2A2PA

Solution structure of selm from mus musculus
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
129
structure length
129
Chain Sequence
MTNYRPDWNRLRGLARGRVETCGGCQLNRLKEVKAFVTEDIQLYHNLVMKHLPGADPELVLLSRNYQELERIPLSQMTRDEINALVQELGFYRKSAPEAQVPPEYLWAPAKPPEEASEHDDLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Selenoprotein M
publication title NMR Structures of the Selenoproteins Sep15 and SelM Reveal Redox Activity of a New Thioredoxin-like Family.
pubmed doi rcsb
source organism Mus musculus
total genus 22
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2005-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08806 Sep15_SelM Sep15/SelM redox domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.50 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2a2pA01
2A4HA 2A2PA
chains in the Genus database with same CATH superfamily
3ERWA 4IELA 2QKEA 2AB6A 3SWLA 4I8BA 2FHEA 3I6AA 3W6GA 3R3EA 3WGEA 2FGXA 4MCUA 1EOGA 5IMCA 3FR6A 4ECBA 2H73A 2GZPA 2CVDA 5C04A 5IOWA 4YQMA 4GWRA 4HUAA 3L9UA 4BWQA 4POLA 2EIQA 2IMKA 3CTGA 5KN1A 3HYPA 2VL3A 2GZZA 3KJYA 1G7EA 1PN0A 1EGOA 2DIZA 4PX1A 3VK9A 2XHFA 2ES7A 1V9WA 2JACA 3C1RA 2YWIA 3TRPA 4HJMA 1HQOA 4KAEA 5IOXA 3IBHA 4BVYB 1AQXA 1ERUA 4MABA 4N30A 2HRKA 1M2BA 5CNWA 1PL1A 4MJCA 3GUSA 3JCML 2B1KA 4XS4B 2C4JA 3LJRA 4NWYA 2VCQA 4IW9A 2TRXA 1AIUA 2LSTA 2HYXA 3HHVA 1XWAA 4AGSA 5A4WA 4KDXA 2IMFA 4NHZA 3QR6A 2LNSA 4I5QA 4MPGA 2TRCP 3CBUA 4G2EA 2F3MA 2GVPA 1M7TA 17GSA 2E7PA 2DSAA 2CX4A 4YQUA 2BMXA 1JLWA 3HVSA 2AUVA 2H70A 2FUG2 4OD7A 4EDYA 1T8EB 3ZMLA 1KEBA 1PL2A 4ZL9A 4N0VA 4NPBA 1OKTA 1AAZA 4F82A 1YY7A 2JZRA 3WT2A 2HRAA 6GSYA 1T1VA 2R0GA 2VO4A 4XS6A 5DQSA 3EU4A 1JZDA 3MWHA 4JZQA 4N11A 5DDLA 4DSSA 4L5LA 1UA5A 1TW9A 5G31A 4ZB6A 1I5GA 4JE1A 1X0RA 3GX0A 1OC8A 5DJMA 4NHWA 2YANA 1Q4JA 5ECMB 1XW9A 1ERVA 19GSA 1OVNA 4F03A 1HNCA 2I81A 3DKSA 2GZYA 1VF3A 3GHAA 1XBSA 3F3QA 1PA3A 3MDKA 2AHEA 4V2LA 2F8FA 2HRFA 2PBJA 1JLVA 1TI3A 2G2QA 2X4AA 2H74A 2H0HA 1J9BA 2H8LA 2F51A 3BJ5A 2VL9A 1XXUA 1AXDA 4OO5A 1PX7A 2DJ0A 2K6VA 1MDKA 5J9CA 2KOKA 1XPVA 2VCZA 3HD5A 1LJRA 1TRUA 3UJ1A 2YV7A 2X64A 3CMIA 3DVWA 3TKSA 1SL0B 2QA2A 5ABRA 2B3SA 1MDIA 1EP8A 2C1YA 3DRNA 2MMAA 2CVKA 2XBIA 3I9V2 3ZL5A 1QXHA 3GH9A 2P5RA 4TKYA 3ZITA 3KXOA 5E4WA 4PUAA 4L0UA 3MNGA 1TJDA 3ME7A 2DJKA 5IPGA 1SU9A 3CSHA 3GRXA 2JADA 5GAPD 3FRCA 1ABAA 3A2XA 3H79A 1AUCA 1K3LA 4KH7A 5AN1A 4O92A 2OKAA 3H93A 3RDWA 1TRVA 4AJ8A 2DBCA 2LKUA 2X49A 4IQAA 1M99A 1QUWA 1TK5B 3FEUA 1PGTA 4QL9A 4MK3A 1A2MA 1RK4A 5COHA 3F6FA 1GSQA 5IO2A 3GNJA 3PPUA 5ID2A 5GSSA 4XHMA 2C3QA 2JZSA 3UIWA 3DGQA 2MMNA 1E2YA 1VRSD 1QFNA 2OE1A 2H30A 3HDCA 1Z7RA 2H01A 5HQPA 3GKXA 3GMFA 1TK8B 2M80A 3GA4A 1F3BA 4IN0A 3M9JA 3ED3A 3WYWA 4LL1B 3HJMA 2IMDA 1XWGA 2VD0A 3MIXA 3UVHA 4P3YB 4WR4A 1USBA 2JL4A 5HFKA 4POBA 2X8HA 1JZRA 5D96A 2AV4A 4KUNA 1R26A 5JCWA 1G0TA 2B1LA 3I69A 2CVBA 2A4HA 5ECSA 4PXOA 2X8GA 2NBSA 1BYEA 1F6MC 4HSCX 2DC5A 2P31A 4OO4A 1FG4A 4DSQA 3ERGA 4K5RA 3EURA 3IK7A 5ELAA 1AQVA 1RW1A 2HZEB 1AC1A 4JBBA 4EUYA 1G7OA 3IDVA 2PPTA 2OADA 2YJHA 2YP6A 4F9ZA 4MH2A 3TKRA 4G0LA 2ON5A 4ACSA 1B4QA 5D93A 3FMWA 4POMA 1WP0A 2QA1A 3GX8A 3C71A 5JCUA 2YN1A 6GSXA 3BD2A 1WWJA 2V6KA 2Z9SA 1TDIA 1EGRA 2L59A 2FY6A 4MJBA 4KNDA 3VWUA 1A8LA 5KOWA 2IWTA 2J23A 4RQXA 1GP1A 3HVVA 2H6XA 3H4KA 2GLRA 4TN8A 5DAKA 3D6IA 3F4RA 4J2FA 4BVYA 3CSIA 5HR0A 1AW9A 2KHPA 4MP4A 4TXOB 7GSSA 1WJKA 4LMWA 4XTSA 4GQCA 2V41A 5JWRB 4PURA 5B7CA 5JWOB 4AJ6A 4ILFA 4TW5A 3FR3A 4HZ4A 5EPFA 2FA4A 4IP1A 4XRDA 3Q6OA 1J0FA 3NIVA 1Z3EA 2MMOA 3D21A 3HCZA 1QGVA 4QL7A 2KP2A 4WETA 5DCHA 3DYRA 1TI1A 1NSWA 3P7XA 3G7IA 2RM5A 4NMUA 2L4CA 3O6TA 1TOFA 4BIKA 3D4TA 3KD0A 1FB0A 3GH6A 3QAVA 2LNTA 3ZFBA 2H19A 3QAWA 2C0EA 1ZZYA 2MMZA 4MJEA 4GSNA 2LEGA 2LRNA 3RPPA 22GSA 1ZMAA 3E0UA 3LEFA 4XS1A 3APQA 3DXBA 2DLXA 1T4YA 1W4VA 1PX6A 2IPAA 1DUGA 3UVTA 4GF0A 1ACVA 4MF7A 1DBYA 4K6XA 2B7JA 4NV5A 4K7OA 3ZIVA 1MEKA 2R3XA 1UN2A 2WULA 5B6NA 3ZZXA 1SYRA 1FOHA 1XWBA 4Q5NA 3TJJA 2N5AA 2C0DA 3VURA 4F0BA 3GTUB 4GLTA 4XCSA 1BJXA 5B8BA 2V2GA 2B5EA 4Z2RA 1SKRB 1DE2A 1ON4A 3RAZA 4FIWA 1PRXA 1YEXA 6GSTA 2VCTA 4K7IA 4YH2A 3HZ8A 3ZVJD 1XWCA 1OYJA 4K2DA 2VUPA 1FVKA 2NTOA 1TXXA 3LYPA 4Q5FA 1T3BA 1A0FA 3ZYWA 3GL3A 1U3IA 3PGTA 4E8HA 3UBKA 1X5DA 1O8WA 1LBKA 1B9XC 3N9JA 5JWQB 3GIXA 2LV3A 1GSYA 1N8JA 3IPZA 4K0NA 5ECNB 2H72A 2VLVA 1OC9B 3Q19A 8GSSA 1XOAA 4LL4B 2M46A 4HS1A 4K0GA 4GCIA 2WS2A 1Z5YE 4YKFA 1YJ6A 3HXSA 5F8BA 4FYUA 5ECQB 4BPYA 3U6VA 5ECRB 2P0GA 2M72A 1WRYA 2GGTA 3CXGA 5G5EA 1FOVA 1XWKA 2MYGA 1B8XA 1SK1A 3KTBA 1V57A 1XZOA 5KN2A 2O7KA 4BL7B 5CO3A 1BX9A 3KEBA 5CRGA 4X43A 1Y25A 2WCIA 1BQ7A 1X5CA 4I2UA 3BBYA 4LMVA 3FYGA 1MD3A 1HNBA 4D73A 2O85A 3CRUA 4Z7XA 3VWVA 3AY8A 3LSZA 3L9SA 1YQ1A 1B9YC 4IVFA 2PU9C 4BA7A 1C72A 1PD21 4HZ2A 2RIIA 1GTUA 2PWJA 1SYXA 4GRFA 2HSYA 4GTUA 2CAQA 1GUKA 4Q5RA 3QD9A 1SENA 5J3RA 4OCFA 2EIRA 2HI7A 4TRXA 2OA7A 3DVXA 3M8NA 1WIKA 4ZBAA 4K9ZA 2OE0A 5IMZA 4BVXA 1M2DA 1WMJA 3L9VA 4IBPA 4LA1A 1FHEA 1JZWA 5IPHA 4EIPA 1CQHA 4G19A 5KN3A 5CP1A 4O5UA 2PMTA 4J57E 2HZEA 5E59A 2A2PA 2YPMA 2V6OA 2VIMA 5IMAA 2HSHA 3EINA 3FZ4A 3P90A 3HZ4A 1SK2A 5HFIA 1TU7A 3RBTA 2H6ZA 2K9FA 1B48A 4OCEA 1SK0A 4RQRA 1Z6MA 18GSA 5H5QA 5D9VA 2IIYA 1F9MA 3QDNA 1ZCPA 2KLXA 1XW6A 4MF6A 2CQ9A 4TR3A 1R5PA 4RI7A 3UMAA 1DSBA 4X4JA 1GUHA 3VI5A 2DMMA 2VCXA 2A4VA 3TB2A 1A24A 3J7Yk 4IKHA 1VF1A 4MJAA 4CDOA 2DJ3A 5FHIA 3LWAA 1SL1B 4TXOA 4CY6A 5ECHB 2HXKA 2YWMA 1YEPA 3KH9A 1GL8A 4WBRD 2DIYA 4ZILA 4OWYA 1JHBA 4HEA2 2H6YA 5IMFA 2YZHA 3DWVA 2R0PA 4NV2A 3ZRDA 1XG8A 2L5OA 5F0GA 2H71A 4L8EA 3IHGA 2EC4A 3LQ7A 5J9BA 2ALBA 2CX3A 3QFAC 4Z2UA 1F2EA 2O87A 3WGDA 1OE8A 1BG5A 1TRSA 1S3AA 1O8XA 1GSEA 1MDJA 1R4WA 2N5FA 4WXTA 1A23A 4O5RA 2AAWA 1FO5A 2YWOA 3RHCA 4N0ZA 4ZIJA 4GXZA 2F8AA 2B5YA 2K8SA 2L57A 5CRHA 3A3TA 4WR5A 2XPEA 3FZAA 1EOHA 3EMPA 4V2MA 4V1Ap 1XIYA 3IR4A 1JFUA 2R2JA 3ZIJA 6GSUA 2IJYA 4EDZA 1G6YA 4KB3A 1M9AA 2LS5A 5A5KA 2OJLA 3CSJA 2RUEA 2AYTA 2YJ7A 3LW9A 4KX4A 1M0UA 4K1FA 3ZFLA 1Y6EA 2R4VA 3APSA 4MMMA 4TR4A 4ZL8A 3GTUA 2I3YA 1WPIA 4HU7A 1U87A 2H0IA 5HR2A 1YDKA 1GH2A 3VI7A 5DCGA 3FR9A 2R0CA 3UOMA 4O7HA 5IM9A 3ZLPA 4TOPA 20GSA 3LGCA 5DJLA 3FZ5A 4G0IA 3HA9A 4RI6A 3IHQA 3IAS2 2E0QA 2V1MA 1H75A 4MPFA 6GSWA 1FW1A 2LRTA 1URMA 4LLRA 2JSZA 3TOTA 5F06A 4PTSA 2HZFA 1QQ2A 2C80A 3F8UA 2MBSA 2H1GA 1PQNA 3A2VA 2FNOA 4X0XA 5D9TA 4TR0A 4JR6A 3MYDA 