2DJJA

Solution structure of the a' domain of thermophilic fungal protein disulfide isomerase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
121
structure length
121
Chain Sequence
GPLGSEGPVTVVVAKNYNEIVLDDTKDVLIEFYAPWCGHCKALAPKYEELGALYAKSEFKDRVVIAKVDATANDVPDEIQGFPTIKLYPAGAKGQPVTYSGSRTVEDLIKFIAENGKYKAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Protein disulfide-isomerase
publication title Solution structure of the a' domain of thermophilic fungal protein disulfide isomerase
rcsb
source organism Humicola insolens
total genus 20
structure length 121
sequence length 121
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2006-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2djjA00
2XC2A 3CBUA 5GAPD 4JU5A 9GSSA 4PUFC 2H19A 2LNTA 2H66A 1YQ1A 1SJIA 2EIQA 5ECHB 2IJYA 4ILFA 1WIKA 3ZITA 1HNBA 4DVCA 1PKZA 4HJMA 1Z6NA 3NZNA 3J7Yb 1ZOFA 4I5QA 3LGCA 1O7UA 3F6FA 4HDEA 2GZPA 3TGZA 2VUPA 2K8SA 2X8HA 4IJ3A 4EF0A 1NM3A 1F2EA 3TKPA 6GSUA 2YV9A 3MNGA 5D9XA 4LA1A 5AIXA 2B7JA 4E8EA 1PX7A 4JEDA 6GSTA 2IMEA 1I9DA 4PX1A 3GKXA 4WEYA 1SJ6A 5IOWA 2OACA 4O7HA 5HFGA 1XOAA 1SKWB 2BJXA 2LNSA 2H8LA 4PQ1A 4IJIA 5F05A 5HR1A 3CRTA 2LJRA 4YH2A 3FR6A 4IP6A 5F07A 2HE3A 3L78A 2DJ2A 4ZL7A 3DGQA 1XFLA 2GQLA 5CREA 1EP7A 2GGTA 2WGRA 2WB9A 5CAXA 5J9CA 1G7OA 1AAZA 1CQHA 3EVIA 2F3MA 2H01A 5ID2B 4KCAA 2HT9A 1NHYA 1OKTA 4GWRA 4MH3A 3F4TA 4JBBA 1V58A 4ZBBA 1V9WA 2LRTA 1ABAA 2FWGA 2ZUPA 4OD7A 1T4YA 5G2ZA 2IPAA 2LKUA 4EO3A 4PNGA 4OFMA 1YEPA 1T4ZA 1I5GA 1OC3A 4MP4A 3BOAA 4MZBA 2CAIA 4GCIA 2HZEB 3QMXA 1DE1A 1B8XA 1SK2A 2GSRA 3HXSA 4YAVA 2X8GA 4LL4B 1VGLA 4QL7A 4X43A 1WOUA 2JZTA 4ZXGA 2FA8A 3D5JA 4G2EA 4Q5NA 1XWBA 4K8MA 5DJMA 1GH2A 1QMVA 3I6AA 3UMAA 1SYXA 4L5OA 3E3EA 1M9AA 1UVZA 2DIYA 20GSA 3D0ZA 3EURA 5ELAA 3W8JA 3IRAA 2YWMA 3D4TA 3IR4A 1OAZA 4GTUA 1ERUA 3KH9A 5ECRB 2VCVA 1F6MC 3G9BA 3LORA 2I1UA 2OADA 3A5WA 4EL1A 1Z6MA 3TJKA 4X0XA 2CVBA 4KH7A 3HYPA 1XVWA 5IPGA 4WBRD 5LNKe 3GKNA 5D9WA 3FHKA 3GL5A 2DJ0A 2VAFA 1OKDA 1TRVA 2CVKA 1MD4A 1K0MA 2L4QA 4WKWA 4EUYA 1EV4A 5CRHA 3ME7A 2FNOA 4PXOA 3OR5A 4MJAA 2A4VA 3RBTA 2VLUA 2C3TA 4GSNA 1EGOA 3D21A 4OCFA 4YQVA 2K18A 3M1GA 4DEJA 4IN0A 2LS5A 1ZMAA 4FO5A 2L5OA 3ZIJA 1XWGA 1GLQA 5HFIA 5F0GA 2X99A 3TDGA 4ZB6A 2FWEA 2XPEA 4WR5A 1VF2A 1K3LA 5JCUA 4QL9A 2JSYA 2O87A 3GURA 1V40A 3GA4A 3C7MA 2WDUA 3QD9A 2VCWA 2CA8A 2HZFA 5IOXA 3TJFA 2H76A 1A8YA 4V2MA 3HDCA 5JWOB 2I81A 2PUKC 4I6XA 3LFLA 2NVLA 4XRDA 1U3IA 1GSYA 1TJDA 1B4QA 1QQ2A 2L6CA 3DYRA 2L5LA 3SBCA 1R4WA 2VL9A 1GTBA 5EPFA 3QAWA 4NAXA 