1S3AA

Nmr solution structure of subunit b8 from human nadh-ubiquinone oxidoreductase complex i (ci-b8)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
85
structure length
85
Chain Sequence
GLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-ubiquinone oxidoreductase B8 subunit
publication title The oxidized subunit B8 from human complex I adopts a thioredoxin fold.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 22
structure length 85
sequence length 85
ec nomenclature ec 1.6.5.3: Transferred entry: 7.1.1.2.
pdb deposition date 2004-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05047 L51_S25_CI-B8 Mitochondrial ribosomal protein L51 / S25 / CI-B8 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1s3aA00
4PGTA 3AY8A 4BPYA 1M9BA 1K0MA 3R2QA 4YAPA 3VFIA 1NSWA 3VLNA 4KA0A 4GWRA 1XZOA 3UEMA 5DQSA 3ZREA 5C00A 3TKSC 1B9YC 2VCXA 1YF0A 5LD0A 1O85A 2L6DA 1SYXA 5B8BA 4ILFA 1BQ7A 5GSTA 5F06A 1B4QA 4TRXA 4XRAA 1KEBA 4HU9A 3ZIJA 3RPNA 5DQYA 5D93A 2CZ3A 3G7YA 5G2ZA 12GSA 3EURA 4F0CA 5A4VA 1F2EA 1SL1B 4PXOA 2K8VA 1THOA 1U3AA 1HQOA 2IL3A 3LSZA 2R5GA 3IK7A 1GSEA 2VLVA 1TK8B 4EC0A 3UVHA 1Z3EA 3GL3A 1UVZA 3UBKA 5DCGA 1AXDA 1VGLA 4EUYA 2V6OA 4GSTA 3KGKA 5CP1A 3HD5A 1ERUA 1V9WA 3VPTA 1GP1A 4LL1B 5IO2A 3DYRA 2FWGA 4KUNA 4JRRA 4OCEA 2E2MA 2KUCA 4I2UA 4G19A 3ZFLA 2LSTA 3FZAA 4ULXA 2X64A 3E3EA 2C3NA 2HYXA 3M9KA 3L9UA 4AF2A 5ECQB 1GLPA 1M99A 3W8SA 5A4WA 1VRSD 5EL8A 3TJFA 1W4VA 2GSRA 4Q5QA 1WIKA 1K0OA 3CSHA 4D73B 3IA1A 2FA8A 2NBSA 3QOUA 4WETA 4JZQA 5IOXA 2PN8A 1O73A 1B8XA 4KDYA 5FWGA 4FYCA 3TCOA 3ZZXA 3F3RA 5IO0A 6GSSA 2VCWA 5DBQA 2AB6A 2LQQA 2V1MA 5CREA 1WJKA 2OACA 2FWFA 5FT3A 4TR0A 2WULA 4FH8A 1XWBA 3S9FA 3RDWA 2G2QA 4RQXA 1HNCA 1YZXA 3GNJA 4IQAA 3LWAA 1BAYA 1W89A 4NAXA 3SWLA 1PMTA 4J56E 5IPGA 2FGXA 1Z5YE 3BJ5A 4KH7A 3A5WA 4OFNA 5F0GA 3TRXA 2A2SA 3LFLA 3EMXA 2X8HA 4F9ZA 3H4KA 4QL9A 4MJCA 5AGYA 3KMNA 1A0RP 1K0CA 2GQLA 5F8BA 4GCIA 5CRHA 4IHUA 2CAIA 1O7UA 1PRXA 3I69A 4ECJA 3GIXA 3U5RE 3TRQA 4HS1A 1FW1A 3DEXA 5IIZA 2JSYA 3MAKA 4MCUA 4L0WA 5ECRB 1DBYA 3TOTA 2XPEA 2YNXA 2YP6A 14GSA 5GAPD 4XS4B 2NDOA 2ZNMA 1EOGA 2WCIA 5INYA 1GL8A 1XBSA 2JSZA 3HY2A 1DSBA 2LJRA 3APSA 2RUEA 2R37A 1YDKA 2TRCP 3C8EA 3ZVJD 2K8SA 5KN3A 4HZ2A 2DJ3A 2VD1A 2YWMA 2H1AA 4F82A 3QCPA 2HRFA 3F3QA 3IAS2 2JZTA 2IN3A 5JCWA 2PVOC 3IV4A 1SD9A 4TOPA 2HZEA 4MH2A 3DMLA 4AJ8A 4E8HA 1XWCA 3D5JA 1ML6A 4V2NA 1XWKA 2HSHA 1GNEA 4TN8A 2B3SA 1X9WB 1R5PA 1J08A 2H8LA 1A8YA 3CTFA 1G6YA 5ABRA 3ZLPA 1T7PB 3GKNA 4KB3A 2P5RA 3FEUA 4V1Ap 3GTUB 4I2TA 3GH9A 1XOBA 1BEDA 3F4RA 1A8LA 2B7KA 3Q18A 4OCFA 4FIWA 1XFLA 1SENA 2KP2A 2QC7A 2DMMA 5IM9A 5IPHA 2FY6A 2GSTA 2DJKA 4FO5A 1ZGNA 5HR1A 4BA7A 1OC3A 2M80A 1TK0B 4FYBA 13GSA 3CBUA 4EKZA 1TU8A 3ERFA 1GH2A 3GTUA 4POLA 2B6MA 3F63A 3TKRA 4KE3A 3KZQA 2YJHA 2DSAA 1KTEA 5AIXA 4J57E 1R26A 1GTIA 1XW9A 5E4WA 3TOUA 2O89A 2DBCA 5AIVA 3HZ8A 5ELGA 3ZVJA 3KM6A 1G7OA 2VL2A 4NMUA 4DVCA 2VL9A 3CXGA 1T1VA 3UMAA 3BD2A 3QAWA 2C0GA 2B5XA 6GSTA 3NZNA 2YPMA 2N5AA 1M9AA 1X9MB 3EMPA 2HFDA 5ECIB 2M46A 4TR1B 3H93A 2VCQA 1PGTA 2ON7A 4EVMA 1EV9A 3L4NA 4LLRA 3L0HA 5AN1A 3TGZA 4MZCA 4XHMA 1TJDA 2LRCA 1K3LA 1YKAA 2X8GA 1M2BA 3HCZA 3TUEA 5GAND 1KBNA 4JR4A 1U6TA 2YZUA 4HJ2A 3WT1A 3A3TA 3RBTA 1DE2A 4HEA2 1EZKA 1TRVA 5J41A 3QAGA 3KP8A 3QDNA 1PSQA 4L5LA 3M3MA 1CQHA 4ISDA 2H0GA 3CSIA 4YQMA 4OFTA 3A2WA 3QFAC 3GUSA 3QD9A 5HR0A 3GURA 2GZPA 3O3TA 1O8XA 3FHKA 4POBA 3CTGA 2XHFA 4XRDA 3GYKA 5J5NA 2YWIA 3LQ7A 2HZFA 3CRTA 1GLQA 3N9JA 1ERWA 2H1DA 4XS6A 2B5YA 2I4AA 4IN0A 1PX7A 3GA4A 3L9VA 1X5DA 4WF5A 3DRNA 2F9SA 3FR9A 4X43A 4DSRA 4RI6A 5CAXA 1T8EB 1QFNA 2NTOA 2A2RA 4K9ZA 2JADA 2ALBA 1TKDB 1QXHA 2C80A 1GSFA 4IS0A 3WGDA 1FAAA 3C7MA 2GSSA 1GUHA 1A2JA 2PBJA 4PQIA 1RK4A 3IE3A 2H6ZA 4WXTA 1ST9A 1V57A 2VCZA 3TJKA 1X0RA 4EE0A 2QKEA 4PURA 4TW5A 5DAKA 4MK3A 1TRWA 5GSSA 1UC7A 2HLSA 4ZL8A 2H74A 4LMVA 2D2ZA 4BWQA 3UVTA 4ZB8A 4ZIJA 4TXOA 2VLTA 2IIYA 3LJRA 4ZBAA 3NOFA 4TKYA 1YQ1A 2A4VA 4DSQA 5EVOA 1QQ2A 2AHEA 1DE1A 1JZWA 2V41A 4KGIA 3RHBA 1YY7A 2H72A 2IFQB 1ACVA 5ID2B 3QR6A 1SK1A 5JWRB 1OKTA 2XPDA 3TDGA 3PINA 4H86A 2B1KA 2C3QA 2H6YA 4EDYA 4KCEA 3E0UA 2VO4A 1VF4A 10GSA 2RUFA 3EVIA 2EIRA 2YN1A 1E6BA 2GLRA 3DVXA 4PUAA 2GQKA 4F2IA 6GSXA 1GRXA 4K7NA 4N10A 2LNTA 3IXRA 2IFQA 4MPGA 5H5QA 5ID2A 1FB0A 5DJMA 3APOA 4RI7A 3A2XA 1TTZA 2DLXA 4GF0A 2FHEA 4HQZA 2V2GA 4BL7A 3IPZA 1AC1A 3KJYA 4G2EA 1SJIA 2WFCA 2X99A 2IJYA 3GKMA 1AIUA 1MD4A 2OKAA 2B5EA 3HDCA 5J4UA 4AJ7A 1PL2A 2LV3A 2GZYA 4V1Ag 5ECPB 1E2YA 4JR6A 3H1NA 1T4YA 3ZYWA 5B6MA 2OADA 4I6XA 3M8NA 2CV4A 5A4UA 3LXTA 2HNLA 3MSZA 2OJLA 1MDJA 3BCIA 1ZYEA 1GUMA 3ZTLA 5B6NA 2H19A 3D6IA 3VWVA 2KOKA 5G1LA 3EU4A 2CX4A 1WOUA 5F07A 7GSSA 4ZILA 1A0FA 1Z6MA 1TRUA 2IMIA 3BBYA 1F3BA 2H0HA 3LYPA 3EWLA 1VF2A 5HQPA 4X1UA 3BCKA 2LRTA 4POMA 1EGOA 1Y25A 3HA9A 1BG5A 4AGSA 3GSTA 4OMVA 1YEXA 4HQSA 2DJ2A 5D8IA 1XOAA 2VD0A 5IMAA 1MEKA 1GUKA 4CDOA 3WD6A 3F6FA 5LNKe 1IYIA 4D73A 1LU4A 2P0GA 4GSNA 3IK9A 1X9SB 4RUVA 2O7KA 2WRTA 1M7TA 2DIZA 3EYTA 2F8FA 1TW9A 2L59A 3CSJA 4LMWA 2CAQA 2H73A 4MF6A 4ML6A 4Q5RA 1ERTA 4I5QA 5C04A 1PX6A 2XC2A 4IP1A 2TIRA 2C4JA 4X0XA 4K0NA 3WGEA 9GSSA 3LGCA 1K0NA 4MJBA 3M1GA 3ZMKA 1XPVA 4HOJA 1Q4JA 1V58A 22GSA 5DALB 2FNOA 2EIOA 2OE0A 1EGRA 4GXZA 1Z7RA 4ZXGA 3TJGA 4JEDA 4PNFA 4AJ6A 1JLVA 4ECBA 3LORA 1TDIA 1X5CA 3M0FA 3ED3A 2GGTA 1SYRA 2CX3A 1HNBA 4OWYA 5AISA 1V98A 3LEFA 4MF7A 4L8EA 3F6DA 1OC9B 4JBBA 5CNWA 3QMXA 5F05A 5KN2A 1G7EA 3EINA 3HXSA 4WEYA 1GSDA 4OFMA 3HJOA 2MYGA 3U6VA 1SL2B 2MMOA 1A23A 4ECCA 4HJMA 2VAFA 3FZ5A 3KP9A 1PQNA 2MBSA 4J2FA 2LNSA 4N0ZA 4HDEA 5ECLB 4XS4A 1J0FA 2YCDA 2DMLA 2HE3A 16GSA 1TK5B 4WR5A 1QMVA 3KH9A 1JHBA 4O5RA 4CW9A 2L5LA 5D9WA 2KHPA 1KNGA 4TR3A 2ES7A 2IWTA 1SKRB 2F8AA 4TXVA 1J9BA 4V2MA 4GLTA 4K6XA 1ILOA 3GV1A 3DGQA 2EC4A 1FHEA 1R4WA 2YV9A 2L4CA 1ZOFA 3TJBA 1NW2A 3IC4A 2IMKA 2NPBA 2LTKA 5IMZA 3HJPA 3TJJA 2CT6A 3GX0A 2C0FA 2TRXA 3WGXA 2B7JA 3EC3A 1I5GA 1ZCPA 4IW9A 3Q74A 2L4QA 4LL4B 3F0IA 1ABAA 2HT9A 5D9TA 2GQMA 1S3AA 1OE7A 3F4TA 3F4SA 1U3IA 4WKWA 1SKWB 1K3OA 3FZ4A 1XCCA 2PGTA 4WBRD 2OE3A 2GZZA 2PPTA 5J9CA 2AUVA 4GSSA 1K3YA 5EPFA 1IYHA 2LRNA 4V2LA 4NHZA 5DVBA 2ZCTA 1BX9A 2C3TA 1ZMAA 4K7OA 6GSYA 2E2GA 2VL2C 2P31A 3VURA 4EXJA 1TOFA 3ZITA 1QK8A 4IJIA 2H01A 2QGVA 2DC5A 3LYKA 3IDVA 2REMA 2WB9A 3I43A 1F6MC 1FG4A 1B48A 3Q6OA 2YV7A 5GZZB 2E0QA 5D9VA 2FCHA 1YKCA 3HKRA 3VI7A 2PERA 1YJ6A 2LUSA 1I9DA 4GRFA 4TR1A 2K6VA 3TB2A 5JWOB 4BVYA 2I1UA 1THXA 1UA5A 2GTUA 3FK8A 3D21A 5G31A 1JZDA 3C71A 4DSSB 4MPFA 4ML1A 6GSWA 1T4ZA 4QQ7A 5DDLA 4POKA 4MZWA 1JZOA 4L5OA 1X5EA 4YQUA 3ZL5A 1V2AA 5IMFA 5FHIA 3PR8A 3ERGA 3D4MA 1WPIA 2XBIA 5JWQB 1BJXA 3DIEA 2VM1A 3C73A 4G9HA 2V6KA 1N8JA 3HJMA 1EV4A 4NXIA 5HR2A 5ECKB 2DJ1A 2JU5A 1OYJA 2HSYA 1TI1A 2ZUPA 2H70A 4DSSA 4OO5A 2FWHA 3N5OA 2R6KA 1PKWA 4XCSA 1M0UA 3QAVA 3HVSA 8GSSA 5ECSA 3I9V2 2WJUA 2AAWA 5J3RA 1WRYA 3TKQA 2VLUA 4HZ4A 4PQ1A 3VWXA 1CQGA 2IMFA 3HZ4A 4IBPA 1HNAA 1RQMA 2WGRA 2LS5A 4MLYA 4KNDA 2H0IA 5ENUA 4Q5FA 4E8EA 4BWSA 3JCML 1GNWA 3KEBA 3UAPA 4OD7A 3UL3A 6GSVA 5IMVA 3TKSA 3DXBA 3OR5A 5IMCA 4ZL7A 1SU9A 2AYTA 1SKSB 1USBA 3D22A 2CQ9A 2GSQA 1WE0A 3M9JA 1PKZA 2IMEA 2PMTA 1TP9A 3E9JB 4N30A 1PD21 2I3YA 1TU7A 2VCTA 3C1RA 1Y6EA 4PX1A 4Q5NA 3KTBA 5B7CA 4YH2A 4YQVA 2VOCA 1U88A 2E7PA 1FVKA 2HI7A 2DIYA 4ZBDA 4IVFA 5G5FA 2PVQA 2L5OA 3RHCA 3GMFA 2L57A 5CYYA 1B9XC 3GRXA 4I97A 1EWXA 1Z6NA 4K0GA 17GSA 2WDUA 3L9SA 3KCMA 1FVJA 2H76A 3GN3A 4PUFC 3GX8A 2O87A 5IQYA 1TRSA 5B8AA 1EP7A 3UJ1A 3HHVA 2HXKA 1MDKA 1EEMA 3GKKA 4K1FA 4N0VA 5H5SA 4IJ3A 3J7Yb 4MZBA 5ECOB 2P5QA 2FWEA 2JZRA 1MD3A 5EY6A 5A5KA 1XIYA 1NHYA 3MWHA 3G9BA 3G7JA 20GSA 3W8JA 4KAEA 3H8QA 5DCHA 5COHA 1U87A 1S3DA 1H75A 3VK9A 3FR3A 3KTLA 11GSA 3MDKA 3QPMA 1MTCA 5D96A 3SBCA 3IBHA 2O8VB 1FB6A 2YANA 3D4TA 5CRDA 1FOVA 5JCUA 5CRWA 3C1SA 3H79A 2FUG2 1O6JA 1QUWA 4NPBA 1AQXA 1NHOA 1RW1A 1TXXA 4IP6A 1ZZYA 4KSMA 1T3BA 4LA1A 4MJAA 4EL1A 3US3A 3ERWA 1PA3A 4P3YB 3P2AA 2GS3A 5ELAA 1O81A 4NHWA 5HFKA 19GSA 3IHQA 5IOWA 2H30A 1GSQA 4KW6A 3VWUA 3FW2A 4XIHA 2YWOA 2OA7A 4F0BA 4MJEA 5D73A 3WT2A 2MMNA 1Q98A 1T00A 1GWCA 3O6TA 2X8CA 2C0DA 3DVWA 4KSOA 4L0UA 1OVNA 5HFGA 2OE1A 4ZL9A 1UN2A 1TI3A 2MMAA 4KDXA 1R5AA 2CVKA 1PN9A 4DEJA 3HVXA 2CZ2A 4XTSA 1JZRA 2VM2A 3CYNA 1AUCA 1SK0A 1JLWA 3IAM2 3IOSA 4KDUA 4MDCA 1HYUA 5LCZA 4K2DA 4K8MA 18GSA 2CVBA 4HUAA 3G7IA 2RLIA 2VL3A 5CO3A 3PGTA 4EDZA 4HI7A 4WF4A 2O85A 2NVLA 3APQA 2F51A 4JU5A 2FA4A 3FRCA 2KP1A 4QL7A 4TR4A 5L71A 2CA8A 4KCAA 2VIMA 1YEPA 2L6CA 1XW6A 1C72A 5G5EA 1A2MA 3CRUA 2CVDA 3DD3A 3WYWA 4EF0A 5DALA 1K0DA 1XXUA 4PNGA 3QFBC 4TVEA 2MZCA 4NV5A 2GVPA 1WMJA 3A2VA 3KD0A 3RAZA 2HZEB 4MMMA 1SL0B 2BTOT 1GSYA 2DJJA 3TRPA 2FD3A 4IELA 3J7Yk 2BJXA 3ZFBA 3KMOA 1M2AA 2G0FA 3ISOA 3CMIA 4ZB9A 3W6GA 1LJRA 2WZ9A 1OC9A 2BMXA 1AQWA 2JL4A 1GSSA 2J23A 5JCGA 2K18A 3UIWA 2PWJA 2H66A 1ERVA 3VI5A 3P90A 1B4PA 1MDIA 3O76A 4IGJA 1HD2A 1V40A 3UOMA 1URMA 1WWJA 2R2JA 2N5FA 5H5RA 3FZ9A 4F03A 5KN1A 4Z7XA 4IQ1A 5HR3A 2RIIA 2LKUA 2WS2A 2KLXA 5KEJA 3GSSA 1F3AA 1OC8A 1Z7PA 1OE8A 2J9HA 1GULA 2FLSA 4NV2A 4RQRA 2PUKC 2H71A 1ZL9A 5CRGA 2ON5A 4GTUA 3GKXA 4O7HA 4XS1A 4GQCA 2LQOA 3V1WA 3GFKA 1FO5A 2R4VA 3I6AA 3IRAA 1K0BA 2EIQA 3F9UA 1PL1A 1VF3A 3KXOA 3NIVA 1N2AA 2AJQB 3DKSA 4MF5A 4JE1A 1AQVA 2LEGA 4O32A 5ECNB 5DJLA 1WP0A 3KIJA 2Z9SA 5HFIA 5G30A 2AV4A 3ZRDA 3TKSE 2GDRA 2YWNA 4GQFA 1K0AA 4OO4A 2N5BA 3LG6A 2YOIA 3P7XA 2C0EA 5IMDA 4MP4A 1O8WA 5E59A 1ON4A 1YF1A 4G10A 1XVWA 3ME7A 3ZIVA 1A2LA 3F8UA 1XVQA 5J9BA 2IPAA 4PQHA 2OBKA 4WBJA 1G0TA 4N11A 2RM5A 2LJKA 2K9FA 2H1BA 2I81A 1XWAA 5ECHB 1JFUA 2JZSA 5G1KA 4EO3A 1S3CA 2HRNA 2JACA 3IR4A 1OKDA 2R3XA 5ECMB 3GL5A 3KH7A 3FY7A 3FR6A 3VWWA 1GTAA 4MA9A 4HU7A 2MMZA 1XW5A 3HYPA 4ZBBA 4IKHA 4BVXA 1GTBA 4ACSA 1SJZA 1VF1A 2B1LA 3ME8A 4ID0A 2GT5A 1F9MA 2PU9C 3BOAA 2IMDA 2RM6A 2VUPA 1BYEA 3ZMLA 4ECIA 1NM3A 3UBLA 4CHSA 1SK2A 3VPQA 2OBIA 1SD8A 1EP8A 2H75A 3Q19A 2F3MA 4WR4A 2XBQA 3FYGA 2C8UA 2I9HA 4FYUA 3DWVA 3HVVA 3LXZA 2YJ7A 2QSIA 3FKFA 3EU3A 3RPPA 1F37A 4NWYA 3L78A 1GSUA 4ZB6A 1SJ6A 1M2DA 1R7HA 5KN0A 1G6WA 3UARA 3GHAA 1XWGA 1H4OA 1EOHA 2YZHA 5D9XA 4O92A 2H1GA 1QGVA 2DJ0A 3PH9A 3MNGA 3GH6A 4I8BA 1OAZA 2MBTA 1ZYQB 2GT6A 4MABA 1A24A 2V32A 3P8WA 3K8NA 2H6XA 4K7IA 5DAKB 1EEJA 1GTUA 1AAZA 1DUGA 1LBKA 2M72A 6GSUA 1Z9HA 2VCVA 3EE2A 4TXOB 1AW9A 4MH3A 3D0ZA 2LJAA 4YAVA 4KX4A 2C1YA 3TKPA