4GSTA 4ICYA 2WFCA 2DJ1A 2H1DA 4HI7A 3LXZA 1T00A 4KDYA 5DBQA 2H0GA 3IC8A 2XBQA 5IMDA 1YF0A 2REMA 2LJRA 3TOUA 3NOFA 9GSSA 2F9SA 2VD1A 3K8NA 10GSA 2UZ8A 5IQYA 4ID0A 5G1KA 1Z6NA 3UBLA 3F0IA 4KCEA 2IMIA 2GDRA 1K0MA 2ZUPA 1JZOA 2DKHA 4XS4A 3M0FA 1VF4A 5H5RA 1YF1A 4MDCA 3EWLA 2JU5A 1A2LA 4TR1B 6GSVA 4TXVA 1YKAA 1O85A 5LCZA 3EE2A 3DIEA 4HOJA 4BL7A 5IIZA 1K0OA 1B4PA 1M3JA 3US3A 3IE3A 3LYKA 2O8VB 1ZYEA 2IFQB 1X5EA 3F4TA 4EE0A 2OACA 3VWWA 1HNAA 1XW5A 3WT1A 5BRTA 4PQHA 4Z2TA 4KCAA 4PGTA 4KSOA 5JCGA 3KH7A 1TU8A 3IV4A 3EYTA 5ECIB 3TGZA 5HR3A 1ZGNA 1GNEA 5G1LA 2H76A 1EV4A 4O32A 1O81A 5FWGA 4I2TA 3IC4A 4O5QA 1GSUA 4JU5A 3E3EA 1K0AA 4IJIA 4FYBA 5D9WA 1V2AA 5G5FA 4FO5A 2YV9A 2OE3A 1RQMA 5KOXA 3H1NA 1S3CA 3GURA 1SL2B 1I9DA 3HJPA 4ZB9A 2PVQA 3S9FA 12GSA 5HFGA 3UEMA 4MNNA 4K8MA 1KBNA 1TK0B 3VWXA 5B6MA 3TDGA 2PGTA 5ELGA 1X9MB 4NXIA 3BCKA 3GKKA 2H66A 4KA0A 1SJ6A 1QMVA 4MH3A 1NM3A 2YNXA 1PN9A 1GNWA 2IN3A 5H5SA 3NZNA 4J56E 3F4SA 4PUFC 1DE1A 3QFBC 3MAKA 1GSDA 4HDEA 2DJJA 4F0CA 5KEJA 1W89A 3UAPA 4HU9A 1K0DA 2E2MA 2GTUA 4WF5A 4OMVA 2O89A 3KGKA 2HSMA 2H1BA 11GSA 3D4MA 1NW2A 5D73A 2K18A 4DEJA 1ILOA 4GSSA 1O7UA 3D22A 1SJIA 3RPNA 3WGXA 2NPBA 2FWFA 1GWCA 2FLSA 3GV1A 3O3TA 4KGIA 5ECLB 4FYCA 2RLIA 2QSIA 3ZVJA 5DAKB 3GN3A 3GKNA 4ZBDA 3SBCA 4ZL7A 4N10A 4V1Ag 2HLSA 3D0ZA 5ECKB 4IQ1A 4PQ1A 5ECPB 1YZXA 1XFLA 2HT9A 1XCCA 1HYUA 3EVIA 6GSSA 5CREA 2CZ3A 1Z9HA 1U88A 1EP7A 1E6BA 2PERA 4JRRA 4WF4A 2GSSA 4L5OA 1XOBA 2VM2A 1EEJA 1EV9A 3P2AA 4IHUA 2RM6A 4EKZA 2L4QA 1OE7A 2B5XA 2ON7A 3ERFA 3GKMA 1FVJA 4ZBBA 1ZYNA 3QPMA 2AJQB 4OFTA 1CQGA 2LJAA 2H1AA 2CAIA 2X8CA 3TJKA 1NHYA 13GSA 4F2IA 3FZ9A 3KMNA 5DALB 2CT6A 1PMTA 4IS0A 1ZYQB 1M2AA 4KW6A 5J4UA 1SKSB 4WBJA 4CW9A 1KNGA 3GSSA 4CY8A 3MSZA 2WJUA 1SD9A 3GL5A 2CV4A 5DVBA 1WOUA 5LNKe 2C3NA 2I4AA 4CHSA 3EPTA 4G0KA 3VLNA 1V40A 3H8QA 5D8IA 1ST9A 2GT5A 3W8SA 4KSMA 3TJGA 4WEYA 1TRWA 1ZOFA 2DKIA 2WDUA 3GFKA 2HRNA 4POKA 1K0NA 4ULXA 3TUEA 1S3RA 1OC3A 1OKDA 3F6DA 1F37A 1IYHA 3QCPA 1ERWA 1GSFA 1UVZA 4K2XA 2A2RA 2NDOA 5EL8A 1K0BA 5ECOB 4ZB8A 2NVLA 3KP8A 2WZ9A 5L71A 2B7KA 2BTOT 2LQQA 2MZCA 2DMLA 1THXA 2J9HA 3ISOA 2GSRA 3TKSC 4L0WA 1O6JA 2PN8A 1X9SB 2FWHA 2C3TA 3G9BA 1QK8A 4RUVA 2HE3A 2PUKC 1HD2A 1OAZA 4X1UA 4K7NA 4EL1A 1GTIA 3IXRA 3C7MA 16GSA 2OBIA 1H4OA 3I43A 3LG6A 5CRDA 2GSTA 3IK9A 2C8UA 3APOA 2XC2A 2QGVA 5HR1A 1FB6A 3G7YA 4DVCA 2WB9A 3QAGA 2WRTA 1GRXA 5AIVA 4WKWA 1TP9A 5F07A 1J08A 4EF0A 4HQZA 4TR1A 3KCMA 1K3OA 1R5AA 5A4UA 2C0GA 3QOUA 3LXTA 3IA1A 2FD3A 2VCWA 3L0HA 4IJ3A 5AISA 4G10A 3VPQA 1ZYPA 4PNFA 4IGJA 2YZUA 4AF2A 1V58A 3EU3A 3HVNA 3F63A 5F05A 3QMXA 1Z7PA 1ERTA 2RUFA 3Q18A 3D5JA 2JSYA 2ZNMA 3GSTA 3VFIA 1GULA 1G6WA 5AGYA 3LORA 3DEXA 3PINA 1GSSA 4OFNA 2R5GA 5KN0A 1TKDB 5FT3A 2IFQA 5LD0A 1T4ZA 4XIHA 1Q98A 3LFLA 4ZXGA 4V2NA 3KMOA 2R37A 1AQWA 4D73B 2GT6A 4EXJA 4JEDA 1WE0A 2LRCA 3UL3A 5GAND 4K5SA 1T7PB 4XRAA 1U6TA 4ML6A 4EC0A 1SKWB 3FKFA 4GQFA 1PKWA 5CYYA 3GYKA 3L78A 2PVOC 3A5IA 4TVEA 3CTFA 3P8WA 4DSSB 2LJKA 2VLTA 3IAM2 4ECJA 4IP6A 2CZ2A 2JZTA 1IYIA 1YKCA 1LU4A 4YAVA 4YQVA 3FHKA 2L5LA 3HJOA 2YOIA 3BCIA 1M9BA 1KTEA 1O73A 4BVXB 1EWXA 2WGRA 4JR4A 2MBTA 4MLYA 4NAXA 3L4NA 3M1GA 5DQYA 5G2ZA 3OR5A 1SD8A 4EO3A 1VGLA 2G0FA 4HJ2A 3U5RE 3HKRA 2XPDA 1XVQA 3V1WA 1EEMA 5AIXA 5J5NA 2P5QA 3ZTLA 1GTBA 1MTCA 3WD6A 4KE3A 2L6DA 5EVOA 3M3MA 5GZZB 3TRXA 4ECCA 3FK8A 1A0RP 4USSA 3TCOA 1TTZA 3EC3A 3ZREA 3E9JB 3KIJA 4ML1A 4KDUA 1K3YA 1VF2A 2FWEA 4H86A 2X99A 1GUMA 1THOA 3EMXA 1S3DA 4KF9A 1FAAA 1OC9A 4FH8A 2KUCA 3DMLA 2K8VA 1N2AA 1NHOA 4DSRA 1ZL9A 2FA8A 3UARA 4MZCA 3KZQA 2LUSA 2FWGA 3KTLA 3HVXA 4MA9A 1BAYA 2QC7A 2L6CA 2B6MA 1PKZA 1A2JA 3O76A 3Q74A 3N5OA 1PFOA 2BJXA 5CRWA 4I6XA 1ML6A 3TRQA 4ISDA 3RHBA 4E8EA 2IL3A 5C00A 2VLUA 2VL2C 2FCHA 3F3RA 1A8YA 4PQIA 3FW2A 1SJZA 2I1UA 2IMEA 2ZCTA 1GLPA 2R6KA 2VM1A 2H75A 3M9KA 3ME8A 3TKPA 2CA8A 2GQKA 3KP9A 3R2QA 2VL2A 2TIRA 1EZKA 2KP1A 4AJ7A 5ENUA 5IMVA 3TJFA 5GSTA 5ID2B 2LTKA 2VAFA 4OFMA 2E2GA 3PH9A 4MF5A 14GSA 3IOSA 2LQOA 5IO0A 5CAXA 4MZBA 2GQLA 2GS3A 2C0FA 1GTAA 4BWSA 2YWNA 3G7JA 1UC7A 5DALA 2VCVA 3A2WA 1BEDA 3F9UA 2DJ2A 2VOCA 2YCDA 3TJBA 1V98A 3C1SA 4PNGA 2EIOA 5G30A 2N5BA 1K0CA 3A5WA 4YAPA 3VPTA 4EVMA 3J7Yb 1MD4A 4A5PA 4YKGA 3IRAA 1GLQA 3C73A 2HNLA 5J41A 5BMUA 3PR8A 4EIQA 5A4VA 3C8EA 2D2ZA 3TKQA 3KM6A 2V32A 1X9WB 3W8JA 3ZMKA 1XVWA 4G9HA 3CQFA 2HFDA 5D9XA 2A2SA 3DD3A 3CYNA 4Q5QA 3FY7A 2OBKA 2GQMA 5INYA 1R7HA 4HQSA 3BOAA 1U3AA 3TKSE 4FQUA 3HY2A 4MZWA 1M3IA 4ECIA 5EY6A 4I97A 3CRTA 1PSQA 2GSQA 5B8AA 2I9HA 1F3AA 4QQ7A
chains in the Genus database with same CATH topology
3ERWA 4IELA 2QKEA 2AB6A 3SWLA 4I8BA 2FHEA 3I6AA 3W6GA 3R3EA 3WGEA 2FGXA 4MCUA 1EOGA 5IMCA 3FR6A 4ECBA 2H73A 2GZPA 2CVDA 5C04A 5IOWA 4YQMA 4GWRA 4HUAA 3L9UA 4BWQA 4POLA 2EIQA 2IMKA 3CTGA 5KN1A 3HYPA 2VL3A 2GZZA 3KJYA 1G7EA 1PN0A 1EGOA 2DIZA 4PX1A 3VK9A 2XHFA 2ES7A 1V9WA 2JACA 3C1RA 2YWIA 3TRPA 4HJMA 1HQOA 4KAEA 5IOXA 3IBHA 4BVYB 1AQXA 1ERUA 4MABA 4N30A 2HRKA 1M2BA 5CNWA 1PL1A 4MJCA 3GUSA 3JCML 2B1KA 4XS4B 2C4JA 3LJRA 4NWYA 2VCQA 4IW9A 2TRXA 1AIUA 2LSTA 2HYXA 3HHVA 1XWAA 4AGSA 5A4WA 4KDXA 2IMFA 4NHZA 3QR6A 2LNSA 4I5QA 4MPGA 2TRCP 3CBUA 4G2EA 2F3MA 2GVPA 1M7TA 17GSA 2E7PA 2DSAA 2CX4A 4YQUA 2BMXA 1JLWA 3HVSA 2AUVA 2H70A 2FUG2 4OD7A 4EDYA 1T8EB 3ZMLA 1KEBA 1PL2A 4ZL9A 4N0VA 4NPBA 1OKTA 1AAZA 4F82A 1YY7A 2JZRA 3WT2A 2HRAA 6GSYA 1T1VA 2R0GA 2VO4A 4XS6A 5DQSA 3EU4A 1JZDA 3MWHA 4JZQA 4N11A 5DDLA 4DSSA 4L5LA 1UA5A 1TW9A 5G31A 4ZB6A 1I5GA 4JE1A 1X0RA 3GX0A 1OC8A 5DJMA 4NHWA 2YANA 1Q4JA 5ECMB 1XW9A 1ERVA 19GSA 1OVNA 4F03A 1HNCA 2I81A 3DKSA 2GZYA 1VF3A 3GHAA 1XBSA 3F3QA 1PA3A 3MDKA 2AHEA 4V2LA 2F8FA 2HRFA 2PBJA 1JLVA 1TI3A 2G2QA 2X4AA 2H74A 2H0HA 1J9BA 2H8LA 2F51A 3BJ5A 2VL9A 1XXUA 1AXDA 4OO5A 1PX7A 2DJ0A 2K6VA 1MDKA 5J9CA 2KOKA 1XPVA 2VCZA 3HD5A 1LJRA 1TRUA 3UJ1A 2YV7A 2X64A 3CMIA 3DVWA 3TKSA 1SL0B 2QA2A 5ABRA 2B3SA 1MDIA 1EP8A 2C1YA 3DRNA 2MMAA 2CVKA 2XBIA 3I9V2 3ZL5A 1QXHA 3GH9A 2P5RA 4TKYA 3ZITA 3KXOA 5E4WA 4PUAA 4L0UA 3MNGA 1TJDA 3ME7A 2DJKA 5IPGA 1SU9A 3CSHA 3GRXA 2JADA 5GAPD 3FRCA 1ABAA 3A2XA 3H79A 1AUCA 1K3LA 4KH7A 5AN1A 4O92A 2OKAA 3H93A 3RDWA 1TRVA 4AJ8A 2DBCA 2LKUA 2X49A 4IQAA 1M99A 1QUWA 1TK5B 3FEUA 1PGTA 4QL9A 4MK3A 1A2MA 1RK4A 5COHA 3F6FA 1GSQA 5IO2A 3GNJA 3PPUA 5ID2A 5GSSA 4XHMA 2C3QA 2JZSA 3UIWA 3DGQA 2MMNA 1E2YA 1VRSD 1QFNA 2OE1A 2H30A 3HDCA 1Z7RA 2H01A 5HQPA 3GKXA 3GMFA 1TK8B 