1SKRB

T7 dna polymerase complexed to dna primer/template and ddatp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
105
Chain Sequence
KIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/electron transport/dna
molecule keywords 5'-D(*CP*GP*AP*AP*AP*AP*CP*GP*AP*C*GP*GP*CP*CP*AP*GP*TP*GP*C
publication title Nucleotide insertion opposite a cis-syn thymine dimer by a replicative DNA polymerase from bacteriophage T7.
pubmed doi rcsb
source organism Enterobacteria phage t7
total genus 25
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2004-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1skrB00
1T4ZA 3WT1A 1M7TA 4PUAA 5DCHA 2HSHA 1EEMA 4ML6A 3EINA 3D22A 4RI6A 4GSSA 3KIJA 4NHZA 5B8AA 4OCFA 2LJRA 2G2QA 3WGXA 2NVLA 2HRNA 4N11A 1EWXA 4BWSA 4WR5A 3HHVA 3QFAC 3EWLA 1A24A 1JZDA 3PINA 2K6VA 4EXJA 3GH9A 3ERFA 1XPVA 4TOPA 1FB0A 3F0IA 2DJ1A 2JADA 3A3TA 3GX8A 4F0CA 2O85A 2R3XA 2L4QA 1E2YA 4KH7A 3HD5A 1GNEA 5ECKB 3MAKA 4I97A 2H1GA 1MDKA 1PD21 5G31A 3IAS2 3GHAA 4CW9A 2YOIA 2LEGA 2YV7A 5EVOA 2I81A 1GULA 2AJQB 1ERUA 2D2ZA 4PGTA 2H1DA 3GN3A 3HZ8A 5ECLB 2HZEA 1GLPA 1WPIA 2TRXA 4WKWA 4NV2A 4IQ1A 1YY7A 4KUNA 3IA1A 1USBA 2OA7A 4FH8A 5EL8A 3S9FA 1SL2B 2H6YA 4X43A 2XHFA 3W6GA 4XS6A 4E8EA 1X5DA 1FW1A 1X9WB 3HVVA 3I69A 3AY8A 4O92A 1A0FA 2BMXA 2O7KA 3F4SA 1TW9A 2LV3A 4TR4A 1GSYA 4L5LA 3RDWA 3RHCA 1GLQA 5DVBA 1I5GA 2R5GA 3VWUA 2R4VA 1ZOFA 1ILOA 2K8VA 3VPQA 4DVCA 2KUCA 2H1BA 3QR6A 2DSAA 3TUEA 3C1SA 1GRXA 2OBIA 2YJ7A 2RLIA 1GUHA 1A8YA 1TRWA 2XBQA 3P2AA 2LUSA 1JZOA 3ZTLA 1DE2A 4L0WA 4KB3A 5J41A 3GV1A 3GL5A 3ZZXA 3UBKA 4NWYA 3ZRDA 3TKRA 1MD4A 1K3YA 3DMLA 1XW5A 2OE3A 1A2MA 1HQOA 1G0TA 2X8HA 4ZBAA 1YKAA 1OKTA 2PERA 5GZZB 1G6WA 2L57A 4MH2A 4LL4B 4X0XA 3VWVA 4XS1A 2V2GA 1XW9A 2HI7A 4JEDA 5FWGA 3MWHA 3CTFA 2QC7A 4OD7A 2I9HA 1F37A 1M2BA 1R26A 2H8LA 4IHUA 3ZLPA 3IV4A 2R2JA 1XFLA 3VURA 1PRXA 5CNWA 5E4WA 2LS5A 5G5FA 2DMLA 3F4RA 4J56E 3EMPA 3MNGA 1XWKA 3KMOA 2VAFA 3N9JA 4POLA 2B5YA 3M0FA 4GQFA 1QQ2A 1XWGA 2XPDA 5J3RA 1J9BA 1V9WA 1BG5A 1GSSA 2O8VB 4ZBDA 1ZMAA 3UAPA 2LSTA 2P31A 3FZ9A 3O76A 1WOUA 4EKZA 2B6MA 1Q98A 1RQMA 3APOA 1SKSB 4K6XA 1TK5B 1T7PB 4G9HA 2JSYA 4YQUA 5CREA 2L6CA 4MJCA 5DQYA 4EC0A 2WJUA 3UJ1A 1BEDA 1THOA 4IQAA 1OVNA 1VF4A 3GIXA 1PSQA 4LMWA 3G7IA 5AIXA 1K0NA 3VWWA 2HRFA 3TJGA 4I6XA 4K0NA 3GH6A 4J57E 4MJAA 1SL1B 1XW6A 2KOKA 4POBA 1PL1A 3FR9A 2JSZA 2EIRA 1KEBA 3M9KA 3F4TA 4F2IA 3CMIA 3KD0A 3TJBA 18GSA 5F07A 3W8SA 4PNGA 2LNSA 1OE7A 1T4YA 2MYGA 2H01A 4ISDA 2B1KA 1Z6MA 2CZ2A 3UOMA 3HJPA 5ECSA 3ZITA 4YAVA 4QL7A 2VCZA 2DIYA 2JZTA 6GSSA 2REMA 3QAGA 2DJJA 3KM6A 3L9VA 1NSWA 1WWJA 2YPMA 2J23A 1OC8A 3WT2A 1ERVA 3LEFA 4JU5A 4ZXGA 3CRUA 3NOFA 3ZFBA 4DSQA 4H86A 3FZAA 2E2MA 3TKPA 2FA8A 1BQ7A 12GSA 1TU7A 4IGJA 1GTBA 3QPMA 5ID2A 1K0OA 4WEYA 4TR1B 3GMFA 5B6MA 5H5SA 4K7NA 4QL9A 4KX4A 1ZYQB 3IBHA 3CSJA 4POKA 3ZMKA 1PMTA 3FW2A 3HDCA 1GSUA 2H6ZA 3OR5A 3QAWA 4L0UA 1F3BA 2MMAA 3QMXA 1KNGA 4EE0A 2IN3A 1B4PA 1F3AA 4QQ7A 3UL3A 2IMEA 3TJKA 4X1UA 1X0RA 3LFLA 4KDUA 2GT6A 1RK4A 4ML1A 3FY7A 1WJKA 2GQMA 2HSYA 1SL0B 1V58A 1GUKA 4OFMA 1J08A 4L5OA 3E0UA 2CAIA 3O3TA 4IJIA 5IPGA 2VLTA 1CQHA 3WD6A 2N5BA 1WIKA 2FWEA 2GZZA 1JLVA 2WFCA 4OWYA 4KE3A 3U6VA 3FZ5A 3MSZA 3IXRA 5LCZA 4I2UA 4Q5FA 5G30A 3HJOA 4K9ZA 5HFKA 1V98A 3V1WA 5DALB 3GKNA 2V41A 2YANA 4NMUA 4ZB9A 3QOUA 2VO4A 1IYHA 4ECIA 2GS3A 1QK8A 2H70A 5JWQB 4ECJA 1IYIA 1K3OA 2V32A 2A2RA 3Q6OA 2FLSA 1XOAA 3EMXA 4LA1A 3L78A 2F8AA 4XIHA 3KGKA 4V2LA 2YWOA 4WBRD 1NW2A 2VLVA 5CP1A 1FVKA 3EURA 1FHEA 1M2DA 2XPEA 3WYWA 3UARA 1PKZA 1K3LA 2H76A 5HR2A 2HFDA 4ZB6A 5ECOB 5JCGA 2X8CA 2RIIA 5IMVA 1K0MA 2JL4A 2MBSA 1SYXA 4GTUA 5DBQA 5KN2A 5IO0A 1LU4A 2H74A 3GYKA 3GX0A 1S3DA 3CBUA 3E9JB 5CYYA 3VLNA 2DJKA 5DQSA 4ZIJA 1GL8A 2WCIA 3TRXA 1AQVA 4FYBA 1X9SB 1G7EA 2YWNA 1O8XA 4HS1A 2NDOA 5JWOB 3ZYWA 4TRXA 2C8UA 1PX7A 3LYPA 2CX4A 3HCZA 2GQLA 4MJBA 3HYPA 2VCXA 4KDXA 4Z7XA 1ZL9A 2LRNA 3UVHA 4FYCA 4IBPA 3WGDA 4N30A 1U3IA 2N5AA 3ZVJA 4TR1A 1DE1A 4OMVA 4KSOA 2JU5A 1MDIA 4TXOB 3APQA 1SK1A 5IOWA 4ZL7A 4MCUA 3RHBA 3D21A 1THXA 5D9TA 5D73A 1MTCA 2EIOA 3P90A 3BD2A 1NM3A 1R7HA 1JHBA 3BCIA 3J7Yk 3F3RA 2H73A 3A2WA 1XZOA 4E8HA 1SENA 5A4WA 2M72A 4KGIA 2GT5A 2GTUA 5AN1A 1U88A 3CYNA 3IRAA 4GLTA 3D6IA 1BAYA 2HE3A 3FZ4A 5A5KA 4GXZA 8GSSA 2OADA 4JBBA 2VM2A 1PN9A 3H1NA 3O6TA 2VM1A 1CQGA 2BJXA 4G19A 2I1UA 3N5OA 1SYRA 4V1Ag 3CRTA 2RM5A 2FWFA 3DYRA 6GSVA 3IK9A 3FHKA 2LRCA 2IIYA 3M9JA 1TK0B 4I8BA 1U6TA 5F0GA 1GWCA 4MMMA 4V1Ap 1DSBA 3NZNA 5CAXA 2PBJA 5ECQB 2CA8A 3KP8A 2E2GA 2GSRA 2J9HA 1V2AA 3SWLA 3GUSA 5DALA 1O85A 3I43A 1PL2A 1AW9A 3L9UA 3IPZA 4HOJA 1XOBA 4XRDA 1FB6A 2DJ3A 3L4NA 1EOHA 3EYTA 1SD8A 5ELAA 1ZYEA 3TKQA 2H75A 2CVBA 2LKUA 3GKKA 2V6OA 5DCGA 1X5CA 1XCCA 3EVIA 2H0GA 3FR3A 4WBJA 4OFTA 1YEPA 4NPBA 1B9YC 4MJEA 4WF4A 5AISA 4IW9A 1OAZA 1EEJA 2LRTA 3QAVA 4MABA 1UA5A 5ECIB 1FG4A 5IIZA 5DJMA 2AUVA 2VL2C 1XXUA 5DDLA 5IQYA 3KP9A 2H71A 3F9UA 2L6DA 1MEKA 4FYUA 1TI1A 2HNLA 2L5OA 3LXZA 2DBCA 1AUCA 4Q5QA 5IOXA 3HJMA 5G5EA 14GSA 5CRGA 3ME8A 1PGTA 2WULA 5B7CA 2I4AA 4K8MA 5ELGA 3FR6A 2GDRA 1SJZA 2JZRA 3D0ZA 3D4TA 4OO4A 2PWJA 10GSA 3C8EA 5G2ZA 4OFNA 4XRAA 3GSSA 1R5AA 5DAKB 3NIVA 1JZRA 1M2AA 4TKYA 5HFIA 3FEUA 2CAQA 5C04A 4HQZA 2WDUA 4KAEA 5HR1A 4YH2A 5IMFA 1QFNA 1GSQA 20GSA 1MD3A 2ON5A 3LJRA 1XIYA 4MK3A 2X99A 1ERWA 4BPYA 2VCQA 3ISOA 3W8JA 4BL7A 2RUEA 1Z5YE 2C3NA 3VPTA 2FY6A 2NTOA 5H5QA 1V40A 4MP4A 4JZQA 2FNOA 5ENUA 2HZFA 2WB9A 4RQRA 1Q4JA 3RPPA 1B9XC 3BOAA 1GUMA 1YF1A 4O5RA 4F9ZA 2MBTA 4GRFA 2MZCA 4MPFA 4NV5A 5IM9A 2LTKA 5D9XA 4O7HA 2B1LA 1ZCPA 3GRXA 4N0ZA 3LXTA 4XTSA 1O6JA 1Z6NA 11GSA 2L59A 5ECRB 3RPNA 1QGVA 4HJ2A 4TVEA 1H4OA 2VCWA 3TRQA 3CSIA 1UVZA 3DD3A 5EY6A 3TRPA 3HXSA 1EV4A 1T3BA 4AF2A 2TIRA 2YZUA 1A2JA 2IMFA 2WGRA 3SBCA 1Y25A 3ED3A 3PGTA 3UIWA 3A2XA 1F2EA 5H5RA 2B3SA 1SU9A 3GSTA 2C0DA 2F51A 4XCSA 1X9MB 3ME7A 3TOTA 1TDIA 1SJ6A 2N5FA 3RBTA 1YF0A 2FUG2 5FT3A 2IJYA 2M46A 3UMAA 3A5WA 2E7PA 1QUWA 5KEJA 2DLXA 3L9SA 4PX1A 3TB2A 3L0HA 1TRVA 4ZL8A 2L4CA 2MMZA 16GSA 2VL2A 3ZIVA 2FWGA 6GSTA 2P0GA 3DVXA 1DUGA 2YJHA 4D73B 2B7KA 2PPTA 2IMIA 1SKRB 3G9BA 2I3YA 4YQMA 4LL1B 1TJDA 5ECHB 5E59A 1S3AA 4EDYA 3I6AA 3DVWA 2FCHA 3P7XA 3VI7A 3TKSE 3GFKA 1FAAA 2YWIA 2PVOC 3DKSA 1HYUA 1R5PA 2WRTA 2NPBA 3RAZA 1ABAA 2C80A 3TGZA 4K7IA 1ACVA 1DBYA 2H66A 5HFGA 3IC4A 1HNBA 3H79A 3BBYA 2OKAA 2YV9A 4ZILA 4K2DA 2XC2A 3ZMLA 2ZUPA 1YKCA 5AIVA 2K8SA 2PUKC 2GQKA 1V57A 2OE0A 2KP2A 1GTUA 5J9CA 1C72A 3F8UA 1ST9A 5IMZA 4ZB8A 1OKDA 3F3QA 3BJ5A 5C00A 5F05A 4PQIA 3DEXA 1Z9HA 2CV4A 4RUVA 4JRRA 2EC4A 3CXGA 3ZREA 4MDCA 2TRCP 1GNWA 3J7Yb 1B48A 1NHYA 4NXIA 2G0FA 4ILFA 4MZBA 4POMA 2VL3A 4XS4B 1OYJA 2NBSA 3K8NA 1PX6A 3EU4A 4MZWA 2GVPA 4WR4A 4GCIA 3TJJA 1Z7RA 3HY2A 1FVJA 2R37A 3TKSC 17GSA 5HR0A 1TRUA 1HD2A 3HZ4A 1GTAA 5G1LA 2KLXA 1B8XA 3IR4A 1YZXA 4V2NA 2C3QA 4HU7A 2LNTA 4K0GA 4NAXA 1B4QA 2GSQA 2CX3A 3M8NA 2KHPA 2MMNA 1A2LA 4IELA 5IMDA 2OE1A 2C0GA 2P5RA 4LLRA 1A0RP 1O8WA 5ECPB 5LD0A 4DSRA 2IFQB 3CTGA 1NHOA 4NHWA 2ZNMA 5J5NA 3QCPA 2C4JA 1H75A 2KP1A 2IL3A 1TU8A 3UEMA 3H93A 3PR8A 1K0AA 3VK9A 3EU3A 5KN0A 3LORA 1AQWA 5HQPA 4GWRA 1O73A 4ECBA 2OBKA 3GURA 2DMMA 4OCEA 1M99A 4Q5RA 3DGQA 2CVDA 1JZWA 4GSTA 2X8GA 3LGCA 2YP6A 2A2SA 2LQQA 5JCWA 4TN8A 4KCEA 2EIQA 4D73A 3ZL5A 4IP1A 2PN8A 1X5EA 4JE1A 2DJ0A 2YCDA 2DIZA 4EL1A 4EUYA 3ZFLA 2YZHA 4IKHA 4HJMA 1QMVA 2WZ9A 3IK7A 2VCTA 2VCVA 2H72A 1VF2A 3ERGA 2YN1A 3DXBA 1N8JA 3KEBA 2JZSA 4K7OA 4BVYA 1T1VA 2RM6A 1ZZYA 1SD9A 2CVKA 2HYXA 5GAPD 1AQXA 1K0CA 2CZ3A 4WETA 1WP0A 2MMOA 3DRNA 4IJ3A 4GQCA 2JACA 4J2FA 3KJYA 1VF1A 2VD0A 4EF0A 1VF3A 1GH2A 4HEA2 1SK0A 2ES7A 3ZVJD 3EE2A 3GNJA 5IMAA 5IO2A 4K1FA 5B8BA 3Q18A 4MH3A 3F6DA 4P3YB 1M0UA 4ID0A 5DJLA 3HVSA 4KW6A 2ON7A 2HLSA 2WS2A 2IWTA 13GSA 5KN3A 3GL3A 3QDNA 5L71A 3GKMA 4YAPA 1A8LA 1UN2A 3F6FA 1R4WA 3C73A 2R6KA 3IE3A 2OACA 3E3EA 1E6BA 2FGXA 1W4VA 1G6YA 2IPAA 2L5LA 5A4UA 4XS4A 2A4VA 2B5XA 3H4KA 3LG6A 2VUPA 4IP6A 1EGRA 1EP7A 3I9V2 3TKSA 1PQNA 2H0IA 4PUFC 4AJ8A 3P8WA 4HDEA 3D4MA 4PQ1A 9GSSA 1HNCA 2O87A 5ID2B 1URMA 2YWMA 5D9VA 2AYTA 4PNFA 3ERWA 2FWHA 1F6MC 2FA4A 1GSEA 2C3TA 3CSHA 1YEXA 1S3CA 3IOSA 5D8IA 3A2VA 4EO3A 1F9MA 2M80A 1XWCA 3WGEA 1AAZA 6GSUA 3KMNA 4V2MA 2IMDA 3U5RE 3VWXA 2IFQA 1YDKA 1N2AA 3H8QA 5JCUA 3Q19A 2GSTA 2VIMA 3DWVA 5GSSA 2PVQA 3M3MA 1VRSD 5GSTA 4PQHA 4TR3A 2PMTA 5AGYA 1TXXA 4DSSB 2VOCA 1BYEA 4GSNA 1EZKA 4MPGA 5CO3A 2C0FA 5GAND 1PKWA 5IPHA 6GSYA 3VI5A 3C7MA 1FOVA 4TXOA 1XWAA 2B5EA 4XHMA 3Q74A 4TXVA 1I9DA 4HQSA 2QGVA 4OO5A 5D9WA 4CHSA 3R2QA 4KCAA 1J0FA 4IVFA 3KTLA 1HNAA 2C1YA 1EGOA 1U3AA 4ZL9A 4O32A 4I5QA 4GF0A 1SKWB 2QSIA 1XWBA 1QXHA 2E0QA 2F3MA 2F9SA 4WXTA 3LSZA 5G1KA 4FIWA 1Y6EA 1OC9B 3LWAA 2AB6A 3KH9A 1VGLA 1GSDA 2ALBA 5JWRB 3DIEA 2PU9C 3EC3A 3HA9A 1TOFA 3KH7A 2VLUA 1ML6A 5CRWA 1TI3A 1W89A 1LBKA 4PURA 4KSMA 4L8EA 2QKEA 1KBNA 2H19A 3FYGA 3LQ7A 1G7OA 1TTZA 4TR0A 4RQXA 3FK8A 2O89A 4Q5NA 2FHEA 4EDZA 3GTUB 4JR4A 2XBIA 2K18A 3IHQA 3G7JA 1T8EB 3HVXA 3D5JA 3KCMA 2VD1A 4MF5A 5KN1A 2H0HA 4KNDA 2GLRA 1ZGNA 2BTOT 2VL9A 3C1RA 1WE0A 2H1AA 2GGTA 1K0DA 2CT6A 2DC5A 3TDGA 3US3A 22GSA 5COHA 4EVMA 1Z7PA 3TCOA 3BCKA 3GKXA 4RI7A 4I2TA 3G7YA 4G10A 1EOGA 2PGTA 3JCML 5FHIA 1XVWA 3UBLA 2H30A 4F0BA 5ABRA 2RUFA 4DEJA 5INYA 4N10A 1ON4A 2C0EA 3IAM2 3KZQA 4AJ7A 1FO5A 4HZ2A 3QD9A 3M1GA 1O7UA 2DJ2A 3MDKA 1EV9A 6GSXA 1XBSA 5EPFA 5CRHA 3KXOA 1JLWA 2GSSA 2V1MA 4KA0A 1TP9A 4JR6A 4MLYA 4MZCA 4ECCA 1YQ1A 1A23A 1BX9A 2LJKA 2FD3A 2LJAA 4PXOA 2K9FA 1WMJA 1OC3A 5D93A 1KTEA 1GP1A 4HU9A 1GTIA 2GZYA 1WRYA 4HUAA 4KDYA 5A4VA 4BA7A 1UC7A 1T00A 2AHEA 1M9AA 2HZEB 1M9BA 2CQ9A 4DSSA 4ACSA 1TKDB 2X64A 2LQOA 1U87A 1XVQA 4BVXA 5B6NA 5DAKA 2GZPA 1Z3EA 1AC1A 3UVTA 3KTBA 1K0BA 6GSWA 4ZBBA 4LMVA 1TK8B 5IMCA 4BWQA 3QFBC 2B7JA 1LJRA 2YNXA 4HI7A 4AGSA 1GSFA 1ERTA 4CDOA 2AAWA 1PA3A 5LNKe 4IS0A 3IDVA 5J4UA 1AIUA 3GA4A 2P5QA 5ECMB 1SK2A 2H6XA 1RW1A 4YQVA 4MF6A 4F82A 1TRSA 4TW5A 5CRDA 1YJ6A 1OE8A 1EP8A 1BJXA 2ZCTA 5J9BA 1AXDA 1MDJA 3C71A 19GSA 1SJIA 3ZIJA 2OJLA 2V6KA 3PH9A 1OC9A 2HXKA 5D96A 3LYKA 3HKRA 4AJ6A 2IMKA 4MA9A 3F63A 4MF7A 4G2EA 3VFIA 4FO5A 3APSA 1JFUA 5F8BA 4ULXA 7GSSA 3TJFA 4N0VA 3FRCA 4WF5A 3TOUA 5ECNB 5F06A 4IN0A 2HT9A 2Z9SA 2AV4A 5HR3A 1O81A 3FKFA 4HZ4A 2F8FA 3GTUA 4F03A
