4ZL9A

Crystal structure of pseudomonas aeruginosa dsba e82i: crystal iii
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
187
structure length
187
Chain Sequence
DYTAGKEYVELSSPVPVSQPGKIEVVELFWYGCPHCYAFEPTIVPWSEKLPADVHFVRLPALFGGIWNVHGQMFLTLISMGVEHDVHNAVFEAIHKEHKKLATPEEMADFLAGKGVDKEKFLSTYNSFAIKGQMEKAKKLAMAYQVTGVPTMVVNGKYRFDIGSAGGPEETLKLADYLIEKERAAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thiol:disulfide interchange protein DsbA
publication title Sent packing: protein engineering generates a new crystal form of Pseudomonas aeruginosa DsbA1 with increased catalytic surface accessibility.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 64
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2015-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4zl9A00
5G30A 3GIXA 3P90A 4MDCA 4ISDA 3GURA 3TOTA 4LL4B 4TR1B 4FO5A 1QMVA 1RQMA 1AQWA 5IMVA 1XW5A 3VWVA 3K8NA 4F9ZA 4MK3A 3ZFLA 3DVXA 1ACVA 3GFKA 2C0EA 5F8BA 4OD7A 1HD2A 3QMXA 1YY7A 4V1Ap 5EPFA 4JZQA 10GSA 2VL3A 1PN9A 5L71A 1F37A 3TJGA 1QGVA 3LWAA 1T7PB 4MZBA 6GSYA 2LS5A 2LNTA 1YZXA 3O76A 1R5PA 3CRTA 2IIYA 3BOAA 2OE1A 2H75A 3UAPA 3A2VA 1FB6A 3HDCA 4Q5FA 4K1FA 3VK9A 3FZ9A 4POMA 4AJ7A 2PUKC 4GSNA 1AQVA 1JHBA 3HCZA 3EU3A 4XS1A 4IHUA 3UMAA 1ZOFA 1GSUA 2WGRA 3WGEA 5GAPD 1XVQA 4ECJA 1USBA 1F9MA 2F3MA 1XIYA 1FOVA 1YKCA 3O3TA 3WGXA 4KB3A 4NAXA 2IMDA 3KEBA 2I4AA 4YAVA 3N5OA 3HKRA 1PGTA 2VD1A 2LJAA 3EMXA 3FZAA 3HVSA 4I97A 2VUPA 2LJRA 1FVKA 4JEDA 2B1KA 4N0ZA 3TKSA 1XWKA 1OKTA 3IV4A 2LRTA 4GLTA 3D6IA 4BWSA 1TK0B 3DEXA 2IN3A 2HSHA 4MJCA 4KDYA 4ZB9A 2V6KA 1PKWA 1O7UA 5IPGA 1A8YA 2ZUPA 3LXTA 4ECBA 1PSQA 2X8HA 4ZB6A 1KTEA 2YCDA 5GSTA 2EIQA 4PNGA 1TI3A 1LJRA 1KEBA 4FYCA 1B48A 1V2AA 4ZL8A 1PL2A 3ZIVA 2WZ9A 1PRXA 2YWIA 4NMUA 1SK0A 1X5EA 3DKSA 4JR6A 1A0FA 4NV5A 1H75A 3UVTA 4IP1A 2YV9A 3H8QA 4I5QA 2E2MA 5DALB 3GKKA 1K3YA 6GSVA 1X9SB 1E6BA 1ABAA 2P5QA 3KH7A 4MF6A 3LYKA 3TKRA 2F9SA 16GSA 3BBYA 3VWUA 5ID2A 1KNGA 3CTGA 1XOAA 4L5LA 4OWYA 3QD9A 1K0DA 2R3XA 1LBKA 2TIRA 1GSSA 2A2RA 4K9ZA 2L4QA 1SD9A 4XS4B 5GZZB 3M0FA 2DJ2A 2IFQB 3J7Yk 5ENUA 3CRUA 5AGYA 2JL4A 1OE7A 2E0QA 1O8XA 1SU9A 3L9VA 1GTBA 1W89A 2G0FA 1HNCA 4HJMA 2YN1A 4FIWA 5D8IA 1EGOA 4POLA 3E9JB 4IBPA 2F8AA 1XW9A 4N10A 4TN8A 2X8CA 4YQVA 1M7TA 3CSIA 3HJMA 2FWGA 3KXOA 4LMWA 1ZMAA 4G2EA 2FLSA 4KW6A 3IXRA 3LGCA 2N5AA 4TR3A 3F4TA 4KSMA 2B5XA 3GTUB 2HZEA 2FY6A 3LEFA 2H73A 3MNGA 4ML6A 5CREA 2PWJA 3EMPA 1UC7A 2KOKA 3HA9A 4DSRA 2YZHA 4WF4A 3TRPA 1X9WB 3TRQA 3US3A 5LNKe 3M1GA 4K0GA 3Q74A 2V6OA 2OKAA 2VCZA 4ID0A 5IQYA 3KTLA 2LJKA 1OC9B 3EC3A 1GP1A 4HI7A 2K8VA 2GZPA 1UN2A 4TXOA 4DSQA 1MDJA 5IMAA 4TKYA 2OADA 2VCVA 2CVDA 3C1RA 5HFGA 2L5OA 1N2AA 5G31A 5EY6A 3PINA 2DJJA 5JWRB 1Q98A 4E8HA 2HLSA 5KEJA 1EV4A 1TU8A 2PERA 4MJAA 4NWYA 3ERGA 1AQXA 1SK1A 1R4WA 1YEXA 3QAGA 4JU5A 1PX7A 3E3EA 5G5FA 1MD4A 6GSXA 1PL1A 1NHOA 3HZ4A 1EGRA 3LJRA 2LSTA 1X0RA 3F6FA 3FK8A 2RLIA 2B1LA 2IL3A 3IAS2 1R5AA 1U87A 1OC3A 4O7HA 3ERWA 1Z7RA 4WXTA 6GSTA 1UVZA 1O8WA 3ZYWA 1DBYA 1K0BA 5FT3A 5IMDA 3CBUA 3HVXA 1TKDB 4CHSA 2GLRA 4ZBDA 3L9SA 1NM3A 4J56E 2PVQA 3L78A 3E0UA 1SKWB 5ECRB 3HJOA 5GSSA 1A23A 4L8EA 1AC1A 3MAKA 1GUKA 2YWOA 2CX3A 3IBHA 1VGLA 3ERFA 4CW9A 3KMNA 3F3RA 1TRSA 2I3YA 1TTZA 3H4KA 3NIVA 2J9HA 3HVVA 4TW5A 1J9BA 4V2NA 1O85A 1G6WA 2CAIA 3VFIA 5J41A 4NHWA 2GVPA 1WIKA 3APSA 2DBCA 2F51A 3GX0A 4KSOA 1W4VA 2HFDA 1WWJA 3QFAC 3FW2A 2CVBA 2OBIA 2X8GA 1XFLA 2I9HA 4X1UA 3G9BA 4TXOB 5ECQB 3IK9A 2N5BA 3WD6A 4KDXA 1X9MB 2FA8A 1QK8A 4HU7A 2L5LA 3IRAA 4PQIA 4GQFA 4EF0A 5IO2A 2H1GA 1THOA 1VF2A 1G0TA 4K7NA 5J9CA 2MBTA 4MMMA 3KGKA 4MPGA 2H71A 1EZKA 1LU4A 2FWFA 5D93A 1F3BA 5A5KA 2OE0A 2H72A 1EOHA 5ECHB 5CRGA 1MD3A 2C3QA 3RHCA 4F0CA 5DJMA 4IQ1A 3TGZA 2KLXA 4N30A 1GNWA 4OMVA 5JCUA 4WF5A 6GSSA 2EIOA 1V40A 4ILFA 3LYPA 2C0GA 2KUCA 1TRVA 1JLWA 5KN3A 3FR9A 2B5EA 1HYUA 2VCQA 4EVMA 5JCWA 1EP7A 2YWNA 3EE2A 2WFCA 3D21A 2TRCP 1WJKA 3W8JA 3TJKA 3IC4A 2YJHA 3QOUA 3D5JA 5H5RA 1SENA 1PD21 2FWHA 3IA1A 1FHEA 2YNXA 2GZZA 2JSZA 1A2JA 3C8EA 2VO4A 2OACA 2ZCTA 4AJ6A 1AXDA 2GQKA 2H74A 3KP9A 4K7IA 2J23A 3UOMA 2R6KA 5IMCA 2O8VB 4HQSA 5DALA 4ZL7A 4IGJA 2K9FA 2H1DA 4BL7A 1S3AA 2L6DA 3HHVA 3UBKA 1G7EA 2VLVA 4MH2A 1BG5A 2HYXA 4CDOA 4V2LA 3GN3A 3HZ8A 1CQHA 3WT2A 3GH9A 4F03A 1HQOA 5CAXA 2E2GA 4G10A 1SJ6A 2FUG2 1GSEA 4HUAA 4PQHA 3RPPA 3CMIA 1B4PA 4KCEA 2MBSA 3TCOA 3S9FA 5C04A 3ZMLA 4BWQA 1U88A 2JZTA 1F3AA 1VRSD 1ZYEA 1J08A 1F6MC 3W8SA 1XPVA 2MYGA 4XS4A 1V57A 4V2MA 5IIZA 2IFQA 4MCUA 2MMAA 1MEKA 1VF3A 2AYTA 3QCPA 1BJXA 4AF2A 4H86A 3UJ1A 2GS3A 4RQXA 3Q6OA 4GSTA 4GCIA 3MWHA 1A8LA 3IPZA 4ML1A 1EWXA 2R4VA 2LQQA 3FEUA 2YJ7A 2XHFA 1YKAA 2FNOA 1XWAA 2PPTA 2VIMA 3GL3A 5DCHA 4BVYA 5DQSA 2JSYA 2XBQA 3DYRA 14GSA 4ZBAA 1WRYA 2AJQB 4KAEA 2L4CA 3O6TA 3GTUA 1PKZA 3DIEA 2IWTA 3RPNA 2FHEA 2DJ3A 3TDGA 4O32A 5IMFA 5DAKB 4IVFA 4ZXGA 3BCKA 4XHMA 2B7JA 1PMTA 1SYXA 3A2WA 5J3RA 1OC9A 1SKRB 2L57A 3HXSA 1GUMA 1XBSA 3G7YA 1FG4A 1T00A 2YZUA 5JWQB 4BPYA 2H8LA 2GT5A 3FR3A 3F6DA 1TP9A 3QDNA 5A4WA 4NXIA 4EC0A 3GX8A 2GSRA 5D9TA 4I2TA 1BX9A 3F4RA 3KTBA 4KH7A 4MPFA 4WETA 1SKSB 1OYJA 2N5FA 1YF0A 2E7PA 3C73A 2DMLA 5J4UA 3TJBA 2VL2C 4WEYA 3WYWA 2GDRA 2DIYA 1R26A 2H1AA 3H79A 2H76A 5J5NA 4ECIA 1M99A 4HJ2A 1TDIA 2O85A 1TRUA 3FR6A 4L5OA 2IMEA 4K0NA 4EE0A 3UBLA 1T4YA 1YF1A 4IS0A 2FA4A 3P7XA 4XCSA 3D0ZA 3DRNA 5DBQA 2BTOT 4Q5NA 1ZL9A 1XXUA 3DWVA 5GAND 2KP1A 2P5RA 1FAAA 4V1Ag 3KIJA 3VLNA 2YWMA 1VF4A 3IE3A 2H01A 2HNLA 1BEDA 4N11A 4KA0A 1JLVA 3DXBA 3F0IA 2ON7A 2IPAA 5FHIA 1PA3A 1OVNA 1V58A 2IJYA 3C71A 3F4SA 3MSZA 3NZNA 3U6VA 2JADA 1PX6A 1M9AA 1T1VA 3ZLPA 1NSWA 3ISOA 5G2ZA 1B4QA 2MMZA 2B7KA 3GYKA 1GLPA 1OKDA 2H19A 2C0DA 4NPBA 1QQ2A 2CZ3A 5D96A 1Y6EA 1EEJA 3P8WA 1GLQA 4PUFC 3TOUA 4IP6A 5A4VA 3LFLA 4POKA 1XCCA 3TKSC 1K0MA 1TJDA 3UARA 1BQ7A 1GSYA 1Q4JA 2BJXA 3VI5A 4MJBA 2XBIA 2LNSA 2KP2A 5ECIB 4EDZA 5ELAA 1UA5A 4KDUA 4YH2A 1FW1A 11GSA 2EC4A 2WULA 3PH9A 2PGTA 3GRXA 4OFNA 1G7OA 1GSDA 3V1WA 4FH8A 5G1LA 3G7JA 1GUHA 1J0FA 2GSTA 3C1SA 3CXGA 1M2DA 1TOFA 7GSSA 1I5GA 5CRHA 3N9JA 2EIRA 1IYHA 2Z9SA 5ECSA 4GXZA 3LORA 1Z9HA 3PR8A 3VI7A 2GT6A 3KMOA 3KH9A 3A3TA 4GTUA 5KN2A 1DE1A 5EL8A 1U3IA 3ME8A 4XRDA 4HZ4A 4WR5A 2JZSA 4EXJA 1AIUA 4QL7A 1B8XA 2MMOA 2CV4A 4LMVA 2NBSA 5JWOB 3CSHA 1IYIA 2P0GA 5H5QA 1WE0A 2OBKA 4F2IA 2GSQA 2GGTA 2VCWA 2DJKA 2H0GA 4ZL9A 1EEMA 5AISA 1GL8A 2H66A 3KJYA 1GTUA 2LUSA 4J2FA 5ABRA 1KBNA 3KM6A 4MA9A 2R2JA 1Y25A 5F05A 3GNJA 4PNFA 1YJ6A 2BMXA 1K3LA 4TVEA 2PN8A 4NV2A 1DUGA 1K0AA 4PQ1A 2CZ2A 2YPMA 1C72A 1QXHA 2XC2A 4HOJA 2IMIA 2L59A 4QL9A 3GHAA 3QFBC 1YEPA 3VWXA 2PMTA 4RI7A 4IW9A 4MZWA 4JBBA 3CTFA 2GZYA 1TK8B 4G19A 3QPMA 2QSIA 4G9HA 1GULA 4RUVA 4Z7XA 4PURA 5DQYA 4D73A 4E8EA 1TK5B 2WJUA 3UVHA 3WT1A 2DSAA 2ON5A 2B6MA 2NTOA 4GSSA 3KD0A 3KZQA 5LD0A 1Z6MA 4GWRA 1K0NA 3BJ5A 1NHYA 3ME7A 1M0UA 4NHZA 4MF7A 13GSA 20GSA 5ECMB 3VPTA 1SL0B 3APQA 4XIHA 5G5EA 2R5GA 2YV7A 2VM2A 4BVXA 2VCTA 1MDIA 2B5YA 5KN0A 1E2YA 2LTKA 3FRCA 3TKQA 1GH2A 4PGTA 1I9DA 4ULXA 2WB9A 2H30A 2XPEA 1A24A 3GKXA 3OR5A 2GQLA 1A2LA 3HJPA 3IAM2 1AAZA 1THXA 5HFKA 2HE3A 1XWBA 2RIIA 3GSTA 2AHEA 2X64A 4L0WA 4GRFA 4WKWA 8GSSA 4OO5A 2A4VA 5DAKA 4JE1A 2FCHA 3UL3A 2JZRA 1TW9A 3FHKA 3DD3A 1VF1A 1JZWA 2HI7A 3IR4A 3ZIJA 3SWLA 5AN1A 1ST9A 3ZRDA 2OE3A 1A2MA 5IMZA 1ERUA 4MABA 2WCIA 5CRDA 2D2ZA 4YQMA 1CQGA 3JCML 2G2QA 5J9BA 1GNEA 2HXKA 2CVKA 3HYPA 2AAWA 2MMNA 2M46A 3MDKA 2OJLA 5ECOB 3G7IA 2HRNA 5CP1A 2DJ1A 3F8UA 3QAWA 4HU9A 1M2BA 1XOBA 2VAFA 3U5RE 1U6TA 2AB6A 1EOGA 4EL1A 4EKZA 4ZBBA 4LL1B 5CO3A 4PXOA 2CT6A 1YDKA 4IELA 1TI1A 3P2AA 1S3DA 3TJFA 1M9BA 2M80A 5ECNB 3ZITA 4D73B 1O81A 3IHQA 1BAYA 18GSA 4YQUA 1GRXA 2CQ9A 4KGIA 4K7OA 3GSSA 1MTCA 2ES7A 17GSA 3VWWA 5A4UA 3F3QA 3EVIA 5D9XA 2XPDA 2V1MA 1ERTA 1GWCA 1WMJA 2DLXA 1RK4A 2VLUA 4DSSA 2O89A 1JFUA 1X5DA 1QFNA 1XVWA 1AUCA 5C00A 2I1UA 4KNDA 4Q5RA 2DJ0A 2B3SA 19GSA 3W6GA 1R7HA 4RI6A 5LCZA 4I6XA 2AUVA 1FB0A 5CYYA 4HS1A 3LQ7A 2V32A 2H6XA 2P31A 1Z7PA 1F2EA 2V2GA 1RW1A 3ZZXA 2LKUA 4KCAA 4K2DA 1DSBA 4GF0A 4XTSA 4TOPA 2C80A 4O5RA 4J57E 2M72A 2LEGA 1K0CA 4F82A 3HY2A 1GTIA 2K18A 5HR0A 2F8FA 1T4ZA 1BYEA 1G6YA 5IPHA 2IMFA 2DIZA 3I9V2 3TRXA 3M3MA 2NPBA 2A2SA 5DCGA 4I8BA 4XS6A 3RAZA 2H6YA 1OAZA 3NOFA 3PGTA 2MZCA 4HDEA 5D9VA 4DEJA 2O87A 4TR4A 3QAVA 5COHA 3ZVJA 3EWLA 2C8UA 3ZMKA 2CA8A 2TRXA 1ZCPA 1XWGA 4ZB8A 4IJIA 1ML6A 3L9UA 5E59A 1O6JA 1T3BA 2V41A 3IDVA 5DDLA 3I69A 2HSYA 3TB2A 4OCFA 1K0OA 2RM5A 1B9YC 2KHPA 5ELGA 5AIXA 4MZCA 2LQOA 4EUYA 1YQ1A 1GTAA 4WR4A 4IKHA 2CAQA 4EO3A 2C4JA 2R37A 3UEMA 3TUEA 5F06A 5KN1A 5HQPA 4DSSB 5ECPB 1SD8A 3VURA 3APOA 1JZOA 1O73A 3GH6A 2LV3A 2VL9A 3FZ4A 5E4WA 2H6ZA 4KE3A 4RQRA 2L6CA 3KP8A 2AV4A 4KX4A 2FGXA 1T8EB 3M8NA 1V9WA 3Q19A 2VCXA 4ZILA 1SK2A 4LA1A 4K6XA 1DE2A 2LRNA 2WS2A 4PX1A 3LXZA 5ECLB 4HQZA 1N8JA 4OFMA 1V98A 4X43A 1SYRA 4HEA2 3GKNA 3UIWA 2RUEA 4HZ2A 1HNBA 5JCGA 2X99A 2C3NA 4FYBA 5IOXA 5IO0A 3ZFBA 4PUAA 6GSWA 5CRWA 3EURA 1AW9A 5HR1A 2RUFA 4Q5QA 3TKSE 1ERWA 4KUNA 1NW2A 1Z6NA 1ZGNA 4ACSA 1FO5A 1M2AA 3M9JA 3D4TA 5DJLA 2NVLA 2K8SA 3QR6A 3GL5A 5H5SA 4POBA 1ZYQB 2OA7A 2VD0A 4MLYA 1OE8A 2PU9C 12GSA 4JRRA 3A5WA 5FWGA 3GA4A 2PBJA 2DC5A 2FD3A 2WRTA 3Q18A 1XW6A 3I6AA 4OCEA 3D22A 4XRAA 2REMA 2ZNMA 3F9UA 4K8MA 1ERVA 1K3OA 4ECCA 1ILOA 3EYTA 3F63A 3DGQA 4L0UA 5D73A 1X5CA 5HR2A 1B9XC 3H1NA 1SJZA 2LRCA 5ID2B 3D4MA 4DVCA 2I81A 2YOIA 2QC7A 1S3CA 1HNAA 4TXVA 3BCIA 4MF5A 2YANA 1EP8A 2QKEA 1TU7A 4X0XA 2QGVA 4IQAA 2JU5A 2C0FA 1WP0A 4OFTA 3DVWA 3L0HA 5B6MA 5B7CA 1JZDA 3FZ5A 3EINA 2GTUA 3DMLA 2C1YA 3H93A 1PQNA 2H0IA 5CNWA 4MH3A 4TR1A 1GSQA 5INYA 1TRWA 3FYGA 2WDUA 2IMKA 6GSUA 3GKMA 1XZOA 2C3TA 3SBCA 1MDKA 3AY8A 4GQCA 2DMMA 5HR3A 2HZEB 4YAPA 1SJIA 3J7Yb 4QQ7A 5EVOA 2H70A 5IM9A 3CYNA 1OC8A 4N0VA 3RDWA 3RHBA 3IK7A 4JR4A 3EU4A 5G1KA 3RBTA 5DVBA 5D9WA 1EV9A 3ZREA 2FWEA 3ZTLA 3I43A 3FKFA 1FVJA 4EDYA 3TJJA 3L4NA 4AJ8A 1TXXA 2HZFA 3BD2A 22GSA 3GUSA 5F07A 2VM1A 4LLRA 1Z3EA 3VPQA 2GSSA 4OO4A 3FY7A 2VLTA 1U3AA 5B6NA 2O7KA 4MP4A 1WPIA 2K6VA 3LSZA 5B8BA 3C7MA 4MJEA 4I2UA 3IOSA 9GSSA 5IOWA 3HD5A 5AIVA 1XWCA 3LG6A 1ON4A 1QUWA 1SL1B 1H4OA 5B8AA 4F0BA 2HT9A 1SL2B 4TRXA 5F0GA 3GMFA 2YP6A 3GV1A 4P3YB 4BA7A 4FYUA 3TKPA 3ZVJD 2JACA 2PVOC 3ED3A 5ECKB 3ZL5A 2H0HA 5HFIA 4WBJA 1URMA 3A2XA 4IJ3A 1Z5YE 3R2QA 2VOCA 4ZIJA 3WGDA 3M9KA 1WOUA 4O92A 1A0RP 2CX4A 1ZZYA 4IN0A 2NDOA 2HRFA 2RM6A 3KCMA 2ALBA 4TR0A 1GSFA 4AGSA 2H1BA 3CSJA 2GQMA 2VL2A 1JZRA 4WBRD
