1A2MA

Oxidized dsba at 2.7 angstroms resolution, crystal form iii
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
188
structure length
188
Chain Sequence
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DISULFIDE BOND FORMATION PROTEIN
publication title Crystal structures of reduced and oxidized DsbA: investigation of domain motion and thiolate stabilization.
pubmed doi rcsb
source organism Escherichia coli
total genus 58
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1a2mA00
3KP9A 1DE1A 1MD4A 1IYIA 1ZZYA 4GTUA 3N5OA 5DALA 2OJLA 2ZNMA 3A2VA 3C1RA 2I81A 1R4WA 3HJOA 2CVDA 1ZGNA 2YWIA 3KJYA 2JZRA 2K8SA 2GT6A 5AIXA 4AGSA 3EURA 5B8AA 2NPBA 3KTLA 3D6IA 2WS2A 3V1WA 4IS0A 4GF0A 4O5RA 3UEMA 2RIIA 3HVXA 4EE0A 5DAKA 2KP2A 1WPIA 1SJ6A 2XBIA 2MMNA 1AQXA 4BVYA 3NIVA 2C3QA 1T4YA 1EZKA 4KDXA 5ECRB 2H1GA 3CYNA 5DVBA 2GTUA 1OC9B 1AAZA 3CSJA 4MABA 4LA1A 3HY2A 5INYA 2YWNA 5AN1A 1WP0A 1K0CA 1Z5YE 1YZXA 3HDCA 5IIZA 20GSA 2MMAA 2RM5A 1G6WA 4EDZA 3Q18A 1ERUA 5KN0A 2DBCA 2H1DA 2HRNA 2BJXA 2LEGA 1FAAA 2M46A 3M9KA 4I8BA 2F9SA 1A0RP 3DD3A 2GQMA 2H71A 3KMNA 4F82A 4D73B 2LRTA 4K9ZA 2LQQA 1WE0A 1UN2A 2K9FA 1TK5B 1MEKA 1Y6EA 4XHMA 3TOTA 4N10A 3WYWA 2L59A 2P5QA 1EOGA 3LJRA 3I43A 3RAZA 1GUMA 5C04A 2B5YA 5GAND 4HZ2A 5HR1A 1FOVA 3IXRA 5CRWA 3E9JB 3O76A 2J23A 3UIWA 1TRVA 1SD9A 3G7IA 1JZOA 2FA4A 2XBQA 3FR6A 2NTOA 4TR3A 1U87A 2DMLA 2PVQA 3MWHA 2VD1A 3E3EA 2LKUA 1MDIA 2HZEA 3APQA 1F37A 4BWQA 4DSSB 1A2LA 4KH7A 4HJMA 4N11A 2H19A 3L78A 5DJLA 1GULA 3TB2A 4WBRD 3FR9A 3TUEA 3ISOA 1IYHA 5CNWA 1THOA 4V1Ag 3IBHA 4G19A 2DJKA 1PN9A 1XW6A 5JWQB 4HZ4A 4F2IA 3QAWA 1K3YA 4ECIA 3ZFBA 1MTCA 3G7JA 2QKEA 2A2SA 3A2XA 3ZITA 4F0CA 1W89A 5A4VA 3KP8A 1E2YA 1TP9A 3HJPA 2YANA 3HHVA 3IAS2 2O8VB 4POLA 5ECSA 1PD21 1XBSA 3F6FA 4WBJA 2VM2A 3GNJA 4QL9A 3TJGA 2ON5A 2HXKA 3DXBA 3IV4A 2C8UA 5ABRA 2OACA 2OA7A 3W8JA 1JFUA 2JSZA 1V57A 2PU9C 4IBPA 4ZL8A 4ZL9A 1GNEA 2L4QA 6GSUA 1OYJA 2WGRA 1Z7PA 1S3DA 1RK4A 1U6TA 2KUCA 3KGKA 2X64A 1SK1A 4OFNA 2LNTA 1TRUA 5ELGA 3P90A 2XHFA 3C8EA 4WETA 5EL8A 2QSIA 2JZTA 4RQRA 4ZXGA 2OADA 4IKHA 1GSFA 2CA8A 2LRCA 2ON7A 2LS5A 2CVKA 5FWGA 5J4UA 3TKPA 3GKMA 2O85A 2K6VA 2JADA 2H0HA 2NBSA 4NV2A 1GTUA 5E4WA 2H8LA 14GSA 5D93A 3F6DA 2NVLA 4TXOA 4K7IA 4EKZA 3R2QA 4TVEA 4L0WA 4HI7A 4ZBAA 3ZYWA 2IMEA 4YAVA 4XIHA 4TR1B 4POBA 5IMCA 4OWYA 2E7PA 2CQ9A 5B7CA 1U3AA 2HT9A 2L4CA 1JLWA 1WWJA 4HJ2A 4G9HA 5HFGA 1B9XC 1SL2B 4ECJA 16GSA 12GSA 1GTIA 2H76A 5D9WA 4MZCA 5G1KA 2M80A 7GSSA 4J2FA 3FZ5A 2CZ3A 2H72A 2NDOA 2H30A 2VCTA 4OCFA 2PVOC 2HYXA 3GH6A 2C0FA 3UJ1A 1GRXA 3QR6A 1SKSB 2LNSA 1V9WA 4HQSA 3CXGA 4MMMA 4PUAA 1K0OA 2M72A 3WT1A 3HZ8A 2YJHA 4JRRA 1J0FA 4EO3A 2VL2C 4HU7A 2VLVA 1UA5A 2LQOA 3LSZA 4Q5FA 4JE1A 1GUKA 3Q6OA 3HKRA 2GT5A 1BX9A 3M9JA 1W4VA 1XVQA 2F3MA 1R5AA 4F03A 3RDWA 1OVNA 1SYXA 4Q5QA 4WR5A 4Z7XA 1K0NA 4XS4B 4ZB8A 4K0GA 3IOSA 1BAYA 4WF4A 2RM6A 1O85A 4MF6A 1MDJA 4YQUA 5KN3A 4ZBBA 4IJIA 1JLVA 4IHUA 1RQMA 1T7PB 3QCPA 3HCZA 3LWAA 4QQ7A 3UBLA 1VF4A 1HNBA 1OC9A 3FW2A 4PQ1A 5ECNB 1X9WB 3UVTA 3QD9A 3EU4A 3AY8A 5HR0A 3CTGA 2L6DA 2XC2A 4KCEA 4AJ8A 2AJQB 1TXXA 5J9CA 11GSA 1SL0B 1NM3A 3WGXA 5D73A 2ZCTA 3BOAA 3GL5A 5KN1A 2OE3A 4V2NA 1TRWA 3GKNA 4FH8A 2VL9A 2H1BA 4IJ3A 3BD2A 3DRNA 3DVWA 1MD3A 1A8YA 1OKDA 1TI3A 5G31A 3TDGA 2IJYA 3FRCA 4K7NA 4DEJA 3QPMA 2G2QA 1HNCA 5D9XA 3KEBA 1PKZA 4PNFA 3D0ZA 1PA3A 2R37A 6GSWA 2FWEA 1TRSA 3EE2A 2IWTA 1EEJA 1ZOFA 3EINA 4FO5A 2GS3A 4NHWA 1GNWA 2OBIA 1Z7RA 2H01A 2YNXA 2A2RA 5IO2A 4L0UA 2GZZA 4KNDA 4MZWA 2F51A 1JZWA 2I4AA 3TJFA 4PURA 1ERVA 8GSSA 1JHBA 3UOMA 4ZB9A 5JWOB 2VIMA 4EXJA 4FYBA 2B3SA 2VD0A 5IPGA 1VF1A 1GSEA 4DSQA 1O81A 1XCCA 1SENA 5D8IA 3C7MA 1GLQA 3QAVA 3N9JA 3F63A 4HS1A 4ILFA 1AQVA 2AHEA 4ZILA 1T00A 6GSSA 2DJJA 1MDKA 4ECCA 5HFIA 3ZTLA 4TW5A 3US3A 2FY6A 2PGTA 2R6KA 1A2MA 4V1Ap 1GTAA 4J56E 1AW9A 1ZYQB 2O7KA 1XWBA 4GSTA 2VCXA 5AISA 5CAXA 3D21A 13GSA 4GQCA 2L6CA 2JZSA 2HNLA 2DIYA 4GXZA 1NHYA 2JACA 3IK7A 2F8FA 4HQZA 1USBA 5IO0A 2JU5A 2KP1A 1HNAA 1F3AA 4HDEA 2VM1A 5J5NA 1QUWA 3QMXA 1U3IA 2D2ZA 1J08A 2C1YA 2PMTA 2FUG2 3F8UA 5D9TA 2VLTA 5DBQA 4KB3A 1K0MA 1F6MC 3P8WA 1YEXA 2WULA 5H5RA 4OD7A 2KLXA 2GGTA 1G7OA 3E0UA 1H75A 1BEDA 5FHIA 5ECIB 1V98A 4KAEA 4BL7A 5G5EA 4MA9A 3MAKA 3TRXA 4ISDA 3ZVJD 1DBYA 9GSSA 3Q74A 4RI7A 4BWSA 1AIUA 3FK8A 4BVXA 1FB6A 5GAPD 2B7KA 5J3RA 2FD3A 1XWKA 1GH2A 1K0BA 3LXTA 3TKSE 1O6JA 3TOUA 4HUAA 2MMOA 3GIXA 1HD2A 2DJ1A 4LL1B 5KEJA 3CTFA 3SBCA 4GSNA 2K8VA 3VURA 1YQ1A 3GA4A 1ZL9A 2LTKA 3ZREA 4I6XA 3EWLA 3HZ4A 1TTZA 2JL4A 2IFQB 3GMFA 3O6TA 2XPEA 2YN1A 3ZIVA 1QK8A 3DMLA 2X8GA 2I1UA 4TN8A 3TKRA 4KX4A 1SD8A 3DVXA 2VLUA 1I5GA 3GKXA 4L5OA 4MF7A 2VCZA 2IMIA 2VL2A 4WEYA 1THXA 4K6XA 4V2MA 4XRDA 1A0FA 3TRQA 2YZUA 2FNOA 3L4NA 1XXUA 2WZ9A 3UAPA 1SJIA 2B1LA 4K8MA 5IOWA 3KM6A 2WFCA 2VCWA 4TR1A 1R5PA 3GSSA 2C3TA 2H1AA 2OE1A 5G30A 3L9SA 1BQ7A 5G5FA 1T3BA 1XW9A 2V2GA 1YEPA 3DIEA 3TCOA 3IHQA 5B8BA 3VWVA 4MCUA 2X8HA 5A5KA 1TU8A 4KGIA 2IL3A 2DJ0A 19GSA 2L5LA 3HVVA 4EL1A 3FKFA 5FT3A 4KSMA 1YF0A 4LLRA 1U88A 2YV9A 3F4SA 1O73A 1SK0A 3APOA 2VCVA 3DWVA 2V32A 4K0NA 1XWGA 3BJ5A 2HI7A 4KCAA 2MBSA 4PUFC 3VPQA 1EGRA 4I2UA 1GP1A 1HYUA 2DMMA 4MJAA 3F3RA 2WRTA 4IW9A 2I9HA 1R26A 2GQLA 2QGVA 2MZCA 4XS6A 2ES7A 1TK8B 1M2BA 3RHCA 3TKSC 1Q98A 3IRAA 5ECKB 5J9BA 4TRXA 1DSBA 1OC8A 3SWLA 2JSYA 4EVMA 3K8NA 4EDYA 3GURA 5ECLB 5ENUA 1EOHA 2GDRA 2VUPA 3C73A 1O8WA 2HFDA 2YZHA 4RQXA 3J7Yk 2RUFA 4AJ6A 3FEUA 3LGCA 2R5GA 5H5SA 5DQYA 4IQ1A 1GSUA 1GSSA 2HE3A 3F4RA 1EP7A 3ZVJA 4POKA 3D4MA 3ERFA 1OAZA 2GSRA 2R4VA 5HR2A 3LG6A 5CRDA 2E2GA 1YF1A 5JCGA 4G10A 4L8EA 2V6OA 3D5JA 1ST9A 1NHOA 2R3XA 4XS1A 2REMA 1X5EA 3ME7A 1CQGA 1JZRA 2IMFA 4IELA 2X99A 2CZ2A 5J41A 2F8AA 4JR4A 1GUHA 1XFLA 3LEFA 2WJUA 1SKRB 1H4OA 3L0HA 1UVZA 2YV7A 4P3YB 3UARA 2LV3A 3M0FA 3VI5A 1XIYA 4X1UA 4FIWA 3EVIA 2L5OA 6GSYA 5EY6A 3IA1A 3ED3A 2YOIA 4O92A 3DEXA 10GSA 4HEA2 4K1FA 4PQHA 4EC0A 4MLYA 3CBUA 4J57E 4E8EA 4IN0A 2V41A 4ML1A 1TOFA 2PUKC 4XTSA 4JBBA 2FCHA 3FHKA 3WGDA 5ID2B 4KE3A 2MYGA 6GSTA 1AQWA 3G7YA 2CX4A 2MMZA 1GSQA 3FYGA 3L9VA 5LNKe 4KDYA 4IP6A 1M2DA 2ZUPA 1BJXA 2H6YA 1FHEA 4EUYA 1B8XA 2BTOT 1XWCA 3KIJA 4ACSA 1A24A 17GSA 2YP6A 2LJAA 3BCKA 3IE3A 1WOUA 1PMTA 4ECBA 2HLSA 4I97A 3ZMLA 4NAXA 3H8QA 4YH2A 2R2JA 3JCML 2AV4A 1XOBA 2FWHA 3LYPA 1SL1B 1VF2A 1FVKA 2CT6A 5F0GA 2GSSA 3F3QA 4MJCA 1WJKA 1Y25A 1OE7A 5IMDA 4F0BA 3EMPA 1OKTA 5CYYA 1B9YC 2DIZA 2GSQA 2VO4A 5L71A 1PL1A 5E59A 2FLSA 3NZNA 4N0ZA 3OR5A 2KOKA 2FGXA 2IPAA 5DCGA 3KXOA 5IQYA 3GV1A 1X5CA 1ML6A 3IAM2 4LMWA 4NWYA 1FVJA 3ZFLA 2CX3A 1YY7A 1AC1A 5JCWA 1PL2A 1K3OA 2H74A 2B7JA 4I5QA 1X0RA 3BBYA 2KHPA 2H66A 1ERWA 2EIRA 2AUVA 4MH2A 1SYRA 4D73A 1OE8A 3QFAC 3M8NA 5IMAA 1YDKA 4V2LA 1I9DA 2PERA 4GQFA 1T8EB 3CRTA 3H79A 1F3BA 1FW1A 3FZAA 3UL3A 4OO5A 2PBJA 1ZCPA 3RPNA 4NPBA 4WR4A 3ZL5A 1X9MB 2X8CA 4GWRA 1Z6MA 5CRGA 3GYKA 3GN3A 4JEDA 1XPVA 4JU5A 3GTUB 5JWRB 2CAIA 5EVOA 1GTBA 3QDNA 1V2AA 3MDKA 4GCIA 2OE0A 3MSZA 1PSQA 2VCQA 3C71A 1YJ6A 1WRYA 2YJ7A 2B5XA 1A8LA 2B1KA 3A2WA 4EF0A 4O32A 1JZDA 2E0QA 4LL4B 3GFKA 2PN8A 1QGVA 1ACVA 5F8BA 2O89A 4DSSA 2YPMA 2IFQA 3VLNA 4K2DA 1KNGA 2GQKA 2C4JA 3GX8A 4FYUA 3IPZA 4OFTA 2XPDA 1NW2A 2IN3A 2L57A 1EEMA 2PWJA 2A4VA 3S9FA 1SK2A 3TKSA 1KBNA 3APSA 3TGZA 4OMVA 5CREA 1VF3A 4MZBA 2GZYA 4PQIA 3TKQA 4OCEA 1N8JA 4YQMA 2CAQA 3VFIA 3FR3A 3I6AA 4WKWA 4CHSA 1Z6NA 2AAWA 5GZZB 5AGYA 2EIQA 5JCUA 4XCSA 2E2MA 4TKYA 1J9BA 5IMFA 3I69A 5GSTA 1PGTA 3CSHA 1PQNA 2MBTA 1B4PA 4F9ZA 3F9UA 2LJRA 1TW9A 1BG5A 3KCMA 4X0XA 3KZQA 4ULXA 4H86A 2EC4A 4JR6A 4HOJA 4DVCA 1QMVA 4TR4A 4IVFA 5HQPA 4IGJA 2IMKA 3IC4A 1GLPA 22GSA 5CRHA 2AYTA 3UBKA 1G0TA 1E6BA 1XVWA 5A4UA 3H93A 1M7TA 5DALB 5F06A 1M2AA 3FZ9A 5G1LA 3KH9A 3LORA 5ELAA 4BA7A 1O8XA 2LRNA 2HSYA 1T1VA 1ABAA 5H5QA 2H0IA 3I9V2 4MP4A 4ZL7A 2J9HA 2VOCA 3M3MA 2C0EA 5F07A 2B6MA 2GLRA 2DLXA 1LJRA 3GRXA 3ZMKA 4MPFA 5HR3A 2QC7A 4RI6A 4E8HA 4KDUA 2FHEA 4RUVA 2EIOA 5DAKB 3PR8A 1OC3A 3KD0A 1ERTA 3EYTA 2P5RA 1DUGA 4Q5RA 4GSSA 4KSOA 3QFBC 1R7HA 5ECMB 1GWCA 1WMJA 4FYCA 3VK9A 3A3TA 3LYKA 1UC7A 1EWXA 2O87A 5DQSA 5HFKA 2TRCP 1LU4A 2TRXA 3WD6A 5ECOB 3D22A 1PRXA 2I3YA 1V58A 1F2EA 3TJJA 4ZBDA 2Z9SA 1F9MA 6GSVA 2YWMA 3PH9A 2LJKA 4I2TA 4PXOA 3TJKA 4TR0A 1FB0A 2V1MA 3KMOA 1XWAA 4ZB6A 3H1NA 2GZPA 5AIVA 3IR4A 1VRSD 5D9VA 1G7EA 3GH9A 5ECQB 2OKAA 2H0GA 5CO3A 5B6NA 2WB9A 4LMVA 4ML6A 1XOAA 5LCZA 4WXTA 2G0FA 1TK0B 5ID2A 2HRFA 3LQ7A 4NV5A 4POMA 3MNGA 5ECHB 2C0DA 1ON4A 1AXDA 3GHAA 1K0AA 1KEBA 2LUSA 5COHA 3EC3A 1N2AA 3KTBA 4BPYA 3ZIJA 5ECPB 3F0IA 2N5FA 4MF5A 3TRPA 4N0VA 3DGQA 3Q19A 2FWFA 1A2JA 4XS4A 4TOPA 4NMUA 3C1SA 5F05A 2DSAA 1T4ZA 2DC5A 1X9SB 1FO5A 3HA9A 1KTEA 5C00A 1WIKA 2VL3A 1TI1A 1CQHA 3VWUA 2HZEB 3LFLA 1NSWA 3CRUA 4ZIJA 3HJMA 4G2EA 1PX6A 2OBKA 3J7Yb 1M9BA 1M99A 4YAPA 4PGTA 4OFMA 4QL7A 1Z3EA 4JZQA 2PPTA 3DYRA 4MJBA 4X43A 3IDVA 18GSA 1DE2A 2FWGA 4TXVA 5IOXA 3BCIA 3U6VA 1AUCA 4IP1A 2C3NA 5DJMA 1HQOA 1ZMAA 4K7OA 4KUNA 5G2ZA 3PGTA 1ILOA 3CMIA 1VGLA 3ZZXA 2DJ3A 3NOFA 4GLTA 1EP8A 5EPFA 4XRAA 2H75A 4KW6A 5LD0A 3ERGA 2GVPA 3CSIA 1XZOA 3VWWA 2P0GA 2TIRA 4IQAA 2RLIA 4MH3A 6GSXA 1YKAA 1SJZA 2P31A 1EV9A 3O3TA 5IMVA 3HD5A 5CP1A 1S3AA 4YQVA 1C72A 1XW5A 4MDCA 1G6YA 4N30A 4AJ7A 1GSYA 1PX7A 1TDIA 2YCDA 3FZ4A 1PKWA 2K18A 3WT2A 1EV4A 3QAGA 3VI7A 3QOUA 2WDUA 3GTUA 4MJEA 3VPTA 2GSTA 3GKKA 1B4QA 2CV4A 4O7HA 3TJBA 4PNGA 1O7UA 3PINA 1K3LA 1GL8A 5D96A 1URMA 3ZRDA 3FY7A 3LXZA 1TJDA 3D4TA 1SKWB 3A5WA 4NHZA 4CW9A 2YWOA 5IPHA 3HXSA 5KN2A 4HU9A 3L9UA 4AF2A 2CVBA 3HVSA 5DDLA 3P7XA 3RPPA 2H70A 1BYEA 4PX1A 1YKCA 3UVHA 1FG4A 3GX0A 3EU3A 2C0GA 1GSDA 4L5LA 3GUSA 2AB6A 3UMAA 3P2AA 3W6GA 3RBTA 2IMDA 4DSRA 1TU7A 2H6ZA 2N5BA 4WF5A 4TXOB 4NXIA 1ZYEA 4OO4A 1QQ2A 1QXHA 3WGEA 1SU9A 2HZFA 3IK9A 1TKDB 2VAFA 2H6XA 4GRFA 1S3CA 1M0UA 2ALBA 5GSSA 3GSTA 3H4KA 1B48A 1RW1A 3HYPA 4Q5NA 2C80A 3ME8A 4MPGA 1V40A 2BMXA 4CDOA 5A4WA 1QFNA 3G9BA 4ID0A 2IIYA 5IMZA 2FA8A 2RUEA 3W8SA 3GL3A 1A23A 1K0DA 3DKSA 3EMXA 2H73A 2B5EA 1X5DA 2WCIA 3M1GA 5DCHA 2DJ2A 1Q4JA 1M9AA 1LBKA 2HSHA 1EGOA 3KH7A 3VWXA 3U5RE 2V6KA 3F4TA 4KA0A 3ERWA 5IM9A 5B6MA 2N5AA 3RHBA 2LSTA 4MK3A 1Z9HA 3ZLPA