chains in the Genus database with same CATH superfamily
1T4ZA 3WT1A 1M7TA 5KOWA 4PUAA 5DCHA 2HSHA 1EEMA 4ML6A 3EINA 3D22A 4RI6A 4GSSA 3KIJA 4NHZA 5B8AA 4OCFA 2LJRA 2G2QA 3WGXA 2NVLA 2HRNA 4N11A 1EWXA 4BWSA 4WR5A 3HHVA 3QFAC 3EWLA 1A24A 1JZDA 3PINA 2K6VA 4EXJA 3GH9A 3ERFA 1XPVA 4TOPA 4CY6A 1FB0A 3F0IA 3FMWA 2DJ1A 2JADA 3A3TA 3GX8A 4F0CA 2O85A 2R3XA 2L4QA 1E2YA 4KH7A 3HD5A 1GNEA 5ECKB 3MAKA 4I97A 2H1GA 1MDKA 2A2PA 1PD21 5G31A 2X4AA 3IAS2 3GHAA 4CW9A 2YOIA 2LEGA 2YV7A 5EVOA 2I81A 1GULA 2AJQB 1ERUA 2D2ZA 4PGTA 2H1DA 3GN3A 3HZ8A 2X49A 5ECLB 2HZEA 1GLPA 1WPIA 2TRXA 4WKWA 4NV2A 4IQ1A 1YY7A 4KUNA 3IA1A 1USBA 2OA7A 4FH8A 4EIPA 5EL8A 3S9FA 1SL2B 2H6YA 4X43A 2XHFA 3W6GA 4XS6A 4E8EA 1X5DA 1FW1A 1X9WB 3HVVA 3I69A 3AY8A 4O92A 1A0FA 2BMXA 2O7KA 3F4SA 1TW9A 2LV3A 4TR4A 1GSYA 4L5LA 3RDWA 3RHCA 1GLQA 5DVBA 1I5GA 2R5GA 3VWUA 2R4VA 1ZOFA 1ILOA 2K8VA 3VPQA 4DVCA 2KUCA 2H1BA 3QR6A 2DSAA 3TUEA 3C1SA 1GRXA 2OBIA 2YJ7A 2RLIA 1GUHA 1A8YA 1TRWA 2XBQA 3P2AA 2LUSA 1JZOA 3ZTLA 1DE2A 4L0WA 4KB3A 5J41A 3GV1A 3GL5A 3ZZXA 1XG8A 4K2XA 3UBKA 4NWYA 3ZRDA 3TKRA 1MD4A 1K3YA 3DMLA 1XW5A 2OE3A 1A2MA 1HQOA 1G0TA 2X8HA 4ZBAA 1YKAA 1OKTA 2PERA 5GZZB 1G6WA 2L57A 4MH2A 4LL4B 4X0XA 3VWVA 4XS1A 2V2GA 1XW9A 2HI7A 4JEDA 5FWGA 3MWHA 3CTFA 2QC7A 4OD7A 2I9HA 1F37A 1M2BA 1R26A 2H8LA 4IHUA 3ZLPA 3IV4A 2R2JA 1M3IA 1XFLA 3VURA 1PRXA 5CNWA 5E4WA 2LS5A 5G5FA 2DMLA 3F4RA 4J56E 3EMPA 3MNGA 1XWKA 3KMOA 2VAFA 3N9JA 4POLA 2B5YA 3M0FA 4GQFA 1QQ2A 1XWGA 2XPDA 5J3RA 1J9BA 1V9WA 1BG5A 1GSSA 2O8VB 4ZBDA 1ZMAA 3UAPA 2LSTA 2P31A 3FZ9A 3O76A 1WOUA 4EKZA 2B6MA 1Q98A 1RQMA 3APOA 1SKSB 1M3JA 4K6XA 3HVNA 1TK5B 1T7PB 1PFOA 4G9HA 2JSYA 4YQUA 5CREA 2L6CA 4MJCA 5DQYA 4EC0A 2WJUA 3UJ1A 1BEDA 1THOA 4IQAA 1OVNA 1VF4A 3GIXA 1PSQA 4LMWA 3G7IA 5AIXA 1K0NA 3VWWA 2HRFA 3TJGA 4I6XA 4K0NA 3GH6A 4J57E 4MJAA 1SL1B 1XW6A 2KOKA 4POBA 1PL1A 3FR9A 2JSZA 3IC8A 2EIRA 1KEBA 3M9KA 3F4TA 4F2IA 3CMIA 3KD0A 3TJBA 18GSA 5F07A 2QA1A 3W8SA 4PNGA 2LNSA 1OE7A 1T4YA 2MYGA 2H01A 4ISDA 2B1KA 1Z6MA 2CZ2A 3UOMA 3HJPA 5ECSA 3ZITA 4YAVA 4QL7A 2VCZA 2DIYA 2JZTA 6GSSA 2REMA 3QAGA 2DJJA 3KM6A 3L9VA 1NSWA 1WWJA 2YPMA 2J23A 1OC8A 3WT2A 1ERVA 3LEFA 4JU5A 4ZXGA 3CRUA 3NOFA 3ZFBA 4DSQA 4H86A 3FZAA 4K5SA 2E2MA 3TKPA 2FA8A 1BQ7A 12GSA 1TU7A 4IGJA 1GTBA 3QPMA 5ID2A 1K0OA 4WEYA 4TR1B 3GMFA 5B6MA 5H5SA 4K7NA 4QL9A 4KX4A 1ZYQB 3IBHA 3CSJA 4POKA 3ZMKA 1PMTA 3FW2A 3HDCA 1GSUA 2H6ZA 3OR5A 3QAWA 4L0UA 1F3BA 2MMAA 3QMXA 1KNGA 4EE0A 2IN3A 1B4PA 1F3AA 4QQ7A 3UL3A 2IMEA 3TJKA 4X1UA 1X0RA 3LFLA 4KDUA 2GT6A 1RK4A 4ML1A 3FY7A 1WJKA 2GQMA 2HSYA 1SL0B 4KF9A 1V58A 1GUKA 4K5RA 4OFMA 1J08A 4L5OA 3E0UA 2CAIA 3O3TA 4IJIA 5IPGA 2VLTA 1CQHA 3WD6A 2N5BA 1WIKA 2FWEA 2GZZA 1JLVA 2WFCA 4OWYA 4KE3A 3U6VA 3FZ5A 3MSZA 3A5IA 3IXRA 1ZYNA 5LCZA 4I2UA 4Q5FA 5G30A 2R0PA 3HJOA 4K9ZA 5HFKA 1V98A 3V1WA 5DALB 3GKNA 2V41A 2YANA 4NMUA 4ZB9A 3QOUA 2QA2A 2VO4A 2A4HA 1IYHA 4ECIA 2GS3A 1QK8A 2H70A 5JWQB 4ECJA 1IYIA 1K3OA 2V32A 2A2RA 3Q6OA 2FLSA 1XOAA 3EMXA 4LA1A 3L78A 4HSCX 2F8AA 4XIHA 3KGKA 4V2LA 2YWOA 4WBRD 1NW2A 2VLVA 5CP1A 1FVKA 3EURA 1FHEA 1M2DA 2XPEA 3WYWA 3UARA 1PKZA 1K3LA 2H76A 5HR2A 2HFDA 4ZB6A 5ECOB 5JCGA 4O5QA 2X8CA 2RIIA 5IMVA 1K0MA 2JL4A 2MBSA 4G0KA 1SYXA 4GTUA 5DBQA 5KN2A 5IO0A 1LU4A 2H74A 3GYKA 3GX0A 1S3DA 3CBUA 3E9JB 5CYYA 3VLNA 2DJKA 5DQSA 4ZIJA 1GL8A 2WCIA 5BMUA 3TRXA 1AQVA 4FYBA 1X9SB 1G7EA 2YWNA 1O8XA 4HS1A 2NDOA 5JWOB 3ZYWA 4TRXA 2C8UA 1PX7A 3LYPA 2CX4A 3HCZA 2GQLA 4MJBA 3HYPA 2VCXA 4KDXA 4Z7XA 1ZL9A 2LRNA 3UVHA 4FYCA 4IBPA 3WGDA 4N30A 1U3IA 2N5AA 3ZVJA 4TR1A 1DE1A 4OMVA 4KSOA 2JU5A 1MDIA 4TXOB 3APQA 1SK1A 5IOWA 4ZL7A 4MCUA 3RHBA 3D21A 1THXA 5D9TA 5D73A 1MTCA 2EIOA 3P90A 3BD2A 4Z2TA 1NM3A 1R7HA 1JHBA 3BCIA 4MNNA 3J7Yk 3F3RA 2H73A 3A2WA 1XZOA 4E8HA 1SENA 5A4WA 2M72A 4BL7B 4KGIA 2GT5A 2GTUA 5AN1A 1U88A 3CYNA 3IRAA 4GLTA 3D6IA 1BAYA 2HE3A 3FZ4A 5A5KA 4GXZA 8GSSA 2OADA 4JBBA 2VM2A 1PN9A 3H1NA 3O6TA 2VM1A 1CQGA 2BJXA 4G19A 2I1UA 3N5OA 1SYRA 4V1Ag 3CRTA 2RM5A 2FWFA 3DYRA 6GSVA 3IK9A 4ICYA 3FHKA 2LRCA 2IIYA 3M9JA 1TK0B 4I8BA 1U6TA 4A5PA 5F0GA 1GWCA 4MMMA 4V1Ap 1DSBA 3NZNA 5CAXA 2PBJA 5ECQB 2CA8A 3KP8A 2E2GA 2GSRA 2J9HA 1V2AA 3SWLA 3GUSA 5DALA 1O85A 3I43A 1PL2A 1AW9A 3L9UA 3IPZA 4HOJA 1XOBA 4XRDA 1FB6A 2DJ3A 3L4NA 1EOHA 3LW9A 3EYTA 1SD8A 5ELAA 1ZYEA 3TKQA 2R0CA 2H75A 2CVBA 2LKUA 3GKKA 2V6OA 3R3EA 5DCGA 1X5CA 4Z2RA 1XCCA 3EVIA 2H0GA 3FR3A 4WBJA 4OFTA 1YEPA 4NPBA 1B9YC 4MJEA 4WF4A 5AISA 4IW9A 2DKIA 1OAZA 1EEJA 2LRTA 3QAVA 4MABA 1UA5A 5ECIB 1FG4A 5IIZA 5DJMA 2AUVA 2VL2C 1XXUA 5DDLA 5IQYA 3KP9A 2H71A 3F9UA 2L6DA 1MEKA 4FYUA 1TI1A 2HNLA 2L5OA 3LXZA 2DBCA 1AUCA 4Q5QA 5IOXA 3HJMA 5G5EA 14GSA 5CRGA 3ME8A 1PGTA 2WULA 5B7CA 2I4AA 4K8MA 5ELGA 3FR6A 2GDRA 1SJZA 2JZRA 3D0ZA 3D4TA 4OO4A 2PWJA 10GSA 3C8EA 5G2ZA 4OFNA 4XRAA 3GSSA 1R5AA 5DAKB 3NIVA 3IHGA 1JZRA 1M2AA 4TKYA 5HFIA 3FEUA 2CAQA 5C04A 4HQZA 2WDUA 4KAEA 5HR1A 4YH2A 5IMFA 1QFNA 1GSQA 20GSA 1MD3A 2ON5A 3LJRA 1XIYA 4MK3A 2X99A 1ERWA 4BPYA 2VCQA 3ISOA 3W8JA 4BL7A 2RUEA 1Z5YE 2C3NA 3VPTA 2FY6A 2NTOA 5H5QA 1V40A 4MP4A 4JZQA 2FNOA 5ENUA 2HZFA 2WB9A 4RQRA 1Q4JA 3RPPA 1B9XC 3BOAA 1GUMA 1YF1A 4O5RA 4F9ZA 2MBTA 4GRFA 2MZCA 4MPFA 4NV5A 5IM9A 2LTKA 5D9XA 4O7HA 2B1LA 1ZCPA 3GRXA 4N0ZA 3LXTA 4XTSA 1O6JA 1Z6NA 11GSA 2L59A 5ECRB 3RPNA 1QGVA 4HJ2A 4TVEA 1H4OA 2VCWA 3TRQA 3CSIA 1UVZA 3DD3A 5EY6A 3TRPA 3HXSA 1EV4A 1T3BA 4AF2A 2TIRA 2YZUA 1A2JA 4YKFA 2IMFA 2WGRA 3SBCA 1Y25A 3ED3A 3PGTA 3UIWA 3A2XA 1F2EA 5H5RA 2B3SA 1SU9A 3GSTA 2C0DA 2F51A 4XCSA 1X9MB 3ME7A 3TOTA 1TDIA 1SJ6A 2N5FA 3RBTA 2HRAA 1S3RA 1YF0A 2FUG2 5FT3A 2IJYA 2M46A 3UMAA 3A5WA 2E7PA 1QUWA 5KEJA 2DLXA 3L9SA 4PX1A 3TB2A 3L0HA 1TRVA 4ZL8A 2L4CA 2MMZA 16GSA 2VL2A 3ZIVA 2FWGA 6GSTA 2P0GA 3DVXA 1DUGA 2YJHA 4D73B 2B7KA 2PPTA 2IMIA 1SKRB 3G9BA 2I3YA 4YQMA 4LL1B 1TJDA 5ECHB 5E59A 2R0GA 1S3AA 4EDYA 3I6AA 3DVWA 2FCHA 3P7XA 3VI7A 3TKSE 3GFKA 1FAAA 2YWIA 2PVOC 3DKSA 1HYUA 1R5PA 2WRTA 2NPBA 3RAZA 1ABAA 2C80A 3TGZA 4K7IA 1ACVA 1DBYA 2H66A 5HFGA 3IC4A 1HNBA 4BVYB 3H79A 3BBYA 2OKAA 2YV9A 4ZILA 4K2DA 2XC2A 3ZMLA 2ZUPA 1YKCA 5AIVA 2DKHA 2K8SA 2PUKC 2GQKA 1V57A 2OE0A 2KP2A 1GTUA 5J9CA 1C72A 3F8UA 1ST9A 5IMZA 4ZB8A 1OKDA 3F3QA 3BJ5A 5C00A 5F05A 4PQIA 5BRTA 3DEXA 1Z9HA 2CV4A 4RUVA 4JRRA 1FOHA 2EC4A 3CXGA 3ZREA 4MDCA 2TRCP 1GNWA 3J7Yb 1B48A 1NHYA 4NXIA 2G0FA 4ILFA 4MZBA 4POMA 2VL3A 4XS4B 1OYJA 2NBSA 3K8NA 2UZ8A 4G0IA 1PX6A 3EU4A 4MZWA 2GVPA 4WR4A 4GCIA 3TJJA 1Z7RA 3HY2A 1FVJA 2R37A 3TKSC 17GSA 5HR0A 1TRUA 1HD2A 3HZ4A 1GTAA 5G1LA 2KLXA 1B8XA 3IR4A 1YZXA 4V2NA 2C3QA 4HU7A 2LNTA 4K0GA 4NAXA 1B4QA 2GSQA 2CX3A 3M8NA 2KHPA 2MMNA 1A2LA 4IELA 5IMDA 2OE1A 2C0GA 2P5RA 4LLRA 1A0RP 1O8WA 5ECPB 5LD0A 4DSRA 2IFQB 3CTGA 1NHOA 4NHWA 2ZNMA 5J5NA 3QCPA 2C4JA 1H75A 2KP1A 2IL3A 1TU8A 3UEMA 3H93A 3PR8A 1K0AA 3VK9A 3EU3A 5KN0A 3LORA 1AQWA 5HQPA 4GWRA 1O73A 4ECBA 2OBKA 3GURA 2DMMA 4OCEA 1M99A 4Q5RA 3DGQA 2CVDA 1JZWA 4GSTA 2X8GA 3LGCA 2YP6A 2A2SA 2LQQA 5JCWA 4TN8A 4KCEA 2EIQA 4D73A 3ZL5A 4IP1A 2PN8A 1X5EA 4JE1A 2DJ0A 2YCDA 2DIZA 4EL1A 4EUYA 3ZFLA 2YZHA 4IKHA 4HJMA 1QMVA 2WZ9A 3IK7A 2VCTA 2VCVA 2H72A 1VF2A 3ERGA 2YN1A 3DXBA 1N8JA 3KEBA 2JZSA 4K7OA 4BVYA 1T1VA 2RM6A 1ZZYA 1SD9A 2CVKA 2HYXA 5GAPD 1AQXA 1K0CA 2CZ3A 4WETA 1WP0A 2MMOA 3DRNA 4IJ3A 4GQCA 2JACA 4J2FA 3KJYA 1VF1A 2VD0A 4EF0A 1VF3A 1GH2A 4HEA2 1SK0A 2ES7A 3ZVJD 4Z2UA 3EE2A 3GNJA 5IMAA 5IO2A 4K1FA 5B8BA 3Q18A 4MH3A 3F6DA 4P3YB 1M0UA 4ID0A 5DJLA 1ZYPA 3CQFA 3HVSA 4KW6A 2ON7A 2HLSA 2WS2A 2IWTA 13GSA 5KN3A 3GL3A 3QDNA 5L71A 3GKMA 4YAPA 1A8LA 1UN2A 3F6FA 1R4WA 3C73A 2R6KA 3IE3A 2OACA 3E3EA 1E6BA 2FGXA 1W4VA 1G6YA 2IPAA 3EPTA 2L5LA 5A4UA 4XS4A 2A4VA 2B5XA 3H4KA 3LG6A 2VUPA 4IP6A 1EGRA 1EP7A 3I9V2 3TKSA 1PQNA 2H0IA 4PUFC 4AJ8A 3P8WA 4HDEA 3D4MA 4PQ1A 9GSSA 1HNCA 2O87A 5ID2B 1URMA 2YWMA 5D9VA 2AYTA 4PNFA 3ERWA 2FWHA 1F6MC 2FA4A 1GSEA 2C3TA 3CSHA 1YEXA 1S3CA 3IOSA 5D8IA 3A2VA 4EO3A 1F9MA 4G0LA 2M80A 2HSMA 1XWCA 3WGEA 1AAZA 6GSUA 3KMNA 4V2MA 2IMDA 3U5RE 3VWXA 2IFQA 1YDKA 1N2AA 3H8QA 4FQUA 5JCUA 3Q19A 2GSTA 2VIMA 3DWVA 5GSSA 2PVQA 3M3MA 1VRSD 5GSTA 4PQHA 4TR3A 2PMTA 5AGYA 1TXXA 4DSSB 2VOCA 1BYEA 4GSNA 4X4JA 1EZKA 4MPGA 5CO3A 2C0FA 5GAND 1PKWA 5IPHA 6GSYA 3VI5A 3C7MA 4PTSA 4BVXB 1FOVA 4TXOA 4YKGA 1XWAA 2B5EA 4XHMA 3MIXA 3Q74A 4TXVA 1I9DA 4HQSA 2QGVA 4OO5A 5D9WA 4CHSA 3R2QA 3PPUA 4KCAA 1J0FA 4IVFA 3KTLA 1HNAA 2C1YA 1EGOA 1U3AA 4ZL9A 4O32A 4I5QA 4GF0A 1SKWB 2QSIA 1XWBA 1QXHA 2E0QA 2F3MA 2F9SA 4WXTA 3LSZA 5G1KA 4FIWA 1Y6EA 1OC9B 3LWAA 2AB6A 3KH9A 