4ZL9A

Crystal structure of pseudomonas aeruginosa dsba e82i: crystal iii
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
187
structure length
187
Chain Sequence
b'DYTAGKEYVELSSPVPVSQPGKIEVVELFWYGCPHCYAFEPTIVPWSEKLPADVHFVRLPALFGGIWNVHGQMFLTLISMGVEHDVHNAVFEAIHKEHKKLATPEEMADFLAGKGVDKEKFLSTYNSFAIKGQMEKAKKLAMAYQVTGVPTMVVNGKYRFDIGSAGGPEETLKLADYLIEKERAAAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein DsbA
publication title Sent packing: protein engineering generates a new crystal form of Pseudomonas aeruginosa DsbA1 with increased catalytic surface accessibility.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 64
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2015-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4zl9A00
5HQPA 9GSSA 2FLSA 5C00A 1GWCA 4MJAA 2PVOC 3TGZA 3GN3A 2IN3A 3GV1A 1T00A 1Z6MA 4EL1A 1XXUA 5IMCA 4Z7XA 2H8LA 4N11A 2VLVA 1YQ1A 3WYWA 2L6DA 3A2XA 4XHMA 4MF6A 2B5EA 2CZ3A 4L8EA 4IKHA 1RW1A 2KP2A 4FYCA 2I9HA 5IOWA 4PXOA 1GSUA 1F37A 5D96A 5G2ZA 5CRDA 1ZYQB 5ECKB 5DCHA 5HR0A 5CYYA 3L0HA 1RQMA 5HR3A 1AW9A 4HS1A 1V58A 3U5RE 4QL9A 2X64A 2CVDA 2PERA 5JWRB 1UVZA 1SK1A 4V2NA 1GLQA 3EWLA 3GNJA 2HZEA 3HJMA 4HJ2A 4IQ1A 5A4WA 2O8VB 2VCVA 3FR9A 5H5RA 1R26A 1X0RA 2F51A 2DLXA 3EVIA 1YZXA 1MTCA 3EMPA 4HI7A 3P90A 2IPAA 1EP7A 2HNLA 5GSSA 5ECHB 4KSMA 5D9XA 1SL0B 5KN2A 4I6XA 4DVCA 4MABA 1YF0A 1QK8A 5ELGA 3UARA 1X5EA 4ZB6A 3W6GA 5AISA 1T4YA 3RPNA 1UN2A 1SYRA 2JADA 2AV4A 2DJ2A 4PQIA 2EIQA 5J3RA 1OC8A 1XZOA 5JWQB 4F0BA 2VAFA 4N10A 1XW5A 1GSDA 4BWSA 4GSTA 4MCUA 2HFDA 3DYRA 3O76A 4XRAA 3SWLA 4YAVA 1MEKA 1GULA 1AQWA 3MWHA 3L9VA 3VWXA 2FNOA 1J0FA 1DE2A 1TJDA 3HD5A 3RBTA 2VM1A 1XCCA 1SD9A 2MZCA 1GUHA 1F2EA 3MAKA 1NW2A 3HHVA 2X8GA 3PINA 4ECCA 2HYXA 3LORA 2HZEB 4POKA 1THOA 1M9AA 1DSBA 2ZUPA 2HSHA 1Z9HA 1TU8A 1F3AA 2VL2C 5J9BA 1PX7A 3C73A 4H86A 1SK0A 2PMTA 4JR4A 4V2LA 5IMDA 4IGJA 3HA9A 5L71A 5IMFA 2B5XA 4L0WA 2H72A 4WF4A 4XS6A 4E8EA 2ES7A 1BX9A 3IV4A 4IN0A 2OE0A 2V1MA 3ZTLA 4Q5NA 3VWUA 4WR5A 3FZ5A 3K8NA 2PUKC 3VI5A 5ID2A 5LNKe 4EXJA 1SL1B 3HCZA 4OCFA 3QAVA 2HRNA 2DJ3A 4AJ6A 3LEFA 1EGOA 5IO0A 4K8MA 2ON7A 3TUEA 3KH7A 1NHOA 4LMWA 3GIXA 6GSWA 3UMAA 4XS4B 4ZL9A 2DSAA 1S3CA 2CX3A 1NSWA 1QGVA 1H4OA 3KTLA 3QR6A 1GSSA 5HR2A 2CX4A 2H1DA 4MJBA 20GSA 5G1KA 2PWJA 1QFNA 1V98A 3MNGA 4AGSA 3DMLA 5ECSA 2YV7A 2OBIA 5CRGA 2JSYA 2VL2A 4WEYA 1M2DA 1XWGA 1TKDB 1FB0A 2ZNMA 4Q5QA 2OJLA 3GHAA 4TW5A 6GSYA 4G9HA 2FD3A 2N5BA 2IMDA 2H6YA 3IPZA 1TXXA 10GSA 1JZRA 3VWWA 3IOSA 5AN1A 3TKSE 3IRAA 1PN9A 3L9SA 5ECIB 5D73A 3US3A 4FO5A 4OO5A 3EU3A 1EOGA 1W4VA 1ERWA 1KBNA 2IFQA 2MMZA 1HQOA 3GX0A 2FWGA 3C7MA 2MBSA 3F0IA 5KN0A 3IC4A 1MDIA 4TXOB 3RHBA 4F9ZA 2B7KA 4O32A 3ZVJA 3F63A 4PURA 4MJEA 3UIWA 4NPBA 2PU9C 3FY7A 1Z7PA 4F0CA 2OADA 5G31A 4ZXGA 3TCOA 5GAPD 5FT3A 2VM2A 3LXTA 4K2DA 4LL4B 5B8BA 1TW9A 5COHA 5CRWA 1OC9B 3PH9A 4WETA 1AXDA 4KCEA 5IM9A 4MZCA 3GSTA 1OVNA 4X43A 2YOIA 2HZFA 3Q74A 2LUSA 5DAKA 1U3AA 3I9V2 1OAZA 2C0FA 1KEBA 2R5GA 1B8XA 4E8HA 3F4TA 1Q98A 2LRTA 3ISOA 2GSSA 3IK7A 5CAXA 2YN1A 1AAZA 4ZL7A 4HU9A 2XBQA 3ERFA 3UBKA 3UVTA 4NAXA 4TKYA 5A4VA 1AQXA 1ZZYA 2M46A 4ZIJA 1SENA 4GCIA 2GSQA 3PR8A 4BL7A 1A2LA 2IJYA 2GQLA 5CREA 4TXVA 2LTKA 1GP1A 2PPTA 3CYNA 4GLTA 2VO4A 1A24A 2L6CA 4DSSA 1ERTA 1TRSA 2R2JA 4HQSA 5B8AA 3GFKA 5INYA 3MSZA 1XBSA 4WXTA 5ECOB 1BAYA 6GSSA 1PX6A 2A4VA 3CRTA 2LNSA 12GSA 4ZB9A 5F07A 1VRSD 1O85A 1HD2A 4MH2A 1V2AA 5H5SA 4BWQA 4K7NA 2GVPA 4J57E 4CW9A 2LJAA 3GX8A 2XC2A 1T7PB 2E7PA 3GTUA 3IE3A 3KMOA 2R3XA 4IJ3A 1Q4JA 1R5PA 4F2IA 2CQ9A 2RM5A 3L78A 4GTUA 2N5AA 3FRCA 1J08A 2YJHA 2JSZA 1BYEA 2CVKA 2YWOA 5C04A 1DUGA 1SK2A 3C8EA 5IMZA 2K9FA 4RUVA 5ECQB 4MPFA 2GZPA 1ST9A 1Z3EA 3APQA 3GH6A 3LWAA 3WGXA 3ZZXA 2QGVA 3W8SA 2H73A 1M9BA 1YKCA 3RHCA 2XPDA 2K8SA 3QAWA 2A2SA 3GRXA 1O7UA 2HLSA 2FGXA 4IW9A 2E0QA 2C3QA 3FZ9A 4DSSB 2DJ0A 4PUFC 2YWIA 1V57A 2KP1A 3QAGA 1WIKA 4OFMA 1GLPA 4V2MA 3TOTA 1ZCPA 4WBJA 4KH7A 4BA7A 4GQFA 7GSSA 1G6YA 1QXHA 4YAPA 2YZHA 4EDYA 1JZWA 1K3LA 1B48A 3ZRDA 1THXA 2NTOA 3QCPA 3FYGA 1Y25A 2ON5A 5DJLA 1PKZA 4JEDA 4TRXA 3H93A 3J7Yb 1PSQA 4MF7A 4KW6A 3EMXA 4CDOA 1EOHA 3LQ7A 3GKKA 1R7HA 4XCSA 2GZYA 2YANA 3GL5A 2AJQB 3TJFA 2N5FA 2K8VA 5D9WA 4PNFA 2P5QA 2LKUA 2L4QA 5G5EA 4K7OA 3A2VA 2WJUA 3GURA 1F9MA 3BCIA 2H66A 3D4MA 1G0TA 3F6DA 4KUNA 1XW9A 2FWFA 5JCUA 5IMVA 3BCKA 1ML6A 1T1VA 16GSA 4N0VA 5HR1A 1YDKA 1JLWA 1EZKA 1T3BA 3IK9A 4MF5A 1Y6EA 3NIVA 4YH2A 2TRXA 4I97A 5ECLB 4YQMA 3ME7A 3TJKA 2X8HA 2CZ2A 3F3RA 3HVVA 1XWKA 2EC4A 4DSQA 2KLXA 5ECPB 5B6MA 5DJMA 19GSA 3P8WA 3ED3A 4JU5A 2L5OA 3GYKA 1BQ7A 2O87A 5IPHA 3RPPA 4LL1B 4NXIA 4KGIA 2VCXA 2VIMA 4MA9A 4XIHA 1ACVA 4OD7A 3M3MA 22GSA 5FHIA 5D9TA 5IQYA 1XWCA 2XHFA 4ZBDA 4WKWA 2KHPA 1GRXA 1RK4A 1SKRB 1FAAA 2YJ7A 3I69A 4PUAA 2H6XA 4IBPA 3H1NA 4GSNA 3M0FA 2PGTA 5D93A 5IO2A 1AQVA 1YF1A 3G7YA 3ZFLA 3DVWA 1FVKA 1TRUA 1S3AA 3IHQA 4X1UA 2GSTA 2NVLA 2LJKA 5AIVA 3FK8A 4D73A 4EO3A 4IVFA 3VLNA 4TR3A 1WJKA 2C4JA 3KXOA 1J9BA 1QMVA 5CRHA 2H76A 6GSUA 2MBTA 1USBA 1M7TA 1OKTA 2V32A 3KP9A 3GKMA 4JE1A 2IIYA 3A2WA 1SKWB 1DBYA 2HRFA 3LFLA 2FUG2 2K18A 5F06A 3H4KA 3Q6OA 1HYUA 1O6JA 3IBHA 2LSTA 3UOMA 3E3EA 3ERWA 4EE0A 3LYPA 3WT1A 2XPEA 3D21A 1DE1A 4TR1A 3R2QA 3FR3A 5FWGA 3QDNA 3UEMA 3L9UA 4MH3A 3O6TA 3WD6A 4K9ZA 2M80A 3LJRA 2JACA 2KOKA 3M8NA 1TRWA 3L4NA 2RLIA 4J56E 4PNGA 4K7IA 3ZITA 2WB9A 3KP8A 4KA0A 4Q5RA 3D0ZA 4NV5A 1HNBA 3N9JA 4GQCA 3UJ1A 4WR4A 3CBUA 3F9UA 3VWVA 1BEDA 2H19A 1HNCA 2VLTA 4K0NA 1F3BA 1WWJA 2H1BA 3JCML 2JZTA 4PQ1A 1XW6A 1SL2B 2WDUA 2X8CA 5ID2B 1OC3A 3F3QA 2HE3A 3BOAA 2C0GA 2YP6A 4MP4A 2FWHA 3ERGA 4JZQA 1O81A 2E2MA 4LA1A 3ZREA 1K0BA 3VPQA 1U6TA 5EL8A 1GTUA 4MLYA 1ERUA 5J9CA 3GKXA 4OCEA 1XVQA 1K3OA 2LRNA 4TR1B 1A0RP 4YQVA 1UA5A 1JZDA 2JU5A 3QFAC 3DVXA 2EIRA 1R5AA 3PGTA 2LNTA 2OE3A 4FH8A 3QOUA 2OBKA 4TOPA 1JLVA 1VGLA 4GXZA 2HI7A 1XWAA 4L0UA 2BJXA 2YWNA 4EF0A 4LMVA 1U87A 1H75A 4AF2A 3TJGA 2J23A 2V6OA 3HY2A 4GSSA 1SJZA 4NHZA 2LJRA 3VK9A 1HNAA 4EUYA 2NPBA 2J9HA 2IMIA 5J5NA 3LG6A 3D22A 5IPGA 1TDIA 2HSYA 4ZILA 5JCGA 1FB6A 2P5RA 4NMUA 1X5DA 3ZL5A 3IXRA 2EIOA 6GSXA 1VF1A 2LEGA 4MMMA 4HDEA 2IFQB 1K0AA 4JR6A 1IYIA 2DMLA 3BBYA 3KM6A 2H0HA 1AIUA 1CQHA 3M1GA 2VOCA 2B7JA 4POBA 3ZLPA 6GSVA 3UL3A 3ZMLA 3QMXA 2H75A 4I5QA 2VL3A 3Q19A 4F03A 3NOFA 5J41A 1Z7RA 2YZUA 1FVJA 1U88A 3AY8A 3EYTA 3O3TA 5D9VA 3P2AA 2LS5A 4ILFA 1SJIA 3TKPA 1FO5A 2JZSA 3TKRA 1EP8A 5A4UA 2DJKA 3FR6A 3GL3A 3KEBA 1W89A 3M9KA 1ABAA 1M99A 1A2MA 1UC7A 3HYPA 5DAKB 1YKAA 3LXZA 4OWYA 4X0XA 4XS1A 3A3TA 3LGCA 2JL4A 1PQNA 2CAIA 1WP0A 1GNWA 2OE1A 3KCMA 2FA4A 4K1FA 1K0OA 2OA7A 4AJ8A 4QQ7A 2ALBA 1MDKA 3BJ5A 2C0EA 1O73A 5B6NA 2FCHA 3M9JA 3APOA 17GSA 5HFKA 2GTUA 5JCWA 4ECBA 3BD2A 4POMA 2Z9SA 3N5OA 2H0IA 2WFCA 1I9DA 4HOJA 2YWMA 2WRTA 4ISDA 5JWOB 2IMKA 1GTAA 3D5JA 4Q5FA 3IAM2 2RUEA 4DSRA 4KDXA 4TR0A 13GSA 5F0GA 3OR5A 4ID0A 2GQMA 3RAZA 2H70A 1A2JA 3F6FA 3WGDA 3KZQA 1A8LA 4PX1A 3F8UA 2MMAA 3CXGA 1K3YA 1F6MC 2VCQA 1TP9A 4I8BA 3G7IA 1TTZA 2QC7A 4ACSA 3HVSA 1GNEA 2FWEA 4OMVA 4KE3A 1SYXA 1O8WA 3I43A 2F3MA 1FOVA 1GL8A 3DWVA 4WBRD 3QD9A 4RI6A 5KEJA 4FIWA 2P0GA 3GTUB 4ECJA 3APSA 3G7JA 3H8QA 4WF5A 4MDCA 2LV3A 4HZ4A 1ERVA 5DQYA 3FHKA 4O92A 3IDVA 4GWRA 1TOFA 2GLRA 5ELAA 1TK8B 3DGQA 3CMIA 4I2UA 1YEXA 1XFLA 5F05A 2AUVA 1E6BA 3D6IA 1TU7A 1EV9A 3F4RA 2LQQA 2C8UA 2OKAA 1GUMA 3HZ8A 1ON4A 3ZMKA 4IHUA 1VF3A 5IOXA 4RQRA 5DALA 1PGTA 3DEXA 1G7OA 5E4WA 4EDZA 4NHWA 1OYJA 3CSIA 1XVWA 4OFNA 3IA1A 5A5KA 1MD4A 3KTBA 2AB6A 3S9FA 2GT5A 3FZ4A 4JBBA 2DJ1A 5B7CA 3TKSA 3QPMA 2H6ZA 3NZNA 2O89A 2VLUA 1ZL9A 3TRQA 5DDLA 1IYHA 5J4UA 2IWTA 1V9WA 4F82A 1JFUA 4IJIA 1N2AA 2H01A 3Q18A 1NHYA 4PQHA 5KN1A 4XS4A 2TIRA 4P3YB 2IMFA 4RI7A 5IIZA 1XOAA 2PVQA 3TB2A 1N8JA 4IP6A 2VCWA 1LBKA 2IL3A 1MDJA 11GSA 1A8YA 5GZZB 1AC1A 1PRXA 2C0DA 5GAND 2QSIA 2HT9A 3J7Yk 6GSTA 4IELA 4G10A 1Z5YE 3D4TA 3KGKA 1SJ6A 2I3YA 2C3TA 4J2FA 5DALB 1C72A 2A2RA 4XTSA 4EC0A 1FG4A 1XIYA 4ZL8A 3F4SA 5G5FA 5ECMB 3MDKA 2L4CA 2PN8A 3KMNA 1X9WB 3SBCA 2GS3A 4EVMA 4HZ2A 1YEPA 4IP1A 3UVHA 2BMXA 1U3IA 5HFGA 2JZRA 4KNDA 5AIXA 3ZIJA 8GSSA 2C1YA 3GKNA 2FHEA 4HEA2 2GQKA 3FKFA 3GA4A 4NV2A 4BVXA 2R4VA 3C1SA 1XWBA 4NWYA 2GGTA 2WULA 3GH9A 3VURA 5CNWA 2LRCA 4K6XA 4N30A 1T4ZA 3DD3A 2IMEA 3IR4A 2CT6A 2F8AA 1G6WA 3DKSA 4TXOA 4FYBA 3ZVJD 1EEJA 2I81A 1S3DA 2GT6A 3ZYWA 3TOUA 1WPIA 3KJYA 2V2GA 2MMNA 1PKWA 1YJ6A 4MJCA 2X99A 3HJPA 1BJXA 1BG5A 1VF4A 3CRUA 4O5RA 2L57A 1WOUA 1OC9A 5HFIA 2YV9A 4D73B 2V41A 2QKEA 2DJJA 2H1GA 5DBQA 3HJOA 4IQAA 4OO4A 3TRPA 5DVBA 4ML6A 1O8XA 2ZCTA 1XOBA 1X9SB 2DC5A 4V1Ap 3KH9A 1GTBA 4FYUA 1G7EA 1B4PA 2H71A 4G19A 2HXKA 1JHBA 2CVBA 2H0GA 5GSTA 4HU7A 2MYGA 4K0GA 2L59A 2REMA 1A0FA 2XBIA 1LJRA 1X5CA 4KAEA 1GSEA 4ECIA 1TI3A 3HDCA 2B1LA 2WS2A 3EINA 2GZZA 4L5OA 2VCTA 1VF2A 4KDYA 5DCGA 4V1Ag 3FEUA 5IMAA 4GF0A 5EY6A 1MD3A 1XPVA 1OKDA 3WT2A 1B9XC 2VUPA 2O85A 1EGRA 3GSSA 5G30A 1URMA 1GUKA 1TK5B 2AAWA 1PL1A 2F9SA 4TR4A 3LYKA 1GH2A 4IS0A 2CV4A 1WMJA 2PBJA 3IAS2 1NM3A 2E2GA 3E9JB 4LLRA 3TDGA 3GUSA 3GMFA 1EEMA 2VD1A 2I4AA 3UAPA 3CTGA 3QFBC 2M72A 3KD0A 3ZFBA 5E59A 4BPYA 4BVYA 4RQXA 5CO3A 3V1WA 1Z6NA 4ZBAA 1ZMAA 1R4WA 1TK0B 3HXSA 2L5LA 3ME8A 2P31A 3C71A 2F8FA 2G2QA 1K0MA 1PL2A 1PD21 3FZAA 2C3NA 1FHEA 2GSRA 1SU9A 2RM6A 1EWXA 3U6VA 1CQGA 2R37A 1FW1A 1ZGNA 2WGRA 2DBCA 1QQ2A 1YY7A 4EKZA 3A5WA 2VCZA 2DMMA 5AGYA 1PA3A 4MZBA 1PMTA 1OE7A 1M2AA 3TJBA 3UBLA 2AHEA 3CSJA 2OACA 1A23A 4MPGA 1SD8A 4GRFA 4ML1A 4O7HA 4MK3A 3H79A 2WZ9A 5D8IA 2H74A 2K6VA 1E2YA 2VD0A 1QUWA 5ABRA 2LQOA 2RUFA 4HQZA 1GSYA 3VFIA 4JRRA 4QL7A 2O7KA 4ZBBA 5ECRB 1I5GA 1WE0A 4KSOA 1OE8A 2DIYA 3HKRA 5F8BA 2VL9A 3RDWA 3EC3A 3DIEA 2D2ZA 4HJMA 2V6KA 4OFTA 3FW2A 4L5LA 1SKSB 2R6KA 3LSZA 18GSA 1ZYEA 3C1RA 4G2EA 3KIJA 3HVXA 1M0UA 4CHSA 3TRXA 1KNGA 1LU4A 2GDRA 4ULXA 4MZWA 3I6AA 14GSA 3VPTA 3CSHA 1KTEA 1GSQA 2B3SA 4HUAA 5ENUA 5KN3A 2FY6A 2H1AA 3TKQA 5H5QA 1T8EB 1B9YC 1GTIA 3CTFA 1K0DA 4YQUA 2YCDA 1ILOA 4TVEA 2KUCA 4KX4A 2B6MA 5LCZA 4AJ7A 1GSFA 3WGEA 2FA8A 3DXBA 3G9BA 4KB3A 1M2BA 4DEJA 2CA8A 4XRDA 2I1UA 5CP1A 4PGTA 3EU4A 4KDUA 3ZIVA 1EV4A 1B4QA 1ZOFA 1K0NA 5EVOA 1TI1A 1K0CA 3P7XA 2BTOT 3DRNA 2C80A 1V40A 2TRCP 1AUCA 4N0ZA 2CAQA 5EPFA 5G1LA 2DIZA 1WRYA 2NBSA 3EURA 4POLA 3HZ4A 2H30A 4TN8A 2WCIA 3EE2A 2AYTA 4I2TA 3W8JA 2MMOA 2B5YA 2RIIA 3TKSC 5DQSA 5ECNB 4KCAA 1X9MB 3VI7A 5LD0A 2YNXA 2G0FA 2YPMA 3TJJA 3E0UA 1JZOA 1TRVA 2B1KA 2NDOA 4ZB8A
