A 1LU4A 1WOUA 2A4VA 5ELAA 1XW5A 4NHWA 5ECMB 1GWCA 3IK9A 4J2FA 4L8EA 3ZIJA 4HI7A 4NV2A 4OMVA 4O7HA 2RM6A 1OC9A 1FO5A 4EO3A 1LJRA 1I9DA 4IJIA 4MA9A 1AQWA 3P8WA 4HQSA 4F0CA 2IN3A 3H4KA 3D0ZA 2X8GA 4NV5A 4K0NA 2CZ3A 2YZUA 1GUKA 4Z2RA 5AIXA 1U3IA 5KN0A 3KMNA 4OO4A 3L9UA 3HDCA 5F8BA 2P0GA 4MP4A 3M0FA 3P90A 2XBQA 5GSSA 1T00A 2VL3A 1FOVA 5GSTA 2YPMA 4O32A 4TR1B 4ECIA 1IYHA 1EP7A 12GSA 1E6BA 3GIXA 2LTKA 1DE1A 3FRCA 4TR4A 1WMJA 22GSA 2GZYA 1Z7PA 1TP9A 2IMDA 1B4QA 5D96A 1DBYA 1G6WA 3IA1A 4P3YB 3D4MA 3TRPA 3FZ9A 4TOPA 3QDNA 1ZYNA 2OA7A 2O7KA 4OCFA 1QXHA 3GNJA 3CSJA 5C04A 1EEJA 3GV1A 1KBNA 5G1KA 1X5EA 3GH9A 1G7EA 2J23A 1XOAA 3CSIA 4D73A 2B1KA 4HSCX 4IP1A 5J5NA 3WGDA 2H72A 3LFLA 3A2WA 1OE7A 2YP6A 5AGYA 4X0XA 2XBIA 2R0GA 5D9XA 3ZREA 1ERUA 2DJ3A 5CRDA 4L0WA 1HD2A 4TW5A 4OD7A 3ZIVA 4JEDA 4YQVA 1SJZA 3LG6A 1G7OA 1G6YA 1HYUA 3EURA 1A2JA 2DKIA 3HKRA 3IRAA 2LRCA 2GSTA 1XWCA 3I9V2 16GSA 2VCVA 2LEGA 1XCCA 4PQ1A 3F63A 1DE2A 4IW9A 4WETA 1VF1A 2V2GA 1QQ2A 6GSSA 2HYXA 9GSSA 5IQYA 1TDIA 7GSSA 3VWVA 1GLPA 2WJUA 4EIQA 1ERWA 4KA0A 4KF9A 4HJMA 1HQOA 3HXSA 1OAZA 5BRTA 1YDKA 3LORA 1PSQA 2GZPA 1F37A 2CZ2A 3BOAA 4MJBA 2H1GA 3DXBA 3MAKA 4Q5NA 3S9FA 3ZMLA 3ERGA 2K9FA 4HZ4A 1ERTA 3MNGA 3UAPA 8GSSA 3TUEA 4IHUA 5J4UA 4IS0A 5DAKB 1YF1A 2L5LA 2OE3A 5DJMA 4PTSA 2FGXA 1O81A 4XIHA 4HU7A 2DBCA 4G19A 1T3BA 5AIVA 3PR8A 3IK7A 3GKMA 1YY7A 3L4NA 4MPFA 2H6YA 5CRHA 2VL9A 5D93A 1JHBA 2ZUPA 3LYPA 2X99A 1PGTA 4LL1B 1TK5B 1R26A 4MZBA 4WEYA 2LRTA 5KN1A 1XBSA 5HFIA 1WE0A 3TJBA 1SJIA 4EKZA 3KMOA 2F8AA 1WP0A 2HT9A 1XW6A 4O92A 3GYKA 1O73A 1QMVA 1GSFA 2FCHA 4V2NA 5ECIB 4F9ZA 4DSSA 2YOIA 1K0NA 2FLSA 4ML1A 2GT6A 4DSRA 2FWGA 3KZQA 2MMAA 5HFKA 1M7TA 4AJ6A 3G7YA 4HQZA 1GH2A 4TXVA 1WJKA 3F0IA 3SBCA 5ID2A 1FW1A 1HNAA 2DC5A 4ECBA 5GZZB 5C00A 1H75A 1Z5YE 1J08A 2VLTA 13GSA 3C8EA 1T7PB 3TKPA 1OKDA 4RI6A 1VGLA 1TJDA 5JWRB 2L4QA 2DLXA 1UN2A 2LQOA 4BVYA 2P31A 1SKWB 2FHEA 4EIPA 3BCIA 4LL4B 1NSWA 4IVFA 2OJLA 4KW6A 2XHFA 2WCIA 1KNGA 2DKHA 3DKSA 1GTBA 4G2EA 3VWWA 3HZ8A 1K3OA 2CA8A 1BYEA 5HR1A 5DCGA 4YKFA 3U5RE 4RI7A 1GSDA 1Y6EA 2OADA 3RAZA 1ZCPA 1MD4A 3O76A 5ID2B 2RUFA 3VWXA 3EU3A 5ABRA 3BD2A 1AW9A 4L5OA 4PXOA 4Z2TA 1QGVA 2AV4A 3WT1A 1T1VA 4FO5A 2HRNA 2HZEA 2B5XA 2C1YA 5COHA 1O8XA 4OO5A 2RIIA 3KH7A 3C73A 2R37A 1B48A 4PGTA 3NIVA 3NOFA 1ACVA 2GZZA 1GL8A 2I9HA 3FHKA 5DDLA 1PA3A 3HVSA 1B9YC 3KJYA 4ICYA 1URMA 2A2SA 1PRXA 2TRXA 1SYXA 4NMUA 2BJXA 1K0BA 1XOBA 2C0DA 2ON7A 1Z6MA 2C3QA 5ECSA 4G10A 3TJKA 5DQSA 3APSA 1SK0A 3IOSA 3P2AA 2QSIA 3U6VA 2QGVA 2G0FA 2PWJA 5HR0A 1XZOA 4JR4A 2VCZA 4XS1A 5ECLB 1YEPA 2R4VA 5G2ZA 3E0UA 1A0RP 1ST9A 1TK0B 4G9HA 3ZYWA 5IPGA 1HNCA 2CX3A 3R2QA 1J9BA 3IR4A 1V2AA 1EV9A 1EEMA 2N5FA 4TR3A 2H66A 1OYJA 2ON5A 1LBKA 1VF2A 1A24A 1O6JA 4N10A 4XRDA 4K6XA 1EZKA 4ZILA 3TKRA 2HE3A 2O8VB 3KIJA 2HRFA 2H0HA 1EGOA 3GMFA 2DMLA 4K7NA 2HRAA 2WGRA 2N5BA 4YQMA 3LSZA 1TRSA 4GSNA 1USBA 4OCEA 3C1RA 4K5RA 3GX0A 4EXJA 2GQLA 3LQ7A 3ISOA 4GTUA 4RQXA 2YV7A 4I2UA 3BCKA 3WYWA 2B6MA 3A3TA 4MJAA 1JLVA 1S3CA 3BBYA 1IYIA 4O5QA 1SU9A 1GP1A 4TR1A 2AUVA 2R3XA 2F9SA 2HZFA 1ZYEA 3EINA 4K8MA 5D9VA 4AJ8A 1I5GA 3IPZA 5ECQB 4N11A 1OE8A 1FAAA 1R5PA 3C7MA 2QC7A 3E3EA 2VM1A 5IOWA 1U87A 4KSOA 3GSSA 4XTSA 4POMA 4K0GA 3I6AA 3F4TA 1K3LA 2LS5A 3IHGA 5H5SA 3PGTA 3HCZA 1M9AA 4I5QA 5ECNB 5F05A 3ZRDA 3EC3A 1Z6NA 1BG5A 2H75A 3TOTA 4ZXGA 2O89A 2V32A 3IC4A 3A5IA 1Z9HA 3F6FA 1NM3A 4BA7A 1JFUA 2AAWA 1GSUA 2H6ZA 2JACA 4KX4A 5G31A 3KH9A 2PVQA 1MDKA 3V1WA 2C3TA 1XVQA 4HZ2A 4GQFA 3KEBA 4GSTA 4ZL8A 3CBUA 1GLQA 3EYTA 2IFQA 4Q5QA 3FR3A 3G7JA 2RUEA 2LNTA 4IP6A 5B8BA 2EC4A 1O85A 3HJPA 4I8BA 3DVWA 3E9JB 4I2TA 4ILFA 2MZCA 2A2RA 4G0LA 2H30A 3D5JA 4PQIA 4CY6A 3MSZA 2LKUA 4HU9A 2L6CA 4I6XA 17GSA 2DJ1A 1PKZA 4ZB8A 6GSVA 2IL3A 1T8EB 1XWGA 3H8QA 3IAM2 4PQHA 1A2LA 2H19A 2LJAA 2IJYA 1J0FA 1MDIA 3VI7A 3QAWA 4QQ7A 2R6KA 1JZOA 1PN9A 5KOXA 3GKXA 1K0MA 2E2GA 2FA8A 1MDJA 2HRKA 2GSRA 5ECRB 3QFBC 1X9SB 2LSTA 5DBQA 2JZTA 2YWNA 3LWAA 2EIOA 4YKGA 5DAKA 4BL7B 3H79A 4PNGA 3WD6A 2HSYA 2V1MA 1V40A 3KCMA 1W89A 2X49A 3QAGA 5AN1A 4LA1A 1V57A 2IFQB 2GVPA 4GLTA 5INYA 4BIKA 2CX4A 1ERVA 2L5OA 1ZL9A 4IQ1A 3CTFA 3HVXA 2AJQB 4KSMA 2L4CA 4K9ZA 4TVEA 1SL2B 5E4WA 4HUAA 1KTEA 4LLRA 5F0GA 3IXRA 4CHSA 2VD0A 4FYCA 2PBJA 3FK8A 3HJMA 2I4AA 2FWHA 3D4TA 3HVNA 2OBKA 3FMWA 5H5QA 2FA4A 2AYTA 2RLIA 5A4WA 3W8JA 4NAXA 1OVNA 1UVZA 2P5RA 3UIWA 5CRWA 3CYNA 1XXUA 3HHVA 3LW9A 1QK8A 2L59A 1QFNA 2Z9SA 4IN0A 3EU4A 4EC0A 2B7KA 2VL2A 4O5UA 4WKWA 3Q6OA 1ZZYA 5B6MA 3KD0A 4ML6A 2V6OA 3HZ4A 1N8JA 3CSHA 5ELGA 3A2XA 2IIYA 1YJ6A 3F8UA 4N0VA 1U3AA 1SL0B 5G1LA 1ON4A 2XPDA 1T4ZA 4FYUA 3RHBA 3MDKA 2C0FA 2B7JA 1M2AA 1KEBA 2JZSA 2WDUA 4TN8A 5A4VA 1SK2A 1TW9A 2CQ9A 3VFIA 2X64A 2GSQA 5CAXA 1TI3A 1VF3A 5G5EA 2OE0A 4MH2A
chains in the Genus database with same CATH topology
1TKDB 3UARA 2X8HA 4TXOB 4XS6A 2H1BA 2C3NA 4EDYA 3FW2A 2QA1A 3LYKA 4KB3A 1X5CA 2VAFA 2NTOA 5JCGA 4ZBBA 3J7Yk 1WPIA 1MEKA 4AJ7A 4DEJA 5HR3A 3D6IA 2MMNA 4ZL9A 3RBTA 5F07A 2REMA 2YV9A 2VCQA 2I81A 4K1FA 1R7HA 1YF0A 4O5RA 1TK8B 3J7Yb 2GGTA 4K2XA 5IMVA 3N5OA 3F3RA 2CT6A 5IMDA 3HY2A 5CP1A 3D21A 2IMKA 2LRNA 4OWYA 2WZ9A 1NHOA 1XIYA 5CREA 3EMPA 3M9KA 1BQ7A 3CTGA 2JADA 3LXTA 3QFAC 1SYRA 1O8WA 3I43A 3EMXA 4V1Ap 4F82A 4GQCA 3UVTA 3CRUA 3GFKA 4NWYA 4H86A 2F51A 2B1LA 3F4SA 2ZNMA 3GURA 5D73A 1SD8A 4MF5A 2ES7A 3R3EA 1YQ1A 2IPAA 4ZIJA 4X43A 4CY8A 1M0UA 1B4PA 4V2LA 1GUHA 4EVMA 4EE0A 3TRQA 4MPGA 3ME7A 2E0QA 3L0HA 3C71A 2PU9C 4AF2A 1PN0A 4BPYA 4Z2UA 2X4AA 5DQYA 2YANA 5DJLA 5GAPD 3QD9A 1SL1B 4YAVA 3LGCA 4G0KA 1EOHA 1XPVA 1SENA 2DSAA 3TKSA 1M9BA 3KM6A 4L5LA 1OC3A 2R0PA 4ZBAA 4MCUA 2HNLA 1K0OA 1GTIA 4E8HA 1SKRB 1V9WA 2WS2A 4K7OA 1ZMAA 5KN3A 1Z7RA 3EWLA 4WF4A 4WBJA 3WGEA 2MMZA 2EIQA 4E8EA 2JL4A 2GDRA 5D9TA 1AC1A 3WT2A 2EIRA 1JZRA 1YEXA 2YNXA 1GSSA 4ISDA 1Q98A 3GN3A 3GA4A 4NHZA 1TOFA 4GWRA 1GSYA 1ML6A 4HJ2A 3LXZA 4IBPA 2JZRA 4WF5A 2H1AA 3M9JA 1XVWA 3EE2A 2GT5A 4WR4A 4MH3A 2QKEA 1H4OA 2GS3A 4KUNA 3APOA 2R2JA 3DEXA 2WFCA 1A8YA 1BAYA 2DIYA 5L71A 3QMXA 3DIEA 4FYBA 5ECHB 1ZYQB 18GSA 2GQMA 3HJOA 4BVXB 2PVOC 2HSMA 4EL1A 4YQUA 2J9HA 3GTUB 2A2PA 1DUGA 1W4VA 1T4YA 1VRSD 3DYRA 4KE3A 4MZWA 3ED3A 3TOUA 1THXA 3VLNA 6GSXA 5ECPB 5JCUA 4OFMA 2NVLA 2CVKA 2YN1A 4V1Ag 4MZCA 3ZITA 3QPMA 4ID0A 1A0FA 1AAZA 2L57A 2K8SA 2JSYA 3I69A 4QL7A 5FHIA 4CDOA 4WR5A 1EGRA 4ZB9A 3UJ1A 4BWSA 2P5QA 3DD3A 1SKSB 1XWKA 5IMCA 4MJCA 3MIXA 1GTAA 1F2EA 3W8SA 2D2ZA 4USSA 2XC2A 5LCZA 2VCXA 4ACSA 4K7IA 5KOWA 3UOMA 4WBRD 3VPTA 2VD1A 1AQVA 5A5KA 4MF6A 4RQRA 3UBKA 1NW2A 2NPBA 4L0UA 2CAIA 6GSWA 4ZBDA 1F3BA 1FVJA 1A8LA 4LMVA 4DVCA 1OC8A 3G9BA 3TCOA 1WWJA 6GSUA 2VL2C 3FZAA 3D22A 2H1DA 2F3MA 2H74A 5GAND 2CV4A 4YH2A 5A4UA 2OBIA 2H70A 3F4RA 2CVBA 2K18A 4CW9A 2BMXA 2TRCP 2KHPA 3Q19A 1X9MB 4Q5FA 2HFDA 4OFTA 3TJJA 3RPNA 5CRGA 5B7CA 4BL7A 2HLSA 4GCIA 5LNKe 1TRVA 3UEMA 3ZZXA 3UL3A 4F03A 1EOGA 3EVIA 2PGTA 3IE3A 4RUVA 3P7XA 2MBTA 1N2AA 1TU7A 2H0GA 3ZVJA 2M72A 2N5AA 3FR9A 2R5GA 2A4HA 20GSA 2LQQA 6GSTA 4N0ZA 3HD5A 5IM9A 3DRNA 1MD3A 4XS4B 4PUFC 3GUSA 3VK9A 3N9JA 2YWOA 3KTLA 5BMUA 2DMMA 5EVOA 3BJ5A 3GHAA 3LJRA 1ABAA 3HA9A 1UA5A 2CAQA 1OC9B 1PD21 3M8NA 2PMTA 4TKYA 2DJJA 4ZB6A 3QR6A 4J57E 1EV4A 4K2DA 4LMWA 3GKNA 4JRRA 3Q18A 5F06A 4X4JA 1Q4JA 3UBLA 5CYYA 3OR5A 1VF4A 1RQMA 4MNNA 2YWIA 2VCTA 3FYGA 3ERFA 5HR2A 2FD3A 2DJKA 2I3YA 1BEDA 5LD0A 3VPQA 2VLUA 1Z3EA 1R4WA 5IMFA 4IQAA 1PL2A 2YZHA 3A2VA 1JZDA 2MMOA 3CMIA 4TXOA 