2M80A 3GA4A 1F3BA 4IN0A 3M9JA 3ED3A 3WYWA 4LL1B 3HJMA 2IMDA 1XWGA 2VD0A 3MIXA 3UVHA 4P3YB 4WR4A 1USBA 2JL4A 5HFKA 4POBA 2X8HA 1JZRA 5D96A 2AV4A 4KUNA 1R26A 5JCWA 1G0TA 2B1LA 3I69A 2CVBA 2A4HA 5ECSA 4PXOA 2X8GA 2NBSA 1BYEA 1F6MC 2DC5A 2P31A 4OO4A 1FG4A 4DSQA 3ERGA 4K5RA 3EURA 3IK7A 5ELAA 1AQVA 1RW1A 2HZEB 1AC1A 4JBBA 4EUYA 1G7OA 3IDVA 2PPTA 2OADA 2YJHA 2YP6A 4F9ZA 4MH2A 3TKRA 4G0LA 2ON5A 4ACSA 1B4QA 5D93A 3FMWA 4POMA 1WP0A 2QA1A 3GX8A 3C71A 5JCUA 2YN1A 6GSXA 3BD2A 1WWJA 2V6KA 2Z9SA 1TDIA 1EGRA 2L59A 2FY6A 4MJBA 4KNDA 3VWUA 1A8LA 5KOWA 2IWTA 2J23A 4RQXA 1GP1A 3HVVA 2H6XA 3H4KA 2GLRA 4TN8A 5DAKA 3D6IA 3F4RA 4J2FA 4BVYA 3CSIA 5HR0A 1AW9A 2KHPA 4MP4A 4TXOB 7GSSA 1WJKA 4LMWA 4XTSA 4GQCA 2V41A 5JWRB 4PURA 5B7CA 5JWOB 4AJ6A 4ILFA 4TW5A 3FR3A 4HZ4A 5EPFA 2FA4A 4IP1A 4XRDA 3Q6OA 1J0FA 3NIVA 1Z3EA 2MMOA 3D21A 3HCZA 1QGVA 4QL7A 2KP2A 4WETA 5DCHA 3DYRA 1TI1A 1NSWA 3P7XA 3G7IA 2RM5A 4NMUA 2L4CA 3O6TA 1TOFA 3D4TA 3KD0A 1FB0A 3GH6A 3QAVA 2LNTA 3ZFBA 2H19A 3QAWA 2C0EA 1ZZYA 2MMZA 4MJEA 4GSNA 2LEGA 2LRNA 3RPPA 22GSA 1ZMAA 3E0UA 3LEFA 4XS1A 3APQA 3DXBA 2DLXA 1T4YA 1W4VA 1PX6A 2IPAA 1DUGA 3UVTA 4GF0A 1ACVA 4MF7A 1DBYA 4K6XA 2B7JA 4NV5A 4K7OA 3ZIVA 1MEKA 2R3XA 1UN2A 2WULA 5B6NA 3ZZXA 1SYRA 1FOHA 1XWBA 4Q5NA 3TJJA 2N5AA 2C0DA 3VURA 4F0BA 3GTUB 4GLTA 4XCSA 1BJXA 5B8BA 2V2GA 2B5EA 4Z2RA 1SKRB 1DE2A 1ON4A 3RAZA 4FIWA 1PRXA 1YEXA 6GSTA 2VCTA 4K7IA 4YH2A 3HZ8A 3ZVJD 1XWCA 1OYJA 4K2DA 2VUPA 1FVKA 2NTOA 1TXXA 3LYPA 4Q5FA 1T3BA 1A0FA 3ZYWA 3GL3A 1U3IA 3PGTA 4E8HA 3UBKA 1X5DA 1O8WA 1LBKA 1B9XC 3N9JA 5JWQB 3GIXA 2LV3A 1GSYA 1N8JA 3IPZA 4K0NA 5ECNB 2H72A 2VLVA 1OC9B 3Q19A 8GSSA 1XOAA 4LL4B 2M46A 4HS1A 4K0GA 4GCIA 2WS2A 1Z5YE 4YKFA 1YJ6A 3HXSA 5F8BA 4FYUA 5ECQB 4BPYA 3U6VA 5ECRB 2P0GA 2M72A 1WRYA 2GGTA 3CXGA 5G5EA 1FOVA 1XWKA 2MYGA 1B8XA 1SK1A 3KTBA 1V57A 1XZOA 5KN2A 2O7KA 4BL7B 5CO3A 1BX9A 3KEBA 5CRGA 4X43A 1Y25A 2WCIA 1BQ7A 1X5CA 4I2UA 3BBYA 4LMVA 3FYGA 1MD3A 1HNBA 4D73A 2O85A 3CRUA 4Z7XA 3VWVA 3AY8A 3LSZA 3L9SA 1YQ1A 1B9YC 4IVFA 2PU9C 4BA7A 1C72A 1PD21 4HZ2A 2RIIA 1GTUA 2PWJA 1SYXA 4GRFA 2HSYA 4GTUA 2CAQA 1GUKA 4Q5RA 3QD9A 1SENA 5J3RA 4OCFA 2EIRA 2HI7A 4TRXA 2OA7A 3DVXA 3M8NA 1WIKA 4ZBAA 4K9ZA 2OE0A 5IMZA 4BVXA 1M2DA 1WMJA 3L9VA 4IBPA 4LA1A 1FHEA 1JZWA 5IPHA 4EIPA 1CQHA 4G19A 5KN3A 5CP1A 4O5UA 2PMTA 4J57E 2HZEA 5E59A 2A2PA 2YPMA 2V6OA 2VIMA 5IMAA 2HSHA 3EINA 3FZ4A 3P90A 3HZ4A 1SK2A 5HFIA 1TU7A 3RBTA 2H6ZA 2K9FA 1B48A 4OCEA 1SK0A 4RQRA 1Z6MA 18GSA 5H5QA 5D9VA 2IIYA 1F9MA 3QDNA 1ZCPA 2KLXA 1XW6A 4MF6A 2CQ9A 4TR3A 1R5PA 4RI7A 3UMAA 1DSBA 4X4JA 1GUHA 3VI5A 2DMMA 2VCXA 2A4VA 3TB2A 1A24A 3J7Yk 4IKHA 1VF1A 4MJAA 4CDOA 2DJ3A 5FHIA 3LWAA 1SL1B 4TXOA 4CY6A 5ECHB 2HXKA 2YWMA 1YEPA 3KH9A 1GL8A 4WBRD 2DIYA 4ZILA 4OWYA 1JHBA 4HEA2 2H6YA 5IMFA 2YZHA 3DWVA 2R0PA 4NV2A 3ZRDA 2L5OA 5F0GA 2H71A 4L8EA 3IHGA 2EC4A 3LQ7A 5J9BA 2ALBA 2CX3A 3QFAC 4Z2UA 1F2EA 2O87A 3WGDA 1OE8A 1BG5A 1TRSA 1S3AA 1O8XA 1GSEA 1MDJA 1R4WA 2N5FA 4WXTA 1A23A 4O5RA 2AAWA 1FO5A 2YWOA 3RHCA 4N0ZA 4ZIJA 4GXZA 2F8AA 2B5YA 2K8SA 2L57A 5CRHA 3A3TA 4WR5A 2XPEA 3FZAA 1EOHA 3EMPA 4V2MA 4V1Ap 1XIYA 3IR4A 1JFUA 2R2JA 3ZIJA 6GSUA 2IJYA 4EDZA 1G6YA 4KB3A 1M9AA 2LS5A 5A5KA 2OJLA 3CSJA 2RUEA 2AYTA 2YJ7A 3LW9A 4KX4A 1M0UA 4K1FA 3ZFLA 1Y6EA 2R4VA 3APSA 4MMMA 4TR4A 4ZL8A 3GTUA 2I3YA 1WPIA 4HU7A 1U87A 2H0IA 5HR2A 1YDKA 1GH2A 3VI7A 5DCGA 3FR9A 2R0CA 3UOMA 4O7HA 5IM9A 3ZLPA 4TOPA 20GSA 3LGCA 5DJLA 3FZ5A 4G0IA 3HA9A 4RI6A 3IHQA 3IAS2 2E0QA 2V1MA 1H75A 4MPFA 6GSWA 1FW1A 2LRTA 1URMA 4LLRA 2JSZA 3TOTA 5F06A 4PTSA 2HZFA 1QQ2A 2C80A 3F8UA 2MBSA 2H1GA 1PQNA 3A2VA 2FNOA 4X0XA 5D9TA 4TR0A 4JR6A 3MYDA 4GSTA 4ICYA 2WFCA 2DJ1A 2H1DA 4HI7A 3LXZA 1T00A 4KDYA 5DBQA 2H0GA 3IC8A 2XBQA 5IMDA 1YF0A 2REMA 2LJRA 3TOUA 3NOFA 9GSSA 2F9SA 2VD1A 3K8NA 10GSA 2UZ8A 5IQYA 4ID0A 5G1KA 1Z6NA 3UBLA 3F0IA 4KCEA 2IMIA 2GDRA 1K0MA 2ZUPA 1JZOA 2DKHA 4XS4A 3M0FA 1VF4A 5H5RA 1YF1A 4MDCA 3EWLA 2JU5A 1A2LA 4TR1B 6GSVA 4TXVA 1YKAA 1O85A 5LCZA 3EE2A 3DIEA 4HOJA 4BL7A 5IIZA 1K0OA 1B4PA 3US3A 3IE3A 3LYKA 2O8VB 1ZYEA 2IFQB 1X5EA 3F4TA 4EE0A 2OACA 3VWWA 1HNAA 1XW5A 3WT1A 5BRTA 4PQHA 4Z2TA 4KCAA 4PGTA 4KSOA 5JCGA 3KH7A 1TU8A 3IV4A 3EYTA 5ECIB 3TGZA 5HR3A 1ZGNA 1GNEA 5G1LA 2H76A 1EV4A 4O32A 1O81A 5FWGA 4I2TA 3IC4A 4O5QA 1GSUA 4JU5A 3E3EA 1K0AA 4IJIA 4FYBA 5D9WA 1V2AA 5G5FA 4FO5A 2YV9A 2OE3A 1RQMA 5KOXA 3H1NA 1S3CA 3GURA 1SL2B 1I9DA 3HJPA 4ZB9A 2PVQA 3S9FA 12GSA 5HFGA 3UEMA 4MNNA 4K8MA 1KBNA 1TK0B 3VWXA 5B6MA 3TDGA 2PGTA 5ELGA 1X9MB 4NXIA 3BCKA 3GKKA 2H66A 4KA0A 1SJ6A 1QMVA 4MH3A 1NM3A 2YNXA 1PN9A 1GNWA 2IN3A 5H5SA 3NZNA 4J56E 3F4SA 4PUFC 1DE1A 3QFBC 3MAKA 1GSDA 4HDEA 2DJJA 4F0CA 5KEJA 1W89A 3UAPA 4HU9A 1K0DA 2E2MA 2GTUA 4WF5A 4OMVA 2O89A 3KGKA 2HSMA 2H1BA 11GSA 3D4MA 1NW2A 5D73A 2K18A 4DEJA 1ILOA 4GSSA 1O7UA 3D22A 1SJIA 3RPNA 3WGXA 2NPBA 2FWFA 1GWCA 2FLSA 3GV1A 3O3TA 4KGIA 5ECLB 4FYCA 2RLIA 2QSIA 3ZVJA 5DAKB 3GN3A 3GKNA 4ZBDA 3SBCA 4ZL7A 4N10A 4V1Ag 2HLSA 3D0ZA 5ECKB 4IQ1A 4PQ1A 5ECPB 1YZXA 1XFLA 2HT9A 1XCCA 1HYUA 3EVIA 6GSSA 5CREA 2CZ3A 1Z9HA 1U88A 1EP7A 1E6BA 2PERA 4JRRA 4WF4A 2GSSA 4L5OA 1XOBA 2VM2A 1EEJA 1EV9A 3P2AA 4IHUA 2RM6A 4EKZA 2L4QA 1OE7A 2B5XA 2ON7A 3ERFA 3GKMA 1FVJA 4ZBBA 1ZYNA 3QPMA 2AJQB 4OFTA 1CQGA 2LJAA 2H1AA 2CAIA 2X8CA 3TJKA 1NHYA 13GSA 4F2IA 3FZ9A 3KMNA 5DALB 2CT6A 1PMTA 4IS0A 1ZYQB 1M2AA 4KW6A 5J4UA 1SKSB 4WBJA 4CW9A 1KNGA 3GSSA 4CY8A 3MSZA 2WJUA 1SD9A 3GL5A 2CV4A 5DVBA 1WOUA 5LNKe 2C3NA 2I4AA 4CHSA 3EPTA 4G0KA 3VLNA 1V40A 3H8QA 5D8IA 1ST9A 2GT5A 3W8SA 4KSMA 3TJGA 4WEYA 1TRWA 1ZOFA 2DKIA 2WDUA 3GFKA 2HRNA 4POKA 1K0NA 4ULXA 3TUEA 1OC3A 1OKDA 3F6DA 1F37A 1IYHA 3QCPA 1ERWA 1GSFA 1UVZA 4K2XA 2A2RA 2NDOA 5EL8A 1K0BA 5ECOB 4ZB8A 2NVLA 3KP8A 2WZ9A 5L71A 2B7KA 2BTOT 2LQQA 2MZCA 2DMLA 1THXA 2J9HA 3ISOA 2GSRA 3TKSC 4L0WA 1O6JA 2PN8A 1X9SB 2FWHA 2C3TA 3G9BA 1QK8A 4RUVA 2HE3A 2PUKC 1HD2A 1OAZA 4X1UA 4K7NA 4EL1A 1GTIA 3IXRA 3C7MA 16GSA 2OBIA 1H4OA 3I43A 3LG6A 5CRDA 2GSTA 3IK9A 2C8UA 3APOA 2XC2A 2QGVA 5HR1A 1FB6A 3G7YA 4DVCA 2WB9A 3QAGA 2WRTA 1GRXA 5AIVA 4WKWA 1TP9A 5F07A 1J08A 4EF0A 4HQZA 4TR1A 3KCMA 1K3OA 1R5AA 5A4UA 2C0GA 3QOUA 3LXTA 3IA1A 2FD3A 2VCWA 3L0HA 4IJ3A 5AISA 4G10A 3VPQA 1ZYPA 4PNFA 4IGJA 2YZUA 4AF2A 1V58A 3EU3A 3F63A 5F05A 3QMXA 1Z7PA 1ERTA 2RUFA 3Q18A 3D5JA 2JSYA 2ZNMA 3GSTA 3VFIA 1GULA 1G6WA 5AGYA 3LORA 3DEXA 3PINA 1GSSA 4OFNA 2R5GA 5KN0A 1TKDB 5FT3A 