chains in the Genus database with same CATH superfamily
5HQPA 9GSSA 2FLSA 5C00A 1GWCA 4MJAA 2PVOC 3TGZA 3GN3A 2IN3A 3GV1A 1T00A 1Z6MA 4EL1A 1XXUA 5IMCA 4Z7XA 2H8LA 4N11A 2VLVA 1YQ1A 3WYWA 2L6DA 3A2XA 4XHMA 4MF6A 2B5EA 2CZ3A 4L8EA 4IKHA 1RW1A 2KP2A 4FYCA 2I9HA 5IOWA 4PXOA 1GSUA 1F37A 3IC8A 5D96A 5G2ZA 5CRDA 1ZYQB 5ECKB 5DCHA 5HR0A 5CYYA 2HRAA 3L0HA 1RQMA 5HR3A 1AW9A 4HS1A 1V58A 3U5RE 4CY8A 4QL9A 2X64A 2CVDA 2PERA 5JWRB 1UVZA 1SK1A 4V2NA 1GLQA 3EWLA 3GNJA 2HZEA 3HJMA 4HJ2A 4IQ1A 5A4WA 2O8VB 2VCVA 3FR9A 5H5RA 1R26A 1X0RA 2F51A 2DLXA 3EVIA 1YZXA 1MTCA 3EMPA 4HI7A 3P90A 2IPAA 1EP7A 2HNLA 5GSSA 5ECHB 4KSMA 5D9XA 1SL0B 5KN2A 4I6XA 4DVCA 4MABA 1YF0A 1QK8A 5ELGA 3UARA 1X5EA 4ZB6A 3W6GA 5AISA 1T4YA 3RPNA 1UN2A 1SYRA 2JADA 2AV4A 2DJ2A 4PQIA 2EIQA 5J3RA 1OC8A 1XZOA 5JWQB 4F0BA 2VAFA 4N10A 1XW5A 1GSDA 4BWSA 4GSTA 4MCUA 2HFDA 3DYRA 3O76A 4XRAA 3SWLA 4YAVA 1MEKA 1GULA 1AQWA 3MWHA 3L9VA 3VWXA 2FNOA 1J0FA 1DE2A 1TJDA 3HD5A 3RBTA 2VM1A 1XCCA 1SD9A 2MZCA 1GUHA 1F2EA 4G0KA 3MAKA 1NW2A 3HHVA 2X8GA 3PINA 4ECCA 2HYXA 3LORA 2HZEB 4POKA 1THOA 1M9AA 3FMWA 1DSBA 2ZUPA 2HSHA 1Z9HA 1TU8A 1F3AA 2VL2C 5J9BA 1PX7A 3C73A 4H86A 1SK0A 2PMTA 4JR4A 4V2LA 5IMDA 4IGJA 3HA9A 5L71A 5IMFA 2B5XA 4L0WA 2H72A 4WF4A 4XS6A 4E8EA 2ES7A 1BX9A 3IV4A 4IN0A 2OE0A 2V1MA 3ZTLA 4Q5NA 3VWUA 5KOWA 4WR5A 3FZ5A 3K8NA 2PUKC 3VI5A 5ID2A 5LNKe 4EXJA 1SL1B 3HCZA 4OCFA 3QAVA 2HRNA 2DJ3A 4AJ6A 3LEFA 1EGOA 5IO0A 4K8MA 2ON7A 3TUEA 3KH7A 1NHOA 4LMWA 3GIXA 6GSWA 3UMAA 4XS4B 4ZL9A 2DSAA 1S3CA 2CX3A 1NSWA 1QGVA 1H4OA 3KTLA 3QR6A 1GSSA 5HR2A 2CX4A 2H1DA 4MJBA 20GSA 5G1KA 2PWJA 1FOHA 1QFNA 1V98A 3MNGA 4AGSA 3DMLA 5ECSA 2YV7A 2OBIA 5CRGA 2X49A 4HSCX 2JSYA 2VL2A 4WEYA 1M2DA 1XWGA 1TKDB 1FB0A 2ZNMA 4Q5QA 2OJLA 4EIPA 3GHAA 4TW5A 6GSYA 4G9HA 2FD3A 2N5BA 2IMDA 2H6YA 3IPZA 1TXXA 10GSA 1JZRA 3VWWA 3IOSA 5AN1A 3TKSE 3IRAA 1PN9A 4K5SA 3L9SA 5ECIB 3R3EA 5D73A 3US3A 4FO5A 4OO5A 3EU3A 1EOGA 1W4VA 1ERWA 1KBNA 2IFQA 2MMZA 1HQOA 3GX0A 2FWGA 3LW9A 3C7MA 2MBSA 3F0IA 5KN0A 3IC4A 1MDIA 4TXOB 3RHBA 4F9ZA 2B7KA 3MIXA 4O32A 3ZVJA 3F63A 4PURA 4MJEA 3UIWA 4NPBA 2PU9C 3FY7A 1Z7PA 4F0CA 2OADA 5G31A 4ZXGA 3TCOA 5GAPD 5FT3A 2VM2A 3LXTA 4K2DA 4LL4B 5B8BA 1TW9A 5COHA 5CRWA 1OC9B 3PH9A 4WETA 1AXDA 4KCEA 5IM9A 4MZCA 3GSTA 1OVNA 4X43A 2YOIA 2HZFA 3Q74A 2LUSA 5DAKA 1U3AA 4O5QA 3I9V2 1OAZA 2C0FA 1KEBA 2R5GA 1B8XA 4E8HA 3F4TA 1Q98A 2LRTA 3ISOA 4YKFA 2GSSA 3IK7A 5CAXA 2YN1A 1AAZA 4ZL7A 4HU9A 2XBQA 3ERFA 3UBKA 3UVTA 4NAXA 4TKYA 5A4VA 1AQXA 1ZZYA 2M46A 4ZIJA 1SENA 4GCIA 2GSQA 3PR8A 4BL7A 1A2LA 2IJYA 2GQLA 5CREA 4TXVA 2LTKA 1GP1A 2PPTA 3CYNA 4GLTA 2VO4A 1A24A 2L6CA 4DSSA 1ERTA 1TRSA 2R2JA 4HQSA 5B8AA 3GFKA 5INYA 3MSZA 1XBSA 4WXTA 5ECOB 1BAYA 6GSSA 1PX6A 2A4VA 3CRTA 4BVYB 2LNSA 12GSA 4ZB9A 5F07A 1VRSD 1O85A 1HD2A 4MH2A 1V2AA 5H5SA 4BWQA 4K7NA 2GVPA 4J57E 4CW9A 2LJAA 3GX8A 2XC2A 1T7PB 2E7PA 3GTUA 3IE3A 3KMOA 2R3XA 4IJ3A 1Q4JA 1R5PA 4F2IA 2CQ9A 2RM5A 3L78A 4GTUA 2N5AA 3FRCA 1J08A 3MYDA 2YJHA 2JSZA 1BYEA 2CVKA 2YWOA 5C04A 1DUGA 1SK2A 3C8EA 5IMZA 2K9FA 4RUVA 5ECQB 4MPFA 2GZPA 1ST9A 1Z3EA 3APQA 3GH6A 3LWAA 3WGXA 3ZZXA 2QGVA 3W8SA 2H73A 1M9BA 1YKCA 3RHCA 2XPDA 2K8SA 3QAWA 2A2SA 3GRXA 1O7UA 2HLSA 2FGXA 4IW9A 2E0QA 2C3QA 3FZ9A 4DSSB 2DJ0A 4PUFC 2YWIA 1V57A 2KP1A 3QAGA 1WIKA 4OFMA 1GLPA 4V2MA 3TOTA 1ZCPA 4WBJA 5KOXA 4KH7A 4BA7A 4GQFA 7GSSA 1G6YA 1QXHA 4YAPA 2YZHA 4EDYA 1JZWA 1K3LA 1B48A 3ZRDA 1THXA 2NTOA 3QCPA 3FYGA 1Y25A 2ON5A 5DJLA 1PKZA 4JEDA 4TRXA 3H93A 3J7Yb 1PSQA 4MF7A 4KW6A 3EMXA 4CDOA 1EOHA 3LQ7A 3GKKA 1R7HA 4XCSA 2GZYA 2YANA 3GL5A 2AJQB 3TJFA 2N5FA 2K8VA 5D9WA 4PNFA 2P5QA 2LKUA 2L4QA 5G5EA 4K7OA 3A2VA 3A5IA 2WJUA 3GURA 1F9MA 3BCIA 2H66A 4KF9A 3D4MA 1G0TA 3F6DA 4KUNA 1XW9A 2FWFA 5JCUA 5IMVA 3BCKA 4FQUA 1ML6A 1T1VA 16GSA 4N0VA 5HR1A 1YDKA 1JLWA 1EZKA 1T3BA 3IK9A 4MF5A 1Y6EA 2HRKA 3NIVA 4YH2A 2TRXA 1XG8A 4I97A 5ECLB 4YQMA 3ME7A 3TJKA 2X8HA 2CZ2A 3F3RA 3HVVA 1XWKA 2EC4A 4DSQA 2KLXA 1M3JA 5ECPB 5B6MA 5DJMA 19GSA 3P8WA 3ED3A 4JU5A 2L5OA 3GYKA 1BQ7A 2O87A 5IPHA 4A5PA 3RPPA 4LL1B 4NXIA 4KGIA 2VCXA 2VIMA 4MA9A 4XIHA 1ACVA 4OD7A 3M3MA 22GSA 5FHIA 5D9TA 5IQYA 1XWCA 2XHFA 4ZBDA 4WKWA 2KHPA 1GRXA 1RK4A 1SKRB 1FAAA 2YJ7A 3I69A 4PUAA 2H6XA 4IBPA 3H1NA 4GSNA 3M0FA 2PGTA 5D93A 5IO2A 1AQVA 1YF1A 3G7YA 3ZFLA 3DVWA 1FVKA 1TRUA 1S3AA 3IHQA 4X1UA 2GSTA 2NVLA 4X4JA 2LJKA 5AIVA 3FK8A 4D73A 4EO3A 4IVFA 3VLNA 4TR3A 1WJKA 2C4JA 3KXOA 1J9BA 1QMVA 5CRHA 2H76A 6GSUA 2MBTA 2DKIA 1USBA 1M7TA 2QA1A 3HVNA 1OKTA 2V32A 3KP9A 3GKMA 4JE1A 2IIYA 3A2WA 1SKWB 1DBYA 2HRFA 3LFLA 2FUG2 4Z2RA 2K18A 5F06A 3H4KA 3Q6OA 1HYUA 1O6JA 3IBHA 2LSTA 3UOMA 3E3EA 3ERWA 4EE0A 3LYPA 3WT1A 2XPEA 3D21A 1DE1A 4TR1A 3R2QA 3FR3A 5FWGA 3QDNA 3PPUA 3UEMA 3L9UA 4MH3A 3O6TA 3WD6A 4K9ZA 2M80A 3LJRA 2JACA 2KOKA 3M8NA 1TRWA 3L4NA 2RLIA 4J56E 4PNGA 4K7IA 3ZITA 2WB9A 3KP8A 4KA0A 4Q5RA 3D0ZA 4NV5A 1HNBA 3N9JA 4GQCA 3UJ1A 4WR4A 3CBUA 3F9UA 3VWVA 1BEDA 2H19A 1HNCA 2VLTA 4K0NA 1F3BA 1WWJA 2H1BA 3JCML 2JZTA 2X4AA 4PQ1A 3IHGA 1XW6A 1SL2B 2WDUA 2X8CA 5ID2B 1OC3A 3F3QA 2HE3A 3BOAA 2C0GA 2YP6A 4MP4A 2FWHA 3ERGA 4JZQA 1O81A 2E2MA 4LA1A 3ZREA 1K0BA 3VPQA 1U6TA 5EL8A 1GTUA 4MLYA 1ERUA 5J9CA 3GKXA 1ZYNA 4OCEA 1XVQA 1K3OA 2LRNA 4TR1B 1A0RP 4YQVA 1UA5A 1JZDA 2JU5A 3QFAC 3DVXA 2EIRA 1R5AA 3PGTA 5BRTA 2LNTA 2OE3A 4FH8A 4MNNA 3QOUA 2OBKA 4TOPA 1JLVA 1VGLA 4GXZA 2HI7A 1XWAA 4L0UA 2BJXA 2YWNA 4EF0A 4LMVA 1U87A 1H75A 4AF2A 3TJGA 2J23A 2V6OA 3HY2A 4GSSA 2R0CA 1SJZA 4NHZA 2LJRA 3VK9A 1HNAA 4EUYA 2NPBA 2J9HA 2IMIA 5J5NA 3LG6A 3D22A 2A4HA 5IPGA 1TDIA 2HSYA 4ZILA 5JCGA 1FB6A 2P5RA 4NMUA 1X5DA 3ZL5A 3IXRA 2EIOA 6GSXA 1VF1A 2LEGA 2QA2A 4MMMA 4HDEA 2IFQB 1K0AA 4JR6A 1IYIA 2DMLA 3BBYA 3KM6A 2H0HA 1AIUA 1CQHA 3M1GA 2VOCA 2B7JA 4POBA 3ZLPA 6GSVA 1ZYPA 3UL3A 3ZMLA 3QMXA 2H75A 4I5QA 2VL3A 3Q19A 4F03A 3NOFA 5J41A 1Z7RA 2YZUA 1FVJA 1U88A 3AY8A 3EYTA 3O3TA 5D9VA 3P2AA 2LS5A 4ILFA 1SJIA 3TKPA 1FO5A 2JZSA 3TKRA 1EP8A 5A4UA 2DJKA 3FR6A 3GL3A 3KEBA 1W89A 3M9KA 1ABAA 1M99A 1A2MA 1UC7A 3HYPA 5DAKB 1YKAA 3LXZA 2DKHA 4OWYA 4X0XA 4XS1A 3A3TA 3LGCA 2JL4A 1PQNA 2CAIA 1WP0A 1GNWA 2OE1A 3KCMA 2FA4A 4K1FA 1K0OA 2OA7A 4AJ8A 4QQ7A 2ALBA 1MDKA 3BJ5A 2C0EA 1O73A 5B6NA 2FCHA 3M9JA 3APOA 17GSA 5HFKA 2GTUA 5JCWA 4ECBA 3BD2A 4POMA 2Z9SA 3N5OA 2H0IA 2WFCA 1I9DA 4HOJA 2YWMA 2WRTA 4ISDA 5JWOB 2IMKA 1GTAA 3D5JA 4Q5FA 4BL7B 3IAM2 2RUEA 4DSRA 4KDXA 4TR0A 13GSA 5F0GA 3OR5A 4ID0A 2GQMA 4Z2UA 3RAZA 2H70A 1A2JA 3F6FA 3WGDA 3KZQA 1A8LA 4PX1A 3F8UA 2MMAA 3CXGA 1K3YA 1F6MC 2VCQA 1TP9A 4I8BA 3G7IA 1TTZA 2QC7A 4ACSA 3HVSA 1GNEA 2FWEA 4OMVA 4KE3A 1SYXA 1O8WA 3I43A 2F3MA 1FOVA 1GL8A 3DWVA 4USSA 4WBRD 3QD9A 4RI6A 5KEJA 4FIWA 2P0GA 3GTUB 4ECJA 3APSA 3G7JA 3H8QA 1PN0A 4WF5A 4MDCA 2LV3A 4HZ4A 1ERVA 5DQYA 3FHKA 4O92A 3IDVA 4GWRA 1TOFA 2GLRA 5ELAA 1TK8B 3DGQA 3CMIA 4I2UA 1YEXA 1XFLA 2R0GA 5F05A 2AUVA 1E6BA 3D6IA 1TU7A 1EV9A 3F4RA 2LQQA 2C8UA 2OKAA 1GUMA 3HZ8A 1ON4A 3ZMKA 4IHUA 1VF3A 5IOXA 4RQRA 5DALA 1PGTA 3DEXA 1G7OA 5E4WA 4EDZA 4NHWA 1OYJA 3CSIA 1XVWA 4OFNA 3IA1A 5A5KA 1MD4A 3KTBA 2AB6A 3S9FA 2GT5A 3FZ4A 4JBBA 2DJ1A 5B7CA 3TKSA 3QPMA 2H6ZA 3NZNA 2O89A 2VLUA 4Z2TA 1ZL9A 3TRQA 5DDLA 4EIQA 1IYHA 5J4UA 2IWTA 1V9WA 4F82A 1JFUA 4IJIA 1N2AA 2H01A 3Q18A 1NHYA 4PQHA 5KN1A 4XS4A 2TIRA 4P3YB 2IMFA 5BMUA 4RI7A 5IIZA 1XOAA 2PVQA 3TB2A 1N8JA 4IP6A 2VCWA 1LBKA 2IL3A 1MDJA 11GSA 1A8YA 5GZZB 2A2PA 1AC1A 1PRXA 2C0DA 5GAND 2QSIA 2HT9A 3J7Yk 6GSTA 4IELA 4G10A 1Z5YE 3D4TA 3KGKA 1SJ6A 2I3YA 2C3TA 4J2FA 5DALB 1C72A 2A2RA 4XTSA 4EC0A 1FG4A 1XIYA 4ZL8A 3F4SA 5G5FA 5ECMB 3MDKA 2L4CA 2PN8A 3KMNA 1X9WB 3SBCA 2GS3A 4EVMA 4HZ2A 4K2XA 1YEPA 4IP1A 3UVHA 2BMXA 1U3IA 5HFGA 2JZRA 4KNDA 5AIXA 3ZIJA 8GSSA 2C1YA 3GKNA 2FHEA 4HEA2 2GQKA 3FKFA 4YKGA 3GA4A 4NV2A 4BVXA 2R4VA 3C1SA 1XWBA 4NWYA 2GGTA 2WULA 3GH9A 3VURA 5CNWA 2LRCA 4K6XA 4N30A 1T4ZA 2HSMA 3DD3A 2IMEA 3IR4A 2CT6A 2F8AA 1G6WA 3DKSA 1M3IA 2R0PA 4TXOA 4FYBA 3ZVJD 1EEJA 2I81A 4CY6A 1S3DA 2GT6A 3ZYWA 3TOUA 1WPIA 3KJYA 4PTSA 2V2GA 2MMNA 1PKWA 4O5UA 1YJ6A 4MJCA 2X99A 3HJPA 1BJXA 1BG5A 1VF4A 3CRUA 4O5RA 2L57A 1WOUA 1OC9A 5HFIA 2YV9A 4D73B 2V41A 2QKEA 2DJJA 2H1GA 5DBQA 3HJOA 4IQAA 4OO4A 3TRPA 5DVBA 4ML6A 1O8XA 2ZCTA 1XOBA 1X9SB 1PFOA 2DC5A 4V1Ap 3KH9A 1GTBA 4FYUA 1G7EA 1B4PA 2H71A 4G19A 2HXKA 1JHBA 2CVBA 2H0GA 5GSTA 4HU7A 2MYGA 4K0GA 2L59A 2REMA 1A0FA 2XBIA 1LJRA 1X5CA 4KAEA 1GSEA 4ECIA 1TI3A 3HDCA 2B1LA 2WS2A 3EINA 2GZZA 