chains in the Genus database with same CATH superfamily
5G30A 3GIXA 3P90A 4MDCA 4ISDA 3GURA 3TOTA 4LL4B 4TR1B 4FO5A 1QMVA 1RQMA 1AQWA 5IMVA 1XW5A 3VWVA 3K8NA 4F9ZA 4MK3A 3ZFLA 3DVXA 1ACVA 3GFKA 2C0EA 5F8BA 4OD7A 1HD2A 3QMXA 1YY7A 4V1Ap 5EPFA 4JZQA 10GSA 2VL3A 1PN9A 5L71A 1F37A 3TJGA 1QGVA 3LWAA 1T7PB 4MZBA 6GSYA 2LS5A 2LNTA 1YZXA 3O76A 1R5PA 3CRTA 2IIYA 3BOAA 2OE1A 2H75A 3UAPA 3A2VA 1FB6A 3HDCA 4Q5FA 4K1FA 3VK9A 3FZ9A 4POMA 4AJ7A 2PUKC 4GSNA 1AQVA 1JHBA 3HCZA 3EU3A 4XS1A 4IHUA 3UMAA 1ZOFA 1GSUA 2WGRA 3WGEA 5GAPD 1XVQA 4ECJA 1USBA 1F9MA 2F3MA 1XIYA 1FOVA 1YKCA 3O3TA 3WGXA 4KB3A 4NAXA 2IMDA 3KEBA 2I4AA 4YAVA 3N5OA 3HKRA 1PGTA 2VD1A 2LJAA 3EMXA 3FZAA 3MYDA 3HVSA 4I97A 2DKHA 2VUPA 2LJRA 1FVKA 4JEDA 2B1KA 4N0ZA 3TKSA 1XWKA 1OKTA 3IV4A 2LRTA 4GLTA 3D6IA 4Z2RA 4BWSA 1TK0B 3DEXA 2IN3A 2HSHA 4MJCA 4KDYA 4ZB9A 2V6KA 1PKWA 1O7UA 5IPGA 1A8YA 2ZUPA 3LXTA 4X4JA 4ECBA 1PSQA 2X8HA 4ZB6A 1KTEA 2YCDA 5GSTA 2EIQA 2HRKA 4PNGA 1TI3A 1LJRA 1KEBA 4FYCA 1B48A 1V2AA 4ZL8A 1PL2A 3ZIVA 2WZ9A 1PRXA 2YWIA 4EIPA 4NMUA 1SK0A 1X5EA 3DKSA 4JR6A 1A0FA 4NV5A 1H75A 3UVTA 4IP1A 2YV9A 3H8QA 4I5QA 2E2MA 5DALB 3GKKA 1K3YA 6GSVA 1X9SB 1E6BA 4BL7B 1ABAA 2P5QA 3KH7A 4MF6A 3LYKA 3TKRA 2F9SA 16GSA 3BBYA 3VWUA 5ID2A 1KNGA 3CTGA 1XOAA 4L5LA 4OWYA 3QD9A 1K0DA 2R0GA 2R3XA 1LBKA 2TIRA 1GSSA 2A2RA 4K9ZA 2L4QA 1SD9A 4XS4B 5GZZB 3M0FA 2DJ2A 2IFQB 3J7Yk 5ENUA 5KOXA 3CRUA 5AGYA 2JL4A 1OE7A 2E0QA 1O8XA 1SU9A 3L9VA 1GTBA 1W89A 2G0FA 1HNCA 4HJMA 2YN1A 4FIWA 5D8IA 1EGOA 4POLA 3E9JB 4IBPA 2F8AA 1XW9A 4N10A 4TN8A 2X8CA 4YQVA 1M7TA 3CSIA 3HJMA 2FWGA 3KXOA 4LMWA 1ZMAA 4G2EA 4BVYB 2FLSA 4KW6A 3IXRA 3LGCA 2N5AA 4TR3A 3F4TA 4KSMA 2B5XA 3GTUB 2HZEA 2FY6A 3LEFA 2H73A 3MNGA 4ML6A 5CREA 2PWJA 3EMPA 1UC7A 2KOKA 3HA9A 4DSRA 2YZHA 4WF4A 3TRPA 1X9WB 3TRQA 3US3A 5LNKe 3M1GA 4K0GA 3Q74A 2V6OA 2OKAA 2VCZA 4ID0A 5IQYA 3KTLA 2LJKA 1OC9B 3EC3A 1GP1A 4HI7A 2K8VA 4K2XA 2GZPA 1UN2A 4TXOA 4DSQA 1MDJA 5IMAA 4TKYA 2OADA 2VCVA 2CVDA 3C1RA 4KF9A 5BMUA 5HFGA 2L5OA 1N2AA 3IC8A 5G31A 5EY6A 3PINA 2DJJA 5JWRB 1Q98A 4E8HA 2HLSA 5KEJA 1EV4A 1TU8A 2PERA 4MJAA 4NWYA 3ERGA 1AQXA 3MIXA 1SK1A 1R4WA 1YEXA 3QAGA 4JU5A 1PX7A 3E3EA 5G5FA 1MD4A 6GSXA 1PL1A 1NHOA 3HZ4A 1EGRA 3LJRA 2LSTA 2QA1A 1X0RA 3F6FA 3FK8A 2RLIA 2B1LA 2IL3A 3IAS2 1R5AA 1U87A 1OC3A 4O7HA 3ERWA 1Z7RA 4WXTA 6GSTA 1UVZA 1O8WA 3ZYWA 1DBYA 1K0BA 5FT3A 5IMDA 3CBUA 3HVXA 1TKDB 4CHSA 2GLRA 4ZBDA 3L9SA 1NM3A 4J56E 2PVQA 3L78A 3E0UA 1SKWB 5ECRB 3HJOA 5GSSA 3CQFA 1A23A 4L8EA 1AC1A 3MAKA 1GUKA 2YWOA 2CX3A 3IBHA 1VGLA 3ERFA 4CW9A 3KMNA 3F3RA 1S3RA 1TRSA 2I3YA 1TTZA 3H4KA 3NIVA 4O5QA 2J9HA 3HVVA 4TW5A 1J9BA 4V2NA 1O85A 1G6WA 2CAIA 3VFIA 5J41A 4NHWA 2GVPA 1WIKA 3APSA 4USSA 2DBCA 2F51A 3GX0A 4KSOA 1W4VA 2HFDA 1WWJA 3QFAC 3FW2A 2CVBA 2OBIA 2X8GA 1XFLA 2I9HA 4X1UA 3G9BA 4TXOB 5ECQB 3IK9A 2N5BA 3WD6A 4KDXA 1X9MB 2FA8A 1QK8A 4HU7A 2L5LA 3IRAA 4PQIA 4GQFA 4EF0A 5IO2A 2H1GA 4YKFA 1THOA 1VF2A 1G0TA 4K7NA 5J9CA 2MBTA 4MMMA 3KGKA 4MPGA 2H71A 1EZKA 1LU4A 2FWFA 5D93A 1F3BA 5A5KA 2OE0A 2H72A 1EOHA 5ECHB 5CRGA 1MD3A 2C3QA 3RHCA 4F0CA 5DJMA 4IQ1A 3TGZA 2KLXA 4N30A 1GNWA 4OMVA 5JCUA 4WF5A 6GSSA 2EIOA 1V40A 4ILFA 3LYPA 2C0GA 2KUCA 1TRVA 1JLWA 5KN3A 3FR9A 2B5EA 1HYUA 2VCQA 4EVMA 5JCWA 1EP7A 2YWNA 3EE2A 2WFCA 3D21A 2TRCP 1WJKA 3W8JA 3TJKA 3IC4A 2YJHA 3QOUA 3D5JA 2X4AA 5H5RA 1SENA 1PD21 2FWHA 3IA1A 1FHEA 2YNXA 2GZZA 2JSZA 1A2JA 3C8EA 2VO4A 2OACA 2ZCTA 4AJ6A 1AXDA 2GQKA 2H74A 3KP9A 4K7IA 2J23A 3UOMA 2R0PA 2R6KA 5IMCA 2O8VB 4HQSA 5DALA 4ZL7A 4IGJA 2K9FA 2H1DA 4BL7A 1S3AA 2L6DA 3HHVA 3UBKA 1G7EA 2VLVA 4MH2A 1BG5A 2HYXA 4CDOA 4V2LA 3GN3A 3HZ8A 1CQHA 3WT2A 3GH9A 4F03A 1HQOA 5CAXA 2E2GA 4G10A 1SJ6A 2FUG2 1GSEA 4G0KA 4HUAA 2HRAA 4PQHA 3RPPA 3CMIA 1B4PA 4KCEA 2MBSA 3TCOA 3S9FA 5C04A 3ZMLA 4BWQA 1U88A 2JZTA 1F3AA 1VRSD 1ZYEA 1J08A 1F6MC 3W8SA 1XPVA 2MYGA 4XS4A 1V57A 4V2MA 5IIZA 3LW9A 2IFQA 4MCUA 2MMAA 1MEKA 1VF3A 2AYTA 3QCPA 1BJXA 4AF2A 4H86A 3UJ1A 2GS3A 4RQXA 3Q6OA 4GSTA 4Z2UA 4GCIA 3MWHA 1A8LA 3IPZA 4BVXB 4ML1A 1EWXA 2R4VA 2LQQA 3FEUA 2YJ7A 2XHFA 1YKAA 2FNOA 1XWAA 2PPTA 2VIMA 3GL3A 5DCHA 4BVYA 5DQSA 2JSYA 2XBQA 3DYRA 14GSA 4ZBAA 1WRYA 2AJQB 4KAEA 2L4CA 3O6TA 3GTUA 1PKZA 3DIEA 2IWTA 3RPNA 2FHEA 2DJ3A 1M3JA 3TDGA 2X49A 4O32A 5IMFA 5DAKB 4IVFA 4ZXGA 3BCKA 4XHMA 2B7JA 1PMTA 1SYXA 3A2WA 5J3RA 1OC9A 1SKRB 2L57A 3HXSA 1GUMA 1XBSA 3G7YA 1FG4A 1T00A 2YZUA 5JWQB 4O5UA 4BPYA 4BIKA 2H8LA 2GT5A 3FR3A 3F6DA 1TP9A 3QDNA 5A4WA 4NXIA 4EC0A 3GX8A 2GSRA 5D9TA 4I2TA 1BX9A 3F4RA 3KTBA 4KH7A 4MPFA 4WETA 1SKSB 1OYJA 2N5FA 1YF0A 2E7PA 3C73A 2DMLA 5J4UA 3TJBA 2VL2C 4WEYA 3WYWA 2GDRA 2DIYA 1R26A 2H1AA 3H79A 2H76A 5J5NA 4ECIA 1M99A 4HJ2A 1TDIA 2O85A 1TRUA 3FR6A 4L5OA 2IMEA 4Z2TA 4K0NA 4EE0A 3UBLA 1T4YA 1YF1A 4IS0A 2FA4A 3P7XA 4XCSA 3D0ZA 3DRNA 5DBQA 2BTOT 4Q5NA 1ZL9A 1XXUA 3DWVA 5GAND 2KP1A 2P5RA 1FAAA 4V1Ag 3KIJA 3VLNA 2YWMA 1VF4A 3IE3A 2H01A 2HNLA 1BEDA 4N11A 4KA0A 4PTSA 1JLVA 3DXBA 3F0IA 2ON7A 2IPAA 5FHIA 1PA3A 1OVNA 1V58A 2IJYA 3C71A 3F4SA 3MSZA 3NZNA 1XG8A 3U6VA 2JADA 1PX6A 1M9AA 1T1VA 3ZLPA 1NSWA 3ISOA 5G2ZA 1B4QA 2MMZA 2B7KA 3GYKA 1GLPA 1OKDA 2H19A 2C0DA 4NPBA 1QQ2A 2CZ3A 5D96A 1Y6EA 1EEJA 3P8WA 1GLQA 4PUFC 3TOUA 4IP6A 2HSMA 5A4VA 3LFLA 4POKA 1XCCA 3TKSC 1K0MA 1TJDA 3UARA 1BQ7A 1GSYA 1Q4JA 2BJXA 3VI5A 4MJBA 2XBIA 2LNSA 2KP2A 5ECIB 4EDZA 5ELAA 1UA5A 4KDUA 4YH2A 1FW1A 11GSA 2EC4A 2WULA 3PH9A 2PGTA 3GRXA 4OFNA 1G7OA 4FQUA 1GSDA 3V1WA 4FH8A 5G1LA 3G7JA 1GUHA 1J0FA 2GSTA 3C1SA 3CXGA 1M2DA 1TOFA 7GSSA 1I5GA 5CRHA 3N9JA 1ZYNA 1M3IA 2EIRA 1IYHA 2Z9SA 5ECSA 4GXZA 4CY8A 3LORA 1Z9HA 3PR8A 3VI7A 2GT6A 3KMOA 3KH9A 3A3TA 4GTUA 5KN2A 1DE1A 5EL8A 1U3IA 3ME8A 4XRDA 4CY6A 4HZ4A 4WR5A 2JZSA 4EXJA 1AIUA 4QL7A 1B8XA 2MMOA 2CV4A 4LMVA 2NBSA 5JWOB 3CSHA 1IYIA 2P0GA 5H5QA 1WE0A 2OBKA 4F2IA 2GSQA 2GGTA 2VCWA 2DJKA 2H0GA 4ZL9A 1EEMA 5AISA 1GL8A 2H66A 3KJYA 1GTUA 2LUSA 4J2FA 5ABRA 1KBNA 3KM6A 4MA9A 2R2JA 1Y25A 5F05A 3GNJA 4PNFA 1YJ6A 2BMXA 1K3LA 4TVEA 2PN8A 4NV2A 1DUGA 1K0AA 4PQ1A 2CZ2A 2YPMA 1C72A 1QXHA 2XC2A 4HOJA 2IMIA 2L59A 4QL9A 3GHAA 3QFBC 1YEPA 3VWXA 2PMTA 4RI7A 4IW9A 4MZWA 4JBBA 3CTFA 2GZYA 1TK8B 4G19A 3QPMA 2QSIA 4G9HA 1GULA 4RUVA 4Z7XA 4PURA 5DQYA 4D73A 4E8EA 1TK5B 2WJUA 3UVHA 3WT1A 2DSAA 2ON5A 2B6MA 2NTOA 4GSSA 3KD0A 3KZQA 5LD0A 1Z6MA 4GWRA 4HSCX 1K0NA 3BJ5A 1NHYA 3ME7A 1M0UA 4NHZA 4MF7A 13GSA 20GSA 5ECMB 3VPTA 1SL0B 3APQA 4XIHA 5G5EA 2R5GA 2YV7A 2VM2A 4YKGA 4BVXA 2VCTA 1MDIA 2B5YA 5KN0A 1E2YA 2LTKA 3FRCA 3TKQA 1GH2A 4PGTA 1I9DA 4ULXA 2WB9A 2H30A 2XPEA 1A24A 3GKXA 3OR5A 2GQLA 1A2LA 3HJPA 3IAM2 1AAZA 1THXA 5HFKA 2HE3A 1XWBA 2RIIA 3GSTA 2AHEA 2X64A 4L0WA 4GRFA 4WKWA 8GSSA 1FOHA 4OO5A 2A4VA 5DAKA 4JE1A 2FCHA 3UL3A 2JZRA 1TW9A 3FHKA 3DD3A 1VF1A 1JZWA 2HI7A 3IR4A 3ZIJA 3SWLA 5AN1A 1ST9A 3ZRDA 2OE3A 1A2MA 5IMZA 1ERUA 4MABA 2WCIA 5CRDA 2D2ZA 4YQMA 1CQGA 3JCML 2G2QA 5J9BA 1GNEA 2HXKA 2CVKA 3HYPA 2AAWA 1ZYPA 2MMNA 2M46A 3MDKA 2OJLA 5ECOB 3G7IA 2HRNA 5CP1A 2DJ1A 3F8UA 3QAWA 4HU9A 1M2BA 1XOBA 2VAFA 3U5RE 1U6TA 2AB6A 1EOGA 4EL1A 4EKZA 4ZBBA 4LL1B 5CO3A 4PXOA 2CT6A 1YDKA 4IELA 1TI1A 3P2AA 1S3DA 3TJFA 1PFOA 1M9BA 2M80A 5ECNB 3ZITA 4D73B 1O81A 3IHQA 1BAYA 18GSA 4YQUA 1GRXA 2CQ9A 4KGIA 4K7OA 3GSSA 1MTCA 2ES7A 17GSA 3VWWA 5A4UA 3F3QA 3EVIA 2A4HA 5D9XA 2XPDA 2V1MA 1ERTA 4ICYA 1GWCA 1WMJA 2DLXA 1RK4A 4EIQA 2VLUA 4DSSA 2O89A 1JFUA 1X5DA 1QFNA 1XVWA 1AUCA 5C00A 2A2PA 2I1UA 4KNDA 4Q5RA 2DJ0A 2B3SA 19GSA 3W6GA 1R7HA 4RI6A 5LCZA 4I6XA 2AUVA 1FB0A 5CYYA 4HS1A 3LQ7A 3IHGA 5BRTA 2V32A 2H6XA 2P31A 2QA2A 1Z7PA 1F2EA 2V2GA 1RW1A 3ZZXA 2LKUA 4KCAA 4K2DA 1DSBA 4GF0A 4XTSA 4TOPA 2C80A 4O5RA 4J57E 2M72A 2LEGA 1K0CA 4F82A 3HY2A 1GTIA 2K18A 5HR0A 2F8FA 1T4ZA 1BYEA 1G6YA 5IPHA 2IMFA 2DIZA 3I9V2 3TRXA 3M3MA 2NPBA 2A2SA 5DCGA 4I8BA 4XS6A 3RAZA 2H6YA 1OAZA 3NOFA 3PGTA 2MZCA 4HDEA 5D9VA 4DEJA 2UZ8A 2O87A 4TR4A 3QAVA 5COHA 3ZVJA 3EWLA 2C8UA 3ZMKA 2CA8A 2TRXA 1ZCPA 1XWGA 4ZB8A 4IJIA 1ML6A 3L9UA 5E59A 1O6JA 1T3BA 2V41A 3IDVA 5DDLA 3I69A 2HSYA 3TB2A 4OCFA 1K0OA 2RM5A 1B9YC 2KHPA 5ELGA 5AIXA 4MZCA 2LQOA 4EUYA 1YQ1A 1GTAA 4WR4A 4IKHA 2CAQA 4EO3A 2C4JA 2R37A 3UEMA 4G0LA 3TUEA 5F06A 5KN1A 5HQPA 4DSSB 5ECPB 1SD8A 3VURA 3APOA 1JZOA 1O73A 3GH6A 4G0IA 2LV3A 2VL9A 3FZ4A 5E4WA 2H6ZA 4KE3A 4RQRA 2L6CA 3KP8A 2AV4A 4KX4A 2FGXA 1T8EB 3M8NA 1V9WA 3R3EA 3Q19A 2VCXA 4ZILA 1SK2A 4LA1A 4K6XA 1DE2A 2LRNA 2WS2A 4PX1A 3LXZA 5ECLB 