1VGLA 1GSDA 2ALBA 5JWRB 3DIEA 2PU9C 3EC3A 3HA9A 1TOFA 3KH7A 2VLUA 1ML6A 5CRWA 1TI3A 1W89A 1LBKA 5KOXA 4PURA 4KSMA 4L8EA 2QKEA 1KBNA 2H19A 3FYGA 3LQ7A 1G7OA 1TTZA 4TR0A 4RQXA 3FK8A 2O89A 4Q5NA 2FHEA 4EDZA 3GTUB 4JR4A 2XBIA 2K18A 3IHQA 3G7JA 1T8EB 3HVXA 3D5JA 3KCMA 2VD1A 4MF5A 5KN1A 2H0HA 4KNDA 2GLRA 1ZGNA 2BTOT 2VL9A 3C1RA 1WE0A 2H1AA 2GGTA 1K0DA 2CT6A 2DC5A 3TDGA 3US3A 22GSA 5COHA 4EVMA 1Z7PA 3TCOA 3BCKA 3GKXA 4RI7A 4I2TA 3G7YA 4G10A 1EOGA 2PGTA 3JCML 5FHIA 1XVWA 3UBLA 2H30A 4F0BA 5ABRA 2RUFA 4DEJA 5INYA 4N10A 1ON4A 2C0EA 3IAM2 3KZQA 4AJ7A 1FO5A 4HZ2A 3QD9A 3M1GA 1O7UA 2DJ2A 3MDKA 1EV9A 6GSXA 1XBSA 5EPFA 5CRHA 3KXOA 1JLWA 2GSSA 2V1MA 4KA0A 1TP9A 4JR6A 4MLYA 4MZCA 4USSA 4ECCA 1YQ1A 1A23A 1BX9A 2LJKA 2FD3A 2LJAA 4PXOA 2K9FA 1WMJA 1OC3A 1KTEA 5D93A 1GP1A 4HU9A 3MYDA 1GTIA 2GZYA 1WRYA 4HUAA 4KDYA 5A4VA 4BA7A 1UC7A 1T00A 2AHEA 1M9AA 2HZEB 1M9BA 2CQ9A 4DSSA 4ACSA 1TKDB 4CY8A 2X64A 2LQOA 1U87A 1XVQA 4BVXA 5B6NA 5DAKA 2GZPA 1Z3EA 1AC1A 3UVTA 3KTBA 1K0BA 6GSWA 4ZBBA 4LMVA 1TK8B 5IMCA 4BWQA 3QFBC 2B7JA 1LJRA 2YNXA 4HI7A 4AGSA 1GSFA 1ERTA 4CDOA 2AAWA 1PA3A 5LNKe 4IS0A 3IDVA 5J4UA 1AIUA 3GA4A 2P5QA 5ECMB 1SK2A 2HRKA 1PN0A 2H6XA 1RW1A 4YQVA 4MF6A 4F82A 1TRSA 4BIKA 4TW5A 5CRDA 4EIQA 1YJ6A 1OE8A 1EP8A 1BJXA 2ZCTA 5J9BA 1AXDA 1MDJA 3C71A 19GSA 1SJIA 3ZIJA 2OJLA 2V6KA 3PH9A 1OC9A 2HXKA 5D96A 3LYKA 3HKRA 4AJ6A 2IMKA 4MA9A 3F63A 4MF7A 4G2EA 3VFIA 4FO5A 3APSA 1JFUA 5F8BA 4ULXA 7GSSA 3TJFA 4N0VA 3FRCA 4WF5A 3TOUA 5ECNB 5F06A 4IN0A 4O5UA 2HT9A 2Z9SA 2AV4A 5HR3A 1O81A 3FKFA 4HZ4A 2F8FA 3GTUA 4F03A
chains in the Genus database with same CATH topology
1T4ZA 3WT1A 1M7TA 5KOWA 4PUAA 5DCHA 2HSHA 1EEMA 4ML6A 3EINA 3D22A 4RI6A 4GSSA 3KIJA 4NHZA 5B8AA 4OCFA 2LJRA 2G2QA 3WGXA 2NVLA 2HRNA 4N11A 1EWXA 4BWSA 4WR5A 3HHVA 3QFAC 3EWLA 1A24A 1JZDA 3PINA 2K6VA 4EXJA 3GH9A 3ERFA 1XPVA 4TOPA 4CY6A 1FB0A 3F0IA 3FMWA 2DJ1A 2JADA 3A3TA 3GX8A 4F0CA 2O85A 2R3XA 2L4QA 1E2YA 4KH7A 3HD5A 1GNEA 5ECKB 3MAKA 4I97A 2H1GA 1MDKA 2A2PA 1PD21 5G31A 2X4AA 3IAS2 3GHAA 4CW9A 2YOIA 2LEGA 2YV7A 5EVOA 2I81A 1GULA 2AJQB 1ERUA 2D2ZA 4PGTA 2H1DA 3GN3A 3HZ8A 2X49A 5ECLB 2HZEA 1GLPA 1WPIA 2TRXA 4WKWA 4NV2A 4IQ1A 1YY7A 4KUNA 3IA1A 1USBA 2OA7A 4FH8A 4EIPA 5EL8A 3S9FA 1SL2B 2H6YA 4X43A 2XHFA 3W6GA 4XS6A 4E8EA 1X5DA 1FW1A 1X9WB 3HVVA 3I69A 3AY8A 4O92A 1A0FA 2BMXA 2O7KA 3F4SA 1TW9A 2LV3A 4TR4A 1GSYA 4L5LA 3RDWA 3RHCA 1GLQA 5DVBA 1I5GA 2R5GA 3VWUA 2R4VA 1ZOFA 1ILOA 2K8VA 3VPQA 4DVCA 2KUCA 2H1BA 3QR6A 2DSAA 3TUEA 3C1SA 1GRXA 2OBIA 2YJ7A 2RLIA 1GUHA 1A8YA 1TRWA 2XBQA 3P2AA 2LUSA 1JZOA 3ZTLA 1DE2A 4L0WA 4KB3A 5J41A 3GV1A 3GL5A 3ZZXA 4K2XA 3UBKA 4NWYA 3ZRDA 3TKRA 1MD4A 1K3YA 3DMLA 1XW5A 2OE3A 1A2MA 1HQOA 1G0TA 2X8HA 4ZBAA 1YKAA 1OKTA 2PERA 5GZZB 1G6WA 2L57A 4MH2A 4LL4B 4X0XA 3VWVA 4XS1A 2V2GA 1XW9A 2HI7A 4JEDA 5FWGA 3MWHA 3CTFA 2QC7A 4OD7A 2I9HA 1F37A 1M2BA 1R26A 2H8LA 4IHUA 3ZLPA 3IV4A 2R2JA 1XFLA 3VURA 1PRXA 5CNWA 5E4WA 2LS5A 5G5FA 2DMLA 3F4RA 4J56E 3EMPA 3MNGA 1XWKA 3KMOA 2VAFA 3N9JA 4POLA 2B5YA 3M0FA 4GQFA 1QQ2A 1XWGA 2XPDA 5J3RA 1J9BA 1V9WA 1BG5A 1GSSA 2O8VB 4ZBDA 1ZMAA 3UAPA 2LSTA 2P31A 3FZ9A 3O76A 1WOUA 4EKZA 2B6MA 1Q98A 1RQMA 3APOA 1SKSB 4K6XA 1TK5B 1T7PB 4G9HA 2JSYA 4YQUA 5CREA 2L6CA 4MJCA 5DQYA 4EC0A 2WJUA 3UJ1A 1BEDA 1THOA 4IQAA 1OVNA 1VF4A 3GIXA 1PSQA 4LMWA 3G7IA 5AIXA 1K0NA 3VWWA 2HRFA 3TJGA 4I6XA 4K0NA 3GH6A 4J57E 4MJAA 1SL1B 1XW6A 2KOKA 4POBA 1PL1A 3FR9A 2JSZA 3IC8A 2EIRA 1KEBA 3M9KA 3F4TA 4F2IA 3CMIA 3KD0A 3TJBA 18GSA 5F07A 2QA1A 3W8SA 4PNGA 2LNSA 1OE7A 1T4YA 2MYGA 2H01A 4ISDA 2B1KA 1Z6MA 2CZ2A 3UOMA 3HJPA 5ECSA 3ZITA 4YAVA 4QL7A 2VCZA 2DIYA 2JZTA 6GSSA 2REMA 3QAGA 2DJJA 3KM6A 3L9VA 1NSWA 1WWJA 2YPMA 2J23A 1OC8A 3WT2A 1ERVA 3LEFA 4JU5A 4ZXGA 3CRUA 3NOFA 3ZFBA 4DSQA 4H86A 3FZAA 4K5SA 2E2MA 3TKPA 2FA8A 1BQ7A 12GSA 1TU7A 4IGJA 1GTBA 3QPMA 5ID2A 1K0OA 4WEYA 4TR1B 3GMFA 5B6MA 5H5SA 4K7NA 4QL9A 4KX4A 1ZYQB 3IBHA 3CSJA 4POKA 3ZMKA 1PMTA 3FW2A 3HDCA 1GSUA 2H6ZA 3OR5A 3QAWA 4L0UA 1F3BA 2MMAA 3QMXA 1KNGA 4EE0A 2IN3A 1B4PA 1F3AA 4QQ7A 3UL3A 2IMEA 3TJKA 4X1UA 1X0RA 3LFLA 4KDUA 2GT6A 1RK4A 4ML1A 3FY7A 1WJKA 2GQMA 2HSYA 1SL0B 4KF9A 1V58A 1GUKA 4K5RA 4OFMA 1J08A 4L5OA 3E0UA 2CAIA 3O3TA 4IJIA 5IPGA 2VLTA 1CQHA 3WD6A 2N5BA 1WIKA 2FWEA 2GZZA 1JLVA 2WFCA 4OWYA 4KE3A 3U6VA 3FZ5A 3MSZA 3A5IA 3IXRA 1ZYNA 5LCZA 4I2UA 4Q5FA 5G30A 2R0PA 3HJOA 4K9ZA 5HFKA 1V98A 3V1WA 5DALB 3GKNA 2V41A 2YANA 4NMUA 4ZB9A 3QOUA 2QA2A 2VO4A 2A4HA 1IYHA 4ECIA 2GS3A 1QK8A 2H70A 5JWQB 4ECJA 1IYIA 1K3OA 2V32A 2A2RA 3Q6OA 2FLSA 1XOAA 3EMXA 4LA1A 3L78A 2F8AA 4XIHA 3KGKA 4V2LA 2YWOA 4WBRD 1NW2A 2VLVA 5CP1A 1FVKA 3EURA 1FHEA 1M2DA 2XPEA 3WYWA 3UARA 1PKZA 1K3LA 2H76A 5HR2A 2HFDA 4ZB6A 5ECOB 5JCGA 4O5QA 2X8CA 2RIIA 5IMVA 1K0MA 2JL4A 2MBSA 4G0KA 1SYXA 4GTUA 5DBQA 5KN2A 5IO0A 1LU4A 2H74A 3GYKA 3GX0A 1S3DA 3CBUA 3E9JB 5CYYA 3VLNA 2DJKA 5DQSA 4ZIJA 1GL8A 2WCIA 5BMUA 3TRXA 1AQVA 4FYBA 1X9SB 1G7EA 2YWNA 1O8XA 4HS1A 2NDOA 5JWOB 3ZYWA 4TRXA 2C8UA 1PX7A 3LYPA 2CX4A 3HCZA 2GQLA 4MJBA 3HYPA 2VCXA 4KDXA 4Z7XA 1ZL9A 2LRNA 3UVHA 4FYCA 4IBPA 3WGDA 4N30A 1U3IA 2N5AA 3ZVJA 4TR1A 1DE1A 4OMVA 4KSOA 2JU5A 1MDIA 4TXOB 3APQA 1SK1A 5IOWA 4ZL7A 4MCUA 3RHBA 3D21A 1THXA 5D9TA 5D73A 1MTCA 2EIOA 3P90A 3BD2A 4Z2TA 1NM3A 1R7HA 1JHBA 3BCIA 4MNNA 3J7Yk 3F3RA 2H73A 3A2WA 1XZOA 4E8HA 1SENA 5A4WA 2M72A 4BL7B 4KGIA 2GT5A 2GTUA 5AN1A 1U88A 3CYNA 3IRAA 4GLTA 3D6IA 1BAYA 2HE3A 3FZ4A 5A5KA 4GXZA 8GSSA 2OADA 4JBBA 2VM2A 1PN9A 3H1NA 3O6TA 2VM1A 1CQGA 2BJXA 4G19A 2I1UA 3N5OA 1SYRA 4V1Ag 3CRTA 2RM5A 2FWFA 3DYRA 6GSVA 3IK9A 4ICYA 3FHKA 2LRCA 2IIYA 3M9JA 1TK0B 4I8BA 1U6TA 4A5PA 5F0GA 1GWCA 4MMMA 4V1Ap 1DSBA 3NZNA 5CAXA 2PBJA 5ECQB 2CA8A 3KP8A 2E2GA 2GSRA 2J9HA 1V2AA 3SWLA 3GUSA 5DALA 1O85A 3I43A 1PL2A 1AW9A 3L9UA 3IPZA 4HOJA 1XOBA 4XRDA 1FB6A 2DJ3A 3L4NA 1EOHA 3LW9A 3EYTA 1SD8A 5ELAA 1ZYEA 3TKQA 2R0CA 2H75A 2CVBA 2LKUA 3GKKA 2V6OA 3R3EA 5DCGA 1X5CA 4Z2RA 1XCCA 3EVIA 2H0GA 3FR3A 4WBJA 4OFTA 1YEPA 4NPBA 1B9YC 4MJEA 4WF4A 5AISA 4IW9A 2DKIA 1OAZA 1EEJA 2LRTA 3QAVA 4MABA 1UA5A 5ECIB 1FG4A 5IIZA 5DJMA 2AUVA 2VL2C 1XXUA 5DDLA 5IQYA 3KP9A 2H71A 3F9UA 2L6DA 1MEKA 4FYUA 1TI1A 2HNLA 2L5OA 3LXZA 2DBCA 1AUCA 4Q5QA 5IOXA 3HJMA 5G5EA 14GSA 5CRGA 3ME8A 1PGTA 2WULA 5B7CA 2I4AA 4K8MA 5ELGA 3FR6A 2GDRA 1SJZA 2JZRA 3D0ZA 3D4TA 4OO4A 2PWJA 10GSA 3C8EA 5G2ZA 4OFNA 4XRAA 3GSSA 1R5AA 5DAKB 3NIVA 3IHGA 1JZRA 1M2AA 4TKYA 5HFIA 3FEUA 2CAQA 5C04A 4HQZA 2WDUA 4KAEA 5HR1A 4YH2A 5IMFA 1QFNA 1GSQA 20GSA 1MD3A 2ON5A 3LJRA 1XIYA 4MK3A 2X99A 1ERWA 4BPYA 2VCQA 3ISOA 3W8JA 4BL7A 2RUEA 1Z5YE 2C3NA 3VPTA 2FY6A 2NTOA 5H5QA 1V40A 4MP4A 4JZQA 2FNOA 5ENUA 2HZFA 2WB9A 4RQRA 1Q4JA 3RPPA 1B9XC 3BOAA 1GUMA 1YF1A 4O5RA 4F9ZA 2MBTA 4GRFA 2MZCA 4MPFA 4NV5A 5IM9A 2LTKA 5D9XA 4O7HA 2B1LA 1ZCPA 3GRXA 4N0ZA 3LXTA 4XTSA 1O6JA 1Z6NA 11GSA 2L59A 5ECRB 3RPNA 1QGVA 4HJ2A 4TVEA 1H4OA 2VCWA 3TRQA 3CSIA 1UVZA 3DD3A 5EY6A 3TRPA 3HXSA 1EV4A 1T3BA 4AF2A 2TIRA 2YZUA 1A2JA 4YKFA 2IMFA 2WGRA 3SBCA 1Y25A 3ED3A 3PGTA 3UIWA 3A2XA 1F2EA 5H5RA 2B3SA 1SU9A 3GSTA 2C0DA 2F51A 4XCSA 1X9MB 3ME7A 3TOTA 1TDIA 1SJ6A 2N5FA 3RBTA 2HRAA 1YF0A 2FUG2 5FT3A 2IJYA 2M46A 3UMAA 3A5WA 2E7PA 1QUWA 5KEJA 2DLXA 3L9SA 4PX1A 3TB2A 3L0HA 1TRVA 4ZL8A 2L4CA 2MMZA 16GSA 2VL2A 3ZIVA 2FWGA 6GSTA 2P0GA 3DVXA 1DUGA 2YJHA 4D73B 2B7KA 2PPTA 2IMIA 1SKRB 3G9BA 2I3YA 4YQMA 4LL1B 1TJDA 5ECHB 5E59A 2R0GA 1S3AA 4EDYA 3I6AA 3DVWA 2FCHA 3P7XA 3VI7A 3TKSE 3GFKA 1FAAA 2YWIA 2PVOC 3DKSA 1HYUA 1R5PA 2WRTA 2NPBA 3RAZA 1ABAA 2C80A 3TGZA 4K7IA 1ACVA 1DBYA 2H66A 5HFGA 3IC4A 1HNBA 4BVYB 3H79A 3BBYA 2OKAA 2YV9A 4ZILA 4K2DA 2XC2A 3ZMLA 2ZUPA 1YKCA 5AIVA 2DKHA 2K8SA 2PUKC 2GQKA 1V57A 2OE0A 2KP2A 1GTUA 5J9CA 1C72A 3F8UA 1ST9A 5IMZA 4ZB8A 1OKDA 3F3QA 3BJ5A 5C00A 5F05A 4PQIA 5BRTA 3DEXA 1Z9HA 2CV4A 4RUVA 4JRRA 1FOHA 2EC4A 3CXGA 3ZREA 4MDCA 2TRCP 1GNWA 3J7Yb 1B48A 1NHYA 4NXIA 2G0FA 4ILFA 4MZBA 4POMA 2VL3A 4XS4B 1OYJA 2NBSA 3K8NA 2UZ8A 4G0IA 1PX6A 3EU4A 4MZWA 2GVPA 4WR4A 4GCIA 3TJJA 1Z7RA 3HY2A 1FVJA 2R37A 3TKSC 17GSA 5HR0A 1TRUA 1HD2A 3HZ4A 1GTAA 5G1LA 2KLXA 1B8XA 3IR4A 1YZXA 4V2NA 2C3QA 4HU7A 2LNTA 4K0GA 4NAXA 1B4QA 2GSQA 2CX3A 3M8NA 2KHPA 2MMNA 1A2LA 4IELA 5IMDA 2OE1A 2C0GA 2P5RA 4LLRA 1A0RP 1O8WA 5ECPB 5LD0A 4DSRA 2IFQB 3CTGA 1NHOA 4NHWA 2ZNMA 5J5NA 3QCPA 2C4JA 1H75A 2KP1A 2IL3A 1TU8A 3UEMA 3H93A 3PR8A 1K0AA 3VK9A 3EU3A 5KN0A 3LORA 1AQWA 5HQPA 4GWRA 1O73A 4ECBA 2OBKA 3GURA 2DMMA 4OCEA 1M99A 4Q5RA 3DGQA 2CVDA 1JZWA 4GSTA 2X8GA 3LGCA 2YP6A 2A2SA 2LQQA 5JCWA 4TN8A 4KCEA 2EIQA 4D73A 3ZL5A 4IP1A 2PN8A 1X5EA 4JE1A 2DJ0A 2YCDA 2DIZA 4EL1A 4EUYA 3ZFLA 2YZHA 4IKHA 4HJMA 1QMVA 2WZ9A 3IK7A 2VCTA 2VCVA 2H72A 1VF2A 3ERGA 2YN1A 3DXBA 1N8JA 3KEBA 2JZSA 4K7OA 4BVYA 1T1VA 2RM6A 1ZZYA 1SD9A 2CVKA 2HYXA 5GAPD 1AQXA 1K0CA 2CZ3A 4WETA 1WP0A 2MMOA 3DRNA 4IJ3A 4GQCA 2JACA 4J2FA 3KJYA 1VF1A 2VD0A 4EF0A 1VF3A 1GH2A 4HEA2 1SK0A 2ES7A 3ZVJD 4Z2UA 3EE2A 3GNJA 5IMAA 5IO2A 4K1FA 5B8BA 3Q18A 4MH3A 3F6DA 4P3YB 1M0UA 4ID0A 5DJLA 1ZYPA 3HVSA 4KW6A 2ON7A 2HLSA 2WS2A 2IWTA 13GSA 5KN3A 3GL3A 3QDNA 5L71A 3GKMA 4YAPA 1A8LA 1UN2A 3F6FA 1R4WA 3C73A 2R6KA 3IE3A 2OACA 3E3EA 1E6BA 2FGXA 1W4VA 1G6YA 2IPAA 3EPTA 2L5LA 5A4UA 4XS4A 2A4VA 2B5XA 3H4KA 3LG6A 2VUPA 4IP6A 1EGRA 1EP7A 3I9V2 3TKSA 1PQNA 2H0IA 4PUFC 4AJ8A 3P8WA 4HDEA 3D4MA 4PQ1A 9GSSA 1HNCA 2O87A 5ID2B 1URMA 2YWMA 5D9VA 2AYTA 4PNFA 3ERWA 2FWHA 1F6MC 2FA4A 