3TB2A 4MMMA 3MWHA 2VIMA 5G30A 3FEUA 1JLWA 5IMAA 2KP2A 5J41A 1C72A 4V2MA 4XRAA 5DCHA 3M3MA 1AUCA 2PUKC 2IMIA 4F2IA 4Z7XA 3ERWA 1UC7A 3GH6A 5CO3A 3F9UA 3ZFLA 1K3YA 2CVDA 4HS1A 4GXZA 1M99A 3TKSC 5JCWA 3CXGA 1THOA 3TJFA 4D73B 2O87A 1PQNA 2L6DA 5J3RA 4KCEA 4ULXA 5B6NA 2AHEA 4KDUA 5FT3A 3IHQA 1A23A 1JZWA 4ZL7A 5B8AA 1FG4A 1U6TA 5AISA 1ZYPA 3KGKA 1V58A 4WXTA 4GSSA 4KDYA 2G2QA 4PUAA 2H73A 4ECJA 3ZTLA 3GRXA 5EL8A 2PPTA 3NZNA 5IIZA 3TGZA 4JU5A 3IC8A 1XWAA 3CRTA 1FB6A 1XW9A 3QOUA 2PERA 1Y25A 5CNWA 3GX8A 2GSSA 1FHEA 3PH9A 1PX7A 3JCML 1ZOFA 4KNDA 2YJ7A 2B5EA 4K5SA 3TKSE 4IKHA 3IAS2 1GSQA 4FIWA 3QCPA 5IOXA 4BWQA 2JU5A 3ZVJD 5JWOB 2K8VA 2QA2A 1TXXA 2H8LA 3FY7A 4OFNA 2IWTA 1FB0A 1X0RA 4JR6A 2H76A 3DVXA 4EDZA 2KLXA 1BJXA 3TKQA 1NHYA 1F6MC 4F0BA 2VM2A 2VCWA 2HI7A 4MLYA 4JE1A 4JZQA 1U88A 1WIKA 2FWFA 2M80A 2LJKA 1FVKA 4XCSA 5KN2A 3FKFA 4POLA 3SWLA 11GSA 3VURA 1FOHA 4HOJA 4IELA 2MYGA 4N30A 4HEA2 1OKTA 1S3AA 4KAEA 2H6XA 3IDVA 1TI1A 3PINA 1M2DA 3C1SA 4GRFA 2DJ2A 1GSEA 2AB6A 1PKWA 2VLVA 4PX1A 2C8UA 3KXOA 1DSBA 1TTZA 3EPTA 3A5WA 2KP1A 2WB9A 5J9BA 3ZMKA 3ZFBA 4ECCA 5J9CA 5IMZA 3LEFA 2DIZA 5DALA 3KTBA 2R0CA 3TRXA 2C4JA 2GQKA 5IO2A 3KP9A 3DWVA 4NXIA 1ZGNA 2NDOA 1K0AA 4Q5RA 1GRXA 4DSSB 5ENUA 3US3A 2VO4A 1YKAA 2C0EA 3QAVA 3FZ5A 4MABA 4POBA 4TR0A 4AGSA 2TIRA 3WGXA 4MF7A 4G0IA 2C0GA 2LUSA 3M1GA 4X1UA 2KOKA 3VI5A 1SJ6A 3GL5A 3G7IA 4I97A 1GULA 4FH8A 1EP8A 2VOCA 4A5PA 2E7PA 2OKAA 3H93A 4EUYA 4EF0A 1GNWA 1B9XC 4POKA 4DSQA 4BVXA 3UVHA 3DGQA 3GTUA 2JSZA 2LV3A 1CQHA 2B3SA 1F3AA 5ECOB 5EPFA 3FR6A 4HDEA 5G5FA 2YCDA 1GTUA 3GL3A 1G0TA 2K6VA 4IGJA 3K8NA 1B8XA 2OE1A 3F3QA 4KGIA 5DALB 2RM5A 4FQUA 2FWEA 3RPPA 2B5YA 4BVYB 1M2BA 2FUG2 3L9VA 3FZ4A 6GSYA 2NBSA 2H0IA 2C80A 2F8FA 3APQA 3Q74A 5JWQB 4KDXA 1A2MA 1AXDA 3GKKA 3HVVA 2HXKA 2LNSA 5EY6A 2VUPA 2ZCTA 3HYPA 1X9WB 1K0DA 2FNOA 1S3DA 2MBSA 1E2YA 2ALBA 2DJ0A 1YKCA 5D8IA 3IV4A 2V6KA 14GSA 4IJ3A 5IPHA 2H71A 4KH7A 1BX9A 2GTUA 5D9WA 3VWUA 2BTOT 1SD9A 1WRYA 2YWMA 1HNBA 4JBBA 1SK1A 4YAPA 4MK3A 2I1UA 2HZEB 2WULA 5FWGA 2O85A 3ZL5A 2V41A 5KEJA 1YZXA 3L9SA 4GF0A 5IO0A 3W6GA 4TRXA 1TU8A 5HFGA 5ECKB 1XWBA 2H01A 2M46A 1O7UA 3PPUA 2YJHA 4PURA 1ILOA 1PL1A 1X5DA 3TJGA 3O6TA 2IMFA 3RHCA 5HQPA 2OACA 2WRTA 3RDWA 2X8CA 5H5RA 2HSHA 4XHMA 3AY8A 1V98A 3IBHA 2XPEA 4KCAA 4J56E 1RK4A 2UZ8A 1F9MA 5DVBA 1PX6A 1XFLA 2PN8A 1AIUA 2IMEA 4NPBA 2E2MA 3MYDA 1GUMA 2LJRA 2KUCA 3GSTA 3O3TA 4PNFA 1AQXA 4MJEA 3KP8A 3UMAA 3TDGA 1TRUA 3DMLA 1TRWA 5E59A 1GNEA 4QL9A 1QUWA 1RW1A 3ZLPA 1R5AA 1CQGA 1EWXA 19GSA 4MDCA 3F6DA 2GLRA 1MTCA 3H1NA 4XS4A 3ME8A 10GSA 1PMTA 1K0CA 2FY6A 3L78A 1LU4A 1WOUA 2A4VA 5ELAA 1XW5A 4NHWA 5ECMB 1GWCA 3IK9A 4J2FA 4L8EA 3ZIJA 4HI7A 4NV2A 4OMVA 4O7HA 2RM6A 1OC9A 1FO5A 4EO3A 1LJRA 1I9DA 4IJIA 4MA9A 1AQWA 3P8WA 4HQSA 4F0CA 2IN3A 3H4KA 3D0ZA 2X8GA 4NV5A 4K0NA 2CZ3A 2YZUA 1GUKA 4Z2RA 5AIXA 1U3IA 5KN0A 3KMNA 4OO4A 3L9UA 3HDCA 5F8BA 2P0GA 4MP4A 3M0FA 3P90A 2XBQA 5GSSA 1T00A 2VL3A 1FOVA 5GSTA 2YPMA 4O32A 4TR1B 4ECIA 1IYHA 1EP7A 12GSA 1E6BA 3GIXA 2LTKA 1DE1A 3FRCA 4TR4A 1WMJA 22GSA 2GZYA 1Z7PA 1TP9A 2IMDA 1B4QA 5D96A 1DBYA 1G6WA 3IA1A 4P3YB 3D4MA 3TRPA 3FZ9A 4TOPA 3QDNA 1ZYNA 2OA7A 2O7KA 4OCFA 1QXHA 3GNJA 3CSJA 5C04A 1EEJA 3GV1A 1KBNA 5G1KA 1X5EA 3GH9A 1G7EA 2J23A 1XOAA 3CSIA 4D73A 2B1KA 4IP1A 5J5NA 3WGDA 2H72A 3LFLA 3A2WA 1OE7A 2YP6A 5AGYA 4X0XA 2XBIA 2R0GA 5D9XA 3ZREA 1ERUA 2DJ3A 5CRDA 4L0WA 1HD2A 4TW5A 4OD7A 3ZIVA 4JEDA 4YQVA 1SJZA 3LG6A 1G7OA 1G6YA 1HYUA 3EURA 1A2JA 2DKIA 3HKRA 3IRAA 2LRCA 2GSTA 1XWCA 3I9V2 16GSA 2VCVA 2LEGA 1XCCA 4PQ1A 3F63A 1DE2A 4IW9A 4WETA 1VF1A 2V2GA 1QQ2A 6GSSA 2HYXA 9GSSA 5IQYA 1TDIA 7GSSA 3VWVA 1GLPA 2WJUA 4EIQA 1ERWA 4KA0A 4KF9A 4HJMA 1HQOA 3HXSA 1OAZA 5BRTA 1YDKA 3LORA 1PSQA 2GZPA 1F37A 2CZ2A 3BOAA 4MJBA 2H1GA 3DXBA 3MAKA 4Q5NA 3S9FA 3ZMLA 3ERGA 2K9FA 4HZ4A 1ERTA 3MNGA 3UAPA 8GSSA 3TUEA 4IHUA 5J4UA 4IS0A 5DAKB 1YF1A 2L5LA 2OE3A 5DJMA 4PTSA 2FGXA 1O81A 4XIHA 4HU7A 2DBCA 4G19A 1T3BA 5AIVA 3PR8A 3IK7A 3GKMA 1YY7A 3L4NA 4MPFA 2H6YA 5CRHA 2VL9A 5D93A 1JHBA 2ZUPA 3LYPA 2X99A 1PGTA 4LL1B 1TK5B 1R26A 4MZBA 4WEYA 2LRTA 5KN1A 1XBSA 5HFIA 1WE0A 3TJBA 1SJIA 4EKZA 3KMOA 2F8AA 1WP0A 2HT9A 1XW6A 4O92A 3GYKA 1O73A 1QMVA 1GSFA 2FCHA 4V2NA 5ECIB 4F9ZA 4DSSA 2YOIA 1K0NA 2FLSA 4ML1A 2GT6A 4DSRA 2FWGA 3KZQA 2MMAA 5HFKA 1M7TA 4AJ6A 3G7YA 4HQZA 1GH2A 4TXVA 1WJKA 3F0IA 3SBCA 5ID2A 1FW1A 1HNAA 2DC5A 4ECBA 5GZZB 5C00A 1H75A 1Z5YE 1J08A 2VLTA 13GSA 3C8EA 1T7PB 3TKPA 1OKDA 4RI6A 1VGLA 1TJDA 5JWRB 2L4QA 2DLXA 1UN2A 2LQOA 4BVYA 2P31A 1SKWB 2FHEA 4EIPA 3BCIA 4LL4B 1NSWA 4IVFA 2OJLA 4KW6A 2XHFA 2WCIA 1KNGA 2DKHA 3DKSA 1GTBA 4G2EA 3VWWA 3HZ8A 1K3OA 2CA8A 1BYEA 5HR1A 5DCGA 4YKFA 3U5RE 4RI7A 1GSDA 1Y6EA 2OADA 3RAZA 1ZCPA 1MD4A 3O76A 5ID2B 2RUFA 3VWXA 3EU3A 5ABRA 3BD2A 1AW9A 4L5OA 4PXOA 4Z2TA 1QGVA 2AV4A 3WT1A 1T1VA 4FO5A 2HRNA 2HZEA 2B5XA 2C1YA 5COHA 1O8XA 4OO5A 2RIIA 3KH7A 3C73A 2R37A 1B48A 4PGTA 3NIVA 3NOFA 1ACVA 2GZZA 1GL8A 2I9HA 3FHKA 5DDLA 1PA3A 3HVSA 1B9YC 3KJYA 4ICYA 1URMA 2A2SA 1PRXA 2TRXA 1SYXA 4NMUA 2BJXA 1K0BA 1XOBA 2C0DA 2ON7A 1Z6MA 2C3QA 5ECSA 4G10A 3TJKA 5DQSA 3APSA 1SK0A 3IOSA 3P2AA 2QSIA 3U6VA 2QGVA 2G0FA 2PWJA 5HR0A 1XZOA 4JR4A 2VCZA 4XS1A 5ECLB 1YEPA 2R4VA 5G2ZA 3E0UA 1A0RP 1ST9A 1TK0B 4G9HA 3ZYWA 5IPGA 1HNCA 2CX3A 3R2QA 1J9BA 3IR4A 1V2AA 1EV9A 1EEMA 2N5FA 4TR3A 2H66A 1OYJA 2ON5A 1LBKA 1VF2A 1A24A 1O6JA 4N10A 4XRDA 4K6XA 1EZKA 4ZILA 3TKRA 2HE3A 2O8VB 3KIJA 2HRFA 2H0HA 1EGOA 3GMFA 2DMLA 4K7NA 2HRAA 2WGRA 2N5BA 4YQMA 3LSZA 1TRSA 4GSNA 1USBA 4OCEA 3C1RA 4K5RA 3GX0A 4EXJA 2GQLA 3LQ7A 3ISOA 4GTUA 4RQXA 2YV7A 4I2UA 3BCKA 3WYWA 2B6MA 3A3TA 4MJAA 1JLVA 1S3CA 3BBYA 1IYIA 4O5QA 1SU9A 1GP1A 4TR1A 2AUVA 2R3XA 2F9SA 2HZFA 1ZYEA 3EINA 4K8MA 5D9VA 4AJ8A 1I5GA 3IPZA 5ECQB 4N11A 1OE8A 1FAAA 1R5PA 3C7MA 2QC7A 3E3EA 2VM1A 5IOWA 1U87A 4KSOA 3GSSA 4XTSA 4POMA 4K0GA 3I6AA 3F4TA 1K3LA 2LS5A 3IHGA 5H5SA 3PGTA 3HCZA 1M9AA 4I5QA 5ECNB 5F05A 3ZRDA 3EC3A 1Z6NA 1BG5A 2H75A 3TOTA 4ZXGA 2O89A 2V32A 3IC4A 3A5IA 1Z9HA 3F6FA 1NM3A 4BA7A 1JFUA 2AAWA 1GSUA 2H6ZA 2JACA 4KX4A 5G31A 3KH9A 2PVQA 1MDKA 3V1WA 2C3TA 1XVQA 4HZ2A 4GQFA 3KEBA 4GSTA 4ZL8A 3CBUA 1GLQA 3EYTA 2IFQA 4Q5QA 3FR3A 3G7JA 2RUEA 2LNTA 4IP6A 5B8BA 2EC4A 1O85A 3HJPA 4I8BA 3DVWA 3E9JB 4I2TA 4ILFA 2MZCA 2A2RA 4G0LA 2H30A 3D5JA 4PQIA 4CY6A 3MSZA 2LKUA 4HU9A 2L6CA 4I6XA 17GSA 2DJ1A 1PKZA 4ZB8A 6GSVA 2IL3A 1T8EB 1XWGA 3H8QA 3IAM2 4PQHA 1A2LA 2H19A 2LJAA 2IJYA 1J0FA 1MDIA 3VI7A 3QAWA 4QQ7A 2R6KA 1JZOA 1PN9A 5KOXA 3GKXA 1K0MA 2E2GA 2FA8A 1MDJA 2HRKA 2GSRA 5ECRB 3QFBC 1X9SB 2LSTA 5DBQA 2JZTA 2YWNA 3LWAA 2EIOA 4YKGA 5DAKA 4BL7B 3H79A 4PNGA 3WD6A 2HSYA 2V1MA 1V40A 3KCMA 1W89A 2X49A 3QAGA 5AN1A 4LA1A 1V57A 2IFQB 2GVPA 4GLTA 5INYA 2CX4A 1ERVA 2L5OA 1ZL9A 4IQ1A 3CTFA 3HVXA 2AJQB 4KSMA 2L4CA 4K9ZA 4TVEA 1SL2B 5E4WA 4HUAA 1KTEA 4LLRA 5F0GA 3IXRA 4CHSA 2VD0A 4FYCA 2PBJA 3FK8A 3HJMA 2I4AA 2FWHA 3D4TA 2OBKA 3FMWA 5H5QA 2FA4A 2AYTA 2RLIA 5A4WA 3W8JA 4NAXA 1OVNA 1UVZA 2P5RA 3UIWA 5CRWA 3CYNA 1XXUA 3HHVA 3LW9A 1QK8A 2L59A 1QFNA 2Z9SA 4IN0A 3EU4A 4EC0A 2B7KA 2VL2A 4O5UA 4WKWA 3Q6OA 1ZZYA 5B6MA 3KD0A 4ML6A 2V6OA 3HZ4A 1N8JA 3CSHA 5ELGA 3A2XA 2IIYA 1YJ6A 3F8UA 4N0VA 1U3AA 1SL0B 5G1LA 1ON4A 2XPDA 1T4ZA 4FYUA 3RHBA 3MDKA 2C0FA 2B7JA 1M2AA 1KEBA 2JZSA 2WDUA 4TN8A 5A4VA 1SK2A 1TW9A 2CQ9A 3VFIA 2X64A 2GSQA 5CAXA 1TI3A 1VF3A 5G5EA 2OE0A 4MH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TKD