4HQZA 2DKIA 1N8JA 4OFMA 1V98A 4X43A 1SYRA 4HEA2 3GKNA 3UIWA 2RUEA 4HZ2A 1HNBA 5JCGA 2X99A 2C3NA 4FYBA 5IOXA 5IO0A 3ZFBA 4PUAA 6GSWA 5CRWA 3EURA 1AW9A 5HR1A 2RUFA 4Q5QA 3TKSE 1ERWA 4KUNA 1NW2A 1Z6NA 1ZGNA 4ACSA 1FO5A 1M2AA 3M9JA 3D4TA 5DJLA 2NVLA 2K8SA 3QR6A 3GL5A 5H5SA 4POBA 1ZYQB 2OA7A 4K5RA 2VD0A 4MLYA 1OE8A 2PU9C 12GSA 4JRRA 3A5WA 5FWGA 3GA4A 2PBJA 2DC5A 2FD3A 2WRTA 3Q18A 1XW6A 3I6AA 4OCEA 3D22A 4XRAA 2REMA 2ZNMA 3F9UA 4K8MA 1ERVA 1K3OA 4ECCA 3HVNA 1ILOA 3EYTA 3F63A 3DGQA 4L0UA 5D73A 1X5CA 5HR2A 1B9XC 3H1NA 1SJZA 2LRCA 5ID2B 3D4MA 4DVCA 2I81A 3A5IA 2YOIA 2QC7A 1S3CA 1HNAA 4TXVA 3BCIA 4MF5A 2YANA 1EP8A 2QKEA 1TU7A 4X0XA 2QGVA 2R0CA 4IQAA 2JU5A 2C0FA 4K5SA 1WP0A 3PPUA 4OFTA 3DVWA 3L0HA 5B6MA 5B7CA 1JZDA 3FZ5A 3EINA 2GTUA 3DMLA 2C1YA 3EPTA 3H93A 1PQNA 2H0IA 5CNWA 4MH3A 4TR1A 1GSQA 5INYA 1TRWA 3FYGA 2WDUA 2IMKA 6GSUA 3GKMA 1XZOA 2C3TA 3SBCA 1MDKA 3AY8A 4GQCA 2DMMA 5HR3A 2HZEB 4YAPA 1SJIA 3J7Yb 4QQ7A 5EVOA 1PN0A 2H70A 5IM9A 3CYNA 1OC8A 4N0VA 3RDWA 3RHBA 3IK7A 4JR4A 3EU4A 5G1KA 3RBTA 4MNNA 5DVBA 5D9WA 1EV9A 3ZREA 2FWEA 4A5PA 3ZTLA 3I43A 3FKFA 1FVJA 4EDYA 3TJJA 3L4NA 4AJ8A 1TXXA 2HZFA 3BD2A 22GSA 3GUSA 5F07A 2VM1A 4LLRA 1Z3EA 3VPQA 2GSSA 4OO4A 3FY7A 2VLTA 1U3AA 5B6NA 2O7KA 3FMWA 4MP4A 1WPIA 2K6VA 3LSZA 5B8BA 3C7MA 4MJEA 4I2UA 3IOSA 9GSSA 5IOWA 3HD5A 5AIVA 1XWCA 5KOWA 3LG6A 1ON4A 1QUWA 1SL1B 1H4OA 5B8AA 4F0BA 2HT9A 1SL2B 4TRXA 5F0GA 3GMFA 2YP6A 3GV1A 4P3YB 4BA7A 4FYUA 3TKPA 3ZVJD 2JACA 2PVOC 3ED3A 5ECKB 3ZL5A 2H0HA 5HFIA 4WBJA 1URMA 3A2XA 4IJ3A 1Z5YE 3R2QA 2VOCA 4ZIJA 3WGDA 3M9KA 1WOUA 4O92A 1A0RP 2CX4A 1ZZYA 4IN0A 2NDOA 2HRFA 2RM6A 3KCMA 2ALBA 4TR0A 1GSFA 4AGSA 2H1BA 3CSJA 2GQMA 2VL2A 1JZRA 4WBRD
chains in the Genus database with same CATH topology
5G30A 3GIXA 3P90A 4MDCA 4ISDA 3GURA 3TOTA 4LL4B 4TR1B 4FO5A 1QMVA 1RQMA 1AQWA 5IMVA 1XW5A 3VWVA 3K8NA 4F9ZA 4MK3A 3ZFLA 3DVXA 1ACVA 3GFKA 2C0EA 5F8BA 4OD7A 1HD2A 3QMXA 1YY7A 4V1Ap 5EPFA 4JZQA 10GSA 2VL3A 1PN9A 5L71A 1F37A 3TJGA 1QGVA 3LWAA 1T7PB 4MZBA 6GSYA 2LS5A 2LNTA 1YZXA 3O76A 1R5PA 3CRTA 2IIYA 3BOAA 2OE1A 2H75A 3UAPA 3A2VA 1FB6A 3HDCA 4Q5FA 4K1FA 3VK9A 3FZ9A 4POMA 4AJ7A 2PUKC 4GSNA 1AQVA 1JHBA 3HCZA 3EU3A 4XS1A 4IHUA 3UMAA 1ZOFA 1GSUA 2WGRA 3WGEA 5GAPD 1XVQA 4ECJA 1USBA 1F9MA 2F3MA 1XIYA 1FOVA 1YKCA 3O3TA 3WGXA 4KB3A 4NAXA 2IMDA 3KEBA 2I4AA 4YAVA 3N5OA 3HKRA 1PGTA 2VD1A 2LJAA 3EMXA 3FZAA 3MYDA 3HVSA 4I97A 2DKHA 2VUPA 2LJRA 1FVKA 4JEDA 2B1KA 4N0ZA 3TKSA 1XWKA 1OKTA 3IV4A 2LRTA 4GLTA 3D6IA 4Z2RA 4BWSA 1TK0B 3DEXA 2IN3A 2HSHA 4MJCA 4KDYA 4ZB9A 2V6KA 1PKWA 1O7UA 5IPGA 1A8YA 2ZUPA 3LXTA 4X4JA 4ECBA 1PSQA 2X8HA 4ZB6A 1KTEA 2YCDA 5GSTA 2EIQA 2HRKA 4PNGA 1TI3A 1LJRA 1KEBA 4FYCA 1B48A 1V2AA 4ZL8A 1PL2A 3ZIVA 2WZ9A 1PRXA 2YWIA 4EIPA 4NMUA 1SK0A 1X5EA 3DKSA 4JR6A 1A0FA 4NV5A 1H75A 3UVTA 4IP1A 2YV9A 3H8QA 4I5QA 2E2MA 5DALB 3GKKA 1K3YA 6GSVA 1X9SB 1E6BA 4BL7B 1ABAA 2P5QA 3KH7A 4MF6A 3LYKA 3TKRA 2F9SA 16GSA 3BBYA 3VWUA 5ID2A 1KNGA 3CTGA 1XOAA 4L5LA 4OWYA 3QD9A 1K0DA 2R0GA 2R3XA 1LBKA 2TIRA 1GSSA 2A2RA 4K9ZA 2L4QA 1SD9A 4XS4B 5GZZB 3M0FA 2DJ2A 2IFQB 3J7Yk 5ENUA 5KOXA 3CRUA 5AGYA 2JL4A 1OE7A 2E0QA 1O8XA 1SU9A 3L9VA 1GTBA 1W89A 2G0FA 1HNCA 4HJMA 2YN1A 4FIWA 5D8IA 1EGOA 4POLA 3E9JB 4IBPA 2F8AA 1XW9A 4N10A 4TN8A 2X8CA 4YQVA 1M7TA 3CSIA 3HJMA 2FWGA 3KXOA 4LMWA 1ZMAA 4G2EA 4BVYB 2FLSA 4KW6A 3IXRA 3LGCA 2N5AA 4TR3A 3F4TA 4KSMA 2B5XA 3GTUB 2HZEA 2FY6A 3LEFA 2H73A 3MNGA 4ML6A 5CREA 2PWJA 3EMPA 1UC7A 2KOKA 3HA9A 4DSRA 2YZHA 4WF4A 3TRPA 1X9WB 3TRQA 3US3A 5LNKe 3M1GA 4K0GA 3Q74A 2V6OA 2OKAA 2VCZA 4ID0A 5IQYA 3KTLA 2LJKA 1OC9B 3EC3A 1GP1A 4HI7A 2K8VA 4K2XA 2GZPA 1UN2A 4TXOA 4DSQA 1MDJA 5IMAA 4TKYA 2OADA 2VCVA 2CVDA 3C1RA 4KF9A 5BMUA 5HFGA 2L5OA 1N2AA 3IC8A 5G31A 5EY6A 3PINA 2DJJA 5JWRB 1Q98A 4E8HA 2HLSA 5KEJA 1EV4A 1TU8A 2PERA 4MJAA 4NWYA 3ERGA 1AQXA 3MIXA 1SK1A 1R4WA 1YEXA 3QAGA 4JU5A 1PX7A 3E3EA 5G5FA 1MD4A 6GSXA 1PL1A 1NHOA 3HZ4A 1EGRA 3LJRA 2LSTA 2QA1A 1X0RA 3F6FA 3FK8A 2RLIA 2B1LA 2IL3A 3IAS2 1R5AA 1U87A 1OC3A 4O7HA 3ERWA 1Z7RA 4WXTA 6GSTA 1UVZA 1O8WA 3ZYWA 1DBYA 1K0BA 5FT3A 5IMDA 3CBUA 3HVXA 1TKDB 4CHSA 2GLRA 4ZBDA 3L9SA 1NM3A 4J56E 2PVQA 3L78A 3E0UA 1SKWB 5ECRB 3HJOA 5GSSA 1A23A 4L8EA 1AC1A 3MAKA 1GUKA 2YWOA 2CX3A 3IBHA 1VGLA 3ERFA 4CW9A 3KMNA 3F3RA 1TRSA 2I3YA 1TTZA 3H4KA 3NIVA 4O5QA 2J9HA 3HVVA 4TW5A 1J9BA 4V2NA 1O85A 1G6WA 2CAIA 3VFIA 5J41A 4NHWA 2GVPA 1WIKA 3APSA 4USSA 2DBCA 2F51A 3GX0A 4KSOA 1W4VA 2HFDA 1WWJA 3QFAC 3FW2A 2CVBA 2OBIA 2X8GA 1XFLA 2I9HA 4X1UA 3G9BA 4TXOB 5ECQB 3IK9A 2N5BA 3WD6A 4KDXA 1X9MB 2FA8A 1QK8A 4HU7A 2L5LA 3IRAA 4PQIA 4GQFA 4EF0A 5IO2A 2H1GA 4YKFA 1THOA 1VF2A 1G0TA 4K7NA 5J9CA 2MBTA 4MMMA 3KGKA 4MPGA 2H71A 1EZKA 1LU4A 2FWFA 5D93A 1F3BA 5A5KA 2OE0A 2H72A 1EOHA 5ECHB 5CRGA 1MD3A 2C3QA 3RHCA 4F0CA 5DJMA 4IQ1A 3TGZA 2KLXA 4N30A 1GNWA 4OMVA 5JCUA 4WF5A 6GSSA 2EIOA 1V40A 4ILFA 3LYPA 2C0GA 2KUCA 1TRVA 1JLWA 5KN3A 3FR9A 2B5EA 1HYUA 2VCQA 4EVMA 5JCWA 1EP7A 2YWNA 3EE2A 2WFCA 3D21A 2TRCP 1WJKA 3W8JA 3TJKA 3IC4A 2YJHA 3QOUA 3D5JA 2X4AA 5H5RA 1SENA 1PD21 2FWHA 3IA1A 1FHEA 2YNXA 2GZZA 2JSZA 1A2JA 3C8EA 2VO4A 2OACA 2ZCTA 4AJ6A 1AXDA 2GQKA 2H74A 3KP9A 4K7IA 2J23A 3UOMA 2R0PA 2R6KA 5IMCA 2O8VB 4HQSA 5DALA 4ZL7A 4IGJA 2K9FA 2H1DA 4BL7A 1S3AA 2L6DA 3HHVA 3UBKA 1G7EA 2VLVA 4MH2A 1BG5A 2HYXA 4CDOA 4V2LA 3GN3A 3HZ8A 1CQHA 3WT2A 3GH9A 4F03A 1HQOA 5CAXA 2E2GA 4G10A 1SJ6A 2FUG2 1GSEA 4G0KA 4HUAA 2HRAA 4PQHA 3RPPA 3CMIA 1B4PA 4KCEA 2MBSA 3TCOA 3S9FA 5C04A 3ZMLA 4BWQA 1U88A 2JZTA 1F3AA 1VRSD 1ZYEA 1J08A 1F6MC 3W8SA 1XPVA 2MYGA 4XS4A 1V57A 4V2MA 5IIZA 3LW9A 2IFQA 4MCUA 2MMAA 1MEKA 1VF3A 2AYTA 3QCPA 1BJXA 4AF2A 4H86A 3UJ1A 2GS3A 4RQXA 3Q6OA 4GSTA 4Z2UA 4GCIA 3MWHA 1A8LA 3IPZA 4BVXB 4ML1A 1EWXA 2R4VA 2LQQA 3FEUA 2YJ7A 2XHFA 1YKAA 2FNOA 1XWAA 2PPTA 2VIMA 3GL3A 5DCHA 4BVYA 5DQSA 2JSYA 2XBQA 3DYRA 14GSA 4ZBAA 1WRYA 2AJQB 4KAEA 2L4CA 3O6TA 3GTUA 1PKZA 3DIEA 2IWTA 3RPNA 2FHEA 2DJ3A 3TDGA 2X49A 4O32A 5IMFA 5DAKB 4IVFA 4ZXGA 3BCKA 4XHMA 2B7JA 1PMTA 1SYXA 3A2WA 5J3RA 1OC9A 1SKRB 2L57A 3HXSA 1GUMA 1XBSA 3G7YA 1FG4A 1T00A 2YZUA 5JWQB 4O5UA 4BPYA 2H8LA 2GT5A 3FR3A 3F6DA 1TP9A 3QDNA 5A4WA 4NXIA 4EC0A 3GX8A 2GSRA 5D9TA 4I2TA 1BX9A 3F4RA 3KTBA 4KH7A 4MPFA 4WETA 1SKSB 1OYJA 2N5FA 1YF0A 2E7PA 3C73A 2DMLA 5J4UA 3TJBA 2VL2C 4WEYA 3WYWA 2GDRA 2DIYA 1R26A 2H1AA 3H79A 2H76A 5J5NA 4ECIA 1M99A 4HJ2A 1TDIA 2O85A 1TRUA 3FR6A 4L5OA 2IMEA 4Z2TA 4K0NA 4EE0A 3UBLA 1T4YA 1YF1A 4IS0A 2FA4A 3P7XA 4XCSA 3D0ZA 3DRNA 5DBQA 2BTOT 4Q5NA 1ZL9A 1XXUA 3DWVA 5GAND 2KP1A 2P5RA 1FAAA 4V1Ag 3KIJA 3VLNA 2YWMA 1VF4A 3IE3A 2H01A 2HNLA 1BEDA 4N11A 4KA0A 4PTSA 1JLVA 3DXBA 3F0IA 2ON7A 2IPAA 5FHIA 1PA3A 1OVNA 1V58A 2IJYA 3C71A 3F4SA 3MSZA 3NZNA 3U6VA 2JADA 1PX6A 1M9AA 1T1VA 3ZLPA 1NSWA 3ISOA 5G2ZA 1B4QA 2MMZA 2B7KA 3GYKA 1GLPA 1OKDA 2H19A 2C0DA 4NPBA 1QQ2A 2CZ3A 5D96A 1Y6EA 1EEJA 3P8WA 1GLQA 4PUFC 3TOUA 4IP6A 2HSMA 5A4VA 3LFLA 4POKA 1XCCA 3TKSC 1K0MA 1TJDA 3UARA 1BQ7A 1GSYA 1Q4JA 2BJXA 3VI5A 4MJBA 2XBIA 2LNSA 2KP2A 5ECIB 4EDZA 5ELAA 1UA5A 4KDUA 4YH2A 1FW1A 11GSA 2EC4A 2WULA 3PH9A 2PGTA 3GRXA 4OFNA 1G7OA 4FQUA 1GSDA 3V1WA 4FH8A 5G1LA 3G7JA 1GUHA 1J0FA 2GSTA 3C1SA 3CXGA 1M2DA 1TOFA 7GSSA 1I5GA 5CRHA 3N9JA 1ZYNA 2EIRA 1IYHA 2Z9SA 5ECSA 4GXZA 4CY8A 3LORA 1Z9HA 3PR8A 3VI7A 2GT6A 3KMOA 3KH9A 3A3TA 4GTUA 5KN2A 1DE1A 5EL8A 1U3IA 3ME8A 4XRDA 4CY6A 4HZ4A 4WR5A 2JZSA 4EXJA 1AIUA 4QL7A 1B8XA 2MMOA 2CV4A 4LMVA 2NBSA 5JWOB 3CSHA 1IYIA 2P0GA 5H5QA 1WE0A 2OBKA 4F2IA 2GSQA 2GGTA 2VCWA 2DJKA 2H0GA 4ZL9A 1EEMA 5AISA 1GL8A 2H66A 3KJYA 1GTUA 2LUSA 4J2FA 5ABRA 1KBNA 3KM6A 4MA9A 2R2JA 1Y25A 5F05A 3GNJA 4PNFA 1YJ6A 2BMXA 1K3LA 4TVEA 2PN8A 4NV2A 1DUGA 1K0AA 4PQ1A 2CZ2A 2YPMA 1C72A 1QXHA 2XC2A 4HOJA 2IMIA 2L59A 4QL9A 3GHAA 3QFBC 1YEPA 3VWXA 2PMTA 4RI7A 4IW9A 4MZWA 4JBBA 3CTFA 2GZYA 1TK8B 4G19A 3QPMA 2QSIA 4G9HA 1GULA 4RUVA 4Z7XA 4PURA 5DQYA 4D73A 4E8EA 1TK5B 2WJUA 3UVHA 3WT1A 2DSAA 2ON5A 2B6MA 2NTOA 4GSSA 3KD0A 3KZQA 5LD0A 1Z6MA 4GWRA 1K0NA 3BJ5A 1NHYA 3ME7A 1M0UA 4NHZA 4MF7A 13GSA 20GSA 5ECMB 3VPTA 1SL0B 3APQA 4XIHA 5G5EA 2R5GA 2YV7A 2VM2A 4YKGA 4BVXA 2VCTA 1MDIA 2B5YA 5KN0A 1E2YA 2LTKA 3FRCA 3TKQA 1GH2A 4PGTA 1I9DA 4ULXA 2WB9A 2H30A 2XPEA 1A24A 3GKXA 3OR5A 2GQLA 1A2LA 3HJPA 3IAM2 1AAZA 1THXA 5HFKA 2HE3A 1XWBA 2RIIA 3GSTA 2AHEA 2X64A 4L0WA 4GRFA 4WKWA 8GSSA 1FOHA 4OO5A 2A4VA 5DAKA 4JE1A 2FCHA 3UL3A 2JZRA 1TW9A 3FHKA 3DD3A 1VF1A 1JZWA 2HI7A 3IR4A 3ZIJA 3SWLA 5AN1A 1ST9A 3ZRDA 2OE3A 1A2MA 5IMZA 1ERUA 4MABA 2WCIA 5CRDA 2D2ZA 4YQMA 1CQGA 3JCML 2G2QA 5J9BA 1GNEA 2HXKA 2CVKA 3HYPA 2AAWA 1ZYPA 2MMNA 2M46A 3MDKA 2OJLA 5ECOB 3G7IA 2HRNA 5CP1A 2DJ1A 3F8UA 3QAWA 4HU9A 1M2BA 1XOBA 2VAFA 3U5RE 1U6TA 2AB6A 1EOGA 4EL1A 4EKZA 4ZBBA 4LL1B 5CO3A 4PXOA 2CT6A 1YDKA 4IELA 1TI1A 3P2AA 1S3DA 3TJFA 1M9BA 2M80A 5ECNB 3ZITA 4D73B 1O81A 3IHQA 1BAYA 18GSA 4YQUA 1GRXA 2CQ9A 4KGIA 4K7OA 3GSSA 1MTCA 2ES7A 17GSA 3VWWA 5A4UA 3F3QA 3EVIA 2A4HA 5D9XA 2XPDA 2V1MA 1ERTA 4ICYA 1GWCA 1WMJA 2DLXA 1RK4A 4EIQA 2VLUA 4DSSA 2O89A 1JFUA 1X5DA 1QFNA 1XVWA 1AUCA 5C00A 2A2PA 2I1UA 4KNDA 4Q5RA 2DJ0A 2B3SA 19GSA 3W6GA 1R7HA 4RI6A 5LCZA 4I6XA 2AUVA 1FB0A 5CYYA 4HS1A 3LQ7A 3IHGA 5BRTA 2V32A 2H6XA 2P31A 2QA2A 1Z7PA 1F2EA 2V2GA 1RW1A 3ZZXA 2LKUA 4KCAA 4K2DA 1DSBA 4GF0A 4XTSA 4TOPA 2C80A 4O5RA 4J57E 2M72A 2LEGA 1K0CA 4F82A 3HY2A 1GTIA 2K18A 5HR0A 2F8FA 1T4ZA 1BYEA 1G6YA 5IPHA 2IMFA 2DIZA 3I9V2 3TRXA 3M3MA 