2A2PA

Solution structure of selm from mus musculus
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
129
structure length
129
Chain Sequence
MTNYRPDWNRLRGLARGRVETCGGCQLNRLKEVKAFVTEDIQLYHNLVMKHLPGADPELVLLSRNYQELERIPLSQMTRDEINALVQELGFYRKSAPEAQVPPEYLWAPAKPPEEASEHDDLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Selenoprotein M
publication title NMR Structures of the Selenoproteins Sep15 and SelM Reveal Redox Activity of a New Thioredoxin-like Family.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 22
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2005-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08806 Sep15_SelM Sep15/SelM redox domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.50 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2a2pA01
2A2PA 2A4HA
chains in the Genus database with same CATH superfamily
1B9XC 1JHBA 5D8IA 2K18A 2F9SA 3HVSA 4I8BA 2OBIA 4G0IA 5CRGA 4WF4A 1Z5YE 2YNXA 1T8EB 5HFGA 4N11A 2LEGA 1TJDA 5CRWA 4GRFA 2LNTA 2X99A 1PQNA 1AQWA 3ZIJA 3KH7A 4BVXA 2H74A 1A8YA 2JACA 4WBRD 2H0GA 2RM6A 4G10A 2PWJA 2B7KA 4HU9A 2GQLA 3VURA 4KA0A 4OO4A 3FZ5A 3CTGA 4BL7B 3KP8A 3TJFA 1JZDA 2NVLA 4BIKA 1Z6NA 1SJ6A 5IMFA 1ZZYA 1EEMA 3FK8A 4EL1A 4AJ8A 1ZYQB 2CAQA 5IMDA 4ZL9A 2OADA 4IP6A 2B5YA 3IDVA 5HR1A 4TR3A 2GSSA 3WT2A 4GSSA 3TKPA 3IR4A 1N2AA 3UL3A 1S3RA 2C80A 4O92A 1FHEA 4BA7A 2IPAA 4AF2A 10GSA 4ILFA 2JADA 4MF5A 5ELGA 1T4ZA 3UOMA 1EV9A 3GRXA 4O5QA 2ON7A 2UZ8A 2HXKA 1U88A 2XPDA 4HI7A 4BVXB 5A4VA 1B8XA 2IIYA 2VLUA 4Z2TA 1ZCPA 3D4TA 3F3RA 1WP0A 1JZOA 2M46A 5FWGA 1FG4A 3J7Yb 2ZUPA 3UVHA 2WFCA 2H72A 1TRVA 4POKA 5DALB 3U6VA 1XVQA 4TVEA 5HR3A 5IMVA 4FQUA 1F37A 2WZ9A 5B6NA 1PD21 2GVPA 4V1Ag 5AIXA 5G5EA 3RPPA 5GAPD 5KN1A 3P8WA 3M0FA 4YQVA 4IQAA 2VM2A 2GZYA 2ZNMA 2IMFA 5ECPB 3KD0A 4WF5A 4K2DA 3V1WA 1EOGA 2V41A 4HQSA 1M2AA 5IMZA 1QFNA 3VI5A 2C3NA 4JR4A 1TK8B 2XHFA 1UVZA 1VF1A 3ZMLA 4F0BA 3TRQA 3GHAA 1MDKA 1A2JA 2FUG2 2GT6A 1SL1B 1U87A 1JLVA 5CO3A 2FGXA 4PUFC 1XWGA 1XW6A 4WEYA 3FEUA 1YF0A 1A0FA 3IHQA 1GWCA 3GSTA 4G9HA 2N5BA 3PH9A 3ZITA 4GXZA 4POBA 4DVCA 2GT5A 5EPFA 1XOAA 1ZYNA 3A5IA 5F06A 4PNFA 1O7UA 2O87A 1YDKA 5D9WA 2IN3A 4MZWA 2N5FA 3HHVA 5DCGA 1M2BA 1S3CA 1PL1A 3SWLA 1JFUA 1R5PA 2NTOA 2VLTA 1A23A 4KDUA 3TRPA 4KUNA 4NV2A 1HD2A 4RI6A 3SBCA 3LFLA 5B6MA 3TKQA 1QK8A 1PA3A 4NHZA 5HR0A 1TDIA 22GSA 3HD5A 3ZRDA 2RLIA 2FA8A 2HSMA 3H1NA 2QSIA 1T4YA 4ZILA 3TUEA 4LL4B 2EC4A 3KXOA 1JZRA 1F2EA 3HA9A 4NAXA 2LTKA 2HZEA 4TXOA 2X49A 3G7JA 3P90A 3TJJA 3D22A 2O89A 1ERUA 4YAPA 3UMAA 4KNDA 3DWVA 4F2IA 1YJ6A 4USSA 4G19A 3GFKA 1AC1A 1F3AA 3MDKA 4TKYA 3RHCA 3CSHA 2LQOA 3DRNA 1T3BA 3RBTA 1X9WB 2KLXA 4EE0A 2I81A 1GUMA 1SYXA 2FWHA 2CVDA 4MF6A 2MZCA 3LYPA 5AGYA 1SD9A 4K1FA 3IHGA 4MABA 2GZPA 3EVIA 2KP1A 1DE1A 1I5GA 3FHKA 2DIZA 2VUPA 4KB3A 1GTUA 5IPHA 2PERA 1OE7A 2CVKA 4Q5QA 3ZTLA 4ULXA 2HLSA 3D21A 4HSCX 5G1KA 2R0GA 2G0FA 1BJXA 1OC3A 4ZBBA 4O7HA 5HR2A 2CT6A 3CRTA 4IHUA 1Y25A 2HZEB 3WGXA 1VF4A 2PMTA 1SD8A 3A3TA 3TOTA 3OR5A 1PN9A 5ECOB 2YZHA 4ZL7A 1NSWA 4PXOA 4OCEA 1GTAA 2H8LA 2RM5A 3ERGA 2A2RA 2H19A 3NZNA 4BPYA 2TRCP 19GSA 2R2JA 1X5DA 1ZL9A 5F05A 4DSQA 2K6VA 1A8LA 1GSUA 2X8GA 4V2NA 1KTEA 3EMXA 5DJLA 11GSA 4ML6A 1O81A 1BEDA 3MNGA 1ST9A 1XWAA 2DKHA 3F63A 2HT9A 3F6DA 2VM1A 2FNOA 1PFOA 1OC9A 3FMWA 2HFDA 1G7OA 3F4SA 2JZTA 4IBPA 1OAZA 5LNKe 3CTFA 2PGTA 3C1SA 3CSJA 5KEJA 1BX9A 1UA5A 2RUEA 4X1UA 3VI7A 2DJ3A 2G2QA 2IJYA 2CX3A 4GSNA 2F8AA 3HJOA 3KH9A 1HYUA 4F9ZA 5C00A 2TIRA 2KOKA 4TXVA 2I4AA 1SYRA 5G31A 1GP1A 1J9BA 1GSQA 1K3YA 1WPIA 2H30A 2RUFA 3HY2A 1EGOA 5E4WA 1K0CA 2QKEA 5F07A 3EURA 2IWTA 4A5PA 1X9SB 4CY6A 3ERFA 5ECHB 1FO5A 3RAZA 1KNGA 2EIOA 1K0MA 5DQSA 3BCIA 3E0UA 2H66A 2H6YA 3A2XA 1O8WA 1GRXA 4G2EA 4OFMA 1OKDA 4ZB9A 2C3TA 1YF1A 2LUSA 4D73A 3G9BA 1AW9A 1GUHA 5L71A 1OKTA 3QCPA 1AUCA 1QUWA 3KGKA 1AIUA 1TP9A 3VWWA 1VGLA 1PN0A 3GYKA 1Y6EA 3ZFLA 2NPBA 4MJCA 1ERVA 2XC2A 3F8UA 1XWKA 4MJBA 2XBQA 3APQA 3UIWA 4I6XA 4MP4A 4XS6A 1Q98A 1X0RA 3LWAA 4GWRA 4TRXA 2JSZA 1QQ2A 3W8SA 1TI1A 2QC7A 3QFBC 1PX7A 3UVTA 3Q18A 3UBLA 2LJKA 4IELA 3US3A 1NW2A 4JZQA 1G7EA 3O3TA 3IC4A 2YV9A 3GKXA 3JCML 2VO4A 4EVMA 3F0IA 4LMWA 4QL9A 1PSQA 3D5JA 1OVNA 4POLA 3L0HA 3ZIVA 1FAAA 2H01A 1TKDB 3L9UA 4AGSA 1QMVA 1Q4JA 4KCEA 3R2QA 3LGCA 3IXRA 4K7IA 4EO3A 1RQMA 1GSDA 3I9V2 5E59A 4D73B 1G6WA 4Q5FA 4K6XA 3DYRA 2LJAA 4KAEA 2V6OA 1YKAA 1EOHA 4H86A 4LA1A 5ECNB 1DE2A 2H70A 3BOAA 5JCGA 2KHPA 3F3QA 4WBJA 4V2LA 1SL0B 1VF2A 3DIEA 5DAKA 4EIPA 4TW5A 1SK2A 2D2ZA 2K8VA 3TRXA 1AQVA 4BVYA 1A24A 2C1YA 4K0GA 1MD4A 1M3JA 3EWLA 5DQYA 1XPVA 3RHBA 2LQQA 2GSRA 1HNBA 3QAWA 2GTUA 2WULA 2H1BA 3WT1A 2V2GA 4E8HA 2MYGA 1BYEA 2C0GA 4K5RA 2MMAA 3TJBA 3KTLA 2BJXA 4EIQA 5J3RA 3IK9A 5IM9A 1R5AA 3L9VA 2VL2A 6GSWA 1THXA 3HDCA 3I6AA 4OD7A 1J0FA 1TW9A 5ECRB 4CDOA 4XHMA 3ME7A 1E2YA 1SJIA 4XTSA 1K0BA 1PKZA 4MMMA 5ECQB 3IC8A 4K0NA 3F4RA 4ID0A 3O76A 1OYJA 5AIVA 5DAKB 4KE3A 1M0UA 1EEJA 3CQFA 4FYUA 4NMUA 3TKSC 4BVYB 1SK1A 2MMZA 2DJ0A 5ID2A 2R3XA 2YP6A 2GSQA 3DXBA 2X4AA 1S3DA 3NOFA 7GSSA 3M9KA 5D96A 3HZ4A 2DKIA 3LG6A 1SKWB 1TU7A 3GA4A 2DBCA 5KOWA 2JU5A 4X4JA 3QMXA 2H1GA 2HNLA 3HVXA 4HS1A 20GSA 4ISDA 2P31A 2WRTA 2ZCTA 1R7HA 4ACSA 8GSSA 3EU4A 2CZ3A 5KN3A 4PQHA 5H5RA 4HJMA 1X9MB 2B1LA 1H4OA 4XCSA 2FY6A 1FVKA 1YEPA 1ACVA 5GSTA 2YWMA 4HZ4A 1GUKA 1MTCA 2DMLA 4J57E 1K0OA 4X43A 1YEXA 1M99A 3HKRA 1BG5A 2A2SA 2CX4A 2RIIA 1FVJA 1W89A 4O5RA 1IYIA 2R37A 2JSYA 4Q5RA 4K5SA 3IBHA 2GQMA 4JU5A 3ZREA 3FR3A 4MDCA 13GSA 3GKKA 2MMNA 5ID2B 1CQGA 2YZUA 14GSA 1GLQA 2P5RA 2V1MA 4DEJA 1XXUA 4NPBA 3IV4A 4JBBA 3O6TA 3GURA 3C7MA 2IL3A 3GKMA 5JCUA 2C0EA 2K8SA 5JWQB 3LW9A 1GL8A 4IS0A 5BRTA 2FD3A 3L4NA 18GSA 4MA9A 1WIKA 2I1UA 3TOUA 2CA8A 4HEA2 3EU3A 1TRUA 2YWOA 2B5XA 3M8NA 2O8VB 2IMDA 4FYBA 4RQXA 4HJ2A 3Q6OA 5JWRB 3GIXA 2PBJA 1ON4A 1B48A 1ERTA 1YKCA 2JZSA 2VD0A 4HDEA 4Z2UA 2FLSA 1WJKA 5FHIA 1M9AA 4NV5A 2VLVA 2X8HA 4GSTA 3CMIA 3LORA 4MZCA 4OFTA 1N8JA 5B8AA 3A5WA 4MJEA 4L5OA 1XOBA 3CBUA 5DVBA 1GSEA 2A4VA 4KGIA 4YKFA 2MBTA 1ZYEA 1JLWA 1A2LA 1TK5B 1GTIA 2KP2A 2HSYA 3TB2A 4MK3A 4MLYA 2GGTA 5G30A 5D9XA 3QDNA 3E9JB 2HRFA 3D0ZA 3FYGA 3ZVJA 2VAFA 1GNEA 5G2ZA 1V9WA 4MPFA 2CVBA 2LS5A 1KBNA 5F0GA 5EVOA 3VWXA 3MIXA 1FOVA 3QFAC 2V6KA 5DCHA 4TXOB 2REMA 1S3AA 6GSUA 2YV7A 5BMUA 4PURA 4BWSA 2ALBA 3LYKA 1O85A 1X5EA 2QA2A 2CQ9A 1XVWA 1RW1A 5F8BA 3ZZXA 2KUCA 2B3SA 2OJLA 2JL4A 3F6FA 1T00A 