B;  3UAR A;  2X8H A;  4TXO B;  4XS6 A;  2H1B A;  2C3N A;  4EDY A;  3FW2 A;  3LYK A;  4KB3 A;  1X5C A;  2VAF A;  2NTO A;  5JCG A;  4ZBB A;  3J7Y k;  1WPI A;  1MEK A;  4AJ7 A;  4DEJ A;  5HR3 A;  3D6I A;  2MMN A;  4ZL9 A;  3RBT A;  5F07 A;  2REM A;  2YV9 A;  2VCQ A;  2I81 A;  4K1F A;  1R7H A;  1YF0 A;  4O5R A;  1TK8 B;  3J7Y b;  2GGT A;  5IMV A;  3N5O A;  3F3R A;  2CT6 A;  5IMD A;  3HY2 A;  5CP1 A;  3D21 A;  2IMK A;  2LRN A;  4OWY A;  2WZ9 A;  1NHO A;  1XIY A;  5CRE A;  3EMP A;  3M9K A;  1BQ7 A;  3CTG A;  2JAD A;  3LXT A;  3QFA C;  1SYR A;  1O8W A;  3I43 A;  3EMX A;  4V1A p;  4F82 A;  4GQC A;  3UVT A;  3CRU A;  3GFK A;  4NWY A;  4H86 A;  2F51 A;  2B1L A;  3F4S A;  2ZNM A;  3GUR A;  5D73 A;  1SD8 A;  4MF5 A;  2ES7 A;  1YQ1 A;  2IPA A;  4ZIJ A;  4X43 A;  1M0U A;  1B4P A;  4V2L A;  1GUH A;  4EVM A;  4EE0 A;  3TRQ A;  4MPG A;  3ME7 A;  2E0Q A;  3L0H A;  3C71 A;  2PU9 C;  4AF2 A;  4BPY A;  5DQY A;  2YAN A;  5DJL A;  5GAP D;  3QD9 A;  1SL1 B;  4YAV A;  3LGC A;  1EOH A;  1XPV A;  1SEN A;  2DSA A;  3TKS A;  1M9B A;  3KM6 A;  4L5L A;  1OC3 A;  4ZBA A;  4MCU A;  2HNL A;  1K0O A;  1GTI A;  4E8H A;  1SKR B;  1V9W A;  2WS2 A;  4K7O A;  1ZMA A;  5KN3 A;  1Z7R A;  3EWL A;  4WF4 A;  4WBJ A;  3WGE A;  2MMZ A;  2EIQ A;  4E8E A;  2JL4 A;  2GDR A;  5D9T A;  1AC1 A;  3WT2 A;  2EIR A;  1JZR A;  1YEX A;  2YNX A;  1GSS A;  4ISD A;  1Q98 A;  3GN3 A;  3GA4 A;  4NHZ A;  1TOF A;  4GWR A;  1GSY A;  1ML6 A;  4HJ2 A;  3LXZ A;  4IBP A;  2JZR A;  4WF5 A;  2H1A A;  3M9J A;  1XVW A;  3EE2 A;  2GT5 A;  4WR4 A;  4MH3 A;  2QKE A;  1H4O A;  2GS3 A;  4KUN A;  3APO A;  2R2J A;  3DEX A;  2WFC A;  1A8Y A;  1BAY A;  2DIY A;  5L71 A;  3QMX A;  3DIE A;  4FYB A;  5ECH B;  1ZYQ B;  18GS A;  2GQM A;  3HJO A;  2PVO C;  4EL1 A;  4YQU A;  2J9H A;  3GTU B;  1DUG A;  1W4V A;  1T4Y A;  1VRS D;  3DYR A;  4KE3 A;  4MZW A;  3ED3 A;  3TOU A;  1THX A;  3VLN A;  6GSX A;  5ECP B;  5JCU A;  4OFM A;  2NVL A;  2CVK A;  2YN1 A;  4V1A g;  4MZC A;  3ZIT A;  3QPM A;  4ID0 A;  1A0F A;  1AAZ A;  2L57 A;  2K8S A;  2JSY A;  3I69 A;  4QL7 A;  5FHI A;  4CDO A;  4WR5 A;  1EGR A;  4ZB9 A;  3UJ1 A;  4BWS A;  2P5Q A;  3DD3 A;  1SKS B;  1XWK A;  5IMC A;  4MJC A;  1GTA A;  1F2E A;  3W8S A;  2D2Z A;  2XC2 A;  5LCZ A;  2VCX A;  4ACS A;  4K7I A;  3UOM A;  4WBR D;  3VPT A;  2VD1 A;  1AQV A;  5A5K A;  4MF6 A;  4RQR A;  3UBK A;  1NW2 A;  2NPB A;  4L0U A;  2CAI A;  6GSW A;  4ZBD A;  1F3B A;  1FVJ A;  1A8L A;  4LMV A;  4DVC A;  1OC8 A;  3G9B A;  3TCO A;  1WWJ A;  6GSU A;  2VL2 C;  3FZA A;  3D22 A;  2H1D A;  2F3M A;  2H74 A;  5GAN D;  2CV4 A;  4YH2 A;  5A4U A;  2OBI A;  2H70 A;  3F4R A;  2CVB A;  2K18 A;  4CW9 A;  2BMX A;  2TRC P;  2KHP A;  3Q19 A;  1X9M B;  4Q5F A;  2HFD A;  4OFT A;  3TJJ A;  3RPN A;  5CRG A;  5B7C A;  4BL7 A;  2HLS A;  4GCI A;  5LNK e;  1TRV A;  3UEM A;  3ZZX A;  3UL3 A;  4F03 A;  1EOG A;  3EVI A;  2PGT A;  3IE3 A;  4RUV A;  3P7X A;  2MBT A;  1N2A A;  1TU7 A;  2H0G A;  3ZVJ A;  2M72 A;  2N5A A;  3FR9 A;  2R5G A;  20GS A;  2LQQ A;  6GST A;  4N0Z A;  3HD5 A;  5IM9 A;  3DRN A;  1MD3 A;  4XS4 B;  4PUF C;  3GUS A;  3VK9 A;  3N9J A;  2YWO A;  3KTL A;  2DMM A;  5EVO A;  3BJ5 A;  3GHA A;  3LJR A;  1ABA A;  3HA9 A;  1UA5 A;  2CAQ A;  1OC9 B;  1PD2 1;  3M8N A;  2PMT A;  4TKY A;  2DJJ A;  4ZB6 A;  3QR6 A;  4J57 E;  1EV4 A;  4K2D A;  4LMW A;  3GKN A;  4JRR A;  3Q18 A;  5F06 A;  1Q4J A;  3UBL A;  5CYY A;  3OR5 A;  1VF4 A;  1RQM A;  2YWI A;  2VCT A;  3FYG A;  3ERF A;  5HR2 A;  2FD3 A;  2DJK A;  2I3Y A;  1BED A;  5LD0 A;  3VPQ A;  2VLU A;  1Z3E A;  1R4W A;  5IMF A;  4IQA A;  1PL2 A;  2YZH A;  3A2V A;  1JZD A;  2MMO A;  3CMI A;  4TXO A;  3TB2 A;  4MMM A;  3MWH A;  2VIM A;  5G30 A;  3FEU A;  1JLW A;  5IMA A;  2KP2 A;  5J41 A;  1C72 A;  4V2M A;  4XRA A;  5DCH A;  3M3M A;  1AUC A;  2PUK C;  2IMI A;  4F2I A;  4Z7X A;  3ERW A;  1UC7 A;  3GH6 A;  5CO3 A;  3F9U A;  3ZFL A;  1K3Y A;  2CVD A;  4HS1 A;  4GXZ A;  1M99 A;  3TKS C;  5JCW A;  3CXG A;  1THO A;  3TJF A;  4D73 B;  2O87 A;  1PQN A;  2L6D A;  5J3R A;  4KCE A;  4ULX A;  5B6N A;  2AHE A;  4KDU A;  5FT3 A;  3IHQ A;  1A23 A;  1JZW A;  4ZL7 A;  5B8A A;  1FG4 A;  1U6T A;  5AIS A;  3KGK A;  1V58 A;  4WXT A;  4GSS A;  4KDY A;  2G2Q A;  4PUA A;  2H73 A;  4ECJ A;  3ZTL A;  3GRX A;  5EL8 A;  2PPT A;  3NZN A;  5IIZ A;  3TGZ A;  4JU5 A;  1XWA A;  3CRT A;  1FB6 A;  1XW9 A;  3QOU A;  2PER A;  1Y25 A;  5CNW A;  3GX8 A;  2GSS A;  1FHE A;  3PH9 A;  1PX7 A;  3JCM L;  1ZOF A;  4KND A;  2YJ7 A;  2B5E A;  3TKS E;  4IKH A;  3IAS 2;  1GSQ A;  4FIW A;  3QCP A;  5IOX A;  4BWQ A;  2JU5 A;  3ZVJ D;  5JWO B;  2K8V A;  1TXX A;  2H8L A;  3FY7 A;  4OFN A;  2IWT A;  1FB0 A;  1X0R A;  4JR6 A;  2H76 A;  3DVX A;  4EDZ A;  2KLX A;  1BJX A;  3TKQ A;  1NHY A;  1F6M C;  4F0B A;  2VM2 A;  2VCW A;  2HI7 A;  4MLY A;  4JE1 A;  4JZQ A;  1U88 A;  1WIK A;  2FWF A;  2M80 A;  2LJK A;  1FVK A;  4XCS A;  5KN2 A;  3FKF A;  4POL A;  3SWL A;  11GS A;  3VUR A;  4HOJ A;  4IEL A;  2MYG A;  4N30 A;  4HEA 2;  1OKT A;  1S3A A;  4KAE A;  2H6X A;  3IDV A;  1TI1 A;  3PIN A;  1M2D A;  3C1S A;  4GRF A;  2DJ2 A;  1GSE A;  2AB6 A;  1PKW A;  2VLV A;  4PX1 A;  2C8U A;  3KXO A;  1DSB A;  1TTZ A;  3A5W A;  2KP1 A;  2WB9 A;  5J9B A;  3ZMK A;  3ZFB A;  4ECC A;  5J9C A;  5IMZ A;  3LEF A;  2DIZ A;  5DAL A;  3KTB A;  3TRX A;  2C4J A;  2GQK A;  5IO2 A;  3KP9 A;  3DWV A;  4NXI A;  1ZGN A;  2NDO A;  1K0A A;  4Q5R A;  1GRX A;  4DSS B;  5ENU A;  3US3 A;  2VO4 A;  1YKA A;  2C0E A;  3QAV A;  3FZ5 A;  4MAB A;  4POB A;  4TR0 A;  4AGS A;  2TIR A;  3WGX A;  4MF7 A;  2C0G A;  2LUS A;  3M1G A;  4X1U A;  2KOK A;  3VI5 A;  1SJ6 A;  3GL5 A;  3G7I A;  4I97 A;  1GUL A;  4FH8 A;  1EP8 A;  2VOC A;  2E7P A;  2OKA A;  3H93 A;  4EUY A;  4EF0 A;  1GNW A;  1B9X C;  4POK A;  4DSQ A;  4BVX A;  3UVH A;  3DGQ A;  3GTU A;  2JSZ A;  2LV3 A;  1CQH A;  2B3S A;  1F3A A;  5ECO B;  5EPF A;  3FR6 A;  4HDE A;  5G5F A;  2YCD A;  1GTU A;  3GL3 A;  1G0T A;  2K6V A;  4IGJ A;  3K8N A;  1B8X A;  2OE1 A;  3F3Q A;  4KGI A;  5DAL B;  2RM5 A;  2FWE A;  3RPP A;  2B5Y A;  1M2B A;  2FUG 2;  3L9V A;  3FZ4 A;  6GSY A;  2NBS A;  2H0I A;  2C80 A;  2F8F A;  3APQ A;  3Q74 A;  5JWQ B;  4KDX A;  1A2M A;  1AXD A;  3GKK A;  3HVV A;  2HXK A;  2LNS A;  5EY6 A;  2VUP A;  2ZCT A;  3HYP A;  1X9W B;  1K0D A;  2FNO A;  1S3D A;  2MBS A;  1E2Y A;  2ALB A;  2DJ0 A;  1YKC A;  5D8I A;  3IV4 A;  2V6K A;  14GS A;  4IJ3 A;  5IPH A;  2H71 A;  4KH7 A;  1BX9 A;  2GTU A;  5D9W A;  3VWU A;  2BTO T;  1SD9 A;  1WRY A;  2YWM A;  1HNB A;  4JBB A;  1SK1 A;  4YAP A;  4MK3 A;  2I1U A;  2HZE B;  2WUL A;  5FWG A;  2O85 A;  3ZL5 A;  2V41 A;  5KEJ A;  1YZX A;  3L9S A;  4GF0 A;  5IO0 A;  3W6G A;  4TRX A;  1TU8 A;  5HFG A;  5ECK B;  1XWB A;  2H01 A;  2M46 A;  1O7U A;  2YJH A;  4PUR A;  1ILO A;  1PL1 A;  1X5D A;  3TJG A;  3O6T A;  2IMF A;  3RHC A;  5HQP A;  2OAC A;  2WRT A;  3RDW A;  2X8C A;  5H5R A;  2HSH A;  4XHM A;  3AY8 A;  1V98 A;  3IBH A;  2XPE A;  4KCA A;  4J56 E;  1RK4 A;  1F9M A;  5DVB A;  1PX6 A;  1XFL A;  2PN8 A;  1AIU A;  2IME A;  4NPB A;  2E2M A;  1GUM A;  2LJR A;  2KUC A;  3GST A;  3O3T A;  4PNF A;  1AQX A;  4MJE A;  3KP8 A;  3UMA A;  3TDG A;  1TRU A;  3DML A;  1TRW A;  5E59 A;  1GNE A;  4QL9 A;  1QUW A;  1RW1 A;  3ZLP A;  1R5A A;  1CQG A;  1EWX A;  19GS A;  4MDC A;  