2NPBA 2A2SA 5DCGA 4I8BA 4XS6A 3RAZA 2H6YA 1OAZA 3NOFA 3PGTA 2MZCA 4HDEA 5D9VA 4DEJA 2UZ8A 2O87A 4TR4A 3QAVA 5COHA 3ZVJA 3EWLA 2C8UA 3ZMKA 2CA8A 2TRXA 1ZCPA 1XWGA 4ZB8A 4IJIA 1ML6A 3L9UA 5E59A 1O6JA 1T3BA 2V41A 3IDVA 5DDLA 3I69A 2HSYA 3TB2A 4OCFA 1K0OA 2RM5A 1B9YC 2KHPA 5ELGA 5AIXA 4MZCA 2LQOA 4EUYA 1YQ1A 1GTAA 4WR4A 4IKHA 2CAQA 4EO3A 2C4JA 2R37A 3UEMA 4G0LA 3TUEA 5F06A 5KN1A 5HQPA 4DSSB 5ECPB 1SD8A 3VURA 3APOA 1JZOA 1O73A 3GH6A 4G0IA 2LV3A 2VL9A 3FZ4A 5E4WA 2H6ZA 4KE3A 4RQRA 2L6CA 3KP8A 2AV4A 4KX4A 2FGXA 1T8EB 3M8NA 1V9WA 3R3EA 3Q19A 2VCXA 4ZILA 1SK2A 4LA1A 4K6XA 1DE2A 2LRNA 2WS2A 4PX1A 3LXZA 5ECLB 4HQZA 2DKIA 1N8JA 4OFMA 1V98A 4X43A 1SYRA 4HEA2 3GKNA 3UIWA 2RUEA 4HZ2A 1HNBA 5JCGA 2X99A 2C3NA 4FYBA 5IOXA 5IO0A 3ZFBA 4PUAA 6GSWA 5CRWA 3EURA 1AW9A 5HR1A 2RUFA 4Q5QA 3TKSE 1ERWA 4KUNA 1NW2A 1Z6NA 1ZGNA 4ACSA 1FO5A 1M2AA 3M9JA 3D4TA 5DJLA 2NVLA 2K8SA 3QR6A 3GL5A 5H5SA 4POBA 1ZYQB 2OA7A 4K5RA 2VD0A 4MLYA 1OE8A 2PU9C 12GSA 4JRRA 3A5WA 5FWGA 3GA4A 2PBJA 2DC5A 2FD3A 2WRTA 3Q18A 1XW6A 3I6AA 4OCEA 3D22A 4XRAA 2REMA 2ZNMA 3F9UA 4K8MA 1ERVA 1K3OA 4ECCA 1ILOA 3EYTA 3F63A 3DGQA 4L0UA 5D73A 1X5CA 5HR2A 1B9XC 3H1NA 1SJZA 2LRCA 5ID2B 3D4MA 4DVCA 2I81A 3A5IA 2YOIA 2QC7A 1S3CA 1HNAA 4TXVA 3BCIA 4MF5A 2YANA 1EP8A 2QKEA 1TU7A 4X0XA 2QGVA 2R0CA 4IQAA 2JU5A 2C0FA 4K5SA 1WP0A 3PPUA 4OFTA 3DVWA 3L0HA 5B6MA 5B7CA 1JZDA 3FZ5A 3EINA 2GTUA 3DMLA 2C1YA 3EPTA 3H93A 1PQNA 2H0IA 5CNWA 4MH3A 4TR1A 1GSQA 5INYA 1TRWA 3FYGA 2WDUA 2IMKA 6GSUA 3GKMA 1XZOA 2C3TA 3SBCA 1MDKA 3AY8A 4GQCA 2DMMA 5HR3A 2HZEB 4YAPA 1SJIA 3J7Yb 4QQ7A 5EVOA 1PN0A 2H70A 5IM9A 3CYNA 1OC8A 4N0VA 3RDWA 3RHBA 3IK7A 4JR4A 3EU4A 5G1KA 3RBTA 4MNNA 5DVBA 5D9WA 1EV9A 3ZREA 2FWEA 4A5PA 3ZTLA 3I43A 3FKFA 1FVJA 4EDYA 3TJJA 3L4NA 4AJ8A 1TXXA 2HZFA 3BD2A 22GSA 3GUSA 5F07A 2VM1A 4LLRA 1Z3EA 3VPQA 2GSSA 4OO4A 3FY7A 2VLTA 1U3AA 5B6NA 2O7KA 3FMWA 4MP4A 1WPIA 2K6VA 3LSZA 5B8BA 3C7MA 4MJEA 4I2UA 3IOSA 9GSSA 5IOWA 3HD5A 5AIVA 1XWCA 5KOWA 3LG6A 1ON4A 1QUWA 1SL1B 1H4OA 5B8AA 4F0BA 2HT9A 1SL2B 4TRXA 5F0GA 3GMFA 2YP6A 3GV1A 4P3YB 4BA7A 4FYUA 3TKPA 3ZVJD 2JACA 2PVOC 3ED3A 5ECKB 3ZL5A 2H0HA 5HFIA 4WBJA 1URMA 3A2XA 4IJ3A 1Z5YE 3R2QA 2VOCA 4ZIJA 3WGDA 3M9KA 1WOUA 4O92A 1A0RP 2CX4A 1ZZYA 4IN0A 2NDOA 2HRFA 2RM6A 3KCMA 2ALBA 4TR0A 1GSFA 4AGSA 2H1BA 3CSJA 2GQMA 2VL2A 1JZRA 4WBRD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G30 A;  3GIX A;  3P90 A;  4MDC A;  4ISD A;  3GUR A;  3TOT A;  4LL4 B;  4TR1 B;  4FO5 A;  1QMV A;  1RQM A;  1AQW A;  5IMV A;  1XW5 A;  3VWV A;  3K8N A;  4F9Z A;  4MK3 A;  3ZFL A;  3DVX A;  1ACV A;  3GFK A;  2C0E A;  5F8B A;  4OD7 A;  1HD2 A;  3QMX A;  1YY7 A;  4V1A p;  5EPF A;  4JZQ A;  10GS A;  2VL3 A;  1PN9 A;  5L71 A;  1F37 A;  3TJG A;  1QGV A;  3LWA A;  1T7P B;  4MZB A;  6GSY A;  2LS5 A;  2LNT A;  1YZX A;  3O76 A;  1R5P A;  3CRT A;  2IIY A;  3BOA A;  2OE1 A;  2H75 A;  3UAP A;  3A2V A;  1FB6 A;  3HDC A;  4Q5F A;  4K1F A;  3VK9 A;  3FZ9 A;  4POM A;  4AJ7 A;  2PUK C;  4GSN A;  1AQV A;  1JHB A;  3HCZ A;  3EU3 A;  4XS1 A;  4IHU A;  3UMA A;  1ZOF A;  1GSU A;  2WGR A;  3WGE A;  5GAP D;  1XVQ A;  4ECJ A;  1USB A;  1F9M A;  2F3M A;  1XIY A;  1FOV A;  1YKC A;  3O3T A;  3WGX A;  4KB3 A;  4NAX A;  2IMD A;  3KEB A;  2I4A A;  4YAV A;  3N5O A;  3HKR A;  1PGT A;  2VD1 A;  2LJA A;  3EMX A;  3FZA A;  3HVS A;  4I97 A;  2VUP A;  2LJR A;  1FVK A;  4JED A;  2B1K A;  4N0Z A;  3TKS A;  1XWK A;  1OKT A;  3IV4 A;  2LRT A;  4GLT A;  3D6I A;  4BWS A;  1TK0 B;  3DEX A;  2IN3 A;  2HSH A;  4MJC A;  4KDY A;  4ZB9 A;  2V6K A;  1PKW A;  1O7U A;  5IPG A;  1A8Y A;  2ZUP A;  3LXT A;  4ECB A;  1PSQ A;  2X8H A;  4ZB6 A;  1KTE A;  2YCD A;  5GST A;  2EIQ A;  4PNG A;  1TI3 A;  1LJR A;  1KEB A;  4FYC A;  1B48 A;  1V2A A;  4ZL8 A;  1PL2 A;  3ZIV A;  2WZ9 A;  1PRX A;  2YWI A;  4NMU A;  1SK0 A;  1X5E A;  3DKS A;  4JR6 A;  1A0F A;  4NV5 A;  1H75 A;  3UVT A;  4IP1 A;  2YV9 A;  3H8Q A;  4I5Q A;  2E2M A;  5DAL B;  3GKK A;  1K3Y A;  6GSV A;  1X9S B;  1E6B A;  1ABA A;  2P5Q A;  3KH7 A;  4MF6 A;  3LYK A;  3TKR A;  2F9S A;  16GS A;  3BBY A;  3VWU A;  5ID2 A;  1KNG A;  3CTG A;  1XOA A;  4L5L A;  4OWY A;  3QD9 A;  1K0D A;  2R3X A;  1LBK A;  2TIR A;  1GSS A;  2A2R A;  4K9Z A;  2L4Q A;  1SD9 A;  4XS4 B;  5GZZ B;  3M0F A;  2DJ2 A;  2IFQ B;  3J7Y k;  5ENU A;  3CRU A;  5AGY A;  2JL4 A;  1OE7 A;  2E0Q A;  1O8X A;  1SU9 A;  3L9V A;  1GTB A;  1W89 A;  2G0F A;  1HNC A;  4HJM A;  2YN1 A;  4FIW A;  5D8I A;  1EGO A;  4POL A;  3E9J B;  4IBP A;  2F8A A;  1XW9 A;  4N10 A;  4TN8 A;  2X8C A;  4YQV A;  1M7T A;  3CSI A;  3HJM A;  2FWG A;  3KXO A;  4LMW A;  1ZMA A;  4G2E A;  2FLS A;  4KW6 A;  3IXR A;  3LGC A;  2N5A A;  4TR3 A;  3F4T A;  4KSM A;  2B5X A;  3GTU B;  2HZE A;  2FY6 A;  3LEF A;  2H73 A;  3MNG A;  4ML6 A;  5CRE A;  2PWJ A;  3EMP A;  1UC7 A;  2KOK A;  3HA9 A;  4DSR A;  2YZH A;  4WF4 A;  3TRP A;  1X9W B;  3TRQ A;  3US3 A;  5LNK e;  3M1G A;  4K0G A;  3Q74 A;  2V6O A;  2OKA A;  2VCZ A;  4ID0 A;  5IQY A;  3KTL A;  2LJK A;  1OC9 B;  3EC3 A;  1GP1 A;  4HI7 A;  2K8V A;  2GZP A;  1UN2 A;  4TXO A;  4DSQ A;  1MDJ A;  5IMA A;  4TKY A;  2OAD A;  2VCV A;  2CVD A;  3C1R A;  5HFG A;  2L5O A;  1N2A A;  5G31 A;  5EY6 A;  3PIN A;  2DJJ A;  5JWR B;  1Q98 A;  4E8H A;  2HLS A;  5KEJ A;  1EV4 A;  1TU8 A;  2PER A;  4MJA A;  4NWY A;  3ERG A;  1AQX A;  1SK1 A;  1R4W A;  1YEX A;  3QAG A;  4JU5 A;  1PX7 A;  3E3E A;  5G5F A;  1MD4 A;  6GSX A;  1PL1 A;  1NHO A;  3HZ4 A;  1EGR A;  3LJR A;  2LST A;  1X0R A;  3F6F A;  3FK8 A;  2RLI A;  2B1L A;  2IL3 A;  3IAS 2;  1R5A A;  1U87 A;  1OC3 A;  4O7H A;  3ERW A;  1Z7R A;  4WXT A;  6GST A;  1UVZ A;  1O8W A;  3ZYW A;  1DBY A;  1K0B A;  5FT3 A;  5IMD A;  3CBU A;  3HVX A;  1TKD B;  4CHS A;  2GLR A;  4ZBD A;  3L9S A;  1NM3 A;  4J56 E;  2PVQ A;  3L78 A;  3E0U A;  1SKW B;  5ECR B;  3HJO A;  5GSS A;  1A23 A;  4L8E A;  1AC1 A;  3MAK A;  1GUK A;  2YWO A;  2CX3 A;  3IBH A;  1VGL A;  3ERF A;  4CW9 A;  3KMN A;  3F3R A;  1TRS A;  2I3Y A;  1TTZ A;  3H4K A;  3NIV A;  2J9H A;  3HVV A;  4TW5 A;  1J9B A;  4V2N A;  1O85 A;  1G6W A;  2CAI A;  3VFI A;  5J41 A;  4NHW A;  2GVP A;  1WIK A;  3APS A;  2DBC A;  2F51 A;  3GX0 A;  4KSO A;  1W4V A;  2HFD A;  1WWJ A;  3QFA C;  3FW2 A;  2CVB A;  2OBI A;  2X8G A;  1XFL A;  2I9H A;  4X1U A;  3G9B A;  4TXO B;  5ECQ B;  3IK9 A;  2N5B A;  3WD6 A;  4KDX A;  1X9M B;  2FA8 A;  1QK8 A;  4HU7 A;  2L5L A;  3IRA A;  4PQI A;  4GQF A;  4EF0 A;  5IO2 A;  2H1G A;  1THO A;  1VF2 A;  1G0T A;  4K7N A;  5J9C A;  2MBT A;  4MMM A;  3KGK A;  4MPG A;  2H71 A;  1EZK A;  1LU4 A;  2FWF A;  5D93 A;  1F3B A;  5A5K A;  2OE0 A;  2H72 A;  1EOH A;  5ECH B;  5CRG A;  1MD3 A;  2C3Q A;  3RHC A;  4F0C A;  5DJM A;  4IQ1 A;  3TGZ A;  2KLX A;  4N30 A;  1GNW A;  4OMV A;  5JCU A;  4WF5 A;  6GSS A;  2EIO A;  1V40 A;  4ILF A;  3LYP A;  2C0G A;  2KUC A;  1TRV A;  1JLW A;  5KN3 A;  3FR9 A;  2B5E A;  1HYU A;  2VCQ A;  4EVM A;  5JCW A;  1EP7 A;  2YWN A;  3EE2 A;  2WFC A;  3D21 A;  2TRC P;  1WJK A;  3W8J A;  3TJK A;  3IC4 A;  2YJH A;  3QOU A;  3D5J A;  5H5R A;  1SEN A;  1PD2 1;  2FWH A;  3IA1 A;  1FHE A;  2YNX A;  2GZZ A;  2JSZ A;  1A2J A;  3C8E A;  2VO4 A;  2OAC A;  2ZCT A;  4AJ6 A;  1AXD A;  2GQK A;  2H74 A;  3KP9 A;  4K7I A;  2J23 A;  3UOM A;  2R6K A;  5IMC A;  2O8V B;  4HQS A;  5DAL A;  4ZL7 A;  4IGJ A;  2K9F A;  2H1D A;  4BL7 A;  1S3A A;  2L6D A;  3HHV A;  3UBK A;  1G7E A;  2VLV A;  4MH2 A;  1BG5 A;  2HYX A;  4CDO A;  4V2L A;  3GN3 A;  3HZ8 A;  1CQH A;  3WT2 A;  3GH9 A;  4F03 A;  1HQO A;  5CAX A;  2E2G A;  4G10 A;  1SJ6 A;  2FUG 2;  1GSE A;  4HUA A;  4PQH A;  3RPP A;  3CMI A;  1B4P A;  4KCE A;  2MBS A;  3TCO A;  3S9F A;  5C04 A;  3ZML A;  4BWQ A;  1U88 A;  2JZT A;  1F3A A;  1VRS D;  1ZYE A;  1J08 A;  1F6M C;  3W8S A;  1XPV A;  2MYG A;  4XS4 A;  1V57 A;  4V2M A;  5IIZ A;  2IFQ A;  4MCU A;  2MMA A;  1MEK A;  1VF3 A;  2AYT A;  3QCP A;  1BJX A;  4AF2 A;  4H86 A;  3UJ1 A;  2GS3 A;  4RQX A;  3Q6O A;  4GST A;  4GCI A;  3MWH A;  1A8L A;  3IPZ A;  4ML1 A;  1EWX A;  2R4V A;  2LQQ A;  3FEU A;  2YJ7 A;  2XHF A;  1YKA A;  2FNO A;  1XWA A;  2PPT A;  2VIM A;  3GL3 A;  5DCH A;  4BVY A;  5DQS A;  2JSY A;  2XBQ A;  3DYR A;  14GS A;  4ZBA A;  1WRY A;  2AJQ B;  4KAE A;  2L4C A;  3O6T A;  3GTU A;  1PKZ A;  3DIE A;  2IWT A;  3RPN A;  2FHE A;  2DJ3 A;  3TDG A;  4O32 A;  5IMF A;  5DAK B;  4IVF A;  4ZXG A;  3BCK A;  4XHM A;  2B7J A;  1PMT A;  1SYX A;  3A2W A;  5J3R A;  1OC9 A;  1SKR B;  2L57 A;  3HXS A;  1GUM A;  1XBS A;  3G7Y A;  1FG4 A;  1T00 A;  2YZU A;  5JWQ B;  4BPY A;  2H8L A;  2GT5 A;  3FR3 A;  3F6D A;  1TP9 A;  3QDN A;  5A4W A;  4NXI A;  4EC0 A;  3GX8 A;  2GSR A;  5D9T A;  4I2T A;  1BX9 A;  3F4R A;  3KTB A;  4KH7 A;  4MPF A;  4WET A;  1SKS B;  1OYJ A;  2N5F A;  1YF0 A;  2E7P A;  3C73 A;  2DML A;  5J4U A;  3TJB A;  2VL2 C;  4WEY A;  3WYW A;  2GDR A;  2DIY A;  1R26 A;  2H1A A;  3H79 A;  2H76 A;  5J5N A;  4ECI A;  1M99 A;  4HJ2 A;  1TDI A;  2O85 A;  1TRU A;  3FR6 A;  4L5O A;  2IME A;  4K0N A;  4EE0 A;  3UBL A;  1T4Y A;  1YF1 A;  4IS0 A;  2FA4 A;  3P7X A;  4XCS A;  3D0Z A;  3DRN A;  5DBQ A;  2BTO T;  4Q5N A;  1ZL9 A;  1XXU A;  3DWV A;  5GAN D;  2KP1 A;  2P5R A;  1FAA A;  4V1A g;  3KIJ A;  3VLN A;  2YWM A;  1VF4 A;  3IE3 A;  2H01 A;  2HNL A;  1BED A;  4N11 A;  4KA0 