chains in the Genus database with same CATH superfamily
4PGTA 3AY8A 4BPYA 1M9BA 1K0MA 3R2QA 4YAPA 3VFIA 4O5UA 1NSWA 3VLNA 4KA0A 4GWRA 2UZ8A 1XZOA 3UEMA 5DQSA 3ZREA 5C00A 3TKSC 1B9YC 2VCXA 1YF0A 5LD0A 1O85A 2L6DA 1SYXA 5B8BA 4ILFA 1BQ7A 5GSTA 5F06A 1B4QA 4TRXA 4XRAA 1KEBA 4HU9A 3ZIJA 3RPNA 5DQYA 5D93A 2CZ3A 3G7YA 5G2ZA 12GSA 1PFOA 3EURA 4F0CA 5A4VA 1F2EA 4K2XA 1SL1B 4PXOA 2K8VA 1THOA 1U3AA 1HQOA 2IL3A 3LSZA 2R5GA 3IK7A 1GSEA 2VLVA 1TK8B 4EC0A 3UVHA 1Z3EA 3GL3A 1UVZA 3UBKA 5DCGA 1AXDA 1VGLA 2R0CA 4EUYA 2V6OA 4GSTA 3KGKA 4O5QA 5CP1A 3HD5A 1ERUA 1V9WA 3VPTA 1GP1A 4LL1B 5IO2A 3DYRA 2FWGA 4KUNA 4X4JA 4JRRA 4OCEA 1FOHA 2E2MA 3FMWA 2KUCA 4I2UA 4G19A 3ZFLA 4BIKA 2LSTA 3FZAA 4ULXA 2X64A 3E3EA 2C3NA 2HYXA 3M9KA 3L9UA 4AF2A 4CY8A 5ECQB 1GLPA 1M99A 3W8SA 5A4WA 1VRSD 5EL8A 3TJFA 1W4VA 2GSRA 4Q5QA 1WIKA 1K0OA 3CSHA 4D73B 3IA1A 2FA8A 2NBSA 3QOUA 4WETA 4JZQA 5IOXA 2PN8A 1O73A 1B8XA 4KDYA 5FWGA 4FYCA 3TCOA 3ZZXA 3F3RA 5IO0A 6GSSA 2VCWA 5DBQA 2AB6A 2LQQA 2V1MA 5CREA 1WJKA 2OACA 2FWFA 5FT3A 4TR0A 2WULA 4FH8A 1XWBA 3S9FA 3RDWA 2G2QA 4RQXA 1HNCA 1YZXA 3GNJA 4IQAA 3LWAA 1BAYA 1W89A 4NAXA 3SWLA 1PMTA 4J56E 5IPGA 2FGXA 1Z5YE 3BJ5A 4KH7A 3A5WA 4OFNA 5F0GA 3TRXA 2A2SA 3LFLA 3EMXA 2X8HA 4F9ZA 3H4KA 4QL9A 4MJCA 5AGYA 3KMNA 1A0RP 1K0CA 2GQLA 5F8BA 4GCIA 5CRHA 4IHUA 2CAIA 1O7UA 1PRXA 3I69A 4ECJA 3GIXA 3U5RE 3TRQA 4HS1A 1FW1A 3DEXA 5IIZA 2JSYA 3MAKA 4MCUA 4L0WA 5ECRB 1DBYA 3TOTA 2XPEA 2YNXA 4G0LA 2YP6A 14GSA 5GAPD 4XS4B 2NDOA 2ZNMA 1EOGA 2WCIA 5INYA 1GL8A 1XBSA 2JSZA 3HY2A 1DSBA 2LJRA 3APSA 2RUEA 2R37A 1YDKA 2TRCP 3C8EA 3R3EA 3ZVJD 2K8SA 5KN3A 4HZ2A 2DJ3A 2VD1A 2YWMA 2H1AA 4F82A 3QCPA 2HRFA 3F3QA 3IAS2 2JZTA 2IN3A 5JCWA 2PVOC 3IV4A 1SD9A 4TOPA 2HZEA 4MH2A 3DMLA 4AJ8A 4E8HA 1XWCA 3D5JA 1ML6A 4V2NA 1XWKA 2HSHA 1GNEA 4TN8A 2B3SA 1X9WB 1R5PA 1J08A 2H8LA 1A8YA 3CTFA 1G6YA 5ABRA 3ZLPA 1T7PB 3GKNA 4KB3A 2P5RA 3FEUA 4V1Ap 3GTUB 4I2TA 3GH9A 1XOBA 1S3RA 1BEDA 3F4RA 1A8LA 2B7KA 3Q18A 4OCFA 4FIWA 1XFLA 1SENA 2KP2A 2QC7A 2DMMA 5IM9A 5IPHA 2FY6A 2GSTA 2DJKA 4FO5A 1ZGNA 5HR1A 4BA7A 1OC3A 2M80A 3A5IA 1TK0B 4FYBA 13GSA 3CBUA 4EKZA 1TU8A 3ERFA 1GH2A 3GTUA 4POLA 2B6MA 3F63A 3TKRA 4KE3A 3KZQA 2YJHA 2DSAA 1KTEA 5AIXA 4J57E 1R26A 1GTIA 1XW9A 5E4WA 3TOUA 2O89A 2DBCA 5AIVA 3HZ8A 5ELGA 3ZVJA 3KM6A 1G7OA 2VL2A 4NMUA 4DVCA 2VL9A 3CXGA 1T1VA 3UMAA 3BD2A 3QAWA 2C0GA 2B5XA 6GSTA 3NZNA 2YPMA 2N5AA 1M9AA 1X9MB 3EMPA 5BRTA 2HFDA 5ECIB 2M46A 4TR1B 3H93A 2VCQA 1PGTA 2ON7A 4EVMA 1EV9A 3L4NA 4LLRA 3L0HA 5AN1A 3TGZA 4MZCA 4XHMA 1TJDA 2LRCA 1K3LA 1YKAA 2X8GA 1M2BA 3HCZA 3TUEA 5GAND 1KBNA 4JR4A 1U6TA 2YZUA 4HJ2A 3WT1A 3A3TA 3RBTA 1DE2A 4HEA2 1EZKA 1TRVA 5J41A 3QAGA 3KP8A 3QDNA 1PSQA 4L5LA 3M3MA 1CQHA 4ISDA 2H0GA 3CSIA 4YQMA 4OFTA 3A2WA 3QFAC 3GUSA 3QD9A 5HR0A 3GURA 2GZPA 3O3TA 1O8XA 3FHKA 4POBA 3CTGA 2XHFA 4XRDA 3GYKA 5J5NA 2YWIA 3LQ7A 2HZFA 3CRTA 1GLQA 3N9JA 1ERWA 2H1DA 4XS6A 2B5YA 2I4AA 4IN0A 1PX7A 3GA4A 4FQUA 3L9VA 1X5DA 4WF5A 3DRNA 4EIPA 2F9SA 3FR9A 4X43A 4DSRA 4RI6A 5CAXA 1T8EB 1QFNA 2NTOA 2A2RA 4K9ZA 2JADA 2ALBA 1TKDB 1QXHA 2C80A 1GSFA 4IS0A 3WGDA 1FAAA 3C7MA 2GSSA 1GUHA 1A2JA 2PBJA 4PQIA 1RK4A 3IE3A 2H6ZA 4WXTA 1ST9A 1V57A 2VCZA 3TJKA 3MYDA 1X0RA 4EE0A 2QKEA 4PURA 4TW5A 5DAKA 4MK3A 1TRWA 5GSSA 1UC7A 2HLSA 4ZL8A 2H74A 4LMVA 2D2ZA 4BWQA 3UVTA 4ZB8A 4ZIJA 4TXOA 2VLTA 2IIYA 3LJRA 4ZBAA 3NOFA 4TKYA 1YQ1A 2A4VA 4DSQA 4K5SA 5EVOA 1QQ2A 2AHEA 1DE1A 1JZWA 2V41A 4KGIA 3RHBA 1YY7A 2H72A 2IFQB 1ACVA 5ID2B 3QR6A 1SK1A 5JWRB 1OKTA 2XPDA 3TDGA 3PINA 4H86A 2B1KA 2C3QA 2H6YA 4EDYA 4BL7B 4KCEA 3E0UA 2VO4A 1VF4A 4KF9A 10GSA 2RUFA 3EVIA 2EIRA 2YN1A 1E6BA 2GLRA 3DVXA 4PUAA 2GQKA 4F2IA 6GSXA 1GRXA 4K7NA 4N10A 2LNTA 3IXRA 2X4AA 2IFQA 4MPGA 5H5QA 5ID2A 1FB0A 5DJMA 3APOA 4RI7A 3A2XA 1TTZA 2DLXA 4GF0A 2FHEA 4HQZA 2V2GA 4BL7A 3IPZA 1AC1A 3KJYA 4G2EA 1SJIA 2WFCA 2X99A 2IJYA 3GKMA 1AIUA 1MD4A 2OKAA 4A5PA 2B5EA 3HDCA 5J4UA 4AJ7A 1PL2A 2LV3A 2GZYA 4V1Ag 5ECPB 1E2YA 4JR6A 3H1NA 1T4YA 3ZYWA 5B6MA 2OADA 4I6XA 3M8NA 2CV4A 5A4UA 3LXTA 2HNLA 3MSZA 2OJLA 1MDJA 3BCIA 1ZYNA 1ZYEA 1GUMA 3ZTLA 5B6NA 2H19A 3D6IA 3VWVA 2KOKA 5G1LA 3EU4A 2CX4A 1WOUA 5F07A 7GSSA 2QA1A 4ZILA 1A0FA 1Z6MA 1TRUA 2IMIA 3BBYA 1F3BA 2H0HA 3LYPA 3EWLA 1VF2A 5HQPA 4X1UA 3BCKA 2LRTA 4POMA 1EGOA 1Y25A 3HA9A 1BG5A 4AGSA 3GSTA 4OMVA 1YEXA 4HQSA 2DJ2A 5D8IA 1XOAA 2VD0A 5IMAA 1MEKA 1GUKA 4CDOA 3WD6A 3F6FA 5LNKe 1IYIA 4D73A 1LU4A 2P0GA 4GSNA 3IK9A 1X9SB 4RUVA 2O7KA 2WRTA 1M7TA 2DIZA 3EYTA 4Z2UA 2F8FA 1TW9A 2L59A 3CSJA 4LMWA 2CAQA 2H73A 4MF6A 4ML6A 4Q5RA 1ERTA 4I5QA 5C04A 1PX6A 2XC2A 4IP1A 2TIRA 2C4JA 4X0XA 4K0NA 3WGEA 9GSSA 3LGCA 1K0NA 4MJBA 3M1GA 3ZMKA 1XPVA 4HOJA 1Q4JA 1V58A 22GSA 5DALB 2FNOA 2EIOA 2OE0A 1EGRA 4GXZA 1Z7RA 4ZXGA 3TJGA 4JEDA 4PNFA 4AJ6A 1JLVA 4ECBA 3LORA 1TDIA 1X5CA 3M0FA 3ED3A 2GGTA 1SYRA 2CX3A 1HNBA 4OWYA 5AISA 1V98A 3LEFA 4MF7A 4L8EA 3F6DA 1OC9B 4JBBA 5CNWA 3QMXA 5F05A 5KN2A 1G7EA 3EINA 3HXSA 4WEYA 1GSDA 4OFMA 3HJOA 2MYGA 3U6VA 1SL2B 2MMOA 1A23A 4ECCA 4HJMA 2VAFA 3EPTA 3FZ5A 3KP9A 1PQNA 2MBSA 4J2FA 2LNSA 4N0ZA 4HDEA 5ECLB 4XS4A 1J0FA 2YCDA 2DMLA 2HE3A 16GSA 1TK5B 4WR5A 1QMVA 3KH9A 1JHBA 4O5RA 4ICYA 4CW9A 2L5LA 5D9WA 2KHPA 4G0KA 1KNGA 3HVNA 4TR3A 2ES7A 2IWTA 1SKRB 2F8AA 4TXVA 1J9BA 4V2MA 4GLTA 4K6XA 1ILOA 3GV1A 3DGQA 2EC4A 1FHEA 1R4WA 2YV9A 2L4CA 1ZOFA 3TJBA 1NW2A 3IC4A 2IMKA 2NPBA 2LTKA 5IMZA 3HJPA 3TJJA 2CT6A 3GX0A 2C0FA 4MNNA 2TRXA 3WGXA 2B7JA 3EC3A 1I5GA 1ZCPA 4IW9A 3Q74A 2L4QA 4LL4B 3F0IA 1ABAA 2HT9A 5D9TA 2GQMA 1S3AA 1OE7A 3F4TA 3F4SA 1U3IA 4PTSA 4WKWA 1SKWB 1K3OA 3FZ4A 1XCCA 2PGTA 4WBRD 2OE3A 2GZZA 2PPTA 5J9CA 2AUVA 4GSSA 1K3YA 5EPFA 2HSMA 1IYHA 2LRNA 4V2LA 4NHZA 5DVBA 2ZCTA 1BX9A 2C3TA 1ZMAA 4K7OA 6GSYA 2E2GA 2VL2C 2P31A 3VURA 4EXJA 1TOFA 3ZITA 1QK8A 4IJIA 2H01A 4BVYB 2QGVA 4CY6A 2DC5A 4BVXB 3LYKA 3IDVA 2R0GA 2REMA 2WB9A 3I43A 1F6MC 1FG4A 1B48A 3Q6OA 4YKFA 2YV7A 5GZZB 2E0QA 5D9VA 2FCHA 1YKCA 3HKRA 3VI7A 2PERA 1YJ6A 2LUSA 1I9DA 4GRFA 4TR1A 2K6VA 3TB2A 5JWOB 4BVYA 2I1UA 1THXA 1UA5A 2GTUA 3FK8A 3D21A 5G31A 1JZDA 3C71A 4DSSB 4MPFA 4ML1A 6GSWA 1T4ZA 4QQ7A 5DDLA 4POKA 4MZWA 1JZOA 4L5OA 1X5EA 4YQUA 3ZL5A 1V2AA 5IMFA 5FHIA 3PR8A 3ERGA 3D4MA 1WPIA 2XBIA 4G0IA 5JWQB 1BJXA 3DIEA 3IC8A 2VM1A 3C73A 3PPUA 4G9HA 2V6KA 1N8JA 3HJMA 1EV4A 4NXIA 5HR2A 5ECKB 2DJ1A 2JU5A 1OYJA 2HSYA 1TI1A 2ZUPA 2H70A 4DSSA 1PN0A 2DKIA 4OO5A 2FWHA 3N5OA 2R6KA 1PKWA 4XCSA 1M0UA 3QAVA 3HVSA 8GSSA 5KOXA 1XG8A 5ECSA 3I9V2 2WJUA 2AAWA 5J3RA 1WRYA 3TKQA 2VLUA 4HZ4A 4PQ1A 3VWXA 1CQGA 2IMFA 3HZ4A 4IBPA 1HNAA 1RQMA 2WGRA 2LS5A 4MLYA 4KNDA 2H0IA 5ENUA 4Q5FA 4E8EA 4BWSA 3JCML 1GNWA 3KEBA 3UAPA 4OD7A 3UL3A 6GSVA 5IMVA 3TKSA 3DXBA 3OR5A 5IMCA 4ZL7A 1SU9A 2AYTA 1SKSB 1USBA 3D22A 2CQ9A 2GSQA 1WE0A 2A4HA 2HRAA 3M9JA 1PKZA 2IMEA 2PMTA 1TP9A 3E9JB 4N30A 1PD21 2I3YA 1TU7A 2VCTA 3C1RA 1Y6EA 4PX1A 4Q5NA 3KTBA 5B7CA 4YH2A 4YQVA 2VOCA 1U88A 2E7PA 1FVKA 2HI7A 2DIYA 4ZBDA 4IVFA 5G5FA 2PVQA 2L5OA 3RHCA 3GMFA 2L57A 5CYYA 1B9XC 3GRXA 4I97A 1EWXA 1Z6NA 4K0GA 3LW9A 17GSA 2WDUA 3L9SA 3KCMA 1FVJA 2H76A 3GN3A 4PUFC 3GX8A 2O87A 5IQYA 1TRSA 5B8AA 1EP7A 3UJ1A 3HHVA 2HXKA 1MDKA 1EEMA 3GKKA 4K1FA 4N0VA 5H5SA 4IJ3A 3J7Yb 4MZBA 5ECOB 2P5QA 2FWEA 2JZRA 2QA2A 1MD3A 5EY6A 5A5KA 1XIYA 1NHYA 3MWHA 3G9BA 3G7JA 20GSA 3W8JA 4KAEA 3H8QA 5COHA 1U87A 5DCHA 1S3DA 1H75A 3VK9A 3FR3A 3KTLA 11GSA 3MDKA 3QPMA 1MTCA 1ZYPA 5D96A 3SBCA 3IBHA 2O8VB 1FB6A 2YANA 3D4TA 5CRDA 1FOVA 5JCUA 5CRWA 3C1SA 3H79A 2FUG2 1O6JA 1QUWA 4NPBA 1AQXA 1NHOA 1RW1A 1TXXA 4IP6A 1ZZYA 4KSMA 1T3BA 4LA1A 4MJAA 4EL1A 3US3A 3ERWA 1PA3A 4P3YB 3P2AA 2GS3A 5ELAA 1O81A 4NHWA 5HFKA 19GSA 3IHQA 5IOWA 2H30A 1GSQA 4KW6A 2R0PA 3VWUA 3FW2A 4XIHA 2YWOA 2OA7A 4F0BA 4MJEA 5D73A 3WT2A 2MMNA 1Q98A 1T00A 1GWCA 3O6TA 2X8CA 2C0DA 3DVWA 5BMUA 4KSOA 4L0UA 1OVNA 5HFGA 2OE1A 4ZL9A 1UN2A 1TI3A 2MMAA 4KDXA 1R5AA 2CVKA 1PN9A 4DEJA 3HVXA 2CZ2A 4XTSA 1JZRA 2VM2A 3CYNA 1AUCA 1SK0A 1JLWA 3IAM2 3IOSA 4KDUA 2DKHA 4MDCA 1HYUA 5LCZA 4K2DA 4K8MA 18GSA 2CVBA 4HUAA 3G7IA 2RLIA 2VL3A 5CO3A 3PGTA 4EDZA 4USSA 4HI7A 4WF4A 2O85A 2NVLA 3APQA 2F51A 4JU5A 2FA4A 3FRCA 2KP1A 4QL7A 4TR4A 5L71A 2CA8A 4KCAA 2VIMA 1YEPA 2L6CA 1XW6A 1C72A 5G5EA 1A2MA 3CRUA 2CVDA 3DD3A 3WYWA 4EF0A 5DALA 1K0DA 1XXUA 4PNGA 3QFBC 4TVEA 4EIQA 2MZCA 4NV5A 2GVPA 1WMJA 3A2VA 3KD0A 3RAZA 2HZEB 4MMMA 1SL0B 2BTOT 1GSYA 2DJJA 3TRPA 2FD3A 4IELA 3J7Yk 2BJXA 3ZFBA 3KMOA 1M2AA 2G0FA 3ISOA 3IHGA 3CMIA 4ZB9A 