4L5OA 2VCTA 4BVXB 1VF2A 4KDYA 5DCGA 4V1Ag 4ICYA 3FEUA 5IMAA 4GF0A 5EY6A 4G0LA 1MD3A 1XPVA 1OKDA 3WT2A 4G0IA 1B9XC 2VUPA 2O85A 1EGRA 3GSSA 5G30A 1URMA 1GUKA 1TK5B 2AAWA 1PL1A 2F9SA 4TR4A 3LYKA 1GH2A 4IS0A 2CV4A 1WMJA 2PBJA 3IAS2 1NM3A 2E2GA 3E9JB 4LLRA 3TDGA 3GUSA 3GMFA 1EEMA 2UZ8A 2VD1A 2I4AA 3UAPA 3CTGA 3QFBC 2M72A 3KD0A 3ZFBA 5E59A 4BPYA 4BVYA 4RQXA 5CO3A 3V1WA 1Z6NA 4ZBAA 1ZMAA 1R4WA 1TK0B 3HXSA 2L5LA 3ME8A 2P31A 3C71A 2F8FA 2G2QA 1K0MA 1PL2A 1PD21 3FZAA 2C3NA 1FHEA 2GSRA 1SU9A 2RM6A 1EWXA 3U6VA 1CQGA 2R37A 1FW1A 1ZGNA 2WGRA 2DBCA 1QQ2A 1YY7A 4EKZA 3A5WA 2VCZA 2DMMA 5AGYA 1PA3A 4MZBA 1PMTA 1OE7A 1M2AA 3TJBA 3UBLA 2AHEA 3CSJA 2OACA 1A23A 4MPGA 4K5RA 1SD8A 4GRFA 4ML1A 4O7HA 4MK3A 3H79A 2WZ9A 5D8IA 2H74A 2K6VA 1E2YA 2VD0A 1QUWA 5ABRA 2LQOA 2RUFA 4HQZA 1GSYA 3VFIA 4JRRA 4QL7A 1S3RA 2O7KA 4ZBBA 5ECRB 1I5GA 1WE0A 4KSOA 1OE8A 2DIYA 3HKRA 5F8BA 2VL9A 3RDWA 3EC3A 3DIEA 2D2ZA 4HJMA 2V6KA 4OFTA 3FW2A 4L5LA 1SKSB 2R6KA 3LSZA 18GSA 1ZYEA 3C1RA 4G2EA 3KIJA 3HVXA 1M0UA 4CHSA 3TRXA 1KNGA 1LU4A 2GDRA 4ULXA 4MZWA 3I6AA 14GSA 3VPTA 3CSHA 1KTEA 1GSQA 2B3SA 4HUAA 5ENUA 5KN3A 2FY6A 2H1AA 3TKQA 5H5QA 1T8EB 1B9YC 1GTIA 3CTFA 1K0DA 4YQUA 2YCDA 1ILOA 4TVEA 4BIKA 2KUCA 4KX4A 2B6MA 5LCZA 4AJ7A 1GSFA 3WGEA 2FA8A 3DXBA 3G9BA 4KB3A 3EPTA 1M2BA 4DEJA 2CA8A 4XRDA 2I1UA 5CP1A 4PGTA 3EU4A 4KDUA 3ZIVA 1EV4A 1B4QA 1ZOFA 1K0NA 5EVOA 3CQFA 1TI1A 1K0CA 3P7XA 2BTOT 3DRNA 2C80A 1V40A 2TRCP 1AUCA 4N0ZA 2CAQA 5EPFA 5G1LA 2DIZA 1WRYA 2NBSA 3EURA 4POLA 3HZ4A 2H30A 4TN8A 2WCIA 3EE2A 2AYTA 4I2TA 3W8JA 2MMOA 2B5YA 2RIIA 3TKSC 5DQSA 5ECNB 4KCAA 1X9MB 3VI7A 5LD0A 2YNXA 2G0FA 2YPMA 3TJJA 3E0UA 1JZOA 1TRVA 2B1KA 2NDOA 4ZB8A
chains in the Genus database with same CATH topology
5HQPA 9GSSA 2FLSA 5C00A 1GWCA 4MJAA 2PVOC 3TGZA 3GN3A 2IN3A 3GV1A 1T00A 1Z6MA 4EL1A 1XXUA 5IMCA 4Z7XA 2H8LA 4N11A 2VLVA 1YQ1A 3WYWA 2L6DA 3A2XA 4XHMA 4MF6A 2B5EA 2CZ3A 4L8EA 4IKHA 1RW1A 2KP2A 4FYCA 2I9HA 5IOWA 4PXOA 1GSUA 1F37A 3IC8A 5D96A 5G2ZA 5CRDA 1ZYQB 5ECKB 5DCHA 5HR0A 5CYYA 2HRAA 3L0HA 1RQMA 5HR3A 1AW9A 4HS1A 1V58A 3U5RE 4CY8A 4QL9A 2X64A 2CVDA 2PERA 5JWRB 1UVZA 1SK1A 4V2NA 1GLQA 3EWLA 3GNJA 2HZEA 3HJMA 4HJ2A 4IQ1A 5A4WA 2O8VB 2VCVA 3FR9A 5H5RA 1R26A 1X0RA 2F51A 2DLXA 3EVIA 1YZXA 1MTCA 3EMPA 4HI7A 3P90A 2IPAA 1EP7A 2HNLA 5GSSA 5ECHB 4KSMA 5D9XA 1SL0B 5KN2A 4I6XA 4DVCA 4MABA 1YF0A 1QK8A 5ELGA 3UARA 1X5EA 4ZB6A 3W6GA 5AISA 1T4YA 3RPNA 1UN2A 1SYRA 2JADA 2AV4A 2DJ2A 4PQIA 2EIQA 5J3RA 1OC8A 1XZOA 5JWQB 4F0BA 2VAFA 4N10A 1XW5A 1GSDA 4BWSA 4GSTA 4MCUA 2HFDA 3DYRA 3O76A 4XRAA 3SWLA 4YAVA 1MEKA 1GULA 1AQWA 3MWHA 3L9VA 3VWXA 2FNOA 1J0FA 1DE2A 1TJDA 3HD5A 3RBTA 2VM1A 1XCCA 1SD9A 2MZCA 1GUHA 1F2EA 4G0KA 3MAKA 1NW2A 3HHVA 2X8GA 3PINA 4ECCA 2HYXA 3LORA 2HZEB 4POKA 1THOA 1M9AA 3FMWA 1DSBA 2ZUPA 2HSHA 1Z9HA 1TU8A 1F3AA 2VL2C 5J9BA 1PX7A 3C73A 4H86A 1SK0A 2PMTA 4JR4A 4V2LA 5IMDA 4IGJA 3HA9A 5L71A 5IMFA 2B5XA 4L0WA 2H72A 4WF4A 4XS6A 4E8EA 2ES7A 1BX9A 3IV4A 4IN0A 2OE0A 2V1MA 3ZTLA 4Q5NA 3VWUA 5KOWA 4WR5A 3FZ5A 3K8NA 2PUKC 3VI5A 5ID2A 5LNKe 4EXJA 1SL1B 3HCZA 4OCFA 3QAVA 2HRNA 2DJ3A 4AJ6A 3LEFA 1EGOA 5IO0A 4K8MA 2ON7A 3TUEA 3KH7A 1NHOA 4LMWA 3GIXA 6GSWA 3UMAA 4XS4B 4ZL9A 2DSAA 1S3CA 2CX3A 1NSWA 1QGVA 1H4OA 3KTLA 3QR6A 1GSSA 5HR2A 2CX4A 2H1DA 4MJBA 20GSA 5G1KA 2PWJA 1FOHA 1QFNA 1V98A 3MNGA 4AGSA 3DMLA 5ECSA 2YV7A 2OBIA 5CRGA 2X49A 2JSYA 2VL2A 4WEYA 1M2DA 1XWGA 1TKDB 1FB0A 2ZNMA 4Q5QA 2OJLA 4EIPA 3GHAA 4TW5A 6GSYA 4G9HA 2FD3A 2N5BA 2IMDA 2H6YA 3IPZA 1TXXA 10GSA 1JZRA 3VWWA 3IOSA 5AN1A 3TKSE 3IRAA 1PN9A 4K5SA 3L9SA 5ECIB 3R3EA 5D73A 3US3A 4FO5A 4OO5A 3EU3A 1EOGA 1W4VA 1ERWA 1KBNA 2IFQA 2MMZA 1HQOA 3GX0A 2FWGA 3LW9A 3C7MA 2MBSA 3F0IA 5KN0A 3IC4A 1MDIA 4TXOB 3RHBA 4F9ZA 2B7KA 3MIXA 4O32A 3ZVJA 3F63A 4PURA 4MJEA 3UIWA 4NPBA 2PU9C 3FY7A 1Z7PA 4F0CA 2OADA 5G31A 4ZXGA 3TCOA 5GAPD 5FT3A 2VM2A 3LXTA 4K2DA 4LL4B 5B8BA 1TW9A 5COHA 5CRWA 1OC9B 3PH9A 4WETA 1AXDA 4KCEA 5IM9A 4MZCA 3GSTA 1OVNA 4X43A 2YOIA 2HZFA 3Q74A 2LUSA 5DAKA 1U3AA 4O5QA 3I9V2 1OAZA 2C0FA 1KEBA 2R5GA 1B8XA 4E8HA 3F4TA 1Q98A 2LRTA 3ISOA 4YKFA 2GSSA 3IK7A 5CAXA 2YN1A 1AAZA 4ZL7A 4HU9A 2XBQA 3ERFA 3UBKA 3UVTA 4NAXA 4TKYA 5A4VA 1AQXA 1ZZYA 2M46A 4ZIJA 1SENA 4GCIA 2GSQA 3PR8A 4BL7A 1A2LA 2IJYA 2GQLA 5CREA 4TXVA 2LTKA 1GP1A 2PPTA 3CYNA 4GLTA 2VO4A 1A24A 2L6CA 4DSSA 1ERTA 1TRSA 2R2JA 4HQSA 5B8AA 3GFKA 5INYA 3MSZA 1XBSA 4WXTA 5ECOB 1BAYA 6GSSA 1PX6A 2A4VA 3CRTA 4BVYB 2LNSA 12GSA 4ZB9A 5F07A 1VRSD 1O85A 1HD2A 4MH2A 1V2AA 5H5SA 4BWQA 4K7NA 2GVPA 4J57E 4CW9A 2LJAA 3GX8A 2XC2A 1T7PB 2E7PA 3GTUA 3IE3A 3KMOA 2R3XA 4IJ3A 1Q4JA 1R5PA 4F2IA 2CQ9A 2RM5A 3L78A 4GTUA 2N5AA 3FRCA 1J08A 3MYDA 2YJHA 2JSZA 1BYEA 2CVKA 2YWOA 5C04A 1DUGA 1SK2A 3C8EA 5IMZA 2K9FA 4RUVA 5ECQB 4MPFA 2GZPA 1ST9A 1Z3EA 3APQA 3GH6A 3LWAA 3WGXA 3ZZXA 2QGVA 3W8SA 2H73A 1M9BA 1YKCA 3RHCA 2XPDA 2K8SA 3QAWA 2A2SA 3GRXA 1O7UA 2HLSA 2FGXA 4IW9A 2E0QA 2C3QA 3FZ9A 4DSSB 2DJ0A 4PUFC 2YWIA 1V57A 2KP1A 3QAGA 1WIKA 4OFMA 1GLPA 4V2MA 3TOTA 1ZCPA 4WBJA 5KOXA 4KH7A 4BA7A 4GQFA 7GSSA 1G6YA 1QXHA 4YAPA 2YZHA 4EDYA 1JZWA 1K3LA 1B48A 3ZRDA 1THXA 2NTOA 3QCPA 3FYGA 1Y25A 2ON5A 5DJLA 1PKZA 4JEDA 4TRXA 3H93A 3J7Yb 1PSQA 4MF7A 4KW6A 3EMXA 4CDOA 1EOHA 3LQ7A 3GKKA 1R7HA 4XCSA 2GZYA 2YANA 3GL5A 2AJQB 3TJFA 2N5FA 2K8VA 5D9WA 4PNFA 2P5QA 2LKUA 2L4QA 5G5EA 4K7OA 3A2VA 3A5IA 2WJUA 3GURA 1F9MA 3BCIA 2H66A 4KF9A 3D4MA 1G0TA 3F6DA 4KUNA 1XW9A 2FWFA 5JCUA 5IMVA 3BCKA 4FQUA 1ML6A 1T1VA 16GSA 4N0VA 5HR1A 1YDKA 1JLWA 1EZKA 1T3BA 3IK9A 4MF5A 1Y6EA 2HRKA 3NIVA 4YH2A 2TRXA 4I97A 5ECLB 4YQMA 3ME7A 3TJKA 2X8HA 2CZ2A 3F3RA 3HVVA 1XWKA 2EC4A 4DSQA 2KLXA 5ECPB 5B6MA 5DJMA 19GSA 3P8WA 3ED3A 4JU5A 2L5OA 3GYKA 1BQ7A 2O87A 5IPHA 4A5PA 3RPPA 4LL1B 4NXIA 4KGIA 2VCXA 2VIMA 4MA9A 4XIHA 1ACVA 4OD7A 3M3MA 22GSA 5FHIA 5D9TA 5IQYA 1XWCA 2XHFA 4ZBDA 4WKWA 2KHPA 1GRXA 1RK4A 1SKRB 1FAAA 2YJ7A 3I69A 4PUAA 2H6XA 4IBPA 3H1NA 4GSNA 3M0FA 2PGTA 5D93A 5IO2A 1AQVA 1YF1A 3G7YA 3ZFLA 3DVWA 1FVKA 1TRUA 1S3AA 3IHQA 4X1UA 2GSTA 2NVLA 4X4JA 2LJKA 5AIVA 3FK8A 4D73A 4EO3A 4IVFA 3VLNA 4TR3A 1WJKA 2C4JA 3KXOA 1J9BA 1QMVA 5CRHA 2H76A 6GSUA 2MBTA 2DKIA 1USBA 1M7TA 2QA1A 1OKTA 2V32A 3KP9A 3GKMA 4JE1A 2IIYA 3A2WA 1SKWB 1DBYA 2HRFA 3LFLA 2FUG2 4Z2RA 2K18A 5F06A 3H4KA 3Q6OA 1HYUA 1O6JA 3IBHA 2LSTA 3UOMA 3E3EA 3ERWA 4EE0A 3LYPA 3WT1A 2XPEA 3D21A 1DE1A 4TR1A 3R2QA 3FR3A 5FWGA 3QDNA 3PPUA 3UEMA 3L9UA 4MH3A 3O6TA 3WD6A 4K9ZA 2M80A 3LJRA 2JACA 2KOKA 3M8NA 1TRWA 3L4NA 2RLIA 4J56E 4PNGA 4K7IA 3ZITA 2WB9A 3KP8A 4KA0A 4Q5RA 3D0ZA 4NV5A 1HNBA 3N9JA 4GQCA 3UJ1A 4WR4A 3CBUA 3F9UA 3VWVA 1BEDA 2H19A 1HNCA 2VLTA 4K0NA 1F3BA 1WWJA 2H1BA 3JCML 2JZTA 2X4AA 4PQ1A 3IHGA 1XW6A 1SL2B 2WDUA 2X8CA 5ID2B 1OC3A 3F3QA 2HE3A 3BOAA 2C0GA 2YP6A 4MP4A 2FWHA 3ERGA 4JZQA 1O81A 2E2MA 4LA1A 3ZREA 1K0BA 3VPQA 1U6TA 5EL8A 1GTUA 4MLYA 1ERUA 5J9CA 3GKXA 1ZYNA 4OCEA 1XVQA 1K3OA 2LRNA 4TR1B 1A0RP 4YQVA 1UA5A 1JZDA 2JU5A 3QFAC 3DVXA 2EIRA 1R5AA 3PGTA 5BRTA 2LNTA 2OE3A 4FH8A 4MNNA 3QOUA 2OBKA 4TOPA 1JLVA 1VGLA 4GXZA 2HI7A 1XWAA 4L0UA 2BJXA 2YWNA 4EF0A 4LMVA 1U87A 1H75A 4AF2A 3TJGA 2J23A 2V6OA 3HY2A 4GSSA 2R0CA 1SJZA 4NHZA 2LJRA 3VK9A 1HNAA 4EUYA 2NPBA 2J9HA 2IMIA 5J5NA 3LG6A 3D22A 2A4HA 5IPGA 1TDIA 2HSYA 4ZILA 5JCGA 1FB6A 2P5RA 4NMUA 1X5DA 3ZL5A 3IXRA 2EIOA 6GSXA 1VF1A 2LEGA 2QA2A 4MMMA 4HDEA 2IFQB 1K0AA 4JR6A 1IYIA 2DMLA 3BBYA 3KM6A 2H0HA 1AIUA 1CQHA 3M1GA 2VOCA 2B7JA 4POBA 3ZLPA 6GSVA 1ZYPA 3UL3A 3ZMLA 3QMXA 2H75A 4I5QA 2VL3A 3Q19A 4F03A 3NOFA 5J41A 1Z7RA 2YZUA 1FVJA 1U88A 3AY8A 3EYTA 3O3TA 5D9VA 3P2AA 2LS5A 4ILFA 1SJIA 3TKPA 1FO5A 2JZSA 3TKRA 1EP8A 5A4UA 2DJKA 3FR6A 3GL3A 3KEBA 1W89A 3M9KA 1ABAA 1M99A 1A2MA 1UC7A 3HYPA 5DAKB 1YKAA 3LXZA 2DKHA 4OWYA 4X0XA 4XS1A 3A3TA 3LGCA 2JL4A 1PQNA 2CAIA 1WP0A 1GNWA 2OE1A 3KCMA 2FA4A 4K1FA 1K0OA 2OA7A 4AJ8A 4QQ7A 2ALBA 1MDKA 3BJ5A 2C0EA 1O73A 5B6NA 2FCHA 3M9JA 3APOA 17GSA 5HFKA 2GTUA 5JCWA 4ECBA 3BD2A 4POMA 2Z9SA 3N5OA 2H0IA 2WFCA 1I9DA 4HOJA 2YWMA 2WRTA 4ISDA 5JWOB 2IMKA 1GTAA 3D5JA 4Q5FA 4BL7B 3IAM2 2RUEA 4DSRA 4KDXA 4TR0A 13GSA 5F0GA 3OR5A 4ID0A 2GQMA 4Z2UA 3RAZA 2H70A 1A2JA 3F6FA 3WGDA 3KZQA 1A8LA 4PX1A 3F8UA 2MMAA 3CXGA 1K3YA 1F6MC 2VCQA 1TP9A 4I8BA 3G7IA 1TTZA 2QC7A 4ACSA 3HVSA 1GNEA 2FWEA 4OMVA 4KE3A 1SYXA 1O8WA 3I43A 2F3MA 1FOVA 1GL8A 3DWVA 4USSA 4WBRD 3QD9A 4RI6A 5KEJA 4FIWA 2P0GA 3GTUB 4ECJA 3APSA 3G7JA 3H8QA 1PN0A 4WF5A 4MDCA 2LV3A 4HZ4A 1ERVA 5DQYA 3FHKA 4O92A 3IDVA 4GWRA 1TOFA 2GLRA 5ELAA 1TK8B 3DGQA 3CMIA 4I2UA 1YEXA 1XFLA 2R0GA 5F05A 2AUVA 1E6BA 3D6IA 1TU7A 1EV9A 3F4RA 2LQQA 2C8UA 2OKAA 1GUMA 3HZ8A 1ON4A 3ZMKA 4IHUA 1VF3A 5IOXA 4RQRA 5DALA 1PGTA 3DEXA 1G7OA 5E4WA 4EDZA 4NHWA 1OYJA 3CSIA 1XVWA 4OFNA 3IA1A 5A5KA 1MD4A 3KTBA 2AB6A 3S9FA 2GT5A 3FZ4A 4JBBA 2DJ1A 5B7CA 3TKSA 3QPMA 2H6ZA 3NZNA 2O89A 2VLUA 4Z2TA 1ZL9A 3TRQA 5DDLA 4EIQA 1IYHA 5J4UA 2IWTA 1V9WA 4F82A 1JFUA 4IJIA 1N2AA 2H01A 3Q18A 1NHYA 4PQHA 5KN1A 4XS4A 2TIRA 4P3YB 2IMFA 5BMUA 4RI7A 5IIZA 1XOAA 2PVQA 3TB2A 1N8JA 4IP6A 2VCWA 1LBKA 2IL3A 1MDJA 11GSA 1A8YA 5GZZB 2A2PA 1AC1A 1PRXA 2C0DA 5GAND 2QSIA 2HT9A 3J7Yk 6GSTA 4IELA 4G10A 1Z5YE 3D4TA 3KGKA 1SJ6A 2I3YA 2C3TA 4J2FA 5DALB 1C72A 2A2RA 4XTSA 4EC0A 1FG4A 1XIYA 4ZL8A 3F4SA 5G5FA 5ECMB 3MDKA 2L4CA 2PN8A 3KMNA 1X9WB 3SBCA 2GS3A 4EVMA 4HZ2A 4K2XA 1YEPA 4IP1A 3UVHA 2BMXA 1U3IA 5HFGA 2JZRA 4KNDA 5AIXA 3ZIJA 8GSSA 2C1YA 3GKNA 2FHEA 4HEA2 2GQKA 3FKFA 4YKGA 