A;  1JLV A;  3DXB A;  3F0I A;  2ON7 A;  2IPA A;  5FHI A;  1PA3 A;  1OVN A;  1V58 A;  2IJY A;  3C71 A;  3F4S A;  3MSZ A;  3NZN A;  3U6V A;  2JAD A;  1PX6 A;  1M9A A;  1T1V A;  3ZLP A;  1NSW A;  3ISO A;  5G2Z A;  1B4Q A;  2MMZ A;  2B7K A;  3GYK A;  1GLP A;  1OKD A;  2H19 A;  2C0D A;  4NPB A;  1QQ2 A;  2CZ3 A;  5D96 A;  1Y6E A;  1EEJ A;  3P8W A;  1GLQ A;  4PUF C;  3TOU A;  4IP6 A;  5A4V A;  3LFL A;  4POK A;  1XCC A;  3TKS C;  1K0M A;  1TJD A;  3UAR A;  1BQ7 A;  1GSY A;  1Q4J A;  2BJX A;  3VI5 A;  4MJB A;  2XBI A;  2LNS A;  2KP2 A;  5ECI B;  4EDZ A;  5ELA A;  1UA5 A;  4KDU A;  4YH2 A;  1FW1 A;  11GS A;  2EC4 A;  2WUL A;  3PH9 A;  2PGT A;  3GRX A;  4OFN A;  1G7O A;  1GSD A;  3V1W A;  4FH8 A;  5G1L A;  3G7J A;  1GUH A;  1J0F A;  2GST A;  3C1S A;  3CXG A;  1M2D A;  1TOF A;  7GSS A;  1I5G A;  5CRH A;  3N9J A;  2EIR A;  1IYH A;  2Z9S A;  5ECS A;  4GXZ A;  3LOR A;  1Z9H A;  3PR8 A;  3VI7 A;  2GT6 A;  3KMO A;  3KH9 A;  3A3T A;  4GTU A;  5KN2 A;  1DE1 A;  5EL8 A;  1U3I A;  3ME8 A;  4XRD A;  4HZ4 A;  4WR5 A;  2JZS A;  4EXJ A;  1AIU A;  4QL7 A;  1B8X A;  2MMO A;  2CV4 A;  4LMV A;  2NBS A;  5JWO B;  3CSH A;  1IYI A;  2P0G A;  5H5Q A;  1WE0 A;  2OBK A;  4F2I A;  2GSQ A;  2GGT A;  2VCW A;  2DJK A;  2H0G A;  4ZL9 A;  1EEM A;  5AIS A;  1GL8 A;  2H66 A;  3KJY A;  1GTU A;  2LUS A;  4J2F A;  5ABR A;  1KBN A;  3KM6 A;  4MA9 A;  2R2J A;  1Y25 A;  5F05 A;  3GNJ A;  4PNF A;  1YJ6 A;  2BMX A;  1K3L A;  4TVE A;  2PN8 A;  4NV2 A;  1DUG A;  1K0A A;  4PQ1 A;  2CZ2 A;  2YPM A;  1C72 A;  1QXH A;  2XC2 A;  4HOJ A;  2IMI A;  2L59 A;  4QL9 A;  3GHA A;  3QFB C;  1YEP A;  3VWX A;  2PMT A;  4RI7 A;  4IW9 A;  4MZW A;  4JBB A;  3CTF A;  2GZY A;  1TK8 B;  4G19 A;  3QPM A;  2QSI A;  4G9H A;  1GUL A;  4RUV A;  4Z7X A;  4PUR A;  5DQY A;  4D73 A;  4E8E A;  1TK5 B;  2WJU A;  3UVH A;  3WT1 A;  2DSA A;  2ON5 A;  2B6M A;  2NTO A;  4GSS A;  3KD0 A;  3KZQ A;  5LD0 A;  1Z6M A;  4GWR A;  1K0N A;  3BJ5 A;  1NHY A;  3ME7 A;  1M0U A;  4NHZ A;  4MF7 A;  13GS A;  20GS A;  5ECM B;  3VPT A;  1SL0 B;  3APQ A;  4XIH A;  5G5E A;  2R5G A;  2YV7 A;  2VM2 A;  4BVX A;  2VCT A;  1MDI A;  2B5Y A;  5KN0 A;  1E2Y A;  2LTK A;  3FRC A;  3TKQ A;  1GH2 A;  4PGT A;  1I9D A;  4ULX A;  2WB9 A;  2H30 A;  2XPE A;  1A24 A;  3GKX A;  3OR5 A;  2GQL A;  1A2L A;  3HJP A;  3IAM 2;  1AAZ A;  1THX A;  5HFK A;  2HE3 A;  1XWB A;  2RII A;  3GST A;  2AHE A;  2X64 A;  4L0W A;  4GRF A;  4WKW A;  8GSS A;  4OO5 A;  2A4V A;  5DAK A;  4JE1 A;  2FCH A;  3UL3 A;  2JZR A;  1TW9 A;  3FHK A;  3DD3 A;  1VF1 A;  1JZW A;  2HI7 A;  3IR4 A;  3ZIJ A;  3SWL A;  5AN1 A;  1ST9 A;  3ZRD A;  2OE3 A;  1A2M A;  5IMZ A;  1ERU A;  4MAB A;  2WCI A;  5CRD A;  2D2Z A;  4YQM A;  1CQG A;  3JCM L;  2G2Q A;  5J9B A;  1GNE A;  2HXK A;  2CVK A;  3HYP A;  2AAW A;  2MMN A;  2M46 A;  3MDK A;  2OJL A;  5ECO B;  3G7I A;  2HRN A;  5CP1 A;  2DJ1 A;  3F8U A;  3QAW A;  4HU9 A;  1M2B A;  1XOB A;  2VAF A;  3U5R E;  1U6T A;  2AB6 A;  1EOG A;  4EL1 A;  4EKZ A;  4ZBB A;  4LL1 B;  5CO3 A;  4PXO A;  2CT6 A;  1YDK A;  4IEL A;  1TI1 A;  3P2A A;  1S3D A;  3TJF A;  1M9B A;  2M80 A;  5ECN B;  3ZIT A;  4D73 B;  1O81 A;  3IHQ A;  1BAY A;  18GS A;  4YQU A;  1GRX A;  2CQ9 A;  4KGI A;  4K7O A;  3GSS A;  1MTC A;  2ES7 A;  17GS A;  3VWW A;  5A4U A;  3F3Q A;  3EVI A;  5D9X A;  2XPD A;  2V1M A;  1ERT A;  1GWC A;  1WMJ A;  2DLX A;  1RK4 A;  2VLU A;  4DSS A;  2O89 A;  1JFU A;  1X5D A;  1QFN A;  1XVW A;  1AUC A;  5C00 A;  2I1U A;  4KND A;  4Q5R A;  2DJ0 A;  2B3S A;  19GS A;  3W6G A;  1R7H A;  4RI6 A;  5LCZ A;  4I6X A;  2AUV A;  1FB0 A;  5CYY A;  4HS1 A;  3LQ7 A;  2V32 A;  2H6X A;  2P31 A;  1Z7P A;  1F2E A;  2V2G A;  1RW1 A;  3ZZX A;  2LKU A;  4KCA A;  4K2D A;  1DSB A;  4GF0 A;  4XTS A;  4TOP A;  2C80 A;  4O5R A;  4J57 E;  2M72 A;  2LEG A;  1K0C A;  4F82 A;  3HY2 A;  1GTI A;  2K18 A;  5HR0 A;  2F8F A;  1T4Z A;  1BYE A;  1G6Y A;  5IPH A;  2IMF A;  2DIZ A;  3I9V 2;  3TRX A;  3M3M A;  2NPB A;  2A2S A;  5DCG A;  4I8B A;  4XS6 A;  3RAZ A;  2H6Y A;  1OAZ A;  3NOF A;  3PGT A;  2MZC A;  4HDE A;  5D9V A;  4DEJ A;  2O87 A;  4TR4 A;  3QAV A;  5COH A;  3ZVJ A;  3EWL A;  2C8U A;  3ZMK A;  2CA8 A;  2TRX A;  1ZCP A;  1XWG A;  4ZB8 A;  4IJI A;  1ML6 A;  3L9U A;  5E59 A;  1O6J A;  1T3B A;  2V41 A;  3IDV A;  5DDL A;  3I69 A;  2HSY A;  3TB2 A;  4OCF A;  1K0O A;  2RM5 A;  1B9Y C;  2KHP A;  5ELG A;  5AIX A;  4MZC A;  2LQO A;  4EUY A;  1YQ1 A;  1GTA A;  4WR4 A;  4IKH A;  2CAQ A;  4EO3 A;  2C4J A;  2R37 A;  3UEM A;  3TUE A;  5F06 A;  5KN1 A;  5HQP A;  4DSS B;  5ECP B;  1SD8 A;  3VUR A;  3APO A;  1JZO A;  1O73 A;  3GH6 A;  2LV3 A;  2VL9 A;  3FZ4 A;  5E4W A;  2H6Z A;  4KE3 A;  4RQR A;  2L6C A;  3KP8 A;  2AV4 A;  4KX4 A;  2FGX A;  1T8E B;  3M8N A;  1V9W A;  3Q19 A;  2VCX A;  4ZIL A;  1SK2 A;  4LA1 A;  4K6X A;  1DE2 A;  2LRN A;  2WS2 A;  4PX1 A;  3LXZ A;  5ECL B;  4HQZ A;  1N8J A;  4OFM A;  1V98 A;  4X43 A;  1SYR A;  4HEA 2;  3GKN A;  3UIW A;  2RUE A;  4HZ2 A;  1HNB A;  5JCG A;  2X99 A;  2C3N A;  4FYB A;  5IOX A;  5IO0 A;  3ZFB A;  4PUA A;  6GSW A;  5CRW A;  3EUR A;  1AW9 A;  5HR1 A;  2RUF A;  4Q5Q A;  3TKS E;  1ERW A;  4KUN A;  1NW2 A;  1Z6N A;  1ZGN A;  4ACS A;  1FO5 A;  1M2A A;  3M9J A;  3D4T A;  5DJL A;  2NVL A;  2K8S A;  3QR6 A;  3GL5 A;  5H5S A;  4POB A;  1ZYQ B;  2OA7 A;  2VD0 A;  4MLY A;  1OE8 A;  2PU9 C;  12GS A;  4JRR A;  3A5W A;  5FWG A;  3GA4 A;  2PBJ A;  2DC5 A;  2FD3 A;  2WRT A;  3Q18 A;  1XW6 A;  3I6A A;  4OCE A;  3D22 A;  4XRA A;  2REM A;  2ZNM A;  3F9U A;  4K8M A;  1ERV A;  1K3O A;  4ECC A;  1ILO A;  3EYT A;  3F63 A;  3DGQ A;  4L0U A;  5D73 A;  1X5C A;  5HR2 A;  1B9X C;  3H1N A;  1SJZ A;  2LRC A;  5ID2 B;  3D4M A;  4DVC A;  2I81 A;  2YOI A;  2QC7 A;  1S3C A;  1HNA A;  4TXV A;  3BCI A;  4MF5 A;  2YAN A;  1EP8 A;  2QKE A;  1TU7 A;  4X0X A;  2QGV A;  4IQA A;  2JU5 A;  2C0F A;  1WP0 A;  4OFT A;  3DVW A;  3L0H A;  5B6M A;  5B7C A;  1JZD A;  3FZ5 A;  3EIN A;  2GTU A;  3DML A;  2C1Y A;  3H93 A;  1PQN A;  2H0I A;  5CNW A;  4MH3 A;  4TR1 A;  1GSQ A;  5INY A;  1TRW A;  3FYG A;  2WDU A;  2IMK A;  6GSU A;  3GKM A;  1XZO A;  2C3T A;  3SBC A;  1MDK A;  3AY8 A;  4GQC A;  2DMM A;  5HR3 A;  2HZE B;  4YAP A;  1SJI A;  3J7Y b;  4QQ7 A;  5EVO A;  2H70 A;  5IM9 A;  3CYN A;  1OC8 A;  4N0V A;  3RDW A;  3RHB A;  3IK7 A;  4JR4 A;  3EU4 A;  5G1K A;  3RBT A;  5DVB A;  5D9W A;  1EV9 A;  3ZRE A;  2FWE A;  3ZTL A;  3I43 A;  3FKF A;  1FVJ A;  4EDY A;  3TJJ A;  3L4N A;  4AJ8 A;  1TXX A;  2HZF A;  3BD2 A;  22GS A;  3GUS A;  5F07 A;  2VM1 A;  4LLR A;  1Z3E A;  3VPQ A;  2GSS A;  4OO4 A;  3FY7 A;  2VLT A;  1U3A A;  5B6N A;  2O7K A;  4MP4 A;  1WPI A;  2K6V A;  3LSZ A;  5B8B A;  3C7M A;  4MJE A;  4I2U A;  3IOS A;  9GSS A;  5IOW A;  3HD5 A;  5AIV A;  1XWC A;  3LG6 A;  1ON4 A;  1QUW A;  1SL1 B;  1H4O A;  5B8A A;  4F0B A;  2HT9 A;  1SL2 B;  4TRX A;  5F0G A;  3GMF A;  2YP6 A;  3GV1 A;  4P3Y B;  4BA7 A;  4FYU A;  3TKP A;  3ZVJ D;  2JAC A;  2PVO C;  3ED3 A;  5ECK B;  3ZL5 A;  2H0H A;  5HFI A;  4WBJ A;  1URM A;  3A2X A;  4IJ3 A;  1Z5Y E;  3R2Q A;  2VOC A;  4ZIJ A;  3WGD A;  3M9K A;  1WOU A;  4O92 A;  1A0R P;  2CX4 A;  1ZZY A;  4IN0 A;  2NDO A;  2HRF A;  2RM6 A;  3KCM A;  2ALB A;  4TR0 A;  1GSF A;  4AGS A;  2H1B A;  3CSJ A;  2GQM A;  2VL2 A;  1JZR A;  4WBR D; 
#chains in the Genus database with same CATH topology
 5G30 A;  3GIX A;  3P90 A;  4MDC A;  4ISD A;  3GUR A;  3TOT A;  4LL4 B;  4TR1 B;  4FO5 A;  1QMV A;  1RQM A;  1AQW A;  5IMV A;  1XW5 A;  3VWV A;  3K8N A;  4F9Z A;  4MK3 A;  3ZFL A;  3DVX A;  1ACV A;  3GFK A;  2C0E A;  5F8B A;  4OD7 A;  1HD2 A;  3QMX A;  1YY7 A;  4V1A p;  5EPF A;  4JZQ A;  10GS A;  2VL3 A;  1PN9 A;  5L71 A;  1F37 A;  3TJG A;  1QGV A;  3LWA A;  1T7P B;  4MZB A;  6GSY A;  2LS5 A;  2LNT A;  1YZX A;  3O76 A;  1R5P A;  3CRT A;  2IIY A;  3BOA A;  2OE1 A;  2H75 A;  3UAP A;  3A2V A;  1FB6 A;  3HDC A;  4Q5F A;  4K1F A;  3VK9 A;  3FZ9 A;  4POM A;  4AJ7 A;  2PUK C;  4GSN A;  1AQV A;  1JHB A;  3HCZ A;  3EU3 A;  4XS1 A;  4IHU A;  3UMA A;  1ZOF A;  1GSU A;  2WGR A;  3WGE A;  5GAP D;  1XVQ A;  4ECJ A;  1USB A;  1F9M A;  2F3M A;  1XIY A;  1FOV A;  1YKC A;  3O3T A;  3WGX A;  4KB3 A;  4NAX A;  2IMD A;  3KEB A;  2I4A A;  4YAV A;  3N5O A;  3HKR A;  1PGT A;  2VD1 A;  2LJA A;  3EMX A;  3FZA A;  3MYD A;  3HVS A;  4I97 A;  2DKH A;  2VUP A;  2LJR A;  1FVK A;  4JED A;  2B1K A;  4N0Z A;  3TKS A;  1XWK A;  1OKT A;  3IV4 A;  2LRT A;  4GLT A;  3D6I A;  4Z2R A;  4BWS A;  1TK0 B;  3DEX A;  2IN3 A;  2HSH A;  4MJC A;  4KDY A;  4ZB9 A;  2V6K A;  1PKW A;  1O7U A;  5IPG A;  1A8Y A;  2ZUP A;  3LXT A;  4X4J A;  4ECB A;  1PSQ A;  2X8H A;  4ZB6 A;  1KTE A;  2YCD A;  5GST A;  2EIQ A;  2HRK A;  4PNG A;  1TI3 A;  1LJR A;  1KEB A;  4FYC A;  1B48 A;  1V2A A;  4ZL8 A;  1PL2 A;  3ZIV A;  2WZ9 A;  1PRX A;  2YWI A;  4EIP A;  4NMU A;  1SK0 A;  1X5E A;  3DKS A;  4JR6 A;  1A0F A;  4NV5 A;  1H75 A;  3UVT A;  4IP1 A;  2YV9 A;  3H8Q A;  4I5Q A;  2E2M A;  5DAL B;  3GKK A;  1K3Y A;  6GSV A;  1X9S B;  1E6B A;  4BL7 B;  1ABA A;  2P5Q A;  3KH7 A;  4MF6 A;  3LYK A;  3TKR A;  2F9S A;  16GS A;  3BBY A;  3VWU A;  5ID2 A;  1KNG A;  3CTG A;  1XOA A;  4L5L A;  4OWY A;  3QD9 A;  1K0D A;  2R0G A;  2R3X A;  1LBK A;  2TIR A;  1GSS A;  2A2R A;  4K9Z A;  2L4Q