1PQNA 3PR8A 4IHUA 1JLVA 5HR3A 1SK1A 3BJ5A 4RUVA 3FYGA 2C8UA 2EIRA 1OVNA 1EOHA 3LJRA 2OBKA 3GSSA 1MEKA 1W4VA 1RW1A 3UJ1A 5IO2A 1TI1A 4F0BA 2HXKA 5AIVA 3HKRA 3IBHA 1T3BA 3CSIA 1VF1A 2TRCP 3APSA 4EDZA 4OO5A 5DCHA 1M9BA 3APOA 5GZZB 3FK8A 2GS3A 2I4AA 1O81A 2CT6A 4ID0A 1M0UA 3MWHA 2OE0A 1GL8A 2HRFA 2XHFA 4JZQA 5B6MA 2M72A 1PD21 1AUCA 3ZIVA 3UIWA 1E2YA 4KDYA 3GNJA 1UN2A 1GSDA 4K0NA 2H0HA 1ACVA 3LEFA 4N10A 2VCQA 1WMJA 2M80A 4OO4A 4MPGA 3QOUA 1O85A 3MSZA 3O6TA 2J23A 1X5DA 1JZRA 2DMLA 3A2WA 1FO5A 1XPVA 1W89A 1M99A 3CTFA 3QAVA 4ECCA 2YJHA 3KJYA 3TJJA 4I2UA 2E2MA 4F0CA 3EWLA 2MBSA 4MMMA 2R6KA 1TRSA 2F8FA 3FKFA 1PA3A 1R5PA 1XWCA 1XIYA 5GAND 2L4CA 3BD2A 5CRWA 3FZ4A 1HQOA 3I43A 3L9UA 1QUWA 5IMCA 1SL2B 1YY7A 2GSQA 3KMOA 5ID2A 1TRUA 4YAPA 3IV4A 2WJUA 1ZZYA 3WT2A 2RM6A 4MDCA 1FB6A 4HS1A 3HVVA 1A2JA 4K6XA 1EP8A 3GMFA 3H4KA 1SD9A 3ISOA 3Q74A 5ELGA 3ZFBA 5FT3A 4XS1A 1GLPA 1VRSD 2I9HA 2PN8A 4K1FA 3VWXA 2YWOA 1F9MA 1EV9A 12GSA 1FG4A 1BEDA 2FD3A 1XWKA 2Z9SA 3L4NA 4IP1A 5DALB 2OJLA 3HA9A 2MMZA 2C0GA 1X5CA 1TU8A 3GUSA 4GXZA 2MMAA 4XTSA 4NMUA 4ZIJA 4OMVA 3ZREA 2IFQB 2HZEA 1ST9A 1SL1B 2FLSA 4RI7A 2A2RA 4JRRA 5DQSA 4MABA 1WRYA 2PVOC 3VI7A 3E0UA 2C3QA 4GRFA 3ZFLA 4BL7A 5IMVA 2EIOA 3TCOA 5ECOB 1U3AA 2B5EA 5EVOA 1CQGA 2DC5A 2P0GA 2V1MA 2KUCA 2LRCA 3IC4A 2NBSA 4Q5RA 2B6MA 1K0BA 1M2BA 3NOFA 2LEGA 6GSYA 1THXA 3FZ5A 3I9V2 3P2AA 3ZVJA 1KEBA 3UL3A 3CYNA 5IIZA 5IPHA 3VWUA 2CV4A 1Y25A 4V2NA 3UOMA 3ERWA 1A24A 4ML1A 2K9FA 1OC9B 3ZLPA 3TKSA 1K0OA 1BYEA 2LSTA 1BG5A 3KTBA 2IMDA 2B5YA 2CVDA 3QPMA 1USBA 1YEXA 1A0FA 2AJQB 5FWGA 2DJ1A 2LJAA 3IHQA 3Q19A 4GQCA 5F06A 1T8EB 3PINA 4FYBA 5EY6A 3IAM2 2F9SA 2GVPA 1TDIA 3TKSE 4IQAA 4OCEA 2CAQA 5KN0A 4L5LA 2D2ZA 3P8WA 1YF1A 2VL2A 2YWIA 4Q5FA 3CTGA 1FB0A 2B1LA 2LQOA 2DIZA 5IM9A 1Q98A 3QFBC 4N0ZA 4HU9A 5ECQB 1KNGA 2RUEA 3K8NA 3RPPA 1THOA 4OFTA 2KHPA 2YPMA 4EVMA 2H0IA 1PKWA 1A2MA 2B3SA 2N5BA 1WWJA 2WZ9A 6GSVA 4MK3A 4NHZA 1LU4A 5KN2A 1GUKA 3UVHA 4EE0A 4NXIA 3GX8A 2DSAA 4LMWA 4WETA 3IK9A 2PERA 22GSA 3N9JA 1HNCA 2GTUA 1YDKA 3M9KA 1YF0A 1GWCA 3LWAA 4HZ4A 2JACA 2H74A 2JSZA 4WXTA 4FYCA 4MZWA 4LMVA 1ZGNA 4NWYA 4AF2A 2PWJA 2FA4A 2FWFA 1ZCPA 19GSA 2YV7A 1GSFA 2ON7A 5E4WA 3H93A 4DSQA 2FY6A 3HZ4A 4WBJA 2IL3A 2WFCA 16GSA 5ECPB 4AJ8A 4J57E 5J41A 1PX6A 1DUGA 2OBIA 4BVYA 3HHVA 4KW6A 2IIYA 5ECKB 3TOTA 1MDIA 4TR1B 3GTUB 4V2LA 1ZL9A 3FR3A 1PL1A 1M7TA 3F63A 2C0EA 3VPQA 3VWVA 5A4WA 2KP1A 2PVQA 1ZYQB 5DVBA 4TXVA 2H71A 3BBYA 3F3QA 4KA0A 3MDKA 1G6YA 2XBIA 2YZUA 3KZQA 1TK5B 3NIVA 4XS4B 3DVXA 2H1GA 4JE1A 3ZYWA 5G30A 