3GA4A 4NV2A 4BVXA 2R4VA 3C1SA 1XWBA 4NWYA 2GGTA 2WULA 3GH9A 3VURA 5CNWA 2LRCA 4K6XA 4N30A 1T4ZA 2HSMA 3DD3A 2IMEA 3IR4A 2CT6A 2F8AA 1G6WA 3DKSA 4TXOA 2R0PA 4FYBA 3ZVJD 1EEJA 2I81A 4CY6A 1S3DA 2GT6A 3ZYWA 3TOUA 1WPIA 3KJYA 4PTSA 2V2GA 2MMNA 1PKWA 4O5UA 1YJ6A 4MJCA 2X99A 3HJPA 1BJXA 1BG5A 1VF4A 3CRUA 4O5RA 2L57A 1WOUA 1OC9A 5HFIA 2YV9A 4D73B 2V41A 2QKEA 2DJJA 2H1GA 5DBQA 3HJOA 4IQAA 4OO4A 3TRPA 5DVBA 4ML6A 1O8XA 2ZCTA 1XOBA 1X9SB 2DC5A 4V1Ap 3KH9A 1GTBA 4FYUA 1G7EA 1B4PA 2H71A 4G19A 2HXKA 1JHBA 2CVBA 2H0GA 5GSTA 4HU7A 2MYGA 4K0GA 2L59A 2REMA 1A0FA 2XBIA 1LJRA 1X5CA 4KAEA 1GSEA 4ECIA 1TI3A 3HDCA 2B1LA 2WS2A 3EINA 2GZZA 4L5OA 2VCTA 4BVXB 1VF2A 4KDYA 5DCGA 4V1Ag 4ICYA 3FEUA 5IMAA 4GF0A 5EY6A 4G0LA 1MD3A 1XPVA 1OKDA 3WT2A 4G0IA 1B9XC 2VUPA 2O85A 1EGRA 3GSSA 5G30A 1URMA 1GUKA 1TK5B 2AAWA 1PL1A 2F9SA 4TR4A 3LYKA 1GH2A 4IS0A 2CV4A 1WMJA 2PBJA 3IAS2 1NM3A 2E2GA 3E9JB 4LLRA 3TDGA 3GUSA 3GMFA 1EEMA 2UZ8A 2VD1A 2I4AA 3UAPA 3CTGA 3QFBC 2M72A 3KD0A 3ZFBA 5E59A 4BPYA 4BVYA 4RQXA 5CO3A 3V1WA 1Z6NA 4ZBAA 1ZMAA 1R4WA 1TK0B 3HXSA 2L5LA 3ME8A 2P31A 3C71A 2F8FA 2G2QA 1K0MA 1PL2A 1PD21 3FZAA 2C3NA 1FHEA 2GSRA 1SU9A 2RM6A 1EWXA 3U6VA 1CQGA 2R37A 1FW1A 1ZGNA 2WGRA 2DBCA 1QQ2A 1YY7A 4EKZA 3A5WA 2VCZA 2DMMA 5AGYA 1PA3A 4MZBA 1PMTA 1OE7A 1M2AA 3TJBA 3UBLA 2AHEA 3CSJA 2OACA 1A23A 4MPGA 4K5RA 1SD8A 4GRFA 4ML1A 4O7HA 4MK3A 3H79A 2WZ9A 5D8IA 2H74A 2K6VA 1E2YA 2VD0A 1QUWA 5ABRA 2LQOA 2RUFA 4HQZA 1GSYA 3VFIA 4JRRA 4QL7A 2O7KA 4ZBBA 5ECRB 1I5GA 1WE0A 4KSOA 1OE8A 2DIYA 3HKRA 5F8BA 2VL9A 3RDWA 3EC3A 3DIEA 2D2ZA 4HJMA 2V6KA 4OFTA 3FW2A 4L5LA 1SKSB 2R6KA 3LSZA 18GSA 1ZYEA 3C1RA 4G2EA 3KIJA 3HVXA 1M0UA 4CHSA 3TRXA 1KNGA 1LU4A 2GDRA 4ULXA 4MZWA 3I6AA 14GSA 3VPTA 3CSHA 1KTEA 1GSQA 2B3SA 4HUAA 5ENUA 5KN3A 2FY6A 2H1AA 3TKQA 5H5QA 1T8EB 1B9YC 1GTIA 3CTFA 1K0DA 4YQUA 2YCDA 1ILOA 4TVEA 2KUCA 4KX4A 2B6MA 5LCZA 4AJ7A 1GSFA 3WGEA 2FA8A 3DXBA 3G9BA 4KB3A 3EPTA 1M2BA 4DEJA 2CA8A 4XRDA 2I1UA 5CP1A 4PGTA 3EU4A 4KDUA 3ZIVA 1EV4A 1B4QA 1ZOFA 1K0NA 5EVOA 1TI1A 1K0CA 3P7XA 2BTOT 3DRNA 2C80A 1V40A 2TRCP 1AUCA 4N0ZA 2CAQA 5EPFA 5G1LA 2DIZA 1WRYA 2NBSA 3EURA 4POLA 3HZ4A 2H30A 4TN8A 2WCIA 3EE2A 2AYTA 4I2TA 3W8JA 2MMOA 2B5YA 2RIIA 3TKSC 5DQSA 5ECNB 4KCAA 1X9MB 3VI7A 5LD0A 2YNXA 2G0FA 2YPMA 3TJJA 3E0UA 1JZOA 1TRVA 2B1KA 2NDOA 4ZB8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HQP A;  9GSS A;  2FLS A;  5C00 A;  1GWC A;  4MJA A;  2PVO C;  3TGZ A;  3GN3 A;  2IN3 A;  3GV1 A;  1T00 A;  1Z6M A;  4EL1 A;  1XXU A;  5IMC A;  4Z7X A;  2H8L A;  4N11 A;  2VLV A;  1YQ1 A;  3WYW A;  2L6D A;  3A2X A;  4XHM A;  4MF6 A;  2B5E A;  2CZ3 A;  4L8E A;  4IKH A;  1RW1 A;  2KP2 A;  4FYC A;  2I9H A;  5IOW A;  4PXO A;  1GSU A;  1F37 A;  5D96 A;  5G2Z A;  5CRD A;  1ZYQ B;  5ECK B;  5DCH A;  5HR0 A;  5CYY A;  3L0H A;  1RQM A;  5HR3 A;  1AW9 A;  4HS1 A;  1V58 A;  3U5R E;  4QL9 A;  2X64 A;  2CVD A;  2PER A;  5JWR B;  1UVZ A;  1SK1 A;  4V2N A;  1GLQ A;  3EWL A;  3GNJ A;  2HZE A;  3HJM A;  4HJ2 A;  4IQ1 A;  5A4W A;  2O8V B;  2VCV A;  3FR9 A;  5H5R A;  1R26 A;  1X0R A;  2F51 A;  2DLX A;  3EVI A;  1YZX A;  1MTC A;  3EMP A;  4HI7 A;  3P90 A;  2IPA A;  1EP7 A;  2HNL A;  5GSS A;  5ECH B;  4KSM A;  5D9X A;  1SL0 B;  5KN2 A;  4I6X A;  4DVC A;  4MAB A;  1YF0 A;  1QK8 A;  5ELG A;  3UAR A;  1X5E A;  4ZB6 A;  3W6G A;  5AIS A;  1T4Y A;  3RPN A;  1UN2 A;  1SYR A;  2JAD A;  2AV4 A;  2DJ2 A;  4PQI A;  2EIQ A;  5J3R A;  1OC8 A;  1XZO A;  5JWQ B;  4F0B A;  2VAF A;  4N10 A;  1XW5 A;  1GSD A;  4BWS A;  4GST A;  4MCU A;  2HFD A;  3DYR A;  3O76 A;  4XRA A;  3SWL A;  4YAV A;  1MEK A;  1GUL A;  1AQW A;  3MWH A;  3L9V A;  3VWX A;  2FNO A;  1J0F A;  1DE2 A;  1TJD A;  3HD5 A;  3RBT A;  2VM1 A;  1XCC A;  1SD9 A;  2MZC A;  1GUH A;  1F2E A;  3MAK A;  1NW2 A;  3HHV A;  2X8G A;  3PIN A;  4ECC A;  2HYX A;  3LOR A;  2HZE B;  4POK A;  1THO A;  1M9A A;  1DSB A;  2ZUP A;  2HSH A;  1Z9H A;  1TU8 A;  1F3A A;  2VL2 C;  5J9B A;  1PX7 A;  3C73 A;  4H86 A;  1SK0 A;  2PMT A;  4JR4 A;  4V2L A;  5IMD A;  4IGJ A;  3HA9 A;  5L71 A;  5IMF A;  2B5X A;  4L0W A;  2H72 A;  4WF4 A;  4XS6 A;  4E8E A;  2ES7 A;  1BX9 A;  3IV4 A;  4IN0 A;  2OE0 A;  2V1M A;  3ZTL A;  4Q5N A;  3VWU A;  4WR5 A;  3FZ5 A;  3K8N A;  2PUK C;  3VI5 A;  5ID2 A;  5LNK e;  4EXJ A;  1SL1 B;  3HCZ A;  4OCF A;  3QAV A;  2HRN A;  2DJ3 A;  4AJ6 A;  3LEF A;  1EGO A;  5IO0 A;  4K8M A;  2ON7 A;  3TUE A;  3KH7 A;  1NHO A;  4LMW A;  3GIX A;  6GSW A;  3UMA A;  4XS4 B;  4ZL9 A;  2DSA A;  1S3C A;  2CX3 A;  1NSW A;  1QGV A;  1H4O A;  3KTL A;  3QR6 A;  1GSS A;  5HR2 A;  2CX4 A;  2H1D A;  4MJB A;  20GS A;  5G1K A;  2PWJ A;  1QFN A;  1V98 A;  3MNG A;  4AGS A;  3DML A;  5ECS A;  2YV7 A;  2OBI A;  5CRG A;  2JSY A;  2VL2 A;  4WEY A;  1M2D A;  1XWG A;  1TKD B;  1FB0 A;  2ZNM A;  4Q5Q A;  2OJL A;  3GHA A;  4TW5 A;  6GSY A;  4G9H A;  2FD3 A;  2N5B A;  2IMD A;  2H6Y A;  3IPZ A;  1TXX A;  10GS A;  1JZR A;  3VWW A;  3IOS A;  5AN1 A;  3TKS E;  3IRA A;  1PN9 A;  3L9S A;  5ECI B;  5D73 A;  3US3 A;  4FO5 A;  4OO5 A;  3EU3 A;  1EOG A;  1W4V A;  1ERW A;  1KBN A;  2IFQ A;  2MMZ A;  1HQO A;  3GX0 A;  2FWG A;  3C7M A;  2MBS A;  3F0I A;  5KN0 A;  3IC4 A;  1MDI A;  4TXO B;  3RHB A;  4F9Z A;  2B7K A;  4O32 A;  3ZVJ A;  3F63 A;  4PUR A;  4MJE A;  3UIW A;  4NPB A;  2PU9 C;  3FY7 A;  1Z7P A;  4F0C A;  2OAD A;  5G31 A;  4ZXG A;  3TCO A;  5GAP D;  5FT3 A;  2VM2 A;  3LXT A;  4K2D A;  4LL4 B;  5B8B A;  1TW9 A;  5COH A;  5CRW A;  1OC9 B;  3PH9 A;  4WET A;  1AXD A;  4KCE A;  5IM9 A;  4MZC A;  3GST A;  1OVN A;  4X43 A;  2YOI A;  2HZF A;  3Q74 A;  2LUS A;  5DAK A;  1U3A A;  3I9V 2;  1OAZ A;  2C0F A;  1KEB A;  2R5G A;  1B8X A;  4E8H A;  3F4T A;  1Q98 A;  2LRT A;  3ISO A;  2GSS A;  3IK7 A;  5CAX A;  2YN1 A;  1AAZ A;  4ZL7 A;  4HU9 A;  2XBQ A;  3ERF A;  3UBK A;  3UVT A;  4NAX A;  4TKY A;  5A4V A;  1AQX A;  1ZZY A;  2M46 A;  4ZIJ A;  1SEN A;  4GCI A;  2GSQ A;  3PR8 A;  4BL7 A;  1A2L A;  2IJY A;  2GQL A;  5CRE A;  4TXV A;  2LTK A;  1GP1 A;  2PPT A;  3CYN A;  4GLT A;  2VO4 A;  1A24 A;  2L6C A;  4DSS A;  1ERT A;  1TRS A;  2R2J A;  4HQS A;  5B8A A;  3GFK A;  5INY A;  3MSZ A;  1XBS A;  4WXT A;  5ECO B;  1BAY A;  6GSS A;  1PX6 A;  2A4V A;  3CRT A;  2LNS A;  12GS A;  4ZB9 A;  5F07 A;  1VRS D;  1O85 A;  1HD2 A;  4MH2 A;  1V2A A;  5H5S A;  4BWQ A;  4K7N A;  2GVP A;  4J57 E;  4CW9 A;  2LJA A;  3GX8 A;  2XC2 A;  1T7P B;  2E7P A;  3GTU A;  3IE3 A;  3KMO A;  2R3X A;  4IJ3 A;  1Q4J A;  1R5P A;  4F2I A;  2CQ9 A;  2RM5 A;  3L78 A;  4GTU A;  2N5A A;  3FRC A;  1J08 A;  2YJH A;  2JSZ A;  1BYE A;  2CVK A;  2YWO A;  5C04 A;  1DUG A;  1SK2 A;  3C8E A;  5IMZ A;  2K9F A;  4RUV A;  5ECQ B;  4MPF A;  2GZP A;  1ST9 A;  1Z3E A;  3APQ A;  3GH6 A;  3LWA A;  3WGX A;  3ZZX A;  2QGV A;  3W8S A;  2H73 A;  1M9B A;  1YKC A;  3RHC A;  2XPD A;  2K8S A;  3QAW A;  2A2S A;  3GRX A;  1O7U A;  2HLS A;  2FGX A;  4IW9 A;  2E0Q A;  2C3Q A;  3FZ9 A;  4DSS B;  2DJ0 A;  4PUF C;  2YWI A;  1V57 A;  2KP1 A;  3QAG A;  1WIK A;  4OFM A;  1GLP A;  4V2M A;  3TOT A;  1ZCP A;  4WBJ A;  4KH7 A;  4BA7 A;  4GQF A;  7GSS A;  1G6Y A;  1QXH A;  4YAP A;  2YZH A;  4EDY A;  1JZW A;  1K3L A;  1B48 A;  3ZRD A;  1THX A;  2NTO A;  3QCP A;  3FYG A;  1Y25 A;  2ON5 A;  5DJL A;  1PKZ A;  4JED A;  4TRX A;  3H93 A;  3J7Y b;  1PSQ A;  4MF7 A;  4KW6 A;  3EMX A;  4CDO A;  1EOH A;  3LQ7 A;  3GKK A;  1R7H A;  4XCS A;  2GZY A;  2YAN A;  3GL5 A;  2AJQ B;  3TJF A;  2N5F A;  2K8V A;  5D9W A;  4PNF A;  2P5Q A;  2LKU A;  2L4Q A;  5G5E A;  4K7O A;  3A2V A;  2WJU A;  3GUR A;  1F9M A;  3BCI A;  2H66 A;  3D4M A;  1G0T A;  3F6D A;  4KUN A;  1XW9 A;  2FWF A;  5JCU A;  5IMV A;  3BCK A;  1ML6 A;  1T1V A;  16GS A;  4N0V A;  5HR1 A;  1YDK A;  1JLW A;  1EZK A;  1T3B A;  3IK9 A;  4MF5 A;  1Y6E A;  3NIV A;  4YH2 A;  2TRX A;  4I97 A;  5ECL B;  4YQM A;  3ME7 A;  3TJK A;  2X8H A;  2CZ2 A;  3F3R A;  3HVV A;  1XWK A;  2EC4 A;  4DSQ A;  2KLX A;  5ECP B;  5B6M A;  5DJM A;  19GS A;  3P8W A;  3ED3 A;  4JU5 A;  2L5O A;  3GYK A;  1BQ7 A;  2O87 A;  5IPH A;  3RPP A;  4LL1 B;  4NXI A;  4KGI A;  2VCX A;  2VIM A;  4MA9 A;  4XIH A;  1ACV A;  4OD7 A;  3M3M A;  22GS A;  5FHI A;  5D9T A;  5IQY A;  1XWC A;  2XHF A;  4ZBD A;  4WKW A;  2KHP A;  1GRX A;  1RK4 A;  1SKR B;  1FAA A;  2YJ7 A;  3I69 A;  4PUA A;  2H6X A;  4IBP A;  3H1N A;  4GSN A;  3M0F A;  2PGT A;  5D93 A;  5IO2 A;  1AQV A;  1YF1 A;  3G7Y A;  3ZFL A;  3DVW A;  1FVK A;  1TRU A;  1S3A A;  3IHQ A;  4X1U A;  2GST A;  2NVL A;  2LJK A;  5AIV A;  3FK8 A;  4D73 A;  4EO3 A;  4IVF A;  3VLN A;  4TR3 A;  1WJK A;  2C4J A;  3KXO A;  1J9B A;  1QMV A;  5CRH A;  2H76 A;  6GSU A;  2MBT A;  1USB A;  1M7T A;  1OKT A;  2V32 A;  3KP9 A;  3GKM A;  4JE1 A;  2IIY A;  3A2W A;  1SKW B;  1DBY A;  2HRF A;  3LFL A;  2FUG 2;  2K18 A;  5F06 A;  3H4K A;  3Q6O A;  1HYU A;  1O6J A;  3IBH A;  2LST A;  3UOM A;  3E3E A;  3ERW A;  4EE0 A;  3LYP A;  3WT1 A;  2XPE A;  3D21 A;  1DE1 A;  4TR1 A;  3R2Q A;  3FR3 A;  5FWG A;  3QDN A;  3UEM A;  3L9U A;  4MH3 A;  3O6T A;  3WD6 A;  4K9Z A;  2M80 A;  3LJR A;  2JAC A;  2KOK A;  3M8N A;  1TRW A;  3L4N A;  2RLI A;  4J56 E;  4PNG A;  4K7I A;  3ZIT A;  2WB9 A;  3KP8 A;  4KA0 A;  4Q5R A;  3D0Z A;  4NV5 A;  1HNB A;  3N9J A;  4GQC A;  3UJ1 A;  4WR4 A;  3CBU A;  3F9U A;  3VWV A;  1BED A;  