A;  1SD9 A;  4XS4 B;  5GZZ B;  3M0F A;  2DJ2 A;  2IFQ B;  3J7Y k;  5ENU A;  5KOX A;  3CRU A;  5AGY A;  2JL4 A;  1OE7 A;  2E0Q A;  1O8X A;  1SU9 A;  3L9V A;  1GTB A;  1W89 A;  2G0F A;  1HNC A;  4HJM A;  2YN1 A;  4FIW A;  5D8I A;  1EGO A;  4POL A;  3E9J B;  4IBP A;  2F8A A;  1XW9 A;  4N10 A;  4TN8 A;  2X8C A;  4YQV A;  1M7T A;  3CSI A;  3HJM A;  2FWG A;  3KXO A;  4LMW A;  1ZMA A;  4G2E A;  4BVY B;  2FLS A;  4KW6 A;  3IXR A;  3LGC A;  2N5A A;  4TR3 A;  3F4T A;  4KSM A;  2B5X A;  3GTU B;  2HZE A;  2FY6 A;  3LEF A;  2H73 A;  3MNG A;  4ML6 A;  5CRE A;  2PWJ A;  3EMP A;  1UC7 A;  2KOK A;  3HA9 A;  4DSR A;  2YZH A;  4WF4 A;  3TRP A;  1X9W B;  3TRQ A;  3US3 A;  5LNK e;  3M1G A;  4K0G A;  3Q74 A;  2V6O A;  2OKA A;  2VCZ A;  4ID0 A;  5IQY A;  3KTL A;  2LJK A;  1OC9 B;  3EC3 A;  1GP1 A;  4HI7 A;  2K8V A;  4K2X A;  2GZP A;  1UN2 A;  4TXO A;  4DSQ A;  1MDJ A;  5IMA A;  4TKY A;  2OAD A;  2VCV A;  2CVD A;  3C1R A;  4KF9 A;  5BMU A;  5HFG A;  2L5O A;  1N2A A;  3IC8 A;  5G31 A;  5EY6 A;  3PIN A;  2DJJ A;  5JWR B;  1Q98 A;  4E8H A;  2HLS A;  5KEJ A;  1EV4 A;  1TU8 A;  2PER A;  4MJA A;  4NWY A;  3ERG A;  1AQX A;  3MIX A;  1SK1 A;  1R4W A;  1YEX A;  3QAG A;  4JU5 A;  1PX7 A;  3E3E A;  5G5F A;  1MD4 A;  6GSX A;  1PL1 A;  1NHO A;  3HZ4 A;  1EGR A;  3LJR A;  2LST A;  2QA1 A;  1X0R A;  3F6F A;  3FK8 A;  2RLI A;  2B1L A;  2IL3 A;  3IAS 2;  1R5A A;  1U87 A;  1OC3 A;  4O7H A;  3ERW A;  1Z7R A;  4WXT A;  6GST A;  1UVZ A;  1O8W A;  3ZYW A;  1DBY A;  1K0B A;  5FT3 A;  5IMD A;  3CBU A;  3HVX A;  1TKD B;  4CHS A;  2GLR A;  4ZBD A;  3L9S A;  1NM3 A;  4J56 E;  2PVQ A;  3L78 A;  3E0U A;  1SKW B;  5ECR B;  3HJO A;  5GSS A;  3CQF A;  1A23 A;  4L8E A;  1AC1 A;  3MAK A;  1GUK A;  2YWO A;  2CX3 A;  3IBH A;  1VGL A;  3ERF A;  4CW9 A;  3KMN A;  3F3R A;  1S3R A;  1TRS A;  2I3Y A;  1TTZ A;  3H4K A;  3NIV A;  4O5Q A;  2J9H A;  3HVV A;  4TW5 A;  1J9B A;  4V2N A;  1O85 A;  1G6W A;  2CAI A;  3VFI A;  5J41 A;  4NHW A;  2GVP A;  1WIK A;  3APS A;  4USS A;  2DBC A;  2F51 A;  3GX0 A;  4KSO A;  1W4V A;  2HFD A;  1WWJ A;  3QFA C;  3FW2 A;  2CVB A;  2OBI A;  2X8G A;  1XFL A;  2I9H A;  4X1U A;  3G9B A;  4TXO B;  5ECQ B;  3IK9 A;  2N5B A;  3WD6 A;  4KDX A;  1X9M B;  2FA8 A;  1QK8 A;  4HU7 A;  2L5L A;  3IRA A;  4PQI A;  4GQF A;  4EF0 A;  5IO2 A;  2H1G A;  4YKF A;  1THO A;  1VF2 A;  1G0T A;  4K7N A;  5J9C A;  2MBT A;  4MMM A;  3KGK A;  4MPG A;  2H71 A;  1EZK A;  1LU4 A;  2FWF A;  5D93 A;  1F3B A;  5A5K A;  2OE0 A;  2H72 A;  1EOH A;  5ECH B;  5CRG A;  1MD3 A;  2C3Q A;  3RHC A;  4F0C A;  5DJM A;  4IQ1 A;  3TGZ A;  2KLX A;  4N30 A;  1GNW A;  4OMV A;  5JCU A;  4WF5 A;  6GSS A;  2EIO A;  1V40 A;  4ILF A;  3LYP A;  2C0G A;  2KUC A;  1TRV A;  1JLW A;  5KN3 A;  3FR9 A;  2B5E A;  1HYU A;  2VCQ A;  4EVM A;  5JCW A;  1EP7 A;  2YWN A;  3EE2 A;  2WFC A;  3D21 A;  2TRC P;  1WJK A;  3W8J A;  3TJK A;  3IC4 A;  2YJH A;  3QOU A;  3D5J A;  2X4A A;  5H5R A;  1SEN A;  1PD2 1;  2FWH A;  3IA1 A;  1FHE A;  2YNX A;  2GZZ A;  2JSZ A;  1A2J A;  3C8E A;  2VO4 A;  2OAC A;  2ZCT A;  4AJ6 A;  1AXD A;  2GQK A;  2H74 A;  3KP9 A;  4K7I A;  2J23 A;  3UOM A;  2R0P A;  2R6K A;  5IMC A;  2O8V B;  4HQS A;  5DAL A;  4ZL7 A;  4IGJ A;  2K9F A;  2H1D A;  4BL7 A;  1S3A A;  2L6D A;  3HHV A;  3UBK A;  1G7E A;  2VLV A;  4MH2 A;  1BG5 A;  2HYX A;  4CDO A;  4V2L A;  3GN3 A;  3HZ8 A;  1CQH A;  3WT2 A;  3GH9 A;  4F03 A;  1HQO A;  5CAX A;  2E2G A;  4G10 A;  1SJ6 A;  2FUG 2;  1GSE A;  4G0K A;  4HUA A;  2HRA A;  4PQH A;  3RPP A;  3CMI A;  1B4P A;  4KCE A;  2MBS A;  3TCO A;  3S9F A;  5C04 A;  3ZML A;  4BWQ A;  1U88 A;  2JZT A;  1F3A A;  1VRS D;  1ZYE A;  1J08 A;  1F6M C;  3W8S A;  1XPV A;  2MYG A;  4XS4 A;  1V57 A;  4V2M A;  5IIZ A;  3LW9 A;  2IFQ A;  4MCU A;  2MMA A;  1MEK A;  1VF3 A;  2AYT A;  3QCP A;  1BJX A;  4AF2 A;  4H86 A;  3UJ1 A;  2GS3 A;  4RQX A;  3Q6O A;  4GST A;  4Z2U A;  4GCI A;  3MWH A;  1A8L A;  3IPZ A;  4BVX B;  4ML1 A;  1EWX A;  2R4V A;  2LQQ A;  3FEU A;  2YJ7 A;  2XHF A;  1YKA A;  2FNO A;  1XWA A;  2PPT A;  2VIM A;  3GL3 A;  5DCH A;  4BVY A;  5DQS A;  2JSY A;  2XBQ A;  3DYR A;  14GS A;  4ZBA A;  1WRY A;  2AJQ B;  4KAE A;  2L4C A;  3O6T A;  3GTU A;  1PKZ A;  3DIE A;  2IWT A;  3RPN A;  2FHE A;  2DJ3 A;  1M3J A;  3TDG A;  2X49 A;  4O32 A;  5IMF A;  5DAK B;  4IVF A;  4ZXG A;  3BCK A;  4XHM A;  2B7J A;  1PMT A;  1SYX A;  3A2W A;  5J3R A;  1OC9 A;  1SKR B;  2L57 A;  3HXS A;  1GUM A;  1XBS A;  3G7Y A;  1FG4 A;  1T00 A;  2YZU A;  5JWQ B;  4O5U A;  4BPY A;  4BIK A;  2H8L A;  2GT5 A;  3FR3 A;  3F6D A;  1TP9 A;  3QDN A;  5A4W A;  4NXI A;  4EC0 A;  3GX8 A;  2GSR A;  5D9T A;  4I2T A;  1BX9 A;  3F4R A;  3KTB A;  4KH7 A;  4MPF A;  4WET A;  1SKS B;  1OYJ A;  2N5F A;  1YF0 A;  2E7P A;  3C73 A;  2DML A;  5J4U A;  3TJB A;  2VL2 C;  4WEY A;  3WYW A;  2GDR A;  2DIY A;  1R26 A;  2H1A A;  3H79 A;  2H76 A;  5J5N A;  4ECI A;  1M99 A;  4HJ2 A;  1TDI A;  2O85 A;  1TRU A;  3FR6 A;  4L5O A;  2IME A;  4Z2T A;  4K0N A;  4EE0 A;  3UBL A;  1T4Y A;  1YF1 A;  4IS0 A;  2FA4 A;  3P7X A;  4XCS A;  3D0Z A;  3DRN A;  5DBQ A;  2BTO T;  4Q5N A;  1ZL9 A;  1XXU A;  3DWV A;  5GAN D;  2KP1 A;  2P5R A;  1FAA A;  4V1A g;  3KIJ A;  3VLN A;  2YWM A;  1VF4 A;  3IE3 A;  2H01 A;  2HNL A;  1BED A;  4N11 A;  4KA0 A;  4PTS A;  1JLV A;  3DXB A;  3F0I A;  2ON7 A;  2IPA A;  5FHI A;  1PA3 A;  1OVN A;  1V58 A;  2IJY A;  3C71 A;  3F4S A;  3MSZ A;  3NZN A;  1XG8 A;  3U6V A;  2JAD A;  1PX6 A;  1M9A A;  1T1V A;  3ZLP A;  1NSW A;  3ISO A;  5G2Z A;  1B4Q A;  2MMZ A;  2B7K A;  3GYK A;  1GLP A;  1OKD A;  2H19 A;  2C0D A;  4NPB A;  1QQ2 A;  2CZ3 A;  5D96 A;  1Y6E A;  1EEJ A;  3P8W A;  1GLQ A;  4PUF C;  3TOU A;  4IP6 A;  2HSM A;  5A4V A;  3LFL A;  4POK A;  1XCC A;  3TKS C;  1K0M A;  1TJD A;  3UAR A;  1BQ7 A;  1GSY A;  1Q4J A;  2BJX A;  3VI5 A;  4MJB A;  2XBI A;  2LNS A;  2KP2 A;  5ECI B;  4EDZ A;  5ELA A;  1UA5 A;  4KDU A;  4YH2 A;  1FW1 A;  11GS A;  2EC4 A;  2WUL A;  3PH9 A;  2PGT A;  3GRX A;  4OFN A;  1G7O A;  4FQU A;  1GSD A;  3V1W A;  4FH8 A;  5G1L A;  3G7J A;  1GUH A;  1J0F A;  2GST A;  3C1S A;  3CXG A;  1M2D A;  1TOF A;  7GSS A;  1I5G A;  5CRH A;  3N9J A;  1ZYN A;  1M3I A;  2EIR A;  1IYH A;  2Z9S A;  5ECS A;  4GXZ A;  4CY8 A;  3LOR A;  1Z9H A;  3PR8 A;  3VI7 A;  2GT6 A;  3KMO A;  3KH9 A;  3A3T A;  4GTU A;  5KN2 A;  1DE1 A;  5EL8 A;  1U3I A;  3ME8 A;  4XRD A;  4CY6 A;  4HZ4 A;  4WR5 A;  2JZS A;  4EXJ A;  1AIU A;  4QL7 A;  1B8X A;  2MMO A;  2CV4 A;  4LMV A;  2NBS A;  5JWO B;  3CSH A;  1IYI A;  2P0G A;  5H5Q A;  1WE0 A;  2OBK A;  4F2I A;  2GSQ A;  2GGT A;  2VCW A;  2DJK A;  2H0G A;  4ZL9 A;  1EEM A;  5AIS A;  1GL8 A;  2H66 A;  3KJY A;  1GTU A;  2LUS A;  4J2F A;  5ABR A;  1KBN A;  3KM6 A;  4MA9 A;  2R2J A;  1Y25 A;  5F05 A;  3GNJ A;  4PNF A;  1YJ6 A;  2BMX A;  1K3L A;  4TVE A;  2PN8 A;  4NV2 A;  1DUG A;  1K0A A;  4PQ1 A;  2CZ2 A;  2YPM A;  1C72 A;  1QXH A;  2XC2 A;  4HOJ A;  2IMI A;  2L59 A;  4QL9 A;  3GHA A;  3QFB C;  1YEP A;  3VWX A;  2PMT A;  4RI7 A;  4IW9 A;  4MZW A;  4JBB A;  3CTF A;  2GZY A;  1TK8 B;  4G19 A;  3QPM A;  2QSI A;  4G9H A;  1GUL A;  4RUV A;  4Z7X A;  4PUR A;  5DQY A;  4D73 A;  4E8E A;  1TK5 B;  2WJU A;  3UVH A;  3WT1 A;  2DSA A;  2ON5 A;  2B6M A;  2NTO A;  4GSS A;  3KD0 A;  3KZQ A;  5LD0 A;  1Z6M A;  4GWR A;  4HSC X;  1K0N A;  3BJ5 A;  1NHY A;  3ME7 A;  1M0U A;  4NHZ A;  4MF7 A;  13GS A;  20GS A;  5ECM B;  3VPT A;  1SL0 B;  3APQ A;  4XIH A;  5G5E A;  2R5G A;  2YV7 A;  2VM2 A;  4YKG A;  4BVX A;  2VCT A;  1MDI A;  2B5Y A;  5KN0 A;  1E2Y A;  2LTK A;  3FRC A;  3TKQ A;  1GH2 A;  4PGT A;  1I9D A;  4ULX A;  2WB9 A;  2H30 A;  2XPE A;  1A24 A;  3GKX A;  3OR5 A;  2GQL A;  1A2L A;  3HJP A;  3IAM 2;  1AAZ A;  1THX A;  5HFK A;  2HE3 A;  1XWB A;  2RII A;  3GST A;  2AHE A;  2X64 A;  4L0W A;  4GRF A;  4WKW A;  8GSS A;  1FOH A;  4OO5 A;  2A4V A;  5DAK A;  4JE1 A;  2FCH A;  3UL3 A;  2JZR A;  1TW9 A;  3FHK A;  3DD3 A;  1VF1 A;  1JZW A;  2HI7 A;  3IR4 A;  3ZIJ A;  3SWL A;  5AN1 A;  1ST9 A;  3ZRD A;  2OE3 A;  1A2M A;  5IMZ A;  1ERU A;  4MAB A;  2WCI A;  5CRD A;  2D2Z A;  4YQM A;  1CQG A;  3JCM L;  2G2Q A;  5J9B A;  1GNE A;  2HXK A;  2CVK A;  3HYP A;  2AAW A;  1ZYP A;  2MMN A;  2M46 A;  3MDK A;  2OJL A;  5ECO B;  3G7I A;  2HRN A;  5CP1 A;  2DJ1 A;  3F8U A;  3QAW A;  4HU9 A;  1M2B A;  1XOB A;  2VAF A;  3U5R E;  1U6T A;  2AB6 A;  1EOG A;  4EL1 A;  4EKZ A;  4ZBB A;  4LL1 B;  5CO3 A;  4PXO A;  2CT6 A;  1YDK A;  4IEL A;  1TI1 A;  3P2A A;  1S3D A;  3TJF A;  1PFO A;  1M9B A;  2M80 A;  5ECN B;  3ZIT A;  4D73 B;  1O81 A;  3IHQ A;  1BAY A;  18GS A;  4YQU A;  1GRX A;  2CQ9 A;  4KGI A;  4K7O A;  3GSS A;  1MTC A;  2ES7 A;  17GS A;  3VWW A;  5A4U A;  3F3Q A;  3EVI A;  2A4H A;  5D9X A;  2XPD A;  2V1M A;  1ERT A;  4ICY A;  1GWC A;  1WMJ A;  2DLX A;  1RK4 A;  4EIQ A;  2VLU A;  4DSS A;  2O89 A;  1JFU A;  1X5D A;  1QFN A;  1XVW A;  1AUC A;  5C00 A;  2A2P A;  2I1U A;  4KND A;  4Q5R A;  2DJ0 A;  2B3S A;  19GS A;  3W6G A;  1R7H A;  4RI6 A;  5LCZ A;  4I6X A;  2AUV A;  1FB0 A;  5CYY A;  4HS1 A;  3LQ7 A;  3IHG A;  5BRT A;  2V32 A;  2H6X A;  2P31 A;  2QA2 A;  1Z7P A;  1F2E A;  2V2G A;  1RW1 A;  3ZZX A;  2LKU A;  4KCA A;  4K2D A;  1DSB A;  4GF0 A;  4XTS A;  4TOP A;  2C80 A;  4O5R A;  4J57 