2IFQA 5LD0A 1T4ZA 4XIHA 1Q98A 3LFLA 4ZXGA 4V2NA 3KMOA 2R37A 1AQWA 4D73B 2GT6A 4EXJA 4JEDA 1WE0A 2LRCA 3UL3A 5GAND 4K5SA 1T7PB 4XRAA 1U6TA 4ML6A 4EC0A 1SKWB 3FKFA 4GQFA 1PKWA 5CYYA 3GYKA 3L78A 2PVOC 3A5IA 4TVEA 3CTFA 3P8WA 4DSSB 2LJKA 2VLTA 3IAM2 4ECJA 4IP6A 2CZ2A 2JZTA 1IYIA 1YKCA 1LU4A 4YAVA 4YQVA 3FHKA 2L5LA 3HJOA 2YOIA 3BCIA 1M9BA 1KTEA 1O73A 4BVXB 1EWXA 2WGRA 4JR4A 2MBTA 4MLYA 4NAXA 3L4NA 3M1GA 5DQYA 5G2ZA 3OR5A 1SD8A 4EO3A 1VGLA 2G0FA 4HJ2A 3U5RE 3HKRA 2XPDA 1XVQA 3V1WA 1EEMA 5AIXA 5J5NA 2P5QA 3ZTLA 1GTBA 1MTCA 3WD6A 4KE3A 2L6DA 5EVOA 3M3MA 5GZZB 3TRXA 4ECCA 3FK8A 1A0RP 4USSA 3TCOA 1TTZA 3EC3A 3ZREA 3E9JB 3KIJA 4ML1A 4KDUA 1K3YA 1VF2A 2FWEA 4H86A 2X99A 1GUMA 1THOA 3EMXA 1S3DA 4KF9A 1FAAA 1OC9A 4FH8A 2KUCA 3DMLA 2K8VA 1N2AA 1NHOA 4DSRA 1ZL9A 2FA8A 3UARA 4MZCA 3KZQA 2LUSA 2FWGA 3KTLA 3HVXA 4MA9A 1BAYA 2QC7A 2L6CA 2B6MA 1PKZA 1A2JA 3O76A 3Q74A 3N5OA 2BJXA 5CRWA 4I6XA 1ML6A 3TRQA 4ISDA 3RHBA 4E8EA 2IL3A 5C00A 2VLUA 2VL2C 2FCHA 3F3RA 1A8YA 4PQIA 3FW2A 1SJZA 2I1UA 2IMEA 2ZCTA 1GLPA 2R6KA 2VM1A 2H75A 3M9KA 3ME8A 3TKPA 2CA8A 2GQKA 3KP9A 3R2QA 2VL2A 2TIRA 1EZKA 2KP1A 4AJ7A 5ENUA 5IMVA 3TJFA 5GSTA 5ID2B 2LTKA 2VAFA 4OFMA 2E2GA 3PH9A 4MF5A 14GSA 3IOSA 2LQOA 5IO0A 5CAXA 4MZBA 2GQLA 2GS3A 2C0FA 1GTAA 4BWSA 2YWNA 3G7JA 1UC7A 5DALA 2VCVA 3A2WA 1BEDA 3F9UA 2DJ2A 2VOCA 2YCDA 3TJBA 1V98A 3C1SA 4PNGA 2EIOA 5G30A 2N5BA 1K0CA 3A5WA 4YAPA 3VPTA 4EVMA 3J7Yb 1MD4A 4A5PA 4YKGA 3IRAA 1GLQA 3C73A 2HNLA 5J41A 5BMUA 3PR8A 4EIQA 5A4VA 3C8EA 2D2ZA 3TKQA 3KM6A 2V32A 1X9WB 3W8JA 3ZMKA 1XVWA 4G9HA 2HFDA 5D9XA 2A2SA 3DD3A 3CYNA 4Q5QA 3FY7A 2OBKA 2GQMA 5INYA 1R7HA 4HQSA 3BOAA 1U3AA 3TKSE 4FQUA 3HY2A 4MZWA 4ECIA 5EY6A 4I97A 3CRTA 1PSQA 2GSQA 5B8AA 2I9HA 1F3AA 4QQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A4H A;  2A2P A; 
#chains in the Genus database with same CATH topology
 3ERW A;  4IEL A;  2QKE A;  2AB6 A;  3SWL A;  4I8B A;  2FHE A;  3I6A A;  3W6G A;  3R3E A;  3WGE A;  2FGX A;  4MCU A;  1EOG A;  5IMC A;  3FR6 A;  4ECB A;  2H73 A;  2GZP A;  2CVD A;  5C04 A;  5IOW A;  4YQM A;  4GWR A;  4HUA A;  3L9U A;  4BWQ A;  4POL A;  2EIQ A;  2IMK A;  3CTG A;  5KN1 A;  3HYP A;  2VL3 A;  2GZZ A;  3KJY A;  1G7E A;  1PN0 A;  1EGO A;  2DIZ A;  4PX1 A;  3VK9 A;  2XHF A;  2ES7 A;  1V9W A;  2JAC A;  3C1R A;  2YWI A;  3TRP A;  4HJM A;  1HQO A;  4KAE A;  5IOX A;  3IBH A;  4BVY B;  1AQX A;  1ERU A;  4MAB A;  4N30 A;  2HRK A;  1M2B A;  5CNW A;  1PL1 A;  4MJC A;  3GUS A;  3JCM L;  2B1K A;  4XS4 B;  2C4J A;  3LJR A;  4NWY A;  2VCQ A;  4IW9 A;  2TRX A;  1AIU A;  2LST A;  2HYX A;  3HHV A;  1XWA A;  4AGS A;  5A4W A;  4KDX A;  2IMF A;  4NHZ A;  3QR6 A;  2LNS A;  4I5Q A;  4MPG A;  2TRC P;  3CBU A;  4G2E A;  2F3M A;  2GVP A;  1M7T A;  17GS A;  2E7P A;  2DSA A;  2CX4 A;  4YQU A;  2BMX A;  1JLW A;  3HVS A;  2AUV A;  2H70 A;  2FUG 2;  4OD7 A;  4EDY A;  1T8E B;  3ZML A;  1KEB A;  1PL2 A;  4ZL9 A;  4N0V A;  4NPB A;  1OKT A;  1AAZ A;  4F82 A;  1YY7 A;  2JZR A;  3WT2 A;  2HRA A;  6GSY A;  1T1V A;  2R0G A;  2VO4 A;  4XS6 A;  5DQS A;  3EU4 A;  1JZD A;  3MWH A;  4JZQ A;  4N11 A;  5DDL A;  4DSS A;  4L5L A;  1UA5 A;  1TW9 A;  5G31 A;  4ZB6 A;  1I5G A;  4JE1 A;  1X0R A;  3GX0 A;  1OC8 A;  5DJM A;  4NHW A;  2YAN A;  1Q4J A;  5ECM B;  1XW9 A;  1ERV A;  19GS A;  1OVN A;  4F03 A;  1HNC A;  2I81 A;  3DKS A;  2GZY A;  1VF3 A;  3GHA A;  1XBS A;  3F3Q A;  1PA3 A;  3MDK A;  2AHE A;  4V2L A;  2F8F A;  2HRF A;  2PBJ A;  1JLV A;  1TI3 A;  2G2Q A;  2X4A A;  2H74 A;  2H0H A;  1J9B A;  2H8L A;  2F51 A;  3BJ5 A;  2VL9 A;  1XXU A;  1AXD A;  4OO5 A;  1PX7 A;  2DJ0 A;  2K6V A;  1MDK A;  5J9C A;  2KOK A;  1XPV A;  2VCZ A;  3HD5 A;  1LJR A;  1TRU A;  3UJ1 A;  2YV7 A;  2X64 A;  3CMI A;  3DVW A;  3TKS A;  1SL0 B;  2QA2 A;  5ABR A;  2B3S A;  1MDI A;  1EP8 A;  2C1Y A;  3DRN A;  2MMA A;  2CVK A;  2XBI A;  3I9V 2;  3ZL5 A;  1QXH A;  3GH9 A;  2P5R A;  4TKY A;  3ZIT A;  3KXO A;  5E4W A;  4PUA A;  4L0U A;  3MNG A;  1TJD A;  3ME7 A;  2DJK A;  5IPG A;  1SU9 A;  3CSH A;  3GRX A;  2JAD A;  5GAP D;  3FRC A;  1ABA A;  3A2X A;  3H79 A;  1AUC A;  1K3L A;  4KH7 A;  5AN1 A;  4O92 A;  2OKA A;  3H93 A;  3RDW A;  1TRV A;  4AJ8 A;  2DBC A;  2LKU A;  2X49 A;  4IQA A;  1M99 A;  1QUW A;  1TK5 B;  3FEU A;  1PGT A;  4QL9 A;  4MK3 A;  1A2M A;  1RK4 A;  5COH A;  3F6F A;  1GSQ A;  5IO2 A;  3GNJ A;  3PPU A;  5ID2 A;  5GSS A;  4XHM A;  2C3Q A;  2JZS A;  3UIW A;  3DGQ A;  2MMN A;  1E2Y A;  1VRS D;  1QFN A;  2OE1 A;  2H30 A;  3HDC A;  1Z7R A;  2H01 A;  5HQP A;  3GKX A;  3GMF A;  1TK8 B;  2M80 A;  3GA4 A;  1F3B A;  4IN0 A;  3M9J A;  3ED3 A;  3WYW A;  4LL1 B;  3HJM A;  2IMD A;  1XWG A;  2VD0 A;  3MIX A;  3UVH A;  4P3Y B;  4WR4 A;  1USB A;  2JL4 A;  5HFK A;  4POB A;  2X8H A;  1JZR A;  5D96 A;  2AV4 A;  4KUN A;  1R26 A;  5JCW A;  1G0T A;  2B1L A;  3I69 A;  2CVB A;  2A4H A;  5ECS A;  4PXO A;  2X8G A;  2NBS A;  1BYE A;  1F6M C;  4HSC X;  2DC5 A;  2P31 A;  4OO4 A;  1FG4 A;  4DSQ A;  3ERG A;  4K5R A;  3EUR A;  3IK7 A;  5ELA A;  1AQV A;  1RW1 A;  2HZE B;  1AC1 A;  4JBB A;  4EUY A;  1G7O A;  3IDV A;  2PPT A;  2OAD A;  2YJH A;  2YP6 A;  4F9Z A;  4MH2 A;  3TKR A;  4G0L A;  2ON5 A;  4ACS A;  1B4Q A;  5D93 A;  3FMW A;  4POM A;  1WP0 A;  2QA1 A;  3GX8 A;  3C71 A;  5JCU A;  2YN1 A;  6GSX A;  3BD2 A;  1WWJ A;  2V6K A;  2Z9S A;  1TDI A;  1EGR A;  2L59 A;  2FY6 A;  4MJB A;  4KND A;  3VWU A;  1A8L A;  5KOW A;  2IWT A;  2J23 A;  4RQX A;  1GP1 A;  3HVV A;  2H6X A;  3H4K A;  2GLR A;  4TN8 A;  5DAK A;  3D6I A;  3F4R A;  4J2F A;  4BVY A;  3CSI A;  5HR0 A;  1AW9 A;  2KHP A;  4MP4 A;  4TXO B;  7GSS A;  1WJK A;  4LMW A;  4XTS A;  4GQC A;  2V41 A;  5JWR B;  4PUR A;  5B7C A;  5JWO B;  4AJ6 A;  4ILF A;  4TW5 A;  3FR3 A;  4HZ4 A;  5EPF A;  2FA4 A;  4IP1 A;  4XRD A;  3Q6O A;  1J0F A;  3NIV A;  1Z3E A;  2MMO A;  3D21 A;  3HCZ A;  1QGV A;  4QL7 A;  2KP2 A;  4WET A;  5DCH A;  3DYR A;  1TI1 A;  1NSW A;  3P7X A;  3G7I A;  2RM5 A;  4NMU A;  2L4C A;  3O6T A;  1TOF A;  4BIK A;  3D4T A;  3KD0 A;  1FB0 A;  3GH6 A;  3QAV A;  2LNT A;  3ZFB A;  2H19 A;  3QAW A;  2C0E A;  1ZZY A;  2MMZ A;  4MJE A;  4GSN A;  2LEG A;  2LRN A;  3RPP A;  22GS A;  1ZMA A;  3E0U A;  3LEF A;  4XS1 A;  3APQ A;  3DXB A;  2DLX A;  1T4Y A;  1W4V A;  1PX6 A;  2IPA A;  1DUG A;  3UVT A;  4GF0 A;  1ACV A;  4MF7 A;  1DBY A;  