2H19 A;  1HNC A;  2VLT A;  4K0N A;  1F3B A;  1WWJ A;  2H1B A;  3JCM L;  2JZT A;  4PQ1 A;  1XW6 A;  1SL2 B;  2WDU A;  2X8C A;  5ID2 B;  1OC3 A;  3F3Q A;  2HE3 A;  3BOA A;  2C0G A;  2YP6 A;  4MP4 A;  2FWH A;  3ERG A;  4JZQ A;  1O81 A;  2E2M A;  4LA1 A;  3ZRE A;  1K0B A;  3VPQ A;  1U6T A;  5EL8 A;  1GTU A;  4MLY A;  1ERU A;  5J9C A;  3GKX A;  4OCE A;  1XVQ A;  1K3O A;  2LRN A;  4TR1 B;  1A0R P;  4YQV A;  1UA5 A;  1JZD A;  2JU5 A;  3QFA C;  3DVX A;  2EIR A;  1R5A A;  3PGT A;  2LNT A;  2OE3 A;  4FH8 A;  3QOU A;  2OBK A;  4TOP A;  1JLV A;  1VGL A;  4GXZ A;  2HI7 A;  1XWA A;  4L0U A;  2BJX A;  2YWN A;  4EF0 A;  4LMV A;  1U87 A;  1H75 A;  4AF2 A;  3TJG A;  2J23 A;  2V6O A;  3HY2 A;  4GSS A;  1SJZ A;  4NHZ A;  2LJR A;  3VK9 A;  1HNA A;  4EUY A;  2NPB A;  2J9H A;  2IMI A;  5J5N A;  3LG6 A;  3D22 A;  5IPG A;  1TDI A;  2HSY A;  4ZIL A;  5JCG A;  1FB6 A;  2P5R A;  4NMU A;  1X5D A;  3ZL5 A;  3IXR A;  2EIO A;  6GSX A;  1VF1 A;  2LEG A;  4MMM A;  4HDE A;  2IFQ B;  1K0A A;  4JR6 A;  1IYI A;  2DML A;  3BBY A;  3KM6 A;  2H0H A;  1AIU A;  1CQH A;  3M1G A;  2VOC A;  2B7J A;  4POB A;  3ZLP A;  6GSV A;  3UL3 A;  3ZML A;  3QMX A;  2H75 A;  4I5Q A;  2VL3 A;  3Q19 A;  4F03 A;  3NOF A;  5J41 A;  1Z7R A;  2YZU A;  1FVJ A;  1U88 A;  3AY8 A;  3EYT A;  3O3T A;  5D9V A;  3P2A A;  2LS5 A;  4ILF A;  1SJI A;  3TKP A;  1FO5 A;  2JZS A;  3TKR A;  1EP8 A;  5A4U A;  2DJK A;  3FR6 A;  3GL3 A;  3KEB A;  1W89 A;  3M9K A;  1ABA A;  1M99 A;  1A2M A;  1UC7 A;  3HYP A;  5DAK B;  1YKA A;  3LXZ A;  4OWY A;  4X0X A;  4XS1 A;  3A3T A;  3LGC A;  2JL4 A;  1PQN A;  2CAI A;  1WP0 A;  1GNW A;  2OE1 A;  3KCM A;  2FA4 A;  4K1F A;  1K0O A;  2OA7 A;  4AJ8 A;  4QQ7 A;  2ALB A;  1MDK A;  3BJ5 A;  2C0E A;  1O73 A;  5B6N A;  2FCH A;  3M9J A;  3APO A;  17GS A;  5HFK A;  2GTU A;  5JCW A;  4ECB A;  3BD2 A;  4POM A;  2Z9S A;  3N5O A;  2H0I A;  2WFC A;  1I9D A;  4HOJ A;  2YWM A;  2WRT A;  4ISD A;  5JWO B;  2IMK A;  1GTA A;  3D5J A;  4Q5F A;  3IAM 2;  2RUE A;  4DSR A;  4KDX A;  4TR0 A;  13GS A;  5F0G A;  3OR5 A;  4ID0 A;  2GQM A;  3RAZ A;  2H70 A;  1A2J A;  3F6F A;  3WGD A;  3KZQ A;  1A8L A;  4PX1 A;  3F8U A;  2MMA A;  3CXG A;  1K3Y A;  1F6M C;  2VCQ A;  1TP9 A;  4I8B A;  3G7I A;  1TTZ A;  2QC7 A;  4ACS A;  3HVS A;  1GNE A;  2FWE A;  4OMV A;  4KE3 A;  1SYX A;  1O8W A;  3I43 A;  2F3M A;  1FOV A;  1GL8 A;  3DWV A;  4WBR D;  3QD9 A;  4RI6 A;  5KEJ A;  4FIW A;  2P0G A;  3GTU B;  4ECJ A;  3APS A;  3G7J A;  3H8Q A;  4WF5 A;  4MDC A;  2LV3 A;  4HZ4 A;  1ERV A;  5DQY A;  3FHK A;  4O92 A;  3IDV A;  4GWR A;  1TOF A;  2GLR A;  5ELA A;  1TK8 B;  3DGQ A;  3CMI A;  4I2U A;  1YEX A;  1XFL A;  5F05 A;  2AUV A;  1E6B A;  3D6I A;  1TU7 A;  1EV9 A;  3F4R A;  2LQQ A;  2C8U A;  2OKA A;  1GUM A;  3HZ8 A;  1ON4 A;  3ZMK A;  4IHU A;  1VF3 A;  5IOX A;  4RQR A;  5DAL A;  1PGT A;  3DEX A;  1G7O A;  5E4W A;  4EDZ A;  4NHW A;  1OYJ A;  3CSI A;  1XVW A;  4OFN A;  3IA1 A;  5A5K A;  1MD4 A;  3KTB A;  2AB6 A;  3S9F A;  2GT5 A;  3FZ4 A;  4JBB A;  2DJ1 A;  5B7C A;  3TKS A;  3QPM A;  2H6Z A;  3NZN A;  2O89 A;  2VLU A;  1ZL9 A;  3TRQ A;  5DDL A;  1IYH A;  5J4U A;  2IWT A;  1V9W A;  4F82 A;  1JFU A;  4IJI A;  1N2A A;  2H01 A;  3Q18 A;  1NHY A;  4PQH A;  5KN1 A;  4XS4 A;  2TIR A;  4P3Y B;  2IMF A;  4RI7 A;  5IIZ A;  1XOA A;  2PVQ A;  3TB2 A;  1N8J A;  4IP6 A;  2VCW A;  1LBK A;  2IL3 A;  1MDJ A;  11GS A;  1A8Y A;  5GZZ B;  1AC1 A;  1PRX A;  2C0D A;  5GAN D;  2QSI A;  2HT9 A;  3J7Y k;  6GST A;  4IEL A;  4G10 A;  1Z5Y E;  3D4T A;  3KGK A;  1SJ6 A;  2I3Y A;  2C3T A;  4J2F A;  5DAL B;  1C72 A;  2A2R A;  4XTS A;  4EC0 A;  1FG4 A;  1XIY A;  4ZL8 A;  3F4S A;  5G5F A;  5ECM B;  3MDK A;  2L4C A;  2PN8 A;  3KMN A;  1X9W B;  3SBC A;  2GS3 A;  4EVM A;  4HZ2 A;  1YEP A;  4IP1 A;  3UVH A;  2BMX A;  1U3I A;  5HFG A;  2JZR A;  4KND A;  5AIX A;  3ZIJ A;  8GSS A;  2C1Y A;  3GKN A;  2FHE A;  4HEA 2;  2GQK A;  3FKF A;  3GA4 A;  4NV2 A;  4BVX A;  2R4V A;  3C1S A;  1XWB A;  4NWY A;  2GGT A;  2WUL A;  3GH9 A;  3VUR A;  5CNW A;  2LRC A;  4K6X A;  4N30 A;  1T4Z A;  3DD3 A;  2IME A;  3IR4 A;  2CT6 A;  2F8A A;  1G6W A;  3DKS A;  4TXO A;  4FYB A;  3ZVJ D;  1EEJ A;  2I81 A;  1S3D A;  2GT6 A;  3ZYW A;  3TOU A;  1WPI A;  3KJY A;  2V2G A;  2MMN A;  1PKW A;  1YJ6 A;  4MJC A;  2X99 A;  3HJP A;  1BJX A;  1BG5 A;  1VF4 A;  3CRU A;  4O5R A;  2L57 A;  1WOU A;  1OC9 A;  5HFI A;  2YV9 A;  4D73 B;  2V41 A;  2QKE A;  2DJJ A;  2H1G A;  5DBQ A;  3HJO A;  4IQA A;  4OO4 A;  3TRP A;  5DVB A;  4ML6 A;  1O8X A;  2ZCT A;  1XOB A;  1X9S B;  2DC5 A;  4V1A p;  3KH9 A;  1GTB A;  4FYU A;  1G7E A;  1B4P A;  2H71 A;  4G19 A;  2HXK A;  1JHB A;  2CVB A;  2H0G A;  5GST A;  4HU7 A;  2MYG A;  4K0G A;  2L59 A;  2REM A;  1A0F A;  2XBI A;  1LJR A;  1X5C A;  4KAE A;  1GSE A;  4ECI A;  1TI3 A;  3HDC A;  2B1L A;  2WS2 A;  3EIN A;  2GZZ A;  4L5O A;  2VCT A;  1VF2 A;  4KDY A;  5DCG A;  4V1A g;  3FEU A;  5IMA A;  4GF0 A;  5EY6 A;  1MD3 A;  1XPV A;  1OKD A;  3WT2 A;  1B9X C;  2VUP A;  2O85 A;  1EGR A;  3GSS A;  5G30 A;  1URM A;  1GUK A;  1TK5 B;  2AAW A;  1PL1 A;  2F9S A;  4TR4 A;  3LYK A;  1GH2 A;  4IS0 A;  2CV4 A;  1WMJ A;  2PBJ A;  3IAS 2;  1NM3 A;  2E2G A;  3E9J B;  4LLR A;  3TDG A;  3GUS A;  3GMF A;  1EEM A;  2VD1 A;  2I4A A;  3UAP A;  3CTG A;  3QFB C;  2M72 A;  3KD0 A;  3ZFB A;  5E59 A;  4BPY A;  4BVY A;  4RQX A;  5CO3 A;  3V1W A;  1Z6N A;  4ZBA A;  1ZMA A;  1R4W A;  1TK0 B;  3HXS A;  2L5L A;  3ME8 A;  2P31 A;  3C71 A;  2F8F A;  2G2Q A;  1K0M A;  1PL2 A;  1PD2 1;  3FZA A;  2C3N A;  1FHE A;  2GSR A;  1SU9 A;  2RM6 A;  1EWX A;  3U6V A;  1CQG A;  2R37 A;  1FW1 A;  1ZGN A;  2WGR A;  2DBC A;  1QQ2 A;  1YY7 A;  4EKZ A;  3A5W A;  2VCZ A;  2DMM A;  5AGY A;  1PA3 A;  4MZB A;  1PMT A;  1OE7 A;  1M2A A;  3TJB A;  3UBL A;  2AHE A;  3CSJ A;  2OAC A;  1A23 A;  4MPG A;  1SD8 A;  4GRF A;  4ML1 A;  4O7H A;  4MK3 A;  3H79 A;  2WZ9 A;  5D8I A;  2H74 A;  2K6V A;  1E2Y A;  2VD0 A;  1QUW A;  5ABR A;  2LQO A;  2RUF A;  4HQZ A;  1GSY A;  3VFI A;  4JRR A;  4QL7 A;  2O7K A;  4ZBB A;  5ECR B;  1I5G A;  1WE0 A;  4KSO A;  1OE8 A;  2DIY A;  3HKR A;  5F8B A;  2VL9 A;  3RDW A;  3EC3 A;  3DIE A;  2D2Z A;  4HJM A;  2V6K A;  4OFT A;  3FW2 A;  4L5L A;  1SKS B;  2R6K A;  3LSZ A;  18GS A;  1ZYE A;  3C1R A;  4G2E A;  3KIJ A;  3HVX A;  1M0U A;  4CHS A;  3TRX A;  1KNG A;  1LU4 A;  2GDR A;  4ULX A;  4MZW A;  3I6A A;  14GS A;  3VPT A;  3CSH A;  1KTE A;  1GSQ A;  2B3S A;  4HUA A;  5ENU A;  5KN3 A;  2FY6 A;  2H1A A;  3TKQ A;  5H5Q A;  1T8E B;  1B9Y C;  1GTI A;  3CTF A;  1K0D A;  4YQU A;  2YCD A;  1ILO A;  4TVE A;  2KUC A;  4KX4 A;  2B6M A;  5LCZ A;  4AJ7 A;  1GSF A;  3WGE A;  2FA8 A;  3DXB A;  3G9B A;  4KB3 A;  1M2B A;  4DEJ A;  2CA8 A;  4XRD A;  2I1U A;  5CP1 A;  4PGT A;  3EU4 A;  4KDU A;  3ZIV A;  1EV4 A;  1B4Q A;  1ZOF A;  1K0N A;  5EVO A;  1TI1 A;  1K0C A;  3P7X A;  2BTO T;  3DRN A;  2C80 A;  1V40 A;  2TRC P;  1AUC A;  4N0Z A;  2CAQ A;  5EPF A;  5G1L A;  2DIZ A;  1WRY A;  2NBS A;  3EUR A;  4POL A;  3HZ4 A;  2H30 A;  4TN8 A;  2WCI A;  3EE2 A;  2AYT A;  4I2T A;  3W8J A;  2MMO A;  2B5Y A;  2RII A;  3TKS C;  5DQS A;  5ECN B;  4KCA A;  1X9M B;  3VI7 A;  5LD0 A;  2YNX A;  2G0F A;  2YPM A;  3TJJ A;  3E0U A;  1JZO A;  1TRV A;  2B1K A;  2NDO A;  4ZB8 A; 
#chains in the Genus database with same CATH topology
 5HQP A;  9GSS A;  2FLS A;  5C00 A;  1GWC A;  4MJA A;  2PVO C;  3TGZ A;  3GN3 A;  2IN3 A;  3GV1 A;  1T00 A;  1Z6M A;  4EL1 A;  1XXU A;  5IMC A;  4Z7X A;  2H8L A;  4N11 A;  2VLV A;  1YQ1 A;  3WYW A;  2L6D A;  3A2X A;  4XHM A;  4MF6 A;  2B5E A;  2CZ3 A;  4L8E A;  4IKH A;  1RW1 A;  2KP2 A;  4FYC A;  2I9H A;  5IOW A;  4PXO A;  1GSU A;  1F37 A;  3IC8 A;  5D96 A;  5G2Z A;  5CRD A;  1ZYQ B;  5ECK B;  5DCH A;  5HR0 A;  5CYY A;  2HRA A;  3L0H A;  1RQM A;  5HR3 A;  1AW9 A;  4HS1 A;  1V58 A;  3U5R E;  4CY8 A;  4QL9 A;  2X64 A;  2CVD A;  2PER A;  5JWR B;  1UVZ A;  1SK1 A;  4V2N A;  1GLQ A;  3EWL A;  3GNJ A;  2HZE A;  3HJM A;  4HJ2 A;  4IQ1 A;  5A4W A;  2O8V B;  2VCV A;  3FR9 A;  5H5R A;  1R26 A;  1X0R A;  2F51 A;  2DLX A;  3EVI A;  1YZX A;  1MTC A;  3EMP A;  4HI7 A;  3P90 A;  2IPA A;  1EP7 A;  2HNL A;  5GSS A;  5ECH B;  4KSM A;  5D9X A;  1SL0 B;  5KN2 A;  4I6X A;  4DVC A;  4MAB A;  1YF0 A;  1QK8 A;  5ELG A;  3UAR A;  1X5E A;  4ZB6 A;  3W6G A;  5AIS A;  1T4Y A;  3RPN A;  1UN2 A;  1SYR A;  2JAD A;  2AV4 A;  2DJ2 A;  4PQI A;  2EIQ A;  5J3R A;  1OC8 A;  1XZO A;  5JWQ B;  4F0B A;  2VAF A;  4N10 A;  1XW5 A;  1GSD A;  4BWS A;  4GST A;  4MCU A;  2HFD A;  3DYR A;  3O76 A;  4XRA A;  3SWL A;  4YAV A;  1MEK A;  1GUL A;  1AQW A;  3MWH A;  3L9V A;  3VWX A;  2FNO A;  1J0F A;  1DE2 A;  1TJD A;  3HD5 A;  3RBT A;  2VM1 A;  1XCC A;  1SD9 A;  2MZC A;  1GUH A;  1F2E A;  4G0K A;  3MAK A;  1NW2 A;  3HHV A;  2X8G A;  3PIN A;  4ECC A;  2HYX A;  3LOR A;  2HZE B;  4POK A;  1THO A;  1M9A A;  3FMW A;  1DSB A;  2ZUP A;  2HSH A;  1Z9H A;  1TU8 A;  1F3A A;  2VL2 C;  5J9B A;  1PX7 A;  3C73 A;  4H86 A;  1SK0 A;  2PMT A;  4JR4 A;  4V2L A;  5IMD A;  4IGJ A;  3HA9 A;  5L71 A;  5IMF A;  2B5X A;  4L0W A;  2H72 A;  4WF4 A;  4XS6 A;  4E8E A;  2ES7 A;  1BX9 A;  3IV4 A;  4IN0 A;  2OE0 A;  2V1M A;  3ZTL A;  4Q5N A;  3VWU A;  5KOW A;  4WR5 A;  3FZ5 A;  3K8N A;  2PUK