3W6GA 1LJRA 2WZ9A 1OC9A 2BMXA 1AQWA 2JL4A 1GSSA 2J23A 5JCGA 2K18A 3UIWA 2PWJA 2H66A 1ERVA 3VI5A 3P90A 1B4PA 1MDIA 3O76A 4IGJA 1HD2A 1V40A 3UOMA 1M3IA 1URMA 1WWJA 2R2JA 2N5FA 5H5RA 4Z2TA 2A2PA 3FZ9A 4F03A 5KN1A 4Z7XA 4IQ1A 5HR3A 2RIIA 2LKUA 2WS2A 2KLXA 5KEJA 3GSSA 1F3AA 1OC8A 1Z7PA 1OE8A 2J9HA 1GULA 2FLSA 4NV2A 4RQRA 2PUKC 2H71A 1ZL9A 5CRGA 2ON5A 4GTUA 3GKXA 4YKGA 4O7HA 4XS1A 4GQCA 2LQOA 3V1WA 3GFKA 1FO5A 2R4VA 3I6AA 3IRAA 1K0BA 2EIQA 3F9UA 1PL1A 1VF3A 3KXOA 3NIVA 1N2AA 2AJQB 3DKSA 4MF5A 4JE1A 1AQVA 2LEGA 4O32A 5ECNB 5DJLA 1WP0A 3KIJA 2Z9SA 5HFIA 5G30A 2AV4A 3ZRDA 3TKSE 2GDRA 2YWNA 4GQFA 1K0AA 4OO4A 2N5BA 3LG6A 2YOIA 3P7XA 2C0EA 5IMDA 4MP4A 1O8WA 5E59A 1ON4A 1YF1A 4G10A 4HSCX 1XVWA 3ME7A 3ZIVA 1A2LA 3F8UA 1XVQA 5J9BA 2IPAA 4PQHA 2OBKA 4WBJA 1G0TA 4N11A 2RM5A 2LJKA 2K9FA 2H1BA 4Z2RA 2I81A 1XWAA 5ECHB 1JFUA 2JZSA 5G1KA 4EO3A 1S3CA 2HRNA 2JACA 3IR4A 1OKDA 2R3XA 5ECMB 3GL5A 3CQFA 3KH7A 3FY7A 3FR6A 3VWWA 1GTAA 4MA9A 4HU7A 4K5RA 2MMZA 1XW5A 3HYPA 4ZBBA 4IKHA 4BVXA 1GTBA 4ACSA 1SJZA 1VF1A 2B1LA 3ME8A 4ID0A 2GT5A 1F9MA 2PU9C 3BOAA 5KOWA 2IMDA 2RM6A 2VUPA 1BYEA 3ZMLA 4ECIA 1NM3A 3UBLA 4CHSA 1SK2A 3VPQA 2OBIA 1SD8A 1EP8A 2H75A 3Q19A 2F3MA 4WR4A 2XBQA 3FYGA 2C8UA 2I9HA 2HRKA 4FYUA 3DWVA 3HVVA 3LXZA 2YJ7A 1M3JA 2QSIA 3FKFA 3EU3A 3RPPA 1F37A 4NWYA 3L78A 1GSUA 4ZB6A 1SJ6A 1M2DA 1R7HA 5KN0A 1G6WA 3UARA 3GHAA 1XWGA 1H4OA 1EOHA 2YZHA 5D9XA 4O92A 2H1GA 1QGVA 2DJ0A 3PH9A 3MNGA 3GH6A 4I8BA 1OAZA 2MBTA 1ZYQB 2GT6A 4MABA 1A24A 2V32A 3P8WA 3K8NA 2H6XA 4K7IA 5DAKB 1EEJA 1GTUA 1AAZA 1DUGA 1LBKA 2M72A 6GSUA 1Z9HA 2VCVA 3EE2A 4TXOB 1AW9A 4MH3A 2X49A 3D0ZA 2LJAA 4YAVA 4KX4A 3MIXA 2C1YA 3TKPA
chains in the Genus database with same CATH topology
4PGTA 3AY8A 4BPYA 1M9BA 1K0MA 3R2QA 4YAPA 3VFIA 4O5UA 1NSWA 3VLNA 4KA0A 4GWRA 2UZ8A 1XZOA 3UEMA 5DQSA 3ZREA 5C00A 3TKSC 1B9YC 2VCXA 1YF0A 5LD0A 1O85A 2L6DA 1SYXA 5B8BA 4ILFA 1BQ7A 5GSTA 5F06A 1B4QA 4TRXA 4XRAA 1KEBA 4HU9A 3ZIJA 3RPNA 5DQYA 5D93A 2CZ3A 3G7YA 5G2ZA 12GSA 3EURA 4F0CA 5A4VA 1F2EA 4K2XA 1SL1B 4PXOA 2K8VA 1THOA 1U3AA 1HQOA 2IL3A 3LSZA 2R5GA 3IK7A 1GSEA 2VLVA 1TK8B 4EC0A 3UVHA 1Z3EA 3GL3A 1UVZA 3UBKA 5DCGA 1AXDA 1VGLA 2R0CA 4EUYA 2V6OA 4GSTA 3KGKA 4O5QA 5CP1A 3HD5A 1ERUA 1V9WA 3VPTA 1GP1A 4LL1B 5IO2A 3DYRA 2FWGA 4KUNA 4X4JA 4JRRA 4OCEA 1FOHA 2E2MA 3FMWA 2KUCA 4I2UA 4G19A 3ZFLA 2LSTA 3FZAA 4ULXA 2X64A 3E3EA 2C3NA 2HYXA 3M9KA 3L9UA 4AF2A 4CY8A 5ECQB 1GLPA 1M99A 3W8SA 5A4WA 1VRSD 5EL8A 3TJFA 1W4VA 2GSRA 4Q5QA 1WIKA 1K0OA 3CSHA 4D73B 3IA1A 2FA8A 2NBSA 3QOUA 4WETA 4JZQA 5IOXA 2PN8A 1O73A 1B8XA 4KDYA 5FWGA 4FYCA 3TCOA 3ZZXA 3F3RA 5IO0A 6GSSA 2VCWA 5DBQA 2AB6A 2LQQA 2V1MA 5CREA 1WJKA 2OACA 2FWFA 5FT3A 4TR0A 2WULA 4FH8A 1XWBA 3S9FA 3RDWA 2G2QA 4RQXA 1HNCA 1YZXA 3GNJA 4IQAA 3LWAA 1BAYA 1W89A 4NAXA 3SWLA 1PMTA 4J56E 5IPGA 2FGXA 1Z5YE 3BJ5A 4KH7A 3A5WA 4OFNA 5F0GA 3TRXA 2A2SA 3LFLA 3EMXA 2X8HA 4F9ZA 3H4KA 4QL9A 4MJCA 5AGYA 3KMNA 1A0RP 1K0CA 2GQLA 5F8BA 4GCIA 5CRHA 4IHUA 2CAIA 1O7UA 1PRXA 3I69A 4ECJA 3GIXA 3U5RE 3TRQA 4HS1A 1FW1A 3DEXA 5IIZA 2JSYA 3MAKA 4MCUA 4L0WA 5ECRB 1DBYA 3TOTA 2XPEA 2YNXA 4G0LA 2YP6A 14GSA 5GAPD 4XS4B 2NDOA 2ZNMA 1EOGA 2WCIA 5INYA 1GL8A 1XBSA 2JSZA 3HY2A 1DSBA 2LJRA 3APSA 2RUEA 2R37A 1YDKA 2TRCP 3C8EA 3R3EA 3ZVJD 2K8SA 5KN3A 4HZ2A 2DJ3A 2VD1A 2YWMA 2H1AA 4F82A 3QCPA 2HRFA 3F3QA 3IAS2 2JZTA 2IN3A 5JCWA 2PVOC 3IV4A 1SD9A 4TOPA 2HZEA 4MH2A 3DMLA 4AJ8A 4E8HA 1XWCA 3D5JA 1ML6A 4V2NA 1XWKA 2HSHA 1GNEA 4TN8A 2B3SA 1X9WB 1R5PA 1J08A 2H8LA 1A8YA 3CTFA 1G6YA 5ABRA 3ZLPA 1T7PB 3GKNA 4KB3A 2P5RA 3FEUA 4V1Ap 3GTUB 4I2TA 3GH9A 1XOBA 1BEDA 3F4RA 1A8LA 2B7KA 3Q18A 4OCFA 4FIWA 1XFLA 1SENA 2KP2A 2QC7A 2DMMA 5IM9A 5IPHA 2FY6A 2GSTA 2DJKA 4FO5A 1ZGNA 5HR1A 4BA7A 1OC3A 2M80A 3A5IA 1TK0B 4FYBA 13GSA 3CBUA 4EKZA 1TU8A 3ERFA 1GH2A 3GTUA 4POLA 2B6MA 3F63A 3TKRA 4KE3A 3KZQA 2YJHA 2DSAA 1KTEA 5AIXA 4J57E 1R26A 1GTIA 1XW9A 5E4WA 3TOUA 2O89A 2DBCA 5AIVA 3HZ8A 5ELGA 3ZVJA 3KM6A 1G7OA 2VL2A 4NMUA 4DVCA 2VL9A 3CXGA 1T1VA 3UMAA 3BD2A 3QAWA 2C0GA 2B5XA 6GSTA 3NZNA 2YPMA 2N5AA 1M9AA 1X9MB 3EMPA 5BRTA 2HFDA 5ECIB 2M46A 4TR1B 3H93A 2VCQA 1PGTA 2ON7A 4EVMA 1EV9A 3L4NA 4LLRA 3L0HA 5AN1A 3TGZA 4MZCA 4XHMA 1TJDA 2LRCA 1K3LA 1YKAA 2X8GA 1M2BA 3HCZA 3TUEA 5GAND 1KBNA 4JR4A 1U6TA 2YZUA 4HJ2A 3WT1A 3A3TA 3RBTA 1DE2A 4HEA2 1EZKA 1TRVA 5J41A 3QAGA 3KP8A 3QDNA 1PSQA 4L5LA 3M3MA 1CQHA 4ISDA 2H0GA 3CSIA 4YQMA 4OFTA 3A2WA 3QFAC 3GUSA 3QD9A 5HR0A 3GURA 2GZPA 3O3TA 1O8XA 3FHKA 4POBA 3CTGA 2XHFA 4XRDA 3GYKA 5J5NA 2YWIA 3LQ7A 2HZFA 3CRTA 1GLQA 3N9JA 1ERWA 2H1DA 4XS6A 2B5YA 2I4AA 4IN0A 1PX7A 3GA4A 4FQUA 3L9VA 1X5DA 4WF5A 3DRNA 4EIPA 2F9SA 3FR9A 4X43A 4DSRA 4RI6A 5CAXA 1T8EB 1QFNA 2NTOA 2A2RA 4K9ZA 2JADA 2ALBA 1TKDB 1QXHA 2C80A 1GSFA 4IS0A 3WGDA 1FAAA 3C7MA 2GSSA 1GUHA 1A2JA 2PBJA 4PQIA 1RK4A 3IE3A 2H6ZA 4WXTA 1ST9A 1V57A 2VCZA 3TJKA 3MYDA 1X0RA 4EE0A 2QKEA 4PURA 4TW5A 5DAKA 4MK3A 1TRWA 5GSSA 1UC7A 2HLSA 4ZL8A 2H74A 4LMVA 2D2ZA 4BWQA 3UVTA 4ZB8A 4ZIJA 4TXOA 2VLTA 2IIYA 3LJRA 4ZBAA 3NOFA 4TKYA 1YQ1A 2A4VA 4DSQA 4K5SA 5EVOA 1QQ2A 2AHEA 1DE1A 1JZWA 2V41A 4KGIA 3RHBA 1YY7A 2H72A 2IFQB 1ACVA 5ID2B 3QR6A 1SK1A 5JWRB 1OKTA 2XPDA 3TDGA 3PINA 4H86A 2B1KA 2C3QA 2H6YA 4EDYA 4BL7B 4KCEA 3E0UA 2VO4A 1VF4A 4KF9A 10GSA 2RUFA 3EVIA 2EIRA 2YN1A 1E6BA 2GLRA 3DVXA 4PUAA 2GQKA 4F2IA 6GSXA 1GRXA 4K7NA 4N10A 2LNTA 3IXRA 2X4AA 2IFQA 4MPGA 5H5QA 5ID2A 1FB0A 5DJMA 3APOA 4RI7A 3A2XA 1TTZA 2DLXA 4GF0A 2FHEA 4HQZA 2V2GA 4BL7A 3IPZA 1AC1A 3KJYA 4G2EA 1SJIA 2WFCA 2X99A 2IJYA 3GKMA 1AIUA 1MD4A 2OKAA 4A5PA 2B5EA 3HDCA 5J4UA 4AJ7A 1PL2A 2LV3A 2GZYA 4V1Ag 5ECPB 1E2YA 4JR6A 3H1NA 1T4YA 3ZYWA 5B6MA 2OADA 4I6XA 3M8NA 2CV4A 5A4UA 3LXTA 2HNLA 3MSZA 2OJLA 1MDJA 3BCIA 1ZYNA 1ZYEA 1GUMA 3ZTLA 5B6NA 2H19A 3D6IA 3VWVA 2KOKA 5G1LA 3EU4A 2CX4A 1WOUA 5F07A 7GSSA 2QA1A 4ZILA 1A0FA 1Z6MA 1TRUA 2IMIA 3BBYA 1F3BA 2H0HA 3LYPA 3EWLA 1VF2A 5HQPA 4X1UA 3BCKA 2LRTA 4POMA 1EGOA 1Y25A 3HA9A 1BG5A 4AGSA 3GSTA 4OMVA 1YEXA 4HQSA 2DJ2A 5D8IA 1XOAA 2VD0A 5IMAA 1MEKA 1GUKA 4CDOA 3WD6A 3F6FA 5LNKe 1IYIA 4D73A 1LU4A 2P0GA 4GSNA 3IK9A 1X9SB 4RUVA 2O7KA 2WRTA 1M7TA 2DIZA 3EYTA 4Z2UA 2F8FA 1TW9A 2L59A 3CSJA 4LMWA 2CAQA 2H73A 4MF6A 4ML6A 4Q5RA 1ERTA 4I5QA 5C04A 1PX6A 2XC2A 4IP1A 2TIRA 2C4JA 4X0XA 4K0NA 3WGEA 9GSSA 3LGCA 1K0NA 4MJBA 3M1GA 3ZMKA 1XPVA 4HOJA 1Q4JA 1V58A 22GSA 5DALB 2FNOA 2EIOA 2OE0A 1EGRA 4GXZA 1Z7RA 4ZXGA 3TJGA 4JEDA 4PNFA 4AJ6A 1JLVA 4ECBA 3LORA 1TDIA 1X5CA 3M0FA 3ED3A 2GGTA 1SYRA 2CX3A 1HNBA 4OWYA 5AISA 1V98A 3LEFA 4MF7A 4L8EA 3F6DA 1OC9B 4JBBA 5CNWA 3QMXA 5F05A 5KN2A 1G7EA 3EINA 3HXSA 4WEYA 1GSDA 4OFMA 3HJOA 2MYGA 3U6VA 1SL2B 2MMOA 1A23A 4ECCA 4HJMA 2VAFA 3EPTA 3FZ5A 3KP9A 1PQNA 2MBSA 4J2FA 2LNSA 4N0ZA 4HDEA 5ECLB 4XS4A 1J0FA 2YCDA 2DMLA 2HE3A 16GSA 1TK5B 4WR5A 1QMVA 3KH9A 1JHBA 4O5RA 4ICYA 4CW9A 2L5LA 5D9WA 2KHPA 4G0KA 1KNGA 4TR3A 2ES7A 2IWTA 1SKRB 2F8AA 4TXVA 1J9BA 4V2MA 4GLTA 4K6XA 1ILOA 3GV1A 3DGQA 2EC4A 1FHEA 1R4WA 2YV9A 2L4CA 1ZOFA 3TJBA 1NW2A 3IC4A 2IMKA 2NPBA 2LTKA 5IMZA 3HJPA 3TJJA 2CT6A 3GX0A 2C0FA 4MNNA 2TRXA 3WGXA 2B7JA 3EC3A 1I5GA 1ZCPA 4IW9A 3Q74A 2L4QA 4LL4B 3F0IA 1ABAA 2HT9A 5D9TA 2GQMA 1S3AA 1OE7A 3F4TA 3F4SA 1U3IA 4PTSA 4WKWA 1SKWB 1K3OA 3FZ4A 1XCCA 2PGTA 4WBRD 2OE3A 2GZZA 2PPTA 5J9CA 2AUVA 4GSSA 1K3YA 5EPFA 2HSMA 1IYHA 2LRNA 4V2LA 4NHZA 5DVBA 2ZCTA 1BX9A 2C3TA 1ZMAA 4K7OA 6GSYA 2E2GA 2VL2C 2P31A 3VURA 4EXJA 1TOFA 3ZITA 1QK8A 4IJIA 2H01A 4BVYB 2QGVA 4CY6A 2DC5A 4BVXB 3LYKA 3IDVA 2R0GA 2REMA 2WB9A 3I43A 1F6MC 1FG4A 1B48A 3Q6OA 4YKFA 2YV7A 5GZZB 2E0QA 5D9VA 2FCHA 1YKCA 3HKRA 3VI7A 2PERA 1YJ6A 2LUSA 1I9DA 4GRFA 4TR1A 2K6VA 3TB2A 5JWOB 4BVYA 2I1UA 1THXA 1UA5A 2GTUA 3FK8A 3D21A 5G31A 1JZDA 3C71A 4DSSB 4MPFA 4ML1A 6GSWA 1T4ZA 4QQ7A 5DDLA 4POKA 4MZWA 1JZOA 4L5OA 1X5EA 4YQUA 3ZL5A 1V2AA 5IMFA 5FHIA 3PR8A 3ERGA 3D4MA 1WPIA 2XBIA 4G0IA 5JWQB 1BJXA 3DIEA 3IC8A 2VM1A 3C73A 3PPUA 4G9HA 2V6KA 1N8JA 3HJMA 1EV4A 4NXIA 5HR2A 5ECKB 2DJ1A 2JU5A 1OYJA 2HSYA 1TI1A 2ZUPA 2H70A 4DSSA 1PN0A 2DKIA 4OO5A 2FWHA 3N5OA 2R6KA 1PKWA 4XCSA 1M0UA 3QAVA 3HVSA 8GSSA 5KOXA 5ECSA 3I9V2 2WJUA 2AAWA 5J3RA 1WRYA 3TKQA 2VLUA 4HZ4A 4PQ1A 3VWXA 1CQGA 2IMFA 3HZ4A 4IBPA 1HNAA 1RQMA 2WGRA 2LS5A 4MLYA 4KNDA 2H0IA 5ENUA 4Q5FA 4E8EA 4BWSA 3JCML 1GNWA 3KEBA 3UAPA 4OD7A 3UL3A 6GSVA 5IMVA 3TKSA 3DXBA 3OR5A 5IMCA 4ZL7A 1SU9A 2AYTA 1SKSB 1USBA 3D22A 2CQ9A 2GSQA 1WE0A 2A4HA 2HRAA 3M9JA 1PKZA 2IMEA 2PMTA 1TP9A 3E9JB 4N30A 1PD21 2I3YA 1TU7A 2VCTA 3C1RA 1Y6EA 4PX1A 4Q5NA 3KTBA 5B7CA 4YH2A 4YQVA 2VOCA 1U88A 2E7PA 1FVKA 2HI7A 2DIYA 4ZBDA 4IVFA 5G5FA 2PVQA 2L5OA 3RHCA 3GMFA 2L57A 5CYYA 1B9XC 3GRXA 4I97A 1EWXA 1Z6NA 4K0GA 3LW9A 17GSA 2WDUA 3L9SA 3KCMA 1FVJA 2H76A 3GN3A 4PUFC 3GX8A 2O87A 5IQYA 1TRSA 5B8AA 1EP7A 3UJ1A 3HHVA 2HXKA 1MDKA 1EEMA 3GKKA 4K1FA 4N0VA 5H5SA 4IJ3A 3J7Yb 4MZBA 5ECOB 2P5QA 2FWEA 2JZRA 2QA2A 1MD3A 5EY6A 5A5KA 1XIYA 1NHYA 3MWHA 3G9BA 3G7JA 20GSA 3W8JA 4KAEA 3H8QA 5COHA 1U87A 5DCHA 1S3DA 1H75A 3VK9A 3FR3A 3KTLA 11GSA 3MDKA 3QPMA 1MTCA 1ZYPA 5D96A 3SBCA 3IBHA 2O8VB 1FB6A 2YANA 3D4TA 5CRDA 1FOVA 5JCUA 5CRWA 3C1SA 3H79A 2FUG2 1O6JA 1QUWA 4NPBA 1AQXA 1NHOA 1RW1A 1TXXA 4IP6A 1ZZYA 4KSMA 1T3BA 4LA1A 4MJAA 4EL1A 3US3A 3ERWA 1PA3A 4P3YB 3P2AA 2GS3A 5ELAA 1O81A 4NHWA 5HFKA 19GSA 3IHQA 5IOWA 2H30A 1GSQA 4KW6A 2R0PA 3VWUA 3FW2A 4XIHA 2YWOA 2OA7A 4F0BA 4MJEA 5D73A 3WT2A 2MMNA 1Q98A 1T00A 1GWCA 3O6TA 2X8CA 