3GV1A 17GSA 4N0VA 1U3IA 2MBSA 4OMVA 4K8MA 3TKSE 3ERWA 2PVOC 3GTUA 5EL8A 4AJ6A 4FO5A 2DJ2A 4XRDA 1PRXA 3IAM2 3MAKA 2H0HA 3LSZA 1O8XA 1H75A 5ENUA 3L78A 3Q19A 4N10A 2WDUA 4GQFA 6GSVA 3DKSA 2QGVA 3BBYA 4ZL8A 1FOHA 4TR1A 2C0FA 3QAGA 1TRWA 3M3MA 2HRAA 4KX4A 1F9MA 5IPGA 5LCZA 2IMKA 3BJ5A 2XBIA 3CSIA 3DGQA 3P2AA 2OE0A 2FHEA 2L4CA 3S9FA 4KDXA 2TRXA 3HJMA 1M2DA 3PR8A 3WGDA 1BAYA 2AUVA 3UAPA 1XIYA 4ECCA 2DMMA 2VCTA 1AAZA 5KN2A 1SKSB 4IJIA 1SJZA 2HZFA 2LRNA 3ZVJD 5J41A 2WJUA 2IMIA 1WWJA 2YWNA 2LJRA 3C71A 3GTUB 1ILOA 4K7NA 2ON5A 4WR5A 3KCMA 4KW6A 1GSFA 2M80A 3HXSA 2CZ2A 2H76A 3TGZA 2VCZA 2H71A 4ZBAA 3KZQA 1OC9B 1AXDA 5J9BA 4ZIJA 3LJRA 1V40A 2GSTA 1ERWA 1K3LA 5J9CA 4FIWA 1XCCA 4NXIA 4L0WA 4OO5A 3F4TA 3IRAA 1XW5A 4TR1B 4YKGA 1FB6A 1TK0B 3ISOA 3GL3A 1DSBA 2MMOA 1V58A 2AAWA 3I43A 2B7JA 1UN2A 2LNSA 2R0CA 2LRCA 4MNNA 3QOUA 4GCIA 2OKAA 1PL2A 3EINA 1C72A 3VWVA 4LL1B 2EIQA 2CV4A 4TOPA 4EC0A 4TN8A 4QL7A 4XS1A 4ECBA 3M1GA 3GKNA 3H4KA 3N5OA 4P3YB 2VL3A 3DMLA 1PKWA 5DDLA 3CRUA 3GH9A 4I2TA 2GZZA 5G1LA 4YH2A 1NM3A 2HE3A 1I9DA 2B6MA 3M9JA 1CQHA 3K8NA 4CHSA 3G7IA 1PX6A 1ML6A 5J4UA 2J9HA 4EDZA 1OE8A 3BCKA 2VOCA 5CYYA 1Z9HA 4I2UA 1EP8A 3DEXA 4F82A 3ZYWA 4HZ2A 4PQIA 1O6JA 2B1KA 2EIRA 4KH7A 4EUYA 1UC7A 3TJGA 4ZB6A 1K0NA 1NHYA 4ECIA 1ABAA 3FW2A 16GSA 5IMCA 3KJYA 3EPTA 3KMNA 4GF0A 4G0KA 3R3EA 1GTBA 2WS2A 4ZBDA 4WXTA 3IE3A 2PPTA 3QR6A 3UARA 5DALA 2AHEA 1GNWA 4IJ3A 3DVWA 3KM6A 1GSSA 2HI7A 3DVXA 2VIMA 1Z7PA 2AB6A 2L59A 2H1AA 2FA4A 3TDGA 4X0XA 4ECJA 3GNJA 5HQPA 3EMPA 2I9HA 1TU8A 2K9FA 4OCFA 4PNGA 4POMA 1ZGNA 3TJKA 1B4QA 1RK4A 5H5SA 1B9YC 3H8QA 4XIHA 2YANA 4JEDA 2FCHA 3GX0A 4K2XA 1U6TA 4MPGA 5AN1A 5D93A 2LRTA 2E7PA 2YN1A 5IO2A 1MDIA 3A2VA 1GLPA 2PUKC 4K9ZA 3FR6A 3IA1A 3VPTA 1HNCA 4MH2A 4N30A 4V2MA 5CRHA 2BMXA 2P5QA 3D6IA 3GUSA 4IGJA 4JRRA 2DJ1A 5FT3A 3E3EA 3WD6A 2GQKA 3FY7A 5JCWA 2R6KA 5ECIB 4ZB8A 4G0LA 4IVFA 4HUAA 4EDYA 4YAVA 2DIYA 5COHA 1A0RP 3CXGA 2H6ZA 2L5OA 2GS3A 3U5RE 5CRDA 5CAXA 2VCQA 5D9TA 2P0GA 4Z7XA 2B5EA 4JR6A 3PPUA 2YPMA 5HFIA 4OWYA 1K0AA 1Z6MA 3CYNA 4CY8A 1M7TA 2H0IA 4YQUA 4CW9A 2WGRA 3GH6A 3IK7A 3DD3A 2PN8A 3G7YA 2NDOA 1YY7A 2AYTA 2VCVA 1M9BA 2NBSA 1DBYA 3C1RA 1EZKA 1V98A 2R0PA 3LEFA 4WR4A 5IOWA 3TCOA 2HRKA 6GSXA 4RI7A 1BQ7A 4EF0A 4KSOA 1QXHA 3C73A 5DBQA 3L9SA 1EP7A 5A4WA 3APOA 3D4MA 2C4JA 2CAIA 4RQRA 1B4PA 4PTSA 1HNAA 4Z2RA 2E2GA 5D73A 3C8EA 4L0UA 4ICYA 1SL2B 1WRYA 3RDWA 2L6DA 1ZMAA 5KOXA 4QQ7A 1TTZA 2OE3A 1LU4A 1G0TA 2FWGA 4J2FA 5JWOB 1F3BA 3HYPA 1MEKA 3GMFA 2C8UA 4HU7A 2QA1A 1WE0A 5KN0A 5GZZB 2XPEA 5ECLB 1SU9A 3UEMA 6GSTA 2E0QA 1T7PB 1GULA 1SK0A 2WB9A 2BTOT 3WYWA 2AJQB 4MF7A 2H6XA 3KMOA 4FYCA 2YJHA 4TR0A 2M72A 2LV3A 2OACA 4XS4A 4AJ7A 4L5LA 3GSSA 1XWBA 4BWQA 3VFIA 1FW1A 3IOSA 4PUAA 1JZWA 3UJ1A 2O7KA 1XBSA 4EXJA 4IW9A 1J08A 2LKUA 4IQ1A 3QAVA 3KEBA 1XZOA 1FB0A 1XFLA 3ZL5A 3MYDA 4V1Ap 5G5FA 2F8FA 3FZ9A 5B8BA 3VPQA 2F3MA 2L5LA 2IMEA 2A4HA 1MDJA 2E2MA 9GSSA 4MJAA 3FR9A 5ELAA 5INYA 4TR4A 12GSA 1M3IA 2PVQA 1TI3A 3LQ7A 5B7CA 4KSMA 2VL9A 3KTBA 5EY6A 4YQMA 2L57A 3RPNA 2N5AA 2AV4A 1SENA 1Z7RA 1TXXA 5ABRA 1YZXA 2H75A 3KIJA 5D9VA 2A2PA 3FRCA 5CNWA 3A2WA 5ECMB 3TKSA 1PGTA 1ZOFA 1TRSA 3ED3A 3WGEA 1THOA 2C3QA 3F9UA 2X8CA 1ZYPA 2VCWA 5GAND 3FKFA 2F51A 2IFQA 3BD2A 5IMAA 2L4QA 3P7XA 3PGTA 3LXTA 2HSHA 4NWYA 4XS4B 4LLRA 1GSYA 5A5KA 1VRSD 1MD3A 3MSZA 5IQYA 2PU9C 2X64A 2H73A 3ZFBA 4EKZA 2V32A 3APSA 4E8EA 3HJPA 2C0DA 4DSSA 2YCDA 2DJKA 3TKRA 4IKHA 4MH3A 2VD1A 4O5UA 1LBKA 2OA7A 2GDRA 1V2AA 2HYXA 3MWHA 2FWFA 3GX8A 1HQOA 1A2MA 2ES7A 1VF3A 3PINA 4F0CA 1W4VA 4K7OA 5HFKA 4LMVA 2FWEA 4F03A 5CP1A 3LXZA 1U3AA 3GL5A 3NIVA 4J56E 4JE1A 4L8EA 1TOFA 1R26A 3ZMKA 5CREA 3QPMA 4MZBA 1F6MC 1K0DA 1Z3EA 4I97A 3HZ8A 5C04A 4KF9A 2LSTA 1EV4A 4PQ1A 3N9JA 2Z9SA 3HCZA 6GSYA 1EWXA 2HRNA 4GTUA 3QD9A 3Q74A 2IFQB 1E6BA 3VLNA 3EC3A 1XG8A 4PX1A 3W8JA 3FZAA 3UBKA 4HQZA 1QGVA 4XRAA 1NHOA 1URMA 2WCIA 4Q5NA 3W6GA 1IYHA 3VK9A 4GLTA 4DSSB 2L6CA 5LD0A 4ML1A 2I3YA 3AY8A 3ZLPA 1G6YA 4DSRA 2R4VA 2YWIA 1OC8A 2VL2C 2OE1A 1R4WA 2YOIA 1X5CA 4RUVA 3EYTA 4ZXGA 5ECSA 5J5NA 2VCXA 3IPZA 2YJ7A 2R5GA 1K3OA 3KP9A 4WETA 5IOXA 5IO0A 4GQCA 1O73A 3EE2A 3GN3A 3FZ4A 1PMTA 1USBA 2J23A 1WMJA 1KEBA 2DSAA 6GSSA 3I69A 3HVNA 5IIZA 2OBKA 1YQ1A 4OFNA 1WOUA 4HOJA 3VWUA 1GH2A 3ME8A 4IN0A 4IP1A 4MCUA 3H93A 4BL7A 3H79A 2JZRA 3HVVA 1XWCA 5GSSA 4WKWA 2DLXA 5ECKB 1XW9A 3J7Yk 1DUGA 1V57A 4PGTA 4N0ZA 2O85A 1T1VA 2DC5A 4KCAA 5DJMA 4NHWA 4KDYA 2GLRA 5AISA 5H5QA 1SKRB 2DJJA 5A4UA 2H1DA 4FH8A 4I5QA 3IAS2 1EGRA 1LJRA 4O32A 1AQXA
chains in the Genus database with same CATH topology
1B9XC 1JHBA 5D8IA 2K18A 2F9SA 3HVSA 4I8BA 2OBIA 4G0IA 5CRGA 4WF4A 1Z5YE 2YNXA 1T8EB 5HFGA 4N11A 2LEGA 1TJDA 5CRWA 4GRFA 2LNTA 2X99A 1PQNA 1AQWA 3ZIJA 3KH7A 4BVXA 2H74A 1A8YA 2JACA 4WBRD 2H0GA 2RM6A 4G10A 2PWJA 2B7KA 4HU9A 2GQLA 3VURA 4KA0A 4OO4A 3FZ5A 3CTGA 4BL7B 3KP8A 3TJFA 1JZDA 2NVLA 1Z6NA 1SJ6A 5IMFA 1ZZYA 1EEMA 3FK8A 4EL1A 4AJ8A 1ZYQB 2CAQA 5IMDA 4ZL9A 2OADA 4IP6A 2B5YA 3IDVA 5HR1A 4TR3A 2GSSA 3WT2A 4GSSA 3TKPA 3IR4A 1N2AA 3UL3A 2C80A 4O92A 1FHEA 4BA7A 2IPAA 4AF2A 10GSA 4ILFA 2JADA 4MF5A 5ELGA 1T4ZA 3UOMA 1EV9A 3GRXA 4O5QA 2ON7A 2UZ8A 2HXKA 1U88A 2XPDA 4HI7A 4BVXB 5A4VA 1B8XA 2IIYA 2VLUA 4Z2TA 1ZCPA 3D4TA 3F3RA 1WP0A 1JZOA 2M46A 5FWGA 1FG4A 3J7Yb 2ZUPA 3UVHA 2WFCA 2H72A 1TRVA 4POKA 5DALB 3U6VA 1XVQA 4TVEA 5HR3A 5IMVA 4FQUA 1F37A 2WZ9A 5B6NA 1PD21 2GVPA 4V1Ag 5AIXA 5G5EA 3RPPA 5GAPD 5KN1A 3P8WA 3M0FA 4YQVA 4IQAA 2VM2A 2GZYA 2ZNMA 2IMFA 5ECPB 3KD0A 4WF5A 4K2DA 3V1WA 1EOGA 2V41A 4HQSA 1M2AA 5IMZA 1QFNA 3VI5A 2C3NA 4JR4A 1TK8B 2XHFA 1UVZA 1VF1A 3ZMLA 4F0BA 3TRQA 3GHAA 1MDKA 1A2JA 2FUG2 2GT6A 1SL1B 1U87A 1JLVA 5CO3A 2FGXA 4PUFC 1XWGA 1XW6A 4WEYA 3FEUA 1YF0A 1A0FA 3IHQA 1GWCA 3GSTA 4G9HA 2N5BA 3PH9A 3ZITA 4GXZA 4POBA 4DVCA 2GT5A 5EPFA 1XOAA 1ZYNA 3A5IA 5F06A 4PNFA 1O7UA 2O87A 1YDKA 5D9WA 2IN3A 4MZWA 2N5FA 3HHVA 5DCGA 1M2BA 1S3CA 1PL1A 3SWLA 1JFUA 1R5PA 2NTOA 2VLTA 1A23A 4KDUA 3TRPA 4KUNA 4NV2A 1HD2A 4RI6A 3SBCA 3LFLA 5B6MA 3TKQA 1QK8A 1PA3A 4NHZA 5HR0A 1TDIA 22GSA 3HD5A 3ZRDA 2RLIA 2FA8A 2HSMA 3H1NA 2QSIA 1T4YA 4ZILA 3TUEA 4LL4B 2EC4A 3KXOA 1JZRA 1F2EA 3HA9A 4NAXA 2LTKA 2HZEA 4TXOA 2X49A 3G7JA 3P90A 3TJJA 3D22A 2O89A 1ERUA 4YAPA 3UMAA 4KNDA 3DWVA 4F2IA 1YJ6A 4USSA 4G19A 3GFKA 1AC1A 1F3AA 3MDKA 4TKYA 3RHCA 3CSHA 2LQOA 3DRNA 1T3BA 3RBTA 1X9WB 2KLXA 4EE0A 2I81A 1GUMA 1SYXA 2FWHA 2CVDA 