1GSEA 2C3TA 3CSHA 1YEXA 1S3CA 3IOSA 5D8IA 3A2VA 4EO3A 1F9MA 4G0LA 2M80A 2HSMA 1XWCA 3WGEA 1AAZA 6GSUA 3KMNA 4V2MA 2IMDA 3U5RE 3VWXA 2IFQA 1YDKA 1N2AA 3H8QA 4FQUA 5JCUA 3Q19A 2GSTA 2VIMA 3DWVA 5GSSA 2PVQA 3M3MA 1VRSD 5GSTA 4PQHA 4TR3A 2PMTA 5AGYA 1TXXA 4DSSB 2VOCA 1BYEA 4GSNA 4X4JA 1EZKA 4MPGA 5CO3A 2C0FA 5GAND 1PKWA 5IPHA 6GSYA 3VI5A 3C7MA 4PTSA 4BVXB 1FOVA 4TXOA 4YKGA 1XWAA 2B5EA 4XHMA 3MIXA 3Q74A 4TXVA 1I9DA 4HQSA 2QGVA 4OO5A 5D9WA 4CHSA 3R2QA 3PPUA 4KCAA 1J0FA 4IVFA 3KTLA 1HNAA 2C1YA 1EGOA 1U3AA 4ZL9A 4O32A 4I5QA 4GF0A 1SKWB 2QSIA 1XWBA 1QXHA 2E0QA 2F3MA 2F9SA 4WXTA 3LSZA 5G1KA 4FIWA 1Y6EA 1OC9B 3LWAA 2AB6A 3KH9A 1VGLA 1GSDA 2ALBA 5JWRB 3DIEA 2PU9C 3EC3A 3HA9A 1TOFA 3KH7A 2VLUA 1ML6A 5CRWA 1TI3A 1W89A 1LBKA 5KOXA 4PURA 4KSMA 4L8EA 2QKEA 1KBNA 2H19A 3FYGA 3LQ7A 1G7OA 1TTZA 4TR0A 4RQXA 3FK8A 2O89A 4Q5NA 2FHEA 4EDZA 3GTUB 4JR4A 2XBIA 2K18A 3IHQA 3G7JA 1T8EB 3HVXA 3D5JA 3KCMA 2VD1A 4MF5A 5KN1A 2H0HA 4KNDA 2GLRA 1ZGNA 2BTOT 2VL9A 3C1RA 1WE0A 2H1AA 2GGTA 1K0DA 2CT6A 2DC5A 3TDGA 3US3A 22GSA 5COHA 4EVMA 1Z7PA 3TCOA 3BCKA 3GKXA 4RI7A 4I2TA 3G7YA 4G10A 1EOGA 2PGTA 3JCML 5FHIA 1XVWA 3UBLA 2H30A 4F0BA 5ABRA 2RUFA 4DEJA 5INYA 4N10A 1ON4A 2C0EA 3IAM2 3KZQA 4AJ7A 1FO5A 4HZ2A 3QD9A 3M1GA 1O7UA 2DJ2A 3MDKA 1EV9A 6GSXA 1XBSA 5EPFA 5CRHA 3KXOA 1JLWA 2GSSA 2V1MA 4KA0A 1TP9A 4JR6A 4MLYA 4MZCA 4USSA 4ECCA 1YQ1A 1A23A 1BX9A 2LJKA 2FD3A 2LJAA 4PXOA 2K9FA 1WMJA 1OC3A 1KTEA 5D93A 1GP1A 4HU9A 3MYDA 1GTIA 2GZYA 1WRYA 4HUAA 4KDYA 5A4VA 4BA7A 1UC7A 1T00A 2AHEA 1M9AA 2HZEB 1M9BA 2CQ9A 4DSSA 4ACSA 1TKDB 4CY8A 2X64A 2LQOA 1U87A 1XVQA 4BVXA 5B6NA 5DAKA 2GZPA 1Z3EA 1AC1A 3UVTA 3KTBA 1K0BA 6GSWA 4ZBBA 4LMVA 1TK8B 5IMCA 4BWQA 3QFBC 2B7JA 1LJRA 2YNXA 4HI7A 4AGSA 1GSFA 1ERTA 4CDOA 2AAWA 1PA3A 5LNKe 4IS0A 3IDVA 5J4UA 1AIUA 3GA4A 2P5QA 5ECMB 1SK2A 2HRKA 1PN0A 2H6XA 1RW1A 4YQVA 4MF6A 4F82A 1TRSA 4TW5A 5CRDA 4EIQA 1YJ6A 1OE8A 1EP8A 1BJXA 2ZCTA 5J9BA 1AXDA 1MDJA 3C71A 19GSA 1SJIA 3ZIJA 2OJLA 2V6KA 3PH9A 1OC9A 2HXKA 5D96A 3LYKA 3HKRA 4AJ6A 2IMKA 4MA9A 3F63A 4MF7A 4G2EA 3VFIA 4FO5A 3APSA 1JFUA 5F8BA 4ULXA 7GSSA 3TJFA 4N0VA 3FRCA 4WF5A 3TOUA 5ECNB 5F06A 4IN0A 4O5UA 2HT9A 2Z9SA 2AV4A 5HR3A 1O81A 3FKFA 4HZ4A 2F8FA 3GTUA 4F03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T4Z A;  3WT1 A;  1M7T A;  4PUA A;  5DCH A;  2HSH A;  1EEM A;  4ML6 A;  3EIN A;  3D22 A;  4RI6 A;  4GSS A;  3KIJ A;  4NHZ A;  5B8A A;  4OCF A;  2LJR A;  2G2Q A;  3WGX A;  2NVL A;  2HRN A;  4N11 A;  1EWX A;  4BWS A;  4WR5 A;  3HHV A;  3QFA C;  3EWL A;  1A24 A;  1JZD A;  3PIN A;  2K6V A;  4EXJ A;  3GH9 A;  3ERF A;  1XPV A;  4TOP A;  1FB0 A;  3F0I A;  2DJ1 A;  2JAD A;  3A3T A;  3GX8 A;  4F0C A;  2O85 A;  2R3X A;  2L4Q A;  1E2Y A;  4KH7 A;  3HD5 A;  1GNE A;  5ECK B;  3MAK A;  4I97 A;  2H1G A;  1MDK A;  1PD2 1;  5G31 A;  3IAS 2;  3GHA A;  4CW9 A;  2YOI A;  2LEG A;  2YV7 A;  5EVO A;  2I81 A;  1GUL A;  2AJQ B;  1ERU A;  2D2Z A;  4PGT A;  2H1D A;  3GN3 A;  3HZ8 A;  5ECL B;  2HZE A;  1GLP A;  1WPI A;  2TRX A;  4WKW A;  4NV2 A;  4IQ1 A;  1YY7 A;  4KUN A;  3IA1 A;  1USB A;  2OA7 A;  4FH8 A;  5EL8 A;  3S9F A;  1SL2 B;  2H6Y A;  4X43 A;  2XHF A;  3W6G A;  4XS6 A;  4E8E A;  1X5D A;  1FW1 A;  1X9W B;  3HVV A;  3I69 A;  3AY8 A;  4O92 A;  1A0F A;  2BMX A;  2O7K A;  3F4S A;  1TW9 A;  2LV3 A;  4TR4 A;  1GSY A;  4L5L A;  3RDW A;  3RHC A;  1GLQ A;  5DVB A;  1I5G A;  2R5G A;  3VWU A;  2R4V A;  1ZOF A;  1ILO A;  2K8V A;  3VPQ A;  4DVC A;  2KUC A;  2H1B A;  3QR6 A;  2DSA A;  3TUE A;  3C1S A;  1GRX A;  2OBI A;  2YJ7 A;  2RLI A;  1GUH A;  1A8Y A;  1TRW A;  2XBQ A;  3P2A A;  2LUS A;  1JZO A;  3ZTL A;  1DE2 A;  4L0W A;  4KB3 A;  5J41 A;  3GV1 A;  3GL5 A;  3ZZX A;  3UBK A;  4NWY A;  3ZRD A;  3TKR A;  1MD4 A;  1K3Y A;  3DML A;  1XW5 A;  2OE3 A;  1A2M A;  1HQO A;  1G0T A;  2X8H A;  4ZBA A;  1YKA A;  1OKT A;  2PER A;  5GZZ B;  1G6W A;  2L57 A;  4MH2 A;  4LL4 B;  4X0X A;  3VWV A;  4XS1 A;  2V2G A;  1XW9 A;  2HI7 A;  4JED A;  5FWG A;  3MWH A;  3CTF A;  2QC7 A;  4OD7 A;  2I9H A;  1F37 A;  1M2B A;  1R26 A;  2H8L A;  4IHU A;  3ZLP A;  3IV4 A;  2R2J A;  1XFL A;  3VUR A;  1PRX A;  5CNW A;  5E4W A;  2LS5 A;  5G5F A;  2DML A;  3F4R A;  4J56 E;  3EMP A;  3MNG A;  1XWK A;  3KMO A;  2VAF A;  3N9J A;  4POL A;  2B5Y A;  3M0F A;  4GQF A;  1QQ2 A;  1XWG A;  2XPD A;  5J3R A;  1J9B A;  1V9W A;  1BG5 A;  1GSS A;  2O8V B;  4ZBD A;  1ZMA A;  3UAP A;  2LST A;  2P31 A;  3FZ9 A;  3O76 A;  1WOU A;  4EKZ A;  2B6M A;  1Q98 A;  1RQM A;  3APO A;  1SKS B;  4K6X A;  1TK5 B;  1T7P B;  4G9H A;  2JSY A;  4YQU A;  5CRE A;  2L6C A;  4MJC A;  5DQY A;  4EC0 A;  2WJU A;  3UJ1 A;  1BED A;  1THO A;  4IQA A;  1OVN A;  1VF4 A;  3GIX A;  1PSQ A;  4LMW A;  3G7I A;  5AIX A;  1K0N A;  3VWW A;  2HRF A;  3TJG A;  4I6X A;  4K0N A;  3GH6 A;  4J57 E;  4MJA A;  1SL1 B;  1XW6 A;  2KOK A;  4POB A;  1PL1 A;  3FR9 A;  2JSZ A;  2EIR A;  1KEB A;  3M9K A;  3F4T A;  4F2I A;  3CMI A;  3KD0 A;  3TJB A;  18GS A;  5F07 A;  3W8S A;  4PNG A;  2LNS A;  1OE7 A;  1T4Y A;  2MYG A;  2H01 A;  4ISD A;  2B1K A;  1Z6M A;  2CZ2 A;  3UOM A;  3HJP A;  5ECS A;  3ZIT A;  4YAV A;  4QL7 A;  2VCZ A;  2DIY A;  2JZT A;  6GSS A;  2REM A;  3QAG A;  2DJJ A;  3KM6 A;  3L9V A;  1NSW A;  1WWJ A;  2YPM A;  2J23 A;  1OC8 A;  3WT2 A;  1ERV A;  3LEF A;  4JU5 A;  4ZXG A;  3CRU A;  3NOF A;  3ZFB A;  4DSQ A;  4H86 A;  3FZA A;  2E2M A;  3TKP A;  2FA8 A;  1BQ7 A;  12GS A;  1TU7 A;  4IGJ A;  1GTB A;  3QPM A;  5ID2 A;  1K0O A;  4WEY A;  4TR1 B;  3GMF A;  5B6M A;  5H5S A;  4K7N A;  4QL9 A;  4KX4 A;  1ZYQ B;  3IBH A;  3CSJ A;  4POK A;  3ZMK A;  1PMT A;  3FW2 A;  3HDC A;  1GSU A;  2H6Z A;  3OR5 A;  3QAW A;  4L0U A;  1F3B A;  2MMA A;  3QMX A;  1KNG A;  4EE0 A;  2IN3 A;  1B4P A;  1F3A A;  4QQ7 A;  3UL3 A;  2IME A;  3TJK A;  4X1U A;  1X0R A;  3LFL A;  4KDU A;  2GT6 A;  1RK4 A;  4ML1 A;  3FY7 A;  1WJK A;  2GQM A;  2HSY A;  1SL0 B;  1V58 A;  1GUK A;  4OFM A;  1J08 A;  4L5O A;  3E0U A;  2CAI A;  3O3T A;  4IJI A;  5IPG A;  2VLT A;  1CQH A;  3WD6 A;  2N5B A;  1WIK A;  2FWE A;  2GZZ A;  1JLV A;  2WFC A;  4OWY A;  4KE3 A;  3U6V A;  3FZ5 A;  3MSZ A;  3IXR A;  5LCZ A;  4I2U A;  4Q5F A;  5G30 A;  3HJO A;  4K9Z A;  5HFK A;  1V98 A;  3V1W A;  5DAL B;  3GKN A;  2V41 A;  2YAN A;  4NMU A;  4ZB9 A;  3QOU A;  2VO4 A;  1IYH A;  4ECI A;  2GS3 A;  1QK8 A;  2H70 A;  5JWQ B;  4ECJ A;  1IYI A;  1K3O A;  2V32 A;  2A2R A;  3Q6O A;  2FLS A;  1XOA A;  3EMX A;  4LA1 A;  3L78 A;  2F8A A;  4XIH A;  3KGK A;  4V2L A;  2YWO A;  4WBR D;  1NW2 A;  2VLV A;  5CP1 A;  1FVK A;  3EUR A;  1FHE A;  1M2D A;  2XPE A;  3WYW A;  3UAR A;  1PKZ A;  1K3L A;  2H76 A;  5HR2 A;  2HFD A;  4ZB6 A;  5ECO B;  5JCG A;  2X8C A;  2RII A;  5IMV A;  1K0M A;  2JL4 A;  2MBS A;  1SYX A;  4GTU A;  5DBQ A;  5KN2 A;  5IO0 A;  1LU4 A;  2H74 A;  3GYK A;  3GX0 A;  1S3D A;  3CBU A;  3E9J B;  5CYY A;  3VLN A;  2DJK A;  5DQS A;  4ZIJ A;  1GL8 A;  2WCI A;  3TRX A;  1AQV A;  4FYB A;  1X9S B;  1G7E A;  2YWN A;  1O8X A;  4HS1 A;  2NDO A;  5JWO B;  3ZYW A;  4TRX A;  2C8U A;  1PX7 A;  3LYP A;  2CX4 A;  3HCZ A;  2GQL A;  4MJB A;  3HYP A;  2VCX A;  4KDX A;  4Z7X A;  1ZL9 A;  2LRN A;  3UVH A;  4FYC A;  4IBP A;  3WGD A;  4N30 A;  1U3I A;  2N5A A;  3ZVJ A;  4TR1 A;  1DE1 A;  4OMV A;  4KSO A;  2JU5 A;  1MDI A;  4TXO B;  3APQ A;  1SK1 A;  5IOW A;  4ZL7 A;  4MCU A;  3RHB A;  3D21 A;  1THX A;  5D9T A;  5D73 A;  1MTC A;  2EIO A;  3P90 A;  3BD2 A;  1NM3 A;  1R7H A;  1JHB A;  3BCI A;  3J7Y k;  3F3R A;  2H73 A;  3A2W A;  1XZO A;  4E8H A;  1SEN A;  5A4W A;  2M72 A;  4KGI A;  2GT5 A;  2GTU A;  5AN1 A;  1U88 A;  3CYN A;  3IRA A;  4GLT A;  3D6I A;  1BAY A;  2HE3 A;  3FZ4 A;  5A5K A;  4GXZ A;  8GSS A;  2OAD A;  4JBB A;  2VM2 A;  1PN9 A;  3H1N A;  3O6T A;  2VM1 A;  1CQG A;  2BJX A;  4G19 A;  2I1U A;  3N5O A;  1SYR A;  4V1A g;  3CRT A;  2RM5 A;  2FWF A;  3DYR A;  6GSV A;  3IK9 A;  3FHK A;  2LRC A;  2IIY A;  3M9J A;  1TK0 B;  4I8B A;  1U6T A;  5F0G A;  1GWC A;  4MMM A;  4V1A p;  1DSB A;  3NZN A;  5CAX A;  2PBJ A;  5ECQ B;  2CA8 A;  3KP8 A;  2E2G A;  2GSR A;  2J9H A;  1V2A A;  3SWL A;  3GUS A;  5DAL A;  1O85 A;  3I43 A;  1PL2 A;  1AW9 A;  3L9U A;  3IPZ A;  4HOJ A;  1XOB A;  4XRD A;  1FB6 A;  2DJ3 A;  3L4N A;  1EOH A;  3EYT A;  1SD8 A;  5ELA A;  1ZYE A;  3TKQ A;  2H75 A;  2CVB A;  2LKU A;  3GKK A;  2V6O A;  5DCG A;  1X5C A;  1XCC A;  3EVI A;  2H0G A;  3FR3 A;  4WBJ A;  4OFT A;  1YEP A;  4NPB A;  1B9Y C;  4MJE A;  4WF4 A;  5AIS A;  4IW9 A;  1OAZ A;  1EEJ A;  2LRT A;  3QAV A;  4MAB A;  1UA5 A;  5ECI B;  1FG4 A;  5IIZ A;  5DJM A;  2AUV A;  2VL2 C;  1XXU A;  5DDL A;  5IQY A;  3KP9 A;  2H71 A;  3F9U A;  2L6D A;  1MEK A;  4FYU A;  1TI1 A;  2HNL A;  2L5O A;  3LXZ A;  2DBC A;  1AUC A;  4Q5Q A;  5IOX A;  3HJM A;  5G5E A;  14GS A;  5CRG A;  3ME8 A;  1PGT A;  2WUL A;  5B7C A;  2I4A A;  4K8M A;  5ELG A;  3FR6 A;  2GDR A;  1SJZ A;  2JZR A;  3D0Z A;  3D4T A;  4OO4 A;  2PWJ A;  10GS A;  3C8E A;  5G2Z A;  4OFN A;  4XRA A;  3GSS A;  1R5A A;  5DAK B;  3NIV A;  1JZR A;  1M2A A;  4TKY A;  5HFI A;  3FEU A;  2CAQ A;  5C04 A;  4HQZ A;  2WDU A;  4KAE A;  5HR1 A;  4YH2 A;  5IMF A;  1QFN A;  1GSQ A;  20GS A;  1MD3 A;  2ON5 A;  3LJR A;  1XIY A;  4MK3 A;  2X99 A;  1ERW A;  4BPY A;  2VCQ A;  3ISO A;  3W8J A;  4BL7 