3F6D A;  2GLR A;  1MTC A;  3H1N A;  4XS4 A;  3ME8 A;  10GS A;  1PMT A;  1K0C A;  2FY6 A;  3L78 A;  1LU4 A;  1WOU A;  2A4V A;  5ELA A;  1XW5 A;  4NHW A;  5ECM B;  1GWC A;  3IK9 A;  4J2F A;  4L8E A;  3ZIJ A;  4HI7 A;  4NV2 A;  4OMV A;  4O7H A;  2RM6 A;  1OC9 A;  1FO5 A;  4EO3 A;  1LJR A;  1I9D A;  4IJI A;  4MA9 A;  1AQW A;  3P8W A;  4HQS A;  4F0C A;  2IN3 A;  3H4K A;  3D0Z A;  2X8G A;  4NV5 A;  4K0N A;  2CZ3 A;  2YZU A;  1GUK A;  5AIX A;  1U3I A;  5KN0 A;  3KMN A;  4OO4 A;  3L9U A;  3HDC A;  5F8B A;  2P0G A;  4MP4 A;  3M0F A;  3P90 A;  2XBQ A;  5GSS A;  1T00 A;  2VL3 A;  1FOV A;  5GST A;  2YPM A;  4O32 A;  4TR1 B;  4ECI A;  1IYH A;  1EP7 A;  12GS A;  1E6B A;  3GIX A;  2LTK A;  1DE1 A;  3FRC A;  4TR4 A;  1WMJ A;  22GS A;  2GZY A;  1Z7P A;  1TP9 A;  2IMD A;  1B4Q A;  5D96 A;  1DBY A;  1G6W A;  3IA1 A;  4P3Y B;  3D4M A;  3TRP A;  3FZ9 A;  4TOP A;  3QDN A;  2OA7 A;  2O7K A;  4OCF A;  1QXH A;  3GNJ A;  3CSJ A;  5C04 A;  1EEJ A;  3GV1 A;  1KBN A;  5G1K A;  1X5E A;  3GH9 A;  1G7E A;  2J23 A;  1XOA A;  3CSI A;  4D73 A;  2B1K A;  4IP1 A;  5J5N A;  3WGD A;  2H72 A;  3LFL A;  3A2W A;  1OE7 A;  2YP6 A;  5AGY A;  4X0X A;  2XBI A;  5D9X A;  3ZRE A;  1ERU A;  2DJ3 A;  5CRD A;  4L0W A;  1HD2 A;  4TW5 A;  4OD7 A;  3ZIV A;  4JED A;  4YQV A;  1SJZ A;  3LG6 A;  1G7O A;  1G6Y A;  1HYU A;  3EUR A;  1A2J A;  3HKR A;  3IRA A;  2LRC A;  2GST A;  1XWC A;  3I9V 2;  16GS A;  2VCV A;  2LEG A;  1XCC A;  4PQ1 A;  3F63 A;  1DE2 A;  4IW9 A;  4WET A;  1VF1 A;  2V2G A;  1QQ2 A;  6GSS A;  2HYX A;  9GSS A;  5IQY A;  1TDI A;  7GSS A;  3VWV A;  1GLP A;  2WJU A;  1ERW A;  4KA0 A;  4HJM A;  1HQO A;  3HXS A;  1OAZ A;  1YDK A;  3LOR A;  1PSQ A;  2GZP A;  1F37 A;  2CZ2 A;  3BOA A;  4MJB A;  2H1G A;  3DXB A;  3MAK A;  4Q5N A;  3S9F A;  3ZML A;  3ERG A;  2K9F A;  4HZ4 A;  1ERT A;  3MNG A;  3UAP A;  8GSS A;  3TUE A;  4IHU A;  5J4U A;  4IS0 A;  5DAK B;  1YF1 A;  2L5L A;  2OE3 A;  5DJM A;  2FGX A;  1O81 A;  4XIH A;  4HU7 A;  2DBC A;  4G19 A;  1T3B A;  5AIV A;  3PR8 A;  3IK7 A;  3GKM A;  1YY7 A;  3L4N A;  4MPF A;  2H6Y A;  5CRH A;  2VL9 A;  5D93 A;  1JHB A;  2ZUP A;  3LYP A;  2X99 A;  1PGT A;  4LL1 B;  1TK5 B;  1R26 A;  4MZB A;  4WEY A;  2LRT A;  5KN1 A;  1XBS A;  5HFI A;  1WE0 A;  3TJB A;  1SJI A;  4EKZ A;  3KMO A;  2F8A A;  1WP0 A;  2HT9 A;  1XW6 A;  4O92 A;  3GYK A;  1O73 A;  1QMV A;  1GSF A;  2FCH A;  4V2N A;  5ECI B;  4F9Z A;  4DSS A;  2YOI A;  1K0N A;  2FLS A;  4ML1 A;  2GT6 A;  4DSR A;  2FWG A;  3KZQ A;  2MMA A;  5HFK A;  1M7T A;  4AJ6 A;  3G7Y A;  4HQZ A;  1GH2 A;  4TXV A;  1WJK A;  3F0I A;  3SBC A;  5ID2 A;  1FW1 A;  1HNA A;  2DC5 A;  4ECB A;  5GZZ B;  5C00 A;  1H75 A;  1Z5Y E;  1J08 A;  2VLT A;  13GS A;  3C8E A;  1T7P B;  3TKP A;  1OKD A;  4RI6 A;  1VGL A;  1TJD A;  5JWR B;  2L4Q A;  2DLX A;  1UN2 A;  2LQO A;  4BVY A;  2P31 A;  1SKW B;  2FHE A;  3BCI A;  4LL4 B;  1NSW A;  4IVF A;  2OJL A;  4KW6 A;  2XHF A;  2WCI A;  1KNG A;  3DKS A;  1GTB A;  4G2E A;  3VWW A;  3HZ8 A;  1K3O A;  2CA8 A;  1BYE A;  5HR1 A;  5DCG A;  3U5R E;  4RI7 A;  1GSD A;  1Y6E A;  2OAD A;  3RAZ A;  1ZCP A;  1MD4 A;  3O76 A;  5ID2 B;  2RUF A;  3VWX A;  3EU3 A;  5ABR A;  3BD2 A;  1AW9 A;  4L5O A;  4PXO A;  1QGV A;  2AV4 A;  3WT1 A;  1T1V A;  4FO5 A;  2HRN A;  2HZE A;  2B5X A;  2C1Y A;  5COH A;  1O8X A;  4OO5 A;  2RII A;  3KH7 A;  3C73 A;  2R37 A;  1B48 A;  4PGT A;  3NIV A;  3NOF A;  1ACV A;  2GZZ A;  1GL8 A;  2I9H A;  3FHK A;  5DDL A;  1PA3 A;  3HVS A;  1B9Y C;  3KJY A;  1URM A;  2A2S A;  1PRX A;  2TRX A;  1SYX A;  4NMU A;  2BJX A;  1K0B A;  1XOB A;  2C0D A;  2ON7 A;  1Z6M A;  2C3Q A;  5ECS A;  4G10 A;  3TJK A;  5DQS A;  3APS A;  1SK0 A;  3IOS A;  3P2A A;  2QSI A;  3U6V A;  2QGV A;  2G0F A;  2PWJ A;  5HR0 A;  1XZO A;  4JR4 A;  2VCZ A;  4XS1 A;  5ECL B;  1YEP A;  2R4V A;  5G2Z A;  3E0U A;  1A0R P;  1ST9 A;  1TK0 B;  4G9H A;  3ZYW A;  5IPG A;  1HNC A;  2CX3 A;  3R2Q A;  1J9B A;  3IR4 A;  1V2A A;  1EV9 A;  1EEM A;  2N5F A;  4TR3 A;  2H66 A;  1OYJ A;  2ON5 A;  1LBK A;  1VF2 A;  1A24 A;  1O6J A;  4N10 A;  4XRD A;  4K6X A;  1EZK A;  4ZIL A;  3TKR A;  2HE3 A;  2O8V B;  3KIJ A;  2HRF A;  2H0H A;  1EGO A;  3GMF A;  2DML A;  4K7N A;  2WGR A;  2N5B A;  4YQM A;  3LSZ A;  1TRS A;  4GSN A;  1USB A;  4OCE A;  3C1R A;  3GX0 A;  4EXJ A;  2GQL A;  3LQ7 A;  3ISO A;  4GTU A;  4RQX A;  2YV7 A;  4I2U A;  3BCK A;  3WYW A;  2B6M A;  3A3T A;  4MJA A;  1JLV A;  1S3C A;  3BBY A;  1IYI A;  1SU9 A;  1GP1 A;  4TR1 A;  2AUV A;  2R3X A;  2F9S A;  2HZF A;  1ZYE A;  3EIN A;  4K8M A;  5D9V A;  4AJ8 A;  1I5G A;  3IPZ A;  5ECQ B;  4N11 A;  1OE8 A;  1FAA A;  1R5P A;  3C7M A;  2QC7 A;  3E3E A;  2VM1 A;  5IOW A;  1U87 A;  4KSO A;  3GSS A;  4XTS A;  4POM A;  4K0G A;  3I6A A;  3F4T A;  1K3L A;  2LS5 A;  5H5S A;  3PGT A;  3HCZ A;  1M9A A;  4I5Q A;  5ECN B;  5F05 A;  3ZRD A;  3EC3 A;  1Z6N A;  1BG5 A;  2H75 A;  3TOT A;  4ZXG A;  2O89 A;  2V32 A;  3IC4 A;  1Z9H A;  3F6F A;  1NM3 A;  4BA7 A;  1JFU A;  2AAW A;  1GSU A;  2H6Z A;  2JAC A;  4KX4 A;  5G31 A;  3KH9 A;  2PVQ A;  1MDK A;  3V1W A;  2C3T A;  1XVQ A;  4HZ2 A;  4GQF A;  3KEB A;  4GST A;  4ZL8 A;  3CBU A;  1GLQ A;  3EYT A;  2IFQ A;  4Q5Q A;  3FR3 A;  3G7J A;  2RUE A;  2LNT A;  4IP6 A;  5B8B A;  2EC4 A;  1O85 A;  3HJP A;  4I8B A;  3DVW A;  3E9J B;  4I2T A;  4ILF A;  2MZC A;  2A2R A;  2H30 A;  3D5J A;  4PQI A;  3MSZ A;  2LKU A;  4HU9 A;  2L6C A;  4I6X A;  17GS A;  2DJ1 A;  1PKZ A;  4ZB8 A;  6GSV A;  2IL3 A;  1T8E B;  1XWG A;  3H8Q A;  3IAM 2;  4PQH A;  1A2L A;  2H19 A;  2LJA A;  2IJY A;  1J0F A;  1MDI A;  3VI7 A;  3QAW A;  4QQ7 A;  2R6K A;  1JZO A;  1PN9 A;  3GKX A;  1K0M A;  2E2G A;  2FA8 A;  1MDJ A;  2GSR A;  5ECR B;  3QFB C;  1X9S B;  2LST A;  5DBQ A;  2JZT A;  2YWN A;  3LWA A;  2EIO A;  5DAK A;  3H79 A;  4PNG A;  3WD6 A;  2HSY A;  2V1M A;  1V40 A;  3KCM A;  1W89 A;  3QAG A;  5AN1 A;  4LA1 A;  1V57 A;  2IFQ B;  2GVP A;  4GLT A;  5INY A;  2CX4 A;  1ERV A;  2L5O A;  1ZL9 A;  4IQ1 A;  3CTF A;  3HVX A;  2AJQ B;  4KSM A;  2L4C A;  4K9Z A;  4TVE A;  1SL2 B;  5E4W A;  4HUA A;  1KTE A;  4LLR A;  5F0G A;  3IXR A;  4CHS A;  2VD0 A;  4FYC A;  2PBJ A;  3FK8 A;  3HJM A;  2I4A A;  2FWH A;  3D4T A;  2OBK A;  5H5Q A;  2FA4 A;  2AYT A;  2RLI A;  5A4W A;  3W8J A;  4NAX A;  1OVN A;  1UVZ A;  2P5R A;  3UIW A;  5CRW A;  3CYN A;  1XXU A;  3HHV A;  1QK8 A;  2L59 A;  1QFN A;  2Z9S A;  4IN0 A;  3EU4 A;  4EC0 A;  2B7K A;  2VL2 A;  4WKW A;  5B6M A;  3Q6O A;  1ZZY A;  3KD0 A;  4ML6 A;  2V6O A;  3HZ4 A;  1N8J A;  3CSH A;  5ELG A;  3A2X A;  2IIY A;  1YJ6 A;  3F8U A;  4N0V A;  1U3A A;  1SL0 B;  5G1L A;  1ON4 A;  2XPD A;  1T4Z A;  4FYU A;  3RHB A;  3MDK A;  2C0F A;  2B7J A;  1M2A A;  1KEB A;  2JZS A;  2WDU A;  4TN8 A;  5A4V A;  1SK2 A;  1TW9 A;  2CQ9 A;  3VFI A;  2X64 A;  2GSQ A;  5CAX A;  1TI3 A;  1VF3 A;  5G5E A;  2OE0 A;  4MH2 A; 
#chains in the Genus database with same CATH topology
