1S3AA

Nmr solution structure of subunit b8 from human nadh-ubiquinone oxidoreductase complex i (ci-b8)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
85
structure length
85
Chain Sequence
GLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADH-ubiquinone oxidoreductase B8 subunit
publication title The oxidized subunit B8 from human complex I adopts a thioredoxin fold.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 85
sequence length 85
ec nomenclature ec 1.6.5.3: Transferred entry: 7.1.1.2.
pdb deposition date 2004-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05047 L51_S25_CI-B8 Mitochondrial ribosomal protein L51 / S25 / CI-B8 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1s3aA00
4GSSA 3GH9A 2VCWA 4FIWA 4ML1A 1YF0A 2G2QA 1G7EA 3NZNA 1K0BA 3G7YA 4JE1A 4MP4A 1ZYQB 1XWCA 2GGTA 1FG4A 2IL3A 2M46A 3VPQA 2YNXA 4IGJA 5FT3A 5FHIA 1O81A 3TCOA 5JCWA 3O6TA 4HQZA 3F4RA 2REMA 4Q5RA 3L9VA 2RM6A 2WRTA 2M72A 2H70A 4HUAA 3APQA 1K3YA 1AIUA 1VF3A 3TRPA 5JCUA 1TTZA 3LXTA 5F06A 5CRWA 2PGTA 2VD1A 1W89A 3VWUA 2P0GA 3WYWA 1KEBA 1TDIA 4O92A 1XPVA 1K0NA 1QGVA 1Y6EA 3BBYA 1WWJA 2G0FA 2H19A 5A4WA 4MJEA 5DAKA 2AUVA 1JZOA 2N5FA 4N11A 5ECSA 4JBBA 4IW9A 4MJBA 1SD8A 2JSZA 1TJDA 1X5CA 1B4QA 2A4VA 2L6DA 3Q18A 4N0ZA 3KTLA 4YAPA 1BG5A 1NM3A 2WCIA 5CRDA 1BQ7A 3FEUA 4EXJA 4F0CA 2AHEA 4POBA 2XBQA 4DVCA 4K2DA 2XPEA 3TDGA 1MEKA 1X5DA 3R2QA 3IR4A 1WIKA 4HJMA 3UL3A 4KA0A 2B5XA 1Y25A 4MZBA 2A2RA 4GQCA 1LU4A 3OR5A 3CTFA 1AW9A 4WF5A 1K0DA 3PINA 4WF4A 2AB6A 2FHEA 3VK9A 20GSA 2KOKA 1Z9HA 4IP1A 4IJ3A 5EY6A 4L0WA 5B8BA 2QKEA 1GUHA 1RQMA 4DSSA 9GSSA 3A3TA 3GUSA 3F4TA 4V2MA 2OKAA 2PVOC 1TK0B 1U3IA 2KUCA 1PRXA 4JR4A 3IK9A 4PGTA 5HR0A 3F6FA 5D73A 3N9JA 3LEFA 2NBSA 1PX6A 2RUFA 4HZ2A 3TRXA 1IYHA 5JWRB 5ECPB 3KH9A 2LUSA 2YWMA 4J2FA 1JZRA 2GZZA 4BVXA 4G9HA 3TRQA 2HT9A 2LNSA 1PX7A 3LQ7A 2ON7A 4GXZA 1F3BA 5GZZB 4KX4A 1TRSA 5IPGA 2H6ZA 4AJ8A 1PKWA 2DIYA 2DJ1A 4HDEA 4KCEA 2L4QA 1X9SB 1K0MA 1KTEA 4FYBA 1MDIA 2KHPA 3GKKA 2R5GA 4TXOA 5G5FA 1RW1A 2OBKA 5CRGA 4O7HA 4FH8A 4KW6A 1OAZA 4PX1A 3RPPA 3GTUA 4KH7A 3TUEA 2H66A 1QXHA 4AGSA 3F3QA 3DWVA 5DQSA 2FWHA 2VM2A 3LXZA 4GQFA 3ZVJA 4GLTA 1HNBA 5IPHA 2VL2C 2PERA 5DCHA 5ID2B 3LORA 1JLVA 2L6CA 1XWAA 3WGXA 1EZKA 2B6MA 1J08A 4ULXA 3A2WA 2WZ9A 5CO3A 2RM5A 2PWJA 2MMNA 2L5LA 5A4UA 3C71A 3L0HA 1XCCA 2YN1A 2H0HA 1NHYA 3BCKA 3GL5A 5AIXA 4BWQA 1SL1B 1SK1A 2ES7A 5CAXA 4KSOA 3VWXA 1TK8B 3H8QA 3HY2A 3VI5A 3WD6A 2F8FA 2CVDA 1XWGA 5ECOB 3W6GA 4CHSA 3RHCA 2JU5A 3M0FA 3E9JB 2ALBA 1M99A 1G7OA 2AJQB 2GT6A 1FW1A 3CTGA 5G31A 1F6MC 19GSA 2LRCA 2PUKC 2GQKA 2R3XA 5AN1A 3TKPA 1T00A 4IHUA 3J7Yk 3D6IA 3DKSA 2MMZA 4ACSA 5IMFA 3CSIA 4TN8A 2H1DA 2V6OA 4D73B 2H75A 2JZSA 4ML6A 4TR1B 1VF2A 2IMDA 3RAZA 1AUCA 5J3RA 1JZDA 5D9TA 2CVKA 8GSSA 1XW5A 4K8MA 4TXVA 1LBKA 4WBJA 3GL3A 3DIEA 5AGYA 2CA8A 1A8LA 2VIMA 3IRAA 1MD3A 1XWBA 2B1KA 5G2ZA 2X64A 2MYGA 2CAQA 22GSA 2VM1A 5DVBA 1AC1A 3G7IA 2HZFA 3EU3A 2FWEA 1M2BA 4TKYA 1ERWA 4QL7A 2OE1A 3F6DA 2I81A 2DMLA 3APOA 3KM6A 1UC7A 2IMFA 4L5LA 4IBPA 5GSSA 4WXTA 1ABAA 2VO4A 1GSQA 1K0OA 1EEMA 3VURA 2DSAA 1SJZA 2N5AA 2MMAA 2BMXA 1A23A 4RQXA 3TJKA 2IPAA 3FW2A 4CDOA 1FOVA 4I2TA 2GQMA 3QDNA 1K0AA 2TIRA 2YOIA 3C1RA 4MF5A 5B6NA 3IK7A 5LCZA 1XVWA 2IMEA 5ELGA 2LJKA 1EWXA 3GKNA 4OFMA 3QD9A 2K8SA 4BPYA 4OD7A 2YP6A 5D93A 1K3LA 3ZREA 1TKDB 1VF4A 2H30A 4G2EA 4MZWA 2B3SA 3LWAA 5G5EA 4PQIA 2GQLA 2C0FA 2IFQA 1A2JA 3TJBA 4PQHA 3HHVA 2OE0A 4Z7XA 3VI7A 4RUVA 4OMVA 3JCML 4LL4B 2JSYA 4MCUA 5IMDA 4I5QA 3ZLPA 4MJCA 16GSA 4L5OA 5J5NA 1XBSA 5ECKB 3MWHA 4KGIA 2K9FA 3HJMA 5DJMA 2I4AA 4KB3A 3FRCA 1GH2A 3GV1A 2JACA 3P90A 3MSZA 5D96A 4H86A 5KEJA 3GRXA 4OO4A 3M9KA 4ZIJA 4L8EA 1GLPA 4XS4A 1E6BA 1TW9A 3IPZA 4BWSA 1I9DA 2DJ0A 12GSA 6GSVA 3LJRA 11GSA 4KCAA 4Q5QA 2BTOT 4F2IA 1S3AA 1EV9A 1PMTA 3LG6A 4YQUA 3TJFA 1FB6A 2YJHA 5E4WA 4POLA 3KGKA 1XIYA 1ZZYA 5DDLA 2BJXA 6GSYA 2D2ZA 4EVMA 3KMNA 4BA7A 1GTAA 4JRRA 4ZB8A 3HA9A 13GSA 1O8WA 4K0NA 1HD2A 4AJ7A 2EIOA 1ML6A 4AJ6A 4GWRA 3CBUA 4N0VA 1ZYEA 3GIXA 3KP9A 5CNWA 5ECIB 5AISA 2FCHA 1YY7A 3GSTA 3ZITA 1AAZA 2HFDA 3QMXA 4GTUA 2H0GA 2K18A 2GLRA 1ILOA 5CYYA 1CQGA 3M8NA 2B1LA 2Z9SA 3PGTA 4OFTA 2K6VA 1MDKA 2LRTA 2TRCP 3HZ4A 4YQVA 4ZB9A 1ZOFA 1XXUA 1Q98A 3Q6OA 2MBSA 5JCGA 4MA9A 5KN0A 2L5OA 4ECCA 3ZTLA 4FYCA 4L0UA 3W8SA 3WGEA 4Q5NA 1OKDA 2DJJA 2E2GA 4MZCA 3SWLA 1MDJA 3F4SA 4BL7A 2MMOA 2GSQA 1XWKA 3Q19A 3HJOA 1M9BA 4HOJA 3IOSA 4ZXGA 3HYPA 2FLSA 5H5RA 5IO2A 2C0GA 4HU9A 3DXBA 2FUG2 2LEGA 1I5GA 2WULA 4ZL9A 4JR6A 4HI7A 4EKZA 1F2EA 3CRTA 4N10A 3BOAA 3IXRA 3W8JA 4F82A 4JZQA 2HLSA 4NHZA 1XFLA 2VD0A 2DJKA 3QR6A 5LD0A 4KSMA 1TRWA 2QGVA 3UVHA 4EE0A 3ZRDA 3RDWA 1PD21 3M3MA 4GSNA 3DGQA 1SENA 1VRSD 2NPBA 5GAPD 1F37A 3D22A 5DJLA 1JFUA 4PQ1A 3PH9A 4POKA 4TRXA 2O7KA 2VAFA 3U5RE 2VL2A 3K8NA 1R5PA 2VLVA 2IJYA 2CZ3A 2RLIA 3UIWA 3BCIA 1GNEA 2VCVA 2GZYA 1YDKA 1SD9A 3RPNA 3TKSA 1EOGA 1PKZA 3GYKA 4EL1A 1O7UA 5ECHB 4EDYA 1O6JA 3KJYA 4ZL8A 3DEXA 3KTBA 2PVQA 2JADA 2O8VB 1ACVA 2H1BA 4PXOA 2V41A 1W4VA 3H1NA 1NW2A 5G1LA 4OO5A 1SKWB 3F0IA 2R4VA 2LNTA 1M7TA 4FO5A 1J0FA 3KIJA 1QQ2A 7GSSA 3C73A 1QMVA 1YKAA 5KN1A 3IBHA 3FR6A 1JLWA 4ZBAA 4LMVA 3VFIA 2GSRA 1QK8A 1A24A 5D9XA 1MTCA 4NAXA 1OC9A 1DE1A 3UMAA 1M2AA 1S3DA 1A0RP 2TRXA 1TRUA 2KP2A 1A2LA 3QFBC 6GSUA 2RIIA 1FHEA 2YZUA 2J23A 2YWIA 1X0RA 4IJIA 3EMXA 1Z7RA 1QFNA 4G10A 2EIRA 5DAKB 3MDKA 1XOAA 5DALA 4V2NA 2GT5A 1SKRB 1MD4A 5D8IA 2M80A 3GNJA 1GUMA 2C0DA 2DLXA 4ZILA 2HXKA 3TKSC 18GSA 3HCZA 1RK4A 3HKRA 1S3CA 5GAND 4K9ZA 4N30A 1HNCA 1BAYA 3CSJA 3DVXA 1SJIA 2CV4A 1U87A 3F9UA 2V1MA 2H8LA 1M0UA 3UVTA 1OYJA 1YQ1A 3APSA 1AQXA 1T4ZA 2H74A 1Z3EA 6GSSA 1JHBA 4YQMA 1VF1A 1YJ6A 2HZEA 3G9BA 1WJKA 3E3EA 4NPBA 4IQAA 3EU4A 4PUFC 1USBA 2PMTA 4DSSB 3IDVA 3ZIJA 1GSEA 1B8XA 2FA8A 1K0CA 4HEA2 3F63A 3GHAA 3O76A 2OA7A 3L4NA 3O3TA 4ID0A 1WP0A 1XW9A 1GUKA 4XIHA 2WFCA 5D9WA 2H71A 1SYRA 4EC0A 3G7JA 4KNDA 1AQWA 3TOTA 4OCFA 3GMFA 1JZWA 2O85A 3VPTA 14GSA 1BJXA 1URMA 4RI6A 1B9XC 1GP1A 4EO3A 4E8HA 17GSA 3UBLA 5IOWA 3FY7A 2A2SA 2H72A 5JWOB 1J9BA 5C00A 5DCGA 3LYPA 2J9HA 3GKXA 1A0FA 2PPTA 2NTOA 5JWQB 4ECBA 4TOPA 4IQ1A 3QAGA 2H0IA 2FA4A 4NXIA 1SK2A 2XHFA 4PNFA 1HYUA 1OVNA 3L9SA 4WR4A 2LTKA 1ERVA 1EV4A 1A2MA 2LRNA 1EEJA 1GRXA 1U6TA 1WPIA 5IMAA 4XS1A 4NWYA 1Z7PA 3TB2A 3GKMA 5ECNB 3KP8A 4TXOB 2LJRA 4JEDA 4ZBDA 1FVJA 1SKSB 3BJ5A 3VWVA 5ECMB 3KMOA 2HRFA 1TOFA 3GTUB 1NHOA 3HD5A 5HFGA 2CAIA 1WMJA 4GRFA 1ERUA 3M1GA 2XBIA 2E2MA 2H6XA 1OE7A 4KAEA 4MABA 3HXSA 3UAPA 3SBCA 2LQOA 2C0EA 2FD3A 2B5YA 2KLXA 3FHKA 4CW9A 4F0BA 3TJJA 1BEDA 3P2AA 2WB9A 1GTBA 1M2DA 1EP8A 1OKTA 3IAM2 3I6AA 1XW6A 1SJ6A 1Z5YE 3DRNA 3GFKA 5ECRB 3S9FA 5EVOA 3A2XA 4GF0A 2JZRA 4F9ZA 4YAVA 2WGRA 4LA1A 1DSBA 5KN3A 1X5EA 3IAS2 3KZQA 4HZ4A 1AXDA 3LGCA 2MZCA 3QPMA 4TR3A 2CZ2A 3ME7A 2V6KA 3QAVA 2E0QA 1WRYA 3FZAA 1R5AA 3HZ8A 5CRHA 3QOUA 1UN2A 3C1SA 2H01A 4WEYA 1R7HA 1T7PB 2R37A 3FK8A 4F03A 2L4CA 2O89A 1OC3A 1HQOA 1O73A 1YEXA 2GS3A 4OCEA 4G19A 5H5QA 2IIYA 2VL9A 4OFNA 2VL3A 5ENUA 2CX4A 2HE3A 4DEJA 5J4UA 3EURA 4XS6A 4MDCA 1C72A 2LV3A 3MNGA 4RI7A 3IA1A 1CQHA 2OE3A 1DE2A 3E0UA 4PURA 5IOXA 3QCPA 1THOA 1TI1A 3ZMKA 3WGDA 1GNWA 1GSYA 2H1AA 3FZ5A 4ILFA 3TOUA 4TR0A 1XZOA 4MK3A 4JU5A 3KCMA 1FAAA 5GSTA 2VCQA 2X99A 1Q4JA 5F0GA 3GA4A 3LSZA 2OACA 1TU8A 3UBKA 2FNOA 2C80A 5HR2A 1XVQA 5EPFA 2HRNA 4WKWA 1YZXA 1ST9A 3CSHA 5HFIA 5D9VA 1WOUA 4K7NA 4DSRA 4QQ7A 10GSA 2ON5A 1PSQA 1M9AA 5HFKA 1SK0A 2VLUA 2H73A 2X8GA 4NV5A 4ZBBA 2EC4A 6GSTA 2VUPA 2C8UA 2DIZA 3FR9A 2LKUA 4O32A 2LQQA 1GL8A 5IMCA 2H6YA 1OE8A 3ZL5A 3ZIVA 3A5WA 1GTUA 3ISOA 1BX9A 1EOHA 3FZ9A 3DVWA 3P7XA 4X0XA 4KDUA 4MF7A 4NMUA 3UJ1A 4ECIA 1GLQA 5ID2A 3DYRA 4LLRA 1F9MA 3VWWA 2CQ9A 3GURA 5C04A 3H4KA 1Z6MA 2HI7A 2AYTA 2IFQB 1X9WB 4EF0A 1H75A 1THXA 2CX3A 3H93A 3WT2A 2OBIA 3TKRA 2KP1A 2HNLA 4NV2A 2YCDA 1ZMAA 2NDOA 2WDUA 3EINA 2B7KA 1GULA 2YV7A 3ME8A 5E59A 4XRDA 4AF2A 2QSIA 2GSSA 2XC2A 4WETA 3GH6A 4K1FA 3QFAC 4LMWA 4ISDA 5J9BA 1O85A 1GSFA 3IE3A 3L78A 5IIZA 3NIVA 5F05A 4MPGA 4MMMA 1LJRA 3HDCA 2X8HA 2ZCTA 4XS4B 1V2AA 2GDRA 4PNGA 1T1VA 1T3BA 4EDZA 1KBNA 2ZUPA 2JZTA 2NVLA 1V9WA 1ERTA 4D73A 1SYXA 1R4WA 5G30A 2L57A 1B4PA 1B48A 4TR1A 4TVEA 3GN3A 4KUNA 6GSWA 1SL2B 4IP6A 3CYNA 5INYA 3GX8A 1N2AA 4KDXA 1N8JA 4K6XA 4MLYA 1Z6NA 4PUAA 3LFLA 4J57E 2WS2A 2H1GA 3M9JA 4IKHA 1YKCA 3TKQA 1TI3A 5DBQA 1FO5A 3AY8A 4OWYA 3FKFA 5ECLB 3I9V2 3ZYWA 1ZGNA 4I2UA 1V57A 1H4OA 1FVKA 4I6XA 1DBYA 2B7JA 3DMLA 5KN2A 1QUWA 4IS0A 4K7IA 3V1WA 2R2JA 4K7OA 2IMIA 1FB0A 3RHBA 2MBTA 2JL4A 4V1Ag 2CVBA 2FY6A 3KEBA 5ELAA 3HVVA 1TXXA 5COHA 2VCTA 3IHQA 2RUEA 1GTIA 4MPFA 3F8UA 3EMPA 2E7PA 5CREA 3ERGA 2YWOA 4P3YB 5IQYA 1V58A 3MAKA 4K0GA 1ZCPA 1F3AA 5F07A 4HU7A 2P31A 2LJAA 2VCZA 2DBCA 1TK5B 3J7Yb 1KNGA 1ZL9A 1AQVA 1WE0A 3FZ4A 4I97A 5J41A 2X8CA 3C8EA 5F8BA 2I1UA 6GSXA 4HJ2A 3F3RA 4X43A 3BD2A 3KD0A 5IM9A 4I8BA 2I3YA 1T4YA 1OC8A 2HYXA 3IC4A 2FWGA 1TU7A 1YF1A 1B9YC 2F8AA 2GVPA 1SU9A 4J56E 2VCXA 4DSQA 4WBRD 1UA5A 2IN3A 1V40A 5G1KA 3GX0A 3ZZXA 3D21A 4HQSA 5AIVA 5L71A 1UVZA 3UEMA 2F51A 2AV4A 1X9MB 2C3QA 4XTSA 3DD3A 2L59A 3HVXA 2FGXA 2YJ7A 1U3AA 3EC3A 3GSSA 1DUGA 1VGLA 1TRVA 4XHMA 5B6MA 2AAWA 3VLNA 2QC7A 4GSTA 1K3OA 2B5EA 2O87A 2HSYA 4X1UA 2GZPA 4BVYA 1ON4A 2DJ3A 5HQPA 2P5RA 3PR8A 2YV9A 3ED3A 3RBTA 2CT6A 1E2YA 2V32A 4ZL7A 1BYEA 4EUYA 3ZFLA 1G6WA 2P5QA 4LL1B 4NHWA 3I43A 3UARA 3ZFBA 3UOMA 3I69A 4IN0A 1GSSA 4QL9A 2DJ2A 4POMA 3C7MA 2C3TA 3D5JA 4KDYA 2YANA 3CXGA 1GSDA 4MH2A 1A8YA 2GTUA 4V2LA 4XRAA 2XPDA 2C3NA 3HVSA 4GCIA 1PN9A 2YPMA 2PU9C 4MJAA 1G6YA 4RQRA 2F9SA 5LNKe 4ZB6A 1OC9B 5IMVA 3D4TA 2LSTA 3TKSE 3CRUA 3ZMLA 4ECJA 1EP7A 3P8WA 2V2GA 3EVIA 3L9UA 3ERWA 3LYKA 1PL2A 1T8EB 4Q5FA 3U6VA 2GSTA 3US3A 4HS1A 3FR3A 3TJGA 3D4MA 1O8XA 5ECQB 1GSUA 5DALB 3IV4A 4O5RA 4XCSA 2WJUA 2C4JA 4IVFA 1EGOA 3Q74A 5A4VA 3EE2A 4TW5A 3N5OA 1EGRA 2N5BA 1YEPA 3A2VA 3EWLA 4V1Ap 1PL1A 2IMKA 1HNAA 1PGTA 2VOCA 2OADA 3NOFA 2VLTA 1GWCA 2R6KA 1NSWA 2FWFA 2OJLA 1XOBA 4MF6A 3HJPA 3ZVJD 3H79A 4MH3A 2PBJA 3KXOA 5B7CA 1R26A 2F3MA 3EYTA 4YH2A 2HZEB 2I9HA 5FWGA 2LS5A 4WR5A 1U88A 4FYUA 2IWTA 1TP9A 4E8EA 3KH7A 2C1YA 2DMMA 2DC5A 5A5KA 5ABRA 2EIQA 5IO0A 5EL8A 2HSHA 3ERFA 1PQNA 5HR1A 4TR4A 2PN8A 2H76A 2K8VA 2YWNA 1IYIA 1G0TA 3QAWA 5HR3A 1SL0B 1PA3A 3D0ZA 5IMZA 5J9CA 3TGZA 4IELA 1V98A 5CP1A 5H5SA 2ZNMA 4KE3A 3WT1A 3FYGA 3CMIA 5B8AA 2YZHA 5DQYA