A;  2RUE A;  1Z5Y E;  2C3N A;  3VPT A;  2FY6 A;  2NTO A;  5H5Q A;  1V40 A;  4MP4 A;  4JZQ A;  2FNO A;  5ENU A;  2HZF A;  2WB9 A;  4RQR A;  1Q4J A;  3RPP A;  1B9X C;  3BOA A;  1GUM A;  1YF1 A;  4O5R A;  4F9Z A;  2MBT A;  4GRF A;  2MZC A;  4MPF A;  4NV5 A;  5IM9 A;  2LTK A;  5D9X A;  4O7H A;  2B1L A;  1ZCP A;  3GRX A;  4N0Z A;  3LXT A;  4XTS A;  1O6J A;  1Z6N A;  11GS A;  2L59 A;  5ECR B;  3RPN A;  1QGV A;  4HJ2 A;  4TVE A;  1H4O A;  2VCW A;  3TRQ A;  3CSI A;  1UVZ A;  3DD3 A;  5EY6 A;  3TRP A;  3HXS A;  1EV4 A;  1T3B A;  4AF2 A;  2TIR A;  2YZU A;  1A2J A;  2IMF A;  2WGR A;  3SBC A;  1Y25 A;  3ED3 A;  3PGT A;  3UIW A;  3A2X A;  1F2E A;  5H5R A;  2B3S A;  1SU9 A;  3GST A;  2C0D A;  2F51 A;  4XCS A;  1X9M B;  3ME7 A;  3TOT A;  1TDI A;  1SJ6 A;  2N5F A;  3RBT A;  1YF0 A;  2FUG 2;  5FT3 A;  2IJY A;  2M46 A;  3UMA A;  3A5W A;  2E7P A;  1QUW A;  5KEJ A;  2DLX A;  3L9S A;  4PX1 A;  3TB2 A;  3L0H A;  1TRV A;  4ZL8 A;  2L4C A;  2MMZ A;  16GS A;  2VL2 A;  3ZIV A;  2FWG A;  6GST A;  2P0G A;  3DVX A;  1DUG A;  2YJH A;  4D73 B;  2B7K A;  2PPT A;  2IMI A;  1SKR B;  3G9B A;  2I3Y A;  4YQM A;  4LL1 B;  1TJD A;  5ECH B;  5E59 A;  1S3A A;  4EDY A;  3I6A A;  3DVW A;  2FCH A;  3P7X A;  3VI7 A;  3TKS E;  3GFK A;  1FAA A;  2YWI A;  2PVO C;  3DKS A;  1HYU A;  1R5P A;  2WRT A;  2NPB A;  3RAZ A;  1ABA A;  2C80 A;  3TGZ A;  4K7I A;  1ACV A;  1DBY A;  2H66 A;  5HFG A;  3IC4 A;  1HNB A;  3H79 A;  3BBY A;  2OKA A;  2YV9 A;  4ZIL A;  4K2D A;  2XC2 A;  3ZML A;  2ZUP A;  1YKC A;  5AIV A;  2K8S A;  2PUK C;  2GQK A;  1V57 A;  2OE0 A;  2KP2 A;  1GTU A;  5J9C A;  1C72 A;  3F8U A;  1ST9 A;  5IMZ A;  4ZB8 A;  1OKD A;  3F3Q A;  3BJ5 A;  5C00 A;  5F05 A;  4PQI A;  3DEX A;  1Z9H A;  2CV4 A;  4RUV A;  4JRR A;  2EC4 A;  3CXG A;  3ZRE A;  4MDC A;  2TRC P;  1GNW A;  3J7Y b;  1B48 A;  1NHY A;  4NXI A;  2G0F A;  4ILF A;  4MZB A;  4POM A;  2VL3 A;  4XS4 B;  1OYJ A;  2NBS A;  3K8N A;  1PX6 A;  3EU4 A;  4MZW A;  2GVP A;  4WR4 A;  4GCI A;  3TJJ A;  1Z7R A;  3HY2 A;  1FVJ A;  2R37 A;  3TKS C;  17GS A;  5HR0 A;  1TRU A;  1HD2 A;  3HZ4 A;  1GTA A;  5G1L A;  2KLX A;  1B8X A;  3IR4 A;  1YZX A;  4V2N A;  2C3Q A;  4HU7 A;  2LNT A;  4K0G A;  4NAX A;  1B4Q A;  2GSQ A;  2CX3 A;  3M8N A;  2KHP A;  2MMN A;  1A2L A;  4IEL A;  5IMD A;  2OE1 A;  2C0G A;  2P5R A;  4LLR A;  1A0R P;  1O8W A;  5ECP B;  5LD0 A;  4DSR A;  2IFQ B;  3CTG A;  1NHO A;  4NHW A;  2ZNM A;  5J5N A;  3QCP A;  2C4J A;  1H75 A;  2KP1 A;  2IL3 A;  1TU8 A;  3UEM A;  3H93 A;  3PR8 A;  1K0A A;  3VK9 A;  3EU3 A;  5KN0 A;  3LOR A;  1AQW A;  5HQP A;  4GWR A;  1O73 A;  4ECB A;  2OBK A;  3GUR A;  2DMM A;  4OCE A;  1M99 A;  4Q5R A;  3DGQ A;  2CVD A;  1JZW A;  4GST A;  2X8G A;  3LGC A;  2YP6 A;  2A2S A;  2LQQ A;  5JCW A;  4TN8 A;  4KCE A;  2EIQ A;  4D73 A;  3ZL5 A;  4IP1 A;  2PN8 A;  1X5E A;  4JE1 A;  2DJ0 A;  2YCD A;  2DIZ A;  4EL1 A;  4EUY A;  3ZFL A;  2YZH A;  4IKH A;  4HJM A;  1QMV A;  2WZ9 A;  3IK7 A;  2VCT A;  2VCV A;  2H72 A;  1VF2 A;  3ERG A;  2YN1 A;  3DXB A;  1N8J A;  3KEB A;  2JZS A;  4K7O A;  4BVY A;  1T1V A;  2RM6 A;  1ZZY A;  1SD9 A;  2CVK A;  2HYX A;  5GAP D;  1AQX A;  1K0C A;  2CZ3 A;  4WET A;  1WP0 A;  2MMO A;  3DRN A;  4IJ3 A;  4GQC A;  2JAC A;  4J2F A;  3KJY A;  1VF1 A;  2VD0 A;  4EF0 A;  1VF3 A;  1GH2 A;  4HEA 2;  1SK0 A;  2ES7 A;  3ZVJ D;  3EE2 A;  3GNJ A;  5IMA A;  5IO2 A;  4K1F A;  5B8B A;  3Q18 A;  4MH3 A;  3F6D A;  4P3Y B;  1M0U A;  4ID0 A;  5DJL A;  3HVS A;  4KW6 A;  2ON7 A;  2HLS A;  2WS2 A;  2IWT A;  13GS A;  5KN3 A;  3GL3 A;  3QDN A;  5L71 A;  3GKM A;  4YAP A;  1A8L A;  1UN2 A;  3F6F A;  1R4W A;  3C73 A;  2R6K A;  3IE3 A;  2OAC A;  3E3E A;  1E6B A;  2FGX A;  1W4V A;  1G6Y A;  2IPA A;  2L5L A;  5A4U A;  4XS4 A;  2A4V A;  2B5X A;  3H4K A;  3LG6 A;  2VUP A;  4IP6 A;  1EGR A;  1EP7 A;  3I9V 2;  3TKS A;  1PQN A;  2H0I A;  4PUF C;  4AJ8 A;  3P8W A;  4HDE A;  3D4M A;  4PQ1 A;  9GSS A;  1HNC A;  2O87 A;  5ID2 B;  1URM A;  2YWM A;  5D9V A;  2AYT A;  4PNF A;  3ERW A;  2FWH A;  1F6M C;  2FA4 A;  1GSE A;  2C3T A;  3CSH A;  1YEX A;  1S3C A;  3IOS A;  5D8I A;  3A2V A;  4EO3 A;  1F9M A;  2M80 A;  1XWC A;  3WGE A;  1AAZ A;  6GSU A;  3KMN A;  4V2M A;  2IMD A;  3U5R E;  3VWX A;  2IFQ A;  1YDK A;  1N2A A;  3H8Q A;  5JCU A;  3Q19 A;  2GST A;  2VIM A;  3DWV A;  5GSS A;  2PVQ A;  3M3M A;  1VRS D;  5GST A;  4PQH A;  4TR3 A;  2PMT A;  5AGY A;  1TXX A;  4DSS B;  2VOC A;  1BYE A;  4GSN A;  1EZK A;  4MPG A;  5CO3 A;  2C0F A;  5GAN D;  1PKW A;  5IPH A;  6GSY A;  3VI5 A;  3C7M A;  1FOV A;  4TXO A;  1XWA A;  2B5E A;  4XHM A;  3Q74 A;  4TXV A;  1I9D A;  4HQS A;  2QGV A;  4OO5 A;  5D9W A;  4CHS A;  3R2Q A;  4KCA A;  1J0F A;  4IVF A;  3KTL A;  1HNA A;  2C1Y A;  1EGO A;  1U3A A;  4ZL9 A;  4O32 A;  4I5Q A;  4GF0 A;  1SKW B;  2QSI A;  1XWB A;  1QXH A;  2E0Q A;  2F3M A;  2F9S A;  4WXT A;  3LSZ A;  5G1K A;  4FIW A;  1Y6E A;  1OC9 B;  3LWA A;  2AB6 A;  3KH9 A;  1VGL A;  1GSD A;  2ALB A;  5JWR B;  3DIE A;  2PU9 C;  3EC3 A;  3HA9 A;  1TOF A;  3KH7 A;  2VLU A;  1ML6 A;  5CRW A;  1TI3 A;  1W89 A;  1LBK A;  4PUR A;  4KSM A;  4L8E A;  2QKE A;  1KBN A;  2H19 A;  3FYG A;  3LQ7 A;  1G7O A;  1TTZ A;  4TR0 A;  4RQX A;  3FK8 A;  2O89 A;  4Q5N A;  2FHE A;  4EDZ A;  3GTU B;  4JR4 A;  2XBI A;  2K18 A;  3IHQ A;  3G7J A;  1T8E B;  3HVX A;  3D5J A;  3KCM A;  2VD1 A;  4MF5 A;  5KN1 A;  2H0H A;  4KND A;  2GLR A;  1ZGN A;  2BTO T;  2VL9 A;  3C1R A;  1WE0 A;  2H1A A;  2GGT A;  1K0D A;  2CT6 A;  2DC5 A;  3TDG A;  3US3 A;  22GS A;  5COH A;  4EVM A;  1Z7P A;  3TCO A;  3BCK A;  3GKX A;  4RI7 A;  4I2T A;  3G7Y A;  4G10 A;  1EOG A;  2PGT A;  3JCM L;  5FHI A;  1XVW A;  3UBL A;  2H30 A;  4F0B A;  5ABR A;  2RUF A;  4DEJ A;  5INY A;  4N10 A;  1ON4 A;  2C0E A;  3IAM 2;  3KZQ A;  4AJ7 A;  1FO5 A;  4HZ2 A;  3QD9 A;  3M1G A;  1O7U A;  2DJ2 A;  3MDK A;  1EV9 A;  6GSX A;  1XBS A;  5EPF A;  5CRH A;  3KXO A;  1JLW A;  2GSS A;  2V1M A;  4KA0 A;  1TP9 A;  4JR6 A;  4MLY A;  4MZC A;  4ECC A;  1YQ1 A;  1A23 A;  1BX9 A;  2LJK A;  2FD3 A;  2LJA A;  4PXO A;  2K9F A;  1WMJ A;  1OC3 A;  5D93 A;  1KTE A;  1GP1 A;  4HU9 A;  1GTI A;  2GZY A;  1WRY A;  4HUA A;  4KDY A;  5A4V A;  4BA7 A;  1UC7 A;  1T00 A;  2AHE A;  1M9A A;  2HZE B;  1M9B A;  2CQ9 A;  4DSS A;  4ACS A;  1TKD B;  2X64 A;  2LQO A;  1U87 A;  1XVQ A;  4BVX A;  5B6N A;  5DAK A;  2GZP A;  1Z3E A;  1AC1 A;  3UVT A;  3KTB A;  1K0B A;  6GSW A;  4ZBB A;  4LMV A;  1TK8 B;  5IMC A;  4BWQ A;  3QFB C;  2B7J A;  1LJR A;  2YNX A;  4HI7 A;  4AGS A;  1GSF A;  1ERT A;  4CDO A;  2AAW A;  1PA3 A;  5LNK e;  4IS0 A;  3IDV A;  5J4U A;  1AIU A;  3GA4 A;  2P5Q A;  5ECM B;  1SK2 A;  2H6X A;  1RW1 A;  4YQV A;  4MF6 A;  4F82 A;  1TRS A;  4TW5 A;  5CRD A;  1YJ6 A;  1OE8 A;  1EP8 A;  1BJX A;  2ZCT A;  5J9B A;  1AXD A;  1MDJ A;  3C71 A;  19GS A;  1SJI A;  3ZIJ A;  2OJL A;  2V6K A;  3PH9 A;  1OC9 A;  2HXK A;  5D96 A;  3LYK A;  3HKR A;  4AJ6 A;  2IMK A;  4MA9 A;  3F63 A;  4MF7 A;  4G2E A;  3VFI A;  4FO5 A;  3APS A;  1JFU A;  5F8B A;  4ULX A;  7GSS A;  3TJF A;  4N0V A;  3FRC A;  4WF5 A;  3TOU A;  5ECN B;  5F06 A;  4IN0 A;  2HT9 A;  2Z9S A;  2AV4 A;  5HR3 A;  1O81 A;  3FKF A;  4HZ4 A;  2F8F A;  3GTU A;  4F03 A; 
#chains in the Genus database with same CATH topology
 1T4Z A;  3WT1 A;  1M7T A;  5KOW A;  4PUA A;  5DCH A;  2HSH A;  1EEM A;  4ML6 A;  3EIN A;  3D22 A;  4RI6 A;  4GSS A;  3KIJ A;  4NHZ A;  5B8A A;  4OCF A;  2LJR A;  2G2Q A;  3WGX A;  2NVL A;  2HRN A;  4N11 A;  1EWX A;  4BWS A;  4WR5 A;  3HHV A;  3QFA C;  3EWL A;  1A24 A;  1JZD A;  3PIN A;  2K6V A;  4EXJ A;  3GH9 A;  3ERF A;  1XPV A;  4TOP A;  4CY6 A;  1FB0 A;  3F0I A;  3FMW A;  2DJ1 A;  2JAD A;  3A3T A;  3GX8 A;  4F0C A;  2O85 A;  2R3X A;  2L4Q A;  1E2Y A;  4KH7 A;  3HD5 A;  1GNE A;  5ECK B;  3MAK A;  4I97 A;  2H1G A;  1MDK A;  2A2P A;  1PD2 1;  5G31 A;  2X4A A;  3IAS 2;  3GHA A;  4CW9 A;  2YOI A;  2LEG A;  2YV7 A;  5EVO A;  2I81 A;  1GUL A;  2AJQ B;  1ERU A;  2D2Z A;  4PGT A;  2H1D A;  3GN3 A;  3HZ8 A;  2X49 A;  5ECL B;  2HZE A;  1GLP A;  1WPI A;  2TRX A;  4WKW A;  4NV2 A;  4IQ1 A;  1YY7 A;  4KUN A;  3IA1 A;  1USB A;  2OA7 A;  4FH8 A;  4EIP A;  5EL8 A;  3S9F A;  1SL2 B;  2H6Y A;  4X43 A;  2XHF A;  3W6G A;  4XS6 A;  4E8E A;  1X5D A;  1FW1 A;  1X9W B;  3HVV A;  3I69 A;  3AY8 A;  4O92 A;  1A0F A;  2BMX A;  2O7K A;  3F4S A;  1TW9 A;  2LV3 A;  4TR4 A;  1GSY A;  4L5L A;  3RDW A;  3RHC A;  1GLQ A;  5DVB A;  1I5G A;  2R5G A;  3VWU A;  2R4V A;  1ZOF A;  1ILO A;  2K8V A;  3VPQ A;  4DVC A;  2KUC A;  2H1B A;  3QR6 A;  2DSA A;  3TUE A;  3C1S A;  1GRX A;  2OBI A;  2YJ7 A;  2RLI A;  1GUH A;  1A8Y A;  1TRW A;  2XBQ A;  3P2A A;  2LUS A;  1JZO A;  3ZTL A;  1DE2 A;  4L0W A;  4KB3 A;  5J41 A;  3GV1 A;  3GL5 A;  3ZZX A;  1XG8 A;  4K2X A;  3UBK A;  4NWY A;  3ZRD A;  3TKR A;  1MD4 A;  1K3Y A;  3DML A;  1XW5 A;  2OE3 A;  1A2M A;  1HQO A;  1G0T A;  2X8H A;  4ZBA A;  1YKA A;  1OKT A;  2PER A;  5GZZ B;  1G6W A;  2L57 A;  4MH2 A;  4LL4 B;  4X0X A;  3VWV A;  4XS1 A;  2V2G A;  1XW9 A;  2HI7 A;  4JED A;  5FWG A;  3MWH A;  3CTF A;  2QC7 A;  4OD7 A;  2I9H A;  1F37 A;  1M2B A;  1R26 A;  2H8L A;  4IHU A;  3ZLP A;  3IV4 A;  2R2J A;  1M3I A;  1XFL A;  3VUR A;  1PRX A;  5CNW A;  5E4W A;  2LS5 A;  5G5F