4MF6A 2MZCA 3LYPA 5AGYA 1SD9A 4K1FA 3IHGA 4MABA 2GZPA 3EVIA 2KP1A 1DE1A 1I5GA 3FHKA 2DIZA 2VUPA 4KB3A 1GTUA 5IPHA 2PERA 1OE7A 2CVKA 4Q5QA 3ZTLA 4ULXA 2HLSA 3D21A 5G1KA 2R0GA 2G0FA 1BJXA 1OC3A 4ZBBA 4O7HA 5HR2A 2CT6A 3CRTA 4IHUA 1Y25A 2HZEB 3WGXA 1VF4A 2PMTA 1SD8A 3A3TA 3TOTA 3OR5A 1PN9A 5ECOB 2YZHA 4ZL7A 1NSWA 4PXOA 4OCEA 1GTAA 2H8LA 2RM5A 3ERGA 2A2RA 2H19A 3NZNA 4BPYA 2TRCP 19GSA 2R2JA 1X5DA 1ZL9A 5F05A 4DSQA 2K6VA 1A8LA 1GSUA 2X8GA 4V2NA 1KTEA 3EMXA 5DJLA 11GSA 4ML6A 1O81A 1BEDA 3MNGA 1ST9A 1XWAA 2DKHA 3F63A 2HT9A 3F6DA 2VM1A 2FNOA 1OC9A 3FMWA 2HFDA 1G7OA 3F4SA 2JZTA 4IBPA 1OAZA 5LNKe 3CTFA 2PGTA 3C1SA 3CSJA 5KEJA 1BX9A 1UA5A 2RUEA 4X1UA 3VI7A 2DJ3A 2G2QA 2IJYA 2CX3A 4GSNA 2F8AA 3HJOA 3KH9A 1HYUA 4F9ZA 5C00A 2TIRA 2KOKA 4TXVA 2I4AA 1SYRA 5G31A 1GP1A 1J9BA 1GSQA 1K3YA 1WPIA 2H30A 2RUFA 3HY2A 1EGOA 5E4WA 1K0CA 2QKEA 5F07A 3EURA 2IWTA 4A5PA 1X9SB 4CY6A 3ERFA 5ECHB 1FO5A 3RAZA 1KNGA 2EIOA 1K0MA 5DQSA 3BCIA 3E0UA 2H66A 2H6YA 3A2XA 1O8WA 1GRXA 4G2EA 4OFMA 1OKDA 4ZB9A 2C3TA 1YF1A 2LUSA 4D73A 3G9BA 1AW9A 1GUHA 5L71A 1OKTA 3QCPA 1AUCA 1QUWA 3KGKA 1AIUA 1TP9A 3VWWA 1VGLA 1PN0A 3GYKA 1Y6EA 3ZFLA 2NPBA 4MJCA 1ERVA 2XC2A 3F8UA 1XWKA 4MJBA 2XBQA 3APQA 3UIWA 4I6XA 4MP4A 4XS6A 1Q98A 1X0RA 3LWAA 4GWRA 4TRXA 2JSZA 1QQ2A 3W8SA 1TI1A 2QC7A 3QFBC 1PX7A 3UVTA 3Q18A 3UBLA 2LJKA 4IELA 3US3A 1NW2A 4JZQA 1G7EA 3O3TA 3IC4A 2YV9A 3GKXA 3JCML 2VO4A 4EVMA 3F0IA 4LMWA 4QL9A 1PSQA 3D5JA 1OVNA 4POLA 3L0HA 3ZIVA 1FAAA 2H01A 1TKDB 3L9UA 4AGSA 1QMVA 1Q4JA 4KCEA 3R2QA 3LGCA 3IXRA 4K7IA 4EO3A 1RQMA 1GSDA 3I9V2 5E59A 4D73B 1G6WA 4Q5FA 4K6XA 3DYRA 2LJAA 4KAEA 2V6OA 1YKAA 1EOHA 4H86A 4LA1A 5ECNB 1DE2A 2H70A 3BOAA 5JCGA 2KHPA 3F3QA 4WBJA 4V2LA 1SL0B 1VF2A 3DIEA 5DAKA 4EIPA 4TW5A 1SK2A 2D2ZA 2K8VA 3TRXA 1AQVA 4BVYA 1A24A 2C1YA 4K0GA 1MD4A 3EWLA 5DQYA 1XPVA 3RHBA 2LQQA 2GSRA 1HNBA 3QAWA 2GTUA 2WULA 2H1BA 3WT1A 2V2GA 4E8HA 2MYGA 1BYEA 2C0GA 4K5RA 2MMAA 3TJBA 3KTLA 2BJXA 4EIQA 5J3RA 3IK9A 5IM9A 1R5AA 3L9VA 2VL2A 6GSWA 1THXA 3HDCA 3I6AA 4OD7A 1J0FA 1TW9A 5ECRB 4CDOA 4XHMA 3ME7A 1E2YA 1SJIA 4XTSA 1K0BA 1PKZA 4MMMA 5ECQB 3IC8A 4K0NA 3F4RA 4ID0A 3O76A 1OYJA 5AIVA 5DAKB 4KE3A 1M0UA 1EEJA 4FYUA 4NMUA 3TKSC 4BVYB 1SK1A 2MMZA 2DJ0A 5ID2A 2R3XA 2YP6A 2GSQA 3DXBA 2X4AA 1S3DA 3NOFA 7GSSA 3M9KA 5D96A 3HZ4A 2DKIA 3LG6A 1SKWB 1TU7A 3GA4A 2DBCA 5KOWA 2JU5A 4X4JA 3QMXA 2H1GA 2HNLA 3HVXA 4HS1A 20GSA 4ISDA 2P31A 2WRTA 2ZCTA 1R7HA 4ACSA 8GSSA 3EU4A 2CZ3A 5KN3A 4PQHA 5H5RA 4HJMA 1X9MB 2B1LA 1H4OA 4XCSA 2FY6A 1FVKA 1YEPA 1ACVA 5GSTA 2YWMA 4HZ4A 1GUKA 1MTCA 2DMLA 4J57E 1K0OA 4X43A 1YEXA 1M99A 3HKRA 1BG5A 2A2SA 2CX4A 2RIIA 1FVJA 1W89A 4O5RA 1IYIA 2R37A 2JSYA 4Q5RA 4K5SA 3IBHA 2GQMA 4JU5A 3ZREA 3FR3A 4MDCA 13GSA 3GKKA 2MMNA 5ID2B 1CQGA 2YZUA 14GSA 1GLQA 2P5RA 2V1MA 4DEJA 1XXUA 4NPBA 3IV4A 4JBBA 3O6TA 3GURA 3C7MA 2IL3A 3GKMA 5JCUA 2C0EA 2K8SA 5JWQB 3LW9A 1GL8A 4IS0A 5BRTA 2FD3A 3L4NA 18GSA 4MA9A 1WIKA 2I1UA 3TOUA 2CA8A 4HEA2 3EU3A 1TRUA 2YWOA 2B5XA 3M8NA 2O8VB 2IMDA 4FYBA 4RQXA 4HJ2A 3Q6OA 5JWRB 3GIXA 2PBJA 1ON4A 1B48A 1ERTA 1YKCA 2JZSA 2VD0A 4HDEA 4Z2UA 2FLSA 1WJKA 5FHIA 1M9AA 4NV5A 2VLVA 2X8HA 4GSTA 3CMIA 3LORA 4MZCA 4OFTA 1N8JA 5B8AA 3A5WA 4MJEA 4L5OA 1XOBA 3CBUA 5DVBA 1GSEA 2A4VA 4KGIA 4YKFA 2MBTA 1ZYEA 1JLWA 1A2LA 1TK5B 1GTIA 2KP2A 2HSYA 3TB2A 4MK3A 4MLYA 2GGTA 5G30A 5D9XA 3QDNA 3E9JB 2HRFA 3D0ZA 3FYGA 3ZVJA 2VAFA 1GNEA 5G2ZA 1V9WA 4MPFA 2CVBA 2LS5A 1KBNA 5F0GA 5EVOA 3VWXA 3MIXA 1FOVA 3QFAC 2V6KA 5DCHA 4TXOB 2REMA 1S3AA 6GSUA 2YV7A 5BMUA 4PURA 4BWSA 2ALBA 3LYKA 1O85A 1X5EA 2QA2A 2CQ9A 1XVWA 1RW1A 5F8BA 3ZZXA 2KUCA 2B3SA 2OJLA 2JL4A 3F6FA 1T00A 3GV1A 17GSA 4N0VA 1U3IA 2MBSA 4OMVA 4K8MA 3TKSE 3ERWA 2PVOC 3GTUA 5EL8A 4AJ6A 4FO5A 2DJ2A 4XRDA 1PRXA 3IAM2 3MAKA 2H0HA 3LSZA 1O8XA 1H75A 5ENUA 3L78A 3Q19A 4N10A 2WDUA 4GQFA 6GSVA 3DKSA 2QGVA 3BBYA 4ZL8A 1FOHA 4TR1A 2C0FA 3QAGA 1TRWA 3M3MA 2HRAA 4KX4A 1F9MA 5IPGA 5LCZA 2IMKA 3BJ5A 2XBIA 3CSIA 3DGQA 3P2AA 2OE0A 2FHEA 2L4CA 3S9FA 4KDXA 2TRXA 3HJMA 1M2DA 3PR8A 3WGDA 1BAYA 2AUVA 3UAPA 1XIYA 4ECCA 2DMMA 2VCTA 1AAZA 5KN2A 1SKSB 4IJIA 1SJZA 2HZFA 2LRNA 3ZVJD 5J41A 2WJUA 2IMIA 1WWJA 2YWNA 2LJRA 3C71A 3GTUB 1ILOA 4K7NA 2ON5A 4WR5A 3KCMA 4KW6A 1GSFA 2M80A 3HXSA 2CZ2A 2H76A 3TGZA 2VCZA 2H71A 4ZBAA 3KZQA 1OC9B 1AXDA 5J9BA 4ZIJA 3LJRA 1V40A 2GSTA 1ERWA 1K3LA 5J9CA 4FIWA 1XCCA 4NXIA 4L0WA 4OO5A 3F4TA 3IRAA 1XW5A 4TR1B 4YKGA 1FB6A 1TK0B 3ISOA 3GL3A 1DSBA 2MMOA 1V58A 2AAWA 3I43A 2B7JA 1UN2A 2LNSA 2R0CA 2LRCA 4MNNA 3QOUA 4GCIA 2OKAA 1PL2A 3EINA 1C72A 3VWVA 4LL1B 2EIQA 2CV4A 4TOPA 4EC0A 4TN8A 4QL7A 4XS1A 4ECBA 3M1GA 3GKNA 3H4KA 3N5OA 4P3YB 2VL3A 3DMLA 1PKWA 5DDLA 3CRUA 3GH9A 4I2TA 2GZZA 5G1LA 4YH2A 1NM3A 2HE3A 1I9DA 2B6MA 3M9JA 1CQHA 3K8NA 4CHSA 3G7IA 1PX6A 1ML6A 5J4UA 2J9HA 4EDZA 1OE8A 3BCKA 2VOCA 5CYYA 1Z9HA 4I2UA 1EP8A 3DEXA 4F82A 3ZYWA 4HZ2A 4PQIA 1O6JA 2B1KA 2EIRA 4KH7A 4EUYA 1UC7A 3TJGA 4ZB6A 1K0NA 1NHYA 4ECIA 1ABAA 3FW2A 16GSA 5IMCA 3KJYA 3EPTA 3KMNA 4GF0A 4G0KA 3R3EA 1GTBA 2WS2A 4ZBDA 4WXTA 3IE3A 2PPTA 3QR6A 3UARA 5DALA 2AHEA 1GNWA 4IJ3A 3DVWA 3KM6A 1GSSA 2HI7A 3DVXA 2VIMA 1Z7PA 2AB6A 2L59A 2H1AA 2FA4A 3TDGA 4X0XA 4ECJA 3GNJA 5HQPA 3EMPA 2I9HA 1TU8A 2K9FA 4OCFA 4PNGA 4POMA 1ZGNA 3TJKA 1B4QA 1RK4A 5H5SA 1B9YC 3H8QA 4XIHA 2YANA 4JEDA 2FCHA 3GX0A 4K2XA 1U6TA 4MPGA 5AN1A 5D93A 2LRTA 2E7PA 2YN1A 5IO2A 1MDIA 3A2VA 1GLPA 2PUKC 4K9ZA 3FR6A 3IA1A 3VPTA 1HNCA 4MH2A 4N30A 4V2MA 5CRHA 2BMXA 2P5QA 3D6IA 3GUSA 4IGJA 4JRRA 2DJ1A 5FT3A 3E3EA 3WD6A 2GQKA 3FY7A 5JCWA 2R6KA 5ECIB 4ZB8A 4G0LA 4IVFA 4HUAA 4EDYA 4YAVA 2DIYA 5COHA 1A0RP 3CXGA 2H6ZA 2L5OA 2GS3A 3U5RE 5CRDA 5CAXA 2VCQA 5D9TA 2P0GA 4Z7XA 2B5EA 4JR6A 3PPUA 2YPMA 5HFIA 4OWYA 1K0AA 1Z6MA 3CYNA 4CY8A 1M7TA 2H0IA 4YQUA 4CW9A 2WGRA 3GH6A 3IK7A 3DD3A 2PN8A 3G7YA 2NDOA 1YY7A 2AYTA 2VCVA 1M9BA 2NBSA 1DBYA 3C1RA 1EZKA 1V98A 2R0PA 3LEFA 4WR4A 5IOWA 3TCOA 2HRKA 6GSXA 4RI7A 1BQ7A 4EF0A 4KSOA 1QXHA 3C73A 5DBQA 3L9SA 1EP7A 5A4WA 3APOA 3D4MA 2C4JA 2CAIA 4RQRA 1B4PA 4PTSA 1HNAA 4Z2RA 2E2GA 5D73A 3C8EA 4L0UA 4ICYA 1SL2B 1WRYA 3RDWA 2L6DA 1ZMAA 5KOXA 4QQ7A 1TTZA 2OE3A 1LU4A 1G0TA 2FWGA 4J2FA 5JWOB 1F3BA 3HYPA 1MEKA 3GMFA 2C8UA 4HU7A 2QA1A 1WE0A 5KN0A 5GZZB 2XPEA 5ECLB 1SU9A 3UEMA 6GSTA 2E0QA 1T7PB 1GULA 1SK0A 2WB9A 2BTOT 3WYWA 2AJQB 4MF7A 2H6XA 3KMOA 4FYCA 2YJHA 4TR0A 2M72A 2LV3A 2OACA 4XS4A 4AJ7A 4L5LA 3GSSA 1XWBA 4BWQA 3VFIA 1FW1A 3IOSA 