2C0DA 3DVWA 5BMUA 4KSOA 4L0UA 1OVNA 5HFGA 2OE1A 4ZL9A 1UN2A 1TI3A 2MMAA 4KDXA 1R5AA 2CVKA 1PN9A 4DEJA 3HVXA 2CZ2A 4XTSA 1JZRA 2VM2A 3CYNA 1AUCA 1SK0A 1JLWA 3IAM2 3IOSA 4KDUA 2DKHA 4MDCA 1HYUA 5LCZA 4K2DA 4K8MA 18GSA 2CVBA 4HUAA 3G7IA 2RLIA 2VL3A 5CO3A 3PGTA 4EDZA 4USSA 4HI7A 4WF4A 2O85A 2NVLA 3APQA 2F51A 4JU5A 2FA4A 3FRCA 2KP1A 4QL7A 4TR4A 5L71A 2CA8A 4KCAA 2VIMA 1YEPA 2L6CA 1XW6A 1C72A 5G5EA 1A2MA 3CRUA 2CVDA 3DD3A 3WYWA 4EF0A 5DALA 1K0DA 1XXUA 4PNGA 3QFBC 4TVEA 4EIQA 2MZCA 4NV5A 2GVPA 1WMJA 3A2VA 3KD0A 3RAZA 2HZEB 4MMMA 1SL0B 2BTOT 1GSYA 2DJJA 3TRPA 2FD3A 4IELA 3J7Yk 2BJXA 3ZFBA 3KMOA 1M2AA 2G0FA 3ISOA 3IHGA 3CMIA 4ZB9A 3W6GA 1LJRA 2WZ9A 1OC9A 2BMXA 1AQWA 2JL4A 1GSSA 2J23A 5JCGA 2K18A 3UIWA 2PWJA 2H66A 1ERVA 3VI5A 3P90A 1B4PA 1MDIA 3O76A 4IGJA 1HD2A 1V40A 3UOMA 1URMA 1WWJA 2R2JA 2N5FA 5H5RA 4Z2TA 2A2PA 3FZ9A 4F03A 5KN1A 4Z7XA 4IQ1A 5HR3A 2RIIA 2LKUA 2WS2A 2KLXA 5KEJA 3GSSA 1F3AA 1OC8A 1Z7PA 1OE8A 2J9HA 1GULA 2FLSA 4NV2A 4RQRA 2PUKC 2H71A 1ZL9A 5CRGA 2ON5A 4GTUA 3GKXA 4YKGA 4O7HA 4XS1A 4GQCA 2LQOA 3V1WA 3GFKA 1FO5A 2R4VA 3I6AA 3IRAA 1K0BA 2EIQA 3F9UA 1PL1A 1VF3A 3KXOA 3NIVA 1N2AA 2AJQB 3DKSA 4MF5A 4JE1A 1AQVA 2LEGA 4O32A 5ECNB 5DJLA 1WP0A 3KIJA 2Z9SA 5HFIA 5G30A 2AV4A 3ZRDA 3TKSE 2GDRA 2YWNA 4GQFA 1K0AA 4OO4A 2N5BA 3LG6A 2YOIA 3P7XA 2C0EA 5IMDA 4MP4A 1O8WA 5E59A 1ON4A 1YF1A 4G10A 1XVWA 3ME7A 3ZIVA 1A2LA 3F8UA 1XVQA 5J9BA 2IPAA 4PQHA 2OBKA 4WBJA 1G0TA 4N11A 2RM5A 2LJKA 2K9FA 2H1BA 4Z2RA 2I81A 1XWAA 5ECHB 1JFUA 2JZSA 5G1KA 4EO3A 1S3CA 2HRNA 2JACA 3IR4A 1OKDA 2R3XA 5ECMB 3GL5A 3KH7A 3FY7A 3FR6A 3VWWA 1GTAA 4MA9A 4HU7A 4K5RA 2MMZA 1XW5A 3HYPA 4ZBBA 4IKHA 4BVXA 1GTBA 4ACSA 1SJZA 1VF1A 2B1LA 3ME8A 4ID0A 2GT5A 1F9MA 2PU9C 3BOAA 5KOWA 2IMDA 2RM6A 2VUPA 1BYEA 3ZMLA 4ECIA 1NM3A 3UBLA 4CHSA 1SK2A 3VPQA 2OBIA 1SD8A 1EP8A 2H75A 3Q19A 2F3MA 4WR4A 2XBQA 3FYGA 2C8UA 2I9HA 2HRKA 4FYUA 3DWVA 3HVVA 3LXZA 2YJ7A 2QSIA 3FKFA 3EU3A 3RPPA 1F37A 4NWYA 3L78A 1GSUA 4ZB6A 1SJ6A 1M2DA 1R7HA 5KN0A 1G6WA 3UARA 3GHAA 1XWGA 1H4OA 1EOHA 2YZHA 5D9XA 4O92A 2H1GA 1QGVA 2DJ0A 3PH9A 3MNGA 3GH6A 4I8BA 1OAZA 2MBTA 1ZYQB 2GT6A 4MABA 1A24A 2V32A 3P8WA 3K8NA 2H6XA 4K7IA 5DAKB 1EEJA 1GTUA 1AAZA 1DUGA 1LBKA 2M72A 6GSUA 1Z9HA 2VCVA 3EE2A 4TXOB 1AW9A 4MH3A 2X49A 3D0ZA 2LJAA 4YAVA 4KX4A 3MIXA 2C1YA 3TKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PGT A;  3AY8 A;  4BPY A;  1M9B A;  1K0M A;  3R2Q A;  4YAP A;  3VFI A;  1NSW A;  3VLN A;  4KA0 A;  4GWR A;  1XZO A;  3UEM A;  5DQS A;  3ZRE A;  5C00 A;  3TKS C;  1B9Y C;  2VCX A;  1YF0 A;  5LD0 A;  1O85 A;  2L6D A;  1SYX A;  5B8B A;  4ILF A;  1BQ7 A;  5GST A;  5F06 A;  1B4Q A;  4TRX A;  4XRA A;  1KEB A;  4HU9 A;  3ZIJ A;  3RPN A;  5DQY A;  5D93 A;  2CZ3 A;  3G7Y A;  5G2Z A;  12GS A;  3EUR A;  4F0C A;  5A4V A;  1F2E A;  1SL1 B;  4PXO A;  2K8V A;  1THO A;  1U3A A;  1HQO A;  2IL3 A;  3LSZ A;  2R5G A;  3IK7 A;  1GSE A;  2VLV A;  1TK8 B;  4EC0 A;  3UVH A;  1Z3E A;  3GL3 A;  1UVZ A;  3UBK A;  5DCG A;  1AXD A;  1VGL A;  4EUY A;  2V6O A;  4GST A;  3KGK A;  5CP1 A;  3HD5 A;  1ERU A;  1V9W A;  3VPT A;  1GP1 A;  4LL1 B;  5IO2 A;  3DYR A;  2FWG A;  4KUN A;  4JRR A;  4OCE A;  2E2M A;  2KUC A;  4I2U A;  4G19 A;  3ZFL A;  2LST A;  3FZA A;  4ULX A;  2X64 A;  3E3E A;  2C3N A;  2HYX A;  3M9K A;  3L9U A;  4AF2 A;  5ECQ B;  1GLP A;  1M99 A;  3W8S A;  5A4W A;  1VRS D;  5EL8 A;  3TJF A;  1W4V A;  2GSR A;  4Q5Q A;  1WIK A;  1K0O A;  3CSH A;  4D73 B;  3IA1 A;  2FA8 A;  2NBS A;  3QOU A;  4WET A;  4JZQ A;  5IOX A;  2PN8 A;  1O73 A;  1B8X A;  4KDY A;  5FWG A;  4FYC A;  3TCO A;  3ZZX A;  3F3R A;  5IO0 A;  6GSS A;  2VCW A;  5DBQ A;  2AB6 A;  2LQQ A;  2V1M A;  5CRE A;  1WJK A;  2OAC A;  2FWF A;  5FT3 A;  4TR0 A;  2WUL A;  4FH8 A;  1XWB A;  3S9F A;  3RDW A;  2G2Q A;  4RQX A;  1HNC A;  1YZX A;  3GNJ A;  4IQA A;  3LWA A;  1BAY A;  1W89 A;  4NAX A;  3SWL A;  1PMT A;  4J56 E;  5IPG A;  2FGX A;  1Z5Y E;  3BJ5 A;  4KH7 A;  3A5W A;  4OFN A;  5F0G A;  3TRX A;  2A2S A;  3LFL A;  3EMX A;  2X8H A;  4F9Z A;  3H4K A;  4QL9 A;  4MJC A;  5AGY A;  3KMN A;  1A0R P;  1K0C A;  2GQL A;  5F8B A;  4GCI A;  5CRH A;  4IHU A;  2CAI A;  1O7U A;  1PRX A;  3I69 A;  4ECJ A;  3GIX A;  3U5R E;  3TRQ A;  4HS1 A;  1FW1 A;  3DEX A;  5IIZ A;  2JSY A;  3MAK A;  4MCU A;  4L0W A;  5ECR B;  1DBY A;  3TOT A;  2XPE A;  2YNX A;  2YP6 A;  14GS A;  5GAP D;  4XS4 B;  2NDO A;  2ZNM A;  1EOG A;  2WCI A;  5INY A;  1GL8 A;  1XBS A;  2JSZ A;  3HY2 A;  1DSB A;  2LJR A;  3APS A;  2RUE A;  2R37 A;  1YDK A;  2TRC P;  3C8E A;  3ZVJ D;  2K8S A;  5KN3 A;  4HZ2 A;  2DJ3 A;  2VD1 A;  2YWM A;  2H1A A;  4F82 A;  3QCP A;  2HRF A;  3F3Q A;  3IAS 2;  2JZT A;  2IN3 A;  5JCW A;  2PVO C;  3IV4 A;  1SD9 A;  4TOP A;  2HZE A;  4MH2 A;  3DML A;  4AJ8 A;  4E8H A;  1XWC A;  3D5J A;  1ML6 A;  4V2N A;  1XWK A;  2HSH A;  1GNE A;  4TN8 A;  2B3S A;  1X9W B;  1R5P A;  1J08 A;  2H8L A;  1A8Y A;  3CTF A;  1G6Y A;  5ABR A;  3ZLP A;  1T7P B;  3GKN A;  4KB3 A;  2P5R A;  3FEU A;  4V1A p;  3GTU B;  4I2T A;  3GH9 A;  1XOB A;  1BED A;  3F4R A;  1A8L A;  2B7K A;  3Q18 A;  4OCF A;  4FIW A;  1XFL A;  1SEN A;  2KP2 A;  2QC7 A;  2DMM A;  5IM9 A;  5IPH A;  2FY6 A;  2GST A;  2DJK A;  4FO5 A;  1ZGN A;  5HR1 A;  4BA7 A;  1OC3 A;  2M80 A;  1TK0 B;  4FYB A;  13GS A;  3CBU A;  4EKZ A;  1TU8 A;  3ERF A;  1GH2 A;  3GTU A;  4POL A;  2B6M A;  3F63 A;  3TKR A;  4KE3 A;  3KZQ A;  2YJH A;  2DSA A;  1KTE A;  5AIX A;  4J57 E;  1R26 A;  1GTI A;  1XW9 A;  5E4W A;  3TOU A;  2O89 A;  2DBC A;  5AIV A;  3HZ8 A;  5ELG A;  3ZVJ A;  3KM6 A;  1G7O A;  2VL2 A;  4NMU A;  4DVC A;  2VL9 A;  3CXG A;  1T1V A;  3UMA A;  3BD2 A;  3QAW A;  2C0G A;  2B5X A;  6GST A;  3NZN A;  2YPM A;  2N5A A;  1M9A A;  1X9M B;  3EMP A;  2HFD A;  5ECI B;  2M46 A;  4TR1 B;  3H93 A;  2VCQ A;  1PGT A;  2ON7 A;  4EVM A;  1EV9 A;  3L4N A;  4LLR A;  3L0H A;  5AN1 A;  3TGZ A;  4MZC A;  4XHM A;  1TJD A;  2LRC A;  1K3L A;  1YKA A;  2X8G A;  1M2B A;  3HCZ A;  3TUE A;  5GAN D;  1KBN A;  4JR4 A;  1U6T A;  2YZU A;  4HJ2 A;  3WT1 A;  3A3T A;  3RBT A;  1DE2 A;  4HEA 2;  1EZK A;  1TRV A;  5J41 A;  3QAG A;  3KP8 A;  3QDN A;  1PSQ A;  4L5L A;  3M3M A;  1CQH A;  4ISD A;  2H0G A;  3CSI A;  4YQM A;  4OFT A;  3A2W A;  3QFA C;  3GUS A;  3QD9 A;  5HR0 A;  3GUR A;  2GZP A;  3O3T A;  1O8X A;  3FHK A;  4POB A;  3CTG A;  2XHF A;  4XRD A;  3GYK A;  5J5N A;  2YWI A;  3LQ7 A;  2HZF A;  3CRT A;  1GLQ A;  3N9J A;  1ERW A;  2H1D A;  4XS6 A;  2B5Y A;  2I4A A;  4IN0 A;  1PX7 A;  3GA4 A;  3L9V A;  1X5D A;  4WF5 A;  3DRN A;  2F9S A;  3FR9 A;  4X43 A;  4DSR A;  4RI6 A;  5CAX A;  1T8E B;  1QFN A;  2NTO A;  2A2R A;  4K9Z A;  2JAD A;  2ALB A;  1TKD B;  1QXH A;  2C80 A;  1GSF A;  4IS0 A;  3WGD A;  1FAA A;  3C7M A;  2GSS A;  1GUH A;  1A2J A;  2PBJ A;  4PQI A;  1RK4 A;  3IE3 A;  2H6Z A;  4WXT A;  1ST9 A;  1V57 A;  2VCZ A;  3TJK A;  1X0R A;  4EE0 A;  2QKE A;  4PUR A;  4TW5 A;  5DAK A;  4MK3 A;  1TRW A;  5GSS A;  1UC7 A;  2HLS A;  4ZL8 A;  2H74 A;  4LMV A;  2D2Z A;  4BWQ A;  3UVT A;  4ZB8 A;  4ZIJ A;  4TXO A;  2VLT A;  2IIY A;  3LJR A;  4ZBA A;  3NOF A;  4TKY A;  1YQ1 A;  2A4V A;  4DSQ A;  5EVO A;  1QQ2 A;  2AHE A;  1DE1 A;  1JZW A;  2V41 A;  4KGI A;  3RHB A;  1YY7 A;  2H72 A;  2IFQ B;  1ACV A;  5ID2 B;  3QR6 A;  1SK1 A;  5JWR B;  1OKT A;  2XPD A;  3TDG A;  3PIN A;  4H86 A;  2B1K A;  2C3Q A;  2H6Y A;  4EDY A;  4KCE A;  3E0U A;  2VO4 A;  1VF4 A;  10GS A;  2RUF A;  3EVI A;  2EIR A;  2YN1 A;  1E6B A;  2GLR A;  3DVX A;  4PUA A;  2GQK A;  4F2I A;  6GSX A;  1GRX A;  4K7N A;  4N10 A;  2LNT A;  3IXR A;  2IFQ A;  4MPG A;  5H5Q A;  5ID2 A;  1FB0 A;  5DJM A;  3APO A;  4RI7 A;  3A2X A;  1TTZ A;  2DLX A;  4GF0 A;  2FHE A;  4HQZ A;  2V2G A;  4BL7 A;  3IPZ A;  1AC1 A;  3KJY A;  4G2E A;  1SJI A;  2WFC A;  2X99 A;  2IJY A;  3GKM A;  1AIU A;  1MD4 A;  2OKA A;  2B5E A;  3HDC A;  5J4U A;  4AJ7 A;  1PL2 A;  2LV3 A;  2GZY A;  4V1A g;  5ECP B;  1E2Y A;  4JR6 A;  3H1N A;  1T4Y A;  3ZYW A;  5B6M A;  2OAD A;  4I6X A;  3M8N A;  2CV4 A;  5A4U A;  3LXT A;  2HNL A;  3MSZ A;  2OJL A;  1MDJ A;  3BCI A;  1ZYE A;  1GUM A;  3ZTL A;  5B6N A;  2H19 A;  3D6I A;  3VWV A;  2KOK A;  5G1L A;  3EU4 A;  2CX4 A;  1WOU A;  5F07 A;  7GSS A;  4ZIL A;  1A0F A;  1Z6M A;  1TRU A;  2IMI A;  3BBY A;  1F3B A;  2H0H A;  3LYP A;  3EWL A;  1VF2 A;  5HQP A;  4X1U A;  3BCK A;  2LRT A;  4POM A;  1EGO A;  1Y25 A;  3HA9 A;  1BG5 A;  4AGS A;  3GST A;  4OMV A;  1YEX A;  4HQS A;  2DJ2 A;  5D8I A;  1XOA A;  2VD0 A;  5IMA A;  1MEK A;  1GUK A;  4CDO A;  3WD6 A;  3F6F A;  5LNK e;  1IYI A;  4D73 A;  1LU4 A;  2P0G A;  4GSN A;  3IK9 A;  1X9S B;  4RUV A;  2O7K A;  2WRT A;  1M7T A;  2DIZ A;  3EYT A;  2F8F A;  1TW9 A;  2L59 A;  3CSJ A;  4LMW A;  2CAQ A;  2H73 A;  4MF6 A;  4ML6 A;  4Q5R A;  1ERT A;  4I5Q A;  5C04 A;  1PX6 A;  2XC2 A;  4IP1 A;  2TIR A;  2C4J A;  4X0X A;  4K0N A;  3WGE A;  9GSS A;  3LGC A;  1K0N A;  4MJB A;  3M1G A;  3ZMK A;  1XPV A;  4HOJ A;  1Q4J A;  1V58 A;  22GS A;  5DAL B;  2FNO A;  2EIO A;  2OE0 A;  1EGR A;  4GXZ A;  1Z7R A;  4ZXG A;  3TJG A;  4JED A;  4PNF A;  4AJ6 A;  1JLV A;  4ECB A;  3LOR A;  1TDI A;  1X5C A;  3M0F A;  3ED3 A;  2GGT A;  1SYR A;  2CX3 A;  1HNB A;  4OWY A;  5AIS A;  1V98 A;  3LEF A;  4MF7 A;  4L8E A;  3F6D A;  1OC9 B;  4JBB A;  5CNW A;  3QMX A;  