A;  2DML A;  3F4R A;  4J56 E;  3EMP A;  3MNG A;  1XWK A;  3KMO A;  2VAF A;  3N9J A;  4POL A;  2B5Y A;  3M0F A;  4GQF A;  1QQ2 A;  1XWG A;  2XPD A;  5J3R A;  1J9B A;  1V9W A;  1BG5 A;  1GSS A;  2O8V B;  4ZBD A;  1ZMA A;  3UAP A;  2LST A;  2P31 A;  3FZ9 A;  3O76 A;  1WOU A;  4EKZ A;  2B6M A;  1Q98 A;  1RQM A;  3APO A;  1SKS B;  1M3J A;  4K6X A;  3HVN A;  1TK5 B;  1T7P B;  1PFO A;  4G9H A;  2JSY A;  4YQU A;  5CRE A;  2L6C A;  4MJC A;  5DQY A;  4EC0 A;  2WJU A;  3UJ1 A;  1BED A;  1THO A;  4IQA A;  1OVN A;  1VF4 A;  3GIX A;  1PSQ A;  4LMW A;  3G7I A;  5AIX A;  1K0N A;  3VWW A;  2HRF A;  3TJG A;  4I6X A;  4K0N A;  3GH6 A;  4J57 E;  4MJA A;  1SL1 B;  1XW6 A;  2KOK A;  4POB A;  1PL1 A;  3FR9 A;  2JSZ A;  3IC8 A;  2EIR A;  1KEB A;  3M9K A;  3F4T A;  4F2I A;  3CMI A;  3KD0 A;  3TJB A;  18GS A;  5F07 A;  2QA1 A;  3W8S A;  4PNG A;  2LNS A;  1OE7 A;  1T4Y A;  2MYG A;  2H01 A;  4ISD A;  2B1K A;  1Z6M A;  2CZ2 A;  3UOM A;  3HJP A;  5ECS A;  3ZIT A;  4YAV A;  4QL7 A;  2VCZ A;  2DIY A;  2JZT A;  6GSS A;  2REM A;  3QAG A;  2DJJ A;  3KM6 A;  3L9V A;  1NSW A;  1WWJ A;  2YPM A;  2J23 A;  1OC8 A;  3WT2 A;  1ERV A;  3LEF A;  4JU5 A;  4ZXG A;  3CRU A;  3NOF A;  3ZFB A;  4DSQ A;  4H86 A;  3FZA A;  4K5S A;  2E2M A;  3TKP A;  2FA8 A;  1BQ7 A;  12GS A;  1TU7 A;  4IGJ A;  1GTB A;  3QPM A;  5ID2 A;  1K0O A;  4WEY A;  4TR1 B;  3GMF A;  5B6M A;  5H5S A;  4K7N A;  4QL9 A;  4KX4 A;  1ZYQ B;  3IBH A;  3CSJ A;  4POK A;  3ZMK A;  1PMT A;  3FW2 A;  3HDC A;  1GSU A;  2H6Z A;  3OR5 A;  3QAW A;  4L0U A;  1F3B A;  2MMA A;  3QMX A;  1KNG A;  4EE0 A;  2IN3 A;  1B4P A;  1F3A A;  4QQ7 A;  3UL3 A;  2IME A;  3TJK A;  4X1U A;  1X0R A;  3LFL A;  4KDU A;  2GT6 A;  1RK4 A;  4ML1 A;  3FY7 A;  1WJK A;  2GQM A;  2HSY A;  1SL0 B;  4KF9 A;  1V58 A;  1GUK A;  4K5R A;  4OFM A;  1J08 A;  4L5O A;  3E0U A;  2CAI A;  3O3T A;  4IJI A;  5IPG A;  2VLT A;  1CQH A;  3WD6 A;  2N5B A;  1WIK A;  2FWE A;  2GZZ A;  1JLV A;  2WFC A;  4OWY A;  4KE3 A;  3U6V A;  3FZ5 A;  3MSZ A;  3A5I A;  3IXR A;  1ZYN A;  5LCZ A;  4I2U A;  4Q5F A;  5G30 A;  2R0P A;  3HJO A;  4K9Z A;  5HFK A;  1V98 A;  3V1W A;  5DAL B;  3GKN A;  2V41 A;  2YAN A;  4NMU A;  4ZB9 A;  3QOU A;  2QA2 A;  2VO4 A;  2A4H A;  1IYH A;  4ECI A;  2GS3 A;  1QK8 A;  2H70 A;  5JWQ B;  4ECJ A;  1IYI A;  1K3O A;  2V32 A;  2A2R A;  3Q6O A;  2FLS A;  1XOA A;  3EMX A;  4LA1 A;  3L78 A;  4HSC X;  2F8A A;  4XIH A;  3KGK A;  4V2L A;  2YWO A;  4WBR D;  1NW2 A;  2VLV A;  5CP1 A;  1FVK A;  3EUR A;  1FHE A;  1M2D A;  2XPE A;  3WYW A;  3UAR A;  1PKZ A;  1K3L A;  2H76 A;  5HR2 A;  2HFD A;  4ZB6 A;  5ECO B;  5JCG A;  4O5Q A;  2X8C A;  2RII A;  5IMV A;  1K0M A;  2JL4 A;  2MBS A;  4G0K A;  1SYX A;  4GTU A;  5DBQ A;  5KN2 A;  5IO0 A;  1LU4 A;  2H74 A;  3GYK A;  3GX0 A;  1S3D A;  3CBU A;  3E9J B;  5CYY A;  3VLN A;  2DJK A;  5DQS A;  4ZIJ A;  1GL8 A;  2WCI A;  5BMU A;  3TRX A;  1AQV A;  4FYB A;  1X9S B;  1G7E A;  2YWN A;  1O8X A;  4HS1 A;  2NDO A;  5JWO B;  3ZYW A;  4TRX A;  2C8U A;  1PX7 A;  3LYP A;  2CX4 A;  3HCZ A;  2GQL A;  4MJB A;  3HYP A;  2VCX A;  4KDX A;  4Z7X A;  1ZL9 A;  2LRN A;  3UVH A;  4FYC A;  4IBP A;  3WGD A;  4N30 A;  1U3I A;  2N5A A;  3ZVJ A;  4TR1 A;  1DE1 A;  4OMV A;  4KSO A;  2JU5 A;  1MDI A;  4TXO B;  3APQ A;  1SK1 A;  5IOW A;  4ZL7 A;  4MCU A;  3RHB A;  3D21 A;  1THX A;  5D9T A;  5D73 A;  1MTC A;  2EIO A;  3P90 A;  3BD2 A;  4Z2T A;  1NM3 A;  1R7H A;  1JHB A;  3BCI A;  4MNN A;  3J7Y k;  3F3R A;  2H73 A;  3A2W A;  1XZO A;  4E8H A;  1SEN A;  5A4W A;  2M72 A;  4BL7 B;  4KGI A;  2GT5 A;  2GTU A;  5AN1 A;  1U88 A;  3CYN A;  3IRA A;  4GLT A;  3D6I A;  1BAY A;  2HE3 A;  3FZ4 A;  5A5K A;  4GXZ A;  8GSS A;  2OAD A;  4JBB A;  2VM2 A;  1PN9 A;  3H1N A;  3O6T A;  2VM1 A;  1CQG A;  2BJX A;  4G19 A;  2I1U A;  3N5O A;  1SYR A;  4V1A g;  3CRT A;  2RM5 A;  2FWF A;  3DYR A;  6GSV A;  3IK9 A;  4ICY A;  3FHK A;  2LRC A;  2IIY A;  3M9J A;  1TK0 B;  4I8B A;  1U6T A;  4A5P A;  5F0G A;  1GWC A;  4MMM A;  4V1A p;  1DSB A;  3NZN A;  5CAX A;  2PBJ A;  5ECQ B;  2CA8 A;  3KP8 A;  2E2G A;  2GSR A;  2J9H A;  1V2A A;  3SWL A;  3GUS A;  5DAL A;  1O85 A;  3I43 A;  1PL2 A;  1AW9 A;  3L9U A;  3IPZ A;  4HOJ A;  1XOB A;  4XRD A;  1FB6 A;  2DJ3 A;  3L4N A;  1EOH A;  3LW9 A;  3EYT A;  1SD8 A;  5ELA A;  1ZYE A;  3TKQ A;  2R0C A;  2H75 A;  2CVB A;  2LKU A;  3GKK A;  2V6O A;  3R3E A;  5DCG A;  1X5C A;  4Z2R A;  1XCC A;  3EVI A;  2H0G A;  3FR3 A;  4WBJ A;  4OFT A;  1YEP A;  4NPB A;  1B9Y C;  4MJE A;  4WF4 A;  5AIS A;  4IW9 A;  2DKI A;  1OAZ A;  1EEJ A;  2LRT A;  3QAV A;  4MAB A;  1UA5 A;  5ECI B;  1FG4 A;  5IIZ A;  5DJM A;  2AUV A;  2VL2 C;  1XXU A;  5DDL A;  5IQY A;  3KP9 A;  2H71 A;  3F9U A;  2L6D A;  1MEK A;  4FYU A;  1TI1 A;  2HNL A;  2L5O A;  3LXZ A;  2DBC A;  1AUC A;  4Q5Q A;  5IOX A;  3HJM A;  5G5E A;  14GS A;  5CRG A;  3ME8 A;  1PGT A;  2WUL A;  5B7C A;  2I4A A;  4K8M A;  5ELG A;  3FR6 A;  2GDR A;  1SJZ A;  2JZR A;  3D0Z A;  3D4T A;  4OO4 A;  2PWJ A;  10GS A;  3C8E A;  5G2Z A;  4OFN A;  4XRA A;  3GSS A;  1R5A A;  5DAK B;  3NIV A;  3IHG A;  1JZR A;  1M2A A;  4TKY A;  5HFI A;  3FEU A;  2CAQ A;  5C04 A;  4HQZ A;  2WDU A;  4KAE A;  5HR1 A;  4YH2 A;  5IMF A;  1QFN A;  1GSQ A;  20GS A;  1MD3 A;  2ON5 A;  3LJR A;  1XIY A;  4MK3 A;  2X99 A;  1ERW A;  4BPY A;  2VCQ A;  3ISO A;  3W8J A;  4BL7 A;  2RUE A;  1Z5Y E;  2C3N A;  3VPT A;  2FY6 A;  2NTO A;  5H5Q A;  1V40 A;  4MP4 A;  4JZQ A;  2FNO A;  5ENU A;  2HZF A;  2WB9 A;  4RQR A;  1Q4J A;  3RPP A;  1B9X C;  3BOA A;  1GUM A;  1YF1 A;  4O5R A;  4F9Z A;  2MBT A;  4GRF A;  2MZC A;  4MPF A;  4NV5 A;  5IM9 A;  2LTK A;  5D9X A;  4O7H A;  2B1L A;  1ZCP A;  3GRX A;  4N0Z A;  3LXT A;  4XTS A;  1O6J A;  1Z6N A;  11GS A;  2L59 A;  5ECR B;  3RPN A;  1QGV A;  4HJ2 A;  4TVE A;  1H4O A;  2VCW A;  3TRQ A;  3CSI A;  1UVZ A;  3DD3 A;  5EY6 A;  3TRP A;  3HXS A;  1EV4 A;  1T3B A;  4AF2 A;  2TIR A;  2YZU A;  1A2J A;  4YKF A;  2IMF A;  2WGR A;  3SBC A;  1Y25 A;  3ED3 A;  3PGT A;  3UIW A;  3A2X A;  1F2E A;  5H5R A;  2B3S A;  1SU9 A;  3GST A;  2C0D A;  2F51 A;  4XCS A;  1X9M B;  3ME7 A;  3TOT A;  1TDI A;  1SJ6 A;  2N5F A;  3RBT A;  2HRA A;  1S3R A;  1YF0 A;  2FUG 2;  5FT3 A;  2IJY A;  2M46 A;  3UMA A;  3A5W A;  2E7P A;  1QUW A;  5KEJ A;  2DLX A;  3L9S A;  4PX1 A;  3TB2 A;  3L0H A;  1TRV A;  4ZL8 A;  2L4C A;  2MMZ A;  16GS A;  2VL2 A;  3ZIV A;  2FWG A;  6GST A;  2P0G A;  3DVX A;  1DUG A;  2YJH A;  4D73 B;  2B7K A;  2PPT A;  2IMI A;  1SKR B;  3G9B A;  2I3Y A;  4YQM A;  4LL1 B;  1TJD A;  5ECH B;  5E59 A;  2R0G A;  1S3A A;  4EDY A;  3I6A A;  3DVW A;  2FCH A;  3P7X A;  3VI7 A;  3TKS E;  3GFK A;  1FAA A;  2YWI A;  2PVO C;  3DKS A;  1HYU A;  1R5P A;  2WRT A;  2NPB A;  3RAZ A;  1ABA A;  2C80 A;  3TGZ A;  4K7I A;  1ACV A;  1DBY A;  2H66 A;  5HFG A;  3IC4 A;  1HNB A;  4BVY B;  3H79 A;  3BBY A;  2OKA A;  2YV9 A;  4ZIL A;  4K2D A;  2XC2 A;  3ZML A;  2ZUP A;  1YKC A;  5AIV A;  2DKH A;  2K8S A;  2PUK C;  2GQK A;  1V57 A;  2OE0 A;  2KP2 A;  1GTU A;  5J9C A;  1C72 A;  3F8U A;  1ST9 A;  5IMZ A;  4ZB8 A;  1OKD A;  3F3Q A;  3BJ5 A;  5C00 A;  5F05 A;  4PQI A;  5BRT A;  3DEX A;  1Z9H A;  2CV4 A;  4RUV A;  4JRR A;  1FOH A;  2EC4 A;  3CXG A;  3ZRE A;  4MDC A;  2TRC P;  1GNW A;  3J7Y b;  1B48 A;  1NHY A;  4NXI A;  2G0F A;  4ILF A;  4MZB A;  4POM A;  2VL3 A;  4XS4 B;  1OYJ A;  2NBS A;  3K8N A;  2UZ8 A;  4G0I A;  1PX6 A;  3EU4 A;  4MZW A;  2GVP A;  4WR4 A;  4GCI A;  3TJJ A;  1Z7R A;  3HY2 A;  1FVJ A;  2R37 A;  3TKS C;  17GS A;  5HR0 A;  1TRU A;  1HD2 A;  3HZ4 A;  1GTA A;  5G1L A;  2KLX A;  1B8X A;  3IR4 A;  1YZX A;  4V2N A;  2C3Q A;  4HU7 A;  2LNT A;  4K0G A;  4NAX A;  1B4Q A;  2GSQ A;  2CX3 A;  3M8N A;  2KHP A;  2MMN A;  1A2L A;  4IEL A;  5IMD A;  2OE1 A;  2C0G A;  2P5R A;  4LLR A;  1A0R P;  1O8W A;  5ECP B;  5LD0 A;  4DSR A;  2IFQ B;  3CTG A;  1NHO A;  4NHW A;  2ZNM A;  5J5N A;  3QCP A;  2C4J A;  1H75 A;  2KP1 A;  2IL3 A;  1TU8 A;  3UEM A;  3H93 A;  3PR8 A;  1K0A A;  3VK9 A;  3EU3 A;  5KN0 A;  3LOR A;  1AQW A;  5HQP A;  4GWR A;  1O73 A;  4ECB A;  2OBK A;  3GUR A;  2DMM A;  4OCE A;  1M99 A;  4Q5R A;  3DGQ A;  2CVD A;  1JZW A;  4GST A;  2X8G A;  3LGC A;  2YP6 A;  2A2S A;  2LQQ A;  5JCW A;  4TN8 A;  4KCE A;  2EIQ A;  4D73 A;  3ZL5 A;  4IP1 A;  2PN8 A;  1X5E A;  4JE1 A;  2DJ0 A;  2YCD A;  2DIZ A;  4EL1 A;  4EUY A;  3ZFL A;  2YZH A;  4IKH A;  4HJM A;  1QMV A;  2WZ9 A;  3IK7 A;  2VCT A;  2VCV A;  2H72 A;  1VF2 A;  3ERG A;  2YN1 A;  3DXB A;  1N8J A;  3KEB A;  2JZS A;  4K7O A;  4BVY A;  1T1V A;  2RM6 A;  1ZZY A;  1SD9 A;  2CVK A;  2HYX A;  5GAP D;  1AQX A;  1K0C A;  2CZ3 A;  4WET A;  1WP0 A;  2MMO A;  3DRN A;  4IJ3 A;  4GQC A;  2JAC A;  4J2F A;  3KJY A;  1VF1 A;  2VD0 A;  4EF0 A;  1VF3 A;  1GH2 A;  4HEA 2;  1SK0 A;  2ES7 A;  3ZVJ D;  4Z2U A;  3EE2 A;  3GNJ A;  5IMA A;  5IO2 A;  4K1F A;  5B8B A;  3Q18 A;  4MH3 A;  3F6D A;  4P3Y B;  1M0U A;  4ID0 A;  5DJL A;  1ZYP A;  3CQF A;  3HVS A;  4KW6 A;  2ON7 A;  2HLS A;  2WS2 A;  2IWT A;  13GS A;  5KN3 A;  3GL3 A;  3QDN A;  5L71 A;  3GKM A;  4YAP A;  1A8L A;  1UN2 A;  3F6F A;  1R4W A;  3C73 A;  2R6K A;  3IE3 A;  2OAC A;  3E3E A;  1E6B A;  2FGX A;  1W4V A;  1G6Y A;  2IPA A;  3EPT A;  2L5L A;  5A4U A;  4XS4 A;  