chains in the Genus database with same CATH superfamily
4GSSA 3GH9A 2VCWA 4FIWA 4ML1A 1YF0A 2G2QA 1G7EA 3NZNA 1K0BA 2R0CA 3G7YA 4JE1A 4MP4A 4CY8A 1ZYQB 1XWCA 4HSCX 2GGTA 1FG4A 2IL3A 2M46A 3VPQA 2YNXA 4IGJA 5FT3A 5FHIA 1O81A 3TCOA 5JCWA 3O6TA 4HQZA 3F4RA 2REMA 4Q5RA 3L9VA 2RM6A 2WRTA 2M72A 2H70A 4HUAA 3APQA 1K3YA 1AIUA 1VF3A 3TRPA 5JCUA 1TTZA 3LXTA 5F06A 5CRWA 2PGTA 2VD1A 1W89A 3VWUA 2P0GA 3WYWA 1KEBA 1TDIA 4O92A 1XPVA 1K0NA 1QGVA 1Y6EA 3BBYA 1WWJA 2G0FA 2H19A 5A4WA 4MJEA 5DAKA 2AUVA 1JZOA 2N5FA 4N11A 5ECSA 4JBBA 4IW9A 4MJBA 1SD8A 2JSZA 1TJDA 1X5CA 1B4QA 2A4VA 2L6DA 3Q18A 4FQUA 4N0ZA 3KTLA 4YAPA 1BG5A 1NM3A 2WCIA 5CRDA 1BQ7A 3FEUA 4EXJA 4F0CA 2AHEA 4POBA 2XBQA 4DVCA 4K2DA 2XPEA 3TDGA 1MEKA 1X5DA 3R2QA 3IR4A 1WIKA 4HJMA 3UL3A 4KA0A 2B5XA 1Y25A 4MZBA 2A2RA 4GQCA 1LU4A 3OR5A 3CTFA 3IC8A 1AW9A 4WF5A 1K0DA 3PINA 4WF4A 2AB6A 2FHEA 3VK9A 20GSA 2KOKA 4X4JA 1Z9HA 4IP1A 4IJ3A 5EY6A 4L0WA 5B8BA 2QKEA 1GUHA 1RQMA 4DSSA 9GSSA 3A3TA 3GUSA 3F4TA 4V2MA 2OKAA 2PVOC 1TK0B 1U3IA 2KUCA 1PRXA 4JR4A 3IK9A 4PGTA 5HR0A 3F6FA 5D73A 3N9JA 3LEFA 2NBSA 1PX6A 2RUFA 4HZ2A 3TRXA 1IYHA 5JWRB 5ECPB 3KH9A 2LUSA 2YWMA 4J2FA 1JZRA 2GZZA 4BVXA 1M3JA 4G9HA 1M3IA 3TRQA 2HT9A 2LNSA 1PX7A 3LQ7A 2ON7A 4GXZA 1F3BA 5GZZB 4KX4A 1TRSA 5IPGA 2H6ZA 4AJ8A 1PKWA 2DIYA 3A5IA 2DJ1A 3PPUA 4HDEA 4KCEA 2L4QA 1X9SB 1K0MA 1KTEA 4FYBA 1MDIA 2KHPA 3GKKA 2R5GA 4TXOA 5G5FA 1RW1A 2OBKA 5CRGA 4O7HA 4FH8A 4KW6A 1OAZA 4PX1A 3RPPA 3GTUA 4KH7A 3TUEA 2H66A 1QXHA 4AGSA 3F3QA 3DWVA 5DQSA 2FWHA 2VM2A 3LXZA 4GQFA 3ZVJA 4GLTA 1HNBA 5IPHA 2VL2C 2PERA 5DCHA 5ID2B 3LORA 1JLVA 2L6CA 1XWAA 3WGXA 1EZKA 2B6MA 1J08A 4ULXA 3A2WA 2WZ9A 5CO3A 2RM5A 2PWJA 2MMNA 2L5LA 5A4UA 3C71A 3L0HA 1XCCA 2YN1A 2H0HA 1NHYA 3BCKA 3GL5A 5AIXA 4BWQA 1SL1B 1SK1A 2ES7A 5CAXA 4KSOA 3VWXA 1TK8B 3H8QA 3HY2A 3VI5A 3WD6A 2F8FA 2CVDA 1XWGA 5ECOB 3W6GA 4CHSA 3RHCA 2JU5A 3M0FA 3E9JB 2ALBA 1M99A 1G7OA 2AJQB 2GT6A 1FW1A 3CTGA 5G31A 1F6MC 19GSA 2LRCA 2PUKC 2GQKA 2R3XA 5AN1A 3TKPA 1T00A 4IHUA 3J7Yk 4EIQA 3D6IA 3DKSA 2MMZA 4ACSA 5IMFA 3CSIA 4TN8A 2H1DA 2V6OA 4D73B 2R0PA 2H75A 2JZSA 4CY6A 4ML6A 4TR1B 1VF2A 2IMDA 3RAZA 1AUCA 5J3RA 1JZDA 5D9TA 2CVKA 8GSSA 1XW5A 4K8MA 4TXVA 2X49A 1LBKA 4WBJA 5AGYA 3GL3A 3DIEA 2CA8A 1A8LA 2VIMA 3IRAA 1MD3A 1XWBA 2B1KA 5G2ZA 2X64A 2MYGA 2CAQA 22GSA 2VM1A 5DVBA 1AC1A 3G7IA 2HZFA 3EU3A 2FWEA 3CQFA 1M2BA 4TKYA 1ERWA 4QL7A 2OE1A 3F6DA 2I81A 2DMLA 3APOA 3KM6A 1UC7A 2IMFA 4L5LA 4IBPA 5GSSA 4WXTA 1ABAA 2VO4A 1GSQA 1K0OA 1EEMA 3VURA 2DSAA 1SJZA 2N5AA 2MMAA 1XG8A 2BMXA 1A23A 4RQXA 3TJKA 2IPAA 3FW2A 4CDOA 1FOVA 4I2TA 2GQMA 3QDNA 1K0AA 2TIRA 2YOIA 3C1RA 4MF5A 5B6NA 3IK7A 5LCZA 1XVWA 2IMEA 5ELGA 2LJKA 1EWXA 3GKNA 4OFMA 3QD9A 2K8SA 4BPYA 4OD7A 2YP6A 5D93A 1K3LA 3ZREA 1TKDB 1VF4A 2H30A 4G2EA 4MZWA 2B3SA 3LWAA 5G5EA 4PQIA 2GQLA 2C0FA 2IFQA 1A2JA 3TJBA 4PQHA 3HHVA 2OE0A 4K5RA 4Z7XA 3VI7A 4RUVA 4OMVA 3JCML 4LL4B 2JSYA 4MCUA 5IMDA 4I5QA 3ZLPA 4MJCA 16GSA 4L5OA 5J5NA 1XBSA 5ECKB 3MWHA 4KGIA 2K9FA 3HJMA 5DJMA 2I4AA 4KB3A 3FRCA 1GH2A 3GV1A 2JACA 3P90A 3MSZA 5D96A 3LW9A 4H86A 5KEJA 3GRXA 4OO4A 3M9KA 4ZIJA 4L8EA 1GLPA 4XS4A 1E6BA 1TW9A 3IPZA 4BWSA 1I9DA 4USSA 4BVYB 2DJ0A 12GSA 6GSVA 3LJRA 4Z2TA 11GSA 2A2PA 4KCAA 4Q5QA 2HSMA 2BTOT 4F2IA 1S3AA 1EV9A 1PMTA 3LG6A 4YQUA 3TJFA 1FB6A 2YJHA 5E4WA 4POLA 3KGKA 1XIYA 1ZZYA 5DDLA 2BJXA 6GSYA 2D2ZA 4EVMA 3KMNA 4BA7A 1GTAA 4JRRA 4ZB8A 3HA9A 13GSA 1O8WA 4K0NA 1HD2A 4AJ7A 2EIOA 1ML6A 4AJ6A 4GWRA 3CBUA 4N0VA 1ZYEA 3GIXA 3KP9A 5CNWA 5ECIB 5AISA 2FCHA 1YY7A 3GSTA 3ZITA 1AAZA 2HFDA 3QMXA 4GTUA 2H0GA 2A4HA 2HRKA 2K18A 2GLRA 1ILOA 5CYYA 1CQGA 3M8NA 2B1LA 2Z9SA 3PGTA 4OFTA 4G0LA 2K6VA 1MDKA 2LRTA 2TRCP 3HZ4A 4YQVA 4ZB9A 1ZOFA 4O5QA 1XXUA 1Q98A 3Q6OA 2MBSA 5JCGA 4MA9A 5KN0A 2L5OA 1ZYPA 3ZTLA 4ECCA 4FYCA 4L0UA 3W8SA 3WGEA 4Q5NA 1OKDA 2DJJA 2E2GA 4MZCA 3SWLA 1MDJA 3F4SA 4BL7A 2MMOA 2GSQA 1XWKA 3Q19A 3HJOA 1M9BA 4HOJA 3IOSA 4ZXGA 3HYPA 2FLSA 5H5RA 5IO2A 2C0GA 4HU9A 3DXBA 2FUG2 2LEGA 1I5GA 2WULA 4ZL9A 4JR6A 4HI7A 4EKZA 1F2EA 3CRTA 4N10A 3BOAA 3IXRA 3W8JA 4F82A 4JZQA 2HLSA 4NHZA 1XFLA 2VD0A 2DJKA 3QR6A 5LD0A 4KSMA 1TRWA 2QGVA 3UVHA 4EE0A 3ZRDA 3RDWA 1PD21 3M3MA 4GSNA 3DGQA 1SENA 1VRSD 2NPBA 5GAPD 1F37A 3D22A 5DJLA 1JFUA 4PQ1A 3PH9A 4POKA 4TRXA 2O7KA 2VAFA 3U5RE 2VL2A 3K8NA 1R5PA 2VLVA 2IJYA 2CZ3A 2RLIA 3UIWA 3BCIA 1GNEA 2VCVA 2GZYA 1YDKA 1SD9A 3RPNA 3TKSA 1EOGA 1PKZA 3GYKA 4EL1A 1O7UA 5ECHB 4EDYA 1O6JA 3KJYA 4ZL8A 3DEXA 3KTBA 2PVQA 2JADA 2O8VB 1ACVA 2H1BA 4PXOA 2V41A 1W4VA 3H1NA 1NW2A 5G1LA 4OO5A 4KF9A 1SKWB 3F0IA 2R4VA 2LNTA 1M7TA 4FO5A 1J0FA 3KIJA 1QQ2A 7GSSA 3C73A 1QMVA 1YKAA 5KN1A 3IBHA 3FR6A 1JLWA 4ZBAA 4LMVA 3VFIA 2GSRA 4Z2RA 1QK8A 1A24A 5D9XA 1MTCA 4NAXA 1OC9A 1DE1A 3UMAA 1M2AA 1S3DA 1A0RP 2TRXA 1TRUA 2KP2A 1A2LA 3QFBC 6GSUA 2DKHA 2RIIA 1FHEA 2YZUA 2J23A 2YWIA 1X0RA 4IJIA 5BRTA 3EMXA 1Z7RA 1QFNA 4G10A 2EIRA 5DAKB 3MDKA 1XOAA 5DALA 4V2NA 2GT5A 1SKRB 1MD4A 5D8IA 2M80A 3GNJA 1GUMA 2C0DA 2DLXA 4ZILA 2HXKA 3TKSC 18GSA 3HCZA 1RK4A 3HKRA 1S3CA 5GAND 1ZYNA 4K9ZA 4N30A 1HNCA 1BAYA 3FMWA 3CSJA 3DVXA 1SJIA 2CV4A 1U87A 3F9UA 2V1MA 2H8LA 1M0UA 3UVTA 1OYJA 1YQ1A 3APSA 1AQXA 1T4ZA 2H74A 1Z3EA 6GSSA 1JHBA 1PN0A 4YQMA 1VF1A 1YJ6A 2HZEA 3G9BA 1WJKA 3E3EA 4NPBA 4IQAA 3EU4A 4PUFC 1USBA 2PMTA 4DSSB 3IDVA 3ZIJA 1GSEA 1B8XA 2FA8A 1K0CA 4HEA2 3F63A 3GHAA 3O76A 2OA7A 3L4NA 3O3TA 1S3RA 4ID0A 1WP0A 1XW9A 1GUKA 4XIHA 2WFCA 5D9WA 2H71A 1SYRA 4EC0A 3G7JA 4KNDA 1AQWA 3TOTA 4OCFA 3GMFA 1JZWA 2O85A 3VPTA 14GSA 1BJXA 1URMA 4RI6A 1B9XC 1GP1A 4EO3A 4E8HA 17GSA 3UBLA 5IOWA 3FY7A 2A2SA 4BVXB 2H72A 5JWOB 4ICYA 1J9BA 5C00A 5DCGA 3LYPA 2J9HA 3GKXA 1A0FA 2PPTA 2NTOA 3IHGA 5JWQB 4ECBA 4TOPA 4IQ1A 3QAGA 2H0IA 2FA4A 4NXIA 1SK2A 2XHFA 4PNFA 1HYUA 1OVNA 3L9SA 4WR4A 2LTKA 1ERVA 1EV4A 1A2MA 2LRNA 1EEJA 1GRXA 1U6TA 1WPIA 5IMAA 4XS1A 4NWYA 1Z7PA 3TB2A 3GKMA 5ECNB 3KP8A 4TXOB 5KOWA 2LJRA 4JEDA 4ZBDA 1FVJA 1SKSB 3BJ5A 3VWVA 5ECMB 3KMOA 2HRFA 1TOFA 3GTUB 1NHOA 3HD5A 5HFGA 2CAIA 1WMJA 4GRFA 1ERUA 3M1GA 2XBIA 2E2MA 2H6XA 1OE7A 4KAEA 4MABA 3HXSA 3UAPA 3SBCA 2LQOA 2C0EA 2FD3A 2B5YA 2KLXA 3FHKA 4CW9A 4F0BA 3TJJA 1BEDA 3P2AA 2WB9A 1GTBA 1M2DA 1EP8A 1OKTA 3IAM2 3I6AA 1XW6A 1SJ6A 1Z5YE 3DRNA 3GFKA 5ECRB 3S9FA 5EVOA 3A2XA 4GF0A 2JZRA 4F9ZA 4K5SA 4YAVA 2WGRA 2UZ8A 4LA1A 1DSBA 5KN3A 1X5EA 3IAS2 3KZQA 4HZ4A 1AXDA 3LGCA 2MZCA 3QPMA 3HVNA 4TR3A 2CZ2A 3ME7A 2V6KA 3QAVA 2E0QA 1WRYA 3FZAA 1PFOA 1R5AA 3HZ8A 5CRHA 3QOUA 1UN2A 3C1SA 2H01A 4WEYA 1R7HA 1T7PB 2R37A 3FK8A 4F03A 2L4CA 2O89A 1OC3A 1HQOA 1O73A 1YEXA 2X4AA 4PTSA 2GS3A 4OCEA 4G19A 5H5QA 2IIYA 2VL9A 4OFNA 2VL3A 5ENUA 2CX4A 2HE3A 4DEJA 5J4UA 3EURA 4XS6A 4MDCA 1C72A 2LV3A 3MNGA 4RI7A 4K2XA 3IA1A 1CQHA 2OE3A 1DE2A 3E0UA 4PURA 5IOXA 3QCPA 1THOA 1TI1A 3ZMKA 3WGDA 1GNWA 1GSYA 2H1AA 3FZ5A 4ILFA 3TOUA 4TR0A 1XZOA 4MK3A 4JU5A 3KCMA 1FAAA 5GSTA 2VCQA 2X99A 1Q4JA 5F0GA 3GA4A 3LSZA 2OACA 1TU8A 3UBKA 2FNOA 2C80A 5HR2A 1XVQA 5EPFA 2HRNA 4YKFA 4WKWA 1YZXA 1ST9A 3CSHA 5HFIA 5D9VA 1WOUA 4K7NA 4DSRA 4QQ7A 10GSA 2ON5A 1PSQA 1M9AA 5HFKA 1SK0A 2VLUA 2H73A 2X8GA 4NV5A 4ZBBA 2EC4A 6GSTA 2VUPA 2C8UA 2DIZA 3FR9A 2LKUA 4O32A 2LQQA 1GL8A 3R3EA 5IMCA 2H6YA 1OE8A 3ZL5A 3ZIVA 3A5WA 1GTUA 3ISOA 1BX9A 1EOHA 3FZ9A 3DVWA 3P7XA 4X0XA 4KDUA 4MF7A 4NMUA 3UJ1A 4ECIA 1GLQA 5ID2A 3DYRA 4LLRA 1F9MA 3VWWA 2CQ9A 3MYDA 3GURA 5C04A 3H4KA 1Z6MA 2HI7A 2AYTA 2IFQB 1X9WB 4EF0A 1H75A 1THXA 2CX3A 3H93A 3WT2A 2OBIA 3TKRA 2KP1A 2HNLA 4NV2A 2YCDA 1ZMAA 2NDOA 2WDUA 3EINA 2B7KA 1GULA 2YV7A 3ME8A 5E59A 4XRDA 4AF2A 2QSIA 2GSSA 2XC2A 4WETA 3GH6A 4K1FA 4A5PA 3QFAC 4LMWA 4ISDA 5J9BA 1O85A 1GSFA 3IE3A 3L78A 5IIZA 3NIVA 5F05A 4MPGA 4MMMA 1LJRA 3HDCA 2X8HA 2ZCTA 4XS4B 1V2AA 2GDRA 4PNGA 1T1VA 1T3BA 4EDZA 1KBNA 2ZUPA 2JZTA 2NVLA 1V9WA 1ERTA 4D73A 1SYXA 1R4WA 5G30A 2L57A 1B4PA 1B48A 4TR1A 4TVEA 3GN3A 4KUNA 6GSWA 1SL2B 4IP6A 4O5UA 3CYNA 5INYA 3GX8A 1N2AA 4KDXA 1N8JA 4K6XA 4MLYA 1Z6NA 4PUAA 3LFLA 4J57E 2WS2A 2H1GA 3M9JA 4IKHA 1YKCA 3TKQA 1TI3A 5DBQA 1FO5A 3AY8A 4OWYA 3FKFA 5ECLB 3I9V2 2QA2A 3ZYWA 1ZGNA 4I2UA 1V57A 1H4OA 1FVKA 4I6XA 1DBYA 2B7JA 3DMLA 5KN2A 1QUWA 4IS0A 4K7IA 3V1WA 2R2JA 4K7OA 2IMIA 1FB0A 3RHBA 2MBTA 2JL4A 4V1Ag 2CVBA 2FY6A 3KEBA 5ELAA 3HVVA 1TXXA 5COHA 2VCTA 3IHQA 2RUEA 1GTIA 4MPFA 3MIXA 3F8UA 3EMPA 2E7PA 5CREA 4EIPA 3ERGA 2YWOA 4BL7B 4P3YB 5IQYA 1V58A 3MAKA 4K0GA 1ZCPA 1F3AA 1FOHA 5F07A 4HU7A 2P31A 2LJAA 2VCZA 2DBCA 1TK5B 3J7Yb 1KNGA 1ZL9A 4MNNA 