5F05 A;  5KN2 A;  1G7E A;  3EIN A;  3HXS A;  4WEY A;  1GSD A;  4OFM A;  3HJO A;  2MYG A;  3U6V A;  1SL2 B;  2MMO A;  1A23 A;  4ECC A;  4HJM A;  2VAF A;  3FZ5 A;  3KP9 A;  1PQN A;  2MBS A;  4J2F A;  2LNS A;  4N0Z A;  4HDE A;  5ECL B;  4XS4 A;  1J0F A;  2YCD A;  2DML A;  2HE3 A;  16GS A;  1TK5 B;  4WR5 A;  1QMV A;  3KH9 A;  1JHB A;  4O5R A;  4CW9 A;  2L5L A;  5D9W A;  2KHP A;  1KNG A;  4TR3 A;  2ES7 A;  2IWT A;  1SKR B;  2F8A A;  4TXV A;  1J9B A;  4V2M A;  4GLT A;  4K6X A;  1ILO A;  3GV1 A;  3DGQ A;  2EC4 A;  1FHE A;  1R4W A;  2YV9 A;  2L4C A;  1ZOF A;  3TJB A;  1NW2 A;  3IC4 A;  2IMK A;  2NPB A;  2LTK A;  5IMZ A;  3HJP A;  3TJJ A;  2CT6 A;  3GX0 A;  2C0F A;  2TRX A;  3WGX A;  2B7J A;  3EC3 A;  1I5G A;  1ZCP A;  4IW9 A;  3Q74 A;  2L4Q A;  4LL4 B;  3F0I A;  1ABA A;  2HT9 A;  5D9T A;  2GQM A;  1S3A A;  1OE7 A;  3F4T A;  3F4S A;  1U3I A;  4WKW A;  1SKW B;  1K3O A;  3FZ4 A;  1XCC A;  2PGT A;  4WBR D;  2OE3 A;  2GZZ A;  2PPT A;  5J9C A;  2AUV A;  4GSS A;  1K3Y A;  5EPF A;  1IYH A;  2LRN A;  4V2L A;  4NHZ A;  5DVB A;  2ZCT A;  1BX9 A;  2C3T A;  1ZMA A;  4K7O A;  6GSY A;  2E2G A;  2VL2 C;  2P31 A;  3VUR A;  4EXJ A;  1TOF A;  3ZIT A;  1QK8 A;  4IJI A;  2H01 A;  2QGV A;  2DC5 A;  3LYK A;  3IDV A;  2REM A;  2WB9 A;  3I43 A;  1F6M C;  1FG4 A;  1B48 A;  3Q6O A;  2YV7 A;  5GZZ B;  2E0Q A;  5D9V A;  2FCH A;  1YKC A;  3HKR A;  3VI7 A;  2PER A;  1YJ6 A;  2LUS A;  1I9D A;  4GRF A;  4TR1 A;  2K6V A;  3TB2 A;  5JWO B;  4BVY A;  2I1U A;  1THX A;  1UA5 A;  2GTU A;  3FK8 A;  3D21 A;  5G31 A;  1JZD A;  3C71 A;  4DSS B;  4MPF A;  4ML1 A;  6GSW A;  1T4Z A;  4QQ7 A;  5DDL A;  4POK A;  4MZW A;  1JZO A;  4L5O A;  1X5E A;  4YQU A;  3ZL5 A;  1V2A A;  5IMF A;  5FHI A;  3PR8 A;  3ERG A;  3D4M A;  1WPI A;  2XBI A;  5JWQ B;  1BJX A;  3DIE A;  2VM1 A;  3C73 A;  4G9H A;  2V6K A;  1N8J A;  3HJM A;  1EV4 A;  4NXI A;  5HR2 A;  5ECK B;  2DJ1 A;  2JU5 A;  1OYJ A;  2HSY A;  1TI1 A;  2ZUP A;  2H70 A;  4DSS A;  4OO5 A;  2FWH A;  3N5O A;  2R6K A;  1PKW A;  4XCS A;  1M0U A;  3QAV A;  3HVS A;  8GSS A;  5ECS A;  3I9V 2;  2WJU A;  2AAW A;  5J3R A;  1WRY A;  3TKQ A;  2VLU A;  4HZ4 A;  4PQ1 A;  3VWX A;  1CQG A;  2IMF A;  3HZ4 A;  4IBP A;  1HNA A;  1RQM A;  2WGR A;  2LS5 A;  4MLY A;  4KND A;  2H0I A;  5ENU A;  4Q5F A;  4E8E A;  4BWS A;  3JCM L;  1GNW A;  3KEB A;  3UAP A;  4OD7 A;  3UL3 A;  6GSV A;  5IMV A;  3TKS A;  3DXB A;  3OR5 A;  5IMC A;  4ZL7 A;  1SU9 A;  2AYT A;  1SKS B;  1USB A;  3D22 A;  2CQ9 A;  2GSQ A;  1WE0 A;  3M9J A;  1PKZ A;  2IME A;  2PMT A;  1TP9 A;  3E9J B;  4N30 A;  1PD2 1;  2I3Y A;  1TU7 A;  2VCT A;  3C1R A;  1Y6E A;  4PX1 A;  4Q5N A;  3KTB A;  5B7C A;  4YH2 A;  4YQV A;  2VOC A;  1U88 A;  2E7P A;  1FVK A;  2HI7 A;  2DIY A;  4ZBD A;  4IVF A;  5G5F A;  2PVQ A;  2L5O A;  3RHC A;  3GMF A;  2L57 A;  5CYY A;  1B9X C;  3GRX A;  4I97 A;  1EWX A;  1Z6N A;  4K0G A;  17GS A;  2WDU A;  3L9S A;  3KCM A;  1FVJ A;  2H76 A;  3GN3 A;  4PUF C;  3GX8 A;  2O87 A;  5IQY A;  1TRS A;  5B8A A;  1EP7 A;  3UJ1 A;  3HHV A;  2HXK A;  1MDK A;  1EEM A;  3GKK A;  4K1F A;  4N0V A;  5H5S A;  4IJ3 A;  3J7Y b;  4MZB A;  5ECO B;  2P5Q A;  2FWE A;  2JZR A;  1MD3 A;  5EY6 A;  5A5K A;  1XIY A;  1NHY A;  3MWH A;  3G9B A;  3G7J A;  20GS A;  3W8J A;  4KAE A;  3H8Q A;  5DCH A;  5COH A;  1U87 A;  1S3D A;  1H75 A;  3VK9 A;  3FR3 A;  3KTL A;  11GS A;  3MDK A;  3QPM A;  1MTC A;  5D96 A;  3SBC A;  3IBH A;  2O8V B;  1FB6 A;  2YAN A;  3D4T A;  5CRD A;  1FOV A;  5JCU A;  5CRW A;  3C1S A;  3H79 A;  2FUG 2;  1O6J A;  1QUW A;  4NPB A;  1AQX A;  1NHO A;  1RW1 A;  1TXX A;  4IP6 A;  1ZZY A;  4KSM A;  1T3B A;  4LA1 A;  4MJA A;  4EL1 A;  3US3 A;  3ERW A;  1PA3 A;  4P3Y B;  3P2A A;  2GS3 A;  5ELA A;  1O81 A;  4NHW A;  5HFK A;  19GS A;  3IHQ A;  5IOW A;  2H30 A;  1GSQ A;  4KW6 A;  3VWU A;  3FW2 A;  4XIH A;  2YWO A;  2OA7 A;  4F0B A;  4MJE A;  5D73 A;  3WT2 A;  2MMN A;  1Q98 A;  1T00 A;  1GWC A;  3O6T A;  2X8C A;  2C0D A;  3DVW A;  4KSO A;  4L0U A;  1OVN A;  5HFG A;  2OE1 A;  4ZL9 A;  1UN2 A;  1TI3 A;  2MMA A;  4KDX A;  1R5A A;  2CVK A;  1PN9 A;  4DEJ A;  3HVX A;  2CZ2 A;  4XTS A;  1JZR A;  2VM2 A;  3CYN A;  1AUC A;  1SK0 A;  1JLW A;  3IAM 2;  3IOS A;  4KDU A;  4MDC A;  1HYU A;  5LCZ A;  4K2D A;  4K8M A;  18GS A;  2CVB A;  4HUA A;  3G7I A;  2RLI A;  2VL3 A;  5CO3 A;  3PGT A;  4EDZ A;  4HI7 A;  4WF4 A;  2O85 A;  2NVL A;  3APQ A;  2F51 A;  4JU5 A;  2FA4 A;  3FRC A;  2KP1 A;  4QL7 A;  4TR4 A;  5L71 A;  2CA8 A;  4KCA A;  2VIM A;  1YEP A;  2L6C A;  1XW6 A;  1C72 A;  5G5E A;  1A2M A;  3CRU A;  2CVD A;  3DD3 A;  3WYW A;  4EF0 A;  5DAL A;  1K0D A;  1XXU A;  4PNG A;  3QFB C;  4TVE A;  2MZC A;  4NV5 A;  2GVP A;  1WMJ A;  3A2V A;  3KD0 A;  3RAZ A;  2HZE B;  4MMM A;  1SL0 B;  2BTO T;  1GSY A;  2DJJ A;  3TRP A;  2FD3 A;  4IEL A;  3J7Y k;  2BJX A;  3ZFB A;  3KMO A;  1M2A A;  2G0F A;  3ISO A;  3CMI A;  4ZB9 A;  3W6G A;  1LJR A;  2WZ9 A;  1OC9 A;  2BMX A;  1AQW A;  2JL4 A;  1GSS A;  2J23 A;  5JCG A;  2K18 A;  3UIW A;  2PWJ A;  2H66 A;  1ERV A;  3VI5 A;  3P90 A;  1B4P A;  1MDI A;  3O76 A;  4IGJ A;  1HD2 A;  1V40 A;  3UOM A;  1URM A;  1WWJ A;  2R2J A;  2N5F A;  5H5R A;  3FZ9 A;  4F03 A;  5KN1 A;  4Z7X A;  4IQ1 A;  5HR3 A;  2RII A;  2LKU A;  2WS2 A;  2KLX A;  5KEJ A;  3GSS A;  1F3A A;  1OC8 A;  1Z7P A;  1OE8 A;  2J9H A;  1GUL A;  2FLS A;  4NV2 A;  4RQR A;  2PUK C;  2H71 A;  1ZL9 A;  5CRG A;  2ON5 A;  4GTU A;  3GKX A;  4O7H A;  4XS1 A;  4GQC A;  2LQO A;  3V1W A;  3GFK A;  1FO5 A;  2R4V A;  3I6A A;  3IRA A;  1K0B A;  2EIQ A;  3F9U A;  1PL1 A;  1VF3 A;  3KXO A;  3NIV A;  1N2A A;  2AJQ B;  3DKS A;  4MF5 A;  4JE1 A;  1AQV A;  2LEG A;  4O32 A;  5ECN B;  5DJL A;  1WP0 A;  3KIJ A;  2Z9S A;  5HFI A;  5G30 A;  2AV4 A;  3ZRD A;  3TKS E;  2GDR A;  2YWN A;  4GQF A;  1K0A A;  4OO4 A;  2N5B A;  3LG6 A;  2YOI A;  3P7X A;  2C0E A;  5IMD A;  4MP4 A;  1O8W A;  5E59 A;  1ON4 A;  1YF1 A;  4G10 A;  1XVW A;  3ME7 A;  3ZIV A;  1A2L A;  3F8U A;  1XVQ A;  5J9B A;  2IPA A;  4PQH A;  2OBK A;  4WBJ A;  1G0T A;  4N11 A;  2RM5 A;  2LJK A;  2K9F A;  2H1B A;  2I81 A;  1XWA A;  5ECH B;  1JFU A;  2JZS A;  5G1K A;  4EO3 A;  1S3C A;  2HRN A;  2JAC A;  3IR4 A;  1OKD A;  2R3X A;  5ECM B;  3GL5 A;  3KH7 A;  3FY7 A;  3FR6 A;  3VWW A;  1GTA A;  4MA9 A;  4HU7 A;  2MMZ A;  1XW5 A;  3HYP A;  4ZBB A;  4IKH A;  4BVX A;  1GTB A;  4ACS A;  1SJZ A;  1VF1 A;  2B1L A;  3ME8 A;  4ID0 A;  2GT5 A;  1F9M A;  2PU9 C;  3BOA A;  2IMD A;  2RM6 A;  2VUP A;  1BYE A;  3ZML A;  4ECI A;  1NM3 A;  3UBL A;  4CHS A;  1SK2 A;  3VPQ A;  2OBI A;  1SD8 A;  1EP8 A;  2H75 A;  3Q19 A;  2F3M A;  4WR4 A;  2XBQ A;  3FYG A;  2C8U A;  2I9H A;  4FYU A;  3DWV A;  3HVV A;  3LXZ A;  2YJ7 A;  2QSI A;  3FKF A;  3EU3 A;  3RPP A;  1F37 A;  4NWY A;  3L78 A;  1GSU A;  4ZB6 A;  1SJ6 A;  1M2D A;  1R7H A;  5KN0 A;  1G6W A;  3UAR A;  3GHA A;  1XWG A;  1H4O A;  1EOH A;  2YZH A;  5D9X A;  4O92 A;  2H1G A;  1QGV A;  2DJ0 A;  3PH9 A;  3MNG A;  3GH6 A;  4I8B A;  1OAZ A;  2MBT A;  1ZYQ B;  2GT6 A;  4MAB A;  1A24 A;  2V32 A;  3P8W A;  3K8N A;  2H6X A;  4K7I A;  5DAK B;  1EEJ A;  1GTU A;  1AAZ A;  1DUG A;  1LBK A;  2M72 A;  6GSU A;  1Z9H A;  2VCV A;  3EE2 A;  4TXO B;  1AW9 A;  4MH3 A;  3D0Z A;  2LJA A;  4YAV A;  4KX4 A;  2C1Y A;  3TKP A; 
#chains in the Genus database with same CATH topology
 4PGT A;  3AY8 A;  4BPY A;  1M9B A;  1K0M A;  3R2Q A;  4YAP A;  3VFI A;  4O5U A;  1NSW A;  3VLN A;  4KA0 A;  4GWR A;  2UZ8 A;  1XZO A;  3UEM A;  5DQS A;  3ZRE A;  5C00 A;  3TKS C;  1B9Y C;  2VCX A;  1YF0 A;  5LD0 A;  1O85 A;  2L6D A;  1SYX A;  5B8B A;  4ILF A;  1BQ7 A;  5GST A;  5F06 A;  1B4Q A;  4TRX A;  4XRA A;  1KEB A;  4HU9 A;  3ZIJ A;  3RPN A;  5DQY A;  5D93 A;  2CZ3 A;  3G7Y A;  5G2Z A;  12GS A;  1PFO A;  3EUR A;  4F0C A;  5A4V A;  1F2E A;  4K2X A;  1SL1 B;  4PXO A;  2K8V A;  1THO A;  1U3A A;  1HQO A;  2IL3 A;  3LSZ A;  2R5G A;  3IK7 A;  1GSE A;  2VLV A;  1TK8 B;  4EC0 A;  3UVH A;  1Z3E A;  3GL3 A;  1UVZ A;  3UBK A;  5DCG A;  1AXD A;  1VGL A;  2R0C A;  4EUY A;  2V6O A;  4GST A;  3KGK A;  4O5Q A;  5CP1 A;  3HD5 A;  1ERU A;  1V9W A;  3VPT A;  1GP1 A;  4LL1 B;  5IO2 A;  3DYR A;  2FWG A;  4KUN A;  4X4J A;  4JRR A;  4OCE A;  1FOH A;  2E2M A;  3FMW A;  2KUC A;  4I2U A;  4G19 A;  3ZFL A;  4BIK A;  2LST A;  3FZA A;  4ULX A;  2X64 A;  3E3E A;  2C3N A;  2HYX A;  3M9K A;  3L9U A;  4AF2 A;  4CY8 A;  5ECQ B;  1GLP A;  1M99 A;  3W8S A;  5A4W A;  1VRS D;  5EL8 A;  3TJF A;  1W4V A;  2GSR A;  4Q5Q A;  1WIK A;  1K0O A;  3CSH A;  4D73 B;  3IA1 A;  2FA8 A;  2NBS A;  3QOU A;  4WET A;  4JZQ A;  5IOX A;  2PN8 A;  1O73 A;  1B8X A;  4KDY A;  5FWG A;  4FYC A;  3TCO A;  3ZZX A;  3F3R A;  5IO0 A;  6GSS A;  2VCW A;  5DBQ A;  2AB6 A;  2LQQ A;  2V1M A;  5CRE A;  1WJK A;  2OAC A;  2FWF A;  5FT3 A;  4TR0 A;  2WUL A;  4FH8 A;  1XWB A;  3S9F A;  3RDW A;  2G2Q A;  4RQX A;  1HNC A;  1YZX A;  3GNJ A;  4IQA A;  3LWA A;  1BAY A;  1W89 A;  4NAX A;  3SWL A;  1PMT A;  4J56 E;  5IPG A;  2FGX A;  1Z5Y E;  3BJ5 A;  4KH7 A;  3A5W A;  4OFN A;  5F0G A;  3TRX A;  2A2S A;  3LFL A;  3EMX A;  2X8H A;  4F9Z A;  3H4K A;  4QL9 A;  4MJC A;  5AGY A;  3KMN A;  1A0R P;  1K0C A;  2GQL A;  5F8B A;  4GCI A;  5CRH A;  4IHU A;  2CAI A;  1O7U A;  1PRX A;  3I69 A;  4ECJ A;  3GIX