 1TKD B;  3UAR A;  2X8H A;  4TXO B;  4XS6 A;  2H1B A;  2C3N A;  4EDY A;  3FW2 A;  2QA1 A;  3LYK A;  4KB3 A;  1X5C A;  2VAF A;  2NTO A;  5JCG A;  4ZBB A;  3J7Y k;  1WPI A;  1MEK A;  3CQF A;  4AJ7 A;  4DEJ A;  5HR3 A;  3D6I A;  2MMN A;  4ZL9 A;  3RBT A;  5F07 A;  2REM A;  2YV9 A;  2VCQ A;  2I81 A;  4K1F A;  1R7H A;  1YF0 A;  4O5R A;  1TK8 B;  3J7Y b;  2GGT A;  4K2X A;  5IMV A;  3N5O A;  3F3R A;  2CT6 A;  5IMD A;  3HY2 A;  5CP1 A;  3D21 A;  2IMK A;  2LRN A;  4OWY A;  2WZ9 A;  1NHO A;  1XIY A;  5CRE A;  3EMP A;  3M9K A;  1BQ7 A;  3CTG A;  2JAD A;  3LXT A;  3QFA C;  1SYR A;  1O8W A;  3I43 A;  3EMX A;  4V1A p;  4F82 A;  4GQC A;  3UVT A;  3CRU A;  3GFK A;  4NWY A;  4H86 A;  2F51 A;  2B1L A;  3F4S A;  2ZNM A;  3GUR A;  5D73 A;  1SD8 A;  4MF5 A;  2ES7 A;  3R3E A;  1YQ1 A;  2IPA A;  4ZIJ A;  4X43 A;  4CY8 A;  1M0U A;  1B4P A;  4V2L A;  1GUH A;  4EVM A;  4EE0 A;  3TRQ A;  4MPG A;  3ME7 A;  2E0Q A;  3L0H A;  3C71 A;  2PU9 C;  4AF2 A;  1PN0 A;  4BPY A;  4Z2U A;  2X4A A;  5DQY A;  2YAN A;  5DJL A;  5GAP D;  3QD9 A;  1SL1 B;  4YAV A;  3LGC A;  4G0K A;  1EOH A;  1XPV A;  1SEN A;  2DSA A;  3TKS A;  1M9B A;  3KM6 A;  4L5L A;  1OC3 A;  2R0P A;  4ZBA A;  4MCU A;  2HNL A;  1K0O A;  1GTI A;  4E8H A;  1SKR B;  1V9W A;  2WS2 A;  4K7O A;  1ZMA A;  5KN3 A;  1Z7R A;  3EWL A;  4WF4 A;  4WBJ A;  3WGE A;  2MMZ A;  2EIQ A;  4E8E A;  2JL4 A;  2GDR A;  5D9T A;  1AC1 A;  3WT2 A;  2EIR A;  1JZR A;  1S3R A;  1YEX A;  2YNX A;  1GSS A;  4ISD A;  1Q98 A;  3GN3 A;  3GA4 A;  4NHZ A;  1TOF A;  4GWR A;  1GSY A;  1ML6 A;  4HJ2 A;  3LXZ A;  4IBP A;  2JZR A;  4WF5 A;  2H1A A;  3M9J A;  1XVW A;  3EE2 A;  2GT5 A;  4WR4 A;  4MH3 A;  2QKE A;  1H4O A;  2GS3 A;  4KUN A;  3APO A;  2R2J A;  3DEX A;  2WFC A;  1A8Y A;  1BAY A;  2DIY A;  5L71 A;  3QMX A;  3DIE A;  4FYB A;  5ECH B;  1ZYQ B;  18GS A;  2GQM A;  3HJO A;  4BVX B;  2PVO C;  2HSM A;  4EL1 A;  4YQU A;  2J9H A;  3GTU B;  2A2P A;  1DUG A;  1W4V A;  1T4Y A;  1VRS D;  3DYR A;  4KE3 A;  4MZW A;  3ED3 A;  3TOU A;  1THX A;  3VLN A;  6GSX A;  5ECP B;  5JCU A;  4OFM A;  2NVL A;  2CVK A;  2YN1 A;  4V1A g;  4MZC A;  3ZIT A;  3QPM A;  4ID0 A;  1A0F A;  1AAZ A;  2L57 A;  2K8S A;  2JSY A;  3I69 A;  4QL7 A;  5FHI A;  4CDO A;  4WR5 A;  1EGR A;  4ZB9 A;  3UJ1 A;  4BWS A;  2P5Q A;  3DD3 A;  1SKS B;  1XWK A;  5IMC A;  4MJC A;  3MIX A;  1GTA A;  1F2E A;  3W8S A;  2D2Z A;  4USS A;  2XC2 A;  5LCZ A;  2VCX A;  4ACS A;  4K7I A;  5KOW A;  3UOM A;  4WBR D;  3VPT A;  2VD1 A;  1AQV A;  5A5K A;  4MF6 A;  4RQR A;  3UBK A;  1NW2 A;  2NPB A;  4L0U A;  2CAI A;  6GSW A;  4ZBD A;  1F3B A;  1FVJ A;  1A8L A;  4LMV A;  4DVC A;  1OC8 A;  3G9B A;  3TCO A;  1WWJ A;  6GSU A;  2VL2 C;  3FZA A;  3D22 A;  2H1D A;  2F3M A;  2H74 A;  5GAN D;  2CV4 A;  4YH2 A;  5A4U A;  2OBI A;  2H70 A;  3F4R A;  2CVB A;  2K18 A;  4CW9 A;  2BMX A;  2TRC P;  2KHP A;  3Q19 A;  1X9M B;  4Q5F A;  2HFD A;  4OFT A;  3TJJ A;  3RPN A;  5CRG A;  5B7C A;  4BL7 A;  2HLS A;  4GCI A;  5LNK e;  1TRV A;  3UEM A;  3ZZX A;  3UL3 A;  4F03 A;  1EOG A;  3EVI A;  2PGT A;  3IE3 A;  4RUV A;  3P7X A;  2MBT A;  1N2A A;  1TU7 A;  2H0G A;  3ZVJ A;  2M72 A;  2N5A A;  3FR9 A;  2R5G A;  2A4H A;  20GS A;  2LQQ A;  6GST A;  4N0Z A;  3HD5 A;  5IM9 A;  3DRN A;  1MD3 A;  4XS4 B;  4PUF C;  3GUS A;  3VK9 A;  3N9J A;  2YWO A;  3KTL A;  5BMU A;  2DMM A;  5EVO A;  3BJ5 A;  3GHA A;  3LJR A;  1ABA A;  3HA9 A;  1UA5 A;  2CAQ A;  1OC9 B;  1PD2 1;  3M8N A;  2PMT A;  4TKY A;  2DJJ A;  4ZB6 A;  3QR6 A;  4J57 E;  1EV4 A;  4K2D A;  4LMW A;  3GKN A;  4JRR A;  3Q18 A;  5F06 A;  4X4J A;  1Q4J A;  3UBL A;  5CYY A;  3OR5 A;  1VF4 A;  1RQM A;  4MNN A;  2YWI A;  2VCT A;  3FYG A;  3ERF A;  5HR2 A;  2FD3 A;  2DJK A;  2I3Y A;  1BED A;  5LD0 A;  3VPQ A;  2VLU A;  1Z3E A;  1R4W A;  5IMF A;  4IQA A;  1PL2 A;  2YZH A;  3A2V A;  1JZD A;  2MMO A;  3CMI A;  4TXO A;  3TB2 A;  4MMM A;  3MWH A;  2VIM A;  5G30 A;  3FEU A;  1JLW A;  5IMA A;  2KP2 A;  5J41 A;  1C72 A;  4V2M A;  4XRA A;  5DCH A;  3M3M A;  1AUC A;  2PUK C;  2IMI A;  4F2I A;  4Z7X A;  3ERW A;  1UC7 A;  3GH6 A;  5CO3 A;  3F9U A;  3ZFL A;  1K3Y A;  2CVD A;  4HS1 A;  4GXZ A;  1M99 A;  3TKS C;  5JCW A;  3CXG A;  1THO A;  3TJF A;  4D73 B;  2O87 A;  1PQN A;  2L6D A;  5J3R A;  4KCE A;  1M3J A;  4ULX A;  5B6N A;  2AHE A;  4KDU A;  5FT3 A;  3IHQ A;  1A23 A;  1JZW A;  4ZL7 A;  5B8A A;  1PFO A;  1FG4 A;  1U6T A;  5AIS A;  1ZYP A;  3KGK A;  1V58 A;  4WXT A;  4GSS A;  4KDY A;  2G2Q A;  4PUA A;  2H73 A;  4ECJ A;  3ZTL A;  3GRX A;  5EL8 A;  2PPT A;  3NZN A;  5IIZ A;  3TGZ A;  4JU5 A;  3IC8 A;  1XWA A;  3CRT A;  1FB6 A;  1XW9 A;  3QOU A;  2PER A;  1Y25 A;  5CNW A;  3GX8 A;  2GSS A;  1FHE A;  3PH9 A;  1PX7 A;  3JCM L;  1ZOF A;  4KND A;  2YJ7 A;  2B5E A;  4K5S A;  3TKS E;  4IKH A;  3IAS 2;  1GSQ A;  4FIW A;  3QCP A;  5IOX A;  4BWQ A;  2JU5 A;  3ZVJ D;  5JWO B;  2K8V A;  2QA2 A;  1TXX A;  2H8L A;  3FY7 A;  4OFN A;  2IWT A;  1FB0 A;  1X0R A;  4JR6 A;  2H76 A;  3DVX A;  4EDZ A;  2KLX A;  1BJX A;  3TKQ A;  1NHY A;  1F6M C;  4F0B A;  2VM2 A;  2VCW A;  2HI7 A;  4MLY A;  4JE1 A;  4JZQ A;  1U88 A;  1WIK A;  2FWF A;  2M80 A;  2LJK A;  1FVK A;  4XCS A;  5KN2 A;  3FKF A;  4POL A;  3SWL A;  11GS A;  3VUR A;  1FOH A;  4HOJ A;  4IEL A;  2MYG A;  4N30 A;  1XG8 A;  4HEA 2;  1OKT A;  1S3A A;  4KAE A;  2H6X A;  3IDV A;  1TI1 A;  3PIN A;  1M2D A;  3C1S A;  4GRF A;  2DJ2 A;  1GSE A;  2AB6 A;  1PKW A;  2VLV A;  4PX1 A;  2C8U A;  3KXO A;  1DSB A;  1TTZ A;  3EPT A;  3A5W A;  2KP1 A;  2WB9 A;  5J9B A;  3ZMK A;  3ZFB A;  4ECC A;  5J9C A;  5IMZ A;  3LEF A;  2DIZ A;  5DAL A;  3KTB A;  2R0C A;  3TRX A;  2C4J A;  2GQK A;  5IO2 A;  3KP9 A;  3DWV A;  4NXI A;  1ZGN A;  2NDO A;  1K0A A;  4Q5R A;  1GRX A;  4DSS B;  5ENU A;  3US3 A;  2VO4 A;  1YKA A;  2C0E A;  3QAV A;  3FZ5 A;  4MAB A;  4POB A;  4TR0 A;  4AGS A;  2TIR A;  3WGX A;  4MF7 A;  4G0I A;  2C0G A;  2LUS A;  3M1G A;  4X1U A;  2KOK A;  3VI5 A;  1SJ6 A;  3GL5 A;  3G7I A;  4I97 A;  1GUL A;  4FH8 A;  1EP8 A;  2VOC A;  4A5P A;  2E7P A;  2OKA A;  3H93 A;  4EUY A;  4EF0 A;  1GNW A;  1B9X C;  4POK A;  4DSQ A;  4BVX A;  3UVH A;  3DGQ A;  3GTU A;  2JSZ A;  2LV3 A;  1CQH A;  2B3S A;  1F3A A;  5ECO B;  5EPF A;  3FR6 A;  4HDE A;  5G5F A;  2YCD A;  1GTU A;  3GL3 A;  1G0T A;  2K6V A;  4IGJ A;  3K8N A;  1B8X A;  2OE1 A;  3F3Q A;  4KGI A;  5DAL B;  2RM5 A;  4FQU A;  2FWE A;  3RPP A;  2B5Y A;  4BVY B;  1M2B A;  2FUG 2;  3L9V A;  3FZ4 A;  6GSY A;  2NBS A;  2H0I A;  2C80 A;  2F8F A;  3APQ A;  3Q74 A;  5JWQ B;  4KDX A;  1A2M A;  1AXD A;  3GKK A;  3HVV A;  2HXK A;  2LNS A;  5EY6 A;  2VUP A;  2ZCT A;  3HYP A;  1X9W B;  1K0D A;  2FNO A;  1S3D A;  2MBS A;  1E2Y A;  2ALB A;  2DJ0 A;  1YKC A;  5D8I A;  3IV4 A;  2V6K A;  14GS A;  4IJ3 A;  5IPH A;  2H71 A;  4KH7 A;  1BX9 A;  2GTU A;  5D9W A;  3VWU A;  2BTO T;  1SD9 A;  1WRY A;  2YWM A;  1HNB A;  4JBB A;  1SK1 A;  4YAP A;  4MK3 A;  2I1U A;  2HZE B;  2WUL A;  5FWG A;  2O85 A;  3ZL5 A;  2V41 A;  5KEJ A;  1YZX A;  3L9S A;  4GF0 A;  5IO0 A;  3W6G A;  4TRX A;  1TU8 A;  5HFG A;  5ECK B;  1XWB A;  2H01 A;  2M46 A;  1O7U A;  3PPU A;  2YJH A;  4PUR A;  1ILO A;  1PL1 A;  1X5D A;  3TJG A;  3O6T A;  2IMF A;  3RHC A;  5HQP A;  2OAC A;  2WRT A;  3RDW A;  2X8C A;  5H5R A;  2HSH A;  4XHM A;  3AY8 A;  1V98 A;  3IBH A;  2XPE A;  4KCA A;  4J56 E;  1RK4 A;  2UZ8 A;  1M3I A;  1F9M A;  5DVB A;  1PX6 A;  1XFL A;  2PN8 A;  1AIU A;  2IME A;  4NPB A;  2E2M A;  3MYD A;  1GUM A;  2LJR A;  2KUC A;  3GST A;  3O3T A;  4PNF A;  1AQX A;  4MJE A;  3KP8 A;  3UMA A;  3TDG A;  1TRU A;  3DML A;  1TRW A;  5E59 A;  1GNE A;  4QL9 A;  1QUW A;  1RW1 A;  3ZLP A;  1R5A A;  1CQG A;  1EWX A;  19GS A;  4MDC A;  3F6D A;  2GLR A;  1MTC A;  3H1N A;  4XS4 