1AQVA 1WE0A 3FZ4A 4I97A 5J41A 2X8CA 3C8EA 5F8BA 2I1UA 6GSXA 4HJ2A 3F3RA 4X43A 3BD2A 3KD0A 5IM9A 4I8BA 2I3YA 1T4YA 1OC8A 2HYXA 3IC4A 2FWGA 1TU7A 1YF1A 1B9YC 2F8AA 2GVPA 1SU9A 4J56E 2VCXA 4DSQA 4WBRD 1UA5A 2IN3A 1V40A 5G1KA 3GX0A 3ZZXA 3D21A 4HQSA 5AIVA 5L71A 1UVZA 3UEMA 2DKIA 2F51A 4YKGA 2AV4A 1X9MB 2C3QA 4XTSA 3DD3A 2L59A 3HVXA 2FGXA 2YJ7A 1U3AA 3EC3A 3GSSA 1DUGA 1VGLA 1TRVA 4XHMA 5B6MA 2AAWA 3VLNA 2QC7A 4G0IA 4GSTA 1K3OA 2B5EA 2O87A 2HSYA 4X1UA 2GZPA 4BVYA 1ON4A 2DJ3A 5HQPA 2P5RA 3PR8A 2YV9A 3ED3A 3RBTA 2CT6A 1E2YA 2V32A 4ZL7A 1BYEA 4EUYA 3ZFLA 1G6WA 2P5QA 4LL1B 4NHWA 3I43A 3UARA 3ZFBA 3UOMA 3I69A 4IN0A 1GSSA 4QL9A 2DJ2A 4POMA 3C7MA 2C3TA 3D5JA 4KDYA 2YANA 3CXGA 1GSDA 4MH2A 1A8YA 2GTUA 4V2LA 4XRAA 2XPDA 2C3NA 3HVSA 4GCIA 1PN9A 2YPMA 2PU9C 4MJAA 1G6YA 4RQRA 2F9SA 5LNKe 4ZB6A 4BIKA 1OC9B 5IMVA 3D4TA 2LSTA 3TKSE 3CRUA 3ZMLA 4ECJA 1EP7A 3P8WA 2V2GA 3EVIA 3L9UA 3ERWA 3LYKA 1PL2A 1T8EB 4Q5FA 3U6VA 2GSTA 3US3A 4HS1A 3FR3A 3TJGA 3D4MA 1O8XA 5ECQB 1GSUA 5DALB 3IV4A 4O5RA 4XCSA 2WJUA 2C4JA 4IVFA 1EGOA 3Q74A 5A4VA 3EE2A 4TW5A 3N5OA 4Z2UA 1EGRA 2N5BA 3EPTA 1YEPA 3A2VA 3EWLA 4V1Ap 1PL1A 2IMKA 1HNAA 1PGTA 2VOCA 2QA1A 2R0GA 2OADA 3NOFA 2VLTA 5BMUA 1GWCA 2R6KA 1NSWA 2FWFA 2OJLA 2HRAA 1XOBA 4MF6A 3HJPA 4G0KA 3ZVJD 3H79A 4MH3A 2PBJA 3KXOA 5B7CA 1R26A 2F3MA 3EYTA 4YH2A 2HZEB 2I9HA 5FWGA 2LS5A 4WR5A 1U88A 4FYUA 2IWTA 1TP9A 4E8EA 3KH7A 2C1YA 2DMMA 2DC5A 5A5KA 5ABRA 2EIQA 5IO0A 5EL8A 2HSHA 5KOXA 3ERFA 1PQNA 5HR1A 4TR4A 2PN8A 2H76A 2K8VA 2YWNA 1IYIA 1G0TA 3QAWA 5HR3A 1SL0B 1PA3A 3D0ZA 5IMZA 5J9CA 3TGZA 4IELA 1V98A 5CP1A 5H5SA 2ZNMA 4KE3A 3WT1A 3FYGA 3CMIA 5B8AA 2YZHA 5DQYA
chains in the Genus database with same CATH topology
4GSSA 3GH9A 2VCWA 4FIWA 4ML1A 1YF0A 2G2QA 1G7EA 3NZNA 1K0BA 2R0CA 3G7YA 4JE1A 4MP4A 4CY8A 1ZYQB 1XWCA 2GGTA 1FG4A 2IL3A 2M46A 3VPQA 2YNXA 4IGJA 5FT3A 5FHIA 1O81A 3TCOA 5JCWA 3O6TA 4HQZA 3F4RA 2REMA 4Q5RA 3L9VA 2RM6A 2WRTA 2M72A 2H70A 4HUAA 3APQA 1K3YA 1AIUA 1VF3A 3TRPA 5JCUA 1TTZA 3LXTA 5F06A 5CRWA 2PGTA 2VD1A 1W89A 3VWUA 2P0GA 3WYWA 1KEBA 1TDIA 4O92A 1XPVA 1K0NA 1QGVA 1Y6EA 3BBYA 1WWJA 2G0FA 2H19A 5A4WA 4MJEA 5DAKA 2AUVA 1JZOA 2N5FA 4N11A 5ECSA 4JBBA 4IW9A 4MJBA 1SD8A 2JSZA 1TJDA 1X5CA 1B4QA 2A4VA 2L6DA 3Q18A 4FQUA 4N0ZA 3KTLA 4YAPA 1BG5A 1NM3A 2WCIA 5CRDA 1BQ7A 3FEUA 4EXJA 4F0CA 2AHEA 4POBA 2XBQA 4DVCA 4K2DA 2XPEA 3TDGA 1MEKA 1X5DA 3R2QA 3IR4A 1WIKA 4HJMA 3UL3A 4KA0A 2B5XA 1Y25A 4MZBA 2A2RA 4GQCA 1LU4A 3OR5A 3CTFA 3IC8A 1AW9A 4WF5A 1K0DA 3PINA 4WF4A 2AB6A 2FHEA 3VK9A 20GSA 2KOKA 4X4JA 1Z9HA 4IP1A 4IJ3A 5EY6A 4L0WA 5B8BA 2QKEA 1GUHA 1RQMA 4DSSA 9GSSA 3A3TA 3GUSA 3F4TA 4V2MA 2OKAA 2PVOC 1TK0B 1U3IA 2KUCA 1PRXA 4JR4A 3IK9A 4PGTA 5HR0A 3F6FA 5D73A 3N9JA 3LEFA 2NBSA 1PX6A 2RUFA 4HZ2A 3TRXA 1IYHA 5JWRB 5ECPB 3KH9A 2LUSA 2YWMA 4J2FA 1JZRA 2GZZA 4BVXA 4G9HA 3TRQA 2HT9A 2LNSA 1PX7A 3LQ7A 2ON7A 4GXZA 1F3BA 5GZZB 4KX4A 1TRSA 5IPGA 2H6ZA 4AJ8A 1PKWA 2DIYA 3A5IA 2DJ1A 3PPUA 4HDEA 4KCEA 2L4QA 1X9SB 1K0MA 1KTEA 4FYBA 1MDIA 2KHPA 3GKKA 2R5GA 4TXOA 5G5FA 1RW1A 2OBKA 5CRGA 4O7HA 4FH8A 4KW6A 1OAZA 4PX1A 3RPPA 3GTUA 4KH7A 3TUEA 2H66A 1QXHA 4AGSA 3F3QA 3DWVA 5DQSA 2FWHA 2VM2A 3LXZA 4GQFA 3ZVJA 4GLTA 1HNBA 5IPHA 2VL2C 2PERA 5DCHA 5ID2B 3LORA 1JLVA 2L6CA 1XWAA 3WGXA 1EZKA 2B6MA 1J08A 4ULXA 3A2WA 2WZ9A 5CO3A 2RM5A 2PWJA 2MMNA 2L5LA 5A4UA 3C71A 3L0HA 1XCCA 2YN1A 2H0HA 1NHYA 3BCKA 3GL5A 5AIXA 4BWQA 1SL1B 1SK1A 2ES7A 5CAXA 4KSOA 3VWXA 1TK8B 3H8QA 3HY2A 3VI5A 3WD6A 2F8FA 2CVDA 1XWGA 5ECOB 3W6GA 4CHSA 3RHCA 2JU5A 3M0FA 3E9JB 2ALBA 1M99A 1G7OA 2AJQB 2GT6A 1FW1A 3CTGA 5G31A 1F6MC 19GSA 2LRCA 2PUKC 2GQKA 2R3XA 5AN1A 3TKPA 1T00A 4IHUA 3J7Yk 4EIQA 3D6IA 3DKSA 2MMZA 4ACSA 5IMFA 3CSIA 4TN8A 2H1DA 2V6OA 4D73B 2R0PA 2H75A 2JZSA 4CY6A 4ML6A 4TR1B 1VF2A 2IMDA 3RAZA 1AUCA 5J3RA 1JZDA 5D9TA 2CVKA 8GSSA 1XW5A 4K8MA 4TXVA 2X49A 1LBKA 4WBJA 5AGYA 3GL3A 3DIEA 2CA8A 1A8LA 2VIMA 3IRAA 1MD3A 1XWBA 2B1KA 5G2ZA 2X64A 2MYGA 2CAQA 22GSA 2VM1A 5DVBA 1AC1A 3G7IA 2HZFA 3EU3A 2FWEA 1M2BA 4TKYA 1ERWA 4QL7A 2OE1A 3F6DA 2I81A 2DMLA 3APOA 3KM6A 1UC7A 2IMFA 4L5LA 4IBPA 5GSSA 4WXTA 1ABAA 2VO4A 1GSQA 1K0OA 1EEMA 3VURA 2DSAA 1SJZA 2N5AA 2MMAA 2BMXA 1A23A 4RQXA 3TJKA 2IPAA 3FW2A 4CDOA 1FOVA 4I2TA 2GQMA 3QDNA 1K0AA 2TIRA 2YOIA 3C1RA 4MF5A 5B6NA 3IK7A 5LCZA 1XVWA 2IMEA 5ELGA 2LJKA 1EWXA 3GKNA 4OFMA 3QD9A 2K8SA 4BPYA 4OD7A 2YP6A 5D93A 1K3LA 3ZREA 1TKDB 1VF4A 2H30A 4G2EA 4MZWA 2B3SA 3LWAA 5G5EA 4PQIA 2GQLA 2C0FA 2IFQA 1A2JA 3TJBA 4PQHA 3HHVA 2OE0A 4K5RA 4Z7XA 3VI7A 4RUVA 4OMVA 3JCML 4LL4B 2JSYA 4MCUA 5IMDA 4I5QA 3ZLPA 4MJCA 16GSA 4L5OA 5J5NA 1XBSA 5ECKB 3MWHA 4KGIA 2K9FA 3HJMA 5DJMA 2I4AA 4KB3A 3FRCA 1GH2A 3GV1A 2JACA 3P90A 3MSZA 5D96A 3LW9A 4H86A 5KEJA 3GRXA 4OO4A 3M9KA 4ZIJA 4L8EA 1GLPA 4XS4A 1E6BA 1TW9A 3IPZA 4BWSA 1I9DA 4USSA 4BVYB 2DJ0A 12GSA 6GSVA 3LJRA 4Z2TA 11GSA 2A2PA 4KCAA 4Q5QA 2HSMA 2BTOT 4F2IA 1S3AA 1EV9A 1PMTA 3LG6A 4YQUA 3TJFA 1FB6A 2YJHA 5E4WA 4POLA 3KGKA 1XIYA 1ZZYA 5DDLA 2BJXA 6GSYA 2D2ZA 4EVMA 3KMNA 4BA7A 1GTAA 4JRRA 4ZB8A 3HA9A 13GSA 1O8WA 4K0NA 1HD2A 4AJ7A 2EIOA 1ML6A 4AJ6A 4GWRA 3CBUA 4N0VA 1ZYEA 3GIXA 3KP9A 5CNWA 5ECIB 5AISA 2FCHA 1YY7A 3GSTA 3ZITA 1AAZA 2HFDA 3QMXA 4GTUA 2H0GA 2A4HA 2HRKA 2K18A 2GLRA 1ILOA 5CYYA 1CQGA 3M8NA 2B1LA 2Z9SA 3PGTA 4OFTA 4G0LA 2K6VA 1MDKA 2LRTA 2TRCP 3HZ4A 4YQVA 4ZB9A 1ZOFA 4O5QA 1XXUA 1Q98A 3Q6OA 2MBSA 5JCGA 4MA9A 5KN0A 2L5OA 1ZYPA 3ZTLA 4ECCA 4FYCA 4L0UA 3W8SA 3WGEA 4Q5NA 1OKDA 2DJJA 2E2GA 4MZCA 3SWLA 1MDJA 3F4SA 4BL7A 2MMOA 2GSQA 1XWKA 3Q19A 3HJOA 1M9BA 4HOJA 3IOSA 4ZXGA 3HYPA 2FLSA 5H5RA 5IO2A 2C0GA 4HU9A 3DXBA 2FUG2 2LEGA 1I5GA 2WULA 4ZL9A 4JR6A 4HI7A 4EKZA 1F2EA 3CRTA 4N10A 3BOAA 3IXRA 3W8JA 4F82A 4JZQA 2HLSA 4NHZA 1XFLA 2VD0A 2DJKA 3QR6A 5LD0A 4KSMA 1TRWA 2QGVA 3UVHA 4EE0A 3ZRDA 3RDWA 1PD21 3M3MA 4GSNA 3DGQA 1SENA 1VRSD 2NPBA 5GAPD 1F37A 3D22A 5DJLA 1JFUA 4PQ1A 3PH9A 4POKA 4TRXA 2O7KA 2VAFA 3U5RE 2VL2A 3K8NA 1R5PA 2VLVA 2IJYA 2CZ3A 2RLIA 3UIWA 3BCIA 1GNEA 2VCVA 2GZYA 1YDKA 1SD9A 3RPNA 3TKSA 1EOGA 1PKZA 3GYKA 4EL1A 1O7UA 5ECHB 4EDYA 1O6JA 3KJYA 4ZL8A 3DEXA 3KTBA 2PVQA 2JADA 2O8VB 1ACVA 2H1BA 4PXOA 2V41A 1W4VA 3H1NA 1NW2A 5G1LA 4OO5A 4KF9A 1SKWB 3F0IA 2R4VA 2LNTA 1M7TA 4FO5A 1J0FA 3KIJA 1QQ2A 7GSSA 3C73A 1QMVA 1YKAA 5KN1A 3IBHA 3FR6A 1JLWA 4ZBAA 4LMVA 3VFIA 2GSRA 4Z2RA 1QK8A 1A24A 5D9XA 1MTCA 4NAXA 1OC9A 1DE1A 3UMAA 1M2AA 1S3DA 1A0RP 2TRXA 1TRUA 2KP2A 1A2LA 3QFBC 6GSUA 2DKHA 2RIIA 1FHEA 2YZUA 2J23A 2YWIA 1X0RA 4IJIA 5BRTA 3EMXA 1Z7RA 1QFNA 4G10A 2EIRA 5DAKB 3MDKA 1XOAA 5DALA 4V2NA 2GT5A 1SKRB 1MD4A 5D8IA 2M80A 3GNJA 1GUMA 2C0DA 2DLXA 4ZILA 2HXKA 3TKSC 18GSA 3HCZA 1RK4A 3HKRA 1S3CA 5GAND 1ZYNA 4K9ZA 4N30A 1HNCA 1BAYA 3FMWA 3CSJA 3DVXA 1SJIA 2CV4A 1U87A 3F9UA 2V1MA 2H8LA 1M0UA 3UVTA 1OYJA 1YQ1A 3APSA 1AQXA 1T4ZA 2H74A 1Z3EA 6GSSA 1JHBA 1PN0A 4YQMA 1VF1A 1YJ6A 2HZEA 3G9BA 1WJKA 3E3EA 4NPBA 4IQAA 3EU4A 4PUFC 1USBA 2PMTA 4DSSB 3IDVA 3ZIJA 1GSEA 1B8XA 2FA8A 1K0CA 4HEA2 3F63A 3GHAA 3O76A 2OA7A 3L4NA 3O3TA 4ID0A 1WP0A 1XW9A 1GUKA 4XIHA 2WFCA 5D9WA 2H71A 1SYRA 4EC0A 3G7JA 4KNDA 1AQWA 3TOTA 4OCFA 3GMFA 1JZWA 2O85A 3VPTA 14GSA 1BJXA 1URMA 4RI6A 1B9XC 1GP1A 4EO3A 4E8HA 17GSA 3UBLA 5IOWA 3FY7A 2A2SA 4BVXB 2H72A 5JWOB 4ICYA 1J9BA 5C00A 5DCGA 3LYPA 2J9HA 3GKXA 1A0FA 2PPTA 2NTOA 3IHGA 5JWQB 4ECBA 4TOPA 4IQ1A 3QAGA 2H0IA 2FA4A 4NXIA 1SK2A 2XHFA 4PNFA 1HYUA 1OVNA 3L9SA 4WR4A 2LTKA 1ERVA 1EV4A 1A2MA 2LRNA 1EEJA 1GRXA 1U6TA 1WPIA 5IMAA 4XS1A 4NWYA 1Z7PA 3TB2A 3GKMA 5ECNB 3KP8A 4TXOB 5KOWA 2LJRA 4JEDA 4ZBDA 1FVJA 1SKSB 3BJ5A 3VWVA 5ECMB 3KMOA 2HRFA 1TOFA 3GTUB 1NHOA 3HD5A 5HFGA 2CAIA 1WMJA 4GRFA 1ERUA 3M1GA 2XBIA 2E2MA 2H6XA 1OE7A 4KAEA 4MABA 3HXSA 3UAPA 3SBCA 2LQOA 2C0EA 2FD3A 2B5YA 2KLXA 3FHKA 4CW9A 4F0BA 3TJJA 1BEDA 3P2AA 2WB9A 1GTBA 1M2DA 1EP8A 1OKTA 3IAM2 3I6AA 1XW6A 1SJ6A 1Z5YE 3DRNA 3GFKA 5ECRB 3S9FA 5EVOA 3A2XA 4GF0A 2JZRA 4F9ZA 4K5SA 4YAVA 2WGRA 2UZ8A 4LA1A 1DSBA 5KN3A 1X5EA 3IAS2 3KZQA 4HZ4A 1AXDA 3LGCA 2MZCA 3QPMA 4TR3A 2CZ2A 3ME7A 2V6KA 3QAVA 2E0QA 1WRYA 3FZAA 1R5AA 3HZ8A 5CRHA 3QOUA 1UN2A 3C1SA 2H01A 4WEYA 1R7HA 1T7PB 2R37A 3FK8A 4F03A 2L4CA 2O89A 1OC3A 1HQOA 1O73A 1YEXA 2X4AA 4PTSA 2GS3A 4OCEA 4G19A 5H5QA 2IIYA 2VL9A 4OFNA 2VL3A 5ENUA 2CX4A 2HE3A 4DEJA 5J4UA 3EURA 4XS6A 4MDCA 1C72A 2LV3A 3MNGA 4RI7A 4K2XA 3IA1A 1CQHA 2OE3A 1DE2A 3E0UA 4PURA 5IOXA 3QCPA 1THOA 1TI1A 3ZMKA 3WGDA 1GNWA 1GSYA 2H1AA 3FZ5A 4ILFA 3TOUA 4TR0A 1XZOA 4MK3A 4JU5A 3KCMA 1FAAA 5GSTA 2VCQA 2X99A 1Q4JA 5F0GA 3GA4A 3LSZA 2OACA 1TU8A 3UBKA 2FNOA 2C80A 5HR2A 1XVQA 5EPFA 2HRNA 4YKFA 4WKWA 1YZXA 1ST9A 3CSHA 5HFIA 5D9VA 1WOUA 4K7NA 4DSRA 4QQ7A 10GSA 2ON5A 1PSQA 1M9AA 5HFKA 1SK0A 2VLUA 2H73A 2X8GA 4NV5A 4ZBBA 2EC4A 6GSTA 2VUPA 2C8UA 2DIZA 3FR9A 2LKUA 4O32A 2LQQA 1GL8A 3R3EA 5IMCA 2H6YA 1OE8A 3ZL5A 3ZIVA 3A5WA 1GTUA 3ISOA 1BX9A 1EOHA 3FZ9A 3DVWA 3P7XA 4X0XA 4KDUA 4MF7A 4NMUA 3UJ1A 4ECIA 1GLQA 5ID2A 3DYRA 4LLRA 1F9MA 3VWWA 2CQ9A 3MYDA 3GURA 5C04A 3H4KA 1Z6MA 2HI7A 2AYTA 2IFQB 1X9WB 4EF0A 1H75A 1THXA 2CX3A 3H93A 3WT2A 2OBIA 3TKRA 2KP1A 2HNLA 4NV2A 2YCDA 1ZMAA 2NDOA 2WDUA 3EINA 2B7KA 1GULA 2YV7A 3ME8A 5E59A 4XRDA 4AF2A 2QSIA 2GSSA 2XC2A 4WETA 3GH6A 4K1FA 4A5PA 3QFAC 4LMWA 4ISDA 5J9BA 1O85A 1GSFA 3IE3A 3L78A 5IIZA 3NIVA 5F05A 4MPGA 4MMMA 1LJRA 3HDCA 2X8HA 2ZCTA 4XS4B 1V2AA 2GDRA 4PNGA 1T1VA 1T3BA 4EDZA 1KBNA 2ZUPA 2JZTA 2NVLA 1V9WA 1ERTA 4D73A 1SYXA 1R4WA 