A;  3U5R E;  3TRQ A;  4HS1 A;  1FW1 A;  3DEX A;  5IIZ A;  2JSY A;  3MAK A;  4MCU A;  4L0W A;  5ECR B;  1DBY A;  3TOT A;  2XPE A;  2YNX A;  4G0L A;  2YP6 A;  14GS A;  5GAP D;  4XS4 B;  2NDO A;  2ZNM A;  1EOG A;  2WCI A;  5INY A;  1GL8 A;  1XBS A;  2JSZ A;  3HY2 A;  1DSB A;  2LJR A;  3APS A;  2RUE A;  2R37 A;  1YDK A;  2TRC P;  3C8E A;  3R3E A;  3ZVJ D;  2K8S A;  5KN3 A;  4HZ2 A;  2DJ3 A;  2VD1 A;  2YWM A;  2H1A A;  4F82 A;  3QCP A;  2HRF A;  3F3Q A;  3IAS 2;  2JZT A;  2IN3 A;  5JCW A;  2PVO C;  3IV4 A;  1SD9 A;  4TOP A;  2HZE A;  4MH2 A;  3DML A;  4AJ8 A;  4E8H A;  1XWC A;  3D5J A;  1ML6 A;  4V2N A;  1XWK A;  2HSH A;  1GNE A;  4TN8 A;  2B3S A;  1X9W B;  1R5P A;  1J08 A;  2H8L A;  1A8Y A;  3CTF A;  1G6Y A;  5ABR A;  3ZLP A;  1T7P B;  3GKN A;  4KB3 A;  2P5R A;  3FEU A;  4V1A p;  3GTU B;  4I2T A;  3GH9 A;  1XOB A;  1S3R A;  1BED A;  3F4R A;  1A8L A;  2B7K A;  3Q18 A;  4OCF A;  4FIW A;  1XFL A;  1SEN A;  2KP2 A;  2QC7 A;  2DMM A;  5IM9 A;  5IPH A;  2FY6 A;  2GST A;  2DJK A;  4FO5 A;  1ZGN A;  5HR1 A;  4BA7 A;  1OC3 A;  2M80 A;  3A5I A;  1TK0 B;  4FYB A;  13GS A;  3CBU A;  4EKZ A;  1TU8 A;  3ERF A;  1GH2 A;  3GTU A;  4POL A;  2B6M A;  3F63 A;  3TKR A;  4KE3 A;  3KZQ A;  2YJH A;  2DSA A;  1KTE A;  5AIX A;  4J57 E;  1R26 A;  1GTI A;  1XW9 A;  5E4W A;  3TOU A;  2O89 A;  2DBC A;  5AIV A;  3HZ8 A;  5ELG A;  3ZVJ A;  3KM6 A;  1G7O A;  2VL2 A;  4NMU A;  4DVC A;  2VL9 A;  3CXG A;  1T1V A;  3UMA A;  3BD2 A;  3QAW A;  2C0G A;  2B5X A;  6GST A;  3NZN A;  2YPM A;  2N5A A;  1M9A A;  1X9M B;  3EMP A;  5BRT A;  2HFD A;  5ECI B;  2M46 A;  4TR1 B;  3H93 A;  2VCQ A;  1PGT A;  2ON7 A;  4EVM A;  1EV9 A;  3L4N A;  4LLR A;  3L0H A;  5AN1 A;  3TGZ A;  4MZC A;  4XHM A;  1TJD A;  2LRC A;  1K3L A;  1YKA A;  2X8G A;  1M2B A;  3HCZ A;  3TUE A;  5GAN D;  1KBN A;  4JR4 A;  1U6T A;  2YZU A;  4HJ2 A;  3WT1 A;  3A3T A;  3RBT A;  1DE2 A;  4HEA 2;  1EZK A;  1TRV A;  5J41 A;  3QAG A;  3KP8 A;  3QDN A;  1PSQ A;  4L5L A;  3M3M A;  1CQH A;  4ISD A;  2H0G A;  3CSI A;  4YQM A;  4OFT A;  3A2W A;  3QFA C;  3GUS A;  3QD9 A;  5HR0 A;  3GUR A;  2GZP A;  3O3T A;  1O8X A;  3FHK A;  4POB A;  3CTG A;  2XHF A;  4XRD A;  3GYK A;  5J5N A;  2YWI A;  3LQ7 A;  2HZF A;  3CRT A;  1GLQ A;  3N9J A;  1ERW A;  2H1D A;  4XS6 A;  2B5Y A;  2I4A A;  4IN0 A;  1PX7 A;  3GA4 A;  4FQU A;  3L9V A;  1X5D A;  4WF5 A;  3DRN A;  4EIP A;  2F9S A;  3FR9 A;  4X43 A;  4DSR A;  4RI6 A;  5CAX A;  1T8E B;  1QFN A;  2NTO A;  2A2R A;  4K9Z A;  2JAD A;  2ALB A;  1TKD B;  1QXH A;  2C80 A;  1GSF A;  4IS0 A;  3WGD A;  1FAA A;  3C7M A;  2GSS A;  1GUH A;  1A2J A;  2PBJ A;  4PQI A;  1RK4 A;  3IE3 A;  2H6Z A;  4WXT A;  1ST9 A;  1V57 A;  2VCZ A;  3TJK A;  3MYD A;  1X0R A;  4EE0 A;  2QKE A;  4PUR A;  4TW5 A;  5DAK A;  4MK3 A;  1TRW A;  5GSS A;  1UC7 A;  2HLS A;  4ZL8 A;  2H74 A;  4LMV A;  2D2Z A;  4BWQ A;  3UVT A;  4ZB8 A;  4ZIJ A;  4TXO A;  2VLT A;  2IIY A;  3LJR A;  4ZBA A;  3NOF A;  4TKY A;  1YQ1 A;  2A4V A;  4DSQ A;  4K5S A;  5EVO A;  1QQ2 A;  2AHE A;  1DE1 A;  1JZW A;  2V41 A;  4KGI A;  3RHB A;  1YY7 A;  2H72 A;  2IFQ B;  1ACV A;  5ID2 B;  3QR6 A;  1SK1 A;  5JWR B;  1OKT A;  2XPD A;  3TDG A;  3PIN A;  4H86 A;  2B1K A;  2C3Q A;  2H6Y A;  4EDY A;  4BL7 B;  4KCE A;  3E0U A;  2VO4 A;  1VF4 A;  4KF9 A;  10GS A;  2RUF A;  3EVI A;  2EIR A;  2YN1 A;  1E6B A;  2GLR A;  3DVX A;  4PUA A;  2GQK A;  4F2I A;  6GSX A;  1GRX A;  4K7N A;  4N10 A;  2LNT A;  3IXR A;  2X4A A;  2IFQ A;  4MPG A;  5H5Q A;  5ID2 A;  1FB0 A;  5DJM A;  3APO A;  4RI7 A;  3A2X A;  1TTZ A;  2DLX A;  4GF0 A;  2FHE A;  4HQZ A;  2V2G A;  4BL7 A;  3IPZ A;  1AC1 A;  3KJY A;  4G2E A;  1SJI A;  2WFC A;  2X99 A;  2IJY A;  3GKM A;  1AIU A;  1MD4 A;  2OKA A;  4A5P A;  2B5E A;  3HDC A;  5J4U A;  4AJ7 A;  1PL2 A;  2LV3 A;  2GZY A;  4V1A g;  5ECP B;  1E2Y A;  4JR6 A;  3H1N A;  1T4Y A;  3ZYW A;  5B6M A;  2OAD A;  4I6X A;  3M8N A;  2CV4 A;  5A4U A;  3LXT A;  2HNL A;  3MSZ A;  2OJL A;  1MDJ A;  3BCI A;  1ZYN A;  1ZYE A;  1GUM A;  3ZTL A;  5B6N A;  2H19 A;  3D6I A;  3VWV A;  2KOK A;  5G1L A;  3EU4 A;  2CX4 A;  1WOU A;  5F07 A;  7GSS A;  2QA1 A;  4ZIL A;  1A0F A;  1Z6M A;  1TRU A;  2IMI A;  3BBY A;  1F3B A;  2H0H A;  3LYP A;  3EWL A;  1VF2 A;  5HQP A;  4X1U A;  3BCK A;  2LRT A;  4POM A;  1EGO A;  1Y25 A;  3HA9 A;  1BG5 A;  4AGS A;  3GST A;  4OMV A;  1YEX A;  4HQS A;  2DJ2 A;  5D8I A;  1XOA A;  2VD0 A;  5IMA A;  1MEK A;  1GUK A;  4CDO A;  3WD6 A;  3F6F A;  5LNK e;  1IYI A;  4D73 A;  1LU4 A;  2P0G A;  4GSN A;  3IK9 A;  1X9S B;  4RUV A;  2O7K A;  2WRT A;  1M7T A;  2DIZ A;  3EYT A;  4Z2U A;  2F8F A;  1TW9 A;  2L59 A;  3CSJ A;  4LMW A;  2CAQ A;  2H73 A;  4MF6 A;  4ML6 A;  4Q5R A;  1ERT A;  4I5Q A;  5C04 A;  1PX6 A;  2XC2 A;  4IP1 A;  2TIR A;  2C4J A;  4X0X A;  4K0N A;  3WGE A;  9GSS A;  3LGC A;  1K0N A;  4MJB A;  3M1G A;  3ZMK A;  1XPV A;  4HOJ A;  1Q4J A;  1V58 A;  22GS A;  5DAL B;  2FNO A;  2EIO A;  2OE0 A;  1EGR A;  4GXZ A;  1Z7R A;  4ZXG A;  3TJG A;  4JED A;  4PNF A;  4AJ6 A;  1JLV A;  4ECB A;  3LOR A;  1TDI A;  1X5C A;  3M0F A;  3ED3 A;  2GGT A;  1SYR A;  2CX3 A;  1HNB A;  4OWY A;  5AIS A;  1V98 A;  3LEF A;  4MF7 A;  4L8E A;  3F6D A;  1OC9 B;  4JBB A;  5CNW A;  3QMX A;  5F05 A;  5KN2 A;  1G7E A;  3EIN A;  3HXS A;  4WEY A;  1GSD A;  4OFM A;  3HJO A;  2MYG A;  3U6V A;  1SL2 B;  2MMO A;  1A23 A;  4ECC A;  4HJM A;  2VAF A;  3EPT A;  3FZ5 A;  3KP9 A;  1PQN A;  2MBS A;  4J2F A;  2LNS A;  4N0Z A;  4HDE A;  5ECL B;  4XS4 A;  1J0F A;  2YCD A;  2DML A;  2HE3 A;  16GS A;  1TK5 B;  4WR5 A;  1QMV A;  3KH9 A;  1JHB A;  4O5R A;  4ICY A;  4CW9 A;  2L5L A;  5D9W A;  2KHP A;  4G0K A;  1KNG A;  3HVN A;  4TR3 A;  2ES7 A;  2IWT A;  1SKR B;  2F8A A;  4TXV A;  1J9B A;  4V2M A;  4GLT A;  4K6X A;  1ILO A;  3GV1 A;  3DGQ A;  2EC4 A;  1FHE A;  1R4W A;  2YV9 A;  2L4C A;  1ZOF A;  3TJB A;  1NW2 A;  3IC4 A;  2IMK A;  2NPB A;  2LTK A;  5IMZ A;  3HJP A;  3TJJ A;  2CT6 A;  3GX0 A;  2C0F A;  4MNN A;  2TRX A;  3WGX A;  2B7J A;  3EC3 A;  1I5G A;  1ZCP A;  4IW9 A;  3Q74 A;  2L4Q A;  4LL4 B;  3F0I A;  1ABA A;  2HT9 A;  5D9T A;  2GQM A;  1S3A A;  1OE7 A;  3F4T A;  3F4S A;  1U3I A;  4PTS A;  4WKW A;  1SKW B;  1K3O A;  3FZ4 A;  1XCC A;  2PGT A;  4WBR D;  2OE3 A;  2GZZ A;  2PPT A;  5J9C A;  2AUV A;  4GSS A;  1K3Y A;  5EPF A;  2HSM A;  1IYH A;  2LRN A;  4V2L A;  4NHZ A;  5DVB A;  2ZCT A;  1BX9 A;  2C3T A;  1ZMA A;  4K7O A;  6GSY A;  2E2G A;  2VL2 C;  2P31 A;  3VUR A;  4EXJ A;  1TOF A;  3ZIT A;  1QK8 A;  4IJI A;  2H01 A;  4BVY B;  2QGV A;  4CY6 A;  2DC5 A;  4BVX B;  3LYK A;  3IDV A;  2R0G A;  2REM A;  2WB9 A;  3I43 A;  1F6M C;  1FG4 A;  1B48 A;  3Q6O A;  4YKF A;  2YV7 A;  5GZZ B;  2E0Q A;  5D9V A;  2FCH A;  1YKC A;  3HKR A;  3VI7 A;  2PER A;  1YJ6 A;  2LUS A;  1I9D A;  4GRF A;  4TR1 A;  2K6V A;  3TB2 A;  5JWO B;  4BVY A;  2I1U A;  1THX A;  1UA5 A;  2GTU A;  3FK8 A;  3D21 A;  5G31 A;  1JZD A;  3C71 A;  4DSS B;  4MPF A;  4ML1 A;  6GSW A;  1T4Z A;  4QQ7 A;  5DDL A;  4POK A;  4MZW A;  1JZO A;  4L5O A;  1X5E A;  4YQU A;  3ZL5 A;  1V2A A;  5IMF A;  5FHI A;  3PR8 A;  3ERG A;  3D4M A;  1WPI A;  2XBI A;  4G0I A;  5JWQ B;  1BJX A;  3DIE A;  3IC8 A;  2VM1 A;  3C73 A;  3PPU A;  4G9H A;  2V6K A;  1N8J A;  3HJM A;  1EV4 A;  4NXI A;  5HR2 A;  5ECK B;  2DJ1 A;  2JU5 A;  1OYJ A;  2HSY A;  1TI1 A;  2ZUP A;  2H70 A;  4DSS A;  1PN0 A;  2DKI A;  4OO5 A;  2FWH A;  3N5O A;  2R6K A;  1PKW A;  4XCS A;  1M0U A;  3QAV A;  3HVS A;  8GSS A;  5KOX A;  1XG8 A;  5ECS A;  3I9V 2;  2WJU A;  2AAW A;  5J3R A;  1WRY A;  3TKQ A;  2VLU A;  4HZ4 A;  4PQ1 A;  3VWX A;  1CQG A;  2IMF A;  3HZ4 A;  4IBP A;  1HNA A;  1RQM A;  2WGR A;  2LS5 A;  4MLY A;  4KND A;  2H0I A;  5ENU A;  4Q5F A;  4E8E A;  4BWS A;  3JCM L;  1GNW A;  3KEB A;  3UAP A;  4OD7 A;  3UL3 A;  6GSV A;  5IMV A;  3TKS A;  3DXB A;  3OR5 A;  5IMC A;  4ZL7 A;  1SU9 A;  2AYT A;  1SKS B;  1USB A;  3D22 A;  2CQ9 A;  2GSQ A;  1WE0 A;  2A4H A;  2HRA A;  3M9J A;  1PKZ A;  2IME A;  2PMT A;  1TP9 A;  3E9J B;  4N30 A;  1PD2 1;  2I3Y A;  1TU7 A;  2VCT A;  3C1R A;  1Y6E A;  4PX1 A;  4Q5N A;  3KTB A;  5B7C A;  4YH2 A;  4YQV A;  2VOC A;  1U88 A;  2E7P A;  1FVK A;  2HI7 A;  2DIY A;  4ZBD A;  4IVF A;  5G5F A;  2PVQ A;  2L5O A;  3RHC A;  3GMF A;  2L57 A;  5CYY A;  1B9X C;  3GRX A;  4I97 A;  1EWX A;  1Z6N A;  4K0G A;  3LW9 A;  17GS A;  2WDU A;  3L9S A;  3KCM A;  1FVJ A;  2H76 A;  3GN3 A;  4PUF C;  3GX8 A;  2O87 A;  5IQY A;  1TRS A;  5B8A A;  1EP7 A;  3UJ1 A;  3HHV A;  2HXK A;  1MDK A;  1EEM A;  3GKK A;  4K1F A;  4N0V A;  5H5S A;  4IJ3 A;  3J7Y b;  4MZB A;  5ECO B;  2P5Q A;  2FWE A;  2JZR A;  2QA2 A;  1MD3 A;  5EY6 A;  5A5K A;  1XIY A;  1NHY A;  3MWH A;  3G9B A;  3G7J A;  20GS A;  3W8J A;  4KAE A;  3H8Q A;  5COH A;  1U87 A;  5DCH A;  1S3D A;  1H75 A;  3VK9 A;  3FR3 A;  3KTL A;  11GS A;  3MDK A;  3QPM A;  1MTC A;  1ZYP A;  5D96 A;  3SBC A;  3IBH A;  2O8V B;  1FB6 A;  2YAN A;  3D4T A;  5CRD A;  1FOV A;  5JCU A;  5CRW A;  3C1S A;  3H79 A;  2FUG 2;  1O6J A;  1QUW A;  4NPB A;  1AQX A;  1NHO A;  1RW1 A;  1TXX A;  4IP6 A;  1ZZY A;  4KSM A;  1T3B A;  4LA1 A;  4MJA A;  4EL1 A;  3US3 A;  3ERW A;  1PA3 A;  4P3Y B;  3P2A A;  2GS3 A;  5ELA A;  1O81 A;  4NHW A;  5HFK A;  19GS A;  3IHQ A;  5IOW A;  2H30 