1F3BA 3J7Yk 5H5QA 2V6OA 3QDNA 3QCPA 4K7OA 1BX9A 4BA7A 2V32A 5FHIA 5B7CA 2MMNA 3VI5A 4HI7A 1TTZA 3IK7A 4ECIA 1FOVA 1Z7RA 1EEMA 1S3AA 2N5AA 3H8QA 4KSMA 3FW2A 4BWSA 1TI3A 3U5RE 3AY8A 4L0WA 1FAAA 2IMKA 2HI7A 2P5RA 4IBPA 4IS0A 1AQVA 5D9TA 2NTOA 1VF4A 4I97A 2VM1A 4RQXA 1PSQA 1K0DA 1OC8A 1OE7A 5IMZA 4BVXA 1Z7PA 4HU7A 2VO4A 10GSA 2OA7A 3HZ8A 5CYYA 2RUFA 1SKSB 5DALA 2YJ7A 3GL3A 4K7NA 3D6IA 3TKQA 2H72A 4D73B 3IPZA 2IFQA 1X9SB 3QR6A 2RLIA 1JHBA 3FZ9A 3UBLA 3ZZXA 3KTLA 4YQMA 1GUHA 1S3CA 5COHA 2HRNA 4LLRA 5D96A 1J9BA 4YQUA 1TKDB 3KEBA 4X1UA 4TW5A 1MTCA 1ON4A 2REMA 5CO3A 2MMOA 5JWQB 1YKCA 3QFAC 2E2GA 5JWRB 2RIIA 2GDRA 1GRXA 3M9JA 2O89A 3DMLA 2GZYA 3VK9A 11GSA 5ECIB 3L9VA 1ML6A 3C71A 5JCGA 3IA1A 5G5FA 1DSBA 2WS2A 1GNEA 1O6JA 3WYWA 4F82A 2LTKA 4HQSA 4ZL8A 2FWHA 3HJPA 4ZBDA 1OC9A 1GUMA 2P31A 3LXTA 1QK8A 1TU7A 3F4SA 1G6WA 4MJBA 3U6VA 1PRXA 2VL3A 4KB3A 1EZKA 2KLXA 5A5KA 2BTOT 2VLTA 3A3TA 4HJ2A 4XIHA 5H5SA 4I2TA 1X9WB 2ES7A 3FR9A 3TRQA 1XW5A 2H6YA 2IWTA 5EL8A 1MD3A 4ECJA 2R3XA 1XCCA 3ZL5A 4MH2A 1B9YC 4IKHA 3F0IA 4V1Ap 3PGTA 1XXUA 5DAKB 1M2AA 4KNDA 4E8HA 5B6NA 2RM5A 3G7YA 5IQYA 4K7IA 2M46A 2KP2A 2PBJA 4F9ZA 5HR0A 1URMA 1OE8A 4BPYA 1A2LA 1BQ7A 3QAGA 3RHBA 5B8AA 2F8AA 1SJZA 1SU9A 2GT6A 1SYRA 4ZB8A 1X5EA 1R5AA 3M0FA 4ZB9A 2VM2A 3KD0A 1XVQA 1S3DA 1JZDA 3IE3A 1U87A 2YNXA 5ECSA 3H79A 1JZOA 1EGRA 1B48A 1Z9HA 4ZILA 3E9JB 3EMPA 3ZTLA 3GYKA 1ERWA 1Y6EA 2CZ3A 1T1VA 1DBYA 5LD0A 1BJXA 2MZCA 4G10A 3ZMKA 3GH6A 4N0VA 2GSTA 5DQYA 2J9HA 3D4MA 1WPIA 1BAYA 2NPBA 1UA5A 4HUAA 4TR3A 4GLTA 2GQMA 2HSYA 2N5FA 2QKEA 1RQMA 3TRXA 2PU9C 1TP9A 1XBSA 2HFDA 2ZNMA 3UVTA 2YP6A 1GNWA 5D73A 18GSA 2H6XA 4TR1A 3IDVA 1ILOA 3GTUA 4WR4A 5ENUA 3ED3A 1AW9A 3IXRA 1EOGA 2L57A 5HR2A 3CXGA 2YOIA 4G19A 2JL4A 2H75A 1TK8B 2F51A 4ML6A 3EINA 1Z5YE 1GULA 5G1KA 5AN1A 3O3TA 3CMIA 4XS4A 3I69A 4TXOB 3GIXA 1F37A 1VF3A 3WGXA 3LQ7A 3GN3A 1SK0A 1H4OA 4POLA 1NHOA 1X0RA 2G0FA 2YANA 5LCZA 2GLRA 3C8EA 4OWYA 2AAWA 3GKMA 5G1LA 4OFNA 2OE3A 4HQZA 4G9HA 3EE2A 3CRUA 2DJJA 2FUG2 4XHMA 14GSA 4H86A 2AYTA 1PGTA 3HY2A 3US3A 3P90A 1V57A 2E7PA 1E6BA 3ME8A 4L0UA 4ULXA 2GT5A 3KIJA 2E0QA 1G0TA 3GSTA 5AGYA 3N5OA 5G5EA 4MJCA 1V98A 5C00A 2VD0A 4IW9A 1EEJA 1SL0B 2CX3A 4IELA 3F4RA 4TVEA 2AUVA 4TR0A 3KMNA 1ERVA 2C1YA 3LYKA 6GSWA 4KX4A 2WCIA 3JCML 1HD2A 1J08A 2YCDA 3EMXA 3D22A 3F6DA 1YJ6A 1K0AA 4HZ2A 4V1Ag 3M8NA 4ZBAA 4MA9A 2FGXA 6GSSA 2LQQA 4POKA 4D73A 3ERFA 1GTAA 3KH7A 4PURA 2QSIA 3CSJA 4JR4A 1GTUA 3DKSA 3G7IA 13GSA 3HVXA 3GKKA 5ABRA 5ECNB 3P7XA 3R2QA 1N8JA 5IO0A 3EC3A 4MCUA 4XCSA 5CRDA 