5G30A 2L57A 1B4PA 1B48A 4TR1A 4TVEA 3GN3A 4KUNA 6GSWA 1SL2B 4IP6A 4O5UA 3CYNA 5INYA 3GX8A 1N2AA 4KDXA 1N8JA 4K6XA 4MLYA 1Z6NA 4PUAA 3LFLA 4J57E 2WS2A 2H1GA 3M9JA 4IKHA 1YKCA 3TKQA 1TI3A 5DBQA 1FO5A 3AY8A 4OWYA 3FKFA 5ECLB 3I9V2 2QA2A 3ZYWA 1ZGNA 4I2UA 1V57A 1H4OA 1FVKA 4I6XA 1DBYA 2B7JA 3DMLA 5KN2A 1QUWA 4IS0A 4K7IA 3V1WA 2R2JA 4K7OA 2IMIA 1FB0A 3RHBA 2MBTA 2JL4A 4V1Ag 2CVBA 2FY6A 3KEBA 5ELAA 3HVVA 1TXXA 5COHA 2VCTA 3IHQA 2RUEA 1GTIA 4MPFA 3MIXA 3F8UA 3EMPA 2E7PA 5CREA 4EIPA 3ERGA 2YWOA 4BL7B 4P3YB 5IQYA 1V58A 3MAKA 4K0GA 1ZCPA 1F3AA 1FOHA 5F07A 4HU7A 2P31A 2LJAA 2VCZA 2DBCA 1TK5B 3J7Yb 1KNGA 1ZL9A 4MNNA 1AQVA 1WE0A 3FZ4A 4I97A 5J41A 2X8CA 3C8EA 5F8BA 2I1UA 6GSXA 4HJ2A 3F3RA 4X43A 3BD2A 3KD0A 5IM9A 4I8BA 2I3YA 1T4YA 1OC8A 2HYXA 3IC4A 2FWGA 1TU7A 1YF1A 1B9YC 2F8AA 2GVPA 1SU9A 4J56E 2VCXA 4DSQA 4WBRD 1UA5A 2IN3A 1V40A 5G1KA 3GX0A 3ZZXA 3D21A 4HQSA 5AIVA 5L71A 1UVZA 3UEMA 2DKIA 2F51A 4YKGA 2AV4A 1X9MB 2C3QA 4XTSA 3DD3A 2L59A 3HVXA 2FGXA 2YJ7A 1U3AA 3EC3A 3GSSA 1DUGA 1VGLA 1TRVA 4XHMA 5B6MA 2AAWA 3VLNA 2QC7A 4G0IA 4GSTA 1K3OA 2B5EA 2O87A 2HSYA 4X1UA 2GZPA 4BVYA 1ON4A 2DJ3A 5HQPA 2P5RA 3PR8A 2YV9A 3ED3A 3RBTA 2CT6A 1E2YA 2V32A 4ZL7A 1BYEA 4EUYA 3ZFLA 1G6WA 2P5QA 4LL1B 4NHWA 3I43A 3UARA 3ZFBA 3UOMA 3I69A 4IN0A 1GSSA 4QL9A 2DJ2A 4POMA 3C7MA 2C3TA 3D5JA 4KDYA 2YANA 3CXGA 1GSDA 4MH2A 1A8YA 2GTUA 4V2LA 4XRAA 2XPDA 2C3NA 3HVSA 4GCIA 1PN9A 2YPMA 2PU9C 4MJAA 1G6YA 4RQRA 2F9SA 5LNKe 4ZB6A 1OC9B 5IMVA 3D4TA 2LSTA 3TKSE 3CRUA 3ZMLA 4ECJA 1EP7A 3P8WA 2V2GA 3EVIA 3L9UA 3ERWA 3LYKA 1PL2A 1T8EB 4Q5FA 3U6VA 2GSTA 3US3A 4HS1A 3FR3A 3TJGA 3D4MA 1O8XA 5ECQB 1GSUA 5DALB 3IV4A 4O5RA 4XCSA 2WJUA 2C4JA 4IVFA 1EGOA 3Q74A 5A4VA 3EE2A 4TW5A 3N5OA 4Z2UA 1EGRA 2N5BA 3EPTA 1YEPA 3A2VA 3EWLA 4V1Ap 1PL1A 2IMKA 1HNAA 1PGTA 2VOCA 2QA1A 2R0GA 2OADA 3NOFA 2VLTA 5BMUA 1GWCA 2R6KA 1NSWA 2FWFA 2OJLA 2HRAA 1XOBA 4MF6A 3HJPA 4G0KA 3ZVJD 3H79A 4MH3A 2PBJA 3KXOA 5B7CA 1R26A 2F3MA 3EYTA 4YH2A 2HZEB 2I9HA 5FWGA 2LS5A 4WR5A 1U88A 4FYUA 2IWTA 1TP9A 4E8EA 3KH7A 2C1YA 2DMMA 2DC5A 5A5KA 5ABRA 2EIQA 5IO0A 5EL8A 2HSHA 5KOXA 3ERFA 1PQNA 5HR1A 4TR4A 2PN8A 2H76A 2K8VA 2YWNA 1IYIA 1G0TA 3QAWA 5HR3A 1SL0B 1PA3A 3D0ZA 5IMZA 5J9CA 3TGZA 4IELA 1V98A 5CP1A 5H5SA 2ZNMA 4KE3A 3WT1A 3FYGA 3CMIA 5B8AA 2YZHA 5DQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GSS A;  3GH9 A;  2VCW A;  4FIW A;  4ML1 A;  1YF0 A;  2G2Q A;  1G7E A;  3NZN A;  1K0B A;  3G7Y A;  4JE1 A;  4MP4 A;  1ZYQ B;  1XWC A;  2GGT A;  1FG4 A;  2IL3 A;  2M46 A;  3VPQ A;  2YNX A;  4IGJ A;  5FT3 A;  5FHI A;  1O81 A;  3TCO A;  5JCW A;  3O6T A;  4HQZ A;  3F4R A;  2REM A;  4Q5R A;  3L9V A;  2RM6 A;  2WRT A;  2M72 A;  2H70 A;  4HUA A;  3APQ A;  1K3Y A;  1AIU A;  1VF3 A;  3TRP A;  5JCU A;  1TTZ A;  3LXT A;  5F06 A;  5CRW A;  2PGT A;  2VD1 A;  1W89 A;  3VWU A;  2P0G A;  3WYW A;  1KEB A;  1TDI A;  4O92 A;  1XPV A;  1K0N A;  1QGV A;  1Y6E A;  3BBY A;  1WWJ A;  2G0F A;  2H19 A;  5A4W A;  4MJE A;  5DAK A;  2AUV A;  1JZO A;  2N5F A;  4N11 A;  5ECS A;  4JBB A;  4IW9 A;  4MJB A;  1SD8 A;  2JSZ A;  1TJD A;  1X5C A;  1B4Q A;  2A4V A;  2L6D A;  3Q18 A;  4N0Z A;  3KTL A;  4YAP A;  1BG5 A;  1NM3 A;  2WCI A;  5CRD A;  1BQ7 A;  3FEU A;  4EXJ A;  4F0C A;  2AHE A;  4POB A;  2XBQ A;  4DVC A;  4K2D A;  2XPE A;  3TDG A;  1MEK A;  1X5D A;  3R2Q A;  3IR4 A;  1WIK A;  4HJM A;  3UL3 A;  4KA0 A;  2B5X A;  1Y25 A;  4MZB A;  2A2R A;  4GQC A;  1LU4 A;  3OR5 A;  3CTF A;  1AW9 A;  4WF5 A;  1K0D A;  3PIN A;  4WF4 A;  2AB6 A;  2FHE A;  3VK9 A;  20GS A;  2KOK A;  1Z9H A;  4IP1 A;  4IJ3 A;  5EY6 A;  4L0W A;  5B8B A;  2QKE A;  1GUH A;  1RQM A;  4DSS A;  9GSS A;  3A3T A;  3GUS A;  3F4T A;  4V2M A;  2OKA A;  2PVO C;  1TK0 B;  1U3I A;  2KUC A;  1PRX A;  4JR4 A;  3IK9 A;  4PGT A;  5HR0 A;  3F6F A;  5D73 A;  3N9J A;  3LEF A;  2NBS A;  1PX6 A;  2RUF A;  4HZ2 A;  3TRX A;  1IYH A;  5JWR B;  5ECP B;  3KH9 A;  2LUS A;  2YWM A;  4J2F A;  1JZR A;  2GZZ A;  4BVX A;  4G9H A;  3TRQ A;  2HT9 A;  2LNS A;  1PX7 A;  3LQ7 A;  2ON7 A;  4GXZ A;  1F3B A;  5GZZ B;  4KX4 A;  1TRS A;  5IPG A;  2H6Z A;  4AJ8 A;  1PKW A;  2DIY A;  2DJ1 A;  4HDE A;  4KCE A;  2L4Q A;  1X9S B;  1K0M A;  1KTE A;  4FYB A;  1MDI A;  2KHP A;  3GKK A;  2R5G A;  4TXO A;  5G5F A;  1RW1 A;  2OBK A;  5CRG A;  4O7H A;  4FH8 A;  4KW6 A;  1OAZ A;  4PX1 A;  3RPP A;  3GTU A;  4KH7 A;  3TUE A;  2H66 A;  1QXH A;  4AGS A;  3F3Q A;  3DWV A;  5DQS A;  2FWH A;  2VM2 A;  3LXZ A;  4GQF A;  3ZVJ A;  4GLT A;  1HNB A;  5IPH A;  2VL2 C;  2PER A;  5DCH A;  5ID2 B;  3LOR A;  1JLV A;  2L6C A;  1XWA A;  3WGX A;  1EZK A;  2B6M A;  1J08 A;  4ULX A;  3A2W A;  2WZ9 A;  5CO3 A;  2RM5 A;  2PWJ A;  2MMN A;  2L5L A;  5A4U A;  3C71 A;  3L0H A;  1XCC A;  2YN1 A;  2H0H A;  1NHY A;  3BCK A;  3GL5 A;  5AIX A;  4BWQ A;  1SL1 B;  1SK1 A;  2ES7 A;  5CAX A;  4KSO A;  3VWX A;  1TK8 B;  3H8Q A;  3HY2 A;  3VI5 A;  3WD6 A;  2F8F A;  2CVD A;  1XWG A;  5ECO B;  3W6G A;  4CHS A;  3RHC A;  2JU5 A;  3M0F A;  3E9J B;  2ALB A;  1M99 A;  1G7O A;  2AJQ B;  2GT6 A;  1FW1 A;  3CTG A;  5G31 A;  1F6M C;  19GS A;  2LRC A;  2PUK C;  2GQK A;  2R3X A;  5AN1 A;  3TKP A;  1T00 A;  4IHU A;  3J7Y k;  3D6I A;  3DKS A;  2MMZ A;  4ACS A;  5IMF A;  3CSI A;  4TN8 A;  2H1D A;  2V6O A;  4D73 B;  2H75 A;  2JZS A;  4ML6 A;  4TR1 B;  1VF2 A;  2IMD A;  3RAZ A;  1AUC A;  5J3R A;  1JZD A;  5D9T A;  2CVK A;  8GSS A;  1XW5 A;  4K8M A;  4TXV A;  1LBK A;  4WBJ A;  3GL3 A;  3DIE A;  5AGY A;  2CA8 A;  1A8L A;  2VIM A;  3IRA A;  1MD3 A;  1XWB A;  2B1K A;  5G2Z A;  2X64 A;  2MYG A;  2CAQ A;  22GS A;  2VM1 A;  5DVB A;  1AC1 A;  3G7I A;  2HZF A;  3EU3 A;  2FWE A;  1M2B A;  4TKY A;  1ERW A;  4QL7 A;  2OE1 A;  3F6D A;  2I81 A;  2DML A;  3APO A;  3KM6 A;  1UC7 A;  2IMF A;  4L5L A;  4IBP A;  5GSS A;  4WXT A;  1ABA A;  2VO4 A;  1GSQ A;  1K0O A;  1EEM A;  3VUR A;  2DSA A;  1SJZ A;  2N5A A;  2MMA A;  2BMX A;  1A23 A;  4RQX A;  3TJK A;  2IPA A;  3FW2 A;  4CDO A;  1FOV A;  4I2T A;  2GQM A;  3QDN A;  1K0A A;  2TIR A;  2YOI A;  3C1R A;  4MF5 A;  5B6N A;  3IK7 A;  5LCZ A;  1XVW A;  2IME A;  5ELG A;  2LJK A;  1EWX A;  3GKN A;  4OFM A;  3QD9 A;  2K8S A;  4BPY A;  4OD7 A;  2YP6 A;  5D93 A;  1K3L A;  3ZRE A;  1TKD B;  1VF4 A;  2H30 A;  4G2E A;  4MZW A;  2B3S A;  3LWA A;  5G5E A;  4PQI A;  2GQL A;  2C0F A;  2IFQ A;  1A2J A;  3TJB A;  4PQH A;  3HHV A;  2OE0 A;  4Z7X A;  3VI7 A;  4RUV A;  4OMV A;  3JCM L;  4LL4 B;  2JSY A;  4MCU A;  5IMD A;  4I5Q A;  3ZLP A;  4MJC A;  16GS A;  4L5O A;  5J5N A;  1XBS A;  5ECK B;  3MWH A;  4KGI A;  2K9F A;  3HJM A;  5DJM A;  2I4A A;  4KB3 A;  3FRC A;  1GH2 A;  3GV1 A;  2JAC A;  3P90 A;  3MSZ A;  5D96 A;  4H86 A;  5KEJ A;  3GRX A;  4OO4 A;  3M9K A;  4ZIJ A;  4L8E A;  1GLP A;  4XS4 A;  1E6B A;  1TW9 A;  3IPZ A;  4BWS A;  1I9D A;  2DJ0 A;  12GS A;  6GSV A;  3LJR A;  11GS A;  4KCA A;  4Q5Q A;  2BTO T;  4F2I A;  1S3A A;  1EV9 A;  1PMT A;  3LG6 A;  4YQU A;  3TJF A;  1FB6 A;  2YJH A;  5E4W A;  4POL A;  3KGK A;  1XIY A;  1ZZY A;  5DDL A;  2BJX A;  6GSY A;  2D2Z A;  4EVM A;  3KMN A;  4BA7 A;  1GTA A;  4JRR A;  4ZB8 A;  3HA9 A;  13GS A;  1O8W A;  4K0N A;  1HD2 A;  4AJ7 A;  2EIO A;  1ML6 A;  4AJ6 A;  4GWR A;  3CBU A;  4N0V A;  1ZYE A;  3GIX A;  3KP9 A;  5CNW A;  5ECI B;  5AIS A;  2FCH A;  1YY7 A;  3GST A;  3ZIT A;  1AAZ A;  2HFD A;  3QMX A;  4GTU A;  2H0G A;  2K18 A;  2GLR A;  1ILO A;  5CYY A;  1CQG A;  3M8N A;  2B1L A;  2Z9S A;  3PGT A;  4OFT A;  2K6V A;  1MDK A;  2LRT A;  2TRC P;  3HZ4 A;  4YQV A;  4ZB9 A;  1ZOF A;  1XXU A;  1Q98 A;  3Q6O A;  2MBS A;  5JCG A;  4MA9 A;  5KN0 A;  2L5O A;  4ECC A;  3ZTL A;  4FYC A;  4L0U A;  3W8S A;  3WGE A;  4Q5N A;  1OKD A;  2DJJ A;  2E2G A;  4MZC A;  3SWL A;  1MDJ A;  3F4S A;  4BL7 A;  2MMO A;  2GSQ A;  1XWK A;  3Q19 A;  3HJO A;  1M9B A;  4HOJ A;  3IOS A;  4ZXG A;  3HYP A;  2FLS A;  5H5R A;  5IO2 A;  2C0G A;  4HU9 A;  3DXB A;  2FUG 2;  2LEG A;  1I5G A;  2WUL A;  4ZL9 A;  4JR6 A;  4HI7 A;  4EKZ A;  1F2E A;  3CRT A;  4N10 A;  3BOA A;  3IXR A;  3W8J A;  4F82 A;  4JZQ A;  2HLS A;  4NHZ A;  1XFL A;  2VD0 A;  2DJK A;  3QR6 A;  5LD0 A;  4KSM A;  1TRW A;  2QGV A;  3UVH A;  4EE0 A;  3ZRD A;  3RDW A;  1PD2 1;  3M3M A;  4GSN A;  3DGQ A;  1SEN A;  1VRS D;  2NPB A;  5GAP D;  1F37 A;  3D22 A;  5DJL A;  1JFU A;  4PQ1 A;  3PH9 A;  4POK A;  4TRX A;  2O7K A;  2VAF A;  3U5R E;  2VL2 A;  3K8N A;  1R5P A;  2VLV A;  2IJY A;  2CZ3 A;  2RLI A;  3UIW A;  3BCI A;  1GNE A;  2VCV A;  2GZY A;  1YDK A;  1SD9 A;  3RPN A;  3TKS A;  1EOG A;  1PKZ A;  3GYK A;  4EL1 A;  1O7U A;  5ECH B;  4EDY A;  1O6J A;  3KJY A;  4ZL8 A;  3DEX A;  3KTB A;  2PVQ A;  2JAD A;  2O8V B;  1ACV A;  2H1B A;  4PXO A;  2V41 A;  1W4V A;  3H1N A;  1NW2 A;  5G1L A;  4OO5 A;  1SKW B;  3F0I A;  2R4V A;  2LNT A;  1M7T A;  4FO5 A;  1J0F A;  3KIJ A;  1QQ2 A;  7GSS A;  3C73 A;  1QMV A;  1YKA A;  5KN1 A;  3IBH A;  3FR6 A;  1JLW A;  4ZBA A;  4LMV A;  3VFI A;  2GSR A;  1QK8 A;  1A24 A;  5D9X A;  1MTC A;  4NAX A;  1OC9 A;  1DE1 A;  3UMA A;  1M2A A;  1S3D A;  1A0R P;  2TRX A;  1TRU A;  2KP2 A;  1A2L A;  3QFB C;  6GSU A;  2RII A;  1FHE A;  2YZU A;  2J23 A;  2YWI A;  1X0R A;  4IJI A;  3EMX A;  1Z7R A;  1QFN A;  4G10 A;  2EIR A;  5DAK B;  3MDK A;  1XOA A;  5DAL A;  4V2N A;  2GT5 A;  1SKR B;  1MD4 A;  5D8I A;  