A;  1GSQ A;  4KW6 A;  2R0P A;  3VWU A;  3FW2 A;  4XIH A;  2YWO A;  2OA7 A;  4F0B A;  4MJE A;  5D73 A;  3WT2 A;  2MMN A;  1Q98 A;  1T00 A;  1GWC A;  3O6T A;  2X8C A;  2C0D A;  3DVW A;  5BMU A;  4KSO A;  4L0U A;  1OVN A;  5HFG A;  2OE1 A;  4ZL9 A;  1UN2 A;  1TI3 A;  2MMA A;  4KDX A;  1R5A A;  2CVK A;  1PN9 A;  4DEJ A;  3HVX A;  2CZ2 A;  4XTS A;  1JZR A;  2VM2 A;  3CYN A;  1AUC A;  1SK0 A;  1JLW A;  3IAM 2;  3IOS A;  4KDU A;  2DKH A;  4MDC A;  1HYU A;  5LCZ A;  4K2D A;  4K8M A;  18GS A;  2CVB A;  4HUA A;  3G7I A;  2RLI A;  2VL3 A;  5CO3 A;  3PGT A;  4EDZ A;  4USS A;  4HI7 A;  4WF4 A;  2O85 A;  2NVL A;  3APQ A;  2F51 A;  4JU5 A;  2FA4 A;  3FRC A;  2KP1 A;  4QL7 A;  4TR4 A;  5L71 A;  2CA8 A;  4KCA A;  2VIM A;  1YEP A;  2L6C A;  1XW6 A;  1C72 A;  5G5E A;  1A2M A;  3CRU A;  2CVD A;  3DD3 A;  3WYW A;  4EF0 A;  5DAL A;  1K0D A;  1XXU A;  4PNG A;  3QFB C;  4TVE A;  4EIQ A;  2MZC A;  4NV5 A;  2GVP A;  1WMJ A;  3A2V A;  3KD0 A;  3RAZ A;  2HZE B;  4MMM A;  1SL0 B;  2BTO T;  1GSY A;  2DJJ A;  3TRP A;  2FD3 A;  4IEL A;  3J7Y k;  2BJX A;  3ZFB A;  3KMO A;  1M2A A;  2G0F A;  3ISO A;  3IHG A;  3CMI A;  4ZB9 A;  3W6G A;  1LJR A;  2WZ9 A;  1OC9 A;  2BMX A;  1AQW A;  2JL4 A;  1GSS A;  2J23 A;  5JCG A;  2K18 A;  3UIW A;  2PWJ A;  2H66 A;  1ERV A;  3VI5 A;  3P90 A;  1B4P A;  1MDI A;  3O76 A;  4IGJ A;  1HD2 A;  1V40 A;  3UOM A;  1M3I A;  1URM A;  1WWJ A;  2R2J A;  2N5F A;  5H5R A;  4Z2T A;  2A2P A;  3FZ9 A;  4F03 A;  5KN1 A;  4Z7X A;  4IQ1 A;  5HR3 A;  2RII A;  2LKU A;  2WS2 A;  2KLX A;  5KEJ A;  3GSS A;  1F3A A;  1OC8 A;  1Z7P A;  1OE8 A;  2J9H A;  1GUL A;  2FLS A;  4NV2 A;  4RQR A;  2PUK C;  2H71 A;  1ZL9 A;  5CRG A;  2ON5 A;  4GTU A;  3GKX A;  4YKG A;  4O7H A;  4XS1 A;  4GQC A;  2LQO A;  3V1W A;  3GFK A;  1FO5 A;  2R4V A;  3I6A A;  3IRA A;  1K0B A;  2EIQ A;  3F9U A;  1PL1 A;  1VF3 A;  3KXO A;  3NIV A;  1N2A A;  2AJQ B;  3DKS A;  4MF5 A;  4JE1 A;  1AQV A;  2LEG A;  4O32 A;  5ECN B;  5DJL A;  1WP0 A;  3KIJ A;  2Z9S A;  5HFI A;  5G30 A;  2AV4 A;  3ZRD A;  3TKS E;  2GDR A;  2YWN A;  4GQF A;  1K0A A;  4OO4 A;  2N5B A;  3LG6 A;  2YOI A;  3P7X A;  2C0E A;  5IMD A;  4MP4 A;  1O8W A;  5E59 A;  1ON4 A;  1YF1 A;  4G10 A;  4HSC X;  1XVW A;  3ME7 A;  3ZIV A;  1A2L A;  3F8U A;  1XVQ A;  5J9B A;  2IPA A;  4PQH A;  2OBK A;  4WBJ A;  1G0T A;  4N11 A;  2RM5 A;  2LJK A;  2K9F A;  2H1B A;  4Z2R A;  2I81 A;  1XWA A;  5ECH B;  1JFU A;  2JZS A;  5G1K A;  4EO3 A;  1S3C A;  2HRN A;  2JAC A;  3IR4 A;  1OKD A;  2R3X A;  5ECM B;  3GL5 A;  3CQF A;  3KH7 A;  3FY7 A;  3FR6 A;  3VWW A;  1GTA A;  4MA9 A;  4HU7 A;  4K5R A;  2MMZ A;  1XW5 A;  3HYP A;  4ZBB A;  4IKH A;  4BVX A;  1GTB A;  4ACS A;  1SJZ A;  1VF1 A;  2B1L A;  3ME8 A;  4ID0 A;  2GT5 A;  1F9M A;  2PU9 C;  3BOA A;  5KOW A;  2IMD A;  2RM6 A;  2VUP A;  1BYE A;  3ZML A;  4ECI A;  1NM3 A;  3UBL A;  4CHS A;  1SK2 A;  3VPQ A;  2OBI A;  1SD8 A;  1EP8 A;  2H75 A;  3Q19 A;  2F3M A;  4WR4 A;  2XBQ A;  3FYG A;  2C8U A;  2I9H A;  2HRK A;  4FYU A;  3DWV A;  3HVV A;  3LXZ A;  2YJ7 A;  1M3J A;  2QSI A;  3FKF A;  3EU3 A;  3RPP A;  1F37 A;  4NWY A;  3L78 A;  1GSU A;  4ZB6 A;  1SJ6 A;  1M2D A;  1R7H A;  5KN0 A;  1G6W A;  3UAR A;  3GHA A;  1XWG A;  1H4O A;  1EOH A;  2YZH A;  5D9X A;  4O92 A;  2H1G A;  1QGV A;  2DJ0 A;  3PH9 A;  3MNG A;  3GH6 A;  4I8B A;  1OAZ A;  2MBT A;  1ZYQ B;  2GT6 A;  4MAB A;  1A24 A;  2V32 A;  3P8W A;  3K8N A;  2H6X A;  4K7I A;  5DAK B;  1EEJ A;  1GTU A;  1AAZ A;  1DUG A;  1LBK A;  2M72 A;  6GSU A;  1Z9H A;  2VCV A;  3EE2 A;  4TXO B;  1AW9 A;  4MH3 A;  2X49 A;  3D0Z A;  2LJA A;  4YAV A;  4KX4 A;  3MIX A;  2C1Y A;  3TKP A; 
#chains in the Genus database with same CATH homology
 4PGT A;  3AY8 A;  4BPY A;  1M9B A;  1K0M A;  3R2Q A;  4YAP A;  3VFI A;  4O5U A;  1NSW A;  3VLN A;  4KA0 A;  4GWR A;  2UZ8 A;  1XZO A;  3UEM A;  5DQS A;  3ZRE A;  5C00 A;  3TKS C;  1B9Y C;  2VCX A;  1YF0 A;  5LD0 A;  1O85 A;  2L6D A;  1SYX A;  5B8B A;  4ILF A;  1BQ7 A;  5GST A;  5F06 A;  1B4Q A;  4TRX A;  4XRA A;  1KEB A;  4HU9 A;  3ZIJ A;  3RPN A;  5DQY A;  5D93 A;  2CZ3 A;  3G7Y A;  5G2Z A;  12GS A;  3EUR A;  4F0C A;  5A4V A;  1F2E A;  4K2X A;  1SL1 B;  4PXO A;  2K8V A;  1THO A;  1U3A A;  1HQO A;  2IL3 A;  3LSZ A;  2R5G A;  3IK7 A;  1GSE A;  2VLV A;  1TK8 B;  4EC0 A;  3UVH A;  1Z3E A;  3GL3 A;  1UVZ A;  3UBK A;  5DCG A;  1AXD A;  1VGL A;  2R0C A;  4EUY A;  2V6O A;  4GST A;  3KGK A;  4O5Q A;  5CP1 A;  3HD5 A;  1ERU A;  1V9W A;  3VPT A;  1GP1 A;  4LL1 B;  5IO2 A;  3DYR A;  2FWG A;  4KUN A;  4X4J A;  4JRR A;  4OCE A;  1FOH A;  2E2M A;  3FMW A;  2KUC A;  4I2U A;  4G19 A;  3ZFL A;  2LST A;  3FZA A;  4ULX A;  2X64 A;  3E3E A;  2C3N A;  2HYX A;  3M9K A;  3L9U A;  4AF2 A;  4CY8 A;  5ECQ B;  1GLP A;  1M99 A;  3W8S A;  5A4W A;  1VRS D;  5EL8 A;  3TJF A;  1W4V A;  2GSR A;  4Q5Q A;  1WIK A;  1K0O A;  3CSH A;  4D73 B;  3IA1 A;  2FA8 A;  2NBS A;  3QOU A;  4WET A;  4JZQ A;  5IOX A;  2PN8 A;  1O73 A;  1B8X A;  4KDY A;  5FWG A;  4FYC A;  3TCO A;  3ZZX A;  3F3R A;  5IO0 A;  6GSS A;  2VCW A;  5DBQ A;  2AB6 A;  2LQQ A;  2V1M A;  5CRE A;  1WJK A;  2OAC A;  2FWF A;  5FT3 A;  4TR0 A;  2WUL A;  4FH8 A;  1XWB A;  3S9F A;  3RDW A;  2G2Q A;  4RQX A;  1HNC A;  1YZX A;  3GNJ A;  4IQA A;  3LWA A;  1BAY A;  1W89 A;  4NAX A;  3SWL A;  1PMT A;  4J56 E;  5IPG A;  2FGX A;  1Z5Y E;  3BJ5 A;  4KH7 A;  3A5W A;  4OFN A;  5F0G A;  3TRX A;  2A2S A;  3LFL A;  3EMX A;  2X8H A;  4F9Z A;  3H4K A;  4QL9 A;  4MJC A;  5AGY A;  3KMN A;  1A0R P;  1K0C A;  2GQL A;  5F8B A;  4GCI A;  5CRH A;  4IHU A;  2CAI A;  1O7U A;  1PRX A;  3I69 A;  4ECJ A;  3GIX A;  3U5R E;  3TRQ A;  4HS1 A;  1FW1 A;  3DEX A;  5IIZ A;  2JSY A;  3MAK A;  4MCU A;  4L0W A;  5ECR B;  1DBY A;  3TOT A;  2XPE A;  2YNX A;  4G0L A;  2YP6 A;  14GS A;  5GAP D;  4XS4 B;  2NDO A;  2ZNM A;  1EOG A;  2WCI A;  5INY A;  1GL8 A;  1XBS A;  2JSZ A;  3HY2 A;  1DSB A;  2LJR A;  3APS A;  2RUE A;  2R37 A;  1YDK A;  2TRC P;  3C8E A;  3R3E A;  3ZVJ D;  2K8S A;  5KN3 A;  4HZ2 A;  2DJ3 A;  2VD1 A;  2YWM A;  2H1A A;  4F82 A;  3QCP A;  2HRF A;  3F3Q A;  3IAS 2;  2JZT A;  2IN3 A;  5JCW A;  2PVO C;  3IV4 A;  1SD9 A;  4TOP A;  2HZE A;  4MH2 A;  3DML A;  4AJ8 A;  4E8H A;  1XWC A;  3D5J A;  1ML6 A;  4V2N A;  1XWK A;  2HSH A;  1GNE A;  4TN8 A;  2B3S A;  1X9W B;  1R5P A;  1J08 A;  2H8L A;  1A8Y A;  3CTF A;  1G6Y A;  5ABR A;  3ZLP A;  1T7P B;  3GKN A;  4KB3 A;  2P5R A;  3FEU A;  4V1A p;  3GTU B;  4I2T A;  3GH9 A;  1XOB A;  1BED A;  3F4R A;  1A8L A;  2B7K A;  3Q18 A;  4OCF A;  4FIW A;  1XFL A;  1SEN A;  2KP2 A;  2QC7 A;  2DMM A;  5IM9 A;  5IPH A;  2FY6 A;  2GST A;  2DJK A;  4FO5 A;  1ZGN A;  5HR1 A;  4BA7 A;  1OC3 A;  2M80 A;  3A5I A;  1TK0 B;  4FYB A;  13GS A;  3CBU A;  4EKZ A;  1TU8 A;  3ERF A;  1GH2 A;  3GTU A;  4POL A;  2B6M A;  3F63 A;  3TKR A;  4KE3 A;  3KZQ A;  2YJH A;  2DSA A;  1KTE A;  5AIX A;  4J57 E;  1R26 A;  1GTI A;  1XW9 A;  5E4W A;  3TOU A;  2O89 A;  2DBC A;  5AIV A;  3HZ8 A;  5ELG A;  3ZVJ A;  3KM6 A;  1G7O A;  2VL2 A;  4NMU A;  4DVC A;  2VL9 A;  3CXG A;  1T1V A;  3UMA A;  3BD2 A;  3QAW A;  2C0G A;  2B5X A;  6GST A;  3NZN A;  2YPM A;  2N5A A;  1M9A A;  1X9M B;  3EMP A;  5BRT A;  2HFD A;  5ECI B;  2M46 A;  4TR1 B;  3H93 A;  2VCQ A;  1PGT A;  2ON7 A;  4EVM A;  1EV9 A;  3L4N A;  4LLR A;  3L0H A;  5AN1 A;  3TGZ A;  4MZC A;  4XHM A;  1TJD A;  2LRC A;  1K3L A;  1YKA A;  2X8G A;  1M2B A;  3HCZ A;  3TUE A;  5GAN D;  1KBN A;  4JR4 A;  1U6T A;  2YZU A;  4HJ2 A;  3WT1 A;  3A3T A;  3RBT A;  1DE2 A;  4HEA 2;  1EZK A;  1TRV A;  5J41 A;  3QAG A;  3KP8 A;  3QDN A;  1PSQ A;  4L5L A;  3M3M A;  1CQH A;  4ISD A;  2H0G A;  3CSI A;  4YQM A;  4OFT A;  3A2W A;  3QFA C;  3GUS A;  3QD9 A;  5HR0 A;  3GUR A;  2GZP A;  3O3T A;  1O8X A;  3FHK A;  4POB A;  3CTG A;  2XHF A;  4XRD A;  3GYK A;  5J5N A;  2YWI A;  3LQ7 A;  2HZF A;  3CRT A;  1GLQ A;  3N9J A;  1ERW A;  2H1D A;  4XS6 A;  2B5Y A;  2I4A A;  4IN0 A;  1PX7 A;  3GA4 A;  4FQU A;  3L9V A;  1X5D A;  4WF5 A;  3DRN A;  4EIP A;  2F9S A;  3FR9 A;  4X43 A;  4DSR A;  4RI6 A;  5CAX A;  1T8E B;  1QFN A;  2NTO A;  2A2R A;  4K9Z A;  2JAD A;  2ALB A;  1TKD B;  1QXH A;  2C80 A;  1GSF A;  4IS0 A;  3WGD A;  1FAA A;  3C7M A;  2GSS A;  1GUH A;  1A2J A;  2PBJ A;  4PQI A;  1RK4 A;  3IE3 A;  2H6Z A;  4WXT A;  1ST9 A;  1V57 A;  2VCZ A;  3TJK A;  3MYD A;  1X0R A;  4EE0 A;  2QKE A;  4PUR A;  4TW5 A;  5DAK A;  4MK3 A;  1TRW A;  5GSS A;  1UC7 A;  2HLS A;  4ZL8 A;  2H74 A;  4LMV A;  2D2Z A;  4BWQ A;  3UVT A;  4ZB8 A;  4ZIJ A;  4TXO A;  2VLT A;  2IIY A;  3LJR A;  4ZBA A;  3NOF A;  4TKY A;  1YQ1 A;  2A4V A;  4DSQ A;  4K5S A;  5EVO A;  1QQ2 A;  2AHE A;  1DE1 A;  1JZW A;  2V41 A;  4KGI A;  3RHB A;  1YY7 A;  2H72 A;  2IFQ B;  1ACV A;  5ID2 B;  3QR6 A;  1SK1 A;  5JWR B;  1OKT A;  2XPD A;  3TDG A;  3PIN A;  4H86 A;  2B1K A;  2C3Q A;  2H6Y A;  4EDY A;  4BL7 B;  4KCE A;  3E0U A;  2VO4 A;  1VF4 A;  4KF9 A;  10GS A;  2RUF A;  3EVI A;  2EIR A;  2YN1 A;  1E6B A;  2GLR A;  3DVX A;  4PUA A;  2GQK A;  4F2I A;  6GSX A;  1GRX A;  4K7N A;  4N10 A;  2LNT A;  3IXR A;  2X4A A;  2IFQ A;  4MPG A;  5H5Q A;  5ID2 A;  1FB0 A;  5DJM A;  3APO A;  4RI7 A;  3A2X A;  1TTZ A;  2DLX A;  4GF0 A;  2FHE A;  4HQZ A;  2V2G A;  4BL7 A;  3IPZ A;  1AC1 A;  