A;  3ME8 A;  10GS A;  1PMT A;  1K0C A;  2FY6 A;  3L78 A;  1LU4 A;  1WOU A;  2A4V A;  5ELA A;  1XW5 A;  4NHW A;  5ECM B;  1GWC A;  3IK9 A;  4J2F A;  4L8E A;  3ZIJ A;  4HI7 A;  4NV2 A;  4OMV A;  4O7H A;  2RM6 A;  1OC9 A;  1FO5 A;  4EO3 A;  1LJR A;  1I9D A;  4IJI A;  4MA9 A;  1AQW A;  3P8W A;  4HQS A;  4F0C A;  2IN3 A;  3H4K A;  3D0Z A;  2X8G A;  4NV5 A;  4K0N A;  2CZ3 A;  2YZU A;  1GUK A;  4Z2R A;  5AIX A;  1U3I A;  5KN0 A;  3KMN A;  4OO4 A;  3L9U A;  3HDC A;  5F8B A;  2P0G A;  4MP4 A;  3M0F A;  3P90 A;  2XBQ A;  5GSS A;  1T00 A;  2VL3 A;  1FOV A;  5GST A;  2YPM A;  4O32 A;  4TR1 B;  4ECI A;  1IYH A;  1EP7 A;  12GS A;  1E6B A;  3GIX A;  2LTK A;  1DE1 A;  3FRC A;  4TR4 A;  1WMJ A;  22GS A;  2GZY A;  1Z7P A;  1TP9 A;  2IMD A;  1B4Q A;  5D96 A;  1DBY A;  1G6W A;  3IA1 A;  4P3Y B;  3D4M A;  3TRP A;  3FZ9 A;  4TOP A;  3QDN A;  1ZYN A;  2OA7 A;  2O7K A;  4OCF A;  1QXH A;  3GNJ A;  3CSJ A;  5C04 A;  1EEJ A;  3GV1 A;  1KBN A;  5G1K A;  1X5E A;  3GH9 A;  1G7E A;  2J23 A;  1XOA A;  3CSI A;  4D73 A;  2B1K A;  4HSC X;  4IP1 A;  5J5N A;  3WGD A;  2H72 A;  3LFL A;  3A2W A;  1OE7 A;  2YP6 A;  5AGY A;  4X0X A;  2XBI A;  2R0G A;  5D9X A;  3ZRE A;  1ERU A;  2DJ3 A;  5CRD A;  4L0W A;  1HD2 A;  4TW5 A;  4OD7 A;  3ZIV A;  4JED A;  4YQV A;  1SJZ A;  3LG6 A;  1G7O A;  1G6Y A;  1HYU A;  3EUR A;  1A2J A;  2DKI A;  3HKR A;  3IRA A;  2LRC A;  2GST A;  1XWC A;  3I9V 2;  16GS A;  2VCV A;  2LEG A;  1XCC A;  4PQ1 A;  3F63 A;  1DE2 A;  4IW9 A;  4WET A;  1VF1 A;  2V2G A;  1QQ2 A;  6GSS A;  2HYX A;  9GSS A;  5IQY A;  1TDI A;  7GSS A;  3VWV A;  1GLP A;  2WJU A;  4EIQ A;  1ERW A;  4KA0 A;  4KF9 A;  4HJM A;  1HQO A;  3HXS A;  1OAZ A;  5BRT A;  1YDK A;  3LOR A;  1PSQ A;  2GZP A;  1F37 A;  2CZ2 A;  3BOA A;  4MJB A;  2H1G A;  3DXB A;  3MAK A;  4Q5N A;  3S9F A;  3ZML A;  3ERG A;  2K9F A;  4HZ4 A;  1ERT A;  3MNG A;  3UAP A;  8GSS A;  3TUE A;  4IHU A;  5J4U A;  4IS0 A;  5DAK B;  1YF1 A;  2L5L A;  2OE3 A;  5DJM A;  4PTS A;  2FGX A;  1O81 A;  4XIH A;  4HU7 A;  2DBC A;  4G19 A;  1T3B A;  5AIV A;  3PR8 A;  3IK7 A;  3GKM A;  1YY7 A;  3L4N A;  4MPF A;  2H6Y A;  5CRH A;  2VL9 A;  5D93 A;  1JHB A;  2ZUP A;  3LYP A;  2X99 A;  1PGT A;  4LL1 B;  1TK5 B;  1R26 A;  4MZB A;  4WEY A;  2LRT A;  5KN1 A;  1XBS A;  5HFI A;  1WE0 A;  3TJB A;  1SJI A;  4EKZ A;  3KMO A;  2F8A A;  1WP0 A;  2HT9 A;  1XW6 A;  4O92 A;  3GYK A;  1O73 A;  1QMV A;  1GSF A;  2FCH A;  4V2N A;  5ECI B;  4F9Z A;  4DSS A;  2YOI A;  1K0N A;  2FLS A;  4ML1 A;  2GT6 A;  4DSR A;  2FWG A;  3KZQ A;  2MMA A;  5HFK A;  1M7T A;  4AJ6 A;  3G7Y A;  4HQZ A;  1GH2 A;  4TXV A;  1WJK A;  3F0I A;  3SBC A;  5ID2 A;  1FW1 A;  1HNA A;  2DC5 A;  4ECB A;  5GZZ B;  5C00 A;  1H75 A;  1Z5Y E;  1J08 A;  2VLT A;  13GS A;  3C8E A;  1T7P B;  3TKP A;  1OKD A;  4RI6 A;  1VGL A;  1TJD A;  5JWR B;  2L4Q A;  2DLX A;  1UN2 A;  2LQO A;  4BVY A;  2P31 A;  1SKW B;  2FHE A;  4EIP A;  3BCI A;  4LL4 B;  1NSW A;  4IVF A;  2OJL A;  4KW6 A;  2XHF A;  2WCI A;  1KNG A;  2DKH A;  3DKS A;  1GTB A;  4G2E A;  3VWW A;  3HZ8 A;  1K3O A;  2CA8 A;  1BYE A;  5HR1 A;  5DCG A;  4YKF A;  3U5R E;  4RI7 A;  1GSD A;  1Y6E A;  2OAD A;  3RAZ A;  1ZCP A;  1MD4 A;  3O76 A;  5ID2 B;  2RUF A;  3VWX A;  3EU3 A;  5ABR A;  3BD2 A;  1AW9 A;  4L5O A;  4PXO A;  4Z2T A;  1QGV A;  2AV4 A;  3WT1 A;  1T1V A;  4FO5 A;  2HRN A;  2HZE A;  2B5X A;  2C1Y A;  5COH A;  1O8X A;  4OO5 A;  2RII A;  3KH7 A;  3C73 A;  2R37 A;  1B48 A;  4PGT A;  3NIV A;  3NOF A;  1ACV A;  2GZZ A;  1GL8 A;  2I9H A;  3FHK A;  5DDL A;  1PA3 A;  3HVS A;  1B9Y C;  3KJY A;  4ICY A;  1URM A;  2A2S A;  1PRX A;  2TRX A;  1SYX A;  4NMU A;  2BJX A;  1K0B A;  1XOB A;  2C0D A;  2ON7 A;  1Z6M A;  2C3Q A;  5ECS A;  4G10 A;  3TJK A;  5DQS A;  3APS A;  1SK0 A;  3IOS A;  3P2A A;  2QSI A;  3U6V A;  2QGV A;  2G0F A;  2PWJ A;  5HR0 A;  1XZO A;  4JR4 A;  2VCZ A;  4XS1 A;  5ECL B;  1YEP A;  2R4V A;  5G2Z A;  3E0U A;  1A0R P;  1ST9 A;  1TK0 B;  4G9H A;  3ZYW A;  5IPG A;  1HNC A;  2CX3 A;  3R2Q A;  1J9B A;  3IR4 A;  1V2A A;  1EV9 A;  1EEM A;  2N5F A;  4TR3 A;  2H66 A;  1OYJ A;  2ON5 A;  1LBK A;  1VF2 A;  1A24 A;  1O6J A;  4N10 A;  4XRD A;  4K6X A;  1EZK A;  4ZIL A;  3TKR A;  2HE3 A;  2O8V B;  3KIJ A;  2HRF A;  2H0H A;  1EGO A;  3GMF A;  2DML A;  4K7N A;  2HRA A;  2WGR A;  2N5B A;  4YQM A;  3LSZ A;  1TRS A;  4GSN A;  1USB A;  4OCE A;  3C1R A;  4K5R A;  3GX0 A;  4EXJ A;  2GQL A;  3LQ7 A;  3ISO A;  4GTU A;  4RQX A;  2YV7 A;  4I2U A;  3BCK A;  3WYW A;  2B6M A;  3A3T A;  4MJA A;  1JLV A;  1S3C A;  3BBY A;  1IYI A;  4O5Q A;  1SU9 A;  1GP1 A;  4TR1 A;  2AUV A;  2R3X A;  2F9S A;  2HZF A;  1ZYE A;  3EIN A;  4K8M A;  5D9V A;  4AJ8 A;  1I5G A;  3IPZ A;  5ECQ B;  4N11 A;  1OE8 A;  1FAA A;  1R5P A;  3C7M A;  2QC7 A;  3E3E A;  2VM1 A;  5IOW A;  1U87 A;  4KSO A;  3GSS A;  4XTS A;  4POM A;  4K0G A;  3I6A A;  3F4T A;  1K3L A;  2LS5 A;  3IHG A;  5H5S A;  3PGT A;  3HCZ A;  1M9A A;  4I5Q A;  5ECN B;  5F05 A;  3ZRD A;  3EC3 A;  1Z6N A;  1BG5 A;  2H75 A;  3TOT A;  4ZXG A;  2O89 A;  2V32 A;  3IC4 A;  3A5I A;  1Z9H A;  3F6F A;  1NM3 A;  4BA7 A;  1JFU A;  2AAW A;  1GSU A;  2H6Z A;  2JAC A;  4KX4 A;  5G31 A;  3KH9 A;  2PVQ A;  1MDK A;  3V1W A;  2C3T A;  1XVQ A;  4HZ2 A;  4GQF A;  3KEB A;  4GST A;  4ZL8 A;  3CBU A;  1GLQ A;  3EYT A;  2IFQ A;  4Q5Q A;  3FR3 A;  3G7J A;  2RUE A;  2LNT A;  4IP6 A;  5B8B A;  2EC4 A;  1O85 A;  3HJP A;  4I8B A;  3DVW A;  3E9J B;  4I2T A;  4ILF A;  2MZC A;  2A2R A;  4G0L A;  2H30 A;  3D5J A;  4PQI A;  4CY6 A;  3MSZ A;  2LKU A;  4HU9 A;  2L6C A;  4I6X A;  17GS A;  2DJ1 A;  1PKZ A;  4ZB8 A;  6GSV A;  2IL3 A;  1T8E B;  1XWG A;  3H8Q A;  3IAM 2;  4PQH A;  1A2L A;  2H19 A;  2LJA A;  2IJY A;  1J0F A;  1MDI A;  3VI7 A;  3QAW A;  4QQ7 A;  2R6K A;  1JZO A;  1PN9 A;  5KOX A;  3GKX A;  1K0M A;  2E2G A;  2FA8 A;  1MDJ A;  2HRK A;  2GSR A;  5ECR B;  3QFB C;  1X9S B;  2LST A;  5DBQ A;  2JZT A;  2YWN A;  3LWA A;  2EIO A;  4YKG A;  5DAK A;  4BL7 B;  3H79 A;  4PNG A;  3WD6 A;  2HSY A;  2V1M A;  1V40 A;  3KCM A;  1W89 A;  2X49 A;  3QAG A;  5AN1 A;  4LA1 A;  1V57 A;  2IFQ B;  2GVP A;  4GLT A;  5INY A;  4BIK A;  2CX4 A;  1ERV A;  2L5O A;  1ZL9 A;  4IQ1 A;  3CTF A;  3HVX A;  2AJQ B;  4KSM A;  2L4C A;  4K9Z A;  4TVE A;  1SL2 B;  5E4W A;  4HUA A;  1KTE A;  4LLR A;  5F0G A;  3IXR A;  4CHS A;  2VD0 A;  4FYC A;  2PBJ A;  3FK8 A;  3HJM A;  2I4A A;  2FWH A;  3D4T A;  3HVN A;  2OBK A;  3FMW A;  5H5Q A;  2FA4 A;  2AYT A;  2RLI A;  5A4W A;  3W8J A;  4NAX A;  1OVN A;  1UVZ A;  2P5R A;  3UIW A;  5CRW A;  3CYN A;  1XXU A;  3HHV A;  3LW9 A;  1QK8 A;  2L59 A;  1QFN A;  2Z9S A;  4IN0 A;  3EU4 A;  4EC0 A;  2B7K A;  2VL2 A;  4O5U A;  4WKW A;  3Q6O A;  1ZZY A;  5B6M A;  3KD0 A;  4ML6 A;  2V6O A;  3HZ4 A;  1N8J A;  3CSH A;  5ELG A;  3A2X A;  2IIY A;  1YJ6 A;  3F8U A;  4N0V A;  1U3A A;  1SL0 B;  5G1L A;  1ON4 A;  2XPD A;  1T4Z A;  4FYU A;  3RHB A;  3MDK A;  2C0F A;  2B7J A;  1M2A A;  1KEB A;  2JZS A;  2WDU A;  4TN8 A;  5A4V A;  1SK2 A;  1TW9 A;  2CQ9 A;  3VFI A;  2X64 A;  2GSQ A;  5CAX A;  1TI3 A;  1VF3 A;  5G5E A;  2OE0 A;  4MH2 A; 
#chains in the Genus database with same CATH homology