C;  3VI5 A;  5ID2 A;  5LNK e;  4EXJ A;  1SL1 B;  3HCZ A;  4OCF A;  3QAV A;  2HRN A;  2DJ3 A;  4AJ6 A;  3LEF A;  1EGO A;  5IO0 A;  4K8M A;  2ON7 A;  3TUE A;  3KH7 A;  1NHO A;  4LMW A;  3GIX A;  6GSW A;  3UMA A;  4XS4 B;  4ZL9 A;  2DSA A;  1S3C A;  2CX3 A;  1NSW A;  1QGV A;  1H4O A;  3KTL A;  3QR6 A;  1GSS A;  5HR2 A;  2CX4 A;  2H1D A;  4MJB A;  20GS A;  5G1K A;  2PWJ A;  1FOH A;  1QFN A;  1V98 A;  3MNG A;  4AGS A;  3DML A;  5ECS A;  2YV7 A;  2OBI A;  5CRG A;  2X49 A;  4HSC X;  2JSY A;  2VL2 A;  4WEY A;  1M2D A;  1XWG A;  1TKD B;  1FB0 A;  2ZNM A;  4Q5Q A;  2OJL A;  4EIP A;  3GHA A;  4TW5 A;  6GSY A;  4G9H A;  2FD3 A;  2N5B A;  2IMD A;  2H6Y A;  3IPZ A;  1TXX A;  10GS A;  1JZR A;  3VWW A;  3IOS A;  5AN1 A;  3TKS E;  3IRA A;  1PN9 A;  4K5S A;  3L9S A;  5ECI B;  3R3E A;  5D73 A;  3US3 A;  4FO5 A;  4OO5 A;  3EU3 A;  1EOG A;  1W4V A;  1ERW A;  1KBN A;  2IFQ A;  2MMZ A;  1HQO A;  3GX0 A;  2FWG A;  3LW9 A;  3C7M A;  2MBS A;  3F0I A;  5KN0 A;  3IC4 A;  1MDI A;  4TXO B;  3RHB A;  4F9Z A;  2B7K A;  3MIX A;  4O32 A;  3ZVJ A;  3F63 A;  4PUR A;  4MJE A;  3UIW A;  4NPB A;  2PU9 C;  3FY7 A;  1Z7P A;  4F0C A;  2OAD A;  5G31 A;  4ZXG A;  3TCO A;  5GAP D;  5FT3 A;  2VM2 A;  3LXT A;  4K2D A;  4LL4 B;  5B8B A;  1TW9 A;  5COH A;  5CRW A;  1OC9 B;  3PH9 A;  4WET A;  1AXD A;  4KCE A;  5IM9 A;  4MZC A;  3GST A;  1OVN A;  4X43 A;  2YOI A;  2HZF A;  3Q74 A;  2LUS A;  5DAK A;  1U3A A;  4O5Q A;  3I9V 2;  1OAZ A;  2C0F A;  1KEB A;  2R5G A;  1B8X A;  4E8H A;  3F4T A;  1Q98 A;  2LRT A;  3ISO A;  4YKF A;  2GSS A;  3IK7 A;  5CAX A;  2YN1 A;  1AAZ A;  4ZL7 A;  4HU9 A;  2XBQ A;  3ERF A;  3UBK A;  3UVT A;  4NAX A;  4TKY A;  5A4V A;  1AQX A;  1ZZY A;  2M46 A;  4ZIJ A;  1SEN A;  4GCI A;  2GSQ A;  3PR8 A;  4BL7 A;  1A2L A;  2IJY A;  2GQL A;  5CRE A;  4TXV A;  2LTK A;  1GP1 A;  2PPT A;  3CYN A;  4GLT A;  2VO4 A;  1A24 A;  2L6C A;  4DSS A;  1ERT A;  1TRS A;  2R2J A;  4HQS A;  5B8A A;  3GFK A;  5INY A;  3MSZ A;  1XBS A;  4WXT A;  5ECO B;  1BAY A;  6GSS A;  1PX6 A;  2A4V A;  3CRT A;  4BVY B;  2LNS A;  12GS A;  4ZB9 A;  5F07 A;  1VRS D;  1O85 A;  1HD2 A;  4MH2 A;  1V2A A;  5H5S A;  4BWQ A;  4K7N A;  2GVP A;  4J57 E;  4CW9 A;  2LJA A;  3GX8 A;  2XC2 A;  1T7P B;  2E7P A;  3GTU A;  3IE3 A;  3KMO A;  2R3X A;  4IJ3 A;  1Q4J A;  1R5P A;  4F2I A;  2CQ9 A;  2RM5 A;  3L78 A;  4GTU A;  2N5A A;  3FRC A;  1J08 A;  3MYD A;  2YJH A;  2JSZ A;  1BYE A;  2CVK A;  2YWO A;  5C04 A;  1DUG A;  1SK2 A;  3C8E A;  5IMZ A;  2K9F A;  4RUV A;  5ECQ B;  4MPF A;  2GZP A;  1ST9 A;  1Z3E A;  3APQ A;  3GH6 A;  3LWA A;  3WGX A;  3ZZX A;  2QGV A;  3W8S A;  2H73 A;  1M9B A;  1YKC A;  3RHC A;  2XPD A;  2K8S A;  3QAW A;  2A2S A;  3GRX A;  1O7U A;  2HLS A;  2FGX A;  4IW9 A;  2E0Q A;  2C3Q A;  3FZ9 A;  4DSS B;  2DJ0 A;  4PUF C;  2YWI A;  1V57 A;  2KP1 A;  3QAG A;  1WIK A;  4OFM A;  1GLP A;  4V2M A;  3TOT A;  1ZCP A;  4WBJ A;  5KOX A;  4KH7 A;  4BA7 A;  4GQF A;  7GSS A;  1G6Y A;  1QXH A;  4YAP A;  2YZH A;  4EDY A;  1JZW A;  1K3L A;  1B48 A;  3ZRD A;  1THX A;  2NTO A;  3QCP A;  3FYG A;  1Y25 A;  2ON5 A;  5DJL A;  1PKZ A;  4JED A;  4TRX A;  3H93 A;  3J7Y b;  1PSQ A;  4MF7 A;  4KW6 A;  3EMX A;  4CDO A;  1EOH A;  3LQ7 A;  3GKK A;  1R7H A;  4XCS A;  2GZY A;  2YAN A;  3GL5 A;  2AJQ B;  3TJF A;  2N5F A;  2K8V A;  5D9W A;  4PNF A;  2P5Q A;  2LKU A;  2L4Q A;  5G5E A;  4K7O A;  3A2V A;  3A5I A;  2WJU A;  3GUR A;  1F9M A;  3BCI A;  2H66 A;  4KF9 A;  3D4M A;  1G0T A;  3F6D A;  4KUN A;  1XW9 A;  2FWF A;  5JCU A;  5IMV A;  3BCK A;  4FQU A;  1ML6 A;  1T1V A;  16GS A;  4N0V A;  5HR1 A;  1YDK A;  1JLW A;  1EZK A;  1T3B A;  3IK9 A;  4MF5 A;  1Y6E A;  2HRK A;  3NIV A;  4YH2 A;  2TRX A;  1XG8 A;  4I97 A;  5ECL B;  4YQM A;  3ME7 A;  3TJK A;  2X8H A;  2CZ2 A;  3F3R A;  3HVV A;  1XWK A;  2EC4 A;  4DSQ A;  2KLX A;  1M3J A;  5ECP B;  5B6M A;  5DJM A;  19GS A;  3P8W A;  3ED3 A;  4JU5 A;  2L5O A;  3GYK A;  1BQ7 A;  2O87 A;  5IPH A;  4A5P A;  3RPP A;  4LL1 B;  4NXI A;  4KGI A;  2VCX A;  2VIM A;  4MA9 A;  4XIH A;  1ACV A;  4OD7 A;  3M3M A;  22GS A;  5FHI A;  5D9T A;  5IQY A;  1XWC A;  2XHF A;  4ZBD A;  4WKW A;  2KHP A;  1GRX A;  1RK4 A;  1SKR B;  1FAA A;  2YJ7 A;  3I69 A;  4PUA A;  2H6X A;  4IBP A;  3H1N A;  4GSN A;  3M0F A;  2PGT A;  5D93 A;  5IO2 A;  1AQV A;  1YF1 A;  3G7Y A;  3ZFL A;  3DVW A;  1FVK A;  1TRU A;  1S3A A;  3IHQ A;  4X1U A;  2GST A;  2NVL A;  4X4J A;  2LJK A;  5AIV A;  3FK8 A;  4D73 A;  4EO3 A;  4IVF A;  3VLN A;  4TR3 A;  1WJK A;  2C4J A;  3KXO A;  1J9B A;  1QMV A;  5CRH A;  2H76 A;  6GSU A;  2MBT A;  2DKI A;  1USB A;  1M7T A;  2QA1 A;  3HVN A;  1OKT A;  2V32 A;  3KP9 A;  3GKM A;  4JE1 A;  2IIY A;  3A2W A;  1SKW B;  1DBY A;  2HRF A;  3LFL A;  2FUG 2;  4Z2R A;  2K18 A;  5F06 A;  3H4K A;  3Q6O A;  1HYU A;  1O6J A;  3IBH A;  2LST A;  3UOM A;  3E3E A;  3ERW A;  4EE0 A;  3LYP A;  3WT1 A;  2XPE A;  3D21 A;  1DE1 A;  4TR1 A;  3R2Q A;  3FR3 A;  5FWG A;  3QDN A;  3PPU A;  3UEM A;  3L9U A;  4MH3 A;  3O6T A;  3WD6 A;  4K9Z A;  2M80 A;  3LJR A;  2JAC A;  2KOK A;  3M8N A;  1TRW A;  3L4N A;  2RLI A;  4J56 E;  4PNG A;  4K7I A;  3ZIT A;  2WB9 A;  3KP8 A;  4KA0 A;  4Q5R A;  3D0Z A;  4NV5 A;  1HNB A;  3N9J A;  4GQC A;  3UJ1 A;  4WR4 A;  3CBU A;  3F9U A;  3VWV A;  1BED A;  2H19 A;  1HNC A;  2VLT A;  4K0N A;  1F3B A;  1WWJ A;  2H1B A;  3JCM L;  2JZT A;  2X4A A;  4PQ1 A;  3IHG A;  1XW6 A;  1SL2 B;  2WDU A;  2X8C A;  5ID2 B;  1OC3 A;  3F3Q A;  2HE3 A;  3BOA A;  2C0G A;  2YP6 A;  4MP4 A;  2FWH A;  3ERG A;  4JZQ A;  1O81 A;  2E2M A;  4LA1 A;  3ZRE A;  1K0B A;  3VPQ A;  1U6T A;  5EL8 A;  1GTU A;  4MLY A;  1ERU A;  5J9C A;  3GKX A;  1ZYN A;  4OCE A;  1XVQ A;  1K3O A;  2LRN A;  4TR1 B;  1A0R P;  4YQV A;  1UA5 A;  1JZD A;  2JU5 A;  3QFA C;  3DVX A;  2EIR A;  1R5A A;  3PGT A;  5BRT A;  2LNT A;  2OE3 A;  4FH8 A;  4MNN A;  3QOU A;  2OBK A;  4TOP A;  1JLV A;  1VGL A;  4GXZ A;  2HI7 A;  1XWA A;  4L0U A;  2BJX A;  2YWN A;  4EF0 A;  4LMV A;  1U87 A;  1H75 A;  4AF2 A;  3TJG A;  2J23 A;  2V6O A;  3HY2 A;  4GSS A;  2R0C A;  1SJZ A;  4NHZ A;  2LJR A;  3VK9 A;  1HNA A;  4EUY A;  2NPB A;  2J9H A;  2IMI A;  5J5N A;  3LG6 A;  3D22 A;  2A4H A;  5IPG A;  1TDI A;  2HSY A;  4ZIL A;  5JCG A;  1FB6 A;  2P5R A;  4NMU A;  1X5D A;  3ZL5 A;  3IXR A;  2EIO A;  6GSX A;  1VF1 A;  2LEG A;  2QA2 A;  4MMM A;  4HDE A;  2IFQ B;  1K0A A;  4JR6 A;  1IYI A;  2DML A;  3BBY A;  3KM6 A;  2H0H A;  1AIU A;  1CQH A;  3M1G A;  2VOC A;  2B7J A;  4POB A;  3ZLP A;  6GSV A;  1ZYP A;  3UL3 A;  3ZML A;  3QMX A;  2H75 A;  4I5Q A;  2VL3 A;  3Q19 A;  4F03 A;  3NOF A;  5J41 A;  1Z7R A;  2YZU A;  1FVJ A;  1U88 A;  3AY8 A;  3EYT A;  3O3T A;  5D9V A;  3P2A A;  2LS5 A;  4ILF A;  1SJI A;  3TKP A;  1FO5 A;  2JZS A;  3TKR A;  1EP8 A;  5A4U A;  2DJK A;  3FR6 A;  3GL3 A;  3KEB A;  1W89 A;  3M9K A;  1ABA A;  1M99 A;  1A2M A;  1UC7 A;  3HYP A;  5DAK B;  1YKA A;  3LXZ A;  2DKH A;  4OWY A;  4X0X A;  4XS1 A;  3A3T A;  3LGC A;  2JL4 A;  1PQN A;  2CAI A;  1WP0 A;  1GNW A;  2OE1 A;  3KCM A;  2FA4 A;  4K1F A;  1K0O A;  2OA7 A;  4AJ8 A;  4QQ7 A;  2ALB A;  1MDK A;  3BJ5 A;  2C0E A;  1O73 A;  5B6N A;  2FCH A;  3M9J A;  3APO A;  17GS A;  5HFK A;  2GTU A;  5JCW A;  4ECB A;  3BD2 A;  4POM A;  2Z9S A;  3N5O A;  2H0I A;  2WFC A;  1I9D A;  4HOJ A;  2YWM A;  2WRT A;  4ISD A;  5JWO B;  2IMK A;  1GTA A;  3D5J A;  4Q5F A;  4BL7 B;  3IAM 2;  2RUE A;  4DSR A;  4KDX A;  4TR0 A;  13GS A;  5F0G A;  3OR5 A;  4ID0 A;  2GQM A;  4Z2U A;  3RAZ A;  2H70 A;  1A2J A;  3F6F A;  3WGD A;  3KZQ A;  1A8L A;  4PX1 A;  3F8U A;  2MMA A;  3CXG A;  1K3Y A;  1F6M C;  2VCQ A;  1TP9 A;  4I8B A;  3G7I A;  1TTZ A;  2QC7 A;  4ACS A;  3HVS A;  1GNE A;  2FWE A;  4OMV A;  4KE3 A;  1SYX A;  1O8W A;  3I43 A;  2F3M A;  1FOV A;  1GL8 A;  3DWV A;  4USS A;  4WBR D;  3QD9 A;  4RI6 A;  5KEJ A;  4FIW A;  2P0G A;  3GTU B;  4ECJ A;  3APS A;  3G7J A;  3H8Q A;  1PN0 A;  4WF5 A;  4MDC A;  2LV3 A;  4HZ4 A;  1ERV A;  5DQY A;  3FHK A;  4O92 A;  3IDV A;  4GWR A;  1TOF A;  2GLR A;  5ELA A;  1TK8 B;  3DGQ A;  3CMI A;  4I2U A;  1YEX A;  1XFL A;  2R0G A;  5F05 A;  2AUV A;  1E6B A;  3D6I A;  1TU7 A;  1EV9 A;  3F4R A;  2LQQ A;  2C8U A;  2OKA A;  1GUM A;  3HZ8 A;  1ON4 A;  3ZMK A;  4IHU A;  1VF3 A;  5IOX A;  4RQR A;  5DAL A;  1PGT A;  3DEX A;  1G7O A;  5E4W A;  4EDZ A;  4NHW A;  1OYJ A;  3CSI A;  1XVW A;  4OFN A;  3IA1 A;  5A5K A;  1MD4 A;  3KTB A;  2AB6 A;  3S9F A;  2GT5 A;  3FZ4 A;  4JBB A;  2DJ1 A;  5B7C A;  3TKS A;  3QPM A;  2H6Z A;  3NZN A;  2O89 A;  2VLU A;  4Z2T A;  1ZL9 A;  3TRQ A;  5DDL A;  4EIQ A;  1IYH A;  5J4U A;  2IWT A;  1V9W A;  4F82 A;  1JFU A;  4IJI A;  1N2A A;  2H01 A;  3Q18 A;  1NHY A;  4PQH A;  5KN1 A;  4XS4 A;  2TIR A;  4P3Y B;  2IMF A;  5BMU A;  4RI7 A;  5IIZ A;  1XOA A;  2PVQ A;  3TB2 A;  1N8J A;  4IP6 A;  2VCW A;  1LBK A;  2IL3 A;  1MDJ A;  11GS A;  1A8Y A;  5GZZ B;  2A2P A;  1AC1 A;  1PRX A;  2C0D A;  5GAN D;  2QSI A;  2HT9 A;  3J7Y k;  6GST A;  4IEL A;  4G10 A;  1Z5Y E;  3D4T A;  3KGK A;  1SJ6 A;  2I3Y A;  2C3T A;  4J2F A;  5DAL B;  1C72 A;  2A2R A;  4XTS A;  4EC0 A;  1FG4 A;  1XIY A;  4ZL8 A;  3F4S A;  5G5F A;  5ECM B;  3MDK A;  2L4C A;  2PN8 A;  3KMN A;  1X9W B;  3SBC A;  2GS3 A;  4EVM A;  4HZ2 A;  4K2X A;  1YEP A;  4IP1 A;  3UVH