2H1AA 1FVKA 4ISDA 2DJKA 5IMDA 3MAKA 4KAEA 1PMTA 4PUAA 5ECLB 3FY7A 1TRWA 4K0GA 3EU3A 2ON5A 2V6KA 2BMXA 2XPDA 1WP0A 3UEMA 2YZHA 4FH8A 3VFIA 3TJGA 1F3AA 4MF5A 4KGIA 3C73A 1B4PA 4DSSB 2I3YA 3BCKA 2X64A 1GP1A 4EC0A 1V2AA 3L0HA 1HNAA 5D93A 4NV5A 1A23A 2HSHA 3EYTA 17GSA 2O85A 4AGSA 4KSOA 2CQ9A 2R37A 5AISA 3M3MA 3TKRA 3BCIA 1K3OA 1SKRB 2H6ZA 4MZCA 3HD5A 2X8CA 1ERTA 3DD3A 1A0RP 4N30A 1AQWA 3Q18A 4GSTA 3PH9A 2C80A 3IOSA 4EKZA 3A2VA 2AB6A 2ZCTA 4FYUA 1IYIA 1T00A 3HCZA 2JU5A 1GSEA 4GSSA 1HYUA 1XW9A 2VCTA 2PPTA 4DSRA 4F2IA 2H30A 4IVFA 1ZYEA 2DMMA 4IGJA 3TRPA 3TOUA 3GX0A 4GQFA 4MF7A 5DAKA 4Z7XA 3ERGA 3APQA 3UBKA 2IMIA 4L8EA 4KE3A 4HOJA 5JCWA 2TIRA 1WE0A 3VLNA 1H75A 4K2DA 3EU4A 1UC7A 4NV2A 5E59A 1YZXA 5H5RA 4CW9A 3WT1A 1LBKA 4FIWA 1J0FA 4GF0A 2XBQA 1O8XA 3GV1A 2QGVA 5CNWA 1QXHA 3CSHA 2LRNA 3FZAA 3G7JA 5HFKA 3LSZA 3DIEA 5GSTA 3VPTA 1KBNA 5HQPA 1XOBA 2JADA 1YKAA 5D8IA 1T7PB 1Z3EA 4ZL9A 3KGKA 3W8SA 1JLWA 2DBCA 4RQRA 3DWVA 2LUSA 2JZRA 1TK0B 3KXOA 3L9SA 3F8UA 3W6GA 1X9MB 2O7KA 3C1RA 3KCMA 1TOFA 2VIMA 1NSWA 3ZRDA 2VOCA 2R4VA 3ZMLA 3KP9A 2B7KA 8GSSA 1XZOA 2P5QA 1TW9A 4WF4A 4NPBA 2R2JA 4J56E 2G2QA 4IQ1A 4I8BA 2YN1A 3DVWA 2K6VA 2OE1A 3UARA 4MF6A 4Q5QA 1IYHA 4CHSA 4N11A 3S9FA 2QC7A 2C3NA 1LJRA 4KDUA 5DJLA 1A8LA 1AXDA 3Q6OA 5A4VA 4TRXA 3HJMA 3GHAA 4RI6A 1GSQA 3O76A 3WGEA 2AV4A 5INYA 1OYJA 5DDLA 2L59A 3DRNA 5IMAA 4PNFA 2DLXA 3IAS2 4KCEA 3SWLA 2K8VA 5F8BA 3LG6A 4TXOA 2WRTA 1GSUA 3H1NA 2GQKA 4EDYA 3RDWA 2FCHA 4TOPA 4KUNA 7GSSA 1AQXA 2V2GA 3GH9A 4TN8A 1U88A 2HNLA 5GSSA 2FHEA 2HYXA 3KP8A 2KOKA 5KN3A 3GFKA 4TKYA 5DCGA 1K0CA 1K3YA 2MYGA 1XW6A 4EXJA 5CRGA 3DEXA 3RHCA 3VWWA 5CP1A 4JR6A 2CX4A 3V1WA 4QQ7A 5A4UA 2VD1A 6GSXA 2EC4A 3TJBA 1DE2A 5IMFA 4O92A 3RAZA 3DXBA 1FW1A 3A2XA 3F3RA 3RPNA 2H0GA 4XRAA 1O73A 2R5GA 4PQIA 2JZSA 1MDJA 2MBTA 4WF5A 3LYPA 4PQHA 4XS6A 2TRXA 5KN1A 3C1SA 2ALBA 2GZZA 3VURA 5C04A 4K9ZA 4F03A 2V41A 2VCZA 3HJOA 2OKAA 4AJ6A 3KM6A 4MPFA 2C0FA 2PMTA 2LV3A 1O8WA 3F9UA 2A2SA 1R26A 2H1BA 3TB2A 3TUEA 1AIUA 4KDXA 1TXXA 1MDKA 1C72A 1EWXA 3ZVJD 2LJKA 1G7EA 1M2DA 1AC1A 2H73A 4TR4A 1XWAA 5D9VA 5B8BA 5J5NA 2CZ2A 1QGVA 4DSSA 1QFNA 1R7HA 4NHWA 3HVSA 1FHEA 5ECMB 1RK4A 2B1KA 2VCXA 3FEUA 1N2AA 4P3YB 4AJ7A 1SD8A 1PL2A 4CDOA 2NDOA 4POBA 1JFUA 4O32A 4J2FA 1Q4JA 4ECBA 4ACSA 3TKSC 4O5RA 1GSSA 2H70A 3UAPA 3FRCA 2AHEA 1PN9A 3WGDA 4BWQA 2C0DA 5G31A 5J3RA 2B5XA 2IMFA 2H1DA 5DBQA 2GSSA 4MJEA 5KEJA 4HEA2 4MLYA 2L6DA 2IN3A 2VLVA 3LXZA 4LL1B 1KTEA 2YWNA 2DJ3A 3WD6A 4POMA 5L71A 2C4JA 1B9XC 1WJKA 2PGTA 1NW2A 2WULA 2HLSA 1K0NA 3GRXA 1JZWA 4PGTA 1GTIA 2O8VB 5J9BA 2VL2C 5J4UA 1FVJA 1U6TA 1SENA