2M80 A;  3GNJ A;  1GUM A;  2C0D A;  2DLX A;  4ZIL A;  2HXK A;  3TKS C;  18GS A;  3HCZ A;  1RK4 A;  3HKR A;  1S3C A;  5GAN D;  4K9Z A;  4N30 A;  1HNC A;  1BAY A;  3CSJ A;  3DVX A;  1SJI A;  2CV4 A;  1U87 A;  3F9U A;  2V1M A;  2H8L A;  1M0U A;  3UVT A;  1OYJ A;  1YQ1 A;  3APS A;  1AQX A;  1T4Z A;  2H74 A;  1Z3E A;  6GSS A;  1JHB A;  4YQM A;  1VF1 A;  1YJ6 A;  2HZE A;  3G9B A;  1WJK A;  3E3E A;  4NPB A;  4IQA A;  3EU4 A;  4PUF C;  1USB A;  2PMT A;  4DSS B;  3IDV A;  3ZIJ A;  1GSE A;  1B8X A;  2FA8 A;  1K0C A;  4HEA 2;  3F63 A;  3GHA A;  3O76 A;  2OA7 A;  3L4N A;  3O3T A;  4ID0 A;  1WP0 A;  1XW9 A;  1GUK A;  4XIH A;  2WFC A;  5D9W A;  2H71 A;  1SYR A;  4EC0 A;  3G7J A;  4KND A;  1AQW A;  3TOT A;  4OCF A;  3GMF A;  1JZW A;  2O85 A;  3VPT A;  14GS A;  1BJX A;  1URM A;  4RI6 A;  1B9X C;  1GP1 A;  4EO3 A;  4E8H A;  17GS A;  3UBL A;  5IOW A;  3FY7 A;  2A2S A;  2H72 A;  5JWO B;  1J9B A;  5C00 A;  5DCG A;  3LYP A;  2J9H A;  3GKX A;  1A0F A;  2PPT A;  2NTO A;  5JWQ B;  4ECB A;  4TOP A;  4IQ1 A;  3QAG A;  2H0I A;  2FA4 A;  4NXI A;  1SK2 A;  2XHF A;  4PNF A;  1HYU A;  1OVN A;  3L9S A;  4WR4 A;  2LTK A;  1ERV A;  1EV4 A;  1A2M A;  2LRN A;  1EEJ A;  1GRX A;  1U6T A;  1WPI A;  5IMA A;  4XS1 A;  4NWY A;  1Z7P A;  3TB2 A;  3GKM A;  5ECN B;  3KP8 A;  4TXO B;  2LJR A;  4JED A;  4ZBD A;  1FVJ A;  1SKS B;  3BJ5 A;  3VWV A;  5ECM B;  3KMO A;  2HRF A;  1TOF A;  3GTU B;  1NHO A;  3HD5 A;  5HFG A;  2CAI A;  1WMJ A;  4GRF A;  1ERU A;  3M1G A;  2XBI A;  2E2M A;  2H6X A;  1OE7 A;  4KAE A;  4MAB A;  3HXS A;  3UAP A;  3SBC A;  2LQO A;  2C0E A;  2FD3 A;  2B5Y A;  2KLX A;  3FHK A;  4CW9 A;  4F0B A;  3TJJ A;  1BED A;  3P2A A;  2WB9 A;  1GTB A;  1M2D A;  1EP8 A;  1OKT A;  3IAM 2;  3I6A A;  1XW6 A;  1SJ6 A;  1Z5Y E;  3DRN A;  3GFK A;  5ECR B;  3S9F A;  5EVO A;  3A2X A;  4GF0 A;  2JZR A;  4F9Z A;  4YAV A;  2WGR A;  4LA1 A;  1DSB A;  5KN3 A;  1X5E A;  3IAS 2;  3KZQ A;  4HZ4 A;  1AXD A;  3LGC A;  2MZC A;  3QPM A;  4TR3 A;  2CZ2 A;  3ME7 A;  2V6K A;  3QAV A;  2E0Q A;  1WRY A;  3FZA A;  1R5A A;  3HZ8 A;  5CRH A;  3QOU A;  1UN2 A;  3C1S A;  2H01 A;  4WEY A;  1R7H A;  1T7P B;  2R37 A;  3FK8 A;  4F03 A;  2L4C A;  2O89 A;  1OC3 A;  1HQO A;  1O73 A;  1YEX A;  2GS3 A;  4OCE A;  4G19 A;  5H5Q A;  2IIY A;  2VL9 A;  4OFN A;  2VL3 A;  5ENU A;  2CX4 A;  2HE3 A;  4DEJ A;  5J4U A;  3EUR A;  4XS6 A;  4MDC A;  1C72 A;  2LV3 A;  3MNG A;  4RI7 A;  3IA1 A;  1CQH A;  2OE3 A;  1DE2 A;  3E0U A;  4PUR A;  5IOX A;  3QCP A;  1THO A;  1TI1 A;  3ZMK A;  3WGD A;  1GNW A;  1GSY A;  2H1A A;  3FZ5 A;  4ILF A;  3TOU A;  4TR0 A;  1XZO A;  4MK3 A;  4JU5 A;  3KCM A;  1FAA A;  5GST A;  2VCQ A;  2X99 A;  1Q4J A;  5F0G A;  3GA4 A;  3LSZ A;  2OAC A;  1TU8 A;  3UBK A;  2FNO A;  2C80 A;  5HR2 A;  1XVQ A;  5EPF A;  2HRN A;  4WKW A;  1YZX A;  1ST9 A;  3CSH A;  5HFI A;  5D9V A;  1WOU A;  4K7N A;  4DSR A;  4QQ7 A;  10GS A;  2ON5 A;  1PSQ A;  1M9A A;  5HFK A;  1SK0 A;  2VLU A;  2H73 A;  2X8G A;  4NV5 A;  4ZBB A;  2EC4 A;  6GST A;  2VUP A;  2C8U A;  2DIZ A;  3FR9 A;  2LKU A;  4O32 A;  2LQQ A;  1GL8 A;  5IMC A;  2H6Y A;  1OE8 A;  3ZL5 A;  3ZIV A;  3A5W A;  1GTU A;  3ISO A;  1BX9 A;  1EOH A;  3FZ9 A;  3DVW A;  3P7X A;  4X0X A;  4KDU A;  4MF7 A;  4NMU A;  3UJ1 A;  4ECI A;  1GLQ A;  5ID2 A;  3DYR A;  4LLR A;  1F9M A;  3VWW A;  2CQ9 A;  3GUR A;  5C04 A;  3H4K A;  1Z6M A;  2HI7 A;  2AYT A;  2IFQ B;  1X9W B;  4EF0 A;  1H75 A;  1THX A;  2CX3 A;  3H93 A;  3WT2 A;  2OBI A;  3TKR A;  2KP1 A;  2HNL A;  4NV2 A;  2YCD A;  1ZMA A;  2NDO A;  2WDU A;  3EIN A;  2B7K A;  1GUL A;  2YV7 A;  3ME8 A;  5E59 A;  4XRD A;  4AF2 A;  2QSI A;  2GSS A;  2XC2 A;  4WET A;  3GH6 A;  4K1F A;  3QFA C;  4LMW A;  4ISD A;  5J9B A;  1O85 A;  1GSF A;  3IE3 A;  3L78 A;  5IIZ A;  3NIV A;  5F05 A;  4MPG A;  4MMM A;  1LJR A;  3HDC A;  2X8H A;  2ZCT A;  4XS4 B;  1V2A A;  2GDR A;  4PNG A;  1T1V A;  1T3B A;  4EDZ A;  1KBN A;  2ZUP A;  2JZT A;  2NVL A;  1V9W A;  1ERT A;  4D73 A;  1SYX A;  1R4W A;  5G30 A;  2L57 A;  1B4P A;  1B48 A;  4TR1 A;  4TVE A;  3GN3 A;  4KUN A;  6GSW A;  1SL2 B;  4IP6 A;  3CYN A;  5INY A;  3GX8 A;  1N2A A;  4KDX A;  1N8J A;  4K6X A;  4MLY A;  1Z6N A;  4PUA A;  3LFL A;  4J57 E;  2WS2 A;  2H1G A;  3M9J A;  4IKH A;  1YKC A;  3TKQ A;  1TI3 A;  5DBQ A;  1FO5 A;  3AY8 A;  4OWY A;  3FKF A;  5ECL B;  3I9V 2;  3ZYW A;  1ZGN A;  4I2U A;  1V57 A;  1H4O A;  1FVK A;  4I6X A;  1DBY A;  2B7J A;  3DML A;  5KN2 A;  1QUW A;  4IS0 A;  4K7I A;  3V1W A;  2R2J A;  4K7O A;  2IMI A;  1FB0 A;  3RHB A;  2MBT A;  2JL4 A;  4V1A g;  2CVB A;  2FY6 A;  3KEB A;  5ELA A;  3HVV A;  1TXX A;  5COH A;  2VCT A;  3IHQ A;  2RUE A;  1GTI A;  4MPF A;  3F8U A;  3EMP A;  2E7P A;  5CRE A;  3ERG A;  2YWO A;  4P3Y B;  5IQY A;  1V58 A;  3MAK A;  4K0G A;  1ZCP A;  1F3A A;  5F07 A;  4HU7 A;  2P31 A;  2LJA A;  2VCZ A;  2DBC A;  1TK5 B;  3J7Y b;  1KNG A;  1ZL9 A;  1AQV A;  1WE0 A;  3FZ4 A;  4I97 A;  5J41 A;  2X8C A;  3C8E A;  5F8B A;  2I1U A;  6GSX A;  4HJ2 A;  3F3R A;  4X43 A;  3BD2 A;  3KD0 A;  5IM9 A;  4I8B A;  2I3Y A;  1T4Y A;  1OC8 A;  2HYX A;  3IC4 A;  2FWG A;  1TU7 A;  1YF1 A;  1B9Y C;  2F8A A;  2GVP A;  1SU9 A;  4J56 E;  2VCX A;  4DSQ A;  4WBR D;  1UA5 A;  2IN3 A;  1V40 A;  5G1K A;  3GX0 A;  3ZZX A;  3D21 A;  4HQS A;  5AIV A;  5L71 A;  1UVZ A;  3UEM A;  2F51 A;  2AV4 A;  1X9M B;  2C3Q A;  4XTS A;  3DD3 A;  2L59 A;  3HVX A;  2FGX A;  2YJ7 A;  1U3A A;  3EC3 A;  3GSS A;  1DUG A;  1VGL A;  1TRV A;  4XHM A;  5B6M A;  2AAW A;  3VLN A;  2QC7 A;  4GST A;  1K3O A;  2B5E A;  2O87 A;  2HSY A;  4X1U A;  2GZP A;  4BVY A;  1ON4 A;  2DJ3 A;  5HQP A;  2P5R A;  3PR8 A;  2YV9 A;  3ED3 A;  3RBT A;  2CT6 A;  1E2Y A;  2V32 A;  4ZL7 A;  1BYE A;  4EUY A;  3ZFL A;  1G6W A;  2P5Q A;  4LL1 B;  4NHW A;  3I43 A;  3UAR A;  3ZFB A;  3UOM A;  3I69 A;  4IN0 A;  1GSS A;  4QL9 A;  2DJ2 A;  4POM A;  3C7M A;  2C3T A;  3D5J A;  4KDY A;  2YAN A;  3CXG A;  1GSD A;  4MH2 A;  1A8Y A;  2GTU A;  4V2L A;  4XRA A;  2XPD A;  2C3N A;  3HVS A;  4GCI A;  1PN9 A;  2YPM A;  2PU9 C;  4MJA A;  1G6Y A;  4RQR A;  2F9S A;  5LNK e;  4ZB6 A;  1OC9 B;  5IMV A;  3D4T A;  2LST A;  3TKS E;  3CRU A;  3ZML A;  4ECJ A;  1EP7 A;  3P8W A;  2V2G A;  3EVI A;  3L9U A;  3ERW A;  3LYK A;  1PL2 A;  1T8E B;  4Q5F A;  3U6V A;  2GST A;  3US3 A;  4HS1 A;  3FR3 A;  3TJG A;  3D4M A;  1O8X A;  5ECQ B;  1GSU A;  5DAL B;  3IV4 A;  4O5R A;  4XCS A;  2WJU A;  2C4J A;  4IVF A;  1EGO A;  3Q74 A;  5A4V A;  3EE2 A;  4TW5 A;  3N5O A;  1EGR A;  2N5B A;  1YEP A;  3A2V A;  3EWL A;  4V1A p;  1PL1 A;  2IMK A;  1HNA A;  1PGT A;  2VOC A;  2OAD A;  3NOF A;  2VLT A;  1GWC A;  2R6K A;  1NSW A;  2FWF A;  2OJL A;  1XOB A;  4MF6 A;  3HJP A;  3ZVJ D;  3H79 A;  4MH3 A;  2PBJ A;  3KXO A;  5B7C A;  1R26 A;  2F3M A;  3EYT A;  4YH2 A;  2HZE B;  2I9H A;  5FWG A;  2LS5 A;  4WR5 A;  1U88 A;  4FYU A;  2IWT A;  1TP9 A;  4E8E A;  3KH7 A;  2C1Y A;  2DMM A;  2DC5 A;  5A5K A;  5ABR A;  2EIQ A;  5IO0 A;  5EL8 A;  2HSH A;  3ERF A;  1PQN A;  5HR1 A;  4TR4 A;  2PN8 A;  2H76 A;  2K8V A;  2YWN A;  1IYI A;  1G0T A;  3QAW A;  5HR3 A;  1SL0 B;  1PA3 A;  3D0Z A;  5IMZ A;  5J9C A;  3TGZ A;  4IEL A;  1V98 A;  5CP1 A;  5H5S A;  2ZNM A;  4KE3 A;  3WT1 A;  3FYG A;  3CMI A;  5B8A A;  2YZH A;  5DQY A; 
#chains in the Genus database with same CATH topology
 4GSS A;  3GH9 A;  2VCW A;  4FIW A;  4ML1 A;  1YF0 A;  2G2Q A;  1G7E A;  3NZN A;  1K0B A;  2R0C A;  3G7Y A;  4JE1 A;  4MP4 A;  4CY8 A;  1ZYQ B;  1XWC A;  4HSC X;  2GGT A;  1FG4 A;  2IL3 A;  2M46 A;  3VPQ A;  2YNX A;  4IGJ A;  5FT3 A;  5FHI A;  1O81 A;  3TCO A;  5JCW A;  3O6T A;  4HQZ A;  3F4R A;  2REM A;  4Q5R A;  3L9V A;  2RM6 A;  2WRT A;  2M72 A;  2H70 A;  4HUA A;  3APQ A;  1K3Y A;  1AIU A;  1VF3 A;  3TRP A;  5JCU A;  1TTZ A;  3LXT A;  5F06 A;  5CRW A;  2PGT A;  2VD1 A;  1W89 A;  3VWU A;  2P0G A;  3WYW A;  1KEB A;  1TDI A;  4O92 A;  1XPV A;  1K0N A;  1QGV A;  1Y6E A;  3BBY A;  1WWJ A;  2G0F A;  2H19 A;  5A4W A;  4MJE A;  5DAK A;  2AUV A;  1JZO A;  2N5F A;  4N11 A;  5ECS A;  4JBB A;  4IW9 A;  4MJB A;  1SD8 A;  2JSZ A;  1TJD A;  1X5C A;  1B4Q A;  2A4V A;  2L6D A;  3Q18 A;  4FQU A;  4N0Z A;  3KTL A;  4YAP A;  1BG5 A;  1NM3 A;  2WCI A;  5CRD A;  1BQ7 A;  3FEU A;  4EXJ A;  4F0C A;  2AHE A;  4POB A;  2XBQ A;  4DVC A;  4K2D A;  2XPE A;  3TDG A;  1MEK A;  1X5D A;  3R2Q A;  3IR4 A;  1WIK A;  4HJM A;  3UL3 A;  4KA0 A;  2B5X A;  1Y25 A;  4MZB A;  2A2R A;  4GQC A;  1LU4 A;  3OR5 A;  3CTF A;  3IC8 A;  1AW9 A;  4WF5 A;  1K0D A;  3PIN A;  4WF4 A;  2AB6 A;  2FHE A;  3VK9 A;  20GS A;  2KOK A;  4X4J A;  1Z9H A;  4IP1 A;  4IJ3 A;  5EY6 A;  4L0W A;  5B8B A;  2QKE A;  1GUH A;  1RQM A;  4DSS A;  9GSS A;  3A3T A;  3GUS A;  3F4T A;  4V2M A;  2OKA A;  2PVO C;  1TK0 B;  1U3I A;  2KUC A;  1PRX A;  4JR4 A;  3IK9 A;  4PGT A;  5HR0 A;  3F6F A;  5D73 A;  3N9J A;  3LEF A;  2NBS A;  1PX6 A;  2RUF A;  4HZ2 A;  3TRX A;  1IYH A;  5JWR B;  5ECP B;  3KH9 A;  2LUS A;  2YWM A;  4J2F A;  1JZR A;  2GZZ A;  4BVX A;  1M3J A;  4G9H A;  1M3I A;  3TRQ A;  2HT9 A;  2LNS A;  1PX7 A;  3LQ7 A;  2ON7 A;  4GXZ A;  1F3B A;  5GZZ B;  4KX4 A;  1TRS A;  5IPG A;  2H6Z A;  4AJ8 A;  1PKW A;  2DIY A;  3A5I A;  2DJ1 A;  3PPU A;  4HDE A;  4KCE A;  2L4Q A;  1X9S B;  1K0M A;  1KTE A;  