2A4V A;  2B5X A;  3H4K A;  3LG6 A;  2VUP A;  4IP6 A;  1EGR A;  1EP7 A;  3I9V 2;  3TKS A;  1PQN A;  2H0I A;  4PUF C;  4AJ8 A;  3P8W A;  4HDE A;  3D4M A;  4PQ1 A;  9GSS A;  1HNC A;  2O87 A;  5ID2 B;  1URM A;  2YWM A;  5D9V A;  2AYT A;  4PNF A;  3ERW A;  2FWH A;  1F6M C;  2FA4 A;  1GSE A;  2C3T A;  3CSH A;  1YEX A;  1S3C A;  3IOS A;  5D8I A;  3A2V A;  4EO3 A;  1F9M A;  4G0L A;  2M80 A;  2HSM A;  1XWC A;  3WGE A;  1AAZ A;  6GSU A;  3KMN A;  4V2M A;  2IMD A;  3U5R E;  3VWX A;  2IFQ A;  1YDK A;  1N2A A;  3H8Q A;  4FQU A;  5JCU A;  3Q19 A;  2GST A;  2VIM A;  3DWV A;  5GSS A;  2PVQ A;  3M3M A;  1VRS D;  5GST A;  4PQH A;  4TR3 A;  2PMT A;  5AGY A;  1TXX A;  4DSS B;  2VOC A;  1BYE A;  4GSN A;  4X4J A;  1EZK A;  4MPG A;  5CO3 A;  2C0F A;  5GAN D;  1PKW A;  5IPH A;  6GSY A;  3VI5 A;  3C7M A;  4PTS A;  4BVX B;  1FOV A;  4TXO A;  4YKG A;  1XWA A;  2B5E A;  4XHM A;  3MIX A;  3Q74 A;  4TXV A;  1I9D A;  4HQS A;  2QGV A;  4OO5 A;  5D9W A;  4CHS A;  3R2Q A;  3PPU A;  4KCA A;  1J0F A;  4IVF A;  3KTL A;  1HNA A;  2C1Y A;  1EGO A;  1U3A A;  4ZL9 A;  4O32 A;  4I5Q A;  4GF0 A;  1SKW B;  2QSI A;  1XWB A;  1QXH A;  2E0Q A;  2F3M A;  2F9S A;  4WXT A;  3LSZ A;  5G1K A;  4FIW A;  1Y6E A;  1OC9 B;  3LWA A;  2AB6 A;  3KH9 A;  1VGL A;  1GSD A;  2ALB A;  5JWR B;  3DIE A;  2PU9 C;  3EC3 A;  3HA9 A;  1TOF A;  3KH7 A;  2VLU A;  1ML6 A;  5CRW A;  1TI3 A;  1W89 A;  1LBK A;  5KOX A;  4PUR A;  4KSM A;  4L8E A;  2QKE A;  1KBN A;  2H19 A;  3FYG A;  3LQ7 A;  1G7O A;  1TTZ A;  4TR0 A;  4RQX A;  3FK8 A;  2O89 A;  4Q5N A;  2FHE A;  4EDZ A;  3GTU B;  4JR4 A;  2XBI A;  2K18 A;  3IHQ A;  3G7J A;  1T8E B;  3HVX A;  3D5J A;  3KCM A;  2VD1 A;  4MF5 A;  5KN1 A;  2H0H A;  4KND A;  2GLR A;  1ZGN A;  2BTO T;  2VL9 A;  3C1R A;  1WE0 A;  2H1A A;  2GGT A;  1K0D A;  2CT6 A;  2DC5 A;  3TDG A;  3US3 A;  22GS A;  5COH A;  4EVM A;  1Z7P A;  3TCO A;  3BCK A;  3GKX A;  4RI7 A;  4I2T A;  3G7Y A;  4G10 A;  1EOG A;  2PGT A;  3JCM L;  5FHI A;  1XVW A;  3UBL A;  2H30 A;  4F0B A;  5ABR A;  2RUF A;  4DEJ A;  5INY A;  4N10 A;  1ON4 A;  2C0E A;  3IAM 2;  3KZQ A;  4AJ7 A;  1FO5 A;  4HZ2 A;  3QD9 A;  3M1G A;  1O7U A;  2DJ2 A;  3MDK A;  1EV9 A;  6GSX A;  1XBS A;  5EPF A;  5CRH A;  3KXO A;  1JLW A;  2GSS A;  2V1M A;  4KA0 A;  1TP9 A;  4JR6 A;  4MLY A;  4MZC A;  4USS A;  4ECC A;  1YQ1 A;  1A23 A;  1BX9 A;  2LJK A;  2FD3 A;  2LJA A;  4PXO A;  2K9F A;  1WMJ A;  1OC3 A;  1KTE A;  5D93 A;  1GP1 A;  4HU9 A;  3MYD A;  1GTI A;  2GZY A;  1WRY A;  4HUA A;  4KDY A;  5A4V A;  4BA7 A;  1UC7 A;  1T00 A;  2AHE A;  1M9A A;  2HZE B;  1M9B A;  2CQ9 A;  4DSS A;  4ACS A;  1TKD B;  4CY8 A;  2X64 A;  2LQO A;  1U87 A;  1XVQ A;  4BVX A;  5B6N A;  5DAK A;  2GZP A;  1Z3E A;  1AC1 A;  3UVT A;  3KTB A;  1K0B A;  6GSW A;  4ZBB A;  4LMV A;  1TK8 B;  5IMC A;  4BWQ A;  3QFB C;  2B7J A;  1LJR A;  2YNX A;  4HI7 A;  4AGS A;  1GSF A;  1ERT A;  4CDO A;  2AAW A;  1PA3 A;  5LNK e;  4IS0 A;  3IDV A;  5J4U A;  1AIU A;  3GA4 A;  2P5Q A;  5ECM B;  1SK2 A;  2HRK A;  1PN0 A;  2H6X A;  1RW1 A;  4YQV A;  4MF6 A;  4F82 A;  1TRS A;  4BIK A;  4TW5 A;  5CRD A;  4EIQ A;  1YJ6 A;  1OE8 A;  1EP8 A;  1BJX A;  2ZCT A;  5J9B A;  1AXD A;  1MDJ A;  3C71 A;  19GS A;  1SJI A;  3ZIJ A;  2OJL A;  2V6K A;  3PH9 A;  1OC9 A;  2HXK A;  5D96 A;  3LYK A;  3HKR A;  4AJ6 A;  2IMK A;  4MA9 A;  3F63 A;  4MF7 A;  4G2E A;  3VFI A;  4FO5 A;  3APS A;  1JFU A;  5F8B A;  4ULX A;  7GSS A;  3TJF A;  4N0V A;  3FRC A;  4WF5 A;  3TOU A;  5ECN B;  5F06 A;  4IN0 A;  4O5U A;  2HT9 A;  2Z9S A;  2AV4 A;  5HR3 A;  1O81 A;  3FKF A;  4HZ4 A;  2F8F A;  3GTU A;  4F03 A; 
#chains in the Genus database with same CATH homology
 1T4Z A;  3WT1 A;  1M7T A;  5KOW A;  4PUA A;  5DCH A;  2HSH A;  1EEM A;  4ML6 A;  3EIN A;  3D22 A;  4RI6 A;  4GSS A;  3KIJ A;  4NHZ A;  5B8A A;  4OCF A;  2LJR A;  2G2Q A;  3WGX A;  2NVL A;  2HRN A;  4N11 A;  1EWX A;  4BWS A;  4WR5 A;  3HHV A;  3QFA C;  3EWL A;  1A24 A;  1JZD A;  3PIN A;  2K6V A;  4EXJ A;  3GH9 A;  3ERF A;  1XPV A;  4TOP A;  4CY6 A;  1FB0 A;  3F0I A;  3FMW A;  2DJ1 A;  2JAD A;  3A3T A;  3GX8 A;  4F0C A;  2O85 A;  2R3X A;  2L4Q A;  1E2Y A;  4KH7 A;  3HD5 A;  1GNE A;  5ECK B;  3MAK A;  4I97 A;  2H1G A;  1MDK A;  2A2P A;  1PD2 1;  5G31 A;  2X4A A;  3IAS 2;  3GHA A;  4CW9 A;  2YOI A;  2LEG A;  2YV7 A;  5EVO A;  2I81 A;  1GUL A;  2AJQ B;  1ERU A;  2D2Z A;  4PGT A;  2H1D A;  3GN3 A;  3HZ8 A;  2X49 A;  5ECL B;  2HZE A;  1GLP A;  1WPI A;  2TRX A;  4WKW A;  4NV2 A;  4IQ1 A;  1YY7 A;  4KUN A;  3IA1 A;  1USB A;  2OA7 A;  4FH8 A;  4EIP A;  5EL8 A;  3S9F A;  1SL2 B;  2H6Y A;  4X43 A;  2XHF A;  3W6G A;  4XS6 A;  4E8E A;  1X5D A;  1FW1 A;  1X9W B;  3HVV A;  3I69 A;  3AY8 A;  4O92 A;  1A0F A;  2BMX A;  2O7K A;  3F4S A;  1TW9 A;  2LV3 A;  4TR4 A;  1GSY A;  4L5L A;  3RDW A;  3RHC A;  1GLQ A;  5DVB A;  1I5G A;  2R5G A;  3VWU A;  2R4V A;  1ZOF A;  1ILO A;  2K8V A;  3VPQ A;  4DVC A;  2KUC A;  2H1B A;  3QR6 A;  2DSA A;  3TUE A;  3C1S A;  1GRX A;  2OBI A;  2YJ7 A;  2RLI A;  1GUH A;  1A8Y A;  1TRW A;  2XBQ A;  3P2A A;  2LUS A;  1JZO A;  3ZTL A;  1DE2 A;  4L0W A;  4KB3 A;  5J41 A;  3GV1 A;  3GL5 A;  3ZZX A;  4K2X A;  3UBK A;  4NWY A;  3ZRD A;  3TKR A;  1MD4 A;  1K3Y A;  3DML A;  1XW5 A;  2OE3 A;  1A2M A;  1HQO A;  1G0T A;  2X8H A;  4ZBA A;  1YKA A;  1OKT A;  2PER A;  5GZZ B;  1G6W A;  2L57 A;  4MH2 A;  4LL4 B;  4X0X A;  3VWV A;  4XS1 A;  2V2G A;  1XW9 A;  2HI7 A;  4JED A;  5FWG A;  3MWH A;  3CTF A;  2QC7 A;  4OD7 A;  2I9H A;  1F37 A;  1M2B A;  1R26 A;  2H8L A;  4IHU A;  3ZLP A;  3IV4 A;  2R2J A;  1XFL A;  3VUR A;  1PRX A;  5CNW A;  5E4W A;  2LS5 A;  5G5F A;  2DML A;  3F4R A;  4J56 E;  3EMP A;  3MNG A;  1XWK A;  3KMO A;  2VAF A;  3N9J A;  4POL A;  2B5Y A;  3M0F A;  4GQF A;  1QQ2 A;  1XWG A;  2XPD A;  5J3R A;  1J9B A;  1V9W A;  1BG5 A;  1GSS A;  2O8V B;  4ZBD A;  1ZMA A;  3UAP A;  2LST A;  2P31 A;  3FZ9 A;  3O76 A;  1WOU A;  4EKZ A;  2B6M A;  1Q98 A;  1RQM A;  3APO A;  1SKS B;  4K6X A;  1TK5 B;  1T7P B;  4G9H A;  2JSY A;  4YQU A;  5CRE A;  2L6C A;  4MJC A;  5DQY A;  4EC0 A;  2WJU A;  3UJ1 A;  1BED A;  1THO A;  4IQA A;  1OVN A;  1VF4 A;  3GIX A;  1PSQ A;  4LMW A;  3G7I A;  5AIX A;  1K0N A;  3VWW A;  2HRF A;  3TJG A;  4I6X A;  4K0N A;  3GH6 A;  4J57 E;  4MJA A;  1SL1 B;  1XW6 A;  2KOK A;  4POB A;  1PL1 A;  3FR9 A;  2JSZ A;  3IC8 A;  2EIR A;  1KEB A;  3M9K A;  3F4T A;  4F2I A;  3CMI A;  3KD0 A;  3TJB A;  18GS A;  5F07 A;  2QA1 A;  3W8S A;  4PNG A;  2LNS A;  1OE7 A;  1T4Y A;  2MYG A;  2H01 A;  4ISD A;  2B1K A;  1Z6M A;  2CZ2 A;  3UOM A;  3HJP A;  5ECS A;  3ZIT A;  4YAV A;  4QL7 A;  2VCZ A;  2DIY A;  2JZT A;  6GSS A;  2REM A;  3QAG A;  2DJJ A;  3KM6 A;  3L9V A;  1NSW A;  1WWJ A;  2YPM A;  2J23 A;  1OC8 A;  3WT2 A;  1ERV A;  3LEF A;  4JU5 A;  4ZXG A;  3CRU A;  3NOF A;  3ZFB A;  4DSQ A;  4H86 A;  3FZA A;  4K5S A;  2E2M A;  3TKP A;  2FA8 A;  1BQ7 A;  12GS A;  1TU7 A;  4IGJ A;  1GTB A;  3QPM A;  5ID2 A;  1K0O A;  4WEY A;  4TR1 B;  3GMF A;  5B6M A;  5H5S A;  4K7N A;  4QL9 A;  4KX4 A;  1ZYQ B;  3IBH A;  3CSJ A;  4POK A;  3ZMK A;  1PMT A;  3FW2 A;  3HDC A;  1GSU A;  2H6Z A;  3OR5 A;  3QAW A;  4L0U A;  1F3B A;  2MMA A;  3QMX A;  1KNG A;  4EE0 A;  2IN3 A;  1B4P A;  1F3A A;  4QQ7 A;  3UL3 A;  2IME A;  3TJK A;  4X1U A;  1X0R A;  3LFL A;  4KDU A;  2GT6 A;  1RK4 A;  4ML1 A;  3FY7 A;  1WJK A;  2GQM A;  2HSY A;  1SL0 B;  4KF9 A;  1V58 A;  1GUK A;  4K5R A;  4OFM A;  1J08 A;  4L5O A;  3E0U A;  2CAI A;  3O3T A;  4IJI A;  5IPG A;  2VLT A;  1CQH A;  3WD6 A;  2N5B A;  1WIK A;  2FWE A;  2GZZ A;  1JLV A;  2WFC A;  4OWY A;  4KE3 A;  3U6V A;  3FZ5 A;  3MSZ A;  3A5I A;  3IXR A;  1ZYN A;  5LCZ A;  4I2U A;  4Q5F A;  5G30 A;  2R0P A;  3HJO A;  4K9Z A;  5HFK A;  1V98 A;  3V1W A;  5DAL B;  3GKN A;  2V41 A;  2YAN A;  4NMU A;  4ZB9 A;  3QOU A;  2QA2 A;  2VO4 A;  2A4H A;  1IYH A;  4ECI A;  2GS3 A;  1QK8 A;  2H70 A;  5JWQ B;  4ECJ A;  1IYI A;  1K3O A;  2V32 A;  2A2R A;  3Q6O A;  2FLS A;  1XOA A;  3EMX A;  4LA1 A;  3L78 A;  2F8A A;  4XIH A;  3KGK A;  4V2L A;  2YWO A;  4WBR D;  1NW2 A;  2VLV A;  5CP1 A;  1FVK A;  3EUR A;  1FHE A;  1M2D A;  2XPE A;  3WYW A;  3UAR A;  1PKZ A;  1K3L A;  2H76 A;  5HR2 A;  2HFD A;  4ZB6 A;  5ECO B;  5JCG A;  4O5Q A;  2X8C A;  2RII A;  5IMV A;  1K0M A;  2JL4 A;  2MBS A;  4G0K A;  1SYX A;  4GTU A;  5DBQ A;  5KN2 A;  5IO0 A;  1LU4 A;  2H74 A;  3GYK A;  3GX0 A;  1S3D A;  3CBU A;  3E9J B;  5CYY A;  3VLN A;  2DJK A;  5DQS A;  4ZIJ A;  1GL8 A;  2WCI A;  5BMU A;  3TRX A;  1AQV A;  4FYB A;  1X9S B;  1G7E A;  2YWN A;  1O8X A;  4HS1 A;  2NDO A;  5JWO B;  3ZYW A;  4TRX A;  2C8U A;  1PX7 A;  3LYP A;  2CX4 A;  3HCZ A;  2GQL A;  4MJB A;  3HYP A;  2VCX A;  4KDX A;  4Z7X A;  1ZL9 A;  2LRN A;  3UVH A;  4FYC A;  4IBP A;  3WGD A;  4N30 A;  1U3I A;  2N5A A;  3ZVJ A;  4TR1 A;  1DE1 A;  4OMV A;  4KSO A;  2JU5 A;  1MDI A;  4TXO B;  3APQ A;  1SK1 A;  5IOW A;  4ZL7 A;  4MCU A;  3RHB A;  3D21 A;  1THX A;  5D9T A;  5D73 A;  1MTC A;  2EIO A;  3P90 A;  3BD2 A;  4Z2T A;  1NM3 A;  1R7H A;  1JHB A;  3BCI A;  4MNN A;  3J7Y k;  3F3R A;  2H73 A;  3A2W A;  1XZO A;  4E8H A;  1SEN A;  5A4W A;  2M72 A;  4BL7 B;  4KGI A;  2GT5 A;  2GTU A;  5AN1 A;  1U88 A;  3CYN A;  3IRA A;  4GLT A;  3D6I A;  