chains in the Genus database with same CATH superfamily
2XC2A 3CBUA 5GAPD 4JU5A 9GSSA 4PUFC 2H19A 2LNTA 2H66A 1YQ1A 1SJIA 2EIQA 5ECHB 4MNNA 2IJYA 4ILFA 1WIKA 3ZITA 1HNBA 4DVCA 1PKZA 4HJMA 1Z6NA 3NZNA 3J7Yb 1ZOFA 4I5QA 3LGCA 1O7UA 3F6FA 4HDEA 2GZPA 3TGZA 2VUPA 2K8SA 2X8HA 4IJ3A 4EF0A 1NM3A 1F2EA 4KF9A 3TKPA 6GSUA 2YV9A 3MNGA 5D9XA 4LA1A 5AIXA 2B7JA 4E8EA 4USSA 1PX7A 4JEDA 6GSTA 2IMEA 1I9DA 4PX1A 3GKXA 4WEYA 1SJ6A 5IOWA 2OACA 4O7HA 5HFGA 1XOAA 1PN0A 4A5PA 1SKWB 2BJXA 2LNSA 2H8LA 4PQ1A 4IJIA 5F05A 5HR1A 3CRTA 2DKIA 2LJRA 4YH2A 3FR6A 4IP6A 5F07A 2HE3A 3L78A 2DJ2A 4ZL7A 3DGQA 1XFLA 2GQLA 5CREA 1EP7A 5BMUA 2GGTA 2WGRA 2WB9A 5CAXA 5J9CA 1G7OA 1AAZA 1CQHA 3EVIA 2F3MA 2H01A 5ID2B 4EIQA 4KCAA 2HT9A 1NHYA 1OKTA 5KOXA 4GWRA 4MH3A 3F4TA 4JBBA 1V58A 3FMWA 4ZBBA 1V9WA 2LRTA 1ABAA 2FWGA 2ZUPA 2R0GA 4OD7A 1T4YA 4PTSA 1ZYPA 5G2ZA 2IPAA 2LKUA 4EO3A 4PNGA 4OFMA 1YEPA 1T4ZA 1I5GA 1OC3A 4MP4A 3BOAA 4MZBA 2CAIA 4GCIA 2HZEB 3QMXA 1DE1A 1B8XA 1SK2A 2GSRA 3HXSA 4YAVA 2X8GA 4LL4B 1VGLA 4QL7A 4X43A 1WOUA 2JZTA 4ZXGA 2FA8A 3D5JA 4G2EA 4Q5NA 1XWBA 4K8MA 5DJMA 1GH2A 1QMVA 3I6AA 3UMAA 4BL7B 1SYXA 4L5OA 3E3EA 1M9AA 1UVZA 2DIYA 2HRKA 20GSA 3D0ZA 3EURA 5ELAA 3W8JA 3IRAA 2YWMA 3D4TA 3IR4A 1OAZA 4GTUA 1ERUA 4BIKA 3KH9A 5ECRB 2VCVA 1F6MC 3HVNA 3G9BA 3LORA 2I1UA 2OADA 3A5WA 4EL1A 1Z6MA 3TJKA 4X0XA 2CVBA 4KH7A 3HYPA 1XVWA 5IPGA 4WBRD 4G0IA 5LNKe 3GKNA 5D9WA 3FHKA 3GL5A 2DJ0A 2VAFA 1OKDA 1TRVA 2CVKA 1MD4A 1K0MA 2L4QA 4WKWA 4EUYA 1EV4A 5CRHA 3ME7A 2FNOA 4PXOA 3OR5A 4MJAA 2A4VA 3RBTA 2VLUA 2C3TA 4GSNA 1EGOA 3D21A 4OCFA 4YQVA 2K18A 3M1GA 4DEJA 4IN0A 2LS5A 1ZMAA 4FO5A 2L5OA 3ZIJA 1XWGA 1GLQA 5HFIA 5F0GA 2X99A 3TDGA 4ZB6A 2FWEA 2XPEA 4WR5A 1VF2A 1K3LA 5JCUA 4QL9A 2JSYA 2O87A 3GURA 1V40A 3GA4A 3C7MA 2WDUA 3QD9A 2VCWA 2CA8A 2HZFA 5IOXA 3TJFA 2H76A 1A8YA 4V2MA 3HDCA 5JWOB 2I81A 2PUKC 4I6XA 3LFLA 2NVLA 4XRDA 1U3IA 1GSYA 1TJDA 1B4QA 3R3EA 1QQ2A 2L6CA 3DYRA 2L5LA 3SBCA 1R4WA 2VL9A 1GTBA 5EPFA 3MIXA 3QAWA 1PQNA 3PR8A 4NAXA 4IHUA 1JLVA 5HR3A 1SK1A 3BJ5A 4RUVA 3FYGA 2C8UA 2EIRA 1OVNA 1EOHA 3LJRA 2OBKA 3GSSA 1MEKA 1W4VA 1RW1A 3UJ1A 5IO2A 1TI1A 4F0BA 2HXKA 5AIVA 3HKRA 3IBHA 1T3BA 3CSIA 1VF1A 2TRCP 3APSA 4EDZA 4OO5A 5DCHA 1M9BA 3APOA 5GZZB 3FK8A 2GS3A 2I4AA 1O81A 2CT6A 3PPUA 1M0UA 3MWHA 4ID0A 2OE0A 1GL8A 1ZYNA 2HRFA 2XHFA 4BVYB 4JZQA 5B6MA 2M72A 1PD21 1AUCA 3ZIVA 3IHGA 3UIWA 1E2YA 4KDYA 3GNJA 1UN2A 1GSDA 4K0NA 2H0HA 1ACVA 3LEFA 4N10A 2VCQA 1WMJA 2M80A 4OO4A 4MPGA 3QOUA 1O85A 