4K6X A;  2B7J A;  4NV5 A;  4K7O A;  3ZIV A;  1MEK A;  2R3X A;  1UN2 A;  2WUL A;  5B6N A;  3ZZX A;  1SYR A;  1FOH A;  1XWB A;  4Q5N A;  3TJJ A;  2N5A A;  2C0D A;  3VUR A;  4F0B A;  3GTU B;  4GLT A;  4XCS A;  1BJX A;  5B8B A;  2V2G A;  2B5E A;  4Z2R A;  1SKR B;  1DE2 A;  1ON4 A;  3RAZ A;  4FIW A;  1PRX A;  1YEX A;  6GST A;  2VCT A;  4K7I A;  4YH2 A;  3HZ8 A;  3ZVJ D;  1XWC A;  1OYJ A;  4K2D A;  2VUP A;  1FVK A;  2NTO A;  1TXX A;  3LYP A;  4Q5F A;  1T3B A;  1A0F A;  3ZYW A;  3GL3 A;  1U3I A;  3PGT A;  4E8H A;  3UBK A;  1X5D A;  1O8W A;  1LBK A;  1B9X C;  3N9J A;  5JWQ B;  3GIX A;  2LV3 A;  1GSY A;  1N8J A;  3IPZ A;  4K0N A;  5ECN B;  2H72 A;  2VLV A;  1OC9 B;  3Q19 A;  8GSS A;  1XOA A;  4LL4 B;  2M46 A;  4HS1 A;  4K0G A;  4GCI A;  2WS2 A;  1Z5Y E;  4YKF A;  1YJ6 A;  3HXS A;  5F8B A;  4FYU A;  5ECQ B;  4BPY A;  3U6V A;  5ECR B;  2P0G A;  2M72 A;  1WRY A;  2GGT A;  3CXG A;  5G5E A;  1FOV A;  1XWK A;  2MYG A;  1B8X A;  1SK1 A;  3KTB A;  1V57 A;  1XZO A;  5KN2 A;  2O7K A;  4BL7 B;  5CO3 A;  1BX9 A;  3KEB A;  5CRG A;  4X43 A;  1Y25 A;  2WCI A;  1BQ7 A;  1X5C A;  4I2U A;  3BBY A;  4LMV A;  3FYG A;  1MD3 A;  1HNB A;  4D73 A;  2O85 A;  3CRU A;  4Z7X A;  3VWV A;  3AY8 A;  3LSZ A;  3L9S A;  1YQ1 A;  1B9Y C;  4IVF A;  2PU9 C;  4BA7 A;  1C72 A;  1PD2 1;  4HZ2 A;  2RII A;  1GTU A;  2PWJ A;  1SYX A;  4GRF A;  2HSY A;  4GTU A;  2CAQ A;  1GUK A;  4Q5R A;  3QD9 A;  1SEN A;  5J3R A;  4OCF A;  2EIR A;  2HI7 A;  4TRX A;  2OA7 A;  3DVX A;  3M8N A;  1WIK A;  4ZBA A;  4K9Z A;  2OE0 A;  5IMZ A;  4BVX A;  1M2D A;  1WMJ A;  3L9V A;  4IBP A;  4LA1 A;  1FHE A;  1JZW A;  5IPH A;  4EIP A;  1CQH A;  4G19 A;  5KN3 A;  5CP1 A;  4O5U A;  2PMT A;  4J57 E;  2HZE A;  5E59 A;  2A2P A;  2YPM A;  2V6O A;  2VIM A;  5IMA A;  2HSH A;  3EIN A;  3FZ4 A;  3P90 A;  3HZ4 A;  1SK2 A;  5HFI A;  1TU7 A;  3RBT A;  2H6Z A;  2K9F A;  1B48 A;  4OCE A;  1SK0 A;  4RQR A;  1Z6M A;  18GS A;  5H5Q A;  5D9V A;  2IIY A;  1F9M A;  3QDN A;  1ZCP A;  2KLX A;  1XW6 A;  4MF6 A;  2CQ9 A;  4TR3 A;  1R5P A;  4RI7 A;  3UMA A;  1DSB A;  4X4J A;  1GUH A;  3VI5 A;  2DMM A;  2VCX A;  2A4V A;  3TB2 A;  1A24 A;  3J7Y k;  4IKH A;  1VF1 A;  4MJA A;  4CDO A;  2DJ3 A;  5FHI A;  3LWA A;  1SL1 B;  4TXO A;  4CY6 A;  5ECH B;  2HXK A;  2YWM A;  1YEP A;  3KH9 A;  1GL8 A;  4WBR D;  2DIY A;  4ZIL A;  4OWY A;  1JHB A;  4HEA 2;  2H6Y A;  5IMF A;  2YZH A;  3DWV A;  2R0P A;  4NV2 A;  3ZRD A;  1XG8 A;  2L5O A;  5F0G A;  2H71 A;  4L8E A;  3IHG A;  2EC4 A;  3LQ7 A;  5J9B A;  2ALB A;  2CX3 A;  3QFA C;  4Z2U A;  1F2E A;  2O87 A;  3WGD A;  1OE8 A;  1BG5 A;  1TRS A;  1S3A A;  1O8X A;  1GSE A;  1MDJ A;  1R4W A;  2N5F A;  4WXT A;  1A23 A;  4O5R A;  2AAW A;  1FO5 A;  2YWO A;  3RHC A;  4N0Z A;  4ZIJ A;  4GXZ A;  2F8A A;  2B5Y A;  2K8S A;  2L57 A;  5CRH A;  3A3T A;  4WR5 A;  2XPE A;  3FZA A;  1EOH A;  3EMP A;  4V2M A;  4V1A p;  1XIY A;  3IR4 A;  1JFU A;  2R2J A;  3ZIJ A;  6GSU A;  2IJY A;  4EDZ A;  1G6Y A;  4KB3 A;  1M9A A;  2LS5 A;  5A5K A;  2OJL A;  3CSJ A;  2RUE A;  2AYT A;  2YJ7 A;  3LW9 A;  4KX4 A;  1M0U A;  4K1F A;  3ZFL A;  1Y6E A;  2R4V A;  3APS A;  4MMM A;  4TR4 A;  4ZL8 A;  3GTU A;  2I3Y A;  1WPI A;  4HU7 A;  1U87 A;  2H0I A;  5HR2 A;  1YDK A;  1GH2 A;  3VI7 A;  5DCG A;  3FR9 A;  2R0C A;  3UOM A;  4O7H A;  5IM9 A;  3ZLP A;  4TOP A;  20GS A;  3LGC A;  5DJL A;  3FZ5 A;  4G0I A;  3HA9 A;  4RI6 A;  3IHQ A;  3IAS 2;  2E0Q A;  2V1M A;  1H75 A;  4MPF A;  6GSW A;  1FW1 A;  2LRT A;  1URM A;  4LLR A;  2JSZ A;  3TOT A;  5F06 A;  4PTS A;  2HZF A;  1QQ2 A;  2C80 A;  3F8U A;  2MBS A;  2H1G A;  1PQN A;  3A2V A;  2FNO A;  4X0X A;  5D9T A;  4TR0 A;  4JR6 A;  3MYD A;  4GST A;  4ICY A;  2WFC A;  2DJ1 A;  2H1D A;  4HI7 A;  3LXZ A;  1T00 A;  4KDY A;  5DBQ A;  2H0G A;  3IC8 A;  2XBQ A;  5IMD A;  1YF0 A;  2REM A;  2LJR A;  3TOU A;  3NOF A;  9GSS A;  2F9S A;  2VD1 A;  3K8N A;  10GS A;  2UZ8 A;  5IQY A;  4ID0 A;  5G1K A;  1Z6N A;  3UBL A;  3F0I A;  4KCE A;  2IMI A;  2GDR A;  1K0M A;  2ZUP A;  1JZO A;  2DKH A;  4XS4 A;  3M0F A;  1VF4 A;  5H5R A;  1YF1 A;  4MDC A;  3EWL A;  2JU5 A;  1A2L A;  4TR1 B;  6GSV A;  4TXV A;  1YKA A;  1O85 A;  5LCZ A;  3EE2 A;  3DIE A;  4HOJ A;  4BL7 A;  5IIZ A;  1K0O A;  1B4P A;  1M3J A;  3US3 A;  3IE3 A;  3LYK A;  2O8V B;  1ZYE A;  2IFQ B;  1X5E A;  3F4T A;  4EE0 A;  2OAC A;  3VWW A;  1HNA A;  1XW5 A;  3WT1 A;  5BRT A;  4PQH A;  4Z2T A;  4KCA A;  4PGT A;  4KSO A;  5JCG A;  3KH7 A;  1TU8 A;  3IV4 A;  3EYT A;  5ECI B;  3TGZ A;  5HR3 A;  1ZGN A;  1GNE A;  5G1L A;  2H76 A;  1EV4 A;  4O32 A;  1O81 A;  5FWG A;  4I2T A;  3IC4 A;  4O5Q A;  1GSU A;  4JU5 A;  3E3E A;  1K0A A;  4IJI A;  4FYB A;  5D9W A;  1V2A A;  5G5F A;  4FO5 A;  2YV9 A;  2OE3 A;  1RQM A;  5KOX A;  3H1N A;  1S3C A;  3GUR A;  1SL2 B;  1I9D A;  3HJP A;  4ZB9 A;  2PVQ A;  3S9F A;  12GS A;  5HFG A;  3UEM A;  4MNN A;  4K8M A;  1KBN A;  1TK0 B;  3VWX A;  5B6M A;  3TDG A;  2PGT A;  5ELG A;  1X9M B;  4NXI A;  3BCK A;  3GKK A;  2H66 A;  4KA0 A;  1SJ6 A;  1QMV A;  4MH3 A;  1NM3 A;  2YNX A;  1PN9 A;  1GNW A;  2IN3 A;  5H5S A;  3NZN A;  4J56 E;  3F4S A;  4PUF C;  1DE1 A;  3QFB C;  3MAK A;  1GSD A;  4HDE A;  2DJJ A;  4F0C A;  5KEJ A;  1W89 A;  3UAP A;  4HU9 A;  1K0D A;  2E2M A;  2GTU A;  4WF5 A;  4OMV A;  2O89 A;  3KGK A;  2HSM A;  2H1B A;  11GS A;  3D4M A;  1NW2 A;  5D73 A;  2K18 A;  4DEJ A;  1ILO A;  4GSS A;  1O7U A;  3D22 A;  1SJI A;  3RPN A;  3WGX A;  2NPB A;  2FWF A;  1GWC A;  2FLS A;  3GV1 A;  3O3T A;  4KGI A;  5ECL B;  4FYC A;  2RLI A;  2QSI A;  3ZVJ A;  5DAK B;  3GN3 A;  3GKN A;  4ZBD A;  3SBC A;  4ZL7 A;  4N10 A;  4V1A g;  2HLS A;  3D0Z A;  5ECK B;  4IQ1 A;  4PQ1 A;  5ECP B;  1YZX A;  1XFL A;  2HT9 A;  1XCC A;  1HYU A;  3EVI A;  6GSS A;  5CRE A;  2CZ3 A;  1Z9H A;  1U88 A;  1EP7 A;  1E6B A;  2PER A;  4JRR A;  4WF4 A;  2GSS A;  4L5O A;  1XOB A;  2VM2 A;  1EEJ A;  1EV9 A;  3P2A A;  4IHU A;  2RM6 A;  4EKZ A;  2L4Q A;  1OE7 A;  2B5X A;  2ON7 A;  3ERF A;  3GKM A;  1FVJ A;  4ZBB A;  1ZYN A;  3QPM A;  2AJQ B;  4OFT A;  1CQG A;  2LJA A;  2H1A A;  2CAI A;  2X8C A;  3TJK A;  1NHY A;  13GS A;  4F2I A;  3FZ9 A;  3KMN A;  5DAL B;  2CT6 A;  1PMT A;  4IS0 A;  1ZYQ B;  1M2A A;  4KW6 A;  5J4U A;  1SKS B;  4WBJ A;  4CW9 A;  1KNG A;  3GSS A;  4CY8 A;  3MSZ A;  2WJU A;  1SD9 A;  3GL5 A;  2CV4 