4FYB A;  1MDI A;  2KHP A;  3GKK A;  2R5G A;  4TXO A;  5G5F A;  1RW1 A;  2OBK A;  5CRG A;  4O7H A;  4FH8 A;  4KW6 A;  1OAZ A;  4PX1 A;  3RPP A;  3GTU A;  4KH7 A;  3TUE A;  2H66 A;  1QXH A;  4AGS A;  3F3Q A;  3DWV A;  5DQS A;  2FWH A;  2VM2 A;  3LXZ A;  4GQF A;  3ZVJ A;  4GLT A;  1HNB A;  5IPH A;  2VL2 C;  2PER A;  5DCH A;  5ID2 B;  3LOR A;  1JLV A;  2L6C A;  1XWA A;  3WGX A;  1EZK A;  2B6M A;  1J08 A;  4ULX A;  3A2W A;  2WZ9 A;  5CO3 A;  2RM5 A;  2PWJ A;  2MMN A;  2L5L A;  5A4U A;  3C71 A;  3L0H A;  1XCC A;  2YN1 A;  2H0H A;  1NHY A;  3BCK A;  3GL5 A;  5AIX A;  4BWQ A;  1SL1 B;  1SK1 A;  2ES7 A;  5CAX A;  4KSO A;  3VWX A;  1TK8 B;  3H8Q A;  3HY2 A;  3VI5 A;  3WD6 A;  2F8F A;  2CVD A;  1XWG A;  5ECO B;  3W6G A;  4CHS A;  3RHC A;  2JU5 A;  3M0F A;  3E9J B;  2ALB A;  1M99 A;  1G7O A;  2AJQ B;  2GT6 A;  1FW1 A;  3CTG A;  5G31 A;  1F6M C;  19GS A;  2LRC A;  2PUK C;  2GQK A;  2R3X A;  5AN1 A;  3TKP A;  1T00 A;  4IHU A;  3J7Y k;  4EIQ A;  3D6I A;  3DKS A;  2MMZ A;  4ACS A;  5IMF A;  3CSI A;  4TN8 A;  2H1D A;  2V6O A;  4D73 B;  2R0P A;  2H75 A;  2JZS A;  4CY6 A;  4ML6 A;  4TR1 B;  1VF2 A;  2IMD A;  3RAZ A;  1AUC A;  5J3R A;  1JZD A;  5D9T A;  2CVK A;  8GSS A;  1XW5 A;  4K8M A;  4TXV A;  2X49 A;  1LBK A;  4WBJ A;  5AGY A;  3GL3 A;  3DIE A;  2CA8 A;  1A8L A;  2VIM A;  3IRA A;  1MD3 A;  1XWB A;  2B1K A;  5G2Z A;  2X64 A;  2MYG A;  2CAQ A;  22GS A;  2VM1 A;  5DVB A;  1AC1 A;  3G7I A;  2HZF A;  3EU3 A;  2FWE A;  3CQF A;  1M2B A;  4TKY A;  1ERW A;  4QL7 A;  2OE1 A;  3F6D A;  2I81 A;  2DML A;  3APO A;  3KM6 A;  1UC7 A;  2IMF A;  4L5L A;  4IBP A;  5GSS A;  4WXT A;  1ABA A;  2VO4 A;  1GSQ A;  1K0O A;  1EEM A;  3VUR A;  2DSA A;  1SJZ A;  2N5A A;  2MMA A;  1XG8 A;  2BMX A;  1A23 A;  4RQX A;  3TJK A;  2IPA A;  3FW2 A;  4CDO A;  1FOV A;  4I2T A;  2GQM A;  3QDN A;  1K0A A;  2TIR A;  2YOI A;  3C1R A;  4MF5 A;  5B6N A;  3IK7 A;  5LCZ A;  1XVW A;  2IME A;  5ELG A;  2LJK A;  1EWX A;  3GKN A;  4OFM A;  3QD9 A;  2K8S A;  4BPY A;  4OD7 A;  2YP6 A;  5D93 A;  1K3L A;  3ZRE A;  1TKD B;  1VF4 A;  2H30 A;  4G2E A;  4MZW A;  2B3S A;  3LWA A;  5G5E A;  4PQI A;  2GQL A;  2C0F A;  2IFQ A;  1A2J A;  3TJB A;  4PQH A;  3HHV A;  2OE0 A;  4K5R A;  4Z7X A;  3VI7 A;  4RUV A;  4OMV A;  3JCM L;  4LL4 B;  2JSY A;  4MCU A;  5IMD A;  4I5Q A;  3ZLP A;  4MJC A;  16GS A;  4L5O A;  5J5N A;  1XBS A;  5ECK B;  3MWH A;  4KGI A;  2K9F A;  3HJM A;  5DJM A;  2I4A A;  4KB3 A;  3FRC A;  1GH2 A;  3GV1 A;  2JAC A;  3P90 A;  3MSZ A;  5D96 A;  3LW9 A;  4H86 A;  5KEJ A;  3GRX A;  4OO4 A;  3M9K A;  4ZIJ A;  4L8E A;  1GLP A;  4XS4 A;  1E6B A;  1TW9 A;  3IPZ A;  4BWS A;  1I9D A;  4USS A;  4BVY B;  2DJ0 A;  12GS A;  6GSV A;  3LJR A;  4Z2T A;  11GS A;  2A2P A;  4KCA A;  4Q5Q A;  2HSM A;  2BTO T;  4F2I A;  1S3A A;  1EV9 A;  1PMT A;  3LG6 A;  4YQU A;  3TJF A;  1FB6 A;  2YJH A;  5E4W A;  4POL A;  3KGK A;  1XIY A;  1ZZY A;  5DDL A;  2BJX A;  6GSY A;  2D2Z A;  4EVM A;  3KMN A;  4BA7 A;  1GTA A;  4JRR A;  4ZB8 A;  3HA9 A;  13GS A;  1O8W A;  4K0N A;  1HD2 A;  4AJ7 A;  2EIO A;  1ML6 A;  4AJ6 A;  4GWR A;  3CBU A;  4N0V A;  1ZYE A;  3GIX A;  3KP9 A;  5CNW A;  5ECI B;  5AIS A;  2FCH A;  1YY7 A;  3GST A;  3ZIT A;  1AAZ A;  2HFD A;  3QMX A;  4GTU A;  2H0G A;  2A4H A;  2HRK A;  2K18 A;  2GLR A;  1ILO A;  5CYY A;  1CQG A;  3M8N A;  2B1L A;  2Z9S A;  3PGT A;  4OFT A;  4G0L A;  2K6V A;  1MDK A;  2LRT A;  2TRC P;  3HZ4 A;  4YQV A;  4ZB9 A;  1ZOF A;  4O5Q A;  1XXU A;  1Q98 A;  3Q6O A;  2MBS A;  5JCG A;  4MA9 A;  5KN0 A;  2L5O A;  1ZYP A;  3ZTL A;  4ECC A;  4FYC A;  4L0U A;  3W8S A;  3WGE A;  4Q5N A;  1OKD A;  2DJJ A;  2E2G A;  4MZC A;  3SWL A;  1MDJ A;  3F4S A;  4BL7 A;  2MMO A;  2GSQ A;  1XWK A;  3Q19 A;  3HJO A;  1M9B A;  4HOJ A;  3IOS A;  4ZXG A;  3HYP A;  2FLS A;  5H5R A;  5IO2 A;  2C0G A;  4HU9 A;  3DXB A;  2FUG 2;  2LEG A;  1I5G A;  2WUL A;  4ZL9 A;  4JR6 A;  4HI7 A;  4EKZ A;  1F2E A;  3CRT A;  4N10 A;  3BOA A;  3IXR A;  3W8J A;  4F82 A;  4JZQ A;  2HLS A;  4NHZ A;  1XFL A;  2VD0 A;  2DJK A;  3QR6 A;  5LD0 A;  4KSM A;  1TRW A;  2QGV A;  3UVH A;  4EE0 A;  3ZRD A;  3RDW A;  1PD2 1;  3M3M A;  4GSN A;  3DGQ A;  1SEN A;  1VRS D;  2NPB A;  5GAP D;  1F37 A;  3D22 A;  5DJL A;  1JFU A;  4PQ1 A;  3PH9 A;  4POK A;  4TRX A;  2O7K A;  2VAF A;  3U5R E;  2VL2 A;  3K8N A;  1R5P A;  2VLV A;  2IJY A;  2CZ3 A;  2RLI A;  3UIW A;  3BCI A;  1GNE A;  2VCV A;  2GZY A;  1YDK A;  1SD9 A;  3RPN A;  3TKS A;  1EOG A;  1PKZ A;  3GYK A;  4EL1 A;  1O7U A;  5ECH B;  4EDY A;  1O6J A;  3KJY A;  4ZL8 A;  3DEX A;  3KTB A;  2PVQ A;  2JAD A;  2O8V B;  1ACV A;  2H1B A;  4PXO A;  2V41 A;  1W4V A;  3H1N A;  1NW2 A;  5G1L A;  4OO5 A;  4KF9 A;  1SKW B;  3F0I A;  2R4V A;  2LNT A;  1M7T A;  4FO5 A;  1J0F A;  3KIJ A;  1QQ2 A;  7GSS A;  3C73 A;  1QMV A;  1YKA A;  5KN1 A;  3IBH A;  3FR6 A;  1JLW A;  4ZBA A;  4LMV A;  3VFI A;  2GSR A;  4Z2R A;  1QK8 A;  1A24 A;  5D9X A;  1MTC A;  4NAX A;  1OC9 A;  1DE1 A;  3UMA A;  1M2A A;  1S3D A;  1A0R P;  2TRX A;  1TRU A;  2KP2 A;  1A2L A;  3QFB C;  6GSU A;  2DKH A;  2RII A;  1FHE A;  2YZU A;  2J23 A;  2YWI A;  1X0R A;  4IJI A;  5BRT A;  3EMX A;  1Z7R A;  1QFN A;  4G10 A;  2EIR A;  5DAK B;  3MDK A;  1XOA A;  5DAL A;  4V2N A;  2GT5 A;  1SKR B;  1MD4 A;  5D8I A;  2M80 A;  3GNJ A;  1GUM A;  2C0D A;  2DLX A;  4ZIL A;  2HXK A;  3TKS C;  18GS A;  3HCZ A;  1RK4 A;  3HKR A;  1S3C A;  5GAN D;  1ZYN A;  4K9Z A;  4N30 A;  1HNC A;  1BAY A;  3FMW A;  3CSJ A;  3DVX A;  1SJI A;  2CV4 A;  1U87 A;  3F9U A;  2V1M A;  2H8L A;  1M0U A;  3UVT A;  1OYJ A;  1YQ1 A;  3APS A;  1AQX A;  1T4Z A;  2H74 A;  1Z3E A;  6GSS A;  1JHB A;  1PN0 A;  4YQM A;  1VF1 A;  1YJ6 A;  2HZE A;  3G9B A;  1WJK A;  3E3E A;  4NPB A;  4IQA A;  3EU4 A;  4PUF C;  1USB A;  2PMT A;  4DSS B;  3IDV A;  3ZIJ A;  1GSE A;  1B8X A;  2FA8 A;  1K0C A;  4HEA 2;  3F63 A;  3GHA A;  3O76 A;  2OA7 A;  3L4N A;  3O3T A;  1S3R A;  4ID0 A;  1WP0 A;  1XW9 A;  1GUK A;  4XIH A;  2WFC A;  5D9W A;  2H71 A;  1SYR A;  4EC0 A;  3G7J A;  4KND A;  1AQW A;  3TOT A;  4OCF A;  3GMF A;  1JZW A;  2O85 A;  3VPT A;  14GS A;  1BJX A;  1URM A;  4RI6 A;  1B9X C;  1GP1 A;  4EO3 A;  4E8H A;  17GS A;  3UBL A;  5IOW A;  3FY7 A;  2A2S A;  4BVX B;  2H72 A;  5JWO B;  4ICY A;  1J9B A;  5C00 A;  5DCG A;  3LYP A;  2J9H A;  3GKX A;  1A0F A;  2PPT A;  2NTO A;  3IHG A;  5JWQ B;  4ECB A;  4TOP A;  4IQ1 A;  3QAG A;  2H0I A;  2FA4 A;  4NXI A;  1SK2 A;  2XHF A;  4PNF A;  1HYU A;  1OVN A;  3L9S A;  4WR4 A;  2LTK A;  1ERV A;  1EV4 A;  1A2M A;  2LRN A;  1EEJ A;  1GRX A;  1U6T A;  1WPI A;  5IMA A;  4XS1 A;  4NWY A;  1Z7P A;  3TB2 A;  3GKM A;  5ECN B;  3KP8 A;  4TXO B;  5KOW A;  2LJR A;  4JED A;  4ZBD A;  1FVJ A;  1SKS B;  3BJ5 A;  3VWV A;  5ECM B;  3KMO A;  2HRF A;  1TOF A;  3GTU B;  1NHO A;  3HD5 A;  5HFG A;  2CAI A;  1WMJ A;  4GRF A;  1ERU A;  3M1G A;  2XBI A;  2E2M A;  2H6X A;  1OE7 A;  4KAE A;  4MAB A;  3HXS A;  3UAP A;  3SBC A;  2LQO A;  2C0E A;  2FD3 A;  2B5Y A;  2KLX A;  3FHK A;  4CW9 A;  4F0B A;  3TJJ A;  1BED A;  3P2A A;  2WB9 A;  1GTB A;  1M2D A;  1EP8 A;  1OKT A;  3IAM 2;  3I6A A;  1XW6 A;  1SJ6 A;  1Z5Y E;  3DRN A;  3GFK A;  5ECR B;  3S9F A;  5EVO A;  3A2X A;  4GF0 A;  2JZR A;  4F9Z A;  4K5S A;  4YAV A;  2WGR A;  2UZ8 A;  4LA1 A;  1DSB A;  5KN3 A;  1X5E A;  3IAS 2;  3KZQ A;  4HZ4 A;  1AXD A;  3LGC A;  2MZC A;  3QPM A;  3HVN A;  4TR3 A;  2CZ2 A;  3ME7 A;  2V6K A;  3QAV A;  2E0Q A;  1WRY A;  3FZA A;  1PFO A;  1R5A A;  3HZ8 A;  5CRH A;  3QOU A;  1UN2 A;  3C1S A;  2H01 A;  4WEY A;  1R7H A;  1T7P B;  2R37 A;  3FK8 A;  4F03 A;  2L4C A;  2O89 A;  1OC3 A;  1HQO A;  1O73 A;  1YEX A;  2X4A A;  4PTS A;  2GS3 A;  4OCE A;  4G19 A;  5H5Q A;  2IIY A;  2VL9 A;  4OFN A;  2VL3 A;  5ENU A;  2CX4 A;  2HE3 A;  4DEJ A;  5J4U A;  3EUR A;  4XS6 A;  4MDC A;  1C72 A;  2LV3 A;  3MNG A;  4RI7 A;  4K2X A;  3IA1 A;  1CQH A;  2OE3 A;  1DE2 A;  3E0U A;  4PUR A;  5IOX A;  3QCP A;  1THO A;  1TI1 A;  3ZMK A;  3WGD A;  1GNW A;  1GSY A;  2H1A A;  3FZ5 A;  4ILF A;  3TOU A;  4TR0 A;  1XZO A;  4MK3 A;  4JU5 A;  3KCM A;  1FAA A;  5GST A;  2VCQ A;  2X99 A;  1Q4J A;  5F0G A;  3GA4 A;  3LSZ A;  2OAC A;  1TU8 A;  3UBK A;  2FNO A;  2C80 A;  5HR2 A;  1XVQ A;  5EPF A;  2HRN A;  4YKF A;  4WKW A;  1YZX A;  1ST9 A;  3CSH A;  5HFI A;  5D9V A;  1WOU A;  4K7N A;  4DSR A;  4QQ7 A;  10GS A;  2ON5 A;  1PSQ A;  1M9A A;  5HFK A;  1SK0 A;  2VLU A;  2H73 A;  2X8G A;  4NV5 A;  4ZBB A;  2EC4 A;  6GST A;  2VUP A;  2C8U A;  2DIZ A;  3FR9 A;  2LKU A;  4O32 A;  2LQQ A;  1GL8 A;  3R3E A;  5IMC A;  2H6Y A;  1OE8 A;  3ZL5 A;  3ZIV A;  3A5W A;  1GTU A;  3ISO A;  1BX9 A;  1EOH A;  3FZ9 A;  3DVW A;  3P7X A;  4X0X A;  4KDU A;  4MF7 A;  4NMU A;  3UJ1 A;  4ECI A;  1GLQ A;  5ID2 A;  3DYR A;  4LLR A;  1F9M A;  3VWW A;  2CQ9 A;  3MYD A;  3GUR A;  5C04 A;  3H4K A;  1Z6M A;  2HI7 A;  2AYT A;  2IFQ B;  1X9W B;  4EF0 A;  1H75 A;  1THX A;  2CX3 A;  3H93 A;  3WT2 A;  2OBI A;  3TKR A;  2KP1 A;  2HNL A;  4NV2 A;  2YCD A;  1ZMA A;  2NDO A;  2WDU A;  3EIN A;  2B7K A;  1GUL A;  2YV7 A;  3ME8 A;  5E59 A;  4XRD A;  4AF2 A;  2QSI A;  2GSS A;  2XC2 A;  4WET A;  3GH6 A;  4K1F A;  4A5P A;  3QFA C;  4LMW A;  4ISD A;  5J9B A;  1O85 A;  1GSF A;  3IE3 A;  3L78 A;  5IIZ A;  3NIV A;  