3MSZA 3O6TA 2J23A 1X5DA 1JZRA 2DMLA 3A2WA 1FO5A 1XPVA 1W89A 1M99A 3CTFA 3QAVA 4ECCA 2YJHA 3KJYA 3TJJA 4I2UA 2E2MA 4F0CA 4YKFA 3EWLA 2MBSA 4MMMA 2R6KA 1TRSA 2F8FA 3FKFA 1PA3A 1R5PA 1XWCA 1XIYA 5GAND 2L4CA 3BD2A 5CRWA 3FZ4A 1HQOA 3I43A 3L9UA 4HSCX 1QUWA 5IMCA 1SL2B 1YY7A 2GSQA 3KMOA 5ID2A 1TRUA 4YAPA 3IV4A 2WJUA 1ZZYA 3WT2A 2RM6A 4MDCA 1FB6A 4HS1A 3HVVA 1A2JA 4K6XA 4BVXB 1EP8A 3GMFA 3H4KA 1SD9A 3ISOA 3Q74A 5ELGA 3ZFBA 5FT3A 4XS1A 1GLPA 1VRSD 2I9HA 2PN8A 4K1FA 3VWXA 2YWOA 1F9MA 1EV9A 12GSA 1FG4A 1BEDA 2FD3A 1XWKA 2Z9SA 3L4NA 4IP1A 5DALB 2OJLA 3HA9A 2MMZA 2C0GA 1X5CA 1TU8A 3GUSA 4GXZA 2MMAA 4XTSA 2A4HA 4NMUA 4ZIJA 4OMVA 3ZREA 2IFQB 2HZEA 1ST9A 1SL1B 4K2XA 2FLSA 4RI7A 2A2RA 4JRRA 5DQSA 4MABA 1WRYA 2PVOC 3VI7A 3E0UA 2C3QA 4ICYA 4GRFA 3ZFLA 4BL7A 5IMVA 2EIOA 3TCOA 5ECOB 1U3AA 2B5EA 5EVOA 1CQGA 2DC5A 2P0GA 2V1MA 2KUCA 2LRCA 3IC4A 2NBSA 4Q5RA 2B6MA 1K0BA 1M2BA 3NOFA 2LEGA 6GSYA 1THXA 3FZ5A 3I9V2 3P2AA 3ZVJA 1KEBA 3UL3A 3CYNA 5IIZA 5IPHA 3VWUA 2CV4A 1Y25A 4V2NA 3UOMA 3ERWA 1A24A 4ML1A 2K9FA 1OC9B 3ZLPA 3TKSA 1K0OA 1BYEA 2LSTA 1BG5A 3KTBA 2IMDA 2B5YA 2CVDA 3QPMA 1USBA 1YEXA 1A0FA 2AJQB 5FWGA 2DJ1A 2LJAA 3IHQA 3Q19A 4GQCA 5F06A 1T8EB 3PINA 4FYBA 5EY6A 3IAM2 2F9SA 2GVPA 1TDIA 3TKSE 4IQAA 4OCEA 2CAQA 5KN0A 4L5LA 2D2ZA 3P8WA 1YF1A 2VL2A 2YWIA 4O5UA 4Q5FA 3CTGA 1FB0A 2B1LA 2LQOA 2DIZA 5IM9A 1Q98A 3QFBC 4N0ZA 4HU9A 5ECQB 1KNGA 2RUEA 3K8NA 3RPPA 1THOA 4OFTA 2KHPA 2YPMA 4EVMA 2H0IA 1PKWA 1A2MA 2B3SA 2N5BA 1WWJA 2WZ9A 6GSVA 4MK3A 4NHZA 1LU4A 5KN2A 2DKHA 1GUKA 3UVHA 4EE0A 4NXIA 3GX8A 2DSAA 4LMWA 4WETA 3IK9A 2PERA 22GSA 3N9JA 1HNCA 2GTUA 2X49A 1YDKA 3M9KA 1YF0A 1GWCA 3LWAA 4HZ4A 2JACA 2H74A 2JSZA 4WXTA 4FYCA 4MZWA 4LMVA 1ZGNA 4NWYA 4AF2A 2PWJA 2FA4A 2FWFA 1ZCPA 19GSA 2YV7A 1GSFA 2ON7A 5E4WA 3H93A 4DSQA 2FY6A 3HZ4A 4WBJA 2IL3A 2WFCA 16GSA 5ECPB 4AJ8A 4J57E 5J41A 1PX6A 1DUGA 2OBIA 4BVYA 3HHVA 4KW6A 2IIYA 5ECKB 3TOTA 1MDIA 4TR1B 3GTUB 4V2LA 1ZL9A 3FR3A 1PL1A 1M7TA 3F63A 2C0EA 3VPQA 3VWVA 5A4WA 2KP1A 2PVQA 1ZYQB 2R0PA 5DVBA 4TXVA 2H71A 3BBYA 3F3QA 4KA0A 3MDKA 1G6YA 2XBIA 3IC8A 4K5RA 2YZUA 3KZQA 1TK5B 3NIVA 4XS4B 3DVXA 2H1GA 4JE1A 3ZYWA 5G30A 1F3BA 3J7Yk 5H5QA 2V6OA 3QDNA 3QCPA 4K7OA 1BX9A 4BA7A 2V32A 5FHIA 5B7CA 2MMNA 3VI5A 4HI7A 1TTZA 3IK7A 4ECIA 1FOVA 1Z7RA 1EEMA 1S3AA 2N5AA 3H8QA 4KSMA 3FW2A 4BWSA 1TI3A 4Z2TA 3U5RE 3AY8A 4L0WA 1FAAA 2IMKA 2HI7A 2P5RA 4IBPA 4IS0A 1AQVA 5D9TA 2NTOA 1VF4A 4I97A 2VM1A 4RQXA 1PSQA 1K0DA 1OC8A 4G0LA 1OE7A 5IMZA 4BVXA 1Z7PA 4HU7A 2VO4A 10GSA 2OA7A 3HZ8A 5CYYA 2RUFA 1SKSB 5DALA 