 1TKD B;  3UAR A;  2X8H A;  4TXO B;  4XS6 A;  2H1B A;  2C3N A;  4EDY A;  3FW2 A;  2QA1 A;  3LYK A;  4KB3 A;  1X5C A;  2VAF A;  2NTO A;  5JCG A;  4ZBB A;  3J7Y k;  1WPI A;  1MEK A;  4AJ7 A;  4DEJ A;  5HR3 A;  3D6I A;  2MMN A;  4ZL9 A;  3RBT A;  5F07 A;  2REM A;  2YV9 A;  2VCQ A;  2I81 A;  4K1F A;  1R7H A;  1YF0 A;  4O5R A;  1TK8 B;  3J7Y b;  2GGT A;  4K2X A;  5IMV A;  3N5O A;  3F3R A;  2CT6 A;  5IMD A;  3HY2 A;  5CP1 A;  3D21 A;  2IMK A;  2LRN A;  4OWY A;  2WZ9 A;  1NHO A;  1XIY A;  5CRE A;  3EMP A;  3M9K A;  1BQ7 A;  3CTG A;  2JAD A;  3LXT A;  3QFA C;  1SYR A;  1O8W A;  3I43 A;  3EMX A;  4V1A p;  4F82 A;  4GQC A;  3UVT A;  3CRU A;  3GFK A;  4NWY A;  4H86 A;  2F51 A;  2B1L A;  3F4S A;  2ZNM A;  3GUR A;  5D73 A;  1SD8 A;  4MF5 A;  2ES7 A;  3R3E A;  1YQ1 A;  2IPA A;  4ZIJ A;  4X43 A;  4CY8 A;  1M0U A;  1B4P A;  4V2L A;  1GUH A;  4EVM A;  4EE0 A;  3TRQ A;  4MPG A;  3ME7 A;  2E0Q A;  3L0H A;  3C71 A;  2PU9 C;  4AF2 A;  1PN0 A;  4BPY A;  4Z2U A;  2X4A A;  5DQY A;  2YAN A;  5DJL A;  5GAP D;  3QD9 A;  1SL1 B;  4YAV A;  3LGC A;  4G0K A;  1EOH A;  1XPV A;  1SEN A;  2DSA A;  3TKS A;  1M9B A;  3KM6 A;  4L5L A;  1OC3 A;  2R0P A;  4ZBA A;  4MCU A;  2HNL A;  1K0O A;  1GTI A;  4E8H A;  1SKR B;  1V9W A;  2WS2 A;  4K7O A;  1ZMA A;  5KN3 A;  1Z7R A;  3EWL A;  4WF4 A;  4WBJ A;  3WGE A;  2MMZ A;  2EIQ A;  4E8E A;  2JL4 A;  2GDR A;  5D9T A;  1AC1 A;  3WT2 A;  2EIR A;  1JZR A;  1YEX A;  2YNX A;  1GSS A;  4ISD A;  1Q98 A;  3GN3 A;  3GA4 A;  4NHZ A;  1TOF A;  4GWR A;  1GSY A;  1ML6 A;  4HJ2 A;  3LXZ A;  4IBP A;  2JZR A;  4WF5 A;  2H1A A;  3M9J A;  1XVW A;  3EE2 A;  2GT5 A;  4WR4 A;  4MH3 A;  2QKE A;  1H4O A;  2GS3 A;  4KUN A;  3APO A;  2R2J A;  3DEX A;  2WFC A;  1A8Y A;  1BAY A;  2DIY A;  5L71 A;  3QMX A;  3DIE A;  4FYB A;  5ECH B;  1ZYQ B;  18GS A;  2GQM A;  3HJO A;  4BVX B;  2PVO C;  2HSM A;  4EL1 A;  4YQU A;  2J9H A;  3GTU B;  2A2P A;  1DUG A;  1W4V A;  1T4Y A;  1VRS D;  3DYR A;  4KE3 A;  4MZW A;  3ED3 A;  3TOU A;  1THX A;  3VLN A;  6GSX A;  5ECP B;  5JCU A;  4OFM A;  2NVL A;  2CVK A;  2YN1 A;  4V1A g;  4MZC A;  3ZIT A;  3QPM A;  4ID0 A;  1A0F A;  1AAZ A;  2L57 A;  2K8S A;  2JSY A;  3I69 A;  4QL7 A;  5FHI A;  4CDO A;  4WR5 A;  1EGR A;  4ZB9 A;  3UJ1 A;  4BWS A;  2P5Q A;  3DD3 A;  1SKS B;  1XWK A;  5IMC A;  4MJC A;  3MIX A;  1GTA A;  1F2E A;  3W8S A;  2D2Z A;  4USS A;  2XC2 A;  5LCZ A;  2VCX A;  4ACS A;  4K7I A;  5KOW A;  3UOM A;  4WBR D;  3VPT A;  2VD1 A;  1AQV A;  5A5K A;  4MF6 A;  4RQR A;  3UBK A;  1NW2 A;  2NPB A;  4L0U A;  2CAI A;  6GSW A;  4ZBD A;  1F3B A;  1FVJ A;  1A8L A;  4LMV A;  4DVC A;  1OC8 A;  3G9B A;  3TCO A;  1WWJ A;  6GSU A;  2VL2 C;  3FZA A;  3D22 A;  2H1D A;  2F3M A;  2H74 A;  5GAN D;  2CV4 A;  4YH2 A;  5A4U A;  2OBI A;  2H70 A;  3F4R A;  2CVB A;  2K18 A;  4CW9 A;  2BMX A;  2TRC P;  2KHP A;  3Q19 A;  1X9M B;  4Q5F A;  2HFD A;  4OFT A;  3TJJ A;  3RPN A;  5CRG A;  5B7C A;  4BL7 A;  2HLS A;  4GCI A;  5LNK e;  1TRV A;  3UEM A;  3ZZX A;  3UL3 A;  4F03 A;  1EOG A;  3EVI A;  2PGT A;  3IE3 A;  4RUV A;  3P7X A;  2MBT A;  1N2A A;  1TU7 A;  2H0G A;  3ZVJ A;  2M72 A;  2N5A A;  3FR9 A;  2R5G A;  2A4H A;  20GS A;  2LQQ A;  6GST A;  4N0Z A;  3HD5 A;  5IM9 A;  3DRN A;  1MD3 A;  4XS4 B;  4PUF C;  3GUS A;  3VK9 A;  3N9J A;  2YWO A;  3KTL A;  5BMU A;  2DMM A;  5EVO A;  3BJ5 A;  3GHA A;  3LJR A;  1ABA A;  3HA9 A;  1UA5 A;  2CAQ A;  1OC9 B;  1PD2 1;  3M8N A;  2PMT A;  4TKY A;  2DJJ A;  4ZB6 A;  3QR6 A;  4J57 E;  1EV4 A;  4K2D A;  4LMW A;  3GKN A;  4JRR A;  3Q18 A;  5F06 A;  4X4J A;  1Q4J A;  3UBL A;  5CYY A;  3OR5 A;  1VF4 A;  1RQM A;  4MNN A;  2YWI A;  2VCT A;  3FYG A;  3ERF A;  5HR2 A;  2FD3 A;  2DJK A;  2I3Y A;  1BED A;  5LD0 A;  3VPQ A;  2VLU A;  1Z3E A;  1R4W A;  5IMF A;  4IQA A;  1PL2 A;  2YZH A;  3A2V A;  1JZD A;  2MMO A;  3CMI A;  4TXO A;  3TB2 A;  4MMM A;  3MWH A;  2VIM A;  5G30 A;  3FEU A;  1JLW A;  5IMA A;  2KP2 A;  5J41 A;  1C72 A;  4V2M A;  4XRA A;  5DCH A;  3M3M A;  1AUC A;  2PUK C;  2IMI A;  4F2I A;  4Z7X A;  3ERW A;  1UC7 A;  3GH6 A;  5CO3 A;  3F9U A;  3ZFL A;  1K3Y A;  2CVD A;  4HS1 A;  4GXZ A;  1M99 A;  3TKS C;  5JCW A;  3CXG A;  1THO A;  3TJF A;  4D73 B;  2O87 A;  1PQN A;  2L6D A;  5J3R A;  4KCE A;  4ULX A;  5B6N A;  2AHE A;  4KDU A;  5FT3 A;  3IHQ A;  1A23 A;  1JZW A;  4ZL7 A;  5B8A A;  1FG4 A;  1U6T A;  5AIS A;  1ZYP A;  3KGK A;  1V58 A;  4WXT A;  4GSS A;  4KDY A;  2G2Q A;  4PUA A;  2H73 A;  4ECJ A;  3ZTL A;  3GRX A;  5EL8 A;  2PPT A;  3NZN A;  5IIZ A;  3TGZ A;  4JU5 A;  3IC8 A;  1XWA A;  3CRT A;  1FB6 A;  1XW9 A;  3QOU A;  2PER A;  1Y25 A;  5CNW A;  3GX8 A;  2GSS A;  1FHE A;  3PH9 A;  1PX7 A;  3JCM L;  1ZOF A;  4KND A;  2YJ7 A;  2B5E A;  4K5S A;  3TKS E;  4IKH A;  3IAS 2;  1GSQ A;  4FIW A;  3QCP A;  5IOX A;  4BWQ A;  2JU5 A;  3ZVJ D;  5JWO B;  2K8V A;  2QA2 A;  1TXX A;  2H8L A;  3FY7 A;  4OFN A;  2IWT A;  1FB0 A;  1X0R A;  4JR6 A;  2H76 A;  3DVX A;  4EDZ A;  2KLX A;  1BJX A;  3TKQ A;  1NHY A;  1F6M C;  4F0B A;  2VM2 A;  2VCW A;  2HI7 A;  4MLY A;  4JE1 A;  4JZQ A;  1U88 A;  1WIK A;  2FWF A;  2M80 A;  2LJK A;  1FVK A;  4XCS A;  5KN2 A;  3FKF A;  4POL A;  3SWL A;  11GS A;  3VUR A;  1FOH A;  4HOJ A;  4IEL A;  2MYG A;  4N30 A;  4HEA 2;  1OKT A;  1S3A A;  4KAE A;  2H6X A;  3IDV A;  1TI1 A;  3PIN A;  1M2D A;  3C1S A;  4GRF A;  2DJ2 A;  1GSE A;  2AB6 A;  1PKW A;  2VLV A;  4PX1 A;  2C8U A;  3KXO A;  1DSB A;  1TTZ A;  3EPT A;  3A5W A;  2KP1 A;  2WB9 A;  5J9B A;  3ZMK A;  3ZFB A;  4ECC A;  5J9C A;  5IMZ A;  3LEF A;  2DIZ A;  5DAL A;  3KTB A;  2R0C A;  3TRX A;  2C4J A;  2GQK A;  5IO2 A;  3KP9 A;  3DWV A;  4NXI A;  1ZGN A;  2NDO A;  1K0A A;  4Q5R A;  1GRX A;  4DSS B;  5ENU A;  3US3 A;  2VO4 A;  1YKA A;  2C0E A;  3QAV A;  3FZ5 A;  4MAB A;  4POB A;  4TR0 A;  4AGS A;  2TIR A;  3WGX A;  4MF7 A;  4G0I A;  2C0G A;  2LUS A;  3M1G A;  4X1U A;  2KOK A;  3VI5 A;  1SJ6 A;  3GL5 A;  3G7I A;  4I97 A;  1GUL A;  4FH8 A;  1EP8 A;  2VOC A;  4A5P A;  2E7P A;  2OKA A;  3H93 A;  4EUY A;  4EF0 A;  1GNW A;  1B9X C;  4POK A;  4DSQ A;  4BVX A;  3UVH A;  3DGQ A;  3GTU A;  2JSZ A;  2LV3 A;  1CQH A;  2B3S A;  1F3A A;  5ECO B;  5EPF A;  3FR6 A;  4HDE A;  5G5F A;  2YCD A;  1GTU A;  3GL3 A;  1G0T A;  2K6V A;  4IGJ A;  3K8N A;  1B8X A;  2OE1 A;  3F3Q A;  4KGI A;  5DAL B;  2RM5 A;  4FQU A;  2FWE A;  3RPP A;  2B5Y A;  4BVY B;  1M2B A;  2FUG 2;  3L9V A;  3FZ4 A;  6GSY A;  2NBS A;  2H0I A;  2C80 A;  2F8F A;  3APQ A;  3Q74 A;  5JWQ B;  4KDX A;  1A2M A;  1AXD A;  3GKK A;  3HVV A;  2HXK A;  2LNS A;  5EY6 A;  2VUP A;  2ZCT A;  3HYP A;  1X9W B;  1K0D A;  2FNO A;  1S3D A;  2MBS A;  1E2Y A;  2ALB A;  2DJ0 A;  1YKC A;  5D8I A;  3IV4 A;  2V6K A;  14GS A;  4IJ3 A;  5IPH A;  2H71 A;  4KH7 A;  1BX9 A;  2GTU A;  5D9W A;  3VWU A;  2BTO T;  1SD9 A;  1WRY A;  2YWM A;  1HNB A;  4JBB A;  1SK1 A;  4YAP A;  4MK3 A;  2I1U A;  2HZE B;  2WUL A;  5FWG A;  2O85 A;  3ZL5 A;  2V41 A;  5KEJ A;  1YZX A;  3L9S A;  4GF0 A;  5IO0 A;  3W6G A;  4TRX A;  1TU8 A;  5HFG A;  5ECK B;  1XWB A;  2H01 A;  2M46 A;  1O7U A;  3PPU A;  2YJH A;  4PUR A;  1ILO A;  1PL1 A;  1X5D A;  3TJG A;  3O6T A;  2IMF A;  3RHC A;  5HQP A;  2OAC A;  2WRT A;  3RDW A;  2X8C A;  5H5R A;  2HSH A;  4XHM A;  3AY8 A;  1V98 A;  3IBH A;  2XPE A;  4KCA A;  4J56 E;  1RK4 A;  2UZ8 A;  1F9M A;  5DVB A;  1PX6 A;  1XFL A;  2PN8 A;  1AIU A;  2IME A;  4NPB A;  2E2M A;  3MYD A;  1GUM A;  2LJR A;  2KUC A;  3GST A;  3O3T A;  4PNF A;  1AQX A;  4MJE A;  3KP8 A;  