chains in the Genus database with same CATH superfamily
3KP9A 1DE1A 1MD4A 1IYIA 1ZZYA 4GTUA 3N5OA 5DALA 2OJLA 2ZNMA 4Z2TA 3A2VA 3C1RA 2I81A 1R4WA 3HJOA 2CVDA 1ZGNA 2YWIA 2R0PA 3KJYA 2JZRA 2K8SA 2GT6A 5AIXA 4AGSA 3EURA 5B8AA 2NPBA 3KTLA 3D6IA 2WS2A 3V1WA 1PFOA 4IS0A 4GF0A 4O5RA 3UEMA 2RIIA 3HVXA 4EE0A 5DAKA 2KP2A 1WPIA 1SJ6A 2XBIA 2MMNA 1AQXA 4BVYA 3NIVA 2C3QA 1T4YA 1EZKA 4KDXA 5ECRB 2H1GA 3CYNA 5DVBA 2GTUA 1OC9B 1AAZA 3CSJA 4MABA 4LA1A 3HY2A 5INYA 2YWNA 5AN1A 1WP0A 2A4HA 1K0CA 1Z5YE 4G0KA 1YZXA 3HDCA 5IIZA 20GSA 2MMAA 2RM5A 1G6WA 4EDZA 3Q18A 1ERUA 5KN0A 2DBCA 2H1DA 2HRNA 2BJXA 2LEGA 1FAAA 2M46A 3M9KA 4I8BA 2F9SA 1A0RP 3DD3A 2GQMA 2H71A 3KMNA 4F82A 4D73B 2LRTA 4K9ZA 2LQQA 1WE0A 1UN2A 2K9FA 1TK5B 1MEKA 1Y6EA 4XHMA 3TOTA 4N10A 3WYWA 2L59A 2P5QA 1EOGA 3LJRA 3I43A 3RAZA 4K2XA 1ZYPA 1GUMA 5C04A 2B5YA 5GAND 4HZ2A 5HR1A 1FOVA 3IXRA 5CRWA 3E9JB 3O76A 2J23A 3UIWA 1TRVA 1SD9A 3G7IA 1JZOA 2FA4A 2XBQA 3FR6A 2NTOA 4TR3A 1U87A 2DMLA 2PVQA 3MWHA 2VD1A 3E3EA 2LKUA 1MDIA 2HZEA 3APQA 1F37A 4BWQA 4DSSB 1A2LA 4KH7A 4HJMA 4N11A 2H19A 3L78A 5DJLA 1GULA 3TB2A 4WBRD 3FR9A 3TUEA 3ISOA 1IYHA 5CNWA 2HSMA 1THOA 4V1Ag 3IBHA 4G19A 2DJKA 1PN9A 1XW6A 5JWQB 4HZ4A 4F2IA 3QAWA 1K3YA 4ECIA 3ZFBA 1MTCA 3G7JA 2QKEA 2A2SA 3A2XA 3ZITA 4F0CA 1W89A 5A4VA 3KP8A 1E2YA 1TP9A 3HJPA 2YANA 3HHVA 3IAS2 2O8VB 4POLA 5ECSA 1PD21 1XBSA 3F6FA 4WBJA 2VM2A 3GNJA 4QL9A 3TJGA 2ON5A 2HXKA 3DXBA 3IV4A 2C8UA 5ABRA 2OACA 2OA7A 3W8JA 1JFUA 2JSZA 1V57A 2PU9C 4IBPA 4ZL8A 5BMUA 4ZL9A 1GNEA 2L4QA 6GSUA 4ICYA 1OYJA 4BL7B 2WGRA 1Z7PA 1S3DA 1RK4A 1U6TA 2KUCA 3KGKA 2X64A 4BVXB 1SK1A 4OFNA 2LNTA 1TRUA 5ELGA 3P90A 2XHFA 3C8EA 4WETA 5EL8A 2QSIA 2JZTA 4RQRA 4ZXGA 2OADA 4IKHA 1GSFA 1M3JA 2CA8A 2LRCA 4MNNA 4BIKA 2ON7A 2LS5A 2CVKA 5FWGA 5BRTA 5J4UA 3TKPA 3GKMA 2O85A 2K6VA 2JADA 2H0HA 2NBSA 4NV2A 1GTUA 5E4WA 2H8LA 14GSA 5D93A 3F6DA 2NVLA 4TXOA 4K7IA 4EKZA 3R2QA 4TVEA 4L0WA 4HI7A 4ZBAA 3ZYWA 2IMEA 4YAVA 4XIHA 4TR1B 4POBA 5IMCA 4OWYA 2E7PA 2CQ9A 5B7CA 1U3AA 2HT9A 2L4CA 1JLWA 1WWJA 4HJ2A 4G9HA 5HFGA 1B9XC 1SL2B 4EIPA 4ECJA 16GSA 12GSA 1GTIA 2H76A 5D9WA 4MZCA 5G1KA 2M80A 2UZ8A 7GSSA 4J2FA 3FZ5A 2CZ3A 2H72A 2NDOA 2H30A 2VCTA 4OCFA 2PVOC 2HYXA 3GH6A 2C0FA 2R0CA 3UJ1A 1GRXA 3QR6A 1SKSB 2LNSA 1V9WA 4HQSA 3CXGA 4MMMA 3MYDA 4PUAA 1K0OA 2M72A 3WT1A 3HZ8A 2YJHA 4JRRA 1J0FA 4EO3A 2VL2C 4HU7A 2VLVA 4KF9A 1UA5A 2LQOA 3LSZA 4Q5FA 2R0GA 2HRKA 4JE1A 1GUKA 3Q6OA 3HKRA 2GT5A 1BX9A 3M9JA 1W4VA 1XVQA 2F3MA 1R5AA 4F03A 3RDWA 1OVNA 1SYXA 4Q5QA 4WR5A 4Z7XA 1K0NA 4XS4B 4ZB8A 4K0GA 3IOSA 1BAYA 4WF4A 2RM6A 1O85A 4MF6A 1MDJA 4YQUA 5KN3A 4ZBBA 4IJIA 1JLVA 4IHUA 1RQMA 2DKIA 1T7PB 3QCPA 3HCZA 3LWAA 4QQ7A 3UBLA 1VF4A 1HNBA 1OC9A 3FW2A 4PQ1A 5ECNB 1X9WB 3UVTA 3QD9A 3EU4A 3AY8A 5HR0A 3CTGA 4YKFA 2L6DA 4USSA 2XC2A 4KCEA 4AJ8A 2AJQB 1TXXA 5J9CA 11GSA 1SL0B 1NM3A 3WGXA 5D73A 2ZCTA 3BOAA 3GL5A 5KN1A 2OE3A 4V2NA 1TRWA 3GKNA 4FH8A 2VL9A 2H1BA 4IJ3A 3BD2A 3DRNA 3DVWA 1MD3A 1A8YA 1OKDA 1TI3A 3R3EA 5G31A 3TDGA 2IJYA 3FRCA 4K7NA 4DEJA 3QPMA 2G2QA 1HNCA 5D9XA 3KEBA 1PKZA 4PNFA 3D0ZA 1PA3A 2R37A 4Z2RA 6GSWA 2FWEA 1TRSA 3EE2A 2IWTA 1EEJA 1ZOFA 3EINA 4FO5A 2GS3A 4NHWA 1GNWA 2OBIA 1Z7RA 2H01A 2YNXA 2A2RA 5IO2A 4L0UA 2GZZA 4KNDA 4MZWA 2F51A 1JZWA 2I4AA 3TJFA 4PURA 1ERVA 8GSSA 1JHBA 3UOMA 4ZB9A 5JWOB 2VIMA 4EXJA 4FYBA 2B3SA 2VD0A 5IPGA 1VF1A 1GSEA 4DSQA 1O81A 1XCCA 1SENA 5D8IA 3C7MA 1GLQA 3QAVA 3N9JA 3F63A 4HS1A 5KOXA 4ILFA 1AQVA 2AHEA 4ZILA 1T00A 6GSSA 2DJJA 1MDKA 4K5RA 5HFIA 4ECCA 2A2PA 3ZTLA 4TW5A 3US3A 2FY6A 2PGTA 2R6KA 1A2MA 4V1Ap 1GTAA 4J56E 1AW9A 1ZYQB 2O7KA 1XWBA 4GSTA 2VCXA 5AISA 5CAXA 1XG8A 3D21A 13GSA 4GQCA 2L6CA 2JZSA 2HNLA 2DIYA 4GXZA 1NHYA 2HRAA 2JACA 3IK7A 2F8FA 4HQZA 1USBA 5IO0A 2JU5A 2KP1A 1HNAA 3A5IA 1F3AA 4HDEA 2VM1A 5J5NA 1QUWA 3QMXA 1U3IA 2D2ZA 1J08A 2C1YA 3CQFA 2PMTA 2FUG2 3F8UA 5D9TA 2VLTA 5DBQA 4KB3A 1K0MA 1F6MC 3P8WA 1YEXA 2WULA 5H5RA 4OD7A 2KLXA 2GGTA 1G7OA 3E0UA 1H75A 1BEDA 5FHIA 5ECIB 1V98A 4KAEA 4BL7A 5G5EA 4MA9A 3MAKA 3TRXA 4ISDA 3ZVJD 1DBYA 9GSSA 3Q74A 4RI7A 4BWSA 1AIUA 3FK8A 4BVXA 4G0IA 1FB6A 5GAPD 2B7KA 5J3RA 2FD3A 1XWKA 1GH2A 1K0BA 3LXTA 3TKSE 1O6JA 3TOUA 4HUAA 2MMOA 3GIXA 1HD2A 2DJ1A 4LL1B 5KEJA 3CTFA 3SBCA 4GSNA 2K8VA 3VURA 1YQ1A 3GA4A 1ZL9A 2LTKA 3ZREA 4I6XA 3EWLA 3HZ4A 1TTZA 2JL4A 2IFQB 3GMFA 3O6TA 2XPEA 2YN1A 3ZIVA 1QK8A 3DMLA 2X8GA 2I1UA 4TN8A 3TKRA 4KX4A 1SD8A 3DVXA 2VLUA 1I5GA 3GKXA 4L5OA 4MF7A 2VCZA 2IMIA 2VL2A 4WEYA 1THXA 4K6XA 4V2MA 4XRDA 1A0FA 3TRQA 2YZUA 2FNOA 3L4NA 1XXUA 3IC8A 2WZ9A 3UAPA 1SJIA 2B1LA 4K8MA 5IOWA 3KM6A 2WFCA 2VCWA 3MIXA 1R5PA 4TR1A 3GSSA 2C3TA 2H1AA 2OE1A 5G30A 3L9SA 1BQ7A 5G5FA 1T3BA 1XW9A 2V2GA 1YEPA 3DIEA 3TCOA 3IHQA 5B8BA 3VWVA 4MCUA 2X8HA 5A5KA 1TU8A 4KGIA 2IL3A 2DJ0A 19GSA 2L5LA 3HVVA 4EL1A 3FKFA 5FT3A 4KSMA 1YF0A 4LLRA 1U88A 2YV9A 3F4SA 1O73A 1SK0A 3APOA 2VCVA 3DWVA 2V32A 4K0NA 1XWGA 3BJ5A 2HI7A 4KCAA 2MBSA 4PUFC 3VPQA 1EGRA 4I2UA 1GP1A 1HYUA 2DMMA 4MJAA 3F3RA 2WRTA 4IW9A 2I9HA 1R26A 2GQLA 2QGVA 2MZCA 4XS6A 2ES7A 1TK8B 1M2BA 3RHCA 3TKSC 1Q98A 3IRAA 5ECKB 5J9BA 4TRXA 1DSBA 1OC8A 3SWLA 2JSYA 4EVMA 3K8NA 4EDYA 3GURA 5ECLB 5ENUA 1EOHA 2GDRA 4A5PA 2VUPA 3C73A 1O8WA 2HFDA 2YZHA 4RQXA 3J7Yk 2RUFA 4AJ6A 4EIQA 3FEUA 3LGCA 2R5GA 5H5SA 5DQYA 4IQ1A 1GSUA 1GSSA 2HE3A 3F4RA 1EP7A 3ZVJA 4POKA 3D4MA 3ERFA 1OAZA 2GSRA 2R4VA 5HR2A 3LG6A 5CRDA 2E2GA 1YF1A 5JCGA 4G10A 4L8EA 2V6OA 3D5JA 1ST9A 1NHOA 2R3XA 4XS1A 2REMA 4O5UA 1X5EA 2QA2A 3ME7A 1CQGA 1JZRA 2IMFA 4IELA 2X99A 2CZ2A 5J41A 2F8AA 4JR4A 1GUHA 1XFLA 3LEFA 2WJUA 1SKRB 1H4OA 3L0HA 1UVZA 2YV7A 4YKGA 4P3YB 3UARA 2LV3A 3M0FA 3VI5A 1XIYA 4X1UA 4FIWA 3EVIA 2L5OA 6GSYA 5EY6A 3IA1A 3ED3A 2YOIA 4FQUA 4O92A 3DEXA 10GSA 4HEA2 4K1FA 4PQHA 4EC0A 4MLYA 3CBUA 4J57E 4E8EA 4IN0A 2V41A 4ML1A 1TOFA 2PUKC 4XTSA 4JBBA 2FCHA 3FHKA 3WGDA 5ID2B 4KE3A 2MYGA 6GSTA 1AQWA 3G7YA 2CX4A 2MMZA 1GSQA 3FYGA 3L9VA 5LNKe 4KDYA 4IP6A 1M2DA 1PN0A 2ZUPA 1BJXA 2H6YA 1FHEA 4EUYA 1B8XA 2BTOT 1XWCA 3KIJA 4ACSA 1A24A 17GSA 2YP6A 2LJAA 3BCKA 3IE3A 1WOUA 1PMTA 4ECBA 2HLSA 4I97A 3ZMLA 4NAXA 3H8QA 3PPUA 4YH2A 2R2JA 3JCML 2AV4A 1XOBA 2FWHA 3LYPA 1SL1B 1VF2A 1FVKA 2CT6A 5F0GA 2GSSA 3F3QA 4MJCA 1WJKA 1Y25A 1OE7A 5IMDA 4F0BA 3EMPA 1OKTA 5CYYA 2X4AA 1B9YC 2DIZA 2GSQA 2VO4A 5L71A 1PL1A 5E59A 2FLSA 3NZNA 4N0ZA 3OR5A 2KOKA 2FGXA 1M3IA 2IPAA 5DCGA 3KXOA 5IQYA 3GV1A 1X5CA 1ML6A 3IAM2 4LMWA 4NWYA 1FVJA 3ZFLA 2CX3A 1YY7A 1AC1A 5JCWA 3HVNA 1PL2A 1K3OA 2H74A 2B7JA 4I5QA 1X0RA 3BBYA 2KHPA 2H66A 1ERWA 2EIRA 2AUVA 4MH2A 1SYRA 4D73A 1OE8A 3QFAC 3M8NA 5IMAA 1YDKA 4V2LA 1I9DA 2PERA 4GQFA 1T8EB 3CRTA 3H79A 1F3BA 1FW1A 3FZAA 3UL3A 4OO5A 2PBJA 1ZCPA 3RPNA 4NPBA 4WR4A 2QA1A 3ZL5A 1X9MB 2X8CA 4GWRA 1Z6MA 5CRGA 3GYKA 3GN3A 4JEDA 1XPVA 4JU5A 3GTUB 5JWRB 2CAIA 5EVOA 1GTBA 3QDNA 1V2AA 3MDKA 4GCIA 2OE0A 3MSZA 1PSQA 2VCQA 3C71A 1YJ6A 1WRYA 2YJ7A 2B5XA 1A8LA 2B1KA 3A2WA 4EF0A 4O32A 1JZDA 2E0QA 4LL4B 3GFKA 2PN8A 1QGVA 1ACVA 5F8BA 2O89A 4DSSA 2YPMA 2IFQA 3VLNA 4K2DA 1KNGA 2GQKA 2C4JA 3GX8A 4FYUA 3IPZA 4OFTA 2XPDA 1NW2A 2IN3A 2L57A 1EEMA 2PWJA 2A4VA 3S9FA 1SK2A 3TKSA 1KBNA 3APSA 3TGZA 4OMVA 5CREA 1VF3A 4MZBA 2GZYA 4PQIA 3TKQA 4OCEA 1N8JA 4YQMA 2CAQA 3VFIA 3FR3A 3I6AA 4WKWA 4CHSA 1Z6NA 2AAWA 5GZZB 5AGYA 2EIQA 5JCUA 4XCSA 2E2MA 4TKYA 1J9BA 5IMFA 3I69A 4PTSA 5GSTA 1PGTA 3CSHA 1PQNA 2MBTA 1B4PA 4F9ZA 3F9UA 2LJRA 1TW9A 1BG5A 3KCMA 4X0XA 3KZQA 4ULXA 2DKHA 4H86A 2EC4A 4JR6A 4HOJA 4DVCA 1QMVA 4TR4A 4IVFA 5HQPA 4IGJA 2IMKA 3IC4A 1GLPA 22GSA 5CRHA 2AYTA 3UBKA 1G0TA 1E6BA 1XVWA 4CY8A 5A4UA 3H93A 1M7TA 5DALB 5F06A 1M2AA 3FZ9A 5G1LA 3KH9A 3LORA 5ELAA 4BA7A 1O8XA 2LRNA 2HSYA 1T1VA 1ABAA 5H5QA 2H0IA 3I9V2 4MP4A 4ZL7A 2J9HA 2VOCA 3M3MA 2C0EA 5F07A 2B6MA 2GLRA 2DLXA 1LJRA 3GRXA 3ZMKA 4MPFA 5HR3A 2QC7A 4RI6A 4E8HA 4KDUA 2FHEA 4RUVA 2EIOA 5DAKB 3PR8A 1OC3A 3KD0A 1ERTA 3EYTA 2P5RA 1DUGA 4Q5RA 4GSSA 4KSOA 4BVYB 5KOWA 3QFBC 1R7HA 5ECMB 1GWCA 1WMJA 1ZYNA 4FYCA 3VK9A 3A3TA 3LYKA 1UC7A 1EWXA 2O87A 5DQSA 5HFKA 2TRCP 1LU4A 2TRXA 3WD6A 5ECOB 3D22A 1PRXA 2I3YA 1V58A 1F2EA 3TJJA 4ZBDA 2Z9SA 1F9MA 6GSVA 2YWMA 3PH9A 2LJKA 4I2TA 4PXOA 4O5QA 3TJKA 4TR0A 1FB0A 2V1MA 3KMOA 1XWAA 4ZB6A 3H1NA 3LW9A 2GZPA 5AIVA 3IR4A 1VRSD 5D9VA 1G7EA 3GH9A 5ECQB 2OKAA 2H0GA 5CO3A 5B6NA 2WB9A 4LMVA 4ML6A 1XOAA 5LCZA 4WXTA 2G0FA 1TK0B 5ID2A 2HRFA 3LQ7A 4NV5A 4POMA 3MNGA 5ECHB 2C0DA 1ON4A 1AXDA 3GHAA 1K0AA 1KEBA 2LUSA 5COHA 3EC3A 1N2AA 3EPTA 3KTBA 4BPYA 4HSCX 3ZIJA 5ECPB 3F0IA 2N5FA 4MF5A 3TRPA 4N0VA 4Z2UA 3DGQA 3Q19A 2FWFA 1A2JA 4XS4A 4TOPA 4NMUA 3C1SA 5F05A 2DSAA 1T4ZA 2DC5A 1X9SB 1FO5A 3HA9A 1KTEA 5C00A 1WIKA 2VL3A 1TI1A 1CQHA 3VWUA 2HZEB 3LFLA 1NSWA 3CRUA 4ZIJA 3HJMA 4G2EA 1PX6A 2OBKA 3J7Yb 1M9BA 1M99A 4YAPA 4X4JA 3IHGA 4PGTA 4OFMA 4QL7A 1Z3EA 4JZQA 2PPTA 3DYRA 4MJBA 1FOHA 4X43A 3IDVA 18GSA 1DE2A 2FWGA 4TXVA 5IOXA 3BCIA 3U6VA 1AUCA 4IP1A 2C3NA 5DJMA 1HQOA 1ZMAA 4K7OA 4KUNA 5G2ZA 3PGTA 1ILOA 3CMIA 1VGLA 3ZZXA 2DJ3A 3NOFA 4GLTA 1EP8A 5EPFA 4XRAA 2H75A 4KW6A 5LD0A 3ERGA 2GVPA 3CSIA 1XZOA 3VWWA 4G0LA 2P0GA 2TIRA 4IQAA 2RLIA 4MH3A 6GSXA 1YKAA 1SJZA 2P31A 1EV9A 3O3TA 5IMVA 3HD5A 5CP1A 1S3AA 4YQVA 1C72A 1XW5A 4MDCA 1G6YA 4N30A 4AJ7A 1GSYA 1PX7A 1TDIA 2YCDA 3FZ4A 1PKWA 2K18A 3WT2A 1EV4A 3QAGA 3VI7A 3QOUA 2WDUA 3GTUA 4MJEA 3VPTA 2GSTA 3GKKA 1B4QA 2CV4A 4O7HA 3TJBA 4PNGA 1O7UA 3PINA 1K3LA 1GL8A 5D96A 1URMA 3ZRDA 3FY7A 3LXZA 1TJDA 3D4TA 1SKWB 3A5WA 4NHZA 4CW9A 2YWOA 5IPHA 3HXSA 5KN2A 4HU9A 3L9UA 3FMWA 2CVBA 3HVSA 5DDLA 4AF2A 3P7XA 3RPPA 2H70A 1BYEA 4PX1A 1YKCA 3UVHA 1FG4A 3GX0A 3EU3A 2C0GA 1GSDA 4L5LA 1S3RA 3GUSA 2AB6A 3UMAA 3P2AA 3W6GA 4K5SA 3RBTA 2IMDA 4DSRA 1TU7A 2H6ZA 2N5BA 4WF5A 4TXOB 4NXIA 1ZYEA 2X49A 4OO4A 1QQ2A 1QXHA 3WGEA 1SU9A 2HZFA 3IK9A 1TKDB 2VAFA 2H6XA 4GRFA 1S3CA 1M0UA 2ALBA 5GSSA 3GSTA 3H4KA 1B48A 1RW1A 3HYPA 4Q5NA 2C80A 3ME8A 4MPGA 1V40A 2BMXA 4CDOA 5A4WA 1QFNA 3G9BA 4ID0A 2IIYA 5IMZA 2FA8A 2RUEA 3W8SA 3GL3A 1A23A 1K0DA 3DKSA 3EMXA 2H73A 2B5EA 1X5DA 2WCIA 4CY6A 3M1GA 5DCHA 2DJ2A 1Q4JA 1M9AA 1LBKA 2HSHA 1EGOA 3KH7A 3VWXA 3U5RE 2V6KA 3F4TA 4KA0A 3ERWA 5IM9A 5B6MA 2N5AA 3RHBA 2LSTA 4MK3A 1Z9HA 3ZLPA
chains in the Genus database with same CATH topology
3KP9A 1DE1A 1MD4A 1IYIA 1ZZYA 4GTUA 3N5OA 5DALA 2OJLA 2ZNMA 4Z2TA 3A2VA 3C1RA 2I81A 1R4WA 3HJOA 2CVDA 1ZGNA 2YWIA 2R0PA 3KJYA 2JZRA 2K8SA 2GT6A 5AIXA 4AGSA 3EURA 5B8AA 2NPBA 3KTLA 3D6IA 2WS2A 3V1WA 4IS0A 4GF0A 4O5RA 3UEMA 2RIIA 3HVXA 4EE0A 5DAKA 2KP2A 1WPIA 1SJ6A 2XBIA 2MMNA 1AQXA 4BVYA 3NIVA 2C3QA 1T4YA 1EZKA 4KDXA 5ECRB 2H1GA 3CYNA 5DVBA 2GTUA 1OC9B 1AAZA 3CSJA 4MABA 4LA1A 3HY2A 5INYA 2YWNA 5AN1A 1WP0A 2A4HA 1K0CA 1Z5YE 4G0KA 1YZXA 3HDCA 5IIZA 20GSA 2MMAA 2RM5A 1G6WA 4EDZA 3Q18A 1ERUA 5KN0A 2DBCA 2H1DA 2HRNA 2BJXA 2LEGA 1FAAA 2M46A 3M9KA 4I8BA 2F9SA 1A0RP 3DD3A 2GQMA 2H71A 3KMNA 4F82A 4D73B 2LRTA 4K9ZA 2LQQA 1WE0A 1UN2A 2K9FA 1TK5B 1MEKA 1Y6EA 4XHMA 3TOTA 4N10A 3WYWA 2L59A 2P5QA 1EOGA 3LJRA 3I43A 3RAZA 4K2XA 1ZYPA 1GUMA 5C04A 2B5YA 5GAND 4HZ2A 5HR1A 1FOVA 3IXRA 5CRWA 3E9JB 3O76A 2J23A 3UIWA 1TRVA 1SD9A 3G7IA 1JZOA 2FA4A 2XBQA 3FR6A 2NTOA 4TR3A 1U87A 2DMLA 2PVQA 3MWHA 2VD1A 3E3EA 2LKUA 1MDIA 2HZEA 3APQA 1F37A 4BWQA 4DSSB 1A2LA 4KH7A 4HJMA 4N11A 2H19A 3L78A 5DJLA 1GULA 3TB2A 4WBRD 3FR9A 3TUEA 3ISOA 1IYHA 5CNWA 2HSMA 1THOA 4V1Ag 3IBHA 4G19A 2DJKA 1PN9A 1XW6A 5JWQB 4HZ4A 4F2IA 3QAWA 1K3YA 4ECIA 3ZFBA 1MTCA 3G7JA 2QKEA 2A2SA 3A2XA 3ZITA 4F0CA 1W89A 5A4VA 3KP8A 1E2YA 1TP9A 3HJPA 2YANA 3HHVA 3IAS2 2O8VB 4POLA 5ECSA 1PD21 1XBSA 3F6FA 4WBJA 2VM2A 3GNJA 4QL9A 3TJGA 2ON5A 2HXKA 3DXBA 3IV4A 2C8UA 5ABRA 2OACA 2OA7A 3W8JA 1JFUA 2JSZA 1V57A 2PU9C 4IBPA 4ZL8A 5BMUA 4ZL9A 1GNEA 2L4QA 6GSUA 4ICYA 1OYJA 4BL7B 2WGRA 1Z7PA 1S3DA 1RK4A 1U6TA 2KUCA 3KGKA 2X64A 4BVXB 1SK1A 4OFNA 2LNTA 1TRUA 5ELGA 3P90A 2XHFA 3C8EA 4WETA 5EL8A 2QSIA 2JZTA 4RQRA 4ZXGA 2OADA 4IKHA 1GSFA 2CA8A 2LRCA 4MNNA 2ON7A 2LS5A 2CVKA 5FWGA 5BRTA 5J4UA 3TKPA 3GKMA 2O85A 2K6VA 2JADA 2H0HA 2NBSA 4NV2A 1GTUA 5E4WA 2H8LA 14GSA 5D93A 3F6DA 2NVLA 4TXOA 4K7IA 4EKZA 3R2QA 4TVEA 4L0WA 4HI7A 4ZBAA 3ZYWA 2IMEA 4YAVA 4XIHA 4TR1B 4POBA 5IMCA 4OWYA 2E7PA 2CQ9A 5B7CA 1U3AA 2HT9A 2L4CA 1JLWA 1WWJA 4HJ2A 4G9HA 5HFGA 1B9XC 1SL2B 4EIPA 4ECJA 16GSA 12GSA 1GTIA 2H76A 5D9WA 4MZCA 5G1KA 2M80A 2UZ8A 7GSSA 4J2FA 3FZ5A 2CZ3A 2H72A 2NDOA 2H30A 2VCTA 4OCFA 2PVOC 2HYXA 3GH6A 2C0FA 2R0CA 3UJ1A 1GRXA 3QR6A 1SKSB 2LNSA 1V9WA 4HQSA 3CXGA 4MMMA 3MYDA 4PUAA 1K0OA 2M72A 3WT1A 3HZ8A 2YJHA 4JRRA 1J0FA 4EO3A 2VL2C 4HU7A 2VLVA 4KF9A 1UA5A 2LQOA 3LSZA 4Q5FA 2R0GA 2HRKA 4JE1A 1GUKA 3Q6OA 3HKRA 2GT5A 1BX9A 3M9JA 1W4VA 1XVQA 2F3MA 1R5AA 4F03A 3RDWA 1OVNA 1SYXA 4Q5QA 4WR5A 4Z7XA 1K0NA 4XS4B 4ZB8A 4K0GA 3IOSA 1BAYA 4WF4A 2RM6A 1O85A 4MF6A 1MDJA 4YQUA 5KN3A 4ZBBA 4IJIA 1JLVA 4IHUA 1RQMA 2DKIA 1T7PB 3QCPA 3HCZA 3LWAA 4QQ7A 3UBLA 1VF4A 1HNBA 1OC9A 3FW2A 4PQ1A 5ECNB 1X9WB 3UVTA 3QD9A 3EU4A 3AY8A 5HR0A 3CTGA 4YKFA 2L6DA 4USSA 2XC2A 4KCEA 4AJ8A 2AJQB 1TXXA 5J9CA 11GSA 1SL0B 1NM3A 3WGXA 5D73A 2ZCTA 3BOAA 3GL5A 5KN1A 2OE3A 4V2NA 1TRWA 3GKNA 4FH8A 2VL9A 2H1BA 4IJ3A 3BD2A 3DRNA 3DVWA 1MD3A 1A8YA 1OKDA 1TI3A 3R3EA 5G31A 3TDGA 2IJYA 3FRCA 4K7NA 4DEJA 3QPMA 2G2QA 1HNCA 5D9XA 3KEBA 1PKZA 4PNFA 3D0ZA 1PA3A 2R37A 4Z2RA 6GSWA 2FWEA 1TRSA 3EE2A 2IWTA 1EEJA 1ZOFA 3EINA 4FO5A 2GS3A 4NHWA 1GNWA 2OBIA 1Z7RA 2H01A 2YNXA 2A2RA 5IO2A 4L0UA 2GZZA 4KNDA 4MZWA 2F51A 1JZWA 2I4AA 3TJFA 4PURA 1ERVA 8GSSA 1JHBA 3UOMA 4ZB9A 5JWOB 2VIMA 4EXJA 4FYBA 2B3SA 2VD0A 5IPGA 1VF1A 1GSEA 4DSQA 1O81A 1XCCA 1SENA 5D8IA 3C7MA 1GLQA 3QAVA 3N9JA 3F63A 4HS1A 5KOXA 4ILFA 1AQVA 2AHEA 4ZILA 1T00A 6GSSA 2DJJA 1MDKA 4K5RA 5HFIA 4ECCA 2A2PA 3ZTLA 4TW5A 3US3A 2FY6A 2PGTA 2R6KA 1A2MA 4V1Ap 1GTAA 4J56E 1AW9A 1ZYQB 2O7KA 1XWBA 4GSTA 2VCXA 5AISA 5CAXA 3D21A 13GSA 4GQCA 2L6CA 2JZSA 2HNLA 2DIYA 4GXZA 1NHYA 2HRAA 2JACA 3IK7A 2F8FA 4HQZA 1USBA 5IO0A 2JU5A 2KP1A 1HNAA 3A5IA 1F3AA 4HDEA 2VM1A 5J5NA 1QUWA 3QMXA 1U3IA 2D2ZA 1J08A 2C1YA 2PMTA 2FUG2 3F8UA 5D9TA 2VLTA 5DBQA 4KB3A 1K0MA 1F6MC 3P8WA 1YEXA 2WULA 5H5RA 4OD7A 2KLXA 2GGTA 1G7OA 3E0UA 1H75A 1BEDA 5FHIA 5ECIB 1V98A 4KAEA 4BL7A 5G5EA 4MA9A 3MAKA 3TRXA 4ISDA 3ZVJD 1DBYA 9GSSA 3Q74A 4RI7A 4BWSA 1AIUA 3FK8A 4BVXA 4G0IA 1FB6A 5GAPD 2B7KA 5J3RA 2FD3A 1XWKA 1GH2A 1K0BA 3LXTA 3TKSE 1O6JA 3TOUA 4HUAA 2MMOA 3GIXA 1HD2A 2DJ1A 4LL1B 5KEJA 3CTFA 3SBCA 4GSNA 2K8VA 3VURA 1YQ1A 3GA4A 1ZL9A 2LTKA 3ZREA 4I6XA 3EWLA 3HZ4A 1TTZA 2JL4A 2IFQB 3GMFA 3O6TA 2XPEA 2YN1A 3ZIVA 1QK8A 3DMLA 2X8GA 2I1UA 4TN8A 3TKRA 4KX4A 1SD8A 3DVXA 2VLUA 1I5GA 3GKXA 4L5OA 4MF7A 2VCZA 2IMIA 2VL2A 4WEYA 1THXA 4K6XA 4V2MA 4XRDA 1A0FA 3TRQA 2YZUA 2FNOA 3L4NA 1XXUA 3IC8A 2WZ9A 3UAPA 1SJIA 2B1LA 4K8MA 5IOWA 3KM6A 2WFCA 2VCWA 3MIXA 1R5PA 4TR1A 3GSSA 2C3TA 2H1AA 2OE1A 5G30A 3L9SA 1BQ7A 5G5FA 1T3BA 1XW9A 2V2GA 1YEPA 3DIEA 3TCOA 3IHQA 5B8BA 3VWVA 4MCUA 2X8HA 5A5KA 1TU8A 4KGIA 2IL3A 2DJ0A 19GSA 2L5LA 3HVVA 4EL1A 3FKFA 5FT3A 4KSMA 1YF0A 4LLRA 1U88A 2YV9A 3F4SA 1O73A 1SK0A 3APOA 2VCVA 3DWVA 2V32A 4K0NA 1XWGA 3BJ5A 2HI7A 4KCAA 2MBSA 4PUFC 3VPQA 1EGRA 4I2UA 1GP1A 1HYUA 2DMMA 4MJAA 3F3RA 2WRTA 4IW9A 2I9HA 1R26A 2GQLA 2QGVA 2MZCA 4XS6A 2ES7A 1TK8B 1M2BA 3RHCA 3TKSC 1Q98A 3IRAA 5ECKB 5J9BA 4TRXA 1DSBA 1OC8A 3SWLA 2JSYA 4EVMA 3K8NA 4EDYA 3GURA 5ECLB 5ENUA 1EOHA 2GDRA 4A5PA 2VUPA 3C73A 1O8WA 2HFDA 2YZHA 4RQXA 3J7Yk 2RUFA 4AJ6A 4EIQA 3FEUA 3LGCA 2R5GA 5H5SA 5DQYA 4IQ1A 1GSUA 1GSSA 2HE3A 3F4RA 1EP7A 3ZVJA 4POKA 3D4MA 3ERFA 1OAZA 2GSRA 2R4VA 5HR2A 3LG6A 5CRDA 2E2GA 1YF1A 5JCGA 4G10A 4L8EA 2V6OA 3D5JA 1ST9A 1NHOA 2R3XA 4XS1A 2REMA 4O5UA 1X5EA 2QA2A 3ME7A 1CQGA 1JZRA 2IMFA 4IELA 2X99A 2CZ2A 5J41A 2F8AA 4JR4A 1GUHA 1XFLA 3LEFA 2WJUA 1SKRB 1H4OA 3L0HA 1UVZA 2YV7A 4YKGA 4P3YB 3UARA 2LV3A 3M0FA 3VI5A 1XIYA 4X1UA 4FIWA 3EVIA 2L5OA 6GSYA 5EY6A 3IA1A 3ED3A 2YOIA 4FQUA 4O92A 3DEXA 10GSA 4HEA2 4K1FA 4PQHA 4EC0A 4MLYA 3CBUA 4J57E 4E8EA 4IN0A 2V41A 4ML1A 1TOFA 2PUKC 4XTSA 4JBBA 2FCHA 3FHKA 3WGDA 5ID2B 4KE3A 2MYGA 6GSTA 1AQWA 3G7YA 2CX4A 2MMZA 1GSQA 3FYGA 3L9VA 5LNKe 4KDYA 4IP6A 1M2DA 1PN0A 2ZUPA 1BJXA 2H6YA 1FHEA 4EUYA 1B8XA 2BTOT 1XWCA 3KIJA 4ACSA 1A24A 17GSA 2YP6A 2LJAA 3BCKA 3IE3A 1WOUA 1PMTA 4ECBA 2HLSA 4I97A 3ZMLA 4NAXA 3H8QA 3PPUA 4YH2A 2R2JA 3JCML 2AV4A 1XOBA 2FWHA 3LYPA 1SL1B 1VF2A 1FVKA 2CT6A 5F0GA 2GSSA 3F3QA 4MJCA 1WJKA 1Y25A 1OE7A 5IMDA 4F0BA 3EMPA 1OKTA 5CYYA 2X4AA 1B9YC 2DIZA 2GSQA 2VO4A 5L71A 1PL1A 5E59A 2FLSA 3NZNA 4N0ZA 3OR5A 2KOKA 2FGXA 2IPAA 5DCGA 3KXOA 5IQYA 3GV1A 1X5CA 1ML6A 3IAM2 4LMWA 4NWYA 1FVJA 3ZFLA 2CX3A 1YY7A 1AC1A 5JCWA 1PL2A 1K3OA 2H74A 2B7JA 4I5QA 1X0RA 3BBYA 2KHPA 2H66A 1ERWA 2EIRA 2AUVA 4MH2A 1SYRA 4D73A 1OE8A 3QFAC 3M8NA 5IMAA 1YDKA 4V2LA 1I9DA 2PERA 4GQFA 1T8EB 3CRTA 3H79A 1F3BA 1FW1A 3FZAA 3UL3A 4OO5A 2PBJA 1ZCPA 3RPNA 4NPBA 4WR4A 2QA1A 3ZL5A 1X9MB 2X8CA 4GWRA 1Z6MA 5CRGA 3GYKA 3GN3A 4JEDA 1XPVA 4JU5A 3GTUB 5JWRB 2CAIA 5EVOA 1GTBA 3QDNA 1V2AA 3MDKA 4GCIA 2OE0A 3MSZA 1PSQA 2VCQA 3C71A 1YJ6A 1WRYA 2YJ7A 2B5XA 1A8LA 2B1KA 3A2WA 4EF0A 4O32A 1JZDA 2E0QA 4LL4B 3GFKA 2PN8A 1QGVA 1ACVA 5F8BA 2O89A 4DSSA 2YPMA 2IFQA 3VLNA 4K2DA 1KNGA 2GQKA 2C4JA 3GX8A 4FYUA 3IPZA 4OFTA 2XPDA 1NW2A 2IN3A 2L57A 1EEMA 2PWJA 2A4VA 3S9FA 1SK2A 3TKSA 1KBNA 3APSA 3TGZA 4OMVA 5CREA 1VF3A 4MZBA 2GZYA 4PQIA 3TKQA 4OCEA 1N8JA 4YQMA 2CAQA 3VFIA 3FR3A 3I6AA 4WKWA 4CHSA 1Z6NA 2AAWA 5GZZB 5AGYA 2EIQA 5JCUA 4XCSA 2E2MA 4TKYA 1J9BA 5IMFA 3I69A 4PTSA 5GSTA 1PGTA 3CSHA 1PQNA 2MBTA 1B4PA 4F9ZA 3F9UA 2LJRA 1TW9A 1BG5A 3KCMA 4X0XA 3KZQA 4ULXA 2DKHA 4H86A 2EC4A 4JR6A 4HOJA 4DVCA 1QMVA 4TR4A 4IVFA 5HQPA 4IGJA 2IMKA 3IC4A 1GLPA 22GSA 5CRHA 2AYTA 3UBKA 1G0TA 1E6BA 1XVWA 4CY8A 5A4UA 3H93A 1M7TA 5DALB 5F06A 1M2AA 3FZ9A 5G1LA 3KH9A 3LORA 5ELAA 4BA7A 1O8XA 2LRNA 2HSYA 1T1VA 1ABAA 5H5QA 2H0IA 3I9V2 4MP4A 4ZL7A 2J9HA 2VOCA 3M3MA 2C0EA 5F07A 2B6MA 2GLRA 2DLXA 1LJRA 3GRXA 3ZMKA 4MPFA 5HR3A 2QC7A 4RI6A 4E8HA 4KDUA 2FHEA 4RUVA 2EIOA 5DAKB 3PR8A 1OC3A 3KD0A 1ERTA 3EYTA 2P5RA 1DUGA 4Q5RA 4GSSA 4KSOA 4BVYB 5KOWA 3QFBC 1R7HA 5ECMB 1GWCA 1WMJA 1ZYNA 4FYCA 3VK9A 3A3TA 3LYKA 1UC7A 1EWXA 2O87A 5DQSA 5HFKA 2TRCP 1LU4A 2TRXA 3WD6A 5ECOB 3D22A 1PRXA 2I3YA 1V58A 1F2EA 3TJJA 4ZBDA 2Z9SA 1F9MA 6GSVA 2YWMA 3PH9A 2LJKA 4I2TA 4PXOA 4O5QA 3TJKA 4TR0A 1FB0A 2V1MA 3KMOA 1XWAA 4ZB6A 3H1NA 3LW9A 2GZPA 5AIVA 3IR4A 1VRSD 5D9VA 1G7EA 3GH9A 5ECQB 2OKAA 2H0GA 5CO3A 5B6NA 2WB9A 4LMVA 4ML6A 1XOAA 5LCZA 4WXTA 2G0FA 1TK0B 5ID2A 2HRFA 3LQ7A 4NV5A 4POMA 3MNGA 5ECHB 2C0DA 1ON4A 1AXDA 3GHAA 1K0AA 1KEBA 2LUSA 5COHA 3EC3A 1N2AA 3EPTA 3KTBA 4BPYA 3ZIJA 5ECPB 3F0IA 2N5FA 4MF5A 3TRPA 4N0VA 4Z2UA 3DGQA 3Q19A 2FWFA 1A2JA 4XS4A 4TOPA 4NMUA 3C1SA 5F05A 2DSAA 1T4ZA 2DC5A 1X9SB 1FO5A 3HA9A 1KTEA 5C00A 1WIKA 2VL3A 1TI1A 1CQHA 3VWUA 2HZEB 3LFLA 1NSWA 3CRUA 4ZIJA 3HJMA 4G2EA 1PX6A 2OBKA 3J7Yb 1M9BA 1M99A 4YAPA 4X4JA 3IHGA 4PGTA 4OFMA 4QL7A 1Z3EA 4JZQA 2PPTA 3DYRA 4MJBA 1FOHA 4X43A 3IDVA 18GSA 1DE2A 2FWGA 4TXVA 5IOXA 3BCIA 3U6VA 1AUCA 4IP1A 2C3NA 5DJMA 1HQOA 1ZMAA 4K7OA 4KUNA 5G2ZA 3PGTA 1ILOA 3CMIA 1VGLA 3ZZXA 2DJ3A 3NOFA 4GLTA 1EP8A 5EPFA 4XRAA 2H75A 4KW6A 5LD0A 3ERGA 2GVPA 3CSIA 1XZOA 3VWWA 4G0LA 2P0GA 2TIRA 4IQAA 2RLIA 4MH3A 6GSXA 1YKAA 1SJZA 2P31A 1EV9A 3O3TA 5IMVA 3HD5A 5CP1A 1S3AA 4YQVA 1C72A 1XW5A 4MDCA 1G6YA 4N30A 4AJ7A 1GSYA 1PX7A 1TDIA 2YCDA 3FZ4A 1PKWA 2K18A 3WT2A 1EV4A 3QAGA 3VI7A 3QOUA 2WDUA 3GTUA 4MJEA 3VPTA 2GSTA 3GKKA 1B4QA 2CV4A 4O7HA 3TJBA 4PNGA 1O7UA 3PINA 1K3LA 1GL8A 5D96A 1URMA 3ZRDA 3FY7A 3LXZA 1TJDA 3D4TA 1SKWB 3A5WA 4NHZA 4CW9A 2YWOA 5IPHA 3HXSA 5KN2A 4HU9A 3L9UA 3FMWA 2CVBA 3HVSA 5DDLA 4AF2A 3P7XA 3RPPA 2H70A 1BYEA 4PX1A 1YKCA 3UVHA 1FG4A 3GX0A 3EU3A 2C0GA 1GSDA 4L5LA 3GUSA 2AB6A 3UMAA 3P2AA 3W6GA 4K5SA 3RBTA 2IMDA 4DSRA 1TU7A 2H6ZA 2N5BA 4WF5A 4TXOB 4NXIA 1ZYEA 2X49A 4OO4A 1QQ2A 1QXHA 3WGEA 1SU9A 2HZFA 3IK9A 1TKDB 2VAFA 2H6XA 4GRFA 1S3CA 1M0UA 2ALBA 5GSSA 3GSTA 3H4KA 1B48A 1RW1A 3HYPA 4Q5NA 2C80A 3ME8A 4MPGA 1V40A 2BMXA 4CDOA 5A4WA 1QFNA 3G9BA 4ID0A 2IIYA 5IMZA 2FA8A 2RUEA 3W8SA 3GL3A 1A23A 1K0DA 3DKSA 3EMXA 2H73A 2B5EA 1X5DA 2WCIA 4CY6A 3M1GA 5DCHA 2DJ2A 1Q4JA 1M9AA 1LBKA 2HSHA 1EGOA 3KH7A 3VWXA 3U5RE 2V6KA 3F4TA 4KA0A 3ERWA 5IM9A 5B6MA 2N5AA 3RHBA 2LSTA 4MK3A 1Z9HA 3ZLPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KP9 A;  1DE1 A;  1MD4 A;  1IYI A;  1ZZY A;  4GTU A;  3N5O A;  5DAL A;  2OJL A;  2ZNM A;  3A2V A;  3C1R A;  2I81 A;  1R4W A;  3HJO A;  2CVD A;  1ZGN A;  2YWI A;  3KJY A;  2JZR A;  2K8S A;  2GT6 A;  5AIX A;  4AGS A;  3EUR A;  5B8A A;  2NPB A;  3KTL A;  3D6I A;  2WS2 A;  3V1W A;  4IS0 A;  4GF0 A;  4O5R A;  3UEM A;  2RII A;  3HVX A;  4EE0 A;  5DAK A;  2KP2 A;  1WPI A;  1SJ6 A;  2XBI A;  2MMN A;  1AQX A;  4BVY A;  3NIV A;  2C3Q A;  1T4Y A;  1EZK A;  4KDX A;  5ECR B;  2H1G A;  3CYN A;  5DVB A;  2GTU A;  1OC9 B;  1AAZ A;  3CSJ A;  4MAB A;  4LA1 A;  3HY2 A;  5INY A;  2YWN A;  5AN1 A;  1WP0 A;  1K0C A;  1Z5Y E;  1YZX A;  3HDC A;  5IIZ A;  20GS A;  2MMA A;  2RM5 A;  1G6W A;  4EDZ A;  3Q18 A;  1ERU A;  5KN0 A;  2DBC A;  2H1D A;  2HRN A;  2BJX A;  2LEG A;  1FAA A;  2M46 A;  3M9K A;  4I8B A;  2F9S A;  1A0R P;  3DD3 A;  2GQM A;  2H71 A;  3KMN A;  4F82 A;  4D73 B;  2LRT A;  4K9Z A;  2LQQ A;  1WE0 A;  1UN2 A;  2K9F A;  1TK5 B;  1MEK A;  1Y6E A;  4XHM A;  3TOT A;  4N10 A;  3WYW A;  2L59 A;  2P5Q A;  1EOG A;  3LJR A;  3I43 A;  3RAZ A;  1GUM A;  5C04 A;  2B5Y A;  5GAN D;  4HZ2 A;  5HR1 A;  1FOV A;  3IXR A;  5CRW A;  3E9J B;  3O76 A;  2J23 A;  3UIW A;  1TRV A;  1SD9 A;  3G7I A;  1JZO A;  2FA4 A;  2XBQ A;  3FR6 A;  2NTO A;  4TR3 A;  1U87 A;  2DML A;  2PVQ A;  3MWH A;  2VD1 A;  3E3E A;  2LKU A;  1MDI A;  2HZE A;  3APQ A;  1F37 A;  4BWQ A;  4DSS B;  1A2L A;  4KH7 A;  4HJM A;  4N11 A;  2H19 A;  3L78 A;  5DJL A;  1GUL A;  3TB2 A;  4WBR D;  3FR9 A;  3TUE A;  3ISO A;  1IYH A;  5CNW A;  1THO A;  4V1A g;  3IBH A;  4G19 A;  2DJK A;  1PN9 A;  1XW6 A;  5JWQ B;  4HZ4 A;  4F2I A;  3QAW A;  1K3Y A;  4ECI A;  3ZFB A;  1MTC A;  3G7J A;  2QKE A;  2A2S A;  3A2X A;  3ZIT A;  4F0C A;  1W89 A;  5A4V A;  3KP8 A;  1E2Y A;  1TP9 A;  3HJP A;  2YAN A;  3HHV A;  3IAS 2;  2O8V B;  4POL A;  5ECS A;  1PD2 1;  1XBS A;  3F6F A;  4WBJ A;  2VM2 A;  3GNJ A;  4QL9 A;  3TJG A;  2ON5 A;  2HXK A;  3DXB A;  3IV4 A;  2C8U A;  5ABR A;  2OAC A;  2OA7 A;  3W8J A;  1JFU A;  2JSZ A;  1V57 A;  2PU9 C;  4IBP A;  4ZL8 A;  4ZL9 A;  1GNE A;  2L4Q A;  6GSU A;  1OYJ A;  2WGR A;  1Z7P A;  1S3D A;  1RK4 A;  1U6T A;  2KUC A;  3KGK A;  2X64 A;  1SK1 A;  4OFN A;  2LNT A;  1TRU A;  5ELG A;  3P90 A;  2XHF A;  3C8E A;  4WET A;  5EL8 A;  2QSI A;  2JZT A;  4RQR A;  4ZXG A;  2OAD A;  4IKH A;  1GSF A;  2CA8 A;  2LRC A;  2ON7 A;  2LS5 A;  2CVK A;  5FWG A;  5J4U A;  3TKP A;  3GKM A;  2O85 A;  2K6V A;  2JAD A;  2H0H A;  2NBS A;  4NV2 A;  1GTU A;  5E4W A;  2H8L A;  14GS A;  5D93 A;  3F6D A;  2NVL A;  4TXO A;  4K7I A;  4EKZ A;  3R2Q A;  4TVE A;  4L0W A;  4HI7 A;  4ZBA A;  3ZYW A;  2IME A;  4YAV A;  4XIH A;  4TR1 B;  4POB A;  5IMC A;  4OWY A;  2E7P A;  2CQ9 A;  5B7C A;  1U3A A;  2HT9 A;  2L4C A;  1JLW A;  1WWJ A;  4HJ2 A;  4G9H A;  5HFG A;  1B9X C;  1SL2 B;  4ECJ A;  16GS A;  12GS A;  1GTI A;  2H76 A;  5D9W A;  4MZC A;  5G1K A;  2M80 A;  7GSS A;  4J2F A;  3FZ5 A;  2CZ3 A;  2H72 A;  2NDO A;  2H30 A;  2VCT A;  4OCF A;  2PVO C;  2HYX A;  3GH6 A;  2C0F A;  3UJ1 A;  1GRX A;  3QR6 A;  1SKS B;  2LNS A;  1V9W A;  4HQS A;  3CXG A;  4MMM A;  4PUA A;  1K0O A;  2M72 A;  3WT1 A;  3HZ8 A;  2YJH A;  4JRR A;  1J0F A;  4EO3 A;  2VL2 C;  4HU7 A;  2VLV A;  1UA5 A;  2LQO A;  3LSZ A;  4Q5F A;  4JE1 A;  1GUK A;  3Q6O A;  3HKR A;  2GT5 A;  1BX9 A;  3M9J A;  1W4V A;  1XVQ A;  2F3M A;  1R5A A;  4F03 A;  3RDW A;  1OVN A;  1SYX A;  4Q5Q A;  4WR5 A;  4Z7X A;  1K0N A;  4XS4 B;  4ZB8 A;  4K0G A;  3IOS A;  1BAY A;  4WF4 A;  2RM6 A;  1O85 A;  4MF6 A;  1MDJ A;  4YQU A;  5KN3 A;  4ZBB A;  4IJI A;  1JLV A;  4IHU A;  1RQM A;  1T7P B;  3QCP A;  3HCZ A;  3LWA A;  4QQ7 A;  3UBL A;  1VF4 A;  1HNB A;  1OC9 A;  3FW2 A;  4PQ1 A;  5ECN B;  1X9W B;  3UVT A;  3QD9 A;  3EU4 A;  3AY8 A;  5HR0 A;  3CTG A;  2L6D A;  2XC2 A;  4KCE A;  4AJ8 A;  2AJQ B;  1TXX A;  5J9C A;  11GS A;  1SL0 B;  1NM3 A;  3WGX A;  5D73 A;  2ZCT A;  3BOA A;  3GL5 A;  5KN1 A;  2OE3 A;  4V2N A;  1TRW A;  3GKN A;  4FH8 A;  2VL9 A;  2H1B A;  4IJ3 A;  3BD2 A;  3DRN A;  3DVW A;  1MD3 A;  1A8Y A;  1OKD A;  1TI3 A;  5G31 A;  3TDG A;  2IJY A;  3FRC A;  4K7N A;  4DEJ A;  3QPM A;  2G2Q A;  1HNC A;  5D9X A;  3KEB A;  1PKZ A;  4PNF A;  3D0Z A;  1PA3 A;  2R37 A;  6GSW A;  2FWE A;  1TRS A;  3EE2 A;  2IWT A;  1EEJ A;  1ZOF A;  3EIN A;  4FO5 A;  2GS3 A;  4NHW A;  1GNW A;  2OBI A;  1Z7R A;  2H01 A;  2YNX A;  2A2R A;  5IO2 A;  4L0U A;  2GZZ A;  4KND A;  4MZW A;  2F51 A;  1JZW A;  2I4A A;  3TJF A;  4PUR A;  1ERV A;  8GSS A;  1JHB A;  3UOM A;  4ZB9 A;  5JWO B;  2VIM A;  4EXJ A;  4FYB A;  2B3S A;  2VD0 A;  5IPG A;  1VF1 A;  1GSE A;  4DSQ A;  1O81 A;  1XCC A;  1SEN A;  5D8I A;  3C7M A;  1GLQ A;  3QAV A;  3N9J A;  3F63 A;  4HS1 A;  4ILF A;  1AQV A;  2AHE A;  4ZIL A;  1T00 A;  6GSS A;  2DJJ A;  1MDK A;  4ECC A;  5HFI A;  3ZTL A;  4TW5 A;  3US3 A;  2FY6 A;  2PGT A;  2R6K A;  1A2M A;  4V1A p;  1GTA A;  4J56 E;  1AW9 A;  1ZYQ B;  2O7K A;  1XWB A;  4GST A;  2VCX A;  5AIS A;  5CAX A;  3D21 A;  13GS A;  4GQC A;  2L6C A;  2JZS A;  2HNL A;  2DIY A;  4GXZ A;  1NHY A;  2JAC A;  3IK7 A;  2F8F A;  4HQZ A;  1USB A;  5IO0 A;  2JU5 A;  2KP1 A;  1HNA A;  1F3A A;  4HDE A;  2VM1 A;  5J5N A;  1QUW A;  3QMX A;  1U3I A;  2D2Z A;  1J08 A;  2C1Y A;  2PMT A;  2FUG 2;  3F8U A;  5D9T A;  2VLT A;  5DBQ A;  4KB3 A;  1K0M A;  1F6M C;  3P8W A;  1YEX A;  2WUL A;  5H5R A;  4OD7 A;  2KLX A;  2GGT A;  1G7O A;  3E0U A;  1H75 A;  1BED A;  5FHI A;  5ECI B;  1V98 A;  4KAE A;  4BL7 A;  5G5E A;  4MA9 A;  3MAK A;  3TRX A;  4ISD A;  3ZVJ D;  1DBY A;  9GSS A;  3Q74 A;  4RI7 A;  4BWS A;  1AIU A;  3FK8 A;  4BVX A;  1FB6 A;  5GAP D;  2B7K A;  5J3R A;  2FD3 A;  1XWK A;  1GH2 A;  1K0B A;  3LXT A;  3TKS E;  1O6J A;  3TOU A;  4HUA A;  2MMO A;  3GIX A;  1HD2 A;  2DJ1 A;  4LL1 B;  5KEJ A;  3CTF A;  3SBC A;  4GSN A;  2K8V A;  3VUR A;  1YQ1 A;  3GA4 A;  1ZL9 A;  2LTK A;  3ZRE A;  4I6X A;  3EWL A;  3HZ4 A;  1TTZ A;  2JL4 A;  2IFQ B;  3GMF A;  3O6T A;  2XPE A;  2YN1 A;  3ZIV A;  1QK8 A;  3DML A;  2X8G A;  2I1U A;  4TN8 A;  3TKR A;  4KX4 A;  1SD8 A;  3DVX A;  2VLU A;  1I5G A;  3GKX A;  4L5O A;  4MF7 A;  2VCZ A;  2IMI A;  2VL2 A;  4WEY A;  1THX A;  4K6X A;  4V2M A;  4XRD A;  1A0F A;  3TRQ A;  2YZU A;  2FNO A;  3L4N A;  1XXU A;  2WZ9 A;  3UAP A;  1SJI A;  2B1L A;  4K8M A;  5IOW A;  3KM6 A;  2WFC A;  2VCW A;  4TR1 A;  1R5P A;  3GSS A;  2C3T A;  2H1A A;  2OE1 A;  5G30 A;  3L9S A;  1BQ7 A;  5G5F A;  1T3B A;  1XW9 A;  2V2G A;  1YEP A;  3DIE A;  3TCO A;  3IHQ A;  5B8B A;  3VWV A;  4MCU A;  2X8H A;  5A5K A;  1TU8 A;  4KGI A;  2IL3 A;  2DJ0 A;  19GS A;  2L5L A;  3HVV A;  4EL1 A;  3FKF A;  5FT3 A;  4KSM A;  1YF0 A;  4LLR A;  1U88 A;  2YV9 A;  3F4S A;  1O73 A;  1SK0 A;  3APO A;  2VCV A;  3DWV A;  2V32 A;  4K0N A;  1XWG A;  3BJ5 A;  2HI7 A;  4KCA A;  2MBS A;  4PUF C;  3VPQ A;  1EGR A;  4I2U A;  1GP1 A;  1HYU A;  2DMM A;  4MJA A;  3F3R A;  2WRT A;  4IW9 A;  2I9H A;  1R26 A;  2GQL A;  2QGV A;  2MZC A;  4XS6 A;  2ES7 A;  1TK8 B;  1M2B A;  3RHC A;  3TKS C;  1Q98 A;  3IRA A;  5ECK B;  5J9B A;  4TRX A;  1DSB A;  1OC8 A;  3SWL A;  2JSY A;  4EVM A;  3K8N A;  4EDY A;  3GUR A;  5ECL B;  5ENU A;  1EOH A;  2GDR A;  2VUP A;  3C73 A;  1O8W A;  2HFD A;  2YZH A;  4RQX A;  3J7Y k;  2RUF A;  4AJ6 A;  3FEU A;  3LGC A;  2R5G A;  5H5S A;  5DQY A;  4IQ1 A;  1GSU A;  1GSS A;  2HE3 A;  3F4R A;  1EP7 A;  3ZVJ A;  4POK A;  3D4M A;  3ERF A;  1OAZ A;  2GSR A;  2R4V A;  5HR2 A;  3LG6 A;  5CRD A;  2E2G A;  1YF1 A;  5JCG A;  4G10 A;  4L8E A;  2V6O A;  3D5J A;  1ST9 A;  1NHO A;  2R3X A;  4XS1 A;  2REM A;  1X5E A;  3ME7 A;  1CQG A;  1JZR A;  2IMF A;  4IEL A;  2X99 A;  2CZ2 A;  5J41 A;  2F8A A;  4JR4 A;  1GUH A;  1XFL A;  3LEF A;  2WJU A;  1SKR B;  1H4O A;  3L0H A;  1UVZ A;  2YV7 A;  4P3Y B;  3UAR A;  2LV3 A;  3M0F A;  3VI5 A;  1XIY A;  4X1U A;  4FIW A;  3EVI A;  2L5O A;  6GSY A;  5EY6 A;  3IA1 A;  3ED3 A;  2YOI A;  4O92 A;  3DEX A;  10GS A;  4HEA 2;  4K1F A;  4PQH A;  4EC0 A;  4MLY A;  3CBU A;  4J57 E;  4E8E A;  4IN0 A;  2V41 A;  4ML1 A;  1TOF A;  2PUK C;  4XTS A;  4JBB A;  2FCH A;  3FHK A;  3WGD A;  5ID2 B;  4KE3 A;  2MYG A;  6GST A;  1AQW A;  3G7Y A;  2CX4 A;  2MMZ A;  1GSQ A;  3FYG A;  3L9V A;  5LNK e;  4KDY A;  4IP6 A;  1M2D A;  2ZUP A;  1BJX A;  2H6Y A;  1FHE A;  4EUY A;  1B8X A;  2BTO T;  1XWC A;  3KIJ A;  4ACS A;  1A24 A;  17GS A;  2YP6 A;  2LJA A;  3BCK A;  3IE3 A;  1WOU A;  1PMT A;  4ECB A;  2HLS A;  4I97 A;  3ZML A;  4NAX A;  3H8Q A;  4YH2 A;  2R2J A;  3JCM L;  2AV4 A;  1XOB A;  2FWH A;  3LYP A;  1SL1 B;  1VF2 A;  1FVK A;  2CT6 A;  5F0G A;  2GSS A;  3F3Q A;  4MJC A;  1WJK A;  1Y25 A;  1OE7 A;  5IMD A;  4F0B A;  3EMP A;  1OKT A;  5CYY A;  1B9Y C;  2DIZ A;  2GSQ A;  2VO4 A;  5L71 A;  1PL1 A;  5E59 A;  2FLS A;  3NZN A;  4N0Z A;  3OR5 A;  2KOK A;  2FGX A;  2IPA A;  5DCG A;  3KXO A;  5IQY A;  3GV1 A;  1X5C A;  1ML6 A;  3IAM 2;  4LMW A;  4NWY A;  1FVJ A;  3ZFL A;  2CX3 A;  1YY7 A;  1AC1 A;  5JCW A;  1PL2 A;  1K3O A;  2H74 A;  2B7J A;  4I5Q A;  1X0R A;  3BBY A;  2KHP A;  2H66 A;  1ERW A;  2EIR A;  2AUV A;  4MH2 A;  1SYR A;  4D73 A;  1OE8 A;  3QFA C;  3M8N A;  5IMA A;  1YDK A;  4V2L A;  1I9D A;  2PER A;  4GQF A;  1T8E B;  3CRT A;  3H79 A;  1F3B A;  1FW1 A;  3FZA A;  3UL3 A;  4OO5 A;  2PBJ A;  1ZCP A;  3RPN A;  4NPB A;  4WR4 A;  3ZL5 A;  1X9M B;  2X8C A;  4GWR A;  1Z6M A;  5CRG A;  3GYK A;  3GN3 A;  4JED A;  1XPV A;  4JU5 A;  3GTU B;  5JWR B;  2CAI A;  5EVO A;  1GTB A;  3QDN A;  1V2A A;  3MDK A;  4GCI A;  2OE0 A;  3MSZ A;  1PSQ A;  2VCQ A;  3C71 A;  1YJ6 A;  1WRY A;  2YJ7 A;  2B5X A;  1A8L A;  2B1K A;  3A2W A;  4EF0 A;  4O32 A;  1JZD A;  2E0Q A;  4LL4 B;  3GFK A;  2PN8 A;  1QGV A;  1ACV A;  5F8B A;  2O89 A;  4DSS A;  2YPM A;  2IFQ A;  3VLN A;  4K2D A;  1KNG A;  2GQK A;  2C4J A;  3GX8 A;  4FYU A;  3IPZ A;  4OFT A;  2XPD A;  1NW2 A;  2IN3 A;  2L57 A;  1EEM A;  2PWJ A;  2A4V A;  3S9F A;  1SK2 A;  3TKS A;  1KBN A;  3APS A;  3TGZ A;  4OMV A;  5CRE A;  1VF3 A;  4MZB A;  2GZY A;  4PQI A;  3TKQ A;  4OCE A;  1N8J A;  4YQM A;  2CAQ A;  3VFI A;  3FR3 A;  3I6A A;  4WKW A;  4CHS A;  1Z6N A;  2AAW A;  5GZZ B;  5AGY A;  2EIQ A;  5JCU A;  4XCS A;  2E2M A;  4TKY A;  1J9B A;  5IMF A;  3I69 A;  5GST A;  1PGT A;  3CSH A;  1PQN A;  2MBT A;  1B4P A;  4F9Z A;  3F9U A;  2LJR A;  1TW9 A;  1BG5 A;  3KCM A;  4X0X A;  3KZQ A;  4ULX A;  4H86 A;  2EC4 A;  4JR6 A;  4HOJ A;  4DVC A;  1QMV A;  4TR4 A;  4IVF A;  5HQP A;  4IGJ A;  2IMK A;  3IC4 A;  1GLP A;  22GS A;  5CRH A;  2AYT A;  3UBK A;  1G0T A;  1E6B A;  1XVW A;  5A4U A;  3H93 A;  1M7T A;  5DAL B;  5F06 A;  1M2A A;  3FZ9 A;  5G1L A;  3KH9 A;  3LOR A;  5ELA A;  4BA7 A;  1O8X A;  2LRN A;  2HSY A;  1T1V A;  1ABA A;  5H5Q A;  2H0I A;  3I9V 2;  4MP4 A;  4ZL7 A;  2J9H A;  2VOC A;  3M3M A;  2C0E A;  5F07 A;  2B6M A;  2GLR A;  2DLX A;  1LJR A;  3GRX A;  3ZMK A;  4MPF A;  5HR3 A;  2QC7 A;  4RI6 A;  4E8H A;  4KDU A;  2FHE A;  4RUV A;  2EIO A;  5DAK B;  3PR8 A;  1OC3 A;  3KD0 A;  1ERT A;  3EYT A;  2P5R A;  1DUG A;  4Q5R A;  4GSS A;  4KSO A;  3QFB C;  1R7H A;  5ECM B;  1GWC A;  1WMJ A;  4FYC A;  3VK9 A;  3A3T A;  3LYK A;  1UC7 A;  1EWX A;  2O87 A;  5DQS A;  5HFK A;  2TRC P;  1LU4 A;  2TRX A;  3WD6 A;  5ECO B;  3D22 A;  1PRX A;  2I3Y A;  1V58 A;  1F2E A;  3TJJ A;  4ZBD A;  2Z9S A;  1F9M A;  6GSV A;  2YWM A;  3PH9 A;  2LJK A;  4I2T A;  4PXO A;  3TJK A;  4TR0 A;  1FB0 A;  2V1M A;  3KMO A;  1XWA A;  4ZB6 A;  3H1N A;  2GZP A;  5AIV A;  3IR4 A;  1VRS D;  5D9V A;  1G7E A;  3GH9 A;  5ECQ B;  2OKA A;  2H0G A;  5CO3 A;  5B6N A;  2WB9 A;  4LMV A;  4ML6 A;  1XOA A;  5LCZ A;  4WXT A;  2G0F A;  1TK0 B;  5ID2 A;  2HRF A;  3LQ7 A;  4NV5 A;  4POM A;  3MNG A;  5ECH B;  2C0D A;  1ON4 A;  1AXD A;  3GHA A;  1K0A A;  1KEB A;  2LUS A;  5COH A;  3EC3 A;  1N2A A;  3KTB A;  4BPY A;  3ZIJ A;  5ECP B;  3F0I A;  2N5F A;  4MF5 A;  3TRP A;  4N0V A;  3DGQ A;  3Q19 A;  2FWF A;  1A2J A;  4XS4 A;  4TOP A;  4NMU A;  3C1S A;  5F05 A;  2DSA A;  1T4Z A;  2DC5 A;  1X9S B;  1FO5 A;  3HA9 A;  1KTE A;  5C00 A;  1WIK A;  2VL3 A;  1TI1 A;  1CQH A;  3VWU A;  2HZE B;  3LFL A;  1NSW A;  3CRU A;  4ZIJ A;  3HJM A;  4G2E A;  1PX6 A;  2OBK A;  3J7Y b;  1M9B A;  1M99 A;  4YAP A;  4PGT A;  4OFM A;  4QL7 A;  1Z3E A;  4JZQ A;  2PPT A;  3DYR A;  4MJB A;  4X43 A;  3IDV A;  18GS A;  1DE2 A;  2FWG A;  4TXV A;  5IOX A;  3BCI A;  3U6V A;  1AUC A;  4IP1 A;  2C3N A;  5DJM A;  1HQO A;  1ZMA A;  4K7O A;  4KUN A;  5G2Z A;  3PGT A;  1ILO A;  3CMI A;  1VGL A;  3ZZX A;  2DJ3 A;  3NOF A;  4GLT A;  1EP8 A;  5EPF A;  4XRA A;  2H75 A;  4KW6 A;  5LD0 A;  3ERG A;  2GVP A;  3CSI A;  1XZO A;  3VWW A;  2P0G A;  2TIR A;  4IQA A;  2RLI A;  4MH3 A;  6GSX A;  1YKA A;  1SJZ A;  2P31 A;  1EV9 A;  3O3T A;  5IMV A;  3HD5 A;  5CP1 A;  1S3A A;  4YQV A;  1C72 A;  1XW5 A;  4MDC A;  1G6Y A;  4N30 A;  4AJ7 A;  1GSY A;  1PX7 A;  1TDI A;  2YCD A;  3FZ4 A;  1PKW A;  2K18 A;  3WT2 A;  1EV4 A;  3QAG A;  3VI7 A;  3QOU A;  2WDU A;  3GTU A;  4MJE A;  3VPT A;  2GST A;  3GKK A;  1B4Q A;  2CV4 A;  4O7H A;  3TJB A;  4PNG A;  1O7U A;  3PIN A;  1K3L A;  1GL8 A;  5D96 A;  1URM A;  3ZRD A;  3FY7 A;  3LXZ A;  1TJD A;  3D4T A;  1SKW B;  3A5W A;  4NHZ A;  4CW9 A;  2YWO A;  5IPH A;  3HXS A;  5KN2 A;  4HU9 A;  3L9U A;  4AF2 A;  2CVB A;  3HVS A;  5DDL A;  3P7X A;  3RPP A;  2H70 A;  1BYE A;  4PX1 A;  1YKC A;  3UVH A;  1FG4 A;  3GX0 A;  3EU3 A;  2C0G A;  1GSD A;  4L5L A;  3GUS A;  2AB6 A;  3UMA A;  3P2A A;  3W6G A;  3RBT A;  2IMD A;  4DSR A;  1TU7 A;  2H6Z A;  2N5B A;  4WF5 A;  4TXO B;  4NXI A;  1ZYE A;  4OO4 A;  1QQ2 A;  1QXH A;  3WGE A;  1SU9 A;  2HZF A;  3IK9 A;  1TKD B;  2VAF A;  2H6X A;  4GRF A;  1S3C A;  1M0U A;  2ALB A;  5GSS A;  3GST A;  3H4K A;  1B48 A;  1RW1 A;  3HYP A;  4Q5N A;  2C80 A;  3ME8 A;  4MPG A;  1V40 A;  2BMX A;  4CDO A;  5A4W A;  1QFN A;  3G9B A;  4ID0 A;  2IIY A;  5IMZ A;  2FA8 A;  2RUE A;  3W8S A;  3GL3 A;  1A23 A;  1K0D A;  3DKS A;  3EMX A;  2H73 A;  2B5E A;  1X5D A;  2WCI A;  3M1G A;  5DCH A;  2DJ2 A;  1Q4J A;  1M9A A;  1LBK A;  2HSH A;  1EGO A;  3KH7 A;  3VWX A;  3U5R E;  2V6K A;  3F4T A;  4KA0 A;  3ERW A;  5IM9 A;  5B6M A;  2N5A A;  3RHB A;  2LST A;  4MK3 A;  1Z9H A;  3ZLP A; 
#chains in the Genus database with same CATH topology
 3KP9 A;  1DE1 A;  1MD4 A;  1IYI A;  1ZZY A;  4GTU A;  3N5O A;  5DAL A;  2OJL A;  2ZNM A;  4Z2T A;  3A2V A;  3C1R A;  2I81 A;  1R4W A;  3HJO A;  2CVD A;  1ZGN A;  2YWI A;  2R0P A;  3KJY A;  2JZR A;  2K8S A;  2GT6 A;  5AIX A;  4AGS A;  3EUR A;  5B8A A;  2NPB A;  3KTL A;  3D6I A;  2WS2 A;  3V1W A;  1PFO A;  4IS0 A;  4GF0 A;  4O5R A;  3UEM A;  2RII A;  3HVX A;  4EE0 A;  5DAK A;  2KP2 A;  1WPI A;  1SJ6 A;  2XBI A;  2MMN A;  1AQX A;  4BVY A;  3NIV A;  2C3Q A;  1T4Y A;  1EZK A;  4KDX A;  5ECR B;  2H1G A;  3CYN A;  5DVB A;  2GTU A;  1OC9 B;  1AAZ A;  3CSJ A;  4MAB A;  4LA1 A;  3HY2 A;  5INY A;  2YWN A;  5AN1 A;  1WP0 A;  2A4H A;  1K0C A;  1Z5Y E;  4G0K A;  1YZX A;  3HDC A;  5IIZ A;  20GS A;  2MMA A;  2RM5 A;  1G6W A;  4EDZ A;  3Q18 A;  1ERU A;  5KN0 A;  2DBC A;  2H1D A;  2HRN A;  2BJX A;  2LEG A;  1FAA A;  2M46 A;  3M9K A;  4I8B A;  2F9S A;  1A0R P;  3DD3 A;  2GQM A;  2H71 A;  3KMN A;  4F82 A;  4D73 B;  2LRT A;  4K9Z A;  2LQQ A;  1WE0 A;  1UN2 A;  2K9F A;  1TK5 B;  1MEK A;  1Y6E A;  4XHM A;  3TOT A;  4N10 A;  3WYW A;  2L59 A;  2P5Q A;  1EOG A;  3LJR A;  3I43 A;  3RAZ A;  4K2X A;  1ZYP A;  1GUM A;  5C04 A;  2B5Y A;  5GAN D;  4HZ2 A;  5HR1 A;  1FOV A;  3IXR A;  5CRW A;  3E9J B;  3O76 A;  2J23 A;  3UIW A;  1TRV A;  1SD9 A;  3G7I A;  1JZO A;  2FA4 A;  2XBQ A;  3FR6 A;  2NTO A;  4TR3 A;  1U87 A;  2DML A;  2PVQ A;  3MWH A;  2VD1 A;  3E3E A;  2LKU A;  1MDI A;  2HZE A;  3APQ A;  1F37 A;  4BWQ A;  4DSS B;  1A2L A;  4KH7 A;  4HJM A;  4N11 A;  2H19 A;  3L78 A;  5DJL A;  1GUL A;  3TB2 A;  4WBR D;  3FR9 A;  3TUE A;  3ISO A;  1IYH A;  5CNW A;  2HSM A;  1THO A;  4V1A g;  3IBH A;  4G19 A;  2DJK A;  1PN9 A;  1XW6 A;  5JWQ B;  4HZ4 A;  4F2I A;  3QAW A;  1K3Y A;  4ECI A;  3ZFB A;  1MTC A;  3G7J A;  2QKE A;  2A2S A;  3A2X A;  3ZIT A;  4F0C A;  1W89 A;  5A4V A;  3KP8 A;  1E2Y A;  1TP9 A;  3HJP A;  2YAN A;  3HHV A;  3IAS 2;  2O8V B;  4POL A;  5ECS A;  1PD2 1;  1XBS A;  3F6F A;  4WBJ A;  2VM2 A;  3GNJ A;  4QL9 A;  3TJG A;  2ON5 A;  2HXK A;  3DXB A;  3IV4 A;  2C8U A;  5ABR A;  2OAC A;  2OA7 A;  3W8J A;  1JFU A;  2JSZ A;  1V57 A;  2PU9 C;  4IBP A;  4ZL8 A;  5BMU A;  4ZL9 A;  1GNE A;  2L4Q A;  6GSU A;  4ICY A;  1OYJ A;  4BL7 B;  2WGR A;  1Z7P A;  1S3D A;  1RK4 A;  1U6T A;  2KUC A;  3KGK A;  2X64 A;  4BVX B;  1SK1 A;  4OFN A;  2LNT A;  1TRU A;  5ELG A;  3P90 A;  2XHF A;  3C8E A;  4WET A;  5EL8 A;  2QSI A;  2JZT A;  4RQR A;  4ZXG A;  2OAD A;  4IKH A;  1GSF A;  1M3J A;  2CA8 A;  2LRC A;  4MNN A;  4BIK A;  2ON7 A;  2LS5 A;  2CVK A;  5FWG A;  5BRT A;  5J4U A;  3TKP A;  3GKM A;  2O85 A;  2K6V A;  2JAD A;  2H0H A;  2NBS A;  4NV2 A;  1GTU A;  5E4W A;  2H8L A;  14GS A;  5D93 A;  3F6D A;  2NVL A;  4TXO A;  4K7I A;  4EKZ A;  3R2Q A;  4TVE A;  4L0W A;  4HI7 A;  4ZBA A;  3ZYW A;  2IME A;  4YAV A;  4XIH A;  4TR1 B;  4POB A;  5IMC A;  4OWY A;  2E7P A;  2CQ9 A;  5B7C A;  1U3A A;  2HT9 A;  2L4C A;  1JLW A;  1WWJ A;  4HJ2 A;  4G9H A;  5HFG A;  1B9X C;  1SL2 B;  4EIP A;  4ECJ A;  16GS A;  12GS A;  1GTI A;  2H76 A;  5D9W A;  4MZC A;  5G1K A;  2M80 A;  2UZ8 A;  7GSS A;  4J2F A;  3FZ5 A;  2CZ3 A;  2H72 A;  2NDO A;  2H30 A;  2VCT A;  4OCF A;  2PVO C;  2HYX A;  3GH6 A;  2C0F A;  2R0C A;  3UJ1 A;  1GRX A;  3QR6 A;  1SKS B;  2LNS A;  1V9W A;  4HQS A;  3CXG A;  4MMM A;  3MYD A;  4PUA A;  1K0O A;  2M72 A;  3WT1 A;  3HZ8 A;  2YJH A;  4JRR A;  1J0F A;  4EO3 A;  2VL2 C;  4HU7 A;  2VLV A;  4KF9 A;  1UA5 A;  2LQO A;  3LSZ A;  4Q5F A;  2R0G A;  2HRK A;  4JE1 A;  1GUK A;  3Q6O A;  3HKR A;  2GT5 A;  1BX9 A;  3M9J A;  1W4V A;  1XVQ A;  2F3M A;  1R5A A;  4F03 A;  3RDW A;  1OVN A;  1SYX A;  4Q5Q A;  4WR5 A;  4Z7X A;  1K0N A;  4XS4 B;  4ZB8 A;  4K0G A;  3IOS A;  1BAY A;  4WF4 A;  2RM6 A;  1O85 A;  4MF6 A;  1MDJ A;  4YQU A;  5KN3 A;  4ZBB A;  4IJI A;  1JLV A;  4IHU A;  1RQM A;  2DKI A;  1T7P B;  3QCP A;  3HCZ A;  3LWA A;  4QQ7 A;  3UBL A;  1VF4 A;  1HNB A;  1OC9 A;  3FW2 A;  4PQ1 A;  5ECN B;  1X9W B;  3UVT A;  3QD9 A;  3EU4 A;  3AY8 A;  5HR0 A;  3CTG A;  4YKF A;  2L6D A;  4USS A;  2XC2 A;  4KCE A;  4AJ8 A;  2AJQ B;  1TXX A;  5J9C A;  11GS A;  1SL0 B;  1NM3 A;  3WGX A;  5D73 A;  2ZCT A;  3BOA A;  3GL5 A;  5KN1 A;  2OE3 A;  4V2N A;  1TRW A;  3GKN A;  4FH8 A;  2VL9 A;  2H1B A;  4IJ3 A;  3BD2 A;  3DRN A;  3DVW A;  1MD3 A;  1A8Y A;  1OKD A;  1TI3 A;  3R3E A;  5G31 A;  3TDG A;  2IJY A;  3FRC A;  4K7N A;  4DEJ A;  3QPM A;  2G2Q A;  1HNC A;  5D9X A;  3KEB A;  1PKZ A;  4PNF A;  3D0Z A;  1PA3 A;  2R37 A;  4Z2R A;  6GSW A;  2FWE A;  1TRS A;  3EE2 A;  2IWT A;  1EEJ A;  1ZOF A;  3EIN A;  4FO5 A;  2GS3 A;  4NHW A;  1GNW A;  2OBI A;  1Z7R A;  2H01 A;  2YNX A;  2A2R A;  5IO2 A;  4L0U A;  2GZZ A;  4KND A;  4MZW A;  2F51 A;  1JZW A;  2I4A A;  3TJF A;  4PUR A;  1ERV A;  8GSS A;  1JHB A;  3UOM A;  4ZB9 A;  5JWO B;  2VIM A;  4EXJ A;  4FYB A;  2B3S A;  2VD0 A;  5IPG A;  1VF1 A;  1GSE A;  4DSQ A;  1O81 A;  1XCC A;  1SEN A;  5D8I A;  3C7M A;  1GLQ A;  3QAV A;  3N9J A;  3F63 A;  4HS1 A;  5KOX A;  4ILF A;  1AQV A;  2AHE A;  4ZIL A;  1T00 A;  6GSS A;  2DJJ A;  1MDK A;  4K5R A;  5HFI A;  4ECC A;  2A2P A;  3ZTL A;  4TW5 A;  3US3 A;  2FY6 A;  2PGT A;  2R6K A;  1A2M A;  4V1A p;  1GTA A;  4J56 E;  1AW9 A;  1ZYQ B;  2O7K A;  1XWB A;  4GST A;  2VCX A;  5AIS A;  5CAX A;  1XG8 A;  3D21 A;  13GS A;  4GQC A;  2L6C A;  2JZS A;  2HNL A;  2DIY A;  4GXZ A;  1NHY A;  2HRA A;  2JAC A;  3IK7 A;  2F8F A;  4HQZ A;  1USB A;  5IO0 A;  2JU5 A;  2KP1 A;  1HNA A;  3A5I A;  1F3A A;  4HDE A;  2VM1 A;  5J5N A;  1QUW A;  3QMX A;  1U3I A;  2D2Z A;  1J08 A;  2C1Y A;  3CQF A;  2PMT A;  2FUG 2;  3F8U A;  5D9T A;  2VLT A;  5DBQ A;  4KB3 A;  1K0M A;  1F6M C;  3P8W A;  1YEX A;  2WUL A;  5H5R A;  4OD7 A;  2KLX A;  2GGT A;  1G7O A;  3E0U A;  1H75 A;  1BED A;  5FHI A;  5ECI B;  1V98 A;  4KAE A;  4BL7 A;  5G5E A;  4MA9 A;  3MAK A;  3TRX A;  4ISD A;  3ZVJ D;  1DBY A;  9GSS A;  3Q74 A;  4RI7 A;  4BWS A;  1AIU A;  3FK8 A;  4BVX A;  4G0I A;  1FB6 A;  5GAP D;  2B7K A;  5J3R A;  2FD3 A;  1XWK A;  1GH2 A;  1K0B A;  3LXT A;  3TKS E;  1O6J A;  3TOU A;  4HUA A;  2MMO A;  3GIX A;  1HD2 A;  2DJ1 A;  4LL1 B;  5KEJ A;  3CTF A;  3SBC A;  4GSN A;  2K8V A;  3VUR A;  1YQ1 A;  3GA4 A;  1ZL9 A;  2LTK A;  3ZRE A;  4I6X A;  3EWL A;  3HZ4 A;  1TTZ A;  2JL4 A;  2IFQ B;  3GMF A;  3O6T A;  2XPE A;  2YN1 A;  3ZIV A;  1QK8 A;  3DML A;  2X8G A;  2I1U A;  4TN8 A;  3TKR A;  4KX4 A;  1SD8 A;  3DVX A;  2VLU A;  1I5G A;  3GKX A;  4L5O A;  4MF7 A;  2VCZ A;  2IMI A;  2VL2 A;  4WEY A;  1THX A;  4K6X A;  4V2M A;  4XRD A;  1A0F A;  3TRQ A;  2YZU A;  2FNO A;  3L4N A;  1XXU A;  3IC8 A;  2WZ9 A;  3UAP A;  1SJI A;  2B1L A;  4K8M A;  5IOW A;  3KM6 A;  2WFC A;  2VCW A;  3MIX A;  1R5P A;  4TR1 A;  3GSS A;  2C3T A;  2H1A A;  2OE1 A;  5G30 A;  3L9S A;  1BQ7 A;  5G5F A;  1T3B A;  1XW9 A;  2V2G A;  1YEP A;  3DIE A;  3TCO A;  3IHQ A;  5B8B A;  3VWV A;  4MCU A;  2X8H A;  5A5K A;  1TU8 A;  4KGI A;  2IL3 A;  2DJ0 A;  19GS A;  2L5L A;  3HVV A;  4EL1 A;  3FKF A;  5FT3 A;  4KSM A;  1YF0 A;  4LLR A;  1U88 A;  2YV9 A;  3F4S A;  1O73 A;  1SK0 A;  3APO A;  2VCV A;  3DWV A;  2V32 A;  4K0N A;  1XWG A;  3BJ5 A;  2HI7 A;  4KCA A;  2MBS A;  4PUF C;  3VPQ A;  1EGR A;  4I2U A;  1GP1 A;  1HYU A;  2DMM A;  4MJA A;  3F3R A;  2WRT A;  4IW9 A;  2I9H A;  1R26 A;  2GQL A;  2QGV A;  2MZC A;  4XS6 A;  2ES7 A;  1TK8 B;  1M2B A;  3RHC A;  3TKS C;  1Q98 A;  3IRA A;  5ECK B;  5J9B A;  4TRX A;  1DSB A;  1OC8 A;  3SWL A;  2JSY A;  4EVM A;  3K8N A;  4EDY A;  3GUR A;  5ECL B;  5ENU A;  1EOH A;  2GDR A;  4A5P A;  2VUP A;  3C73 A;  1O8W A;  2HFD A;  2YZH A;  4RQX A;  3J7Y k;  2RUF A;  4AJ6 A;  4EIQ A;  3FEU A;  3LGC A;  2R5G A;  5H5S A;  5DQY A;  4IQ1 A;  1GSU A;  1GSS A;  2HE3 A;  3F4R A;  1EP7 A;  3ZVJ A;  4POK A;  3D4M A;  3ERF A;  1OAZ A;  2GSR A;  2R4V A;  5HR2 A;  3LG6 A;  5CRD A;  2E2G A;  1YF1 A;  5JCG A;  4G10 A;  4L8E A;  2V6O A;  3D5J A;  1ST9 A;  1NHO A;  2R3X A;  4XS1 A;  2REM A;  4O5U A;  1X5E A;  2QA2 A;  3ME7 A;  1CQG A;  1JZR A;  2IMF A;  4IEL A;  2X99 A;  2CZ2 A;  5J41 A;  2F8A A;  4JR4 A;  1GUH A;  1XFL A;  3LEF A;  2WJU A;  1SKR B;  1H4O A;  3L0H A;  1UVZ A;  2YV7 A;  4YKG A;  4P3Y B;  3UAR A;  2LV3 A;  3M0F A;  3VI5 A;  1XIY A;  4X1U A;  4FIW A;  3EVI A;  2L5O A;  6GSY A;  5EY6 A;  3IA1 A;  3ED3 A;  2YOI A;  4FQU A;  4O92 A;  3DEX A;  10GS A;  4HEA 2;  4K1F A;  4PQH A;  4EC0 A;  4MLY A;  3CBU A;  4J57 E;  4E8E A;  4IN0 A;  2V41 A;  4ML1 A;  1TOF A;  2PUK C;  4XTS A;  4JBB A;  2FCH A;  3FHK A;  3WGD A;  5ID2 B;  4KE3 A;  2MYG A;  6GST A;  1AQW A;  3G7Y A;  2CX4 A;  2MMZ A;  1GSQ A;  3FYG A;  3L9V A;  5LNK e;  4KDY A;  4IP6 A;  1M2D A;  1PN0 A;  2ZUP A;  1BJX A;  2H6Y A;  1FHE A;  4EUY A;  1B8X A;  2BTO T;  1XWC A;  3KIJ A;  4ACS A;  1A24 A;  17GS A;  2YP6 A;  2LJA A;  3BCK A;  3IE3 A;  1WOU A;  1PMT A;  4ECB A;  2HLS A;  4I97 A;  3ZML A;  4NAX A;  3H8Q A;  3PPU A;  4YH2 A;  2R2J A;  3JCM L;  2AV4 A;  1XOB A;  2FWH A;  3LYP A;  1SL1 B;  1VF2 A;  1FVK A;  2CT6 A;  5F0G A;  2GSS A;  3F3Q A;  4MJC A;  1WJK A;  1Y25 A;  1OE7 A;  5IMD A;  4F0B A;  3EMP A;  1OKT A;  5CYY A;  2X4A A;  1B9Y C;  2DIZ A;  2GSQ A;  2VO4 A;  5L71 A;  1PL1 A;  5E59 A;  2FLS A;  3NZN A;  4N0Z A;  3OR5 A;  2KOK A;  2FGX A;  1M3I A;  2IPA A;  5DCG A;  3KXO A;  5IQY A;  3GV1 A;  1X5C A;  1ML6 A;  3IAM 2;  4LMW A;  4NWY A;  1FVJ A;  3ZFL A;  2CX3 A;  1YY7 A;  1AC1 A;  5JCW A;  3HVN A;  1PL2 A;  1K3O A;  2H74 A;  2B7J A;  4I5Q A;  1X0R A;  3BBY A;  2KHP A;  2H66 A;  1ERW A;  2EIR A;  2AUV A;  4MH2 A;  1SYR A;  4D73 A;  1OE8 A;  3QFA C;  3M8N A;  5IMA A;  1YDK A;  4V2L A;  1I9D A;  2PER A;  4GQF A;  1T8E B;  3CRT A;  3H79 A;  1F3B A;  1FW1 A;  3FZA A;  3UL3 A;  4OO5 A;  2PBJ A;  1ZCP A;  3RPN A;  4NPB A;  4WR4 A;  2QA1 A;  3ZL5 A;  1X9M B;  2X8C A;  4GWR A;  1Z6M A;  5CRG A;  3GYK A;  3GN3 A;  4JED A;  1XPV A;  4JU5 A;  3GTU B;  5JWR B;  2CAI A;  5EVO A;  1GTB A;  3QDN A;  1V2A A;  3MDK A;  4GCI A;  2OE0 A;  3MSZ A;  1PSQ A;  2VCQ A;  3C71 A;  1YJ6 A;  1WRY A;  2YJ7 A;  2B5X A;  1A8L A;  2B1K A;  3A2W A;  4EF0 A;  4O32 A;  1JZD A;  2E0Q A;  4LL4 B;  3GFK A;  2PN8 A;  1QGV A;  1ACV A;  5F8B A;  2O89 A;  4DSS A;  2YPM A;  2IFQ A;  3VLN A;  4K2D A;  1KNG A;  2GQK A;  2C4J A;  3GX8 A;  4FYU A;  3IPZ A;  4OFT A;  2XPD A;  1NW2 A;  2IN3 A;  2L57 A;  1EEM A;  2PWJ A;  2A4V A;  3S9F A;  1SK2 A;  3TKS A;  1KBN A;  3APS A;  3TGZ A;  4OMV A;  5CRE A;  1VF3 A;  4MZB A;  2GZY A;  4PQI A;  3TKQ A;  4OCE A;  1N8J A;  4YQM A;  2CAQ A;  3VFI A;  3FR3 A;  3I6A A;  4WKW A;  4CHS A;  1Z6N A;  2AAW A;  5GZZ B;  5AGY A;  2EIQ A;  5JCU A;  4XCS A;  2E2M A;  4TKY A;  1J9B A;  5IMF A;  3I69 A;  4PTS A;  5GST A;  1PGT A;  3CSH A;  1PQN A;  2MBT A;  1B4P A;  4F9Z A;  3F9U A;  2LJR A;  1TW9 A;  1BG5 A;  3KCM A;  4X0X A;  3KZQ A;  4ULX A;  2DKH A;  4H86 A;  2EC4 A;  4JR6 A;  4HOJ A;  4DVC A;  1QMV A;  4TR4 A;  4IVF A;  5HQP A;  4IGJ A;  2IMK A;  3IC4 A;  1GLP A;  22GS A;  5CRH A;  2AYT A;  3UBK A;  1G0T A;  1E6B A;  1XVW A;  4CY8 A;  5A4U A;  3H93 A;  1M7T A;  5DAL B;  5F06 A;  1M2A A;  3FZ9 A;  5G1L A;  3KH9 A;  3LOR A;  5ELA A;  4BA7 A;  1O8X A;  2LRN A;  2HSY A;  1T1V A;  1ABA A;  5H5Q A;  2H0I A;  3I9V 2;  4MP4 A;  4ZL7 A;  2J9H A;  2VOC A;  3M3M A;  2C0E A;  5F07 A;  2B6M A;  2GLR A;  2DLX A;  1LJR A;  3GRX A;  3ZMK A;  4MPF A;  5HR3 A;  2QC7 A;  4RI6 A;  4E8H A;  4KDU A;  2FHE A;  4RUV A;  2EIO A;  5DAK B;  3PR8 A;  1OC3 A;  3KD0 A;  1ERT A;  3EYT A;  2P5R A;  1DUG A;  4Q5R A;  4GSS A;  4KSO A;  4BVY B;  5KOW A;  3QFB C;  1R7H A;  5ECM B;  1GWC A;  1WMJ A;  1ZYN A;  4FYC A;  3VK9 A;  3A3T A;  3LYK A;  1UC7 A;  1EWX A;  2O87 A;  5DQS A;  5HFK A;  2TRC P;  1LU4 A;  2TRX A;  3WD6 A;  5ECO B;  3D22 A;  1PRX A;  2I3Y A;  1V58 A;  1F2E A;  3TJJ A;  4ZBD A;  2Z9S A;  1F9M A;  6GSV A;  2YWM A;  3PH9 A;  2LJK A;  4I2T A;  4PXO A;  4O5Q A;  3TJK A;  4TR0 A;  1FB0 A;  2V1M A;  3KMO A;  1XWA A;  4ZB6 A;  3H1N A;  3LW9 A;  2GZP A;  5AIV A;  3IR4 A;  1VRS D;  5D9V A;  1G7E A;  3GH9 A;  5ECQ B;  2OKA A;  2H0G A;  5CO3 A;  5B6N A;  2WB9 A;  4LMV A;  4ML6 A;  1XOA A;  5LCZ A;  4WXT A;  2G0F A;  1TK0 B;  5ID2 A;  2HRF A;  3LQ7 A;  4NV5 A;  4POM A;  3MNG A;  5ECH B;  2C0D A;  1ON4 A;  1AXD A;  3GHA A;  1K0A A;  1KEB A;  2LUS A;  5COH A;  3EC3 A;  1N2A A;  3EPT A;  3KTB A;  4BPY A;  4HSC X;  3ZIJ A;  5ECP B;  3F0I A;  2N5F A;  4MF5 A;  3TRP A;  4N0V A;  4Z2U A;  3DGQ A;  3Q19 A;  2FWF A;  1A2J A;  4XS4 A;  4TOP A;  4NMU A;  3C1S A;  5F05 A;  2DSA A;  1T4Z A;  2DC5 A;  1X9S B;  1FO5 A;  3HA9 A;  1KTE A;  5C00 A;  1WIK A;  2VL3 A;  1TI1 A;  1CQH A;  3VWU A;  2HZE B;  3LFL A;  1NSW A;  3CRU A;  4ZIJ A;  3HJM A;  4G2E A;  1PX6 A;  2OBK A;  3J7Y b;  1M9B A;  1M99 A;  4YAP A;  4X4J A;  3IHG A;  4PGT A;  4OFM A;  4QL7 A;  1Z3E A;  4JZQ A;  2PPT A;  3DYR A;  4MJB A;  1FOH A;  4X43 A;  3IDV A;  18GS A;  1DE2 A;  2FWG A;  4TXV A;  5IOX A;  3BCI A;  3U6V A;  1AUC A;  4IP1 A;  2C3N A;  5DJM A;  1HQO A;  1ZMA A;  4K7O A;  4KUN A;  5G2Z A;  3PGT A;  1ILO A;  3CMI A;  1VGL A;  3ZZX A;  2DJ3 A;  3NOF A;  4GLT A;  1EP8 A;  5EPF A;  4XRA A;  2H75 A;  4KW6 A;  5LD0 A;  3ERG A;  2GVP A;  3CSI A;  1XZO A;  3VWW A;  4G0L A;  2P0G A;  2TIR A;  4IQA A;  2RLI A;  4MH3 A;  6GSX A;  1YKA A;  1SJZ A;  2P31 A;  1EV9 A;  3O3T A;  5IMV A;  3HD5 A;  5CP1 A;  1S3A A;  4YQV A;  1C72 A;  1XW5 A;  4MDC A;  1G6Y A;  4N30 A;  4AJ7 A;  1GSY A;  1PX7 A;  1TDI A;  2YCD A;  3FZ4 A;  1PKW A;  2K18 A;  3WT2 A;  1EV4 A;  3QAG A;  3VI7 A;  3QOU A;  2WDU A;  3GTU A;  4MJE A;  3VPT A;  2GST A;  3GKK A;  1B4Q A;  2CV4 A;  4O7H A;  3TJB A;  4PNG A;  1O7U A;  3PIN A;  1K3L A;  1GL8 A;  5D96 A;  1URM A;  3ZRD A;  3FY7 A;  3LXZ A;  1TJD A;  3D4T A;  1SKW B;  3A5W A;  4NHZ A;  4CW9 A;  2YWO A;  5IPH A;  3HXS A;  5KN2 A;  4HU9 A;  3L9U A;  3FMW A;  2CVB A;  3HVS A;  5DDL A;  4AF2 A;  3P7X A;  3RPP A;  2H70 A;  1BYE A;  4PX1 A;  1YKC A;  3UVH A;  1FG4 A;  3GX0 A;  3EU3 A;  2C0G A;  1GSD A;  4L5L A;  1S3R A;  3GUS A;  2AB6 A;  3UMA A;  3P2A A;  3W6G A;  4K5S A;  3RBT A;  2IMD A;  4DSR A;  1TU7 A;  2H6Z A;  2N5B A;  4WF5 A;  4TXO B;  4NXI A;  1ZYE A;  2X49 A;  4OO4 A;  1QQ2 A;  1QXH A;  3WGE A;  1SU9 A;  2HZF A;  3IK9 A;  1TKD B;  2VAF A;  2H6X A;  4GRF A;  1S3C A;  1M0U A;  2ALB A;  5GSS A;  3GST A;  3H4K A;  1B48 A;  1RW1 A;  3HYP A;  4Q5N A;  2C80 A;  3ME8 A;  4MPG A;  1V40 A;  2BMX A;  4CDO A;  5A4W A;  1QFN A;  3G9B A;  4ID0 A;  2IIY A;  5IMZ A;  2FA8 A;  2RUE A;  3W8S A;  3GL3 A;  1A23 A;  1K0D A;  3DKS A;  3EMX A;  2H73 A;  2B5E A;  1X5D A;  2WCI A;  4CY6 A;  3M1G A;  5DCH A;  2DJ2 A;  1Q4J A;  1M9A A;  1LBK A;  2HSH A;  1EGO A;  3KH7 A;  3VWX A;  3U5R E;  2V6K A;  3F4T A;  4KA0 A;  3ERW A;  5IM9 A;  5B6M A;  2N5A A;  3RHB A;  2LST A;  4MK3 A;  1Z9H A;  3ZLP A; 
#chains in the Genus database with same CATH homology
 3KP9 A;  1DE1 A;  1MD4 A;  1IYI A;  1ZZY A;  4GTU A;  3N5O A;  5DAL A;  2OJL A;  2ZNM A;  4Z2T A;  3A2V A;  3C1R A;  2I81 A;  1R4W A;  3HJO A;  2CVD A;  1ZGN A;  2YWI A;  2R0P A;  3KJY A;  2JZR A;  2K8S A;  2GT6 A;  5AIX A;  4AGS A;  3EUR A;  5B8A A;  2NPB A;  3KTL A;  3D6I A;  2WS2 A;  3V1W A;  4IS0 A;  4GF0 A;  4O5R A;  3UEM A;  2RII A;  3HVX A;  4EE0 A;  5DAK A;  2KP2 A;  1WPI A;  1SJ6 A;  2XBI A;  2MMN A;  1AQX A;  4BVY A;  3NIV A;  2C3Q A;  1T4Y A;  1EZK A;  4KDX A;  5ECR B;  2H1G A;  3CYN A;  5DVB A;  2GTU A;  1OC9 B;  1AAZ A;  3CSJ A;  4MAB A;  4LA1 A;  3HY2 A;  5INY A;  2YWN A;  5AN1 A;  1WP0 A;  2A4H A;  1K0C A;  1Z5Y E;  4G0K A;  1YZX A;  3HDC A;  5IIZ A;  20GS A;  2MMA A;  2RM5 A;  1G6W A;  4EDZ A;  3Q18 A;  1ERU A;  5KN0 A;  2DBC A;  2H1D A;  2HRN A;  2BJX A;  2LEG A;  1FAA A;  2M46 A;  3M9K A;  4I8B A;  2F9S A;  1A0R P;  3DD3 A;  2GQM A;  2H71 A;  3KMN A;  4F82 A;  4D73 B;  2LRT A;  4K9Z A;  2LQQ A;  1WE0 A;  1UN2 A;  2K9F A;  1TK5 B;  1MEK A;  1Y6E A;  4XHM A;  3TOT A;  4N10 A;  3WYW A;  2L59 A;  2P5Q A;  1EOG A;  3LJR A;  3I43 A;  3RAZ A;  4K2X A;  1ZYP A;  1GUM A;  5C04 A;  2B5Y A;  5GAN D;  4HZ2 A;  5HR1 A;  1FOV A;  3IXR A;  5CRW A;  3E9J B;  3O76 A;  2J23 A;  3UIW A;  1TRV A;  1SD9 A;  3G7I A;  1JZO A;  2FA4 A;  2XBQ A;  3FR6 A;  2NTO A;  4TR3 A;  1U87 A;  2DML A;  2PVQ A;  3MWH A;  2VD1 A;  3E3E A;  2LKU A;  1MDI A;  2HZE A;  3APQ A;  1F37 A;  4BWQ A;  4DSS B;  1A2L A;  4KH7 A;  4HJM A;  4N11 A;  2H19 A;  3L78 A;  5DJL A;  1GUL A;  3TB2 A;  4WBR D;  3FR9 A;  3TUE A;  3ISO A;  1IYH A;  5CNW A;  2HSM A;  1THO A;  4V1A g;  3IBH A;  4G19 A;  2DJK A;  1PN9 A;  1XW6 A;  5JWQ B;  4HZ4 A;  4F2I A;  3QAW A;  1K3Y A;  4ECI A;  3ZFB A;  1MTC A;  3G7J A;  2QKE A;  2A2S A;  3A2X A;  3ZIT A;  4F0C A;  1W89 A;  5A4V A;  3KP8 A;  1E2Y A;  1TP9 A;  3HJP A;  2YAN A;  3HHV A;  3IAS 2;  2O8V B;  4POL A;  5ECS A;  1PD2 1;  1XBS A;  3F6F A;  4WBJ A;  2VM2 A;  3GNJ A;  4QL9 A;  3TJG A;  2ON5 A;  2HXK A;  3DXB A;  3IV4 A;  2C8U A;  5ABR A;  2OAC A;  2OA7 A;  3W8J A;  1JFU A;  2JSZ A;  1V57 A;  2PU9 C;  4IBP A;  4ZL8 A;  5BMU A;  4ZL9 A;  1GNE A;  2L4Q A;  6GSU A;  4ICY A;  1OYJ A;  4BL7 B;  2WGR A;  1Z7P A;  1S3D A;  1RK4 A;  1U6T A;  2KUC A;  3KGK A;  2X64 A;  4BVX B;  1SK1 A;  4OFN A;  2LNT A;  1TRU A;  5ELG A;  3P90 A;  2XHF A;  3C8E A;  4WET A;  5EL8 A;  2QSI A;  2JZT A;  4RQR A;  4ZXG A;  2OAD A;  4IKH A;  1GSF A;  2CA8 A;  2LRC A;  4MNN A;  2ON7 A;  2LS5 A;  2CVK A;  5FWG A;  5BRT A;  5J4U A;  3TKP A;  3GKM A;  2O85 A;  2K6V A;  2JAD A;  2H0H A;  2NBS A;  4NV2 A;  1GTU A;  5E4W A;  2H8L A;  14GS A;  5D93 A;  3F6D A;  2NVL A;  4TXO A;  4K7I A;  4EKZ A;  3R2Q A;  4TVE A;  4L0W A;  4HI7 A;  4ZBA A;  3ZYW A;  2IME A;  4YAV A;  4XIH A;  4TR1 B;  4POB A;  5IMC A;  4OWY A;  2E7P A;  2CQ9 A;  5B7C A;  1U3A A;  2HT9 A;  2L4C A;  1JLW A;  1WWJ A;  4HJ2 A;  4G9H A;  5HFG A;  1B9X C;  1SL2 B;  4EIP A;  4ECJ A;  16GS A;  12GS A;  1GTI A;  2H76 A;  5D9W A;  4MZC A;  5G1K A;  2M80 A;  2UZ8 A;  7GSS A;  4J2F A;  3FZ5 A;  2CZ3 A;  2H72 A;  2NDO A;  2H30 A;  2VCT A;  4OCF A;  2PVO C;  2HYX A;  3GH6 A;  2C0F A;  2R0C A;  3UJ1 A;  1GRX A;  3QR6 A;  1SKS B;  2LNS A;  1V9W A;  4HQS A;  3CXG A;  4MMM A;  3MYD A;  4PUA A;  1K0O A;  2M72 A;  3WT1 A;  3HZ8 A;  2YJH A;  4JRR A;  1J0F A;  4EO3 A;  2VL2 C;  4HU7 A;  2VLV A;  4KF9 A;  1UA5 A;  2LQO A;  3LSZ A;  4Q5F A;  2R0G A;  2HRK A;  4JE1 A;  1GUK A;  3Q6O A;  3HKR A;  2GT5 A;  1BX9 A;  3M9J A;  1W4V A;  1XVQ A;  2F3M A;  1R5A A;  4F03 A;  3RDW A;  1OVN A;  1SYX A;  4Q5Q A;  4WR5 A;  4Z7X A;  1K0N A;  4XS4 B;  4ZB8 A;  4K0G A;  3IOS A;  1BAY A;  4WF4 A;  2RM6 A;  1O85 A;  4MF6 A;  1MDJ A;  4YQU A;  5KN3 A;  4ZBB A;  4IJI A;  1JLV A;  4IHU A;  1RQM A;  2DKI A;  1T7P B;  3QCP A;  3HCZ A;  3LWA A;  4QQ7 A;  3UBL A;  1VF4 A;  1HNB A;  1OC9 A;  3FW2 A;  4PQ1 A;  5ECN B;  1X9W B;  3UVT A;  3QD9 A;  3EU4 A;  3AY8 A;  5HR0 A;  3CTG A;  4YKF A;  2L6D A;  4USS A;  2XC2 A;  4KCE A;  4AJ8 A;  2AJQ B;  1TXX A;  5J9C A;  11GS A;  1SL0 B;  1NM3 A;  3WGX A;  5D73 A;  2ZCT A;  3BOA A;  3GL5 A;  5KN1 A;  2OE3 A;  4V2N A;  1TRW A;  3GKN A;  4FH8 A;  2VL9 A;  2H1B A;  4IJ3 A;  3BD2 A;  3DRN A;  3DVW A;  1MD3 A;  1A8Y A;  1OKD A;  1TI3 A;  3R3E A;  5G31 A;  3TDG A;  2IJY A;  3FRC A;  4K7N A;  4DEJ A;  3QPM A;  2G2Q A;  1HNC A;  5D9X A;  3KEB A;  1PKZ A;  4PNF A;  3D0Z A;  1PA3 A;  2R37 A;  4Z2R A;  6GSW A;  2FWE A;  1TRS A;  3EE2 A;  2IWT A;  1EEJ A;  1ZOF A;  3EIN A;  4FO5 A;  2GS3 A;  4NHW A;  1GNW A;  2OBI A;  1Z7R A;  2H01 A;  2YNX A;  2A2R A;  5IO2 A;  4L0U A;  2GZZ A;  4KND A;  4MZW A;  2F51 A;  1JZW A;  2I4A A;  3TJF A;  4PUR A;  1ERV A;  8GSS A;  1JHB A;  3UOM A;  4ZB9 A;  5JWO B;  2VIM A;  4EXJ A;  4FYB A;  2B3S A;  2VD0 A;  5IPG A;  1VF1 A;  1GSE A;  4DSQ A;  1O81 A;  1XCC A;  1SEN A;  5D8I A;  3C7M A;  1GLQ A;  3QAV A;  3N9J A;  3F63 A;  4HS1 A;  5KOX A;  4ILF A;  1AQV A;  2AHE A;  4ZIL A;  1T00 A;  6GSS A;  2DJJ A;  1MDK A;  4K5R A;  5HFI A;  4ECC A;  2A2P A;  3ZTL A;  4TW5 A;  3US3 A;  2FY6 A;  2PGT A;  2R6K A;  1A2M A;  4V1A p;  1GTA A;  4J56 E;  1AW9 A;  1ZYQ B;  2O7K A;  1XWB A;  4GST A;  2VCX A;  5AIS A;  5CAX A;  3D21 A;  13GS A;  4GQC A;  2L6C A;  2JZS A;  2HNL A;  2DIY A;  4GXZ A;  1NHY A;  2HRA A;  2JAC A;  3IK7 A;  2F8F A;  4HQZ A;  1USB A;  5IO0 A;  2JU5 A;  2KP1 A;  1HNA A;  3A5I A;  1F3A A;  4HDE A;  2VM1 A;  5J5N A;  1QUW A;  3QMX A;  1U3I A;  2D2Z A;  1J08 A;  2C1Y A;  2PMT A;  2FUG 2;  3F8U A;  5D9T A;  2VLT A;  5DBQ A;  4KB3 A;  1K0M A;  1F6M C;  3P8W A;  1YEX A;  2WUL A;  5H5R A;  4OD7 A;  2KLX A;  2GGT A;  1G7O A;  3E0U A;  1H75 A;  1BED A;  5FHI A;  5ECI B;  1V98 A;  4KAE A;  4BL7 A;  5G5E A;  4MA9 A;  3MAK A;  3TRX A;  4ISD A;  3ZVJ D;  1DBY A;  9GSS A;  3Q74 A;  4RI7 A;  4BWS A;  1AIU A;  3FK8 A;  4BVX A;  4G0I A;  1FB6 A;  5GAP D;  2B7K A;  5J3R A;  2FD3 A;  1XWK A;  1GH2 A;  1K0B A;  3LXT A;  3TKS E;  1O6J A;  3TOU A;  4HUA A;  2MMO A;  3GIX A;  1HD2 A;  2DJ1 A;  4LL1 B;  5KEJ A;  3CTF A;  3SBC A;  4GSN A;  2K8V A;  3VUR A;  1YQ1 A;  3GA4 A;  1ZL9 A;  2LTK A;  3ZRE A;  4I6X A;  3EWL A;  3HZ4 A;  1TTZ A;  2JL4 A;  2IFQ B;  3GMF A;  3O6T A;  2XPE A;  2YN1 A;  3ZIV A;  1QK8 A;  3DML A;  2X8G A;  2I1U A;  4TN8 A;  3TKR A;  4KX4 A;  1SD8 A;  3DVX A;  2VLU A;  1I5G A;  3GKX A;  4L5O A;  4MF7 A;  2VCZ A;  2IMI A;  2VL2 A;  4WEY A;  1THX A;  4K6X A;  4V2M A;  4XRD A;  1A0F A;  3TRQ A;  2YZU A;  2FNO A;  3L4N A;  1XXU A;  3IC8 A;  2WZ9 A;  3UAP A;  1SJI A;  2B1L A;  4K8M A;  5IOW A;  3KM6 A;  2WFC A;  2VCW A;  3MIX A;  1R5P A;  4TR1 A;  3GSS A;  2C3T A;  2H1A A;  2OE1 A;  5G30 A;  3L9S A;  1BQ7 A;  5G5F A;  1T3B A;  1XW9 A;  2V2G A;  1YEP A;  3DIE A;  3TCO A;  3IHQ A;  5B8B A;  3VWV A;  4MCU A;  2X8H A;  5A5K A;  1TU8 A;  4KGI A;  2IL3 A;  2DJ0 A;  19GS A;  2L5L A;  3HVV A;  4EL1 A;  3FKF A;  5FT3 A;  4KSM A;  1YF0 A;  4LLR A;  1U88 A;  2YV9 A;  3F4S A;  1O73 A;  1SK0 A;  3APO A;  2VCV A;  3DWV A;  2V32 A;  4K0N A;  1XWG A;  3BJ5 A;  2HI7 A;  4KCA A;  2MBS A;  4PUF C;  3VPQ A;  1EGR A;  4I2U A;  1GP1 A;  1HYU A;  2DMM A;  4MJA A;  3F3R A;  2WRT A;  4IW9 A;  2I9H A;  1R26 A;  2GQL A;  2QGV A;  2MZC A;  4XS6 A;  2ES7 A;  1TK8 B;  1M2B A;  3RHC A;  3TKS C;  1Q98 A;  3IRA A;  5ECK B;  5J9B A;  4TRX A;  1DSB A;  1OC8 A;  3SWL A;  2JSY A;  4EVM A;  3K8N A;  4EDY A;  3GUR A;  5ECL B;  5ENU A;  1EOH A;  2GDR A;  4A5P A;  2VUP A;  3C73 A;  1O8W A;  2HFD A;  2YZH A;  4RQX A;  3J7Y k;  2RUF A;  4AJ6 A;  4EIQ A;  3FEU A;  3LGC A;  2R5G A;  5H5S A;  5DQY A;  4IQ1 A;  1GSU A;  1GSS A;  2HE3 A;  3F4R A;  1EP7 A;  3ZVJ A;  4POK A;  3D4M A;  3ERF A;  1OAZ A;  2GSR A;  2R4V A;  5HR2 A;  3LG6 A;  5CRD A;  2E2G A;  1YF1 A;  5JCG A;  4G10 A;  4L8E A;  2V6O A;  3D5J A;  1ST9 A;  1NHO A;  2R3X A;  4XS1 A;  2REM A;  4O5U A;  1X5E A;  2QA2 A;  3ME7 A;  1CQG A;  1JZR A;  2IMF A;  4IEL A;  2X99 A;  2CZ2 A;  5J41 A;  2F8A A;  4JR4 A;  1GUH A;  1XFL A;  3LEF A;  2WJU A;  1SKR B;  1H4O A;  3L0H A;  1UVZ A;  2YV7 A;  4YKG A;  4P3Y B;  3UAR A;  2LV3 A;  3M0F A;  3VI5 A;  1XIY A;  4X1U A;  4FIW A;  3EVI A;  2L5O A;  6GSY A;  5EY6 A;  3IA1 A;  3ED3 A;  2YOI A;  4FQU A;  4O92 A;  3DEX A;  10GS A;  4HEA 2;  4K1F A;  4PQH A;  4EC0 A;  4MLY A;  3CBU A;  4J57 E;  4E8E A;  4IN0 A;  2V41 A;  4ML1 A;  1TOF A;  2PUK C;  4XTS A;  4JBB A;  2FCH A;  3FHK A;  3WGD A;  5ID2 B;  4KE3 A;  2MYG A;  6GST A;  1AQW A;  3G7Y A;  2CX4 A;  2MMZ A;  1GSQ A;  3FYG A;  3L9V A;  5LNK e;  4KDY A;  4IP6 A;  1M2D A;  1PN0 A;  2ZUP A;  1BJX A;  2H6Y A;  1FHE A;  4EUY A;  1B8X A;  2BTO T;  1XWC A;  3KIJ A;  4ACS A;  1A24 A;  17GS A;  2YP6 A;  2LJA A;  3BCK A;  3IE3 A;  1WOU A;  1PMT A;  4ECB A;  2HLS A;  4I97 A;  3ZML A;  4NAX A;  3H8Q A;  3PPU A;  4YH2 A;  2R2J A;  3JCM L;  2AV4 A;  1XOB A;  2FWH A;  3LYP A;  1SL1 B;  1VF2 A;  1FVK A;  2CT6 A;  5F0G A;  2GSS A;  3F3Q A;  4MJC A;  1WJK A;  1Y25 A;  1OE7 A;  5IMD A;  4F0B A;  3EMP A;  1OKT A;  5CYY A;  2X4A A;  1B9Y C;  2DIZ A;  2GSQ A;  2VO4 A;  5L71 A;  1PL1 A;  5E59 A;  2FLS A;  3NZN A;  4N0Z A;  3OR5 A;  2KOK A;  2FGX A;  2IPA A;  5DCG A;  3KXO A;  5IQY A;  3GV1 A;  1X5C A;  1ML6 A;  3IAM 2;  4LMW A;  4NWY A;  1FVJ A;  3ZFL A;  2CX3 A;  1YY7 A;  1AC1 A;  5JCW A;  1PL2 A;  1K3O A;  2H74 A;  2B7J A;  4I5Q A;  1X0R A;  3BBY A;  2KHP A;  2H66 A;  1ERW A;  2EIR A;  2AUV A;  4MH2 A;  1SYR A;  4D73 A;  1OE8 A;  3QFA C;  3M8N A;  5IMA A;  1YDK A;  4V2L A;  1I9D A;  2PER A;  4GQF A;  1T8E B;  3CRT A;  3H79 A;  1F3B A;  1FW1 A;  3FZA A;  3UL3 A;  4OO5 A;  2PBJ A;  1ZCP A;  3RPN A;  4NPB A;  4WR4 A;  2QA1 A;  3ZL5 A;  1X9M B;  2X8C A;  4GWR A;  1Z6M A;  5CRG A;  3GYK A;  3GN3 A;  4JED A;  1XPV A;  4JU5 A;  3GTU B;  5JWR B;  2CAI A;  5EVO A;  1GTB A;  3QDN A;  1V2A A;  3MDK A;  4GCI A;  2OE0 A;  3MSZ A;  1PSQ A;  2VCQ A;  3C71 A;  1YJ6 A;  1WRY A;  2YJ7 A;  2B5X A;  1A8L A;  2B1K A;  3A2W A;  4EF0 A;  4O32 A;  1JZD A;  2E0Q A;  4LL4 B;  3GFK A;  2PN8 A;  1QGV A;  1ACV A;  5F8B A;  2O89 A;  4DSS A;  2YPM A;  2IFQ A;  3VLN A;  4K2D A;  1KNG A;  2GQK A;  2C4J A;  3GX8 A;  4FYU A;  3IPZ A;  4OFT A;  2XPD A;  1NW2 A;  2IN3 A;  2L57 A;  1EEM A;  2PWJ A;  2A4V A;  3S9F A;  1SK2 A;  3TKS A;  1KBN A;  3APS A;  3TGZ A;  4OMV A;  5CRE A;  1VF3 A;  4MZB A;  2GZY A;  4PQI A;  3TKQ A;  4OCE A;  1N8J A;  4YQM A;  2CAQ A;  3VFI A;  3FR3 A;  3I6A A;  4WKW A;  4CHS A;  1Z6N A;  2AAW A;  5GZZ B;  5AGY A;  2EIQ A;  5JCU A;  4XCS A;  2E2M A;  4TKY A;  1J9B A;  5IMF A;  3I69 A;  4PTS A;  5GST A;  1PGT A;  3CSH A;  1PQN A;  2MBT A;  1B4P A;  4F9Z A;  3F9U A;  2LJR A;  1TW9 A;  1BG5 A;  3KCM A;  4X0X A;  3KZQ A;  4ULX A;  2DKH A;  4H86 A;  2EC4 A;  4JR6 A;  4HOJ A;  4DVC A;  1QMV A;  4TR4 A;  4IVF A;  5HQP A;  4IGJ A;  2IMK A;  3IC4 A;  1GLP A;  22GS A;  5CRH A;  2AYT A;  3UBK A;  1G0T A;  1E6B A;  1XVW A;  4CY8 A;  5A4U A;  3H93 A;  1M7T A;  5DAL B;  5F06 A;  1M2A A;  3FZ9 A;  5G1L A;  3KH9 A;  3LOR A;  5ELA A;  4BA7 A;  1O8X A;  2LRN A;  2HSY A;  1T1V A;  1ABA A;  5H5Q A;  2H0I A;  3I9V 2;  4MP4 A;  4ZL7 A;  2J9H A;  2VOC A;  3M3M A;  2C0E A;  5F07 A;  2B6M A;  2GLR A;  2DLX A;  1LJR A;  3GRX A;  3ZMK A;  4MPF A;  5HR3 A;  2QC7 A;  4RI6 A;  4E8H A;  4KDU A;  2FHE A;  4RUV A;  2EIO A;  5DAK B;  3PR8 A;  1OC3 A;  3KD0 A;  1ERT A;  3EYT A;  2P5R A;  1DUG A;  4Q5R A;  4GSS A;  4KSO A;  4BVY B;  5KOW A;  3QFB C;  1R7H A;  5ECM B;  1GWC A;  1WMJ A;  1ZYN A;  4FYC A;  3VK9 A;  3A3T A;  3LYK A;  1UC7 A;  1EWX A;  2O87 A;  5DQS A;  5HFK A;  2TRC P;  1LU4 A;  2TRX A;  3WD6 A;  5ECO B;  3D22 A;  1PRX A;  2I3Y A;  1V58 A;  1F2E A;  3TJJ A;  4ZBD A;  2Z9S A;  1F9M A;  6GSV A;  2YWM A;  3PH9 A;  2LJK A;  4I2T A;  4PXO A;  4O5Q A;  3TJK A;  4TR0 A;  1FB0 A;  2V1M A;  3KMO A;  1XWA A;  4ZB6 A;  3H1N A;  3LW9 A;  2GZP A;  5AIV A;  3IR4 A;  1VRS D;  5D9V A;  1G7E A;  3GH9 A;  5ECQ B;  2OKA A;  2H0G A;  5CO3 A;  5B6N A;  2WB9 A;  4LMV A;  4ML6 A;  1XOA A;  5LCZ A;  4WXT A;  2G0F A;  1TK0 B;  5ID2 A;  2HRF A;  3LQ7 A;  4NV5 A;  4POM A;  3MNG A;  5ECH B;  2C0D A;  1ON4 A;  1AXD A;  3GHA A;  1K0A A;  1KEB A;  2LUS A;  5COH A;  3EC3 A;  1N2A A;  3EPT A;  3KTB A;  4BPY A;  3ZIJ A;  5ECP B;  3F0I A;  2N5F A;  4MF5 A;  3TRP A;  4N0V A;  4Z2U A;  3DGQ A;  3Q19 A;  2FWF A;  1A2J A;  4XS4 A;  4TOP A;  4NMU A;  3C1S A;  5F05 A;  2DSA A;  1T4Z A;  2DC5 A;  1X9S B;  1FO5 A;  3HA9 A;  1KTE A;  5C00 A;  1WIK A;  2VL3 A;  1TI1 A;  1CQH A;  3VWU A;  2HZE B;  3LFL A;  1NSW A;  3CRU A;  4ZIJ A;  3HJM A;  4G2E A;  1PX6 A;  2OBK A;  3J7Y b;  1M9B A;  1M99 A;  4YAP A;  4X4J A;  3IHG A;  4PGT A;  4OFM A;  4QL7 A;  1Z3E A;  4JZQ A;  2PPT A;  3DYR A;  4MJB A;  1FOH A;  4X43 A;  3IDV A;  18GS A;  1DE2 A;  2FWG A;  4TXV A;  5IOX A;  3BCI A;  3U6V A;  1AUC A;  4IP1 A;  2C3N A;  5DJM A;  1HQO A;  1ZMA A;  4K7O A;  4KUN A;  5G2Z A;  3PGT A;  1ILO A;  3CMI A;  1VGL A;  3ZZX A;  2DJ3 A;  3NOF A;  4GLT A;  1EP8 A;  5EPF A;  4XRA A;  2H75 A;  4KW6 A;  5LD0 A;  3ERG A;  2GVP A;  3CSI A;  1XZO A;  3VWW A;  4G0L A;  2P0G A;  2TIR A;  4IQA A;  2RLI A;  4MH3 A;  6GSX A;  1YKA A;  1SJZ A;  2P31 A;  1EV9 A;  3O3T A;  5IMV A;  3HD5 A;  5CP1 A;  1S3A A;  4YQV A;  1C72 A;  1XW5 A;  4MDC A;  1G6Y A;  4N30 A;  4AJ7 A;  1GSY A;  1PX7 A;  1TDI A;  2YCD A;  3FZ4 A;  1PKW A;  2K18 A;  3WT2 A;  1EV4 A;  3QAG A;  3VI7 A;  3QOU A;  2WDU A;  3GTU A;  4MJE A;  3VPT A;  2GST A;  3GKK A;  1B4Q A;  2CV4 A;  4O7H A;  3TJB A;  4PNG A;  1O7U A;  3PIN A;  1K3L A;  1GL8 A;  5D96 A;  1URM A;  3ZRD A;  3FY7 A;  3LXZ A;  1TJD A;  3D4T A;  1SKW B;  3A5W A;  4NHZ A;  4CW9 A;  2YWO A;  5IPH A;  3HXS A;  5KN2 A;  4HU9 A;  3L9U A;  3FMW A;  2CVB A;  3HVS A;  5DDL A;  4AF2 A;  3P7X A;  3RPP A;  2H70 A;  1BYE A;  4PX1 A;  1YKC A;  3UVH A;  1FG4 A;  3GX0 A;  3EU3 A;  2C0G A;  1GSD A;  4L5L A;  3GUS A;  2AB6 A;  3UMA A;  3P2A A;  3W6G A;  4K5S A;  3RBT A;  2IMD A;  4DSR A;  1TU7 A;  2H6Z A;  2N5B A;  4WF5 A;  4TXO B;  4NXI A;  1ZYE A;  2X49 A;  4OO4 A;  1QQ2 A;  1QXH A;  3WGE A;  1SU9 A;  2HZF A;  3IK9 A;  1TKD B;  2VAF A;  2H6X A;  4GRF A;  1S3C A;  1M0U A;  2ALB A;  5GSS A;  3GST A;  3H4K A;  1B48 A;  1RW1 A;  3HYP A;  4Q5N A;  2C80 A;  3ME8 A;  4MPG A;  1V40 A;  2BMX A;  4CDO A;  5A4W A;  1QFN A;  3G9B A;  4ID0 A;  2IIY A;  5IMZ A;  2FA8 A;  2RUE A;  3W8S A;  3GL3 A;  1A23 A;  1K0D A;  3DKS A;  3EMX A;  2H73 A;  2B5E A;  1X5D A;  2WCI A;  4CY6 A;  3M1G A;  5DCH A;  2DJ2 A;  1Q4J A;  1M9A A;  1LBK A;  2HSH A;  1EGO A;  3KH7 A;  3VWX A;  3U5R E;  2V6K A;  3F4T A;  4KA0 A;  3ERW A;  5IM9 A;  5B6M A;  2N5A A;  3RHB A;  2LST A;  4MK3 A;  1Z9H A;  3ZLP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...