A;  2BMX A;  1U3I A;  5HFG A;  2JZR A;  4KND A;  5AIX A;  3ZIJ A;  8GSS A;  2C1Y A;  3GKN A;  2FHE A;  4HEA 2;  2GQK A;  3FKF A;  4YKG A;  3GA4 A;  4NV2 A;  4BVX A;  2R4V A;  3C1S A;  1XWB A;  4NWY A;  2GGT A;  2WUL A;  3GH9 A;  3VUR A;  5CNW A;  2LRC A;  4K6X A;  4N30 A;  1T4Z A;  2HSM A;  3DD3 A;  2IME A;  3IR4 A;  2CT6 A;  2F8A A;  1G6W A;  3DKS A;  1M3I A;  2R0P A;  4TXO A;  4FYB A;  3ZVJ D;  1EEJ A;  2I81 A;  4CY6 A;  1S3D A;  2GT6 A;  3ZYW A;  3TOU A;  1WPI A;  3KJY A;  4PTS A;  2V2G A;  2MMN A;  1PKW A;  4O5U A;  1YJ6 A;  4MJC A;  2X99 A;  3HJP A;  1BJX A;  1BG5 A;  1VF4 A;  3CRU A;  4O5R A;  2L57 A;  1WOU A;  1OC9 A;  5HFI A;  2YV9 A;  4D73 B;  2V41 A;  2QKE A;  2DJJ A;  2H1G A;  5DBQ A;  3HJO A;  4IQA A;  4OO4 A;  3TRP A;  5DVB A;  4ML6 A;  1O8X A;  2ZCT A;  1XOB A;  1X9S B;  1PFO A;  2DC5 A;  4V1A p;  3KH9 A;  1GTB A;  4FYU A;  1G7E A;  1B4P A;  2H71 A;  4G19 A;  2HXK A;  1JHB A;  2CVB A;  2H0G A;  5GST A;  4HU7 A;  2MYG A;  4K0G A;  2L59 A;  2REM A;  1A0F A;  2XBI A;  1LJR A;  1X5C A;  4KAE A;  1GSE A;  4ECI A;  1TI3 A;  3HDC A;  2B1L A;  2WS2 A;  3EIN A;  2GZZ A;  4L5O A;  2VCT A;  4BVX B;  1VF2 A;  4KDY A;  5DCG A;  4V1A g;  4ICY A;  3FEU A;  5IMA A;  4GF0 A;  5EY6 A;  4G0L A;  1MD3 A;  1XPV A;  1OKD A;  3WT2 A;  4G0I A;  1B9X C;  2VUP A;  2O85 A;  1EGR A;  3GSS A;  5G30 A;  1URM A;  1GUK A;  1TK5 B;  2AAW A;  1PL1 A;  2F9S A;  4TR4 A;  3LYK A;  1GH2 A;  4IS0 A;  2CV4 A;  1WMJ A;  2PBJ A;  3IAS 2;  1NM3 A;  2E2G A;  3E9J B;  4LLR A;  3TDG A;  3GUS A;  3GMF A;  1EEM A;  2UZ8 A;  2VD1 A;  2I4A A;  3UAP A;  3CTG A;  3QFB C;  2M72 A;  3KD0 A;  3ZFB A;  5E59 A;  4BPY A;  4BVY A;  4RQX A;  5CO3 A;  3V1W A;  1Z6N A;  4ZBA A;  1ZMA A;  1R4W A;  1TK0 B;  3HXS A;  2L5L A;  3ME8 A;  2P31 A;  3C71 A;  2F8F A;  2G2Q A;  1K0M A;  1PL2 A;  1PD2 1;  3FZA A;  2C3N A;  1FHE A;  2GSR A;  1SU9 A;  2RM6 A;  1EWX A;  3U6V A;  1CQG A;  2R37 A;  1FW1 A;  1ZGN A;  2WGR A;  2DBC A;  1QQ2 A;  1YY7 A;  4EKZ A;  3A5W A;  2VCZ A;  2DMM A;  5AGY A;  1PA3 A;  4MZB A;  1PMT A;  1OE7 A;  1M2A A;  3TJB A;  3UBL A;  2AHE A;  3CSJ A;  2OAC A;  1A23 A;  4MPG A;  4K5R A;  1SD8 A;  4GRF A;  4ML1 A;  4O7H A;  4MK3 A;  3H79 A;  2WZ9 A;  5D8I A;  2H74 A;  2K6V A;  1E2Y A;  2VD0 A;  1QUW A;  5ABR A;  2LQO A;  2RUF A;  4HQZ A;  1GSY A;  3VFI A;  4JRR A;  4QL7 A;  1S3R A;  2O7K A;  4ZBB A;  5ECR B;  1I5G A;  1WE0 A;  4KSO A;  1OE8 A;  2DIY A;  3HKR A;  5F8B A;  2VL9 A;  3RDW A;  3EC3 A;  3DIE A;  2D2Z A;  4HJM A;  2V6K A;  4OFT A;  3FW2 A;  4L5L A;  1SKS B;  2R6K A;  3LSZ A;  18GS A;  1ZYE A;  3C1R A;  4G2E A;  3KIJ A;  3HVX A;  1M0U A;  4CHS A;  3TRX A;  1KNG A;  1LU4 A;  2GDR A;  4ULX A;  4MZW A;  3I6A A;  14GS A;  3VPT A;  3CSH A;  1KTE A;  1GSQ A;  2B3S A;  4HUA A;  5ENU A;  5KN3 A;  2FY6 A;  2H1A A;  3TKQ A;  5H5Q A;  1T8E B;  1B9Y C;  1GTI A;  3CTF A;  1K0D A;  4YQU A;  2YCD A;  1ILO A;  4TVE A;  4BIK A;  2KUC A;  4KX4 A;  2B6M A;  5LCZ A;  4AJ7 A;  1GSF A;  3WGE A;  2FA8 A;  3DXB A;  3G9B A;  4KB3 A;  3EPT A;  1M2B A;  4DEJ A;  2CA8 A;  4XRD A;  2I1U A;  5CP1 A;  4PGT A;  3EU4 A;  4KDU A;  3ZIV A;  1EV4 A;  1B4Q A;  1ZOF A;  1K0N A;  5EVO A;  3CQF A;  1TI1 A;  1K0C A;  3P7X A;  2BTO T;  3DRN A;  2C80 A;  1V40 A;  2TRC P;  1AUC A;  4N0Z A;  2CAQ A;  5EPF A;  5G1L A;  2DIZ A;  1WRY A;  2NBS A;  3EUR A;  4POL A;  3HZ4 A;  2H30 A;  4TN8 A;  2WCI A;  3EE2 A;  2AYT A;  4I2T A;  3W8J A;  2MMO A;  2B5Y A;  2RII A;  3TKS C;  5DQS A;  5ECN B;  4KCA A;  1X9M B;  3VI7 A;  5LD0 A;  2YNX A;  2G0F A;  2YPM A;  3TJJ A;  3E0U A;  1JZO A;  1TRV A;  2B1K A;  2NDO A;  4ZB8 A; 
#chains in the Genus database with same CATH homology
 5HQP A;  9GSS A;  2FLS A;  5C00 A;  1GWC A;  4MJA A;  2PVO C;  3TGZ A;  3GN3 A;  2IN3 A;  3GV1 A;  1T00 A;  1Z6M A;  4EL1 A;  1XXU A;  5IMC A;  4Z7X A;  2H8L A;  4N11 A;  2VLV A;  1YQ1 A;  3WYW A;  2L6D A;  3A2X A;  4XHM A;  4MF6 A;  2B5E A;  2CZ3 A;  4L8E A;  4IKH A;  1RW1 A;  2KP2 A;  4FYC A;  2I9H A;  5IOW A;  4PXO A;  1GSU A;  1F37 A;  3IC8 A;  5D96 A;  5G2Z A;  5CRD A;  1ZYQ B;  5ECK B;  5DCH A;  5HR0 A;  5CYY A;  2HRA A;  3L0H A;  1RQM A;  5HR3 A;  1AW9 A;  4HS1 A;  1V58 A;  3U5R E;  4CY8 A;  4QL9 A;  2X64 A;  2CVD A;  2PER A;  5JWR B;  1UVZ A;  1SK1 A;  4V2N A;  1GLQ A;  3EWL A;  3GNJ A;  2HZE A;  3HJM A;  4HJ2 A;  4IQ1 A;  5A4W A;  2O8V B;  2VCV A;  3FR9 A;  5H5R A;  1R26 A;  1X0R A;  2F51 A;  2DLX A;  3EVI A;  1YZX A;  1MTC A;  3EMP A;  4HI7 A;  3P90 A;  2IPA A;  1EP7 A;  2HNL A;  5GSS A;  5ECH B;  4KSM A;  5D9X A;  1SL0 B;  5KN2 A;  4I6X A;  4DVC A;  4MAB A;  1YF0 A;  1QK8 A;  5ELG A;  3UAR A;  1X5E A;  4ZB6 A;  3W6G A;  5AIS A;  1T4Y A;  3RPN A;  1UN2 A;  1SYR A;  2JAD A;  2AV4 A;  2DJ2 A;  4PQI A;  2EIQ A;  5J3R A;  1OC8 A;  1XZO A;  5JWQ B;  4F0B A;  2VAF A;  4N10 A;  1XW5 A;  1GSD A;  4BWS A;  4GST A;  4MCU A;  2HFD A;  3DYR A;  3O76 A;  4XRA A;  3SWL A;  4YAV A;  1MEK A;  1GUL A;  1AQW A;  3MWH A;  3L9V A;  3VWX A;  2FNO A;  1J0F A;  1DE2 A;  1TJD A;  3HD5 A;  3RBT A;  2VM1 A;  1XCC A;  1SD9 A;  2MZC A;  1GUH A;  1F2E A;  4G0K A;  3MAK A;  1NW2 A;  3HHV A;  2X8G A;  3PIN A;  4ECC A;  2HYX A;  3LOR A;  2HZE B;  4POK A;  1THO A;  1M9A A;  3FMW A;  1DSB A;  2ZUP A;  2HSH A;  1Z9H A;  1TU8 A;  1F3A A;  2VL2 C;  5J9B A;  1PX7 A;  3C73 A;  4H86 A;  1SK0 A;  2PMT A;  4JR4 A;  4V2L A;  5IMD A;  4IGJ A;  3HA9 A;  5L71 A;  5IMF A;  2B5X A;  4L0W A;  2H72 A;  4WF4 A;  4XS6 A;  4E8E A;  2ES7 A;  1BX9 A;  3IV4 A;  4IN0 A;  2OE0 A;  2V1M A;  3ZTL A;  4Q5N A;  3VWU A;  5KOW A;  4WR5 A;  3FZ5 A;  3K8N A;  2PUK C;  3VI5 A;  5ID2 A;  5LNK e;  4EXJ A;  1SL1 B;  3HCZ A;  4OCF A;  3QAV A;  2HRN A;  2DJ3 A;  4AJ6 A;  3LEF A;  1EGO A;  5IO0 A;  4K8M A;  2ON7 A;  3TUE A;  3KH7 A;  1NHO A;  4LMW A;  3GIX A;  6GSW A;  3UMA A;  4XS4 B;  4ZL9 A;  2DSA A;  1S3C A;  2CX3 A;  1NSW A;  1QGV A;  1H4O A;  3KTL A;  3QR6 A;  1GSS A;  5HR2 A;  2CX4 A;  2H1D A;  4MJB A;  20GS A;  5G1K A;  2PWJ A;  1FOH A;  1QFN A;  1V98 A;  3MNG A;  4AGS A;  3DML A;  5ECS A;  2YV7 A;  2OBI A;  5CRG A;  2X49 A;  2JSY A;  2VL2 A;  4WEY A;  1M2D A;  1XWG A;  1TKD B;  1FB0 A;  2ZNM A;  4Q5Q A;  2OJL A;  4EIP A;  3GHA A;  4TW5 A;  6GSY A;  4G9H A;  2FD3 A;  2N5B A;  2IMD A;  2H6Y A;  3IPZ A;  1TXX A;  10GS A;  1JZR A;  3VWW A;  3IOS A;  5AN1 A;  3TKS E;  3IRA A;  1PN9 A;  4K5S A;  3L9S A;  5ECI B;  3R3E A;  5D73 A;  3US3 A;  4FO5 A;  4OO5 A;  3EU3 A;  1EOG A;  1W4V A;  1ERW A;  1KBN A;  2IFQ A;  2MMZ A;  1HQO A;  3GX0 A;  2FWG A;  3LW9 A;  3C7M A;  2MBS A;  3F0I A;  5KN0 A;  3IC4 A;  1MDI A;  4TXO B;  3RHB A;  4F9Z A;  2B7K A;  3MIX A;  4O32 A;  3ZVJ A;  3F63 A;  4PUR A;  4MJE A;  3UIW A;  4NPB A;  2PU9 C;  3FY7 A;  1Z7P A;  4F0C A;  2OAD A;  5G31 A;  4ZXG A;  3TCO A;  5GAP D;  5FT3 A;  2VM2 A;  3LXT A;  4K2D A;  4LL4 B;  5B8B A;  1TW9 A;  5COH A;  5CRW A;  1OC9 B;  3PH9 A;  4WET A;  1AXD A;  4KCE A;  5IM9 A;  4MZC A;  3GST A;  1OVN A;  4X43 A;  2YOI A;  2HZF A;  3Q74 A;  2LUS A;  5DAK A;  1U3A A;  4O5Q A;  3I9V 2;  1OAZ A;  2C0F A;  1KEB A;  2R5G A;  1B8X A;  4E8H A;  3F4T A;  1Q98 A;  2LRT A;  3ISO A;  4YKF A;  2GSS A;  3IK7 A;  5CAX A;  2YN1 A;  1AAZ A;  4ZL7 A;  4HU9 A;  2XBQ A;  3ERF A;  3UBK A;  3UVT A;  4NAX A;  4TKY A;  5A4V A;  1AQX A;  1ZZY A;  2M46 A;  4ZIJ A;  1SEN A;  4GCI A;  2GSQ A;  3PR8 A;  4BL7 A;  1A2L A;  2IJY A;  2GQL A;  5CRE A;  4TXV A;  2LTK A;  1GP1 A;  2PPT A;  3CYN A;  4GLT A;  2VO4 A;  1A24 A;  2L6C A;  4DSS A;  1ERT A;  1TRS A;  2R2J A;  4HQS A;  5B8A A;  3GFK A;  5INY A;  3MSZ A;  1XBS A;  4WXT A;  5ECO B;  1BAY A;  6GSS A;  1PX6 A;  2A4V A;  3CRT A;  4BVY B;  2LNS A;  12GS A;  4ZB9 A;  5F07 A;  1VRS D;  1O85 A;  1HD2 A;  4MH2 A;  1V2A A;  5H5S A;  4BWQ A;  4K7N A;  2GVP A;  4J57 E;  4CW9 A;  2LJA A;  3GX8 A;  2XC2 A;  1T7P B;  2E7P A;  3GTU A;  3IE3 A;  3KMO A;  2R3X A;  4IJ3 A;  1Q4J A;  1R5P A;  4F2I A;  2CQ9 A;  2RM5 A;  3L78 A;  4GTU A;  2N5A A;  3FRC A;  1J08 A;  3MYD A;  2YJH A;  2JSZ A;  1BYE A;  2CVK A;  2YWO A;  5C04 A;  1DUG A;  1SK2 A;  3C8E A;  5IMZ A;  2K9F A;  4RUV A;  5ECQ B;  4MPF A;  2GZP A;  1ST9 A;  1Z3E A;  3APQ A;  3GH6 A;  3LWA A;  3WGX A;  3ZZX A;  2QGV A;  3W8S A;  2H73 A;  1M9B A;  1YKC A;  3RHC A;  2XPD A;  2K8S A;  3QAW A;  2A2S A;  3GRX A;  1O7U A;  2HLS A;  2FGX A;  4IW9 A;  2E0Q A;  2C3Q A;  3FZ9 A;  4DSS B;  2DJ0 A;  4PUF C;  2YWI A;  1V57 A;  2KP1 A;  3QAG A;  1WIK A;  4OFM A;  1GLP A;  4V2M A;  3TOT A;  1ZCP A;  4WBJ A;  5KOX A;  4KH7 A;  4BA7 A;  4GQF A;  7GSS A;  1G6Y A;  1QXH A;  4YAP A;  2YZH A;  4EDY A;  1JZW A;  1K3L A;  1B48 A;  3ZRD A;  1THX A;  2NTO A;  3QCP A;  3FYG A;  1Y25 A;  2ON5 A;  5DJL A;  1PKZ A;  4JED A;  4TRX A;  3H93 A;  3J7Y b;  1PSQ A;  4MF7 A;  4KW6 A;  3EMX A;  4CDO A;  1EOH A;  3LQ7 A;  3GKK A;  1R7H A;  4XCS A;  2GZY A;  2YAN A;  3GL5 A;  2AJQ B;  3TJF A;  2N5F A;  2K8V A;  5D9W A;  4PNF A;  2P5Q A;  2LKU A;  2L4Q A;  5G5E A;  4K7O A;  3A2V A;  3A5I A;  2WJU A;  3GUR A;  1F9M A;  3BCI A;  2H66 A;  4KF9 A;  3D4M A;  1G0T A;  3F6D A;  4KUN A;  1XW9 A;  2FWF A;  5JCU A;  5IMV A;  3BCK A;  4FQU A;  1ML6 A;  1T1V A;  16GS A;  4N0V A;  5HR1 A;  1YDK A;  1JLW A;  1EZK A;  