3KJY A;  4G2E A;  1SJI A;  2WFC A;  2X99 A;  2IJY A;  3GKM A;  1AIU A;  1MD4 A;  2OKA A;  4A5P A;  2B5E A;  3HDC A;  5J4U A;  4AJ7 A;  1PL2 A;  2LV3 A;  2GZY A;  4V1A g;  5ECP B;  1E2Y A;  4JR6 A;  3H1N A;  1T4Y A;  3ZYW A;  5B6M A;  2OAD A;  4I6X A;  3M8N A;  2CV4 A;  5A4U A;  3LXT A;  2HNL A;  3MSZ A;  2OJL A;  1MDJ A;  3BCI A;  1ZYN A;  1ZYE A;  1GUM A;  3ZTL A;  5B6N A;  2H19 A;  3D6I A;  3VWV A;  2KOK A;  5G1L A;  3EU4 A;  2CX4 A;  1WOU A;  5F07 A;  7GSS A;  2QA1 A;  4ZIL A;  1A0F A;  1Z6M A;  1TRU A;  2IMI A;  3BBY A;  1F3B A;  2H0H A;  3LYP A;  3EWL A;  1VF2 A;  5HQP A;  4X1U A;  3BCK A;  2LRT A;  4POM A;  1EGO A;  1Y25 A;  3HA9 A;  1BG5 A;  4AGS A;  3GST A;  4OMV A;  1YEX A;  4HQS A;  2DJ2 A;  5D8I A;  1XOA A;  2VD0 A;  5IMA A;  1MEK A;  1GUK A;  4CDO A;  3WD6 A;  3F6F A;  5LNK e;  1IYI A;  4D73 A;  1LU4 A;  2P0G A;  4GSN A;  3IK9 A;  1X9S B;  4RUV A;  2O7K A;  2WRT A;  1M7T A;  2DIZ A;  3EYT A;  4Z2U A;  2F8F A;  1TW9 A;  2L59 A;  3CSJ A;  4LMW A;  2CAQ A;  2H73 A;  4MF6 A;  4ML6 A;  4Q5R A;  1ERT A;  4I5Q A;  5C04 A;  1PX6 A;  2XC2 A;  4IP1 A;  2TIR A;  2C4J A;  4X0X A;  4K0N A;  3WGE A;  9GSS A;  3LGC A;  1K0N A;  4MJB A;  3M1G A;  3ZMK A;  1XPV A;  4HOJ A;  1Q4J A;  1V58 A;  22GS A;  5DAL B;  2FNO A;  2EIO A;  2OE0 A;  1EGR A;  4GXZ A;  1Z7R A;  4ZXG A;  3TJG A;  4JED A;  4PNF A;  4AJ6 A;  1JLV A;  4ECB A;  3LOR A;  1TDI A;  1X5C A;  3M0F A;  3ED3 A;  2GGT A;  1SYR A;  2CX3 A;  1HNB A;  4OWY A;  5AIS A;  1V98 A;  3LEF A;  4MF7 A;  4L8E A;  3F6D A;  1OC9 B;  4JBB A;  5CNW A;  3QMX A;  5F05 A;  5KN2 A;  1G7E A;  3EIN A;  3HXS A;  4WEY A;  1GSD A;  4OFM A;  3HJO A;  2MYG A;  3U6V A;  1SL2 B;  2MMO A;  1A23 A;  4ECC A;  4HJM A;  2VAF A;  3EPT A;  3FZ5 A;  3KP9 A;  1PQN A;  2MBS A;  4J2F A;  2LNS A;  4N0Z A;  4HDE A;  5ECL B;  4XS4 A;  1J0F A;  2YCD A;  2DML A;  2HE3 A;  16GS A;  1TK5 B;  4WR5 A;  1QMV A;  3KH9 A;  1JHB A;  4O5R A;  4ICY A;  4CW9 A;  2L5L A;  5D9W A;  2KHP A;  4G0K A;  1KNG A;  4TR3 A;  2ES7 A;  2IWT A;  1SKR B;  2F8A A;  4TXV A;  1J9B A;  4V2M A;  4GLT A;  4K6X A;  1ILO A;  3GV1 A;  3DGQ A;  2EC4 A;  1FHE A;  1R4W A;  2YV9 A;  2L4C A;  1ZOF A;  3TJB A;  1NW2 A;  3IC4 A;  2IMK A;  2NPB A;  2LTK A;  5IMZ A;  3HJP A;  3TJJ A;  2CT6 A;  3GX0 A;  2C0F A;  4MNN A;  2TRX A;  3WGX A;  2B7J A;  3EC3 A;  1I5G A;  1ZCP A;  4IW9 A;  3Q74 A;  2L4Q A;  4LL4 B;  3F0I A;  1ABA A;  2HT9 A;  5D9T A;  2GQM A;  1S3A A;  1OE7 A;  3F4T A;  3F4S A;  1U3I A;  4PTS A;  4WKW A;  1SKW B;  1K3O A;  3FZ4 A;  1XCC A;  2PGT A;  4WBR D;  2OE3 A;  2GZZ A;  2PPT A;  5J9C A;  2AUV A;  4GSS A;  1K3Y A;  5EPF A;  2HSM A;  1IYH A;  2LRN A;  4V2L A;  4NHZ A;  5DVB A;  2ZCT A;  1BX9 A;  2C3T A;  1ZMA A;  4K7O A;  6GSY A;  2E2G A;  2VL2 C;  2P31 A;  3VUR A;  4EXJ A;  1TOF A;  3ZIT A;  1QK8 A;  4IJI A;  2H01 A;  4BVY B;  2QGV A;  4CY6 A;  2DC5 A;  4BVX B;  3LYK A;  3IDV A;  2R0G A;  2REM A;  2WB9 A;  3I43 A;  1F6M C;  1FG4 A;  1B48 A;  3Q6O A;  4YKF A;  2YV7 A;  5GZZ B;  2E0Q A;  5D9V A;  2FCH A;  1YKC A;  3HKR A;  3VI7 A;  2PER A;  1YJ6 A;  2LUS A;  1I9D A;  4GRF A;  4TR1 A;  2K6V A;  3TB2 A;  5JWO B;  4BVY A;  2I1U A;  1THX A;  1UA5 A;  2GTU A;  3FK8 A;  3D21 A;  5G31 A;  1JZD A;  3C71 A;  4DSS B;  4MPF A;  4ML1 A;  6GSW A;  1T4Z A;  4QQ7 A;  5DDL A;  4POK A;  4MZW A;  1JZO A;  4L5O A;  1X5E A;  4YQU A;  3ZL5 A;  1V2A A;  5IMF A;  5FHI A;  3PR8 A;  3ERG A;  3D4M A;  1WPI A;  2XBI A;  4G0I A;  5JWQ B;  1BJX A;  3DIE A;  3IC8 A;  2VM1 A;  3C73 A;  3PPU A;  4G9H A;  2V6K A;  1N8J A;  3HJM A;  1EV4 A;  4NXI A;  5HR2 A;  5ECK B;  2DJ1 A;  2JU5 A;  1OYJ A;  2HSY A;  1TI1 A;  2ZUP A;  2H70 A;  4DSS A;  1PN0 A;  2DKI A;  4OO5 A;  2FWH A;  3N5O A;  2R6K A;  1PKW A;  4XCS A;  1M0U A;  3QAV A;  3HVS A;  8GSS A;  5KOX A;  5ECS A;  3I9V 2;  2WJU A;  2AAW A;  5J3R A;  1WRY A;  3TKQ A;  2VLU A;  4HZ4 A;  4PQ1 A;  3VWX A;  1CQG A;  2IMF A;  3HZ4 A;  4IBP A;  1HNA A;  1RQM A;  2WGR A;  2LS5 A;  4MLY A;  4KND A;  2H0I A;  5ENU A;  4Q5F A;  4E8E A;  4BWS A;  3JCM L;  1GNW A;  3KEB A;  3UAP A;  4OD7 A;  3UL3 A;  6GSV A;  5IMV A;  3TKS A;  3DXB A;  3OR5 A;  5IMC A;  4ZL7 A;  1SU9 A;  2AYT A;  1SKS B;  1USB A;  3D22 A;  2CQ9 A;  2GSQ A;  1WE0 A;  2A4H A;  2HRA A;  3M9J A;  1PKZ A;  2IME A;  2PMT A;  1TP9 A;  3E9J B;  4N30 A;  1PD2 1;  2I3Y A;  1TU7 A;  2VCT A;  3C1R A;  1Y6E A;  4PX1 A;  4Q5N A;  3KTB A;  5B7C A;  4YH2 A;  4YQV A;  2VOC A;  1U88 A;  2E7P A;  1FVK A;  2HI7 A;  2DIY A;  4ZBD A;  4IVF A;  5G5F A;  2PVQ A;  2L5O A;  3RHC A;  3GMF A;  2L57 A;  5CYY A;  1B9X C;  3GRX A;  4I97 A;  1EWX A;  1Z6N A;  4K0G A;  3LW9 A;  17GS A;  2WDU A;  3L9S A;  3KCM A;  1FVJ A;  2H76 A;  3GN3 A;  4PUF C;  3GX8 A;  2O87 A;  5IQY A;  1TRS A;  5B8A A;  1EP7 A;  3UJ1 A;  3HHV A;  2HXK A;  1MDK A;  1EEM A;  3GKK A;  4K1F A;  4N0V A;  5H5S A;  4IJ3 A;  3J7Y b;  4MZB A;  5ECO B;  2P5Q A;  2FWE A;  2JZR A;  2QA2 A;  1MD3 A;  5EY6 A;  5A5K A;  1XIY A;  1NHY A;  3MWH A;  3G9B A;  3G7J A;  20GS A;  3W8J A;  4KAE A;  3H8Q A;  5COH A;  1U87 A;  5DCH A;  1S3D A;  1H75 A;  3VK9 A;  3FR3 A;  3KTL A;  11GS A;  3MDK A;  3QPM A;  1MTC A;  1ZYP A;  5D96 A;  3SBC A;  3IBH A;  2O8V B;  1FB6 A;  2YAN A;  3D4T A;  5CRD A;  1FOV A;  5JCU A;  5CRW A;  3C1S A;  3H79 A;  2FUG 2;  1O6J A;  1QUW A;  4NPB A;  1AQX A;  1NHO A;  1RW1 A;  1TXX A;  4IP6 A;  1ZZY A;  4KSM A;  1T3B A;  4LA1 A;  4MJA A;  4EL1 A;  3US3 A;  3ERW A;  1PA3 A;  4P3Y B;  3P2A A;  2GS3 A;  5ELA A;  1O81 A;  4NHW A;  5HFK A;  19GS A;  3IHQ A;  5IOW A;  2H30 A;  1GSQ A;  4KW6 A;  2R0P A;  3VWU A;  3FW2 A;  4XIH A;  2YWO A;  2OA7 A;  4F0B A;  4MJE A;  5D73 A;  3WT2 A;  2MMN A;  1Q98 A;  1T00 A;  1GWC A;  3O6T A;  2X8C A;  2C0D A;  3DVW A;  5BMU A;  4KSO A;  4L0U A;  1OVN A;  5HFG A;  2OE1 A;  4ZL9 A;  1UN2 A;  1TI3 A;  2MMA A;  4KDX A;  1R5A A;  2CVK A;  1PN9 A;  4DEJ A;  3HVX A;  2CZ2 A;  4XTS A;  1JZR A;  2VM2 A;  3CYN A;  1AUC A;  1SK0 A;  1JLW A;  3IAM 2;  3IOS A;  4KDU A;  2DKH A;  4MDC A;  1HYU A;  5LCZ A;  4K2D A;  4K8M A;  18GS A;  2CVB A;  4HUA A;  3G7I A;  2RLI A;  2VL3 A;  5CO3 A;  3PGT A;  4EDZ A;  4USS A;  4HI7 A;  4WF4 A;  2O85 A;  2NVL A;  3APQ A;  2F51 A;  4JU5 A;  2FA4 A;  3FRC A;  2KP1 A;  4QL7 A;  4TR4 A;  5L71 A;  2CA8 A;  4KCA A;  2VIM A;  1YEP A;  2L6C A;  1XW6 A;  1C72 A;  5G5E A;  1A2M A;  3CRU A;  2CVD A;  3DD3 A;  3WYW A;  4EF0 A;  5DAL A;  1K0D A;  1XXU A;  4PNG A;  3QFB C;  4TVE A;  4EIQ A;  2MZC A;  4NV5 A;  2GVP A;  1WMJ A;  3A2V A;  3KD0 A;  3RAZ A;  2HZE B;  4MMM A;  1SL0 B;  2BTO T;  1GSY A;  2DJJ A;  3TRP A;  2FD3 A;  4IEL A;  3J7Y k;  2BJX A;  3ZFB A;  3KMO A;  1M2A A;  2G0F A;  3ISO A;  3IHG A;  3CMI A;  4ZB9 A;  3W6G A;  1LJR A;  2WZ9 A;  1OC9 A;  2BMX A;  1AQW A;  2JL4 A;  1GSS A;  2J23 A;  5JCG A;  2K18 A;  3UIW A;  2PWJ A;  2H66 A;  1ERV A;  3VI5 A;  3P90 A;  1B4P A;  1MDI A;  3O76 A;  4IGJ A;  1HD2 A;  1V40 A;  3UOM A;  1URM A;  1WWJ A;  2R2J A;  2N5F A;  5H5R A;  4Z2T A;  2A2P A;  3FZ9 A;  4F03 A;  5KN1 A;  4Z7X A;  4IQ1 A;  5HR3 A;  2RII A;  2LKU A;  2WS2 A;  2KLX A;  5KEJ A;  3GSS A;  1F3A A;  1OC8 A;  1Z7P A;  1OE8 A;  2J9H A;  1GUL A;  2FLS A;  4NV2 A;  4RQR A;  2PUK C;  2H71 A;  1ZL9 A;  5CRG A;  2ON5 A;  4GTU A;  3GKX A;  4YKG A;  4O7H A;  4XS1 A;  4GQC A;  2LQO A;  3V1W A;  3GFK A;  1FO5 A;  2R4V A;  3I6A A;  3IRA A;  1K0B A;  2EIQ A;  3F9U A;  1PL1 A;  1VF3 A;  3KXO A;  3NIV A;  1N2A A;  2AJQ B;  3DKS A;  4MF5 A;  4JE1 A;  1AQV A;  2LEG A;  4O32 A;  5ECN B;  5DJL A;  1WP0 A;  3KIJ A;  2Z9S A;  5HFI A;  5G30 A;  2AV4 A;  3ZRD A;  3TKS E;  2GDR A;  2YWN A;  4GQF A;  1K0A A;  4OO4 A;  2N5B A;  3LG6 A;  2YOI A;  3P7X A;  2C0E A;  5IMD A;  4MP4 A;  1O8W A;  5E59 A;  1ON4 A;  1YF1 A;  4G10 A;  1XVW A;  3ME7 A;  3ZIV A;  1A2L A;  3F8U A;  1XVQ A;  5J9B A;  2IPA A;  4PQH A;  2OBK A;  4WBJ A;  1G0T A;  4N11 A;  2RM5 A;  2LJK A;  2K9F A;  2H1B A;  4Z2R A;  2I81 A;  1XWA A;  5ECH B;  1JFU A;  2JZS A;  5G1K A;  4EO3 A;  1S3C A;  2HRN A;  2JAC A;  3IR4 A;  1OKD A;  2R3X A;  5ECM B;  3GL5 A;  3KH7 A;  3FY7 A;  3FR6 A;  3VWW A;  1GTA A;  4MA9 A;  4HU7 A;  4K5R A;  2MMZ A;  1XW5 A;  3HYP A;  4ZBB A;  4IKH A;  4BVX A;  1GTB A;  4ACS A;  1SJZ A;  1VF1 A;  2B1L A;  3ME8 A;  4ID0 A;  2GT5 A;  1F9M A;  2PU9 C;  3BOA A;  5KOW A;  2IMD A;  2RM6 A;  2VUP A;  1BYE A;  3ZML A;  4ECI A;  1NM3 A;  3UBL A;  4CHS A;  1SK2 A;  3VPQ A;  2OBI A;  1SD8 A;  1EP8 A;  2H75 A;  3Q19 A;  2F3M A;  4WR4 A;  2XBQ A;  3FYG A;  2C8U A;  2I9H A;  2HRK A;  4FYU A;  3DWV A;  3HVV A;  3LXZ A;  2YJ7 A;  2QSI A;  3FKF A;  3EU3 A;  3RPP A;  1F37 A;  4NWY A;  3L78 A;  1GSU A;  4ZB6 A;  1SJ6 A;  1M2D A;  1R7H A;  5KN0 A;  1G6W A;  3UAR A;  3GHA A;  1XWG A;  1H4O A;  1EOH A;  2YZH A;  5D9X A;  4O92 A;  2H1G A;  1QGV A;  2DJ0 A;  3PH9 A;  3MNG A;  3GH6 A;  4I8B A;  1OAZ A;  2MBT A;  1ZYQ B;  2GT6 A;  4MAB A;  1A24 A;  2V32 A;  3P8W A;  3K8N A;  2H6X A;  4K7I A;  5DAK B;  1EEJ A;  1GTU A;  1AAZ A;  1DUG A;  1LBK A;  2M72 A;  6GSU A;  1Z9H A;  2VCV A;  3EE2 A;  4TXO B;  1AW9 A;  4MH3 A;  2X49 A;  3D0Z A;  2LJA A;  4YAV A;  4KX4 A;  3MIX A;  2C1Y A;  3TKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...