E;  2M72 A;  2LEG A;  1K0C A;  4F82 A;  3HY2 A;  1GTI A;  2K18 A;  5HR0 A;  2F8F A;  1T4Z A;  1BYE A;  1G6Y A;  5IPH A;  2IMF A;  2DIZ A;  3I9V 2;  3TRX A;  3M3M A;  2NPB A;  2A2S A;  5DCG A;  4I8B A;  4XS6 A;  3RAZ A;  2H6Y A;  1OAZ A;  3NOF A;  3PGT A;  2MZC A;  4HDE A;  5D9V A;  4DEJ A;  2UZ8 A;  2O87 A;  4TR4 A;  3QAV A;  5COH A;  3ZVJ A;  3EWL A;  2C8U A;  3ZMK A;  2CA8 A;  2TRX A;  1ZCP A;  1XWG A;  4ZB8 A;  4IJI A;  1ML6 A;  3L9U A;  5E59 A;  1O6J A;  1T3B A;  2V41 A;  3IDV A;  5DDL A;  3I69 A;  2HSY A;  3TB2 A;  4OCF A;  1K0O A;  2RM5 A;  1B9Y C;  2KHP A;  5ELG A;  5AIX A;  4MZC A;  2LQO A;  4EUY A;  1YQ1 A;  1GTA A;  4WR4 A;  4IKH A;  2CAQ A;  4EO3 A;  2C4J A;  2R37 A;  3UEM A;  4G0L A;  3TUE A;  5F06 A;  5KN1 A;  5HQP A;  4DSS B;  5ECP B;  1SD8 A;  3VUR A;  3APO A;  1JZO A;  1O73 A;  3GH6 A;  4G0I A;  2LV3 A;  2VL9 A;  3FZ4 A;  5E4W A;  2H6Z A;  4KE3 A;  4RQR A;  2L6C A;  3KP8 A;  2AV4 A;  4KX4 A;  2FGX A;  1T8E B;  3M8N A;  1V9W A;  3R3E A;  3Q19 A;  2VCX A;  4ZIL A;  1SK2 A;  4LA1 A;  4K6X A;  1DE2 A;  2LRN A;  2WS2 A;  4PX1 A;  3LXZ A;  5ECL B;  4HQZ A;  2DKI A;  1N8J A;  4OFM A;  1V98 A;  4X43 A;  1SYR A;  4HEA 2;  3GKN A;  3UIW A;  2RUE A;  4HZ2 A;  1HNB A;  5JCG A;  2X99 A;  2C3N A;  4FYB A;  5IOX A;  5IO0 A;  3ZFB A;  4PUA A;  6GSW A;  5CRW A;  3EUR A;  1AW9 A;  5HR1 A;  2RUF A;  4Q5Q A;  3TKS E;  1ERW A;  4KUN A;  1NW2 A;  1Z6N A;  1ZGN A;  4ACS A;  1FO5 A;  1M2A A;  3M9J A;  3D4T A;  5DJL A;  2NVL A;  2K8S A;  3QR6 A;  3GL5 A;  5H5S A;  4POB A;  1ZYQ B;  2OA7 A;  4K5R A;  2VD0 A;  4MLY A;  1OE8 A;  2PU9 C;  12GS A;  4JRR A;  3A5W A;  5FWG A;  3GA4 A;  2PBJ A;  2DC5 A;  2FD3 A;  2WRT A;  3Q18 A;  1XW6 A;  3I6A A;  4OCE A;  3D22 A;  4XRA A;  2REM A;  2ZNM A;  3F9U A;  4K8M A;  1ERV A;  1K3O A;  4ECC A;  3HVN A;  1ILO A;  3EYT A;  3F63 A;  3DGQ A;  4L0U A;  5D73 A;  1X5C A;  5HR2 A;  1B9X C;  3H1N A;  1SJZ A;  2LRC A;  5ID2 B;  3D4M A;  4DVC A;  2I81 A;  3A5I A;  2YOI A;  2QC7 A;  1S3C A;  1HNA A;  4TXV A;  3BCI A;  4MF5 A;  2YAN A;  1EP8 A;  2QKE A;  1TU7 A;  4X0X A;  2QGV A;  2R0C A;  4IQA A;  2JU5 A;  2C0F A;  4K5S A;  1WP0 A;  3PPU A;  4OFT A;  3DVW A;  3L0H A;  5B6M A;  5B7C A;  1JZD A;  3FZ5 A;  3EIN A;  2GTU A;  3DML A;  2C1Y A;  3EPT A;  3H93 A;  1PQN A;  2H0I A;  5CNW A;  4MH3 A;  4TR1 A;  1GSQ A;  5INY A;  1TRW A;  3FYG A;  2WDU A;  2IMK A;  6GSU A;  3GKM A;  1XZO A;  2C3T A;  3SBC A;  1MDK A;  3AY8 A;  4GQC A;  2DMM A;  5HR3 A;  2HZE B;  4YAP A;  1SJI A;  3J7Y b;  4QQ7 A;  5EVO A;  1PN0 A;  2H70 A;  5IM9 A;  3CYN A;  1OC8 A;  4N0V A;  3RDW A;  3RHB A;  3IK7 A;  4JR4 A;  3EU4 A;  5G1K A;  3RBT A;  4MNN A;  5DVB A;  5D9W A;  1EV9 A;  3ZRE A;  2FWE A;  4A5P A;  3ZTL A;  3I43 A;  3FKF A;  1FVJ A;  4EDY A;  3TJJ A;  3L4N A;  4AJ8 A;  1TXX A;  2HZF A;  3BD2 A;  22GS A;  3GUS A;  5F07 A;  2VM1 A;  4LLR A;  1Z3E A;  3VPQ A;  2GSS A;  4OO4 A;  3FY7 A;  2VLT A;  1U3A A;  5B6N A;  2O7K A;  3FMW A;  4MP4 A;  1WPI A;  2K6V A;  3LSZ A;  5B8B A;  3C7M A;  4MJE A;  4I2U A;  3IOS A;  9GSS A;  5IOW A;  3HD5 A;  5AIV A;  1XWC A;  5KOW A;  3LG6 A;  1ON4 A;  1QUW A;  1SL1 B;  1H4O A;  5B8A A;  4F0B A;  2HT9 A;  1SL2 B;  4TRX A;  5F0G A;  3GMF A;  2YP6 A;  3GV1 A;  4P3Y B;  4BA7 A;  4FYU A;  3TKP A;  3ZVJ D;  2JAC A;  2PVO C;  3ED3 A;  5ECK B;  3ZL5 A;  2H0H A;  5HFI A;  4WBJ A;  1URM A;  3A2X A;  4IJ3 A;  1Z5Y E;  3R2Q A;  2VOC A;  4ZIJ A;  3WGD A;  3M9K A;  1WOU A;  4O92 A;  1A0R P;  2CX4 A;  1ZZY A;  4IN0 A;  2NDO A;  2HRF A;  2RM6 A;  3KCM A;  2ALB A;  4TR0 A;  1GSF A;  4AGS A;  2H1B A;  3CSJ A;  2GQM A;  2VL2 A;  1JZR A;  4WBR D; 
#chains in the Genus database with same CATH homology
 5G30 A;  3GIX A;  3P90 A;  4MDC A;  4ISD A;  3GUR A;  3TOT A;  4LL4 B;  4TR1 B;  4FO5 A;  1QMV A;  1RQM A;  1AQW A;  5IMV A;  1XW5 A;  3VWV A;  3K8N A;  4F9Z A;  4MK3 A;  3ZFL A;  3DVX A;  1ACV A;  3GFK A;  2C0E A;  5F8B A;  4OD7 A;  1HD2 A;  3QMX A;  1YY7 A;  4V1A p;  5EPF A;  4JZQ A;  10GS A;  2VL3 A;  1PN9 A;  5L71 A;  1F37 A;  3TJG A;  1QGV A;  3LWA A;  1T7P B;  4MZB A;  6GSY A;  2LS5 A;  2LNT A;  1YZX A;  3O76 A;  1R5P A;  3CRT A;  2IIY A;  3BOA A;  2OE1 A;  2H75 A;  3UAP A;  3A2V A;  1FB6 A;  3HDC A;  4Q5F A;  4K1F A;  3VK9 A;  3FZ9 A;  4POM A;  4AJ7 A;  2PUK C;  4GSN A;  1AQV A;  1JHB A;  3HCZ A;  3EU3 A;  4XS1 A;  4IHU A;  3UMA A;  1ZOF A;  1GSU A;  2WGR A;  3WGE A;  5GAP D;  1XVQ A;  4ECJ A;  1USB A;  1F9M A;  2F3M A;  1XIY A;  1FOV A;  1YKC A;  3O3T A;  3WGX A;  4KB3 A;  4NAX A;  2IMD A;  3KEB A;  2I4A A;  4YAV A;  3N5O A;  3HKR A;  1PGT A;  2VD1 A;  2LJA A;  3EMX A;  3FZA A;  3MYD A;  3HVS A;  4I97 A;  2DKH A;  2VUP A;  2LJR A;  1FVK A;  4JED A;  2B1K A;  4N0Z A;  3TKS A;  1XWK A;  1OKT A;  3IV4 A;  2LRT A;  4GLT A;  3D6I A;  4Z2R A;  4BWS A;  1TK0 B;  3DEX A;  2IN3 A;  2HSH A;  4MJC A;  4KDY A;  4ZB9 A;  2V6K A;  1PKW A;  1O7U A;  5IPG A;  1A8Y A;  2ZUP A;  3LXT A;  4X4J A;  4ECB A;  1PSQ A;  2X8H A;  4ZB6 A;  1KTE A;  2YCD A;  5GST A;  2EIQ A;  2HRK A;  4PNG A;  1TI3 A;  1LJR A;  1KEB A;  4FYC A;  1B48 A;  1V2A A;  4ZL8 A;  1PL2 A;  3ZIV A;  2WZ9 A;  1PRX A;  2YWI A;  4EIP A;  4NMU A;  1SK0 A;  1X5E A;  3DKS A;  4JR6 A;  1A0F A;  4NV5 A;  1H75 A;  3UVT A;  4IP1 A;  2YV9 A;  3H8Q A;  4I5Q A;  2E2M A;  5DAL B;  3GKK A;  1K3Y A;  6GSV A;  1X9S B;  1E6B A;  4BL7 B;  1ABA A;  2P5Q A;  3KH7 A;  4MF6 A;  3LYK A;  3TKR A;  2F9S A;  16GS A;  3BBY A;  3VWU A;  5ID2 A;  1KNG A;  3CTG A;  1XOA A;  4L5L A;  4OWY A;  3QD9 A;  1K0D A;  2R0G A;  2R3X A;  1LBK A;  2TIR A;  1GSS A;  2A2R A;  4K9Z A;  2L4Q A;  1SD9 A;  4XS4 B;  5GZZ B;  3M0F A;  2DJ2 A;  2IFQ B;  3J7Y k;  5ENU A;  5KOX A;  3CRU A;  5AGY A;  2JL4 A;  1OE7 A;  2E0Q A;  1O8X A;  1SU9 A;  3L9V A;  1GTB A;  1W89 A;  2G0F A;  1HNC A;  4HJM A;  2YN1 A;  4FIW A;  5D8I A;  1EGO A;  4POL A;  3E9J B;  4IBP A;  2F8A A;  1XW9 A;  4N10 A;  4TN8 A;  2X8C A;  4YQV A;  1M7T A;  3CSI A;  3HJM A;  2FWG A;  3KXO A;  4LMW A;  1ZMA A;  4G2E A;  4BVY B;  2FLS A;  4KW6 A;  3IXR A;  3LGC A;  2N5A A;  4TR3 A;  3F4T A;  4KSM A;  2B5X A;  3GTU B;  2HZE A;  2FY6 A;  3LEF A;  2H73 A;  3MNG A;  4ML6 A;  5CRE A;  2PWJ A;  3EMP A;  1UC7 A;  2KOK A;  3HA9 A;  4DSR A;  2YZH A;  4WF4 A;  3TRP A;  1X9W B;  3TRQ A;  3US3 A;  5LNK e;  3M1G A;  4K0G A;  3Q74 A;  2V6O A;  2OKA A;  2VCZ A;  4ID0 A;  5IQY A;  3KTL A;  2LJK A;  1OC9 B;  3EC3 A;  1GP1 A;  4HI7 A;  2K8V A;  4K2X A;  2GZP A;  1UN2 A;  4TXO A;  4DSQ A;  1MDJ A;  5IMA A;  4TKY A;  2OAD A;  2VCV A;  2CVD A;  3C1R A;  4KF9 A;  5BMU A;  5HFG A;  2L5O A;  1N2A A;  3IC8 A;  5G31 A;  5EY6 A;  3PIN A;  2DJJ A;  5JWR B;  1Q98 A;  4E8H A;  2HLS A;  5KEJ A;  1EV4 A;  1TU8 A;  2PER A;  4MJA A;  4NWY A;  3ERG A;  1AQX A;  3MIX A;  1SK1 A;  1R4W A;  1YEX A;  3QAG A;  4JU5 A;  1PX7 A;  3E3E A;  5G5F A;  1MD4 A;  6GSX A;  1PL1 A;  1NHO A;  3HZ4 A;  1EGR A;  3LJR A;  2LST A;  2QA1 A;  1X0R A;  3F6F A;  3FK8 A;  2RLI A;  2B1L A;  2IL3 A;  3IAS 2;  1R5A A;  1U87 A;  1OC3 A;  4O7H A;  3ERW A;  1Z7R A;  4WXT A;  6GST A;  1UVZ A;  1O8W A;  3ZYW A;  1DBY A;  1K0B A;  5FT3 A;  5IMD A;  3CBU A;  3HVX A;  1TKD B;  4CHS A;  2GLR A;  4ZBD A;  3L9S A;  1NM3 A;  4J56 E;  2PVQ A;  3L78 A;  3E0U A;  1SKW B;  5ECR B;  3HJO A;  5GSS A;  1A23 A;  4L8E A;  1AC1 A;  3MAK A;  1GUK A;  2YWO A;  2CX3 A;  3IBH A;  1VGL A;  3ERF A;  4CW9 A;  3KMN A;  3F3R A;  1TRS A;  2I3Y A;  1TTZ A;  3H4K A;  3NIV A;  4O5Q A;  2J9H A;  3HVV A;  4TW5 A;  1J9B A;  4V2N A;  1O85 A;  1G6W A;  2CAI A;  3VFI A;  5J41 A;  4NHW A;  2GVP A;  1WIK A;  3APS A;  4USS A;  2DBC A;  2F51 A;  3GX0 A;  4KSO A;  1W4V A;  2HFD A;  1WWJ A;  3QFA C;  3FW2 A;  2CVB A;  2OBI A;  2X8G A;  1XFL A;  2I9H A;  4X1U A;  3G9B A;  4TXO B;  5ECQ B;  3IK9 A;  2N5B A;  3WD6 A;  4KDX A;  1X9M B;  2FA8 A;  1QK8 A;  4HU7 A;  2L5L A;  3IRA A;  4PQI A;  4GQF A;  4EF0 A;  5IO2 A;  2H1G A;  4YKF A;  1THO A;  1VF2 A;  1G0T A;  4K7N A;  5J9C A;  2MBT A;  4MMM A;  3KGK A;  4MPG A;  2H71 A;  1EZK A;  1LU4 A;  2FWF A;  5D93 A;  1F3B A;  5A5K A;  2OE0 A;  2H72 A;  1EOH A;  5ECH B;  5CRG A;  1MD3 A;  2C3Q A;  3RHC A;  4F0C A;  5DJM A;  4IQ1 A;  3TGZ A;  2KLX A;  4N30 A;  1GNW A;  4OMV A;  5JCU A;  4WF5 A;  6GSS A;  2EIO A;  1V40 A;  4ILF A;  3LYP A;  2C0G A;  2KUC A;  1TRV A;  1JLW A;  5KN3 A;  3FR9 A;  2B5E A;  1HYU A;  2VCQ A;  4EVM A;  5JCW A;  1EP7 A;  2YWN A;  3EE2 A;  2WFC A;  3D21 A;  2TRC P;  1WJK A;  3W8J A;  3TJK A;  3IC4 A;  2YJH A;  3QOU A;  3D5J A;  2X4A A;  5H5R A;  1SEN A;  1PD2 1;  2FWH A;  3IA1 A;  1FHE A;  2YNX A;  2GZZ A;  2JSZ A;  1A2J A;  3C8E A;  2VO4 A;  2OAC A;  2ZCT A;  4AJ6 A;  1AXD A;  2GQK A;  2H74 A;  3KP9 A;  4K7I A;  2J23 A;  3UOM A;  2R0P A;  2R6K A;  5IMC A;  2O8V B;  4HQS A;  5DAL A;  4ZL7 A;  4IGJ A;  2K9F A;  2H1D A;  4BL7 A;  1S3A A;  2L6D A;  3HHV A;  3UBK A;  1G7E A;  2VLV A;  4MH2 A;  1BG5 A;  2HYX A;  4CDO A;  4V2L A;  3GN3 A;  3HZ8 A;  1CQH A;  3WT2 A;  3GH9 A;  4F03 A;  1HQO A;  5CAX A;  2E2G A;  4G10 A;  1SJ6 A;  2FUG 2;  1GSE A;  4G0K A;  4HUA A;  2HRA A;  4PQH A;  3RPP A;  3CMI A;  1B4P A;  4KCE A;  2MBS A;  3TCO A;  3S9F A;  5C04 A;  3ZML A;  4BWQ A;  1U88 A;  2JZT A;  1F3A A;  1VRS