5F05 A;  4MPG A;  4MMM A;  1LJR A;  3HDC A;  2X8H A;  2ZCT A;  4XS4 B;  1V2A A;  2GDR A;  4PNG A;  1T1V A;  1T3B A;  4EDZ A;  1KBN A;  2ZUP A;  2JZT A;  2NVL A;  1V9W A;  1ERT A;  4D73 A;  1SYX A;  1R4W A;  5G30 A;  2L57 A;  1B4P A;  1B48 A;  4TR1 A;  4TVE A;  3GN3 A;  4KUN A;  6GSW A;  1SL2 B;  4IP6 A;  4O5U A;  3CYN A;  5INY A;  3GX8 A;  1N2A A;  4KDX A;  1N8J A;  4K6X A;  4MLY A;  1Z6N A;  4PUA A;  3LFL A;  4J57 E;  2WS2 A;  2H1G A;  3M9J A;  4IKH A;  1YKC A;  3TKQ A;  1TI3 A;  5DBQ A;  1FO5 A;  3AY8 A;  4OWY A;  3FKF A;  5ECL B;  3I9V 2;  2QA2 A;  3ZYW A;  1ZGN A;  4I2U A;  1V57 A;  1H4O A;  1FVK A;  4I6X A;  1DBY A;  2B7J A;  3DML A;  5KN2 A;  1QUW A;  4IS0 A;  4K7I A;  3V1W A;  2R2J A;  4K7O A;  2IMI A;  1FB0 A;  3RHB A;  2MBT A;  2JL4 A;  4V1A g;  2CVB A;  2FY6 A;  3KEB A;  5ELA A;  3HVV A;  1TXX A;  5COH A;  2VCT A;  3IHQ A;  2RUE A;  1GTI A;  4MPF A;  3MIX A;  3F8U A;  3EMP A;  2E7P A;  5CRE A;  4EIP A;  3ERG A;  2YWO A;  4BL7 B;  4P3Y B;  5IQY A;  1V58 A;  3MAK A;  4K0G A;  1ZCP A;  1F3A A;  1FOH A;  5F07 A;  4HU7 A;  2P31 A;  2LJA A;  2VCZ A;  2DBC A;  1TK5 B;  3J7Y b;  1KNG A;  1ZL9 A;  4MNN A;  1AQV A;  1WE0 A;  3FZ4 A;  4I97 A;  5J41 A;  2X8C A;  3C8E A;  5F8B A;  2I1U A;  6GSX A;  4HJ2 A;  3F3R A;  4X43 A;  3BD2 A;  3KD0 A;  5IM9 A;  4I8B A;  2I3Y A;  1T4Y A;  1OC8 A;  2HYX A;  3IC4 A;  2FWG A;  1TU7 A;  1YF1 A;  1B9Y C;  2F8A A;  2GVP A;  1SU9 A;  4J56 E;  2VCX A;  4DSQ A;  4WBR D;  1UA5 A;  2IN3 A;  1V40 A;  5G1K A;  3GX0 A;  3ZZX A;  3D21 A;  4HQS A;  5AIV A;  5L71 A;  1UVZ A;  3UEM A;  2DKI A;  2F51 A;  4YKG A;  2AV4 A;  1X9M B;  2C3Q A;  4XTS A;  3DD3 A;  2L59 A;  3HVX A;  2FGX A;  2YJ7 A;  1U3A A;  3EC3 A;  3GSS A;  1DUG A;  1VGL A;  1TRV A;  4XHM A;  5B6M A;  2AAW A;  3VLN A;  2QC7 A;  4G0I A;  4GST A;  1K3O A;  2B5E A;  2O87 A;  2HSY A;  4X1U A;  2GZP A;  4BVY A;  1ON4 A;  2DJ3 A;  5HQP A;  2P5R A;  3PR8 A;  2YV9 A;  3ED3 A;  3RBT A;  2CT6 A;  1E2Y A;  2V32 A;  4ZL7 A;  1BYE A;  4EUY A;  3ZFL A;  1G6W A;  2P5Q A;  4LL1 B;  4NHW A;  3I43 A;  3UAR A;  3ZFB A;  3UOM A;  3I69 A;  4IN0 A;  1GSS A;  4QL9 A;  2DJ2 A;  4POM A;  3C7M A;  2C3T A;  3D5J A;  4KDY A;  2YAN A;  3CXG A;  1GSD A;  4MH2 A;  1A8Y A;  2GTU A;  4V2L A;  4XRA A;  2XPD A;  2C3N A;  3HVS A;  4GCI A;  1PN9 A;  2YPM A;  2PU9 C;  4MJA A;  1G6Y A;  4RQR A;  2F9S A;  5LNK e;  4ZB6 A;  4BIK A;  1OC9 B;  5IMV A;  3D4T A;  2LST A;  3TKS E;  3CRU A;  3ZML A;  4ECJ A;  1EP7 A;  3P8W A;  2V2G A;  3EVI A;  3L9U A;  3ERW A;  3LYK A;  1PL2 A;  1T8E B;  4Q5F A;  3U6V A;  2GST A;  3US3 A;  4HS1 A;  3FR3 A;  3TJG A;  3D4M A;  1O8X A;  5ECQ B;  1GSU A;  5DAL B;  3IV4 A;  4O5R A;  4XCS A;  2WJU A;  2C4J A;  4IVF A;  1EGO A;  3Q74 A;  5A4V A;  3EE2 A;  4TW5 A;  3N5O A;  4Z2U A;  1EGR A;  2N5B A;  3EPT A;  1YEP A;  3A2V A;  3EWL A;  4V1A p;  1PL1 A;  2IMK A;  1HNA A;  1PGT A;  2VOC A;  2QA1 A;  2R0G A;  2OAD A;  3NOF A;  2VLT A;  5BMU A;  1GWC A;  2R6K A;  1NSW A;  2FWF A;  2OJL A;  2HRA A;  1XOB A;  4MF6 A;  3HJP A;  4G0K A;  3ZVJ D;  3H79 A;  4MH3 A;  2PBJ A;  3KXO A;  5B7C A;  1R26 A;  2F3M A;  3EYT A;  4YH2 A;  2HZE B;  2I9H A;  5FWG A;  2LS5 A;  4WR5 A;  1U88 A;  4FYU A;  2IWT A;  1TP9 A;  4E8E A;  3KH7 A;  2C1Y A;  2DMM A;  2DC5 A;  5A5K A;  5ABR A;  2EIQ A;  5IO0 A;  5EL8 A;  2HSH A;  5KOX A;  3ERF A;  1PQN A;  5HR1 A;  4TR4 A;  2PN8 A;  2H76 A;  2K8V A;  2YWN A;  1IYI A;  1G0T A;  3QAW A;  5HR3 A;  1SL0 B;  1PA3 A;  3D0Z A;  5IMZ A;  5J9C A;  3TGZ A;  4IEL A;  1V98 A;  5CP1 A;  5H5S A;  2ZNM A;  4KE3 A;  3WT1 A;  3FYG A;  3CMI A;  5B8A A;  2YZH A;  5DQY A; 
#chains in the Genus database with same CATH homology
 4GSS A;  3GH9 A;  2VCW A;  4FIW A;  4ML1 A;  1YF0 A;  2G2Q A;  1G7E A;  3NZN A;  1K0B A;  2R0C A;  3G7Y A;  4JE1 A;  4MP4 A;  4CY8 A;  1ZYQ B;  1XWC A;  2GGT A;  1FG4 A;  2IL3 A;  2M46 A;  3VPQ A;  2YNX A;  4IGJ A;  5FT3 A;  5FHI A;  1O81 A;  3TCO A;  5JCW A;  3O6T A;  4HQZ A;  3F4R A;  2REM A;  4Q5R A;  3L9V A;  2RM6 A;  2WRT A;  2M72 A;  2H70 A;  4HUA A;  3APQ A;  1K3Y A;  1AIU A;  1VF3 A;  3TRP A;  5JCU A;  1TTZ A;  3LXT A;  5F06 A;  5CRW A;  2PGT A;  2VD1 A;  1W89 A;  3VWU A;  2P0G A;  3WYW A;  1KEB A;  1TDI A;  4O92 A;  1XPV A;  1K0N A;  1QGV A;  1Y6E A;  3BBY A;  1WWJ A;  2G0F A;  2H19 A;  5A4W A;  4MJE A;  5DAK A;  2AUV A;  1JZO A;  2N5F A;  4N11 A;  5ECS A;  4JBB A;  4IW9 A;  4MJB A;  1SD8 A;  2JSZ A;  1TJD A;  1X5C A;  1B4Q A;  2A4V A;  2L6D A;  3Q18 A;  4FQU A;  4N0Z A;  3KTL A;  4YAP A;  1BG5 A;  1NM3 A;  2WCI A;  5CRD A;  1BQ7 A;  3FEU A;  4EXJ A;  4F0C A;  2AHE A;  4POB A;  2XBQ A;  4DVC A;  4K2D A;  2XPE A;  3TDG A;  1MEK A;  1X5D A;  3R2Q A;  3IR4 A;  1WIK A;  4HJM A;  3UL3 A;  4KA0 A;  2B5X A;  1Y25 A;  4MZB A;  2A2R A;  4GQC A;  1LU4 A;  3OR5 A;  3CTF A;  3IC8 A;  1AW9 A;  4WF5 A;  1K0D A;  3PIN A;  4WF4 A;  2AB6 A;  2FHE A;  3VK9 A;  20GS A;  2KOK A;  4X4J A;  1Z9H A;  4IP1 A;  4IJ3 A;  5EY6 A;  4L0W A;  5B8B A;  2QKE A;  1GUH A;  1RQM A;  4DSS A;  9GSS A;  3A3T A;  3GUS A;  3F4T A;  4V2M A;  2OKA A;  2PVO C;  1TK0 B;  1U3I A;  2KUC A;  1PRX A;  4JR4 A;  3IK9 A;  4PGT A;  5HR0 A;  3F6F A;  5D73 A;  3N9J A;  3LEF A;  2NBS A;  1PX6 A;  2RUF A;  4HZ2 A;  3TRX A;  1IYH A;  5JWR B;  5ECP B;  3KH9 A;  2LUS A;  2YWM A;  4J2F A;  1JZR A;  2GZZ A;  4BVX A;  4G9H A;  3TRQ A;  2HT9 A;  2LNS A;  1PX7 A;  3LQ7 A;  2ON7 A;  4GXZ A;  1F3B A;  5GZZ B;  4KX4 A;  1TRS A;  5IPG A;  2H6Z A;  4AJ8 A;  1PKW A;  2DIY A;  3A5I A;  2DJ1 A;  3PPU A;  4HDE A;  4KCE A;  2L4Q A;  1X9S B;  1K0M A;  1KTE A;  4FYB A;  1MDI A;  2KHP A;  3GKK A;  2R5G A;  4TXO A;  5G5F A;  1RW1 A;  2OBK A;  5CRG A;  4O7H A;  4FH8 A;  4KW6 A;  1OAZ A;  4PX1 A;  3RPP A;  3GTU A;  4KH7 A;  3TUE A;  2H66 A;  1QXH A;  4AGS A;  3F3Q A;  3DWV A;  5DQS A;  2FWH A;  2VM2 A;  3LXZ A;  4GQF A;  3ZVJ A;  4GLT A;  1HNB A;  5IPH A;  2VL2 C;  2PER A;  5DCH A;  5ID2 B;  3LOR A;  1JLV A;  2L6C A;  1XWA A;  3WGX A;  1EZK A;  2B6M A;  1J08 A;  4ULX A;  3A2W A;  2WZ9 A;  5CO3 A;  2RM5 A;  2PWJ A;  2MMN A;  2L5L A;  5A4U A;  3C71 A;  3L0H A;  1XCC A;  2YN1 A;  2H0H A;  1NHY A;  3BCK A;  3GL5 A;  5AIX A;  4BWQ A;  1SL1 B;  1SK1 A;  2ES7 A;  5CAX A;  4KSO A;  3VWX A;  1TK8 B;  3H8Q A;  3HY2 A;  3VI5 A;  3WD6 A;  2F8F A;  2CVD A;  1XWG A;  5ECO B;  3W6G A;  4CHS A;  3RHC A;  2JU5 A;  3M0F A;  3E9J B;  2ALB A;  1M99 A;  1G7O A;  2AJQ B;  2GT6 A;  1FW1 A;  3CTG A;  5G31 A;  1F6M C;  19GS A;  2LRC A;  2PUK C;  2GQK A;  2R3X A;  5AN1 A;  3TKP A;  1T00 A;  4IHU A;  3J7Y k;  4EIQ A;  3D6I A;  3DKS A;  2MMZ A;  4ACS A;  5IMF A;  3CSI A;  4TN8 A;  2H1D A;  2V6O A;  4D73 B;  2R0P A;  2H75 A;  2JZS A;  4CY6 A;  4ML6 A;  4TR1 B;  1VF2 A;  2IMD A;  3RAZ A;  1AUC A;  5J3R A;  1JZD A;  5D9T A;  2CVK A;  8GSS A;  1XW5 A;  4K8M A;  4TXV A;  2X49 A;  1LBK A;  4WBJ A;  5AGY A;  3GL3 A;  3DIE A;  2CA8 A;  1A8L A;  2VIM A;  3IRA A;  1MD3 A;  1XWB A;  2B1K A;  5G2Z A;  2X64 A;  2MYG A;  2CAQ A;  22GS A;  2VM1 A;  5DVB A;  1AC1 A;  3G7I A;  2HZF A;  3EU3 A;  2FWE A;  1M2B A;  4TKY A;  1ERW A;  4QL7 A;  2OE1 A;  3F6D A;  2I81 A;  2DML A;  3APO A;  3KM6 A;  1UC7 A;  2IMF A;  4L5L A;  4IBP A;  5GSS A;  4WXT A;  1ABA A;  2VO4 A;  1GSQ A;  1K0O A;  1EEM A;  3VUR A;  2DSA A;  1SJZ A;  2N5A A;  2MMA A;  2BMX A;  1A23 A;  4RQX A;  3TJK A;  2IPA A;  3FW2 A;  4CDO A;  1FOV A;  4I2T A;  2GQM A;  3QDN A;  1K0A A;  2TIR A;  2YOI A;  3C1R A;  4MF5 A;  5B6N A;  3IK7 A;  5LCZ A;  1XVW A;  2IME A;  5ELG A;  2LJK A;  1EWX A;  3GKN A;  4OFM A;  3QD9 A;  2K8S A;  4BPY A;  4OD7 A;  2YP6 A;  5D93 A;  1K3L A;  3ZRE A;  1TKD B;  1VF4 A;  2H30 A;  4G2E A;  4MZW A;  2B3S A;  3LWA A;  5G5E A;  4PQI A;  2GQL A;  2C0F A;  2IFQ A;  1A2J A;  3TJB A;  4PQH A;  3HHV A;  2OE0 A;  4K5R A;  4Z7X A;  3VI7 A;  4RUV A;  4OMV A;  3JCM L;  4LL4 B;  2JSY A;  4MCU A;  5IMD A;  4I5Q A;  3ZLP A;  4MJC A;  16GS A;  4L5O A;  5J5N A;  1XBS A;  5ECK B;  3MWH A;  4KGI A;  2K9F A;  3HJM A;  5DJM A;  2I4A A;  4KB3 A;  3FRC A;  1GH2 A;  3GV1 A;  2JAC A;  3P90 A;  3MSZ A;  5D96 A;  3LW9 A;  4H86 A;  5KEJ A;  3GRX A;  4OO4 A;  3M9K A;  4ZIJ A;  4L8E A;  1GLP A;  4XS4 A;  1E6B A;  1TW9 A;  3IPZ A;  4BWS A;  1I9D A;  4USS A;  4BVY B;  2DJ0 A;  12GS A;  6GSV A;  3LJR A;  4Z2T A;  11GS A;  2A2P A;  4KCA A;  4Q5Q A;  2HSM A;  2BTO T;  4F2I A;  1S3A A;  1EV9 A;  1PMT A;  3LG6 A;  4YQU A;  3TJF A;  1FB6 A;  2YJH A;  5E4W A;  4POL A;  3KGK A;  1XIY A;  1ZZY A;  5DDL A;  2BJX A;  6GSY A;  2D2Z A;  4EVM A;  3KMN A;  4BA7 A;  1GTA A;  4JRR A;  4ZB8 A;  3HA9 A;  13GS A;  1O8W A;  4K0N A;  1HD2 A;  4AJ7 A;  2EIO A;  1ML6 A;  4AJ6 A;  4GWR A;  3CBU A;  4N0V A;  1ZYE A;  3GIX A;  3KP9 A;  5CNW A;  5ECI B;  5AIS A;  2FCH A;  1YY7 A;  3GST A;  3ZIT A;  1AAZ A;  2HFD A;  3QMX A;  4GTU A;  2H0G A;  2A4H A;  2HRK A;  2K18 A;  2GLR A;  1ILO A;  5CYY A;  1CQG A;  3M8N A;  2B1L A;  2Z9S A;  3PGT A;  4OFT A;  4G0L A;  2K6V A;  1MDK A;  2LRT A;  2TRC P;  3HZ4 A;  4YQV A;  4ZB9 A;  1ZOF A;  4O5Q A;  1XXU A;  1Q98 A;  3Q6O A;  2MBS A;  5JCG A;  4MA9 A;  5KN0 A;  2L5O A;  1ZYP A;  3ZTL A;  4ECC A;  4FYC A;  4L0U A;  3W8S A;  3WGE A;  4Q5N A;  1OKD A;  2DJJ A;  2E2G A;  4MZC