1T3B A;  3IK9 A;  4MF5 A;  1Y6E A;  2HRK A;  3NIV A;  4YH2 A;  2TRX A;  4I97 A;  5ECL B;  4YQM A;  3ME7 A;  3TJK A;  2X8H A;  2CZ2 A;  3F3R A;  3HVV A;  1XWK A;  2EC4 A;  4DSQ A;  2KLX A;  5ECP B;  5B6M A;  5DJM A;  19GS A;  3P8W A;  3ED3 A;  4JU5 A;  2L5O A;  3GYK A;  1BQ7 A;  2O87 A;  5IPH A;  4A5P A;  3RPP A;  4LL1 B;  4NXI A;  4KGI A;  2VCX A;  2VIM A;  4MA9 A;  4XIH A;  1ACV A;  4OD7 A;  3M3M A;  22GS A;  5FHI A;  5D9T A;  5IQY A;  1XWC A;  2XHF A;  4ZBD A;  4WKW A;  2KHP A;  1GRX A;  1RK4 A;  1SKR B;  1FAA A;  2YJ7 A;  3I69 A;  4PUA A;  2H6X A;  4IBP A;  3H1N A;  4GSN A;  3M0F A;  2PGT A;  5D93 A;  5IO2 A;  1AQV A;  1YF1 A;  3G7Y A;  3ZFL A;  3DVW A;  1FVK A;  1TRU A;  1S3A A;  3IHQ A;  4X1U A;  2GST A;  2NVL A;  4X4J A;  2LJK A;  5AIV A;  3FK8 A;  4D73 A;  4EO3 A;  4IVF A;  3VLN A;  4TR3 A;  1WJK A;  2C4J A;  3KXO A;  1J9B A;  1QMV A;  5CRH A;  2H76 A;  6GSU A;  2MBT A;  2DKI A;  1USB A;  1M7T A;  2QA1 A;  1OKT A;  2V32 A;  3KP9 A;  3GKM A;  4JE1 A;  2IIY A;  3A2W A;  1SKW B;  1DBY A;  2HRF A;  3LFL A;  2FUG 2;  4Z2R A;  2K18 A;  5F06 A;  3H4K A;  3Q6O A;  1HYU A;  1O6J A;  3IBH A;  2LST A;  3UOM A;  3E3E A;  3ERW A;  4EE0 A;  3LYP A;  3WT1 A;  2XPE A;  3D21 A;  1DE1 A;  4TR1 A;  3R2Q A;  3FR3 A;  5FWG A;  3QDN A;  3PPU A;  3UEM A;  3L9U A;  4MH3 A;  3O6T A;  3WD6 A;  4K9Z A;  2M80 A;  3LJR A;  2JAC A;  2KOK A;  3M8N A;  1TRW A;  3L4N A;  2RLI A;  4J56 E;  4PNG A;  4K7I A;  3ZIT A;  2WB9 A;  3KP8 A;  4KA0 A;  4Q5R A;  3D0Z A;  4NV5 A;  1HNB A;  3N9J A;  4GQC A;  3UJ1 A;  4WR4 A;  3CBU A;  3F9U A;  3VWV A;  1BED A;  2H19 A;  1HNC A;  2VLT A;  4K0N A;  1F3B A;  1WWJ A;  2H1B A;  3JCM L;  2JZT A;  2X4A A;  4PQ1 A;  3IHG A;  1XW6 A;  1SL2 B;  2WDU A;  2X8C A;  5ID2 B;  1OC3 A;  3F3Q A;  2HE3 A;  3BOA A;  2C0G A;  2YP6 A;  4MP4 A;  2FWH A;  3ERG A;  4JZQ A;  1O81 A;  2E2M A;  4LA1 A;  3ZRE A;  1K0B A;  3VPQ A;  1U6T A;  5EL8 A;  1GTU A;  4MLY A;  1ERU A;  5J9C A;  3GKX A;  1ZYN A;  4OCE A;  1XVQ A;  1K3O A;  2LRN A;  4TR1 B;  1A0R P;  4YQV A;  1UA5 A;  1JZD A;  2JU5 A;  3QFA C;  3DVX A;  2EIR A;  1R5A A;  3PGT A;  5BRT A;  2LNT A;  2OE3 A;  4FH8 A;  4MNN A;  3QOU A;  2OBK A;  4TOP A;  1JLV A;  1VGL A;  4GXZ A;  2HI7 A;  1XWA A;  4L0U A;  2BJX A;  2YWN A;  4EF0 A;  4LMV A;  1U87 A;  1H75 A;  4AF2 A;  3TJG A;  2J23 A;  2V6O A;  3HY2 A;  4GSS A;  2R0C A;  1SJZ A;  4NHZ A;  2LJR A;  3VK9 A;  1HNA A;  4EUY A;  2NPB A;  2J9H A;  2IMI A;  5J5N A;  3LG6 A;  3D22 A;  2A4H A;  5IPG A;  1TDI A;  2HSY A;  4ZIL A;  5JCG A;  1FB6 A;  2P5R A;  4NMU A;  1X5D A;  3ZL5 A;  3IXR A;  2EIO A;  6GSX A;  1VF1 A;  2LEG A;  2QA2 A;  4MMM A;  4HDE A;  2IFQ B;  1K0A A;  4JR6 A;  1IYI A;  2DML A;  3BBY A;  3KM6 A;  2H0H A;  1AIU A;  1CQH A;  3M1G A;  2VOC A;  2B7J A;  4POB A;  3ZLP A;  6GSV A;  1ZYP A;  3UL3 A;  3ZML A;  3QMX A;  2H75 A;  4I5Q A;  2VL3 A;  3Q19 A;  4F03 A;  3NOF A;  5J41 A;  1Z7R A;  2YZU A;  1FVJ A;  1U88 A;  3AY8 A;  3EYT A;  3O3T A;  5D9V A;  3P2A A;  2LS5 A;  4ILF A;  1SJI A;  3TKP A;  1FO5 A;  2JZS A;  3TKR A;  1EP8 A;  5A4U A;  2DJK A;  3FR6 A;  3GL3 A;  3KEB A;  1W89 A;  3M9K A;  1ABA A;  1M99 A;  1A2M A;  1UC7 A;  3HYP A;  5DAK B;  1YKA A;  3LXZ A;  2DKH A;  4OWY A;  4X0X A;  4XS1 A;  3A3T A;  3LGC A;  2JL4 A;  1PQN A;  2CAI A;  1WP0 A;  1GNW A;  2OE1 A;  3KCM A;  2FA4 A;  4K1F A;  1K0O A;  2OA7 A;  4AJ8 A;  4QQ7 A;  2ALB A;  1MDK A;  3BJ5 A;  2C0E A;  1O73 A;  5B6N A;  2FCH A;  3M9J A;  3APO A;  17GS A;  5HFK A;  2GTU A;  5JCW A;  4ECB A;  3BD2 A;  4POM A;  2Z9S A;  3N5O A;  2H0I A;  2WFC A;  1I9D A;  4HOJ A;  2YWM A;  2WRT A;  4ISD A;  5JWO B;  2IMK A;  1GTA A;  3D5J A;  4Q5F A;  4BL7 B;  3IAM 2;  2RUE A;  4DSR A;  4KDX A;  4TR0 A;  13GS A;  5F0G A;  3OR5 A;  4ID0 A;  2GQM A;  4Z2U A;  3RAZ A;  2H70 A;  1A2J A;  3F6F A;  3WGD A;  3KZQ A;  1A8L A;  4PX1 A;  3F8U A;  2MMA A;  3CXG A;  1K3Y A;  1F6M C;  2VCQ A;  1TP9 A;  4I8B A;  3G7I A;  1TTZ A;  2QC7 A;  4ACS A;  3HVS A;  1GNE A;  2FWE A;  4OMV A;  4KE3 A;  1SYX A;  1O8W A;  3I43 A;  2F3M A;  1FOV A;  1GL8 A;  3DWV A;  4USS A;  4WBR D;  3QD9 A;  4RI6 A;  5KEJ A;  4FIW A;  2P0G A;  3GTU B;  4ECJ A;  3APS A;  3G7J A;  3H8Q A;  1PN0 A;  4WF5 A;  4MDC A;  2LV3 A;  4HZ4 A;  1ERV A;  5DQY A;  3FHK A;  4O92 A;  3IDV A;  4GWR A;  1TOF A;  2GLR A;  5ELA A;  1TK8 B;  3DGQ A;  3CMI A;  4I2U A;  1YEX A;  1XFL A;  2R0G A;  5F05 A;  2AUV A;  1E6B A;  3D6I A;  1TU7 A;  1EV9 A;  3F4R A;  2LQQ A;  2C8U A;  2OKA A;  1GUM A;  3HZ8 A;  1ON4 A;  3ZMK A;  4IHU A;  1VF3 A;  5IOX A;  4RQR A;  5DAL A;  1PGT A;  3DEX A;  1G7O A;  5E4W A;  4EDZ A;  4NHW A;  1OYJ A;  3CSI A;  1XVW A;  4OFN A;  3IA1 A;  5A5K A;  1MD4 A;  3KTB A;  2AB6 A;  3S9F A;  2GT5 A;  3FZ4 A;  4JBB A;  2DJ1 A;  5B7C A;  3TKS A;  3QPM A;  2H6Z A;  3NZN A;  2O89 A;  2VLU A;  4Z2T A;  1ZL9 A;  3TRQ A;  5DDL A;  4EIQ A;  1IYH A;  5J4U A;  2IWT A;  1V9W A;  4F82 A;  1JFU A;  4IJI A;  1N2A A;  2H01 A;  3Q18 A;  1NHY A;  4PQH A;  5KN1 A;  4XS4 A;  2TIR A;  4P3Y B;  2IMF A;  5BMU A;  4RI7 A;  5IIZ A;  1XOA A;  2PVQ A;  3TB2 A;  1N8J A;  4IP6 A;  2VCW A;  1LBK A;  2IL3 A;  1MDJ A;  11GS A;  1A8Y A;  5GZZ B;  2A2P A;  1AC1 A;  1PRX A;  2C0D A;  5GAN D;  2QSI A;  2HT9 A;  3J7Y k;  6GST A;  4IEL A;  4G10 A;  1Z5Y E;  3D4T A;  3KGK A;  1SJ6 A;  2I3Y A;  2C3T A;  4J2F A;  5DAL B;  1C72 A;  2A2R A;  4XTS A;  4EC0 A;  1FG4 A;  1XIY A;  4ZL8 A;  3F4S A;  5G5F A;  5ECM B;  3MDK A;  2L4C A;  2PN8 A;  3KMN A;  1X9W B;  3SBC A;  2GS3 A;  4EVM A;  4HZ2 A;  4K2X A;  1YEP A;  4IP1 A;  3UVH A;  2BMX A;  1U3I A;  5HFG A;  2JZR A;  4KND A;  5AIX A;  3ZIJ A;  8GSS A;  2C1Y A;  3GKN A;  2FHE A;  4HEA 2;  2GQK A;  3FKF A;  4YKG A;  3GA4 A;  4NV2 A;  4BVX A;  2R4V A;  3C1S A;  1XWB A;  4NWY A;  2GGT A;  2WUL A;  3GH9 A;  3VUR A;  5CNW A;  2LRC A;  4K6X A;  4N30 A;  1T4Z A;  2HSM A;  3DD3 A;  2IME A;  3IR4 A;  2CT6 A;  2F8A A;  1G6W A;  3DKS A;  4TXO A;  2R0P A;  4FYB A;  3ZVJ D;  1EEJ A;  2I81 A;  4CY6 A;  1S3D A;  2GT6 A;  3ZYW A;  3TOU A;  1WPI A;  3KJY A;  4PTS A;  2V2G A;  2MMN A;  1PKW A;  4O5U A;  1YJ6 A;  4MJC A;  2X99 A;  3HJP A;  1BJX A;  1BG5 A;  1VF4 A;  3CRU A;  4O5R A;  2L57 A;  1WOU A;  1OC9 A;  5HFI A;  2YV9 A;  4D73 B;  2V41 A;  2QKE A;  2DJJ A;  2H1G A;  5DBQ A;  3HJO A;  4IQA A;  4OO4 A;  3TRP A;  5DVB A;  4ML6 A;  1O8X A;  2ZCT A;  1XOB A;  1X9S B;  2DC5 A;  4V1A p;  3KH9 A;  1GTB A;  4FYU A;  1G7E A;  1B4P A;  2H71 A;  4G19 A;  2HXK A;  1JHB A;  2CVB A;  2H0G A;  5GST A;  4HU7 A;  2MYG A;  4K0G A;  2L59 A;  2REM A;  1A0F A;  2XBI A;  1LJR A;  1X5C A;  4KAE A;  1GSE A;  4ECI A;  1TI3 A;  3HDC A;  2B1L A;  2WS2 A;  3EIN A;  2GZZ A;  4L5O A;  2VCT A;  4BVX B;  1VF2 A;  4KDY A;  5DCG A;  4V1A g;  4ICY A;  3FEU A;  5IMA A;  4GF0 A;  5EY6 A;  4G0L A;  1MD3 A;  1XPV A;  1OKD A;  3WT2 A;  4G0I A;  1B9X C;  2VUP A;  2O85 A;  1EGR A;  3GSS A;  5G30 A;  1URM A;  1GUK A;  1TK5 B;  2AAW A;  1PL1 A;  2F9S A;  4TR4 A;  3LYK A;  1GH2 A;  4IS0 A;  2CV4 A;  1WMJ A;  2PBJ A;  3IAS 2;  1NM3 A;  2E2G A;  3E9J B;  4LLR A;  3TDG A;  3GUS A;  3GMF A;  1EEM A;  2UZ8 A;  2VD1 A;  2I4A A;  3UAP A;  3CTG A;  3QFB C;  2M72 A;  3KD0 A;  3ZFB A;  5E59 A;  4BPY A;  4BVY A;  4RQX A;  5CO3 A;  3V1W A;  1Z6N A;  4ZBA A;  1ZMA A;  1R4W A;  1TK0 B;  3HXS A;  2L5L A;  3ME8 A;  2P31 A;  3C71 A;  2F8F A;  2G2Q A;  1K0M A;  1PL2 A;  1PD2 1;  3FZA A;  2C3N A;  1FHE A;  2GSR A;  1SU9 A;  2RM6 A;  1EWX A;  3U6V A;  1CQG A;  2R37 A;  1FW1 A;  1ZGN A;  2WGR A;  2DBC A;  1QQ2 A;  1YY7 A;  4EKZ A;  3A5W A;  2VCZ A;  2DMM A;  5AGY A;  1PA3 A;  4MZB A;  1PMT A;  1OE7 A;  1M2A A;  3TJB A;  3UBL A;  2AHE A;  3CSJ A;  2OAC A;  1A23 A;  4MPG A;  4K5R A;  1SD8 A;  4GRF A;  4ML1 A;  4O7H A;  4MK3 A;  3H79 A;  2WZ9 A;  5D8I A;  2H74 A;  2K6V A;  1E2Y A;  2VD0 A;  1QUW A;  5ABR A;  2LQO A;  2RUF A;  4HQZ A;  1GSY A;  3VFI A;  4JRR A;  4QL7 A;  2O7K A;  4ZBB A;  5ECR B;  1I5G A;  1WE0 A;  4KSO A;  1OE8 A;  2DIY A;  3HKR A;  5F8B A;  2VL9 A;  3RDW A;  3EC3 A;  3DIE A;  2D2Z A;  4HJM A;  2V6K A;  4OFT A;  3FW2 A;  4L5L A;  1SKS B;  2R6K A;  3LSZ A;  18GS A;  1ZYE A;  3C1R A;  4G2E A;  3KIJ A;  3HVX A;  1M0U A;  4CHS A;  3TRX A;  1KNG A;  1LU4 A;  2GDR A;  4ULX A;  4MZW A;  3I6A A;  14GS A;  3VPT A;  3CSH A;  1KTE A;  1GSQ A;  2B3S A;  4HUA A;  5ENU A;  5KN3 A;  2FY6 A;  2H1A A;  3TKQ A;  5H5Q A;  1T8E B;  1B9Y C;  1GTI A;  3CTF A;  1K0D A;  4YQU A;  2YCD A;  1ILO A;  4TVE A;  2KUC A;  4KX4 A;  2B6M A;  5LCZ A;  4AJ7 A;  1GSF A;  3WGE A;  2FA8 A;  3DXB A;  3G9B A;  4KB3 A;  3EPT A;  1M2B A;  4DEJ A;  2CA8 A;  4XRD A;  2I1U A;  5CP1 A;  4PGT A;  3EU4 A;  4KDU A;  3ZIV A;  1EV4 A;  1B4Q A;  1ZOF A;  1K0N A;  5EVO A;  1TI1 A;  1K0C A;  3P7X A;  2BTO T;  3DRN A;  2C80 A;  1V40 A;  2TRC P;  1AUC A;  4N0Z A;  2CAQ A;  5EPF A;  5G1L A;  2DIZ A;  1WRY A;  2NBS A;  3EUR A;  4POL A;  3HZ4 A;  2H30 A;  4TN8 A;  2WCI A;  3EE2 A;  2AYT A;  4I2T A;  3W8J A;  2MMO A;  2B5Y A;  2RII A;  3TKS C;  5DQS A;  5ECN B;  4KCA A;  1X9M B;  3VI7 A;  5LD0 A;  2YNX A;  2G0F A;  2YPM A;  3TJJ A;  3E0U A;  1JZO A;  1TRV A;  2B1K A;  2NDO A;  4ZB8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...