1BAY A;  2HE3 A;  3FZ4 A;  5A5K A;  4GXZ A;  8GSS A;  2OAD A;  4JBB A;  2VM2 A;  1PN9 A;  3H1N A;  3O6T A;  2VM1 A;  1CQG A;  2BJX A;  4G19 A;  2I1U A;  3N5O A;  1SYR A;  4V1A g;  3CRT A;  2RM5 A;  2FWF A;  3DYR A;  6GSV A;  3IK9 A;  4ICY A;  3FHK A;  2LRC A;  2IIY A;  3M9J A;  1TK0 B;  4I8B A;  1U6T A;  4A5P A;  5F0G A;  1GWC A;  4MMM A;  4V1A p;  1DSB A;  3NZN A;  5CAX A;  2PBJ A;  5ECQ B;  2CA8 A;  3KP8 A;  2E2G A;  2GSR A;  2J9H A;  1V2A A;  3SWL A;  3GUS A;  5DAL A;  1O85 A;  3I43 A;  1PL2 A;  1AW9 A;  3L9U A;  3IPZ A;  4HOJ A;  1XOB A;  4XRD A;  1FB6 A;  2DJ3 A;  3L4N A;  1EOH A;  3LW9 A;  3EYT A;  1SD8 A;  5ELA A;  1ZYE A;  3TKQ A;  2R0C A;  2H75 A;  2CVB A;  2LKU A;  3GKK A;  2V6O A;  3R3E A;  5DCG A;  1X5C A;  4Z2R A;  1XCC A;  3EVI A;  2H0G A;  3FR3 A;  4WBJ A;  4OFT A;  1YEP A;  4NPB A;  1B9Y C;  4MJE A;  4WF4 A;  5AIS A;  4IW9 A;  2DKI A;  1OAZ A;  1EEJ A;  2LRT A;  3QAV A;  4MAB A;  1UA5 A;  5ECI B;  1FG4 A;  5IIZ A;  5DJM A;  2AUV A;  2VL2 C;  1XXU A;  5DDL A;  5IQY A;  3KP9 A;  2H71 A;  3F9U A;  2L6D A;  1MEK A;  4FYU A;  1TI1 A;  2HNL A;  2L5O A;  3LXZ A;  2DBC A;  1AUC A;  4Q5Q A;  5IOX A;  3HJM A;  5G5E A;  14GS A;  5CRG A;  3ME8 A;  1PGT A;  2WUL A;  5B7C A;  2I4A A;  4K8M A;  5ELG A;  3FR6 A;  2GDR A;  1SJZ A;  2JZR A;  3D0Z A;  3D4T A;  4OO4 A;  2PWJ A;  10GS A;  3C8E A;  5G2Z A;  4OFN A;  4XRA A;  3GSS A;  1R5A A;  5DAK B;  3NIV A;  3IHG A;  1JZR A;  1M2A A;  4TKY A;  5HFI A;  3FEU A;  2CAQ A;  5C04 A;  4HQZ A;  2WDU A;  4KAE A;  5HR1 A;  4YH2 A;  5IMF A;  1QFN A;  1GSQ A;  20GS A;  1MD3 A;  2ON5 A;  3LJR A;  1XIY A;  4MK3 A;  2X99 A;  1ERW A;  4BPY A;  2VCQ A;  3ISO A;  3W8J A;  4BL7 A;  2RUE A;  1Z5Y E;  2C3N A;  3VPT A;  2FY6 A;  2NTO A;  5H5Q A;  1V40 A;  4MP4 A;  4JZQ A;  2FNO A;  5ENU A;  2HZF A;  2WB9 A;  4RQR A;  1Q4J A;  3RPP A;  1B9X C;  3BOA A;  1GUM A;  1YF1 A;  4O5R A;  4F9Z A;  2MBT A;  4GRF A;  2MZC A;  4MPF A;  4NV5 A;  5IM9 A;  2LTK A;  5D9X A;  4O7H A;  2B1L A;  1ZCP A;  3GRX A;  4N0Z A;  3LXT A;  4XTS A;  1O6J A;  1Z6N A;  11GS A;  2L59 A;  5ECR B;  3RPN A;  1QGV A;  4HJ2 A;  4TVE A;  1H4O A;  2VCW A;  3TRQ A;  3CSI A;  1UVZ A;  3DD3 A;  5EY6 A;  3TRP A;  3HXS A;  1EV4 A;  1T3B A;  4AF2 A;  2TIR A;  2YZU A;  1A2J A;  4YKF A;  2IMF A;  2WGR A;  3SBC A;  1Y25 A;  3ED3 A;  3PGT A;  3UIW A;  3A2X A;  1F2E A;  5H5R A;  2B3S A;  1SU9 A;  3GST A;  2C0D A;  2F51 A;  4XCS A;  1X9M B;  3ME7 A;  3TOT A;  1TDI A;  1SJ6 A;  2N5F A;  3RBT A;  2HRA A;  1YF0 A;  2FUG 2;  5FT3 A;  2IJY A;  2M46 A;  3UMA A;  3A5W A;  2E7P A;  1QUW A;  5KEJ A;  2DLX A;  3L9S A;  4PX1 A;  3TB2 A;  3L0H A;  1TRV A;  4ZL8 A;  2L4C A;  2MMZ A;  16GS A;  2VL2 A;  3ZIV A;  2FWG A;  6GST A;  2P0G A;  3DVX A;  1DUG A;  2YJH A;  4D73 B;  2B7K A;  2PPT A;  2IMI A;  1SKR B;  3G9B A;  2I3Y A;  4YQM A;  4LL1 B;  1TJD A;  5ECH B;  5E59 A;  2R0G A;  1S3A A;  4EDY A;  3I6A A;  3DVW A;  2FCH A;  3P7X A;  3VI7 A;  3TKS E;  3GFK A;  1FAA A;  2YWI A;  2PVO C;  3DKS A;  1HYU A;  1R5P A;  2WRT A;  2NPB A;  3RAZ A;  1ABA A;  2C80 A;  3TGZ A;  4K7I A;  1ACV A;  1DBY A;  2H66 A;  5HFG A;  3IC4 A;  1HNB A;  4BVY B;  3H79 A;  3BBY A;  2OKA A;  2YV9 A;  4ZIL A;  4K2D A;  2XC2 A;  3ZML A;  2ZUP A;  1YKC A;  5AIV A;  2DKH A;  2K8S A;  2PUK C;  2GQK A;  1V57 A;  2OE0 A;  2KP2 A;  1GTU A;  5J9C A;  1C72 A;  3F8U A;  1ST9 A;  5IMZ A;  4ZB8 A;  1OKD A;  3F3Q A;  3BJ5 A;  5C00 A;  5F05 A;  4PQI A;  5BRT A;  3DEX A;  1Z9H A;  2CV4 A;  4RUV A;  4JRR A;  1FOH A;  2EC4 A;  3CXG A;  3ZRE A;  4MDC A;  2TRC P;  1GNW A;  3J7Y b;  1B48 A;  1NHY A;  4NXI A;  2G0F A;  4ILF A;  4MZB A;  4POM A;  2VL3 A;  4XS4 B;  1OYJ A;  2NBS A;  3K8N A;  2UZ8 A;  4G0I A;  1PX6 A;  3EU4 A;  4MZW A;  2GVP A;  4WR4 A;  4GCI A;  3TJJ A;  1Z7R A;  3HY2 A;  1FVJ A;  2R37 A;  3TKS C;  17GS A;  5HR0 A;  1TRU A;  1HD2 A;  3HZ4 A;  1GTA A;  5G1L A;  2KLX A;  1B8X A;  3IR4 A;  1YZX A;  4V2N A;  2C3Q A;  4HU7 A;  2LNT A;  4K0G A;  4NAX A;  1B4Q A;  2GSQ A;  2CX3 A;  3M8N A;  2KHP A;  2MMN A;  1A2L A;  4IEL A;  5IMD A;  2OE1 A;  2C0G A;  2P5R A;  4LLR A;  1A0R P;  1O8W A;  5ECP B;  5LD0 A;  4DSR A;  2IFQ B;  3CTG A;  1NHO A;  4NHW A;  2ZNM A;  5J5N A;  3QCP A;  2C4J A;  1H75 A;  2KP1 A;  2IL3 A;  1TU8 A;  3UEM A;  3H93 A;  3PR8 A;  1K0A A;  3VK9 A;  3EU3 A;  5KN0 A;  3LOR A;  1AQW A;  5HQP A;  4GWR A;  1O73 A;  4ECB A;  2OBK A;  3GUR A;  2DMM A;  4OCE A;  1M99 A;  4Q5R A;  3DGQ A;  2CVD A;  1JZW A;  4GST A;  2X8G A;  3LGC A;  2YP6 A;  2A2S A;  2LQQ A;  5JCW A;  4TN8 A;  4KCE A;  2EIQ A;  4D73 A;  3ZL5 A;  4IP1 A;  2PN8 A;  1X5E A;  4JE1 A;  2DJ0 A;  2YCD A;  2DIZ A;  4EL1 A;  4EUY A;  3ZFL A;  2YZH A;  4IKH A;  4HJM A;  1QMV A;  2WZ9 A;  3IK7 A;  2VCT A;  2VCV A;  2H72 A;  1VF2 A;  3ERG A;  2YN1 A;  3DXB A;  1N8J A;  3KEB A;  2JZS A;  4K7O A;  4BVY A;  1T1V A;  2RM6 A;  1ZZY A;  1SD9 A;  2CVK A;  2HYX A;  5GAP D;  1AQX A;  1K0C A;  2CZ3 A;  4WET A;  1WP0 A;  2MMO A;  3DRN A;  4IJ3 A;  4GQC A;  2JAC A;  4J2F A;  3KJY A;  1VF1 A;  2VD0 A;  4EF0 A;  1VF3 A;  1GH2 A;  4HEA 2;  1SK0 A;  2ES7 A;  3ZVJ D;  4Z2U A;  3EE2 A;  3GNJ A;  5IMA A;  5IO2 A;  4K1F A;  5B8B A;  3Q18 A;  4MH3 A;  3F6D A;  4P3Y B;  1M0U A;  4ID0 A;  5DJL A;  1ZYP A;  3HVS A;  4KW6 A;  2ON7 A;  2HLS A;  2WS2 A;  2IWT A;  13GS A;  5KN3 A;  3GL3 A;  3QDN A;  5L71 A;  3GKM A;  4YAP A;  1A8L A;  1UN2 A;  3F6F A;  1R4W A;  3C73 A;  2R6K A;  3IE3 A;  2OAC A;  3E3E A;  1E6B A;  2FGX A;  1W4V A;  1G6Y A;  2IPA A;  3EPT A;  2L5L A;  5A4U A;  4XS4 A;  2A4V A;  2B5X A;  3H4K A;  3LG6 A;  2VUP A;  4IP6 A;  1EGR A;  1EP7 A;  3I9V 2;  3TKS A;  1PQN A;  2H0I A;  4PUF C;  4AJ8 A;  3P8W A;  4HDE A;  3D4M A;  4PQ1 A;  9GSS A;  1HNC A;  2O87 A;  5ID2 B;  1URM A;  2YWM A;  5D9V A;  2AYT A;  4PNF A;  3ERW A;  2FWH A;  1F6M C;  2FA4 A;  1GSE A;  2C3T A;  3CSH A;  1YEX A;  1S3C A;  3IOS A;  5D8I A;  3A2V A;  4EO3 A;  1F9M A;  4G0L A;  2M80 A;  2HSM A;  1XWC A;  3WGE A;  1AAZ A;  6GSU A;  3KMN A;  4V2M A;  2IMD A;  3U5R E;  3VWX A;  2IFQ A;  1YDK A;  1N2A A;  3H8Q A;  4FQU A;  5JCU A;  3Q19 A;  2GST A;  2VIM A;  3DWV A;  5GSS A;  2PVQ A;  3M3M A;  1VRS D;  5GST A;  4PQH A;  4TR3 A;  2PMT A;  5AGY A;  1TXX A;  4DSS B;  2VOC A;  1BYE A;  4GSN A;  4X4J A;  1EZK A;  4MPG A;  5CO3 A;  2C0F A;  5GAN D;  1PKW A;  5IPH A;  6GSY A;  3VI5 A;  3C7M A;  4PTS A;  4BVX B;  1FOV A;  4TXO A;  4YKG A;  1XWA A;  2B5E A;  4XHM A;  3MIX A;  3Q74 A;  4TXV A;  1I9D A;  4HQS A;  2QGV A;  4OO5 A;  5D9W A;  4CHS A;  3R2Q A;  3PPU A;  4KCA A;  1J0F A;  4IVF A;  3KTL A;  1HNA A;  2C1Y A;  1EGO A;  1U3A A;  4ZL9 A;  4O32 A;  4I5Q A;  4GF0 A;  1SKW B;  2QSI A;  1XWB A;  1QXH A;  2E0Q A;  2F3M A;  2F9S A;  4WXT A;  3LSZ A;  5G1K A;  4FIW A;  1Y6E A;  1OC9 B;  3LWA A;  2AB6 A;  3KH9 A;  1VGL A;  1GSD A;  2ALB A;  5JWR B;  3DIE A;  2PU9 C;  3EC3 A;  3HA9 A;  1TOF A;  3KH7 A;  2VLU A;  1ML6 A;  5CRW A;  1TI3 A;  1W89 A;  1LBK A;  5KOX A;  4PUR A;  4KSM A;  4L8E A;  2QKE A;  1KBN A;  2H19 A;  3FYG A;  3LQ7 A;  1G7O A;  1TTZ A;  4TR0 A;  4RQX A;  3FK8 A;  2O89 A;  4Q5N A;  2FHE A;  4EDZ A;  3GTU B;  4JR4 A;  2XBI A;  2K18 A;  3IHQ A;  3G7J A;  1T8E B;  3HVX A;  3D5J A;  3KCM A;  2VD1 A;  4MF5 A;  5KN1 A;  2H0H A;  4KND A;  2GLR A;  1ZGN A;  2BTO T;  2VL9 A;  3C1R A;  1WE0 A;  2H1A A;  2GGT A;  1K0D A;  2CT6 A;  2DC5 A;  3TDG A;  3US3 A;  22GS A;  5COH A;  4EVM A;  1Z7P A;  3TCO A;  3BCK A;  3GKX A;  4RI7 A;  4I2T A;  3G7Y A;  4G10 A;  1EOG A;  2PGT A;  3JCM L;  5FHI A;  1XVW A;  3UBL A;  2H30 A;  4F0B A;  5ABR A;  2RUF A;  4DEJ A;  5INY A;  4N10 A;  1ON4 A;  2C0E A;  3IAM 2;  3KZQ A;  4AJ7 A;  1FO5 A;  4HZ2 A;  3QD9 A;  3M1G A;  1O7U A;  2DJ2 A;  3MDK A;  1EV9 A;  6GSX A;  1XBS A;  5EPF A;  5CRH A;  3KXO A;  1JLW A;  2GSS A;  2V1M A;  4KA0 A;  1TP9 A;  4JR6 A;  4MLY A;  4MZC A;  4USS A;  4ECC A;  1YQ1 A;  1A23 A;  1BX9 A;  2LJK A;  2FD3 A;  2LJA A;  4PXO A;  2K9F A;  1WMJ A;  1OC3 A;  1KTE A;  5D93 A;  1GP1 A;  4HU9 A;  3MYD A;  1GTI A;  2GZY A;  1WRY A;  4HUA A;  4KDY A;  5A4V A;  4BA7 A;  1UC7 A;  1T00 A;  2AHE A;  1M9A A;  2HZE B;  1M9B A;  2CQ9 A;  4DSS A;  4ACS A;  1TKD B;  4CY8 A;  2X64 A;  2LQO A;  1U87 A;  1XVQ A;  4BVX A;  5B6N A;  5DAK A;  2GZP A;  1Z3E A;  1AC1 A;  3UVT A;  3KTB A;  1K0B A;  6GSW A;  4ZBB A;  4LMV A;  1TK8 B;  5IMC A;  4BWQ A;  3QFB C;  2B7J A;  1LJR A;  2YNX A;  4HI7 A;  4AGS A;  1GSF A;  1ERT A;  4CDO A;  2AAW A;  1PA3 A;  5LNK e;  4IS0 A;  3IDV A;  5J4U A;  1AIU A;  3GA4 A;  2P5Q A;  5ECM B;  1SK2 A;  2HRK A;  1PN0 A;  2H6X A;  1RW1 A;  4YQV A;  4MF6 A;  4F82 A;  1TRS A;  4TW5 A;  5CRD A;  4EIQ A;  1YJ6 A;  1OE8 A;  1EP8 A;  1BJX A;  2ZCT A;  5J9B A;  1AXD A;  1MDJ A;  3C71 A;  19GS A;  1SJI A;  3ZIJ A;  2OJL A;  2V6K A;  3PH9 A;  1OC9 A;  2HXK A;  5D96 A;  3LYK A;  3HKR A;  4AJ6 A;  2IMK A;  4MA9 A;  3F63 A;  4MF7 A;  4G2E A;  3VFI A;  4FO5 A;  3APS A;  1JFU A;  5F8B A;  4ULX A;  7GSS A;  3TJF A;  4N0V A;  3FRC A;  4WF5 A;  3TOU A;  5ECN B;  5F06 A;  4IN0 A;  4O5U A;  2HT9 A;  2Z9S A;  2AV4 A;  5HR3 A;  1O81 A;  3FKF A;  4HZ4 A;  2F8F A;  3GTU A;  4F03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...