A;  5DVB A;  1WOU A;  5LNK e;  2C3N A;  2I4A A;  4CHS A;  3EPT A;  4G0K A;  3VLN A;  1V40 A;  3H8Q A;  5D8I A;  1ST9 A;  2GT5 A;  3W8S A;  4KSM A;  3TJG A;  4WEY A;  1TRW A;  1ZOF A;  2DKI A;  2WDU A;  3GFK A;  2HRN A;  4POK A;  1K0N A;  4ULX A;  3TUE A;  1S3R A;  1OC3 A;  1OKD A;  3F6D A;  1F37 A;  1IYH A;  3QCP A;  1ERW A;  1GSF A;  1UVZ A;  4K2X A;  2A2R A;  2NDO A;  5EL8 A;  1K0B A;  5ECO B;  4ZB8 A;  2NVL A;  3KP8 A;  2WZ9 A;  5L71 A;  2B7K A;  2BTO T;  2LQQ A;  2MZC A;  2DML A;  1THX A;  2J9H A;  3ISO A;  2GSR A;  3TKS C;  4L0W A;  1O6J A;  2PN8 A;  1X9S B;  2FWH A;  2C3T A;  3G9B A;  1QK8 A;  4RUV A;  2HE3 A;  2PUK C;  1HD2 A;  1OAZ A;  4X1U A;  4K7N A;  4EL1 A;  1GTI A;  3IXR A;  3C7M A;  16GS A;  2OBI A;  1H4O A;  3I43 A;  3LG6 A;  5CRD A;  2GST A;  3IK9 A;  2C8U A;  3APO A;  2XC2 A;  2QGV A;  5HR1 A;  1FB6 A;  3G7Y A;  4DVC A;  2WB9 A;  3QAG A;  2WRT A;  1GRX A;  5AIV A;  4WKW A;  1TP9 A;  5F07 A;  1J08 A;  4EF0 A;  4HQZ A;  4TR1 A;  3KCM A;  1K3O A;  1R5A A;  5A4U A;  2C0G A;  3QOU A;  3LXT A;  3IA1 A;  2FD3 A;  2VCW A;  3L0H A;  4IJ3 A;  5AIS A;  4G10 A;  3VPQ A;  1ZYP A;  4PNF A;  4IGJ A;  2YZU A;  4AF2 A;  1V58 A;  3EU3 A;  3HVN A;  3F63 A;  5F05 A;  3QMX A;  1Z7P A;  1ERT A;  2RUF A;  3Q18 A;  3D5J A;  2JSY A;  2ZNM A;  3GST A;  3VFI A;  1GUL A;  1G6W A;  5AGY A;  3LOR A;  3DEX A;  3PIN A;  1GSS A;  4OFN A;  2R5G A;  5KN0 A;  1TKD B;  5FT3 A;  2IFQ A;  5LD0 A;  1T4Z A;  4XIH A;  1Q98 A;  3LFL A;  4ZXG A;  4V2N A;  3KMO A;  2R37 A;  1AQW A;  4D73 B;  2GT6 A;  4EXJ A;  4JED A;  1WE0 A;  2LRC A;  3UL3 A;  5GAN D;  4K5S A;  1T7P B;  4XRA A;  1U6T A;  4ML6 A;  4EC0 A;  1SKW B;  3FKF A;  4GQF A;  1PKW A;  5CYY A;  3GYK A;  3L78 A;  2PVO C;  3A5I A;  4TVE A;  3CTF A;  3P8W A;  4DSS B;  2LJK A;  2VLT A;  3IAM 2;  4ECJ A;  4IP6 A;  2CZ2 A;  2JZT A;  1IYI A;  1YKC A;  1LU4 A;  4YAV A;  4YQV A;  3FHK A;  2L5L A;  3HJO A;  2YOI A;  3BCI A;  1M9B A;  1KTE A;  1O73 A;  4BVX B;  1EWX A;  2WGR A;  4JR4 A;  2MBT A;  4MLY A;  4NAX A;  3L4N A;  3M1G A;  5DQY A;  5G2Z A;  3OR5 A;  1SD8 A;  4EO3 A;  1VGL A;  2G0F A;  4HJ2 A;  3U5R E;  3HKR A;  2XPD A;  1XVQ A;  3V1W A;  1EEM A;  5AIX A;  5J5N A;  2P5Q A;  3ZTL A;  1GTB A;  1MTC A;  3WD6 A;  4KE3 A;  2L6D A;  5EVO A;  3M3M A;  5GZZ B;  3TRX A;  4ECC A;  3FK8 A;  1A0R P;  4USS A;  3TCO A;  1TTZ A;  3EC3 A;  3ZRE A;  3E9J B;  3KIJ A;  4ML1 A;  4KDU A;  1K3Y A;  1VF2 A;  2FWE A;  4H86 A;  2X99 A;  1GUM A;  1THO A;  3EMX A;  1S3D A;  4KF9 A;  1FAA A;  1OC9 A;  4FH8 A;  2KUC A;  3DML A;  2K8V A;  1N2A A;  1NHO A;  4DSR A;  1ZL9 A;  2FA8 A;  3UAR A;  4MZC A;  3KZQ A;  2LUS A;  2FWG A;  3KTL A;  3HVX A;  4MA9 A;  1BAY A;  2QC7 A;  2L6C A;  2B6M A;  1PKZ A;  1A2J A;  3O76 A;  3Q74 A;  3N5O A;  1PFO A;  2BJX A;  5CRW A;  4I6X A;  1ML6 A;  3TRQ A;  4ISD A;  3RHB A;  4E8E A;  2IL3 A;  5C00 A;  2VLU A;  2VL2 C;  2FCH A;  3F3R A;  1A8Y A;  4PQI A;  3FW2 A;  1SJZ A;  2I1U A;  2IME A;  2ZCT A;  1GLP A;  2R6K A;  2VM1 A;  2H75 A;  3M9K A;  3ME8 A;  3TKP A;  2CA8 A;  2GQK A;  3KP9 A;  3R2Q A;  2VL2 A;  2TIR A;  1EZK A;  2KP1 A;  4AJ7 A;  5ENU A;  5IMV A;  3TJF A;  5GST A;  5ID2 B;  2LTK A;  2VAF A;  4OFM A;  2E2G A;  3PH9 A;  4MF5 A;  14GS A;  3IOS A;  2LQO A;  5IO0 A;  5CAX A;  4MZB A;  2GQL A;  2GS3 A;  2C0F A;  1GTA A;  4BWS A;  2YWN A;  3G7J A;  1UC7 A;  5DAL A;  2VCV A;  3A2W A;  1BED A;  3F9U A;  2DJ2 A;  2VOC A;  2YCD A;  3TJB A;  1V98 A;  3C1S A;  4PNG A;  2EIO A;  5G30 A;  2N5B A;  1K0C A;  3A5W A;  4YAP A;  3VPT A;  4EVM A;  3J7Y b;  1MD4 A;  4A5P A;  4YKG A;  3IRA A;  1GLQ A;  3C73 A;  2HNL A;  5J41 A;  5BMU A;  3PR8 A;  4EIQ A;  5A4V A;  3C8E A;  2D2Z A;  3TKQ A;  3KM6 A;  2V32 A;  1X9W B;  3W8J A;  3ZMK A;  1XVW A;  4G9H A;  3CQF A;  2HFD A;  5D9X A;  2A2S A;  3DD3 A;  3CYN A;  4Q5Q A;  3FY7 A;  2OBK A;  2GQM A;  5INY A;  1R7H A;  4HQS A;  3BOA A;  1U3A A;  3TKS E;  4FQU A;  3HY2 A;  4MZW A;  1M3I A;  4ECI A;  5EY6 A;  4I97 A;  3CRT A;  1PSQ A;  2GSQ A;  5B8A A;  2I9H A;  1F3A A;  4QQ7 A; 
#chains in the Genus database with same CATH homology
 3ERW A;  4IEL A;  2QKE A;  2AB6 A;  3SWL A;  4I8B A;  2FHE A;  3I6A A;  3W6G A;  3R3E A;  3WGE A;  2FGX A;  4MCU A;  1EOG A;  5IMC A;  3FR6 A;  4ECB A;  2H73 A;  2GZP A;  2CVD A;  5C04 A;  5IOW A;  4YQM A;  4GWR A;  4HUA A;  3L9U A;  4BWQ A;  4POL A;  2EIQ A;  2IMK A;  3CTG A;  5KN1 A;  3HYP A;  2VL3 A;  2GZZ A;  3KJY A;  1G7E A;  1PN0 A;  1EGO A;  2DIZ A;  4PX1 A;  3VK9 A;  2XHF A;  2ES7 A;  1V9W A;  2JAC A;  3C1R A;  2YWI A;  3TRP A;  4HJM A;  1HQO A;  4KAE A;  5IOX A;  3IBH A;  4BVY B;  1AQX A;  1ERU A;  4MAB A;  4N30 A;  2HRK A;  1M2B A;  5CNW A;  1PL1 A;  4MJC A;  3GUS A;  3JCM L;  2B1K A;  4XS4 B;  2C4J A;  3LJR A;  4NWY A;  2VCQ A;  4IW9 A;  2TRX A;  1AIU A;  2LST A;  2HYX A;  3HHV A;  1XWA A;  4AGS A;  5A4W A;  4KDX A;  2IMF A;  4NHZ A;  3QR6 A;  2LNS A;  4I5Q A;  4MPG A;  2TRC P;  3CBU A;  4G2E A;  2F3M A;  2GVP A;  1M7T A;  17GS A;  2E7P A;  2DSA A;  2CX4 A;  4YQU A;  2BMX A;  1JLW A;  3HVS A;  2AUV A;  2H70 A;  2FUG 2;  4OD7 A;  4EDY A;  1T8E B;  3ZML A;  1KEB A;  1PL2 A;  4ZL9 A;  4N0V A;  4NPB A;  1OKT A;  1AAZ A;  4F82 A;  1YY7 A;  2JZR A;  3WT2 A;  2HRA A;  6GSY A;  1T1V A;  2R0G A;  2VO4 A;  4XS6 A;  5DQS A;  3EU4 A;  1JZD A;  3MWH A;  4JZQ A;  4N11 A;  5DDL A;  4DSS A;  4L5L A;  1UA5 A;  1TW9 A;  5G31 A;  4ZB6 A;  1I5G A;  4JE1 A;  1X0R A;  3GX0 A;  1OC8 A;  5DJM A;  4NHW A;  2YAN A;  1Q4J A;  5ECM B;  1XW9 A;  1ERV A;  19GS A;  1OVN A;  4F03 A;  1HNC A;  2I81 A;  3DKS A;  2GZY A;  1VF3 A;  3GHA A;  1XBS A;  3F3Q A;  1PA3 A;  3MDK A;  2AHE A;  4V2L A;  2F8F A;  2HRF A;  2PBJ A;  1JLV A;  1TI3 A;  2G2Q A;  2X4A A;  2H74 A;  2H0H A;  1J9B A;  2H8L A;  2F51 A;  3BJ5 A;  2VL9 A;  1XXU A;  1AXD A;  4OO5 A;  1PX7 A;  2DJ0 A;  2K6V A;  1MDK A;  5J9C A;  2KOK A;  1XPV A;  2VCZ A;  3HD5 A;  1LJR A;  1TRU A;  3UJ1 A;  2YV7 A;  2X64 A;  3CMI A;  3DVW A;  3TKS A;  1SL0 B;  2QA2 A;  5ABR A;  2B3S A;  1MDI A;  1EP8 A;  2C1Y A;  3DRN A;  2MMA A;  2CVK A;  2XBI A;  3I9V 2;  3ZL5 A;  1QXH A;  3GH9 A;  2P5R A;  4TKY A;  3ZIT A;  3KXO A;  5E4W A;  4PUA A;  4L0U A;  3MNG A;  1TJD A;  3ME7 A;  2DJK A;  5IPG A;  1SU9 A;  3CSH A;  3GRX A;  2JAD A;  5GAP