3UMA A;  3TDG A;  1TRU A;  3DML A;  1TRW A;  5E59 A;  1GNE A;  4QL9 A;  1QUW A;  1RW1 A;  3ZLP A;  1R5A A;  1CQG A;  1EWX A;  19GS A;  4MDC A;  3F6D A;  2GLR A;  1MTC A;  3H1N A;  4XS4 A;  3ME8 A;  10GS A;  1PMT A;  1K0C A;  2FY6 A;  3L78 A;  1LU4 A;  1WOU A;  2A4V A;  5ELA A;  1XW5 A;  4NHW A;  5ECM B;  1GWC A;  3IK9 A;  4J2F A;  4L8E A;  3ZIJ A;  4HI7 A;  4NV2 A;  4OMV A;  4O7H A;  2RM6 A;  1OC9 A;  1FO5 A;  4EO3 A;  1LJR A;  1I9D A;  4IJI A;  4MA9 A;  1AQW A;  3P8W A;  4HQS A;  4F0C A;  2IN3 A;  3H4K A;  3D0Z A;  2X8G A;  4NV5 A;  4K0N A;  2CZ3 A;  2YZU A;  1GUK A;  4Z2R A;  5AIX A;  1U3I A;  5KN0 A;  3KMN A;  4OO4 A;  3L9U A;  3HDC A;  5F8B A;  2P0G A;  4MP4 A;  3M0F A;  3P90 A;  2XBQ A;  5GSS A;  1T00 A;  2VL3 A;  1FOV A;  5GST A;  2YPM A;  4O32 A;  4TR1 B;  4ECI A;  1IYH A;  1EP7 A;  12GS A;  1E6B A;  3GIX A;  2LTK A;  1DE1 A;  3FRC A;  4TR4 A;  1WMJ A;  22GS A;  2GZY A;  1Z7P A;  1TP9 A;  2IMD A;  1B4Q A;  5D96 A;  1DBY A;  1G6W A;  3IA1 A;  4P3Y B;  3D4M A;  3TRP A;  3FZ9 A;  4TOP A;  3QDN A;  1ZYN A;  2OA7 A;  2O7K A;  4OCF A;  1QXH A;  3GNJ A;  3CSJ A;  5C04 A;  1EEJ A;  3GV1 A;  1KBN A;  5G1K A;  1X5E A;  3GH9 A;  1G7E A;  2J23 A;  1XOA A;  3CSI A;  4D73 A;  2B1K A;  4IP1 A;  5J5N A;  3WGD A;  2H72 A;  3LFL A;  3A2W A;  1OE7 A;  2YP6 A;  5AGY A;  4X0X A;  2XBI A;  2R0G A;  5D9X A;  3ZRE A;  1ERU A;  2DJ3 A;  5CRD A;  4L0W A;  1HD2 A;  4TW5 A;  4OD7 A;  3ZIV A;  4JED A;  4YQV A;  1SJZ A;  3LG6 A;  1G7O A;  1G6Y A;  1HYU A;  3EUR A;  1A2J A;  2DKI A;  3HKR A;  3IRA A;  2LRC A;  2GST A;  1XWC A;  3I9V 2;  16GS A;  2VCV A;  2LEG A;  1XCC A;  4PQ1 A;  3F63 A;  1DE2 A;  4IW9 A;  4WET A;  1VF1 A;  2V2G A;  1QQ2 A;  6GSS A;  2HYX A;  9GSS A;  5IQY A;  1TDI A;  7GSS A;  3VWV A;  1GLP A;  2WJU A;  4EIQ A;  1ERW A;  4KA0 A;  4KF9 A;  4HJM A;  1HQO A;  3HXS A;  1OAZ A;  5BRT A;  1YDK A;  3LOR A;  1PSQ A;  2GZP A;  1F37 A;  2CZ2 A;  3BOA A;  4MJB A;  2H1G A;  3DXB A;  3MAK A;  4Q5N A;  3S9F A;  3ZML A;  3ERG A;  2K9F A;  4HZ4 A;  1ERT A;  3MNG A;  3UAP A;  8GSS A;  3TUE A;  4IHU A;  5J4U A;  4IS0 A;  5DAK B;  1YF1 A;  2L5L A;  2OE3 A;  5DJM A;  4PTS A;  2FGX A;  1O81 A;  4XIH A;  4HU7 A;  2DBC A;  4G19 A;  1T3B A;  5AIV A;  3PR8 A;  3IK7 A;  3GKM A;  1YY7 A;  3L4N A;  4MPF A;  2H6Y A;  5CRH A;  2VL9 A;  5D93 A;  1JHB A;  2ZUP A;  3LYP A;  2X99 A;  1PGT A;  4LL1 B;  1TK5 B;  1R26 A;  4MZB A;  4WEY A;  2LRT A;  5KN1 A;  1XBS A;  5HFI A;  1WE0 A;  3TJB A;  1SJI A;  4EKZ A;  3KMO A;  2F8A A;  1WP0 A;  2HT9 A;  1XW6 A;  4O92 A;  3GYK A;  1O73 A;  1QMV A;  1GSF A;  2FCH A;  4V2N A;  5ECI B;  4F9Z A;  4DSS A;  2YOI A;  1K0N A;  2FLS A;  4ML1 A;  2GT6 A;  4DSR A;  2FWG A;  3KZQ A;  2MMA A;  5HFK A;  1M7T A;  4AJ6 A;  3G7Y A;  4HQZ A;  1GH2 A;  4TXV A;  1WJK A;  3F0I A;  3SBC A;  5ID2 A;  1FW1 A;  1HNA A;  2DC5 A;  4ECB A;  5GZZ B;  5C00 A;  1H75 A;  1Z5Y E;  1J08 A;  2VLT A;  13GS A;  3C8E A;  1T7P B;  3TKP A;  1OKD A;  4RI6 A;  1VGL A;  1TJD A;  5JWR B;  2L4Q A;  2DLX A;  1UN2 A;  2LQO A;  4BVY A;  2P31 A;  1SKW B;  2FHE A;  4EIP A;  3BCI A;  4LL4 B;  1NSW A;  4IVF A;  2OJL A;  4KW6 A;  2XHF A;  2WCI A;  1KNG A;  2DKH A;  3DKS A;  1GTB A;  4G2E A;  3VWW A;  3HZ8 A;  1K3O A;  2CA8 A;  1BYE A;  5HR1 A;  5DCG A;  4YKF A;  3U5R E;  4RI7 A;  1GSD A;  1Y6E A;  2OAD A;  3RAZ A;  1ZCP A;  1MD4 A;  3O76 A;  5ID2 B;  2RUF A;  3VWX A;  3EU3 A;  5ABR A;  3BD2 A;  1AW9 A;  4L5O A;  4PXO A;  4Z2T A;  1QGV A;  2AV4 A;  3WT1 A;  1T1V A;  4FO5 A;  2HRN A;  2HZE A;  2B5X A;  2C1Y A;  5COH A;  1O8X A;  4OO5 A;  2RII A;  3KH7 A;  3C73 A;  2R37 A;  1B48 A;  4PGT A;  3NIV A;  3NOF A;  1ACV A;  2GZZ A;  1GL8 A;  2I9H A;  3FHK A;  5DDL A;  1PA3 A;  3HVS A;  1B9Y C;  3KJY A;  4ICY A;  1URM A;  2A2S A;  1PRX A;  2TRX A;  1SYX A;  4NMU A;  2BJX A;  1K0B A;  1XOB A;  2C0D A;  2ON7 A;  1Z6M A;  2C3Q A;  5ECS A;  4G10 A;  3TJK A;  5DQS A;  3APS A;  1SK0 A;  3IOS A;  3P2A A;  2QSI A;  3U6V A;  2QGV A;  2G0F A;  2PWJ A;  5HR0 A;  1XZO A;  4JR4 A;  2VCZ A;  4XS1 A;  5ECL B;  1YEP A;  2R4V A;  5G2Z A;  3E0U A;  1A0R P;  1ST9 A;  1TK0 B;  4G9H A;  3ZYW A;  5IPG A;  1HNC A;  2CX3 A;  3R2Q A;  1J9B A;  3IR4 A;  1V2A A;  1EV9 A;  1EEM A;  2N5F A;  4TR3 A;  2H66 A;  1OYJ A;  2ON5 A;  1LBK A;  1VF2 A;  1A24 A;  1O6J A;  4N10 A;  4XRD A;  4K6X A;  1EZK A;  4ZIL A;  3TKR A;  2HE3 A;  2O8V B;  3KIJ A;  2HRF A;  2H0H A;  1EGO A;  3GMF A;  2DML A;  4K7N A;  2HRA A;  2WGR A;  2N5B A;  4YQM A;  3LSZ A;  1TRS A;  4GSN A;  1USB A;  4OCE A;  3C1R A;  4K5R A;  3GX0 A;  4EXJ A;  2GQL A;  3LQ7 A;  3ISO A;  4GTU A;  4RQX A;  2YV7 A;  4I2U A;  3BCK A;  3WYW A;  2B6M A;  3A3T A;  4MJA A;  1JLV A;  1S3C A;  3BBY A;  1IYI A;  4O5Q A;  1SU9 A;  1GP1 A;  4TR1 A;  2AUV A;  2R3X A;  2F9S A;  2HZF A;  1ZYE A;  3EIN A;  4K8M A;  5D9V A;  4AJ8 A;  1I5G A;  3IPZ A;  5ECQ B;  4N11 A;  1OE8 A;  1FAA A;  1R5P A;  3C7M A;  2QC7 A;  3E3E A;  2VM1 A;  5IOW A;  1U87 A;  4KSO A;  3GSS A;  4XTS A;  4POM A;  4K0G A;  3I6A A;  3F4T A;  1K3L A;  2LS5 A;  3IHG A;  5H5S A;  3PGT A;  3HCZ A;  1M9A A;  4I5Q A;  5ECN B;  5F05 A;  3ZRD A;  3EC3 A;  1Z6N A;  1BG5 A;  2H75 A;  3TOT A;  4ZXG A;  2O89 A;  2V32 A;  3IC4 A;  3A5I A;  1Z9H A;  3F6F A;  1NM3 A;  4BA7 A;  1JFU A;  2AAW A;  1GSU A;  2H6Z A;  2JAC A;  4KX4 A;  5G31 A;  3KH9 A;  2PVQ A;  1MDK A;  3V1W A;  2C3T A;  1XVQ A;  4HZ2 A;  4GQF A;  3KEB A;  4GST A;  4ZL8 A;  3CBU A;  1GLQ A;  3EYT A;  2IFQ A;  4Q5Q A;  3FR3 A;  3G7J A;  2RUE A;  2LNT A;  4IP6 A;  5B8B A;  2EC4 A;  1O85 A;  3HJP A;  4I8B A;  3DVW A;  3E9J B;  4I2T A;  4ILF A;  2MZC A;  2A2R A;  4G0L A;  2H30 A;  3D5J A;  4PQI A;  4CY6 A;  3MSZ A;  2LKU A;  4HU9 A;  2L6C A;  4I6X A;  17GS A;  2DJ1 A;  1PKZ A;  4ZB8 A;  6GSV A;  2IL3 A;  1T8E B;  1XWG A;  3H8Q A;  3IAM 2;  4PQH A;  1A2L A;  2H19 A;  2LJA A;  2IJY A;  1J0F A;  1MDI A;  3VI7 A;  3QAW A;  4QQ7 A;  2R6K A;  1JZO A;  1PN9 A;  5KOX A;  3GKX A;  1K0M A;  2E2G A;  2FA8 A;  1MDJ A;  2HRK A;  2GSR A;  5ECR B;  3QFB C;  1X9S B;  2LST A;  5DBQ A;  2JZT A;  2YWN A;  3LWA A;  2EIO A;  4YKG A;  5DAK A;  4BL7 B;  3H79 A;  4PNG A;  3WD6 A;  2HSY A;  2V1M A;  1V40 A;  3KCM A;  1W89 A;  2X49 A;  3QAG A;  5AN1 A;  4LA1 A;  1V57 A;  2IFQ B;  2GVP A;  4GLT A;  5INY A;  2CX4 A;  1ERV A;  2L5O A;  1ZL9 A;  4IQ1 A;  3CTF A;  3HVX A;  2AJQ B;  4KSM A;  2L4C A;  4K9Z A;  4TVE A;  1SL2 B;  5E4W A;  4HUA A;  1KTE A;  4LLR A;  5F0G A;  3IXR A;  4CHS A;  2VD0 A;  4FYC A;  2PBJ A;  3FK8 A;  3HJM A;  2I4A A;  2FWH A;  3D4T A;  2OBK A;  3FMW A;  5H5Q A;  2FA4 A;  2AYT A;  2RLI A;  5A4W A;  3W8J A;  4NAX A;  1OVN A;  1UVZ A;  2P5R A;  3UIW A;  5CRW A;  3CYN A;  1XXU A;  3HHV A;  3LW9 A;  1QK8 A;  2L59 A;  1QFN A;  2Z9S A;  4IN0 A;  3EU4 A;  4EC0 A;  2B7K A;  2VL2 A;  4O5U A;  4WKW A;  3Q6O A;  1ZZY A;  5B6M A;  3KD0 A;  4ML6 A;  2V6O A;  3HZ4 A;  1N8J A;  3CSH A;  5ELG A;  3A2X A;  2IIY A;  1YJ6 A;  3F8U A;  4N0V A;  1U3A A;  1SL0 B;  5G1L A;  1ON4 A;  2XPD A;  1T4Z A;  4FYU A;  3RHB A;  3MDK A;  2C0F A;  2B7J A;  1M2A A;  1KEB A;  2JZS A;  2WDU A;  4TN8 A;  5A4V A;  1SK2 A;  1TW9 A;  2CQ9 A;  3VFI A;  2X64 A;  2GSQ A;  5CAX A;  1TI3 A;  1VF3 A;  5G5E A;  2OE0 A;  4MH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...