4PUAA 1JZWA 3UJ1A 2O7KA 1XBSA 4EXJA 4IW9A 1J08A 2LKUA 4IQ1A 3QAVA 3KEBA 1XZOA 1FB0A 1XFLA 3ZL5A 3MYDA 4V1Ap 5G5FA 2F8FA 3FZ9A 5B8BA 3VPQA 2F3MA 2L5LA 2IMEA 2A4HA 1MDJA 2E2MA 9GSSA 4MJAA 3FR9A 5ELAA 5INYA 4TR4A 12GSA 2PVQA 1TI3A 3LQ7A 5B7CA 4KSMA 2VL9A 3KTBA 5EY6A 4YQMA 2L57A 3RPNA 2N5AA 2AV4A 1SENA 1Z7RA 1TXXA 5ABRA 1YZXA 2H75A 3KIJA 5D9VA 2A2PA 3FRCA 5CNWA 3A2WA 5ECMB 3TKSA 1PGTA 1ZOFA 1TRSA 3ED3A 3WGEA 1THOA 2C3QA 3F9UA 2X8CA 1ZYPA 2VCWA 5GAND 3FKFA 2F51A 2IFQA 3BD2A 5IMAA 2L4QA 3P7XA 3PGTA 3LXTA 2HSHA 4NWYA 4XS4B 4LLRA 1GSYA 5A5KA 1VRSD 1MD3A 3MSZA 5IQYA 2PU9C 2X64A 2H73A 3ZFBA 4EKZA 2V32A 3APSA 4E8EA 3HJPA 2C0DA 4DSSA 2YCDA 2DJKA 3TKRA 4IKHA 4MH3A 2VD1A 4O5UA 1LBKA 2OA7A 2GDRA 1V2AA 2HYXA 3MWHA 2FWFA 3GX8A 1HQOA 1A2MA 2ES7A 1VF3A 3PINA 4F0CA 1W4VA 4K7OA 5HFKA 4LMVA 2FWEA 4F03A 5CP1A 3LXZA 1U3AA 3GL5A 3NIVA 4J56E 4JE1A 4L8EA 1TOFA 1R26A 3ZMKA 5CREA 3QPMA 4MZBA 1F6MC 1K0DA 1Z3EA 4I97A 3HZ8A 5C04A 4KF9A 2LSTA 1EV4A 4PQ1A 3N9JA 2Z9SA 3HCZA 6GSYA 1EWXA 2HRNA 4GTUA 3QD9A 3Q74A 2IFQB 1E6BA 3VLNA 3EC3A 4PX1A 3W8JA 3FZAA 3UBKA 4HQZA 1QGVA 4XRAA 1NHOA 1URMA 2WCIA 4Q5NA 3W6GA 1IYHA 3VK9A 4GLTA 4DSSB 2L6CA 5LD0A 4ML1A 2I3YA 3AY8A 3ZLPA 1G6YA 4DSRA 2R4VA 2YWIA 1OC8A 2VL2C 2OE1A 1R4WA 2YOIA 1X5CA 4RUVA 3EYTA 4ZXGA 5ECSA 5J5NA 2VCXA 3IPZA 2YJ7A 2R5GA 1K3OA 3KP9A 4WETA 5IOXA 5IO0A 4GQCA 1O73A 3EE2A 3GN3A 3FZ4A 1PMTA 1USBA 2J23A 1WMJA 1KEBA 2DSAA 6GSSA 3I69A 5IIZA 2OBKA 1YQ1A 4OFNA 1WOUA 4HOJA 3VWUA 1GH2A 3ME8A 4IN0A 4IP1A 4MCUA 3H93A 4BL7A 3H79A 2JZRA 3HVVA 1XWCA 5GSSA 4WKWA 2DLXA 5ECKB 1XW9A 3J7Yk 1DUGA 1V57A 4PGTA 4N0ZA 2O85A 1T1VA 2DC5A 4KCAA 5DJMA 4NHWA 4KDYA 2GLRA 5AISA 5H5QA 1SKRB 2DJJA 5A4UA 2H1DA 4FH8A 4I5QA 3IAS2 1EGRA 1LJRA 4O32A 1AQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A2P A;  2A4H A; 
#chains in the Genus database with same CATH topology
 1B9X C;  1JHB A;  5D8I A;  2K18 A;  2F9S A;  3HVS A;  4I8B A;  2OBI A;  4G0I A;  5CRG A;  4WF4 A;  1Z5Y E;  2YNX A;  1T8E B;  5HFG A;  4N11 A;  2LEG A;  1TJD A;  5CRW A;  4GRF A;  2LNT A;  2X99 A;  1PQN A;  1AQW A;  3ZIJ A;  3KH7 A;  4BVX A;  2H74 A;  1A8Y A;  2JAC A;  4WBR D;  2H0G A;  2RM6 A;  4G10 A;  2PWJ A;  2B7K A;  4HU9 A;  2GQL A;  3VUR A;  4KA0 A;  4OO4 A;  3FZ5 A;  3CTG A;  4BL7 B;  3KP8 A;  3TJF A;  1JZD A;  2NVL A;  4BIK A;  1Z6N A;  1SJ6 A;  5IMF A;  1ZZY A;  1EEM A;  3FK8 A;  4EL1 A;  4AJ8 A;  1ZYQ B;  2CAQ A;  5IMD A;  4ZL9 A;  2OAD A;  4IP6 A;  2B5Y A;  3IDV A;  5HR1 A;  4TR3 A;  2GSS A;  3WT2 A;  4GSS A;  3TKP A;  3IR4 A;  1N2A A;  3UL3 A;  1S3R A;  2C80 A;  4O92 A;  1FHE A;  4BA7 A;  2IPA A;  4AF2 A;  10GS A;  4ILF A;  2JAD A;  4MF5 A;  5ELG A;  1T4Z A;  3UOM A;  1EV9 A;  3GRX A;  4O5Q A;  2ON7 A;  2UZ8 A;  2HXK A;  1U88 A;  2XPD A;  4HI7 A;  4BVX B;  5A4V A;  1B8X A;  2IIY A;  2VLU A;  4Z2T A;  1ZCP A;  3D4T A;  3F3R A;  1WP0 A;  1JZO A;  2M46 A;  5FWG A;  1FG4 A;  3J7Y b;  2ZUP A;  3UVH A;  2WFC A;  2H72 A;  1TRV A;  4POK A;  5DAL B;  3U6V A;  1XVQ A;  4TVE A;  5HR3 A;  5IMV A;  4FQU A;  1F37 A;  2WZ9 A;  5B6N A;  1PD2 1;  2GVP A;  4V1A g;  5AIX A;  5G5E A;  3RPP A;  5GAP D;  5KN1 A;  3P8W A;  3M0F A;  4YQV A;  4IQA A;  2VM2 A;  2GZY A;  2ZNM A;  2IMF A;  5ECP B;  3KD0 A;  4WF5 A;  4K2D A;  3V1W A;  1EOG A;  2V41 A;  4HQS A;  1M2A A;  5IMZ A;  1QFN A;  3VI5 A;  2C3N A;  4JR4 A;  1TK8 B;  2XHF A;  1UVZ A;  1VF1 A;  3ZML A;  4F0B A;  3TRQ A;  3GHA A;  1MDK A;  1A2J A;  2FUG 2;  2GT6 A;  1SL1 B;  1U87 A;  1JLV A;  5CO3 A;  2FGX A;  4PUF C;  1XWG A;  1XW6 A;  4WEY A;  3FEU A;  1YF0 A;  1A0F A;  3IHQ A;  1GWC A;  3GST A;  4G9H A;  2N5B A;  3PH9 A;  3ZIT A;  4GXZ A;  4POB A;  4DVC A;  2GT5 A;  5EPF A;  1XOA A;  1ZYN A;  3A5I A;  5F06 A;  4PNF A;  1O7U A;  2O87 A;  1YDK A;  5D9W A;  2IN3 A;  4MZW A;  2N5F A;  3HHV A;  5DCG A;  1M2B A;  1S3C A;  1PL1 A;  3SWL A;  1JFU A;  1R5P A;  2NTO A;  2VLT A;  1A23 A;  4KDU A;  3TRP A;  4KUN A;  4NV2 A;  1HD2 A;  4RI6 A;  3SBC A;  3LFL A;  5B6M A;  3TKQ A;  1QK8 A;  1PA3 A;  4NHZ A;  5HR0 A;  1TDI A;  22GS A;  3HD5 A;  3ZRD A;  2RLI A;  2FA8 A;  2HSM A;  3H1N A;  2QSI A;  1T4Y A;  4ZIL A;  3TUE A;  4LL4 B;  2EC4 A;  3KXO A;  1JZR A;  1F2E A;  3HA9 A;  4NAX A;  2LTK A;  2HZE A;  4TXO A;  2X49 A;  3G7J A;  3P90 A;  3TJJ A;  3D22 A;  2O89 A;  1ERU A;  4YAP A;  3UMA A;  4KND A;  3DWV A;  4F2I A;  1YJ6 A;  4USS A;  4G19 A;  3GFK A;  1AC1 A;  1F3A A;  3MDK A;  4TKY A;  3RHC A;  3CSH A;  2LQO A;  3DRN A;  1T3B A;  3RBT A;  1X9W B;  2KLX A;  4EE0 A;  2I81 A;  1GUM A;  1SYX A;  2FWH A;  2CVD A;  4MF6 A;  2MZC A;  3LYP A;  5AGY A;  1SD9 A;  4K1F A;  3IHG A;  4MAB A;  2GZP A;  3EVI A;  2KP1 A;  1DE1 A;  1I5G A;  3FHK A;  2DIZ A;  2VUP A;  4KB3 A;  1GTU A;  5IPH A;  2PER A;  1OE7 A;  2CVK A;  4Q5Q A;  3ZTL A;  4ULX A;  2HLS A;  3D21 A;  4HSC X;  5G1K A;  2R0G A;  2G0F A;  1BJX A;  1OC3 A;  4ZBB A;  4O7H A;  5HR2 A;  2CT6 A;  3CRT A;  4IHU A;  1Y25 A;  2HZE B;  3WGX A;  1VF4 A;  2PMT A;  1SD8 A;  3A3T A;  3TOT A;  3OR5 A;  1PN9 A;  5ECO B;  2YZH A;  4ZL7 A;  1NSW A;  4PXO A;  4OCE A;  1GTA A;  2H8L A;  2RM5 A;  3ERG A;  2A2R A;  2H19 A;  3NZN A;  4BPY A;  2TRC P;  19GS A;  2R2J A;  1X5D A;  1ZL9 A;  5F05 A;  4DSQ A;  2K6V A;  1A8L A;  1GSU A;  2X8G A;  4V2N A;  1KTE A;  3EMX A;  5DJL A;  11GS A;  4ML6 A;  1O81 A;  1BED A;  3MNG A;  1ST9 A;  1XWA A;  2DKH A;  3F63 A;  2HT9 A;  3F6D A;  2VM1 A;  2FNO A;  1PFO A;  1OC9 A;  3FMW A;  2HFD A;  1G7O A;  3F4S A;  2JZT A;  4IBP A;  1OAZ A;  5LNK e;  3CTF A;  2PGT A;  3C1S A;  3CSJ A;  5KEJ A;  1BX9 A;  1UA5 A;  2RUE A;  4X1U A;  3VI7 A;  2DJ3 A;  2G2Q A;  2IJY A;  2CX3 A;  4GSN A;  2F8A A;  3HJO A;  3KH9 A;  1HYU A;  4F9Z A;  5C00 A;  2TIR A;  2KOK A;  4TXV A;  2I4A A;  1SYR A;  5G31 A;  1GP1 A;  1J9B A;  1GSQ A;  1K3Y A;  1WPI A;  2H30 A;  2RUF A;  3HY2 A;  1EGO A;  5E4W A;  1K0C A;  2QKE A;  5F07 A;  3EUR A;  2IWT A;  4A5P A;  1X9S B;  4CY6 A;  3ERF A;  5ECH B;  1FO5 A;  3RAZ A;  1KNG A;  2EIO A;  1K0M A;  5DQS A;  3BCI A;  3E0U A;  2H66 A;  2H6Y A;  3A2X A;  1O8W A;  1GRX A;  4G2E A;  4OFM A;  1OKD A;  4ZB9 A;  2C3T A;  1YF1 A;  2LUS A;  4D73 A;  3G9B A;  1AW9 A;  1GUH A;  5L71 A;  1OKT A;  3QCP A;  1AUC A;  1QUW A;  3KGK A;  1AIU A;  1TP9 A;  3VWW A;  1VGL A;  1PN0 A;  3GYK A;  1Y6E A;  3ZFL A;  