A;  3SWL A;  1MDJ A;  3F4S A;  4BL7 A;  2MMO A;  2GSQ A;  1XWK A;  3Q19 A;  3HJO A;  1M9B A;  4HOJ A;  3IOS A;  4ZXG A;  3HYP A;  2FLS A;  5H5R A;  5IO2 A;  2C0G A;  4HU9 A;  3DXB A;  2FUG 2;  2LEG A;  1I5G A;  2WUL A;  4ZL9 A;  4JR6 A;  4HI7 A;  4EKZ A;  1F2E A;  3CRT A;  4N10 A;  3BOA A;  3IXR A;  3W8J A;  4F82 A;  4JZQ A;  2HLS A;  4NHZ A;  1XFL A;  2VD0 A;  2DJK A;  3QR6 A;  5LD0 A;  4KSM A;  1TRW A;  2QGV A;  3UVH A;  4EE0 A;  3ZRD A;  3RDW A;  1PD2 1;  3M3M A;  4GSN A;  3DGQ A;  1SEN A;  1VRS D;  2NPB A;  5GAP D;  1F37 A;  3D22 A;  5DJL A;  1JFU A;  4PQ1 A;  3PH9 A;  4POK A;  4TRX A;  2O7K A;  2VAF A;  3U5R E;  2VL2 A;  3K8N A;  1R5P A;  2VLV A;  2IJY A;  2CZ3 A;  2RLI A;  3UIW A;  3BCI A;  1GNE A;  2VCV A;  2GZY A;  1YDK A;  1SD9 A;  3RPN A;  3TKS A;  1EOG A;  1PKZ A;  3GYK A;  4EL1 A;  1O7U A;  5ECH B;  4EDY A;  1O6J A;  3KJY A;  4ZL8 A;  3DEX A;  3KTB A;  2PVQ A;  2JAD A;  2O8V B;  1ACV A;  2H1B A;  4PXO A;  2V41 A;  1W4V A;  3H1N A;  1NW2 A;  5G1L A;  4OO5 A;  4KF9 A;  1SKW B;  3F0I A;  2R4V A;  2LNT A;  1M7T A;  4FO5 A;  1J0F A;  3KIJ A;  1QQ2 A;  7GSS A;  3C73 A;  1QMV A;  1YKA A;  5KN1 A;  3IBH A;  3FR6 A;  1JLW A;  4ZBA A;  4LMV A;  3VFI A;  2GSR A;  4Z2R A;  1QK8 A;  1A24 A;  5D9X A;  1MTC A;  4NAX A;  1OC9 A;  1DE1 A;  3UMA A;  1M2A A;  1S3D A;  1A0R P;  2TRX A;  1TRU A;  2KP2 A;  1A2L A;  3QFB C;  6GSU A;  2DKH A;  2RII A;  1FHE A;  2YZU A;  2J23 A;  2YWI A;  1X0R A;  4IJI A;  5BRT A;  3EMX A;  1Z7R A;  1QFN A;  4G10 A;  2EIR A;  5DAK B;  3MDK A;  1XOA A;  5DAL A;  4V2N A;  2GT5 A;  1SKR B;  1MD4 A;  5D8I A;  2M80 A;  3GNJ A;  1GUM A;  2C0D A;  2DLX A;  4ZIL A;  2HXK A;  3TKS C;  18GS A;  3HCZ A;  1RK4 A;  3HKR A;  1S3C A;  5GAN D;  1ZYN A;  4K9Z A;  4N30 A;  1HNC A;  1BAY A;  3FMW A;  3CSJ A;  3DVX A;  1SJI A;  2CV4 A;  1U87 A;  3F9U A;  2V1M A;  2H8L A;  1M0U A;  3UVT A;  1OYJ A;  1YQ1 A;  3APS A;  1AQX A;  1T4Z A;  2H74 A;  1Z3E A;  6GSS A;  1JHB A;  1PN0 A;  4YQM A;  1VF1 A;  1YJ6 A;  2HZE A;  3G9B A;  1WJK A;  3E3E A;  4NPB A;  4IQA A;  3EU4 A;  4PUF C;  1USB A;  2PMT A;  4DSS B;  3IDV A;  3ZIJ A;  1GSE A;  1B8X A;  2FA8 A;  1K0C A;  4HEA 2;  3F63 A;  3GHA A;  3O76 A;  2OA7 A;  3L4N A;  3O3T A;  4ID0 A;  1WP0 A;  1XW9 A;  1GUK A;  4XIH A;  2WFC A;  5D9W A;  2H71 A;  1SYR A;  4EC0 A;  3G7J A;  4KND A;  1AQW A;  3TOT A;  4OCF A;  3GMF A;  1JZW A;  2O85 A;  3VPT A;  14GS A;  1BJX A;  1URM A;  4RI6 A;  1B9X C;  1GP1 A;  4EO3 A;  4E8H A;  17GS A;  3UBL A;  5IOW A;  3FY7 A;  2A2S A;  4BVX B;  2H72 A;  5JWO B;  4ICY A;  1J9B A;  5C00 A;  5DCG A;  3LYP A;  2J9H A;  3GKX A;  1A0F A;  2PPT A;  2NTO A;  3IHG A;  5JWQ B;  4ECB A;  4TOP A;  4IQ1 A;  3QAG A;  2H0I A;  2FA4 A;  4NXI A;  1SK2 A;  2XHF A;  4PNF A;  1HYU A;  1OVN A;  3L9S A;  4WR4 A;  2LTK A;  1ERV A;  1EV4 A;  1A2M A;  2LRN A;  1EEJ A;  1GRX A;  1U6T A;  1WPI A;  5IMA A;  4XS1 A;  4NWY A;  1Z7P A;  3TB2 A;  3GKM A;  5ECN B;  3KP8 A;  4TXO B;  5KOW A;  2LJR A;  4JED A;  4ZBD A;  1FVJ A;  1SKS B;  3BJ5 A;  3VWV A;  5ECM B;  3KMO A;  2HRF A;  1TOF A;  3GTU B;  1NHO A;  3HD5 A;  5HFG A;  2CAI A;  1WMJ A;  4GRF A;  1ERU A;  3M1G A;  2XBI A;  2E2M A;  2H6X A;  1OE7 A;  4KAE A;  4MAB A;  3HXS A;  3UAP A;  3SBC A;  2LQO A;  2C0E A;  2FD3 A;  2B5Y A;  2KLX A;  3FHK A;  4CW9 A;  4F0B A;  3TJJ A;  1BED A;  3P2A A;  2WB9 A;  1GTB A;  1M2D A;  1EP8 A;  1OKT A;  3IAM 2;  3I6A A;  1XW6 A;  1SJ6 A;  1Z5Y E;  3DRN A;  3GFK A;  5ECR B;  3S9F A;  5EVO A;  3A2X A;  4GF0 A;  2JZR A;  4F9Z A;  4K5S A;  4YAV A;  2WGR A;  2UZ8 A;  4LA1 A;  1DSB A;  5KN3 A;  1X5E A;  3IAS 2;  3KZQ A;  4HZ4 A;  1AXD A;  3LGC A;  2MZC A;  3QPM A;  4TR3 A;  2CZ2 A;  3ME7 A;  2V6K A;  3QAV A;  2E0Q A;  1WRY A;  3FZA A;  1R5A A;  3HZ8 A;  5CRH A;  3QOU A;  1UN2 A;  3C1S A;  2H01 A;  4WEY A;  1R7H A;  1T7P B;  2R37 A;  3FK8 A;  4F03 A;  2L4C A;  2O89 A;  1OC3 A;  1HQO A;  1O73 A;  1YEX A;  2X4A A;  4PTS A;  2GS3 A;  4OCE A;  4G19 A;  5H5Q A;  2IIY A;  2VL9 A;  4OFN A;  2VL3 A;  5ENU A;  2CX4 A;  2HE3 A;  4DEJ A;  5J4U A;  3EUR A;  4XS6 A;  4MDC A;  1C72 A;  2LV3 A;  3MNG A;  4RI7 A;  4K2X A;  3IA1 A;  1CQH A;  2OE3 A;  1DE2 A;  3E0U A;  4PUR A;  5IOX A;  3QCP A;  1THO A;  1TI1 A;  3ZMK A;  3WGD A;  1GNW A;  1GSY A;  2H1A A;  3FZ5 A;  4ILF A;  3TOU A;  4TR0 A;  1XZO A;  4MK3 A;  4JU5 A;  3KCM A;  1FAA A;  5GST A;  2VCQ A;  2X99 A;  1Q4J A;  5F0G A;  3GA4 A;  3LSZ A;  2OAC A;  1TU8 A;  3UBK A;  2FNO A;  2C80 A;  5HR2 A;  1XVQ A;  5EPF A;  2HRN A;  4YKF A;  4WKW A;  1YZX A;  1ST9 A;  3CSH A;  5HFI A;  5D9V A;  1WOU A;  4K7N A;  4DSR A;  4QQ7 A;  10GS A;  2ON5 A;  1PSQ A;  1M9A A;  5HFK A;  1SK0 A;  2VLU A;  2H73 A;  2X8G A;  4NV5 A;  4ZBB A;  2EC4 A;  6GST A;  2VUP A;  2C8U A;  2DIZ A;  3FR9 A;  2LKU A;  4O32 A;  2LQQ A;  1GL8 A;  3R3E A;  5IMC A;  2H6Y A;  1OE8 A;  3ZL5 A;  3ZIV A;  3A5W A;  1GTU A;  3ISO A;  1BX9 A;  1EOH A;  3FZ9 A;  3DVW A;  3P7X A;  4X0X A;  4KDU A;  4MF7 A;  4NMU A;  3UJ1 A;  4ECI A;  1GLQ A;  5ID2 A;  3DYR A;  4LLR A;  1F9M A;  3VWW A;  2CQ9 A;  3MYD A;  3GUR A;  5C04 A;  3H4K A;  1Z6M A;  2HI7 A;  2AYT A;  2IFQ B;  1X9W B;  4EF0 A;  1H75 A;  1THX A;  2CX3 A;  3H93 A;  3WT2 A;  2OBI A;  3TKR A;  2KP1 A;  2HNL A;  4NV2 A;  2YCD A;  1ZMA A;  2NDO A;  2WDU A;  3EIN A;  2B7K A;  1GUL A;  2YV7 A;  3ME8 A;  5E59 A;  4XRD A;  4AF2 A;  2QSI A;  2GSS A;  2XC2 A;  4WET A;  3GH6 A;  4K1F A;  4A5P A;  3QFA C;  4LMW A;  4ISD A;  5J9B A;  1O85 A;  1GSF A;  3IE3 A;  3L78 A;  5IIZ A;  3NIV A;  5F05 A;  4MPG A;  4MMM A;  1LJR A;  3HDC A;  2X8H A;  2ZCT A;  4XS4 B;  1V2A A;  2GDR A;  4PNG A;  1T1V A;  1T3B A;  4EDZ A;  1KBN A;  2ZUP A;  2JZT A;  2NVL A;  1V9W A;  1ERT A;  4D73 A;  1SYX A;  1R4W A;  5G30 A;  2L57 A;  1B4P A;  1B48 A;  4TR1 A;  4TVE A;  3GN3 A;  4KUN A;  6GSW A;  1SL2 B;  4IP6 A;  4O5U A;  3CYN A;  5INY A;  3GX8 A;  1N2A A;  4KDX A;  1N8J A;  4K6X A;  4MLY A;  1Z6N A;  4PUA A;  3LFL A;  4J57 E;  2WS2 A;  2H1G A;  3M9J A;  4IKH A;  1YKC A;  3TKQ A;  1TI3 A;  5DBQ A;  1FO5 A;  3AY8 A;  4OWY A;  3FKF A;  5ECL B;  3I9V 2;  2QA2 A;  3ZYW A;  1ZGN A;  4I2U A;  1V57 A;  1H4O A;  1FVK A;  4I6X A;  1DBY A;  2B7J A;  3DML A;  5KN2 A;  1QUW A;  4IS0 A;  4K7I A;  3V1W A;  2R2J A;  4K7O A;  2IMI A;  1FB0 A;  3RHB A;  2MBT A;  2JL4 A;  4V1A g;  2CVB A;  2FY6 A;  3KEB A;  5ELA A;  3HVV A;  1TXX A;  5COH A;  2VCT A;  3IHQ A;  2RUE A;  1GTI A;  4MPF A;  3MIX A;  3F8U A;  3EMP A;  2E7P A;  5CRE A;  4EIP A;  3ERG A;  2YWO A;  4BL7 B;  4P3Y B;  5IQY A;  1V58 A;  3MAK A;  4K0G A;  1ZCP A;  1F3A A;  1FOH A;  5F07 A;  4HU7 A;  2P31 A;  2LJA A;  2VCZ A;  2DBC A;  1TK5 B;  3J7Y b;  1KNG A;  1ZL9 A;  4MNN A;  1AQV A;  1WE0 A;  3FZ4 A;  4I97 A;  5J41 A;  2X8C A;  3C8E A;  5F8B A;  2I1U A;  6GSX A;  4HJ2 A;  3F3R A;  4X43 A;  3BD2 A;  3KD0 A;  5IM9 A;  4I8B A;  2I3Y A;  1T4Y A;  1OC8 A;  2HYX A;  3IC4 A;  2FWG A;  1TU7 A;  1YF1 A;  1B9Y C;  2F8A A;  2GVP A;  1SU9 A;  4J56 E;  2VCX A;  4DSQ A;  4WBR D;  1UA5 A;  2IN3 A;  1V40 A;  5G1K A;  3GX0 A;  3ZZX A;  3D21 A;  4HQS A;  5AIV A;  5L71 A;  1UVZ A;  3UEM A;  2DKI A;  2F51 A;  4YKG A;  2AV4 A;  1X9M B;  2C3Q A;  4XTS A;  3DD3 A;  2L59 A;  3HVX A;  2FGX A;  2YJ7 A;  1U3A A;  3EC3 A;  3GSS A;  1DUG A;  1VGL A;  1TRV A;  4XHM A;  5B6M A;  2AAW A;  3VLN A;  2QC7 A;  4G0I A;  4GST A;  1K3O A;  2B5E A;  2O87 A;  2HSY A;  4X1U A;  2GZP A;  4BVY A;  1ON4 A;  2DJ3 A;  5HQP A;  2P5R A;  3PR8 A;  2YV9 A;  3ED3 A;  3RBT A;  2CT6 A;  1E2Y A;  2V32 A;  4ZL7 A;  1BYE A;  4EUY A;  3ZFL A;  1G6W A;  2P5Q A;  4LL1 B;  4NHW A;  3I43 A;  3UAR A;  3ZFB A;  3UOM A;  3I69 A;  4IN0 A;  1GSS A;  4QL9 A;  2DJ2 A;  4POM A;  3C7M A;  2C3T A;  3D5J A;  4KDY A;  2YAN A;  3CXG A;  1GSD A;  4MH2 A;  1A8Y A;  2GTU A;  4V2L A;  4XRA A;  2XPD A;  2C3N A;  3HVS A;  4GCI A;  1PN9 A;  2YPM A;  2PU9 C;  4MJA A;  1G6Y A;  4RQR A;  2F9S A;  5LNK e;  4ZB6 A;  1OC9 B;  5IMV A;  3D4T A;  2LST A;  3TKS E;  3CRU A;  3ZML A;  4ECJ A;  1EP7 A;  3P8W A;  2V2G A;  3EVI A;  3L9U A;  3ERW A;  3LYK A;  1PL2 A;  1T8E B;  4Q5F A;  3U6V A;  2GST A;  3US3 A;  4HS1 A;  3FR3 A;  3TJG A;  3D4M A;  1O8X A;  5ECQ B;  1GSU A;  5DAL B;  3IV4 A;  4O5R A;  4XCS A;  2WJU A;  2C4J A;  4IVF A;  1EGO A;  3Q74 A;  5A4V A;  3EE2 A;  4TW5 A;  3N5O A;  4Z2U A;  1EGR A;  2N5B A;  3EPT A;  1YEP A;  3A2V A;  3EWL A;  4V1A p;  1PL1 A;  2IMK A;  1HNA A;  1PGT A;  2VOC A;  2QA1 A;  2R0G A;  2OAD A;  3NOF A;  2VLT A;  5BMU A;  1GWC A;  2R6K A;  1NSW A;  2FWF A;  2OJL A;  2HRA A;  1XOB A;  4MF6 A;  3HJP A;  4G0K A;  3ZVJ D;  3H79 A;  4MH3 A;  2PBJ A;  3KXO A;  5B7C A;  1R26 A;  2F3M A;  3EYT A;  4YH2 A;  2HZE B;  2I9H A;  5FWG A;  2LS5 A;  4WR5 A;  1U88 A;  4FYU A;  2IWT A;  1TP9 A;  4E8E A;  3KH7 A;  2C1Y A;  2DMM A;  2DC5 A;  5A5K A;  5ABR A;  2EIQ A;  5IO0 A;  5EL8 A;  2HSH A;  5KOX A;  3ERF A;  1PQN A;  5HR1 A;  4TR4 A;  2PN8 A;  2H76 A;  2K8V A;  2YWN A;  1IYI A;  1G0T A;  3QAW A;  5HR3 A;  1SL0 B;  1PA3 A;  3D0Z A;  5IMZ A;  5J9C A;  3TGZ A;  4IEL A;  1V98 A;  5CP1 A;  5H5S A;  2ZNM A;  4KE3 A;  3WT1 A;  3FYG A;  3CMI A;  5B8A A;  2YZH A;  5DQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...