D;  1ZYE A;  1J08 A;  1F6M C;  3W8S A;  1XPV A;  2MYG A;  4XS4 A;  1V57 A;  4V2M A;  5IIZ A;  3LW9 A;  2IFQ A;  4MCU A;  2MMA A;  1MEK A;  1VF3 A;  2AYT A;  3QCP A;  1BJX A;  4AF2 A;  4H86 A;  3UJ1 A;  2GS3 A;  4RQX A;  3Q6O A;  4GST A;  4Z2U A;  4GCI A;  3MWH A;  1A8L A;  3IPZ A;  4BVX B;  4ML1 A;  1EWX A;  2R4V A;  2LQQ A;  3FEU A;  2YJ7 A;  2XHF A;  1YKA A;  2FNO A;  1XWA A;  2PPT A;  2VIM A;  3GL3 A;  5DCH A;  4BVY A;  5DQS A;  2JSY A;  2XBQ A;  3DYR A;  14GS A;  4ZBA A;  1WRY A;  2AJQ B;  4KAE A;  2L4C A;  3O6T A;  3GTU A;  1PKZ A;  3DIE A;  2IWT A;  3RPN A;  2FHE A;  2DJ3 A;  3TDG A;  2X49 A;  4O32 A;  5IMF A;  5DAK B;  4IVF A;  4ZXG A;  3BCK A;  4XHM A;  2B7J A;  1PMT A;  1SYX A;  3A2W A;  5J3R A;  1OC9 A;  1SKR B;  2L57 A;  3HXS A;  1GUM A;  1XBS A;  3G7Y A;  1FG4 A;  1T00 A;  2YZU A;  5JWQ B;  4O5U A;  4BPY A;  2H8L A;  2GT5 A;  3FR3 A;  3F6D A;  1TP9 A;  3QDN A;  5A4W A;  4NXI A;  4EC0 A;  3GX8 A;  2GSR A;  5D9T A;  4I2T A;  1BX9 A;  3F4R A;  3KTB A;  4KH7 A;  4MPF A;  4WET A;  1SKS B;  1OYJ A;  2N5F A;  1YF0 A;  2E7P A;  3C73 A;  2DML A;  5J4U A;  3TJB A;  2VL2 C;  4WEY A;  3WYW A;  2GDR A;  2DIY A;  1R26 A;  2H1A A;  3H79 A;  2H76 A;  5J5N A;  4ECI A;  1M99 A;  4HJ2 A;  1TDI A;  2O85 A;  1TRU A;  3FR6 A;  4L5O A;  2IME A;  4Z2T A;  4K0N A;  4EE0 A;  3UBL A;  1T4Y A;  1YF1 A;  4IS0 A;  2FA4 A;  3P7X A;  4XCS A;  3D0Z A;  3DRN A;  5DBQ A;  2BTO T;  4Q5N A;  1ZL9 A;  1XXU A;  3DWV A;  5GAN D;  2KP1 A;  2P5R A;  1FAA A;  4V1A g;  3KIJ A;  3VLN A;  2YWM A;  1VF4 A;  3IE3 A;  2H01 A;  2HNL A;  1BED A;  4N11 A;  4KA0 A;  4PTS A;  1JLV A;  3DXB A;  3F0I A;  2ON7 A;  2IPA A;  5FHI A;  1PA3 A;  1OVN A;  1V58 A;  2IJY A;  3C71 A;  3F4S A;  3MSZ A;  3NZN A;  3U6V A;  2JAD A;  1PX6 A;  1M9A A;  1T1V A;  3ZLP A;  1NSW A;  3ISO A;  5G2Z A;  1B4Q A;  2MMZ A;  2B7K A;  3GYK A;  1GLP A;  1OKD A;  2H19 A;  2C0D A;  4NPB A;  1QQ2 A;  2CZ3 A;  5D96 A;  1Y6E A;  1EEJ A;  3P8W A;  1GLQ A;  4PUF C;  3TOU A;  4IP6 A;  2HSM A;  5A4V A;  3LFL A;  4POK A;  1XCC A;  3TKS C;  1K0M A;  1TJD A;  3UAR A;  1BQ7 A;  1GSY A;  1Q4J A;  2BJX A;  3VI5 A;  4MJB A;  2XBI A;  2LNS A;  2KP2 A;  5ECI B;  4EDZ A;  5ELA A;  1UA5 A;  4KDU A;  4YH2 A;  1FW1 A;  11GS A;  2EC4 A;  2WUL A;  3PH9 A;  2PGT A;  3GRX A;  4OFN A;  1G7O A;  4FQU A;  1GSD A;  3V1W A;  4FH8 A;  5G1L A;  3G7J A;  1GUH A;  1J0F A;  2GST A;  3C1S A;  3CXG A;  1M2D A;  1TOF A;  7GSS A;  1I5G A;  5CRH A;  3N9J A;  1ZYN A;  2EIR A;  1IYH A;  2Z9S A;  5ECS A;  4GXZ A;  4CY8 A;  3LOR A;  1Z9H A;  3PR8 A;  3VI7 A;  2GT6 A;  3KMO A;  3KH9 A;  3A3T A;  4GTU A;  5KN2 A;  1DE1 A;  5EL8 A;  1U3I A;  3ME8 A;  4XRD A;  4CY6 A;  4HZ4 A;  4WR5 A;  2JZS A;  4EXJ A;  1AIU A;  4QL7 A;  1B8X A;  2MMO A;  2CV4 A;  4LMV A;  2NBS A;  5JWO B;  3CSH A;  1IYI A;  2P0G A;  5H5Q A;  1WE0 A;  2OBK A;  4F2I A;  2GSQ A;  2GGT A;  2VCW A;  2DJK A;  2H0G A;  4ZL9 A;  1EEM A;  5AIS A;  1GL8 A;  2H66 A;  3KJY A;  1GTU A;  2LUS A;  4J2F A;  5ABR A;  1KBN A;  3KM6 A;  4MA9 A;  2R2J A;  1Y25 A;  5F05 A;  3GNJ A;  4PNF A;  1YJ6 A;  2BMX A;  1K3L A;  4TVE A;  2PN8 A;  4NV2 A;  1DUG A;  1K0A A;  4PQ1 A;  2CZ2 A;  2YPM A;  1C72 A;  1QXH A;  2XC2 A;  4HOJ A;  2IMI A;  2L59 A;  4QL9 A;  3GHA A;  3QFB C;  1YEP A;  3VWX A;  2PMT A;  4RI7 A;  4IW9 A;  4MZW A;  4JBB A;  3CTF A;  2GZY A;  1TK8 B;  4G19 A;  3QPM A;  2QSI A;  4G9H A;  1GUL A;  4RUV A;  4Z7X A;  4PUR A;  5DQY A;  4D73 A;  4E8E A;  1TK5 B;  2WJU A;  3UVH A;  3WT1 A;  2DSA A;  2ON5 A;  2B6M A;  2NTO A;  4GSS A;  3KD0 A;  3KZQ A;  5LD0 A;  1Z6M A;  4GWR A;  1K0N A;  3BJ5 A;  1NHY A;  3ME7 A;  1M0U A;  4NHZ A;  4MF7 A;  13GS A;  20GS A;  5ECM B;  3VPT A;  1SL0 B;  3APQ A;  4XIH A;  5G5E A;  2R5G A;  2YV7 A;  2VM2 A;  4YKG A;  4BVX A;  2VCT A;  1MDI A;  2B5Y A;  5KN0 A;  1E2Y A;  2LTK A;  3FRC A;  3TKQ A;  1GH2 A;  4PGT A;  1I9D A;  4ULX A;  2WB9 A;  2H30 A;  2XPE A;  1A24 A;  3GKX A;  3OR5 A;  2GQL A;  1A2L A;  3HJP A;  3IAM 2;  1AAZ A;  1THX A;  5HFK A;  2HE3 A;  1XWB A;  2RII A;  3GST A;  2AHE A;  2X64 A;  4L0W A;  4GRF A;  4WKW A;  8GSS A;  1FOH A;  4OO5 A;  2A4V A;  5DAK A;  4JE1 A;  2FCH A;  3UL3 A;  2JZR A;  1TW9 A;  3FHK A;  3DD3 A;  1VF1 A;  1JZW A;  2HI7 A;  3IR4 A;  3ZIJ A;  3SWL A;  5AN1 A;  1ST9 A;  3ZRD A;  2OE3 A;  1A2M A;  5IMZ A;  1ERU A;  4MAB A;  2WCI A;  5CRD A;  2D2Z A;  4YQM A;  1CQG A;  3JCM L;  2G2Q A;  5J9B A;  1GNE A;  2HXK A;  2CVK A;  3HYP A;  2AAW A;  1ZYP A;  2MMN A;  2M46 A;  3MDK A;  2OJL A;  5ECO B;  3G7I A;  2HRN A;  5CP1 A;  2DJ1 A;  3F8U A;  3QAW A;  4HU9 A;  1M2B A;  1XOB A;  2VAF A;  3U5R E;  1U6T A;  2AB6 A;  1EOG A;  4EL1 A;  4EKZ A;  4ZBB A;  4LL1 B;  5CO3 A;  4PXO A;  2CT6 A;  1YDK A;  4IEL A;  1TI1 A;  3P2A A;  1S3D A;  3TJF A;  1M9B A;  2M80 A;  5ECN B;  3ZIT A;  4D73 B;  1O81 A;  3IHQ A;  1BAY A;  18GS A;  4YQU A;  1GRX A;  2CQ9 A;  4KGI A;  4K7O A;  3GSS A;  1MTC A;  2ES7 A;  17GS A;  3VWW A;  5A4U A;  3F3Q A;  3EVI A;  2A4H A;  5D9X A;  2XPD A;  2V1M A;  1ERT A;  4ICY A;  1GWC A;  1WMJ A;  2DLX A;  1RK4 A;  4EIQ A;  2VLU A;  4DSS A;  2O89 A;  1JFU A;  1X5D A;  1QFN A;  1XVW A;  1AUC A;  5C00 A;  2A2P A;  2I1U A;  4KND A;  4Q5R A;  2DJ0 A;  2B3S A;  19GS A;  3W6G A;  1R7H A;  4RI6 A;  5LCZ A;  4I6X A;  2AUV A;  1FB0 A;  5CYY A;  4HS1 A;  3LQ7 A;  3IHG A;  5BRT A;  2V32 A;  2H6X A;  2P31 A;  2QA2 A;  1Z7P A;  1F2E A;  2V2G A;  1RW1 A;  3ZZX A;  2LKU A;  4KCA A;  4K2D A;  1DSB A;  4GF0 A;  4XTS A;  4TOP A;  2C80 A;  4O5R A;  4J57 E;  2M72 A;  2LEG A;  1K0C A;  4F82 A;  3HY2 A;  1GTI A;  2K18 A;  5HR0 A;  2F8F A;  1T4Z A;  1BYE A;  1G6Y A;  5IPH A;  2IMF A;  2DIZ A;  3I9V 2;  3TRX A;  3M3M A;  2NPB A;  2A2S A;  5DCG A;  4I8B A;  4XS6 A;  3RAZ A;  2H6Y A;  1OAZ A;  3NOF A;  3PGT A;  2MZC A;  4HDE A;  5D9V A;  4DEJ A;  2UZ8 A;  2O87 A;  4TR4 A;  3QAV A;  5COH A;  3ZVJ A;  3EWL A;  2C8U A;  3ZMK A;  2CA8 A;  2TRX A;  1ZCP A;  1XWG A;  4ZB8 A;  4IJI A;  1ML6 A;  3L9U A;  5E59 A;  1O6J A;  1T3B A;  2V41 A;  3IDV A;  5DDL A;  3I69 A;  2HSY A;  3TB2 A;  4OCF A;  1K0O A;  2RM5 A;  1B9Y C;  2KHP A;  5ELG A;  5AIX A;  4MZC A;  2LQO A;  4EUY A;  1YQ1 A;  1GTA A;  4WR4 A;  4IKH A;  2CAQ A;  4EO3 A;  2C4J A;  2R37 A;  3UEM A;  4G0L A;  3TUE A;  5F06 A;  5KN1 A;  5HQP A;  4DSS B;  5ECP B;  1SD8 A;  3VUR A;  3APO A;  1JZO A;  1O73 A;  3GH6 A;  4G0I A;  2LV3 A;  2VL9 A;  3FZ4 A;  5E4W A;  2H6Z A;  4KE3 A;  4RQR A;  2L6C A;  3KP8 A;  2AV4 A;  4KX4 A;  2FGX A;  1T8E B;  3M8N A;  1V9W A;  3R3E A;  3Q19 A;  2VCX A;  4ZIL A;  1SK2 A;  4LA1 A;  4K6X A;  1DE2 A;  2LRN A;  2WS2 A;  4PX1 A;  3LXZ A;  5ECL B;  4HQZ A;  2DKI A;  1N8J A;  4OFM A;  1V98 A;  4X43 A;  1SYR A;  4HEA 2;  3GKN A;  3UIW A;  2RUE A;  4HZ2 A;  1HNB A;  5JCG A;  2X99 A;  2C3N A;  4FYB A;  5IOX A;  5IO0 A;  3ZFB A;  4PUA A;  6GSW A;  5CRW A;  3EUR A;  1AW9 A;  5HR1 A;  2RUF A;  4Q5Q A;  3TKS E;  1ERW A;  4KUN A;  1NW2 A;  1Z6N A;  1ZGN A;  4ACS A;  1FO5 A;  1M2A A;  3M9J A;  3D4T A;  5DJL A;  2NVL A;  2K8S A;  3QR6 A;  3GL5 A;  5H5S A;  4POB A;  1ZYQ B;  2OA7 A;  4K5R A;  2VD0 A;  4MLY A;  1OE8 A;  2PU9 C;  12GS A;  4JRR A;  3A5W A;  5FWG A;  3GA4 A;  2PBJ A;  2DC5 A;  2FD3 A;  2WRT A;  3Q18 A;  1XW6 A;  3I6A A;  4OCE A;  3D22 A;  4XRA A;  2REM A;  2ZNM A;  3F9U A;  4K8M A;  1ERV A;  1K3O A;  4ECC A;  1ILO A;  3EYT A;  3F63 A;  3DGQ A;  4L0U A;  5D73 A;  1X5C A;  5HR2 A;  1B9X C;  3H1N A;  1SJZ A;  2LRC A;  5ID2 B;  3D4M A;  4DVC A;  2I81 A;  3A5I A;  2YOI A;  2QC7 A;  1S3C A;  1HNA A;  4TXV A;  3BCI A;  4MF5 A;  2YAN A;  1EP8 A;  2QKE A;  1TU7 A;  4X0X A;  2QGV A;  2R0C A;  4IQA A;  2JU5 A;  2C0F A;  4K5S A;  1WP0 A;  3PPU A;  4OFT A;  3DVW A;  3L0H A;  5B6M A;  5B7C A;  1JZD A;  3FZ5 A;  3EIN A;  2GTU A;  3DML A;  2C1Y A;  3EPT A;  3H93 A;  1PQN A;  2H0I A;  5CNW A;  4MH3 A;  4TR1 A;  1GSQ A;  5INY A;  1TRW A;  3FYG A;  2WDU A;  2IMK A;  6GSU A;  3GKM A;  1XZO A;  2C3T A;  3SBC A;  1MDK A;  3AY8 A;  4GQC A;  2DMM A;  5HR3 A;  2HZE B;  4YAP A;  1SJI A;  3J7Y b;  4QQ7 A;  5EVO A;  1PN0 A;  2H70 A;  5IM9 A;  3CYN A;  1OC8 A;  4N0V A;  3RDW A;  3RHB A;  3IK7 A;  4JR4 A;  3EU4 A;  5G1K A;  3RBT A;  4MNN A;  5DVB A;  5D9W A;  1EV9 A;  3ZRE A;  2FWE A;  4A5P A;  3ZTL A;  3I43 A;  3FKF A;  1FVJ A;  4EDY A;  3TJJ A;  3L4N A;  4AJ8 A;  1TXX A;  2HZF A;  3BD2 A;  22GS A;  3GUS A;  5F07 A;  2VM1 A;  4LLR A;  1Z3E A;  3VPQ A;  2GSS A;  4OO4 A;  3FY7 A;  2VLT A;  1U3A A;  5B6N A;  2O7K A;  3FMW A;  4MP4 A;  1WPI A;  2K6V A;  3LSZ A;  5B8B A;  3C7M A;  4MJE A;  4I2U A;  3IOS A;  9GSS A;  5IOW A;  3HD5 A;  5AIV A;  1XWC A;  5KOW A;  3LG6 A;  1ON4 A;  1QUW A;  1SL1 B;  1H4O A;  5B8A A;  4F0B A;  2HT9 A;  1SL2 B;  4TRX A;  5F0G A;  3GMF A;  2YP6 A;  3GV1 A;  4P3Y B;  4BA7 A;  4FYU A;  3TKP A;  3ZVJ D;  2JAC A;  2PVO C;  3ED3 A;  5ECK B;  3ZL5 A;  2H0H A;  5HFI A;  4WBJ A;  1URM A;  3A2X A;  4IJ3 A;  1Z5Y E;  3R2Q A;  2VOC A;  4ZIJ A;  3WGD A;  3M9K A;  1WOU A;  4O92 A;  1A0R P;  2CX4 A;  1ZZY A;  4IN0 A;  2NDO A;  2HRF A;  2RM6 A;  3KCM A;  2ALB A;  4TR0 A;  1GSF A;  4AGS A;  2H1B A;  3CSJ A;  2GQM A;  2VL2 A;  1JZR A;  4WBR D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...