2YJ7A 3GL3A 4K7NA 3D6IA 3TKQA 2H72A 4D73B 3IPZA 2IFQA 1X9SB 3QR6A 2RLIA 1JHBA 3FZ9A 3UBLA 3ZZXA 3KTLA 4YQMA 1GUHA 1S3CA 5COHA 2HRNA 4LLRA 5D96A 1J9BA 4YQUA 1TKDB 3KEBA 4X1UA 4TW5A 2UZ8A 1MTCA 1ON4A 2REMA 5CO3A 2MMOA 5JWQB 1YKCA 3QFAC 2E2GA 3LW9A 5JWRB 2RIIA 2GDRA 1GRXA 3M9JA 2O89A 3DMLA 2GZYA 3VK9A 11GSA 5ECIB 3L9VA 1ML6A 3C71A 5JCGA 3IA1A 5G5FA 1DSBA 2WS2A 1GNEA 1O6JA 3WYWA 4F82A 2LTKA 4HQSA 4ZL8A 2FWHA 3HJPA 4ZBDA 1OC9A 1GUMA 2P31A 3LXTA 1QK8A 1TU7A 3F4SA 1G6WA 4MJBA 3U6VA 1PRXA 2VL3A 4KB3A 1EZKA 2KLXA 5A5KA 2BTOT 2VLTA 3A3TA 4HJ2A 4XIHA 5H5SA 4I2TA 1X9WB 2ES7A 3FR9A 3TRQA 1XW5A 2H6YA 2IWTA 5EL8A 1MD3A 4ECJA 2R3XA 1XCCA 5BRTA 3ZL5A 4MH2A 1B9YC 4IKHA 3F0IA 4K5SA 4V1Ap 3PGTA 1XXUA 5DAKB 1M2AA 4KNDA 4E8HA 5B6NA 2RM5A 3G7YA 5IQYA 4K7IA 2M46A 2KP2A 2PBJA 4FQUA 4F9ZA 5HR0A 1URMA 1OE8A 4BPYA 1A2LA 1BQ7A 3QAGA 3RHBA 5B8AA 2F8AA 1SJZA 1SU9A 2GT6A 1SYRA 4ZB8A 1X5EA 1R5AA 3M0FA 4ZB9A 2VM2A 3KD0A 1XVQA 1S3DA 1JZDA 3IE3A 1U87A 2YNXA 5ECSA 3H79A 1JZOA 1EGRA 1B48A 1Z9HA 4ZILA 3E9JB 3EMPA 3ZTLA 3GYKA 1ERWA 4Z2UA 1Y6EA 2CZ3A 1T1VA 1DBYA 5LD0A 1BJXA 2MZCA 4G10A 3ZMKA 3GH6A 4N0VA 2GSTA 5DQYA 2J9HA 3D4MA 1WPIA 1BAYA 2NPBA 1UA5A 3EPTA 4HUAA 4TR3A 4GLTA 2GQMA 2HSYA 2N5FA 1M3IA 2QKEA 3CQFA 1RQMA 3TRXA 2PU9C 1TP9A 1XBSA 2HFDA 2ZNMA 3UVTA 2YP6A 1GNWA 2R0CA 5D73A 18GSA 2H6XA 4TR1A 3IDVA 1ILOA 3GTUA 4WR4A 5ENUA 3ED3A 1AW9A 3IXRA 1EOGA 2L57A 5HR2A 3CXGA 2YOIA 4G19A 2JL4A 2H75A 1TK8B 2F51A 4ML6A 3EINA 1Z5YE 1GULA 5G1KA 1M3JA 5AN1A 3O3TA 3CMIA 4XS4A 3I69A 4TXOB 3GIXA 1F37A 1VF3A 3WGXA 3LQ7A 3GN3A 1SK0A 1H4OA 4POLA 1NHOA 1X0RA 2G0FA 2YANA 5LCZA 2GLRA 3C8EA 4OWYA 2AAWA 3GKMA 5G1LA 2QA1A 4OFNA 2OE3A 2X4AA 4G9HA 4HQZA 3EE2A 3CRUA 2DJJA 2FUG2 4XHMA 14GSA 4H86A 2AYTA 1PGTA 3HY2A 3US3A 3P90A 1V57A 2E7PA 1E6BA 3ME8A 4L0UA 4ULXA 2GT5A 3KIJA 2E0QA 1G0TA 3GSTA 5AGYA 3N5OA 5G5EA 4MJCA 1V98A 5C00A 2VD0A 4IW9A 1EEJA 1SL0B 2CX3A 4IELA 3F4RA 4TVEA 2AUVA 4TR0A 3KMNA 1ERVA 2C1YA 3LYKA 6GSWA 4KX4A 2WCIA 3JCML 1HD2A 1J08A 2YCDA 3EMXA 3D22A 3F6DA 1YJ6A 1K0AA 4HZ2A 4V1Ag 3M8NA 4ZBAA 4MA9A 2FGXA 6GSSA 2LQQA 4POKA 4D73A 3ERFA 1GTAA 3KH7A 4PURA 2QSIA 3CSJA 4JR4A 1GTUA 3DKSA 3G7IA 13GSA 3HVXA 3GKKA 5ABRA 5ECNB 3P7XA 3R2QA 1N8JA 5IO0A 3EC3A 4MCUA 4XCSA 5CRDA 2H1AA 1FVKA 4ISDA 2DJKA 5IMDA 3MAKA 4KAEA 3A5IA 1PMTA 4PUAA 5ECLB 3FY7A 1TRWA 4K0GA 3EU3A 2ON5A 2V6KA 2BMXA 2XPDA 2QA2A 1WP0A 3UEMA 2YZHA 4FH8A 3VFIA 3TJGA 1F3AA 4MF5A 4KGIA 3C73A 1B4PA 4DSSB 2I3YA 3BCKA 2X64A 1GP1A 4EC0A 1V2AA 3L0HA 1HNAA 5D93A 4NV5A 1A23A 2HSHA 3EYTA 17GSA 2O85A 