2NPB A;  4MJC A;  1ERV A;  2XC2 A;  3F8U A;  1XWK A;  4MJB A;  2XBQ A;  3APQ A;  3UIW A;  4I6X A;  4MP4 A;  4XS6 A;  1Q98 A;  1X0R A;  3LWA A;  4GWR A;  4TRX A;  2JSZ A;  1QQ2 A;  3W8S A;  1TI1 A;  2QC7 A;  3QFB C;  1PX7 A;  3UVT A;  3Q18 A;  3UBL A;  2LJK A;  4IEL A;  3US3 A;  1NW2 A;  4JZQ A;  1G7E A;  3O3T A;  3IC4 A;  2YV9 A;  3GKX A;  3JCM L;  2VO4 A;  4EVM A;  3F0I A;  4LMW A;  4QL9 A;  1PSQ A;  3D5J A;  1OVN A;  4POL A;  3L0H A;  3ZIV A;  1FAA A;  2H01 A;  1TKD B;  3L9U A;  4AGS A;  1QMV A;  1Q4J A;  4KCE A;  3R2Q A;  3LGC A;  3IXR A;  4K7I A;  4EO3 A;  1RQM A;  1GSD A;  3I9V 2;  5E59 A;  4D73 B;  1G6W A;  4Q5F A;  4K6X A;  3DYR A;  2LJA A;  4KAE A;  2V6O A;  1YKA A;  1EOH A;  4H86 A;  4LA1 A;  5ECN B;  1DE2 A;  2H70 A;  3BOA A;  5JCG A;  2KHP A;  3F3Q A;  4WBJ A;  4V2L A;  1SL0 B;  1VF2 A;  3DIE A;  5DAK A;  4EIP A;  4TW5 A;  1SK2 A;  2D2Z A;  2K8V A;  3TRX A;  1AQV A;  4BVY A;  1A24 A;  2C1Y A;  4K0G A;  1MD4 A;  1M3J A;  3EWL A;  5DQY A;  1XPV A;  3RHB A;  2LQQ A;  2GSR A;  1HNB A;  3QAW A;  2GTU A;  2WUL A;  2H1B A;  3WT1 A;  2V2G A;  4E8H A;  2MYG A;  1BYE A;  2C0G A;  4K5R A;  2MMA A;  3TJB A;  3KTL A;  2BJX A;  4EIQ A;  5J3R A;  3IK9 A;  5IM9 A;  1R5A A;  3L9V A;  2VL2 A;  6GSW A;  1THX A;  3HDC A;  3I6A A;  4OD7 A;  1J0F A;  1TW9 A;  5ECR B;  4CDO A;  4XHM A;  3ME7 A;  1E2Y A;  1SJI A;  4XTS A;  1K0B A;  1PKZ A;  4MMM A;  5ECQ B;  3IC8 A;  4K0N A;  3F4R A;  4ID0 A;  3O76 A;  1OYJ A;  5AIV A;  5DAK B;  4KE3 A;  1M0U A;  1EEJ A;  3CQF A;  4FYU A;  4NMU A;  3TKS C;  4BVY B;  1SK1 A;  2MMZ A;  2DJ0 A;  5ID2 A;  2R3X A;  2YP6 A;  2GSQ A;  3DXB A;  2X4A A;  1S3D A;  3NOF A;  7GSS A;  3M9K A;  5D96 A;  3HZ4 A;  2DKI A;  3LG6 A;  1SKW B;  1TU7 A;  3GA4 A;  2DBC A;  5KOW A;  2JU5 A;  4X4J A;  3QMX A;  2H1G A;  2HNL A;  3HVX A;  4HS1 A;  20GS A;  4ISD A;  2P31 A;  2WRT A;  2ZCT A;  1R7H A;  4ACS A;  8GSS A;  3EU4 A;  2CZ3 A;  5KN3 A;  4PQH A;  5H5R A;  4HJM A;  1X9M B;  2B1L A;  1H4O A;  4XCS A;  2FY6 A;  1FVK A;  1YEP A;  1ACV A;  5GST A;  2YWM A;  4HZ4 A;  1GUK A;  1MTC A;  2DML A;  4J57 E;  1K0O A;  4X43 A;  1YEX A;  1M99 A;  3HKR A;  1BG5 A;  2A2S A;  2CX4 A;  2RII A;  1FVJ A;  1W89 A;  4O5R A;  1IYI A;  2R37 A;  2JSY A;  4Q5R A;  4K5S A;  3IBH A;  2GQM A;  4JU5 A;  3ZRE A;  3FR3 A;  4MDC A;  13GS A;  3GKK A;  2MMN A;  5ID2 B;  1CQG A;  2YZU A;  14GS A;  1GLQ A;  2P5R A;  2V1M A;  4DEJ A;  1XXU A;  4NPB A;  3IV4 A;  4JBB A;  3O6T A;  3GUR A;  3C7M A;  2IL3 A;  3GKM A;  5JCU A;  2C0E A;  2K8S A;  5JWQ B;  3LW9 A;  1GL8 A;  4IS0 A;  5BRT A;  2FD3 A;  3L4N A;  18GS A;  4MA9 A;  1WIK A;  2I1U A;  3TOU A;  2CA8 A;  4HEA 2;  3EU3 A;  1TRU A;  2YWO A;  2B5X A;  3M8N A;  2O8V B;  2IMD A;  4FYB A;  4RQX A;  4HJ2 A;  3Q6O A;  5JWR B;  3GIX A;  2PBJ A;  1ON4 A;  1B48 A;  1ERT A;  1YKC A;  2JZS A;  2VD0 A;  4HDE A;  4Z2U A;  2FLS A;  1WJK A;  5FHI A;  1M9A A;  4NV5 A;  2VLV A;  2X8H A;  4GST A;  3CMI A;  3LOR A;  4MZC A;  4OFT A;  1N8J A;  5B8A A;  3A5W A;  4MJE A;  4L5O A;  1XOB A;  3CBU A;  5DVB A;  1GSE A;  2A4V A;  4KGI A;  4YKF A;  2MBT A;  1ZYE A;  1JLW A;  1A2L A;  1TK5 B;  1GTI A;  2KP2 A;  2HSY A;  3TB2 A;  4MK3 A;  4MLY A;  2GGT A;  5G30 A;  5D9X A;  3QDN A;  3E9J B;  2HRF A;  3D0Z A;  3FYG A;  3ZVJ A;  2VAF A;  1GNE A;  5G2Z A;  1V9W A;  4MPF A;  2CVB A;  2LS5 A;  1KBN A;  5F0G A;  5EVO A;  3VWX A;  3MIX A;  1FOV A;  3QFA C;  2V6K A;  5DCH A;  4TXO B;  2REM A;  1S3A A;  6GSU A;  2YV7 A;  5BMU A;  4PUR A;  4BWS A;  2ALB A;  3LYK A;  1O85 A;  1X5E A;  2QA2 A;  2CQ9 A;  1XVW A;  1RW1 A;  5F8B A;  3ZZX A;  2KUC A;  2B3S A;  2OJL A;  2JL4 A;  3F6F A;  1T00 A;  3GV1 A;  17GS A;  4N0V A;  1U3I A;  2MBS A;  4OMV A;  4K8M A;  3TKS E;  3ERW A;  2PVO C;  3GTU A;  5EL8 A;  4AJ6 A;  4FO5 A;  2DJ2 A;  4XRD A;  1PRX A;  3IAM 2;  3MAK A;  2H0H A;  3LSZ A;  1O8X A;  1H75 A;  5ENU A;  3L78 A;  3Q19 A;  4N10 A;  2WDU A;  4GQF A;  6GSV A;  3DKS A;  2QGV A;  3BBY A;  4ZL8 A;  1FOH A;  4TR1 A;  2C0F A;  3QAG A;  1TRW A;  3M3M A;  2HRA A;  4KX4 A;  1F9M A;  5IPG A;  5LCZ A;  2IMK A;  3BJ5 A;  2XBI A;  3CSI A;  3DGQ A;  3P2A A;  2OE0 A;  2FHE A;  2L4C A;  3S9F A;  4KDX A;  2TRX A;  3HJM A;  1M2D A;  3PR8 A;  3WGD A;  1BAY A;  2AUV A;  3UAP A;  1XIY A;  4ECC A;  2DMM A;  2VCT A;  1AAZ A;  5KN2 A;  1SKS B;  4IJI A;  1SJZ A;  2HZF A;  2LRN A;  3ZVJ D;  5J41 A;  2WJU A;  2IMI A;  1WWJ A;  2YWN A;  2LJR A;  3C71 A;  3GTU B;  1ILO A;  4K7N A;  2ON5 A;  4WR5 A;  3KCM A;  4KW6 A;  1GSF A;  2M80 A;  3HXS A;  2CZ2 A;  2H76 A;  3TGZ A;  2VCZ A;  2H71 A;  4ZBA A;  3KZQ A;  1OC9 B;  1AXD A;  5J9B A;  4ZIJ A;  3LJR A;  1V40 A;  2GST A;  1ERW A;  1K3L A;  5J9C A;  4FIW A;  1XCC A;  4NXI A;  4L0W A;  4OO5 A;  3F4T A;  3IRA A;  1XW5 A;  4TR1 B;  4YKG A;  1FB6 A;  1TK0 B;  3ISO A;  3GL3 A;  1DSB A;  2MMO A;  1V58 A;  2AAW A;  3I43 A;  2B7J A;  1UN2 A;  2LNS A;  2R0C A;  2LRC A;  4MNN A;  3QOU A;  4GCI A;  2OKA A;  1PL2 A;  3EIN A;  1C72 A;  3VWV A;  4LL1 B;  2EIQ A;  2CV4 A;  4TOP A;  4EC0 A;  4TN8 A;  4QL7 A;  4XS1 A;  4ECB A;  3M1G A;  3GKN A;  3H4K A;  3N5O A;  4P3Y B;  2VL3 A;  3DML A;  1PKW A;  5DDL A;  3CRU A;  3GH9 A;  4I2T A;  2GZZ A;  5G1L A;  4YH2 A;  1NM3 A;  2HE3 A;  1I9D A;  2B6M A;  3M9J A;  1CQH A;  3K8N A;  4CHS A;  3G7I A;  1PX6 A;  1ML6 A;  5J4U A;  2J9H A;  4EDZ A;  1OE8 A;  3BCK A;  2VOC A;  5CYY A;  1Z9H A;  4I2U A;  1EP8 A;  3DEX A;  4F82 A;  3ZYW A;  4HZ2 A;  4PQI A;  1O6J A;  2B1K A;  2EIR A;  4KH7 A;  4EUY A;  1UC7 A;  3TJG A;  4ZB6 A;  1K0N A;  1NHY A;  4ECI A;  1ABA A;  3FW2 A;  16GS A;  5IMC A;  3KJY A;  3EPT A;  3KMN A;  4GF0 A;  4G0K A;  3R3E A;  1GTB A;  2WS2 A;  4ZBD A;  4WXT A;  3IE3 A;  2PPT A;  3QR6 A;  3UAR A;  5DAL A;  2AHE A;  1GNW A;  4IJ3 A;  3DVW A;  3KM6 A;  1GSS A;  2HI7 A;  3DVX A;  2VIM A;  1Z7P A;  2AB6 A;  2L59 A;  2H1A A;  2FA4 A;  3TDG A;  4X0X A;  4ECJ A;  3GNJ A;  5HQP A;  3EMP A;  2I9H A;  1TU8 A;  2K9F A;  4OCF A;  4PNG A;  4POM A;  1ZGN A;  3TJK A;  1B4Q A;  1RK4 A;  5H5S A;  1B9Y C;  3H8Q A;  4XIH A;  2YAN A;  4JED A;  2FCH A;  3GX0 A;  4K2X A;  1U6T A;  4MPG A;  5AN1 A;  5D93 A;  2LRT A;  2E7P A;  2YN1 A;  5IO2 A;  1MDI A;  3A2V A;  1GLP A;  2PUK C;  4K9Z A;  3FR6 A;  3IA1 A;  3VPT A;  1HNC A;  4MH2 A;  4N30 A;  4V2M A;  5CRH A;  2BMX A;  2P5Q A;  3D6I A;  3GUS A;  4IGJ A;  4JRR A;  2DJ1 A;  5FT3 A;  3E3E A;  3WD6 A;  2GQK A;  3FY7 A;  5JCW A;  2R6K A;  5ECI B;  4ZB8 A;  4G0L A;  4IVF A;  4HUA A;  4EDY A;  4YAV A;  2DIY A;  5COH A;  1A0R P;  3CXG A;  2H6Z A;  2L5O A;  2GS3 A;  3U5R E;  5CRD A;  5CAX A;  2VCQ A;  5D9T A;  2P0G A;  4Z7X A;  2B5E A;  4JR6 A;  3PPU A;  2YPM A;  5HFI A;  4OWY A;  1K0A A;  1Z6M A;  3CYN A;  4CY8 A;  1M7T A;  2H0I A;  4YQU A;  4CW9 A;  2WGR A;  3GH6 A;  3IK7 A;  3DD3 A;  2PN8 A;  3G7Y A;  2NDO A;  1YY7 A;  2AYT A;  2VCV A;  1M9B A;  2NBS A;  1DBY A;  3C1R A;  1EZK A;  1V98 A;  2R0P A;  3LEF A;  4WR4 A;  5IOW A;  3TCO A;  2HRK A;  6GSX A;  4RI7 A;  1BQ7 A;  4EF0 A;  4KSO A;  1QXH A;  3C73 A;  5DBQ A;  3L9S A;  1EP7 A;  5A4W A;  3APO A;  3D4M A;  2C4J A;  2CAI A;  4RQR A;  1B4P A;  4PTS A;  1HNA A;  4Z2R A;  2E2G A;  5D73 A;  3C8E A;  4L0U A;  4ICY A;  1SL2 B;  1WRY A;  3RDW A;  2L6D A;  1ZMA A;  5KOX A;  4QQ7 A;  1TTZ A;  2OE3 A;  1LU4 A;  1G0T A;  2FWG A;  4J2F A;  5JWO B;  1F3B A;  3HYP A;  1MEK A;  3GMF A;  2C8U A;  4HU7 A;  2QA1 A;  1WE0 A;  5KN0 A;  5GZZ B;  2XPE A;  5ECL B;  1SU9 A;  3UEM A;  6GST A;  2E0Q A;  1T7P B;  1GUL A;  1SK0 A;  2WB9 A;  2BTO T;  3WYW A;  2AJQ B;  4MF7 A;  2H6X A;  3KMO A;  4FYC A;  2YJH A;  4TR0 A;  2M72 A;  2LV3 A;  2OAC A;  4XS4 A;  4AJ7 A;  4L5L A;  3GSS A;  1XWB A;  4BWQ A;  3VFI A;  1FW1 A;  3IOS A;  4PUA A;  1JZW A;  3UJ1 A;  2O7K A;  1XBS A;  4EXJ A;  4IW9 A;  1J08 A;  2LKU A;  4IQ1 A;  3QAV A;  3KEB A;  1XZO A;  1FB0 A;  1XFL A;  3ZL5 A;  3MYD A;  4V1A p;  5G5F A;  2F8F A;  3FZ9 A;  5B8B A;  3VPQ A;  2F3M A;  2L5L A;  2IME A;  2A4H A;  1MDJ A;  2E2M A;  9GSS A;  4MJA A;  3FR9 A;  5ELA A;  5INY A;  4TR4 A;  12GS A;  1M3I A;  2PVQ A;  1TI3 A;  3LQ7 A;  5B7C A;  4KSM A;  2VL9 A;  3KTB A;  5EY6 A;  4YQM A;  2L57 A;  3RPN A;  2N5A A;  2AV4 A;  1SEN A;  1Z7R A;  1TXX A;  5ABR A;  1YZX A;  2H75 A;  3KIJ A;  5D9V A;  2A2P A;  3FRC A;  5CNW A;  3A2W A;  5ECM B;  3TKS A;  1PGT A;  1ZOF A;  1TRS A;  3ED3 A;  3WGE A;  1THO A;  2C3Q A;  3F9U A;  2X8C A;  1ZYP A;  2VCW A;  5GAN D;  3FKF A;  2F51 A;  2IFQ A;  3BD2 A;  5IMA A;  2L4Q A;  3P7X A;  3PGT A;  3LXT A;  2HSH A;  4NWY A;  4XS4 B;  4LLR A;  1GSY A;  5A5K A;  1VRS D;  1MD3 A;  3MSZ A;  5IQY A;  2PU9 C;  2X64 A;  2H73 A;  3ZFB A;  4EKZ A;  2V32 A;  3APS A;  4E8E A;  3HJP A;  2C0D A;  4DSS A;  2YCD A;  2DJK A;  3TKR A;  4IKH A;  4MH3 A;  2VD1 A;  4O5U A;  1LBK A;  2OA7 A;  2GDR A;  1V2A A;  2HYX A;  3MWH A;  2FWF A;  3GX8 A;  1HQO A;  1A2M A;  2ES7 A;  1VF3 A;  3PIN A;  4F0C A;  1W4V A;  4K7O A;  5HFK A;  4LMV A;  2FWE A;  4F03 A;  5CP1 A;  3LXZ A;  1U3A A;  3GL5 A;  3NIV A;  4J56 E;  4JE1 A;  4L8E A;  1TOF A;  1R26 A;  3ZMK A;  5CRE A;  3QPM A;  4MZB A;  1F6M C;  1K0D A;  1Z3E A;  4I97 A;  3HZ8 A;  5C04 A;  4KF9 A;  2LST A;  1EV4 A;  4PQ1 A;  3N9J A;  2Z9S A;  3HCZ A;  6GSY A;  1EWX A;  2HRN A;  4GTU A;  3QD9 A;  3Q74 A;  2IFQ B;  1E6B A;  3VLN A;  3EC3 A;  1XG8 A;  4PX1 A;  3W8J A;  3FZA A;  3UBK A;  4HQZ A;  1QGV A;  4XRA A;  1NHO A;  1URM A;  2WCI A;  4Q5N A;  3W6G A;  1IYH A;  3VK9 A;  4GLT A;  4DSS B;  2L6C A;  5LD0 A;  4ML1 A;  2I3Y A;  3AY8 A;  3ZLP A;  1G6Y A;  4DSR A;  2R4V A;  2YWI A;  1OC8 A;  2VL2 C;  2OE1 A;  1R4W A;  2YOI A;  1X5C A;  4RUV A;  3EYT A;  4ZXG A;  5ECS A;  5J5N A;  2VCX A;  3IPZ A;  2YJ7 A;  2R5G A;  1K3O A;  3KP9 A;  4WET A;  5IOX A;  5IO0 A;  4GQC A;  1O73 A;  3EE2 A;  3GN3 A;  3FZ4 A;  1PMT A;  1USB A;  2J23 A;  1WMJ A;  1KEB A;  2DSA A;  6GSS A;  3I69 A;  3HVN A;  5IIZ A;  2OBK A;  1YQ1 A;  4OFN A;  1WOU A;  4HOJ A;  3VWU A;  1GH2 A;  3ME8 A;  4IN0 A;  4IP1 A;  4MCU A;  3H93 A;  4BL7 A;  3H79 A;  2JZR A;  3HVV A;  1XWC A;  5GSS A;  4WKW A;  2DLX A;  5ECK B;  1XW9 A;  3J7Y k;  1DUG A;  1V57 A;  4PGT A;  4N0Z A;  2O85 A;  1T1V A;  2DC5 A;  4KCA A;  5DJM A;  4NHW A;  4KDY A;  2GLR A;  5AIS A;  5H5Q A;  1SKR B;  2DJJ A;  5A4U A;  2H1D A;  4FH8 A;  4I5Q A;  3IAS 2;  1EGR A;  1LJR A;  4O32 A;  1AQX A; 
#chains in the Genus database with same CATH homology
 1B9X C;  1JHB A;  5D8I A;  2K18 A;  2F9S A;  3HVS A;  4I8B A;  2OBI A;  4G0I A;  5CRG A;  4WF4 A;  1Z5Y E;  2YNX A;  1T8E B;  5HFG A;  4N11 A;  2LEG A;  1TJD A;  5CRW A;  4GRF A;  2LNT A;  2X99 A;  1PQN A;  1AQW A;  3ZIJ A;  3KH7 A;  4BVX A;  2H74 A;  1A8Y A;  2JAC A;  4WBR D;  2H0G A;  2RM6 A;  4G10 A;  2PWJ A;  2B7K A;  4HU9 A;  2GQL A;  3VUR A;  4KA0 A;  4OO4 A;  3FZ5 A;  3CTG A;  4BL7 B;  3KP8 A;  3TJF A;  1JZD A;  2NVL A;  1Z6N A;  1SJ6 A;  5IMF A;  1ZZY A;  1EEM A;  3FK8 A;  4EL1 A;  4AJ8 A;  1ZYQ B;  2CAQ A;  5IMD A;  4ZL9 A;  2OAD A;  4IP6 A;  2B5Y A;  3IDV A;  5HR1 A;  4TR3 A;  2GSS A;  3WT2 A;  4GSS A;  3TKP A;  3IR4 A;  1N2A A;  3UL3 A;  2C80 A;  4O92 A;  1FHE A;  4BA7 A;  2IPA A;  4AF2 A;  10GS A;  4ILF A;  2JAD A;  4MF5 A;  5ELG A;  1T4Z A;  3UOM A;  1EV9 A;  3GRX A;  4O5Q A;  2ON7 A;  2UZ8 A;  2HXK A;  1U88 A;  2XPD A;  4HI7 A;  4BVX B;  5A4V A;  1B8X A;  2IIY A;  2VLU A;  4Z2T A;  1ZCP A;  3D4T A;  3F3R A;  1WP0 A;  1JZO A;  2M46 A;  5FWG A;  1FG4 A;  3J7Y b;  2ZUP A;  3UVH A;  2WFC A;  2H72 A;  1TRV A;  4POK A;  5DAL B;  3U6V A;  1XVQ A;  4TVE A;  5HR3 A;  5IMV A;  4FQU A;  1F37 A;  2WZ9 A;  5B6N A;  1PD2 1;  2GVP A;  4V1A g;  5AIX A;  5G5E A;  3RPP A;  5GAP D;  5KN1 A;  3P8W A;  3M0F A;  4YQV A;  4IQA A;  2VM2 A;  2GZY A;  2ZNM A;  2IMF A;  5ECP B;  3KD0 A;  4WF5 A;  4K2D A;  3V1W A;  1EOG A;  2V41 A;  4HQS A;  1M2A A;  5IMZ A;  1QFN A;  3VI5 A;  2C3N A;  4JR4 A;  1TK8 B;  2XHF A;  1UVZ A;  1VF1 A;  3ZML A;  4F0B A;  3TRQ A;  3GHA A;  1MDK A;  1A2J A;  2FUG 2;  2GT6 A;  1SL1 B;  1U87 A;  1JLV A;  5CO3 A;  2FGX A;  4PUF C;  1XWG A;  1XW6 A;  4WEY A;  3FEU A;  1YF0 A;  1A0F A;  3IHQ A;  1GWC A;  3GST A;  4G9H A;  2N5B A;  3PH9 A;  3ZIT A;  4GXZ A;  4POB A;  4DVC A;  2GT5 A;  5EPF A;  1XOA A;  1ZYN A;  3A5I A;  5F06 A;  4PNF A;  1O7U A;  2O87 A;  1YDK A;  5D9W A;  2IN3 A;  4MZW A;  2N5F A;  3HHV A;  5DCG A;  1M2B A;  1S3C A;  1PL1 A;  3SWL A;  1JFU A;  1R5P A;  2NTO A;  2VLT A;  1A23 A;  4KDU A;  3TRP A;  4KUN A;  4NV2 A;  1HD2 A;  4RI6 A;  3SBC A;  3LFL A;  5B6M A;  3TKQ A;  1QK8 A;  1PA3 A;  4NHZ A;  5HR0 A;  1TDI A;  22GS A;  3HD5 A;  3ZRD A;  2RLI A;  2FA8 A;  2HSM A;  3H1N A;  2QSI A;  1T4Y A;  4ZIL A;  3TUE A;  4LL4 B;  2EC4 A;  3KXO A;  1JZR A;  1F2E A;  3HA9 A;  4NAX A;  2LTK A;  2HZE A;  4TXO A;  2X49 A;  3G7J A;  3P90 A;  3TJJ A;  3D22 A;  2O89 A;  1ERU A;  4YAP A;  3UMA A;  4KND A;  3DWV A;  4F2I A;  1YJ6 A;  4USS A;  4G19 A;  3GFK A;  1AC1 A;  1F3A A;  3MDK A;  4TKY A;  3RHC A;  3CSH A;  2LQO A;  3DRN A;  1T3B A;  3RBT A;  1X9W B;  2KLX A;  4EE0 A;  2I81 A;  1GUM A;  1SYX A;  2FWH A;  2CVD A;  4MF6 A;  2MZC A;  3LYP A;  5AGY A;  1SD9 A;  4K1F A;  3IHG A;  4MAB A;  2GZP A;  3EVI A;  2KP1 A;  1DE1 A;  1I5G A;  3FHK A;  2DIZ A;  2VUP A;  4KB3 A;  1GTU A;  5IPH A;  2PER A;  1OE7 A;  2CVK A;  4Q5Q A;  3ZTL A;  4ULX A;  2HLS A;  3D21 A;  5G1K A;  2R0G A;  2G0F A;  1BJX A;  1OC3 A;  4ZBB A;  4O7H A;  5HR2 A;  2CT6 A;  3CRT A;  4IHU A;  1Y25 A;  2HZE B;  3WGX A;  1VF4 A;  2PMT A;  1SD8 A;  3A3T A;  3TOT A;  3OR5 A;  1PN9 A;  5ECO B;  2YZH A;  4ZL7 A;  1NSW A;  4PXO A;  4OCE A;  1GTA A;  2H8L A;  2RM5 A;  3ERG A;  2A2R A;  2H19 A;  3NZN A;  4BPY A;  2TRC P;  19GS A;  2R2J A;  1X5D A;  1ZL9 A;  5F05 A;  4DSQ A;  2K6V A;  1A8L A;  1GSU A;  2X8G A;  4V2N A;  1KTE A;  3EMX A;  5DJL A;  11GS A;  4ML6 A;  1O81 A;  1BED A;  3MNG A;  1ST9 A;  1XWA A;  2DKH A;  3F63 A;  2HT9 A;  3F6D A;  2VM1 A;  2FNO A;  1OC9 A;  3FMW A;  2HFD A;  1G7O A;  3F4S A;  2JZT A;  4IBP A;  1OAZ A;  5LNK e;  3CTF A;  2PGT A;  3C1S A;  3CSJ A;  5KEJ A;  1BX9 A;  1UA5 A;  2RUE A;  4X1U A;  3VI7 A;  2DJ3 A;  2G2Q A;  2IJY A;  2CX3 A;  4GSN A;  2F8A A;  3HJO A;  3KH9 A;  1HYU A;  4F9Z A;  5C00 A;  2TIR A;  2KOK A;  4TXV A;  2I4A A;  1SYR A;  5G31 A;  1GP1 A;  1J9B A;  1GSQ A;  1K3Y A;  1WPI A;  2H30 A;  2RUF A;  3HY2 A;  1EGO A;  5E4W A;  1K0C A;  2QKE A;  5F07 A;  3EUR A;  2IWT A;  4A5P A;  1X9S B;  4CY6 A;  3ERF A;  5ECH B;  1FO5 A;  3RAZ A;  1KNG A;  2EIO A;  1K0M A;  5DQS A;  3BCI A;  3E0U A;  2H66 A;  2H6Y A;  3A2X A;  1O8W A;  1GRX A;  4G2E A;  4OFM A;  1OKD A;  4ZB9 A;  2C3T A;  1YF1 A;  2LUS A;  4D73 A;  3G9B A;  1AW9 A;  1GUH A;  5L71 A;  1OKT A;  3QCP A;  1AUC A;  1QUW A;  3KGK A;  1AIU A;  1TP9 A;  3VWW A;  1VGL A;  1PN0 A;  3GYK A;  1Y6E A;  3ZFL A;  2NPB A;  4MJC A;  1ERV A;  2XC2 A;  3F8U A;  1XWK A;  4MJB A;  2XBQ A;  3APQ A;  3UIW A;  4I6X A;  4MP4 A;  4XS6 A;  1Q98 A;  1X0R A;  3LWA A;  4GWR A;  4TRX A;  2JSZ A;  1QQ2 A;  3W8S A;  1TI1 A;  2QC7 A;  3QFB C;  1PX7 A;  3UVT A;  3Q18 A;  3UBL A;  2LJK A;  4IEL A;  3US3 A;  1NW2 A;  4JZQ A;  1G7E A;  3O3T A;  3IC4 A;  2YV9 A;  3GKX A;  3JCM L;  2VO4 A;  4EVM A;  3F0I A;  4LMW A;  4QL9 A;  1PSQ A;  3D5J A;  1OVN A;  4POL A;  3L0H A;  3ZIV A;  1FAA A;  2H01 A;  1TKD B;  3L9U A;  4AGS A;  1QMV A;  1Q4J A;  4KCE A;  3R2Q A;  3LGC A;  3IXR A;  4K7I A;  4EO3 A;  1RQM A;  1GSD A;  3I9V 2;  5E59 A;  4D73 B;  1G6W A;  4Q5F A;  4K6X A;  3DYR A;  2LJA A;  4KAE A;  2V6O A;  1YKA A;  1EOH A;  4H86 A;  4LA1 A;  5ECN B;  1DE2 A;  2H70 A;  3BOA A;  5JCG A;  2KHP A;  3F3Q A;  4WBJ A;  4V2L A;  1SL0 B;  1VF2 A;  3DIE A;  5DAK A;  4EIP A;  4TW5 A;  1SK2 A;  2D2Z A;  2K8V A;  3TRX A;  1AQV A;  4BVY A;  1A24 A;  2C1Y A;  4K0G A;  1MD4 A;  3EWL A;  5DQY A;  1XPV A;  3RHB A;  2LQQ A;  2GSR A;  1HNB A;  3QAW A;  2GTU A;  2WUL A;  2H1B A;  3WT1 A;  2V2G A;  4E8H A;  2MYG A;  1BYE A;  2C0G A;  4K5R A;  2MMA A;  3TJB A;  3KTL A;  2BJX A;  4EIQ A;  5J3R A;  3IK9 A;  5IM9 A;  1R5A A;  3L9V A;  2VL2 A;  6GSW A;  1THX A;  3HDC A;  3I6A A;  4OD7 A;  1J0F A;  1TW9 A;  5ECR B;  4CDO A;  4XHM A;  3ME7 A;  1E2Y A;  1SJI A;  4XTS A;  1K0B A;  1PKZ A;  4MMM A;  5ECQ B;  3IC8 A;  4K0N A;  3F4R A;  4ID0 A;  3O76 A;  1OYJ A;  5AIV A;  5DAK B;  4KE3 A;  1M0U A;  1EEJ A;  4FYU A;  4NMU A;  3TKS C;  4BVY B;  1SK1 A;  2MMZ A;  2DJ0 A;  5ID2 A;  2R3X A;  2YP6 A;  2GSQ A;  3DXB A;  2X4A A;  1S3D A;  3NOF A;  7GSS A;  3M9K A;  5D96 A;  3HZ4 A;  2DKI A;  3LG6 A;  1SKW B;  1TU7 A;  3GA4 A;  2DBC A;  5KOW A;  2JU5 A;  4X4J A;  3QMX A;  2H1G A;  2HNL A;  3HVX A;  4HS1 A;  20GS A;  4ISD A;  2P31 A;  2WRT A;  2ZCT A;  1R7H A;  4ACS A;  8GSS A;  3EU4 A;  2CZ3 A;  5KN3 A;  4PQH A;  5H5R A;  4HJM A;  1X9M B;  2B1L A;  1H4O A;  4XCS A;  2FY6 A;  1FVK A;  1YEP A;  1ACV A;  5GST A;  2YWM A;  4HZ4 A;  1GUK A;  1MTC A;  2DML A;  4J57 E;  1K0O A;  4X43 A;  1YEX A;  1M99 A;  3HKR A;  1BG5 A;  2A2S A;  2CX4 A;  2RII A;  1FVJ A;  1W89 A;  4O5R A;  1IYI A;  2R37 A;  2JSY A;  4Q5R A;  4K5S A;  3IBH A;  2GQM A;  4JU5 A;  3ZRE A;  3FR3 A;  4MDC A;  13GS A;  3GKK A;  2MMN A;  5ID2 B;  1CQG A;  2YZU A;  14GS A;  1GLQ A;  2P5R A;  2V1M A;  4DEJ A;  1XXU A;  4NPB A;  3IV4 A;  4JBB A;  3O6T A;  3GUR A;  3C7M A;  2IL3 A;  3GKM A;  5JCU A;  2C0E A;  2K8S A;  5JWQ B;  3LW9 A;  1GL8 A;  4IS0 A;  5BRT A;  2FD3 A;  3L4N A;  18GS A;  4MA9 A;  1WIK A;  2I1U A;  3TOU A;  2CA8 A;  4HEA 2;  3EU3 A;  1TRU A;  2YWO A;  2B5X A;  3M8N A;  2O8V B;  2IMD A;  4FYB A;  4RQX A;  4HJ2 A;  3Q6O A;  5JWR B;  3GIX A;  2PBJ A;  1ON4 A;  1B48 A;  1ERT A;  1YKC A;  2JZS A;  2VD0 A;  4HDE A;  4Z2U A;  2FLS A;  1WJK A;  5FHI A;  1M9A A;  4NV5 A;  2VLV A;  2X8H A;  4GST A;  3CMI A;  3LOR A;  4MZC A;  4OFT A;  1N8J A;  5B8A A;  3A5W A;  4MJE A;  4L5O A;  1XOB A;  3CBU A;  5DVB A;  1GSE A;  2A4V A;  4KGI A;  4YKF A;  2MBT A;  1ZYE A;  1JLW A;  1A2L A;  1TK5 B;  1GTI A;  2KP2 A;  2HSY A;  3TB2 A;  4MK3 A;  4MLY A;  2GGT A;  5G30 A;  5D9X A;  3QDN A;  3E9J B;  2HRF A;  3D0Z A;  3FYG A;  3ZVJ A;  2VAF A;  1GNE A;  5G2Z A;  1V9W A;  4MPF A;  2CVB A;  2LS5 A;  1KBN A;  5F0G A;  5EVO A;  3VWX A;  3MIX A;  1FOV A;  3QFA C;  2V6K A;  5DCH A;  4TXO B;  2REM A;  1S3A A;  6GSU A;  2YV7 A;  5BMU A;  4PUR A;  4BWS A;  2ALB A;  3LYK A;  1O85 A;  1X5E A;  2QA2 A;  2CQ9 A;  1XVW A;  1RW1 A;  5F8B A;  3ZZX A;  2KUC A;  2B3S A;  2OJL A;  2JL4 A;  3F6F A;  1T00 A;  3GV1 A;  17GS A;  4N0V A;  1U3I A;  2MBS A;  4OMV A;  4K8M A;  3TKS E;  3ERW A;  2PVO C;  3GTU A;  5EL8 A;  4AJ6 A;  4FO5 A;  2DJ2 A;  4XRD A;  1PRX A;  3IAM 2;  3MAK A;  2H0H A;  3LSZ A;  1O8X A;  1H75 A;  5ENU A;  3L78 A;  3Q19 A;  4N10 A;  2WDU A;  4GQF A;  6GSV A;  3DKS A;  2QGV A;  3BBY A;  4ZL8 A;  1FOH A;  4TR1 A;  2C0F A;  3QAG A;  1TRW A;  3M3M A;  2HRA A;  4KX4 A;  1F9M A;  5IPG A;  5LCZ A;  2IMK A;  3BJ5 A;  2XBI A;  3CSI A;  3DGQ A;  3P2A A;  2OE0 A;  2FHE A;  2L4C A;  3S9F A;  4KDX A;  2TRX A;  3HJM A;  1M2D A;  3PR8 A;  3WGD A;  1BAY A;  2AUV A;  3UAP A;  1XIY A;  4ECC A;  2DMM A;  2VCT A;  1AAZ A;  5KN2 A;  1SKS B;  4IJI A;  1SJZ A;  2HZF A;  2LRN A;  3ZVJ D;  5J41 A;  2WJU A;  2IMI A;  1WWJ A;  2YWN A;  2LJR A;  3C71 A;  3GTU B;  1ILO A;  4K7N A;  2ON5 A;  4WR5 A;  3KCM A;  4KW6 A;  1GSF A;  2M80 A;  3HXS A;  2CZ2 A;  2H76 A;  3TGZ A;  2VCZ A;  2H71 A;  4ZBA A;  3KZQ A;  1OC9 B;  1AXD A;  5J9B A;  4ZIJ A;  3LJR A;  1V40 A;  2GST A;  1ERW A;  1K3L A;  5J9C A;  4FIW A;  1XCC A;  4NXI A;  4L0W A;  4OO5 A;  3F4T A;  3IRA A;  1XW5 A;  4TR1 B;  4YKG A;  1FB6 A;  1TK0 B;  3ISO A;  3GL3 A;  1DSB A;  2MMO A;  1V58 A;  2AAW A;  3I43 A;  2B7J A;  1UN2 A;  2LNS A;  2R0C A;  2LRC A;  4MNN A;  3QOU A;  4GCI A;  2OKA A;  1PL2 A;  3EIN A;  1C72 A;  3VWV A;  4LL1 B;  2EIQ A;  2CV4 A;  4TOP A;  4EC0 A;  4TN8 A;  4QL7 A;  4XS1 A;  4ECB A;  3M1G A;  3GKN A;  3H4K A;  3N5O A;  4P3Y B;  2VL3 A;  3DML A;  1PKW A;  5DDL A;  3CRU A;  3GH9 A;  4I2T A;  2GZZ A;  5G1L A;  4YH2 A;  1NM3 A;  2HE3 A;  1I9D A;  2B6M A;  3M9J A;  1CQH A;  3K8N A;  4CHS A;  3G7I A;  1PX6 A;  1ML6 A;  5J4U A;  2J9H A;  4EDZ A;  1OE8 A;  3BCK A;  2VOC A;  5CYY A;  1Z9H A;  4I2U A;  1EP8 A;  3DEX A;  4F82 A;  3ZYW A;  4HZ2 A;  4PQI A;  1O6J A;  2B1K A;  2EIR A;  4KH7 A;  4EUY A;  1UC7 A;  3TJG A;  4ZB6 A;  1K0N A;  1NHY A;  4ECI A;  1ABA A;  3FW2 A;  16GS A;  5IMC A;  3KJY A;  3EPT A;  3KMN A;  4GF0 A;  4G0K A;  3R3E A;  1GTB A;  2WS2 A;  4ZBD A;  4WXT A;  3IE3 A;  2PPT A;  3QR6 A;  3UAR A;  5DAL A;  2AHE A;  1GNW A;  4IJ3 A;  3DVW A;  3KM6 A;  1GSS A;  2HI7 A;  3DVX A;  2VIM A;  1Z7P A;  2AB6 A;  2L59 A;  2H1A A;  2FA4 A;  3TDG A;  4X0X A;  4ECJ A;  3GNJ A;  5HQP A;  3EMP A;  2I9H A;  1TU8 A;  2K9F A;  4OCF A;  4PNG A;  4POM A;  1ZGN A;  3TJK A;  1B4Q A;  1RK4 A;  5H5S A;  1B9Y C;  3H8Q A;  4XIH A;  2YAN A;  4JED A;  2FCH A;  3GX0 A;  4K2X A;  1U6T A;  4MPG A;  5AN1 A;  5D93 A;  2LRT A;  2E7P A;  2YN1 A;  5IO2 A;  1MDI A;  3A2V A;  1GLP A;  2PUK C;  4K9Z A;  3FR6 A;  3IA1 A;  3VPT A;  1HNC A;  4MH2 A;  4N30 A;  4V2M A;  5CRH A;  2BMX A;  2P5Q A;  3D6I A;  3GUS A;  4IGJ A;  4JRR A;  2DJ1 A;  5FT3 A;  3E3E A;  3WD6 A;  2GQK A;  3FY7 A;  5JCW A;  2R6K A;  5ECI B;  4ZB8 A;  4G0L A;  4IVF A;  4HUA A;  4EDY A;  4YAV A;  2DIY A;  5COH A;  1A0R P;  3CXG A;  2H6Z A;  2L5O A;  2GS3 A;  3U5R E;  5CRD A;  5CAX A;  2VCQ A;  5D9T A;  2P0G A;  4Z7X A;  2B5E A;  4JR6 A;  3PPU A;  2YPM A;  5HFI A;  4OWY A;  1K0A A;  1Z6M A;  3CYN A;  4CY8 A;  1M7T A;  2H0I A;  4YQU A;  4CW9 A;  2WGR A;  3GH6 A;  3IK7 A;  3DD3 A;  2PN8 A;  3G7Y A;  2NDO A;  1YY7 A;  2AYT A;  2VCV A;  1M9B A;  2NBS A;  1DBY A;  3C1R A;  1EZK A;  1V98 A;  2R0P A;  3LEF A;  4WR4 A;  5IOW A;  3TCO A;  2HRK A;  6GSX A;  4RI7 A;  1BQ7 A;  4EF0 A;  4KSO A;  1QXH A;  3C73 A;  5DBQ A;  3L9S A;  1EP7 A;  5A4W A;  3APO A;  3D4M A;  2C4J A;  2CAI A;  4RQR A;  1B4P A;  4PTS A;  1HNA A;  4Z2R A;  2E2G A;  5D73 A;  3C8E A;  4L0U A;  4ICY A;  1SL2 B;  1WRY A;  3RDW A;  2L6D A;  1ZMA A;  5KOX A;  4QQ7 A;  1TTZ A;  2OE3 A;  1LU4 A;  1G0T A;  2FWG A;  4J2F A;  5JWO B;  1F3B A;  3HYP A;  1MEK A;  3GMF A;  2C8U A;  4HU7 A;  2QA1 A;  1WE0 A;  5KN0 A;  5GZZ B;  2XPE A;  5ECL B;  1SU9 A;  3UEM A;  6GST A;  2E0Q A;  1T7P B;  1GUL A;  1SK0 A;  2WB9 A;  2BTO T;  3WYW A;  2AJQ B;  4MF7 A;  2H6X A;  3KMO A;  4FYC A;  2YJH A;  4TR0 A;  2M72 A;  2LV3 A;  2OAC A;  4XS4 A;  4AJ7 A;  4L5L A;  3GSS A;  1XWB A;  4BWQ A;  3VFI A;  1FW1 A;  3IOS A;  4PUA A;  1JZW A;  3UJ1 A;  2O7K A;  1XBS A;  4EXJ A;  4IW9 A;  1J08 A;  2LKU A;  4IQ1 A;  3QAV A;  3KEB A;  1XZO A;  1FB0 A;  1XFL A;  3ZL5 A;  3MYD A;  4V1A p;  5G5F A;  2F8F A;  3FZ9 A;  5B8B A;  3VPQ A;  2F3M A;  2L5L A;  2IME A;  2A4H A;  1MDJ A;  2E2M A;  9GSS A;  4MJA A;  3FR9 A;  5ELA A;  5INY A;  4TR4 A;  12GS A;  2PVQ A;  1TI3 A;  3LQ7 A;  5B7C A;  4KSM A;  2VL9 A;  3KTB A;  5EY6 A;  4YQM A;  2L57 A;  3RPN A;  2N5A A;  2AV4 A;  1SEN A;  1Z7R A;  1TXX A;  5ABR A;  1YZX A;  2H75 A;  3KIJ A;  5D9V A;  2A2P A;  3FRC A;  5CNW A;  3A2W A;  5ECM B;  3TKS A;  1PGT A;  1ZOF A;  1TRS A;  3ED3 A;  3WGE A;  1THO A;  2C3Q A;  3F9U A;  2X8C A;  1ZYP A;  2VCW A;  5GAN D;  3FKF A;  2F51 A;  2IFQ A;  3BD2 A;  5IMA A;  2L4Q A;  3P7X A;  3PGT A;  3LXT A;  2HSH A;  4NWY A;  4XS4 B;  4LLR A;  1GSY A;  5A5K A;  1VRS D;  1MD3 A;  3MSZ A;  5IQY A;  2PU9 C;  2X64 A;  2H73 A;  3ZFB A;  4EKZ A;  2V32 A;  3APS A;  4E8E A;  3HJP A;  2C0D A;  4DSS A;  2YCD A;  2DJK A;  3TKR A;  4IKH A;  4MH3 A;  2VD1 A;  4O5U A;  1LBK A;  2OA7 A;  2GDR A;  1V2A A;  2HYX A;  3MWH A;  2FWF A;  3GX8 A;  1HQO A;  1A2M A;  2ES7 A;  1VF3 A;  3PIN A;  4F0C A;  1W4V A;  4K7O A;  5HFK A;  4LMV A;  2FWE A;  4F03 A;  5CP1 A;  3LXZ A;  1U3A A;  3GL5 A;  3NIV A;  4J56 E;  4JE1 A;  4L8E A;  1TOF A;  1R26 A;  3ZMK A;  5CRE A;  3QPM A;  4MZB A;  1F6M C;  1K0D A;  1Z3E A;  4I97 A;  3HZ8 A;  5C04 A;  4KF9 A;  2LST A;  1EV4 A;  4PQ1 A;  3N9J A;  2Z9S A;  3HCZ A;  6GSY A;  1EWX A;  2HRN A;  4GTU A;  3QD9 A;  3Q74 A;  2IFQ B;  1E6B A;  3VLN A;  3EC3 A;  4PX1 A;  3W8J A;  3FZA A;  3UBK A;  4HQZ A;  1QGV A;  4XRA A;  1NHO A;  1URM A;  2WCI A;  4Q5N A;  3W6G A;  1IYH A;  3VK9 A;  4GLT A;  4DSS B;  2L6C A;  5LD0 A;  4ML1 A;  2I3Y A;  3AY8 A;  3ZLP A;  1G6Y A;  4DSR A;  2R4V A;  2YWI A;  1OC8 A;  2VL2 C;  2OE1 A;  1R4W A;  2YOI A;  1X5C A;  4RUV A;  3EYT A;  4ZXG A;  5ECS A;  5J5N A;  2VCX A;  3IPZ A;  2YJ7 A;  2R5G A;  1K3O A;  3KP9 A;  4WET A;  5IOX A;  5IO0 A;  4GQC A;  1O73 A;  3EE2 A;  3GN3 A;  3FZ4 A;  1PMT A;  1USB A;  2J23 A;  1WMJ A;  1KEB A;  2DSA A;  6GSS A;  3I69 A;  5IIZ A;  2OBK A;  1YQ1 A;  4OFN A;  1WOU A;  4HOJ A;  3VWU A;  1GH2 A;  3ME8 A;  4IN0 A;  4IP1 A;  4MCU A;  3H93 A;  4BL7 A;  3H79 A;  2JZR A;  3HVV A;  1XWC A;  5GSS A;  4WKW A;  2DLX A;  5ECK B;  1XW9 A;  3J7Y k;  1DUG A;  1V57 A;  4PGT A;  4N0Z A;  2O85 A;  1T1V A;  2DC5 A;  4KCA A;  5DJM A;  4NHW A;  4KDY A;  2GLR A;  5AIS A;  5H5Q A;  1SKR B;  2DJJ A;  5A4U A;  2H1D A;  4FH8 A;  4I5Q A;  3IAS 2;  1EGR A;  1LJR A;  4O32 A;  1AQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...