D;  3FRC A;  1ABA A;  3A2X A;  3H79 A;  1AUC A;  1K3L A;  4KH7 A;  5AN1 A;  4O92 A;  2OKA A;  3H93 A;  3RDW A;  1TRV A;  4AJ8 A;  2DBC A;  2LKU A;  2X49 A;  4IQA A;  1M99 A;  1QUW A;  1TK5 B;  3FEU A;  1PGT A;  4QL9 A;  4MK3 A;  1A2M A;  1RK4 A;  5COH A;  3F6F A;  1GSQ A;  5IO2 A;  3GNJ A;  3PPU A;  5ID2 A;  5GSS A;  4XHM A;  2C3Q A;  2JZS A;  3UIW A;  3DGQ A;  2MMN A;  1E2Y A;  1VRS D;  1QFN A;  2OE1 A;  2H30 A;  3HDC A;  1Z7R A;  2H01 A;  5HQP A;  3GKX A;  3GMF A;  1TK8 B;  2M80 A;  3GA4 A;  1F3B A;  4IN0 A;  3M9J A;  3ED3 A;  3WYW A;  4LL1 B;  3HJM A;  2IMD A;  1XWG A;  2VD0 A;  3MIX A;  3UVH A;  4P3Y B;  4WR4 A;  1USB A;  2JL4 A;  5HFK A;  4POB A;  2X8H A;  1JZR A;  5D96 A;  2AV4 A;  4KUN A;  1R26 A;  5JCW A;  1G0T A;  2B1L A;  3I69 A;  2CVB A;  2A4H A;  5ECS A;  4PXO A;  2X8G A;  2NBS A;  1BYE A;  1F6M C;  2DC5 A;  2P31 A;  4OO4 A;  1FG4 A;  4DSQ A;  3ERG A;  4K5R A;  3EUR A;  3IK7 A;  5ELA A;  1AQV A;  1RW1 A;  2HZE B;  1AC1 A;  4JBB A;  4EUY A;  1G7O A;  3IDV A;  2PPT A;  2OAD A;  2YJH A;  2YP6 A;  4F9Z A;  4MH2 A;  3TKR A;  4G0L A;  2ON5 A;  4ACS A;  1B4Q A;  5D93 A;  3FMW A;  4POM A;  1WP0 A;  2QA1 A;  3GX8 A;  3C71 A;  5JCU A;  2YN1 A;  6GSX A;  3BD2 A;  1WWJ A;  2V6K A;  2Z9S A;  1TDI A;  1EGR A;  2L59 A;  2FY6 A;  4MJB A;  4KND A;  3VWU A;  1A8L A;  5KOW A;  2IWT A;  2J23 A;  4RQX A;  1GP1 A;  3HVV A;  2H6X A;  3H4K A;  2GLR A;  4TN8 A;  5DAK A;  3D6I A;  3F4R A;  4J2F A;  4BVY A;  3CSI A;  5HR0 A;  1AW9 A;  2KHP A;  4MP4 A;  4TXO B;  7GSS A;  1WJK A;  4LMW A;  4XTS A;  4GQC A;  2V41 A;  5JWR B;  4PUR A;  5B7C A;  5JWO B;  4AJ6 A;  4ILF A;  4TW5 A;  3FR3 A;  4HZ4 A;  5EPF A;  2FA4 A;  4IP1 A;  4XRD A;  3Q6O A;  1J0F A;  3NIV A;  1Z3E A;  2MMO A;  3D21 A;  3HCZ A;  1QGV A;  4QL7 A;  2KP2 A;  4WET A;  5DCH A;  3DYR A;  1TI1 A;  1NSW A;  3P7X A;  3G7I A;  2RM5 A;  4NMU A;  2L4C A;  3O6T A;  1TOF A;  3D4T A;  3KD0 A;  1FB0 A;  3GH6 A;  3QAV A;  2LNT A;  3ZFB A;  2H19 A;  3QAW A;  2C0E A;  1ZZY A;  2MMZ A;  4MJE A;  4GSN A;  2LEG A;  2LRN A;  3RPP A;  22GS A;  1ZMA A;  3E0U A;  3LEF A;  4XS1 A;  3APQ A;  3DXB A;  2DLX A;  1T4Y A;  1W4V A;  1PX6 A;  2IPA A;  1DUG A;  3UVT A;  4GF0 A;  1ACV A;  4MF7 A;  1DBY A;  4K6X A;  2B7J A;  4NV5 A;  4K7O A;  3ZIV A;  1MEK A;  2R3X A;  1UN2 A;  2WUL A;  5B6N A;  3ZZX A;  1SYR A;  1FOH A;  1XWB A;  4Q5N A;  3TJJ A;  2N5A A;  2C0D A;  3VUR A;  4F0B A;  3GTU B;  4GLT A;  4XCS A;  1BJX A;  5B8B A;  2V2G A;  2B5E A;  4Z2R A;  1SKR B;  1DE2 A;  1ON4 A;  3RAZ A;  4FIW A;  1PRX A;  1YEX A;  6GST A;  2VCT A;  4K7I A;  4YH2 A;  3HZ8 A;  3ZVJ D;  1XWC A;  1OYJ A;  4K2D A;  2VUP A;  1FVK A;  2NTO A;  1TXX A;  3LYP A;  4Q5F A;  1T3B A;  1A0F A;  3ZYW A;  3GL3 A;  1U3I A;  3PGT A;  4E8H A;  3UBK A;  1X5D A;  1O8W A;  1LBK A;  1B9X C;  3N9J A;  5JWQ B;  3GIX A;  2LV3 A;  1GSY A;  1N8J A;  3IPZ A;  4K0N A;  5ECN B;  2H72 A;  2VLV A;  1OC9 B;  3Q19 A;  8GSS A;  1XOA A;  4LL4 B;  2M46 A;  4HS1 A;  4K0G A;  4GCI A;  2WS2 A;  1Z5Y E;  4YKF A;  1YJ6 A;  3HXS A;  5F8B A;  4FYU A;  5ECQ B;  4BPY A;  3U6V A;  5ECR B;  2P0G A;  2M72 A;  1WRY A;  2GGT A;  3CXG A;  5G5E A;  1FOV A;  1XWK A;  2MYG A;  1B8X A;  1SK1 A;  3KTB A;  1V57 A;  1XZO A;  5KN2 A;  2O7K A;  4BL7 B;  5CO3 A;  1BX9 A;  3KEB A;  5CRG A;  4X43 A;  1Y25 A;  2WCI A;  1BQ7 A;  1X5C A;  4I2U A;  3BBY A;  4LMV A;  3FYG A;  1MD3 A;  1HNB A;  4D73 A;  2O85 A;  3CRU A;  4Z7X A;  3VWV A;  3AY8 A;  3LSZ A;  3L9S A;  1YQ1 A;  1B9Y C;  4IVF A;  2PU9 C;  4BA7 A;  1C72 A;  1PD2 1;  4HZ2 A;  2RII A;  1GTU A;  2PWJ A;  1SYX A;  4GRF A;  2HSY A;  4GTU A;  2CAQ A;  1GUK A;  4Q5R A;  3QD9 A;  1SEN A;  5J3R A;  4OCF A;  2EIR A;  2HI7 A;  4TRX A;  2OA7 A;  3DVX A;  3M8N A;  1WIK A;  4ZBA A;  4K9Z A;  2OE0 A;  5IMZ A;  4BVX A;  1M2D A;  1WMJ A;  3L9V A;  4IBP A;  4LA1 A;  1FHE A;  1JZW A;  5IPH A;  4EIP A;  1CQH A;  4G19 A;  5KN3 A;  5CP1 A;  4O5U A;  2PMT A;  4J57 E;  2HZE A;  5E59 A;  2A2P A;  2YPM A;  2V6O A;  2VIM A;  5IMA A;  2HSH A;  3EIN A;  3FZ4 A;  3P90 A;  3HZ4 A;  1SK2 A;  5HFI A;  1TU7 A;  3RBT A;  2H6Z A;  2K9F A;  1B48 A;  4OCE A;  1SK0 A;  4RQR A;  1Z6M A;  18GS A;  5H5Q A;  5D9V A;  2IIY A;  1F9M A;  3QDN A;  1ZCP A;  2KLX A;  1XW6 A;  4MF6 A;  2CQ9 A;  4TR3 A;  1R5P A;  4RI7 A;  3UMA A;  1DSB A;  4X4J A;  1GUH A;  3VI5 A;  2DMM A;  2VCX A;  2A4V A;  3TB2 A;  1A24 A;  3J7Y k;  4IKH A;  1VF1 A;  4MJA A;  4CDO A;  2DJ3 A;  5FHI A;  3LWA A;  1SL1 B;  4TXO A;  4CY6 A;  5ECH B;  2HXK A;  2YWM A;  1YEP A;  3KH9 A;  1GL8 A;  4WBR D;  2DIY A;  4ZIL A;  4OWY A;  1JHB A;  4HEA 2;  2H6Y A;  5IMF A;  2YZH A;  3DWV A;  2R0P A;  4NV2 A;  3ZRD A;  2L5O A;  5F0G A;  2H71 A;  4L8E A;  3IHG A;  2EC4 A;  3LQ7 A;  5J9B A;  2ALB A;  2CX3 A;  3QFA C;  4Z2U A;  1F2E A;  2O87 A;  3WGD A;  1OE8 A;  1BG5 A;  1TRS A;  1S3A A;  1O8X A;  1GSE A;  1MDJ A;  1R4W A;  2N5F A;  4WXT A;  1A23 A;  4O5R A;  2AAW A;  1FO5 A;  2YWO A;  3RHC A;  4N0Z A;  4ZIJ A;  4GXZ A;  2F8A A;  2B5Y A;  2K8S A;  2L57 A;  5CRH A;  3A3T A;  4WR5 A;  2XPE A;  3FZA A;  1EOH A;  3EMP A;  4V2M A;  4V1A p;  1XIY A;  3IR4 A;  1JFU A;  2R2J A;  3ZIJ A;  6GSU A;  2IJY A;  4EDZ A;  1G6Y A;  4KB3 A;  1M9A A;  2LS5 A;  5A5K A;  2OJL A;  3CSJ A;  2RUE A;  2AYT A;  2YJ7 A;  3LW9 A;  4KX4 A;  1M0U A;  4K1F A;  3ZFL A;  1Y6E A;  2R4V A;  3APS A;  4MMM A;  4TR4 A;  4ZL8 A;  3GTU A;  2I3Y A;  1WPI A;  4HU7 A;  1U87 A;  2H0I A;  5HR2 A;  1YDK A;  1GH2 A;  3VI7 A;  5DCG A;  3FR9 A;  2R0C A;  3UOM A;  4O7H A;  5IM9 A;  3ZLP A;  4TOP A;  20GS A;  3LGC A;  5DJL A;  3FZ5 A;  4G0I A;  3HA9 A;  4RI6 A;  3IHQ A;  3IAS 2;  2E0Q A;  2V1M A;  1H75 A;  4MPF A;  6GSW A;  1FW1 A;  2LRT A;  1URM A;  4LLR A;  2JSZ A;  3TOT A;  5F06 A;  4PTS A;  2HZF A;  1QQ2 A;  2C80 A;  3F8U A;  2MBS A;  2H1G A;  1PQN A;  3A2V A;  2FNO A;  4X0X A;  5D9T A;  4TR0 A;  4JR6 A;  3MYD A;  4GST A;  4ICY A;  2WFC A;  2DJ1 A;  2H1D A;  4HI7 A;  3LXZ A;  1T00 A;  4KDY A;  5DBQ A;  2H0G A;  3IC8 A;  2XBQ A;  5IMD A;  1YF0 A;  2REM A;  2LJR A;  3TOU A;  3NOF A;  9GSS A;  2F9S A;  2VD1 A;  3K8N A;  10GS A;  2UZ8 A;  5IQY A;  4ID0 A;  5G1K A;  1Z6N A;  3UBL A;  3F0I A;  4KCE A;  2IMI A;  2GDR A;  1K0M A;  2ZUP A;  1JZO A;  2DKH A;  4XS4 A;  3M0F A;  1VF4 A;  5H5R A;  1YF1 A;  4MDC A;  3EWL A;  2JU5 A;  1A2L A;  4TR1 B;  6GSV A;  4TXV A;  1YKA A;  1O85 A;  5LCZ A;  3EE2 A;  3DIE A;  4HOJ A;  4BL7 A;  5IIZ A;  1K0O A;  1B4P A;  3US3 A;  3IE3 A;  3LYK A;  2O8V B;  1ZYE A;  2IFQ B;  1X5E A;  3F4T A;  4EE0 A;  2OAC A;  3VWW A;  1HNA A;  1XW5 A;  3WT1 A;  5BRT A;  4PQH A;  4Z2T A;  4KCA A;  4PGT A;  4KSO A;  5JCG A;  3KH7 A;  1TU8 A;  3IV4 A;  3EYT A;  5ECI B;  3TGZ A;  5HR3 A;  1ZGN A;  1GNE A;  5G1L A;  2H76 A;  1EV4 A;  4O32 A;  1O81 A;  5FWG A;  4I2T A;  3IC4 A;  4O5Q A;  1GSU A;  4JU5 A;  3E3E A;  1K0A A;  4IJI A;  4FYB A;  5D9W A;  1V2A A;  5G5F A;  4FO5 A;  2YV9 A;  2OE3 A;  1RQM A;  5KOX A;  3H1N A;  1S3C A;  3GUR A;  1SL2 B;  1I9D A;  3HJP A;  4ZB9 A;  2PVQ A;  3S9F A;  12GS A;  5HFG A;  3UEM A;  4MNN A;  4K8M A;  1KBN A;  1TK0 B;  3VWX A;  5B6M A;  3TDG A;  2PGT A;  5ELG A;  1X9M B;  4NXI A;  3BCK A;  3GKK A;  2H66 A;  4KA0 A;  1SJ6 A;  1QMV A;  4MH3 A;  1NM3 A;  2YNX A;  1PN9 A;  1GNW A;  2IN3 A;  5H5S A;  3NZN A;  4J56 E;  3F4S A;  4PUF C;  1DE1 A;  3QFB C;  3MAK A;  1GSD A;  4HDE A;  2DJJ A;  4F0C A;  5KEJ A;  1W89 A;  3UAP A;  4HU9 A;  1K0D A;  2E2M A;  2GTU A;  4WF5 A;  4OMV A;  2O89 A;  3KGK A;  2HSM A;  2H1B A;  11GS A;  3D4M A;  1NW2 A;  5D73 A;  2K18 A;  4DEJ A;  1ILO A;  4GSS A;  1O7U A;  3D22 A;  1SJI A;  3RPN A;  3WGX A;  2NPB A;  2FWF A;  1GWC A;  2FLS A;  3GV1 A;  3O3T A;  4KGI A;  5ECL B;  4FYC A;  2RLI A;  2QSI A;  3ZVJ A;  5DAK B;  3GN3 A;  3GKN A;  4ZBD A;  3SBC A;  4ZL7 A;  4N10 A;  4V1A g;  2HLS A;  3D0Z A;  5ECK B;  4IQ1 A;  4PQ1 A;  5ECP B;  1YZX A;  1XFL A;  2HT9 A;  1XCC A;  1HYU A;  3EVI A;  6GSS A;  5CRE A;  2CZ3 A;  1Z9H A;  1U88 A;  1EP7 A;  1E6B A;  2PER A;  4JRR A;  4WF4 A;  2GSS A;  4L5O A;  1XOB A;  2VM2 A;  1EEJ A;  1EV9 A;  3P2A A;  4IHU A;  2RM6 A;  4EKZ A;  2L4Q A;  1OE7 A;  2B5X A;  2ON7 A;  3ERF A;  3GKM A;  1FVJ A;  4ZBB A;  1ZYN A;  3QPM A;  2AJQ B;  4OFT A;  1CQG A;  2LJA A;  2H1A A;  2CAI A;  2X8C A;  3TJK A;  1NHY A;  13GS A;  4F2I A;  3FZ9 A;  3KMN A;  5DAL B;  2CT6 A;  1PMT A;  4IS0 A;  1ZYQ B;  1M2A A;  4KW6 A;  5J4U A;  1SKS B;  4WBJ A;  4CW9 A;  1KNG A;  3GSS A;  4CY8 A;  3MSZ A;  2WJU A;  1SD9 A;  3GL5 A;  2CV4 A;  5DVB A;  1WOU A;  5LNK e;  2C3N A;  2I4A A;  4CHS A;  3EPT A;  4G0K A;  3VLN A;  1V40 A;  3H8Q A;  5D8I A;  1ST9 A;  2GT5 A;  3W8S A;  4KSM A;  3TJG A;  4WEY A;  1TRW A;  1ZOF A;  2DKI A;  2WDU A;  3GFK A;  2HRN A;  4POK A;  1K0N A;  4ULX A;  3TUE A;  1OC3 A;  1OKD A;  3F6D A;  1F37 A;  1IYH A;  3QCP A;  1ERW A;  1GSF A;  1UVZ A;  4K2X A;  2A2R A;  2NDO A;  5EL8 A;  1K0B A;  5ECO B;  4ZB8 A;  2NVL A;  3KP8 A;  2WZ9 A;  5L71 A;  2B7K A;  2BTO T;  2LQQ A;  2MZC A;  2DML A;  1THX A;  2J9H A;  3ISO A;  2GSR A;  3TKS C;  4L0W A;  1O6J A;  2PN8 A;  1X9S B;  2FWH A;  2C3T A;  3G9B A;  1QK8 A;  4RUV A;  2HE3 A;  2PUK C;  1HD2 A;  1OAZ A;  4X1U A;  4K7N A;  4EL1 A;  1GTI A;  3IXR A;  3C7M A;  16GS A;  2OBI A;  1H4O A;  3I43 A;  3LG6 A;  5CRD A;  2GST A;  3IK9 A;  2C8U A;  3APO A;  2XC2 A;  2QGV A;  5HR1 A;  1FB6 A;  3G7Y A;  4DVC A;  2WB9 A;  3QAG A;  2WRT A;  1GRX A;  5AIV A;  4WKW A;  1TP9 A;  5F07 A;  1J08 A;  4EF0 A;  4HQZ A;  4TR1 A;  3KCM A;  1K3O A;  1R5A A;  5A4U A;  2C0G A;  3QOU A;  3LXT A;  3IA1 A;  2FD3 A;  2VCW A;  3L0H A;  4IJ3 A;  5AIS A;  4G10 A;  3VPQ A;  1ZYP A;  4PNF A;  4IGJ A;  2YZU A;  4AF2 A;  1V58 A;  3EU3 A;  3F63 A;  5F05 A;  3QMX A;  1Z7P A;  1ERT A;  2RUF A;  3Q18 A;  3D5J A;  2JSY A;  2ZNM A;  3GST A;  3VFI A;  1GUL A;  1G6W A;  5AGY A;  3LOR A;  3DEX A;  3PIN A;  1GSS A;  4OFN A;  2R5G A;  5KN0 A;  1TKD B;  5FT3 A;  2IFQ A;  5LD0 A;  1T4Z A;  4XIH A;  1Q98 A;  3LFL A;  4ZXG A;  4V2N A;  3KMO A;  2R37 A;  1AQW A;  4D73 B;  2GT6 A;  4EXJ A;  4JED A;  1WE0 A;  2LRC A;  3UL3 A;  5GAN D;  4K5S A;  1T7P B;  4XRA A;  1U6T A;  4ML6 A;  4EC0 A;  1SKW B;  3FKF A;  4GQF A;  1PKW A;  5CYY A;  3GYK A;  3L78 A;  2PVO C;  3A5I A;  4TVE A;  3CTF A;  3P8W A;  4DSS B;  2LJK A;  2VLT A;  3IAM 2;  4ECJ A;  4IP6 A;  2CZ2 A;  2JZT A;  1IYI A;  1YKC A;  1LU4 A;  4YAV A;  4YQV A;  3FHK A;  2L5L A;  3HJO A;  2YOI A;  3BCI A;  1M9B A;  1KTE A;  1O73 A;  4BVX B;  1EWX A;  2WGR A;  4JR4 A;  2MBT A;  4MLY A;  4NAX A;  3L4N A;  3M1G A;  5DQY A;  5G2Z A;  3OR5 A;  1SD8 A;  4EO3 A;  1VGL A;  2G0F A;  4HJ2 A;  3U5R E;  3HKR A;  2XPD A;  1XVQ A;  3V1W A;  1EEM A;  5AIX A;  5J5N A;  2P5Q A;  3ZTL A;  1GTB A;  1MTC A;  3WD6 A;  4KE3 A;  2L6D A;  5EVO A;  3M3M A;  5GZZ B;  3TRX A;  4ECC A;  3FK8 A;  1A0R P;  4USS A;  3TCO A;  1TTZ A;  3EC3 A;  3ZRE A;  3E9J B;  3KIJ A;  4ML1 A;  4KDU A;  1K3Y A;  1VF2 A;  2FWE A;  4H86 A;  2X99 A;  1GUM A;  1THO A;  3EMX A;  1S3D A;  4KF9 A;  1FAA A;  1OC9 A;  4FH8 A;  2KUC A;  3DML A;  2K8V A;  1N2A A;  1NHO A;  4DSR A;  1ZL9 A;  2FA8 A;  3UAR A;  4MZC A;  3KZQ A;  2LUS A;  2FWG A;  3KTL A;  3HVX A;  4MA9 A;  1BAY A;  2QC7 A;  2L6C A;  2B6M A;  1PKZ A;  1A2J A;  3O76 A;  3Q74 A;  3N5O A;  2BJX A;  5CRW A;  4I6X A;  1ML6 A;  3TRQ A;  4ISD A;  3RHB A;  4E8E A;  2IL3 A;  5C00 A;  2VLU A;  2VL2 C;  2FCH A;  3F3R A;  1A8Y A;  4PQI A;  3FW2 A;  1SJZ A;  2I1U A;  2IME A;  2ZCT A;  1GLP A;  2R6K A;  2VM1 A;  2H75 A;  3M9K A;  3ME8 A;  3TKP A;  2CA8 A;  2GQK A;  3KP9 A;  3R2Q A;  2VL2 A;  2TIR A;  1EZK A;  2KP1 A;  4AJ7 A;  5ENU A;  5IMV A;  3TJF A;  5GST A;  5ID2 B;  2LTK A;  2VAF A;  4OFM A;  2E2G A;  3PH9 A;  4MF5 A;  14GS A;  3IOS A;  2LQO A;  5IO0 A;  5CAX A;  4MZB A;  2GQL A;  2GS3 A;  2C0F A;  1GTA A;  4BWS A;  2YWN A;  3G7J A;  1UC7 A;  5DAL A;  2VCV A;  3A2W A;  1BED A;  3F9U A;  2DJ2 A;  2VOC A;  2YCD A;  3TJB A;  1V98 A;  3C1S A;  4PNG A;  2EIO A;  5G30 A;  2N5B A;  1K0C A;  3A5W A;  4YAP A;  3VPT A;  4EVM A;  3J7Y b;  1MD4 A;  4A5P A;  4YKG A;  3IRA A;  1GLQ A;  3C73 A;  2HNL A;  5J41 A;  5BMU A;  3PR8 A;  4EIQ A;  5A4V A;  3C8E A;  2D2Z A;  3TKQ A;  3KM6 A;  2V32 A;  1X9W B;  3W8J A;  3ZMK A;  1XVW A;  4G9H A;  2HFD A;  5D9X A;  2A2S A;  3DD3 A;  3CYN A;  4Q5Q A;  3FY7 A;  2OBK A;  2GQM A;  5INY A;  1R7H A;  4HQS A;  3BOA A;  1U3A A;  3TKS E;  4FQU A;  3HY2 A;  4MZW A;  4ECI A;  5EY6 A;  4I97 A;  3CRT A;  1PSQ A;  2GSQ A;  5B8A A;  2I9H A;  1F3A A;  4QQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...