4AGSA 4KSOA 2CQ9A 2HSMA 2R37A 5AISA 3M3MA 3TKRA 3BCIA 1K3OA 1SKRB 2H6ZA 4MZCA 3HD5A 2X8CA 1ERTA 3DD3A 4Z2RA 1A0RP 4N30A 1AQWA 3Q18A 4GSTA 3PH9A 2C80A 3IOSA 4EKZA 3A2VA 2AB6A 2ZCTA 4FYUA 1IYIA 1T00A 4YKGA 3HCZA 2JU5A 1GSEA 4GSSA 1HYUA 1XW9A 2VCTA 2PPTA 4DSRA 4F2IA 2H30A 4IVFA 1ZYEA 2DMMA 4IGJA 3TRPA 2A2PA 3GX0A 4GQFA 3TOUA 4MF7A 5DAKA 4Z7XA 3ERGA 3APQA 3UBKA 2IMIA 4L8EA 4KE3A 4HOJA 5JCWA 2TIRA 1WE0A 3VLNA 1H75A 4K2DA 3EU4A 1UC7A 4NV2A 5E59A 1YZXA 5H5RA 4CW9A 3WT1A 1LBKA 4FIWA 1J0FA 4GF0A 5KOWA 2XBQA 1O8XA 3GV1A 2QGVA 5CNWA 1QXHA 3CSHA 2LRNA 3FZAA 3G7JA 5HFKA 3LSZA 3DIEA 5GSTA 3VPTA 1KBNA 5HQPA 1XOBA 2JADA 1YKAA 5D8IA 1T7PB 1Z3EA 4ZL9A 3KGKA 3W8SA 1JLWA 2DBCA 4RQRA 3DWVA 2LUSA 2JZRA 1TK0B 1XG8A 3KXOA 3L9SA 3F8UA 3W6GA 1X9MB 2O7KA 3C1RA 1FOHA 3KCMA 1TOFA 2VIMA 1NSWA 3ZRDA 2VOCA 2R4VA 3ZMLA 3KP9A 2B7KA 8GSSA 1XZOA 2P5QA 1TW9A 4WF4A 4NPBA 2R2JA 4J56E 2G2QA 4IQ1A 4I8BA 2YN1A 3DVWA 2K6VA 2OE1A 3UARA 4MF6A 4Q5QA 1IYHA 4CHSA 4N11A 3S9FA 2QC7A 2C3NA 1LJRA 4KDUA 5DJLA 1A8LA 1S3RA 1AXDA 3Q6OA 5A4VA 4TRXA 3HJMA 3GHAA 4RI6A 1GSQA 3O76A 3WGEA 2AV4A 5INYA 1OYJA 5DDLA 2L59A 3DRNA 5IMAA 4PNFA 2DLXA 3IAS2 4KCEA 3SWLA 2K8VA 5F8BA 3LG6A 4TXOA 2WRTA 1GSUA 3H1NA 2GQKA 4EDYA 3RDWA 4TOPA 2FCHA 4KUNA 7GSSA 1AQXA 2V2GA 3GH9A 3MYDA 4TN8A 1U88A 2HNLA 5GSSA 2FHEA 2HYXA 3KP8A 2KOKA 5KN3A 3GFKA 4TKYA 5DCGA 1K0CA 1K3YA 2MYGA 1XW6A 4EXJA 5CRGA 3DEXA 3RHCA 3VWWA 5CP1A 4JR6A 2CX4A 3V1WA 4QQ7A 5A4UA 2VD1A 6GSXA 2EC4A 3TJBA 1DE2A 5IMFA 4O92A 3RAZA 3DXBA 1FW1A 3A2XA 3F3RA 3RPNA 2H0GA 4XRAA 1O73A 2R5GA 4G0KA 4PQIA 2JZSA 1MDJA 2MBTA 4WF5A 3LYPA 4PQHA 4XS6A 2TRXA 5KN1A 3C1SA 2ALBA 2GZZA 3VURA 5C04A 4K9ZA 4F03A 2V41A 4O5QA 2VCZA 3HJOA 2OKAA 4AJ6A 3KM6A 2HRAA 4MPFA 2C0FA 2PMTA 2LV3A 1O8WA 3F9UA 2A2SA 1R26A 2H1BA 3TB2A 3TUEA 1AIUA 4KDXA 1TXXA 1MDKA 1C72A 1EWXA 3ZVJD 2LJKA 1G7EA 1M2DA 4X4JA 1AC1A 2H73A 4TR4A 1XWAA 5D9VA 5B8BA 5J5NA 2CZ2A 1QGVA 4DSSA 1QFNA 1R7HA 4NHWA 3HVSA 1FHEA 5ECMB 1RK4A 2B1KA 2VCXA 3FEUA 1N2AA 4P3YB 4AJ7A 1SD8A 1PL2A 4CDOA 2NDOA 4POBA 1JFUA 4O32A 4J2FA 1Q4JA 4ECBA 4EIPA 4ACSA 3TKSC 4O5RA 1GSSA 2H70A 3UAPA 3FRCA 2AHEA 1PN9A 3WGDA 4BWQA 2C0DA 5G31A 4CY8A 5J3RA 2B5XA 2IMFA 2H1DA 5DBQA 2GSSA 4MJEA 5KEJA 4HEA2 4MLYA 2L6DA 2IN3A 2VLVA 3LXZA 4LL1B 1KTEA 2YWNA 2DJ3A 3WD6A 4POMA 5L71A 2C4JA 1B9XC 1WJKA 4CY6A 2PGTA 1NW2A 2WULA 2HLSA 1K0NA 3GRXA 1JZWA 1PFOA 4PGTA 1GTIA 2O8VB 5J9BA 2VL2C 5J4UA 1FVJA 1U6TA 1SENA
chains in the Genus database with same CATH topology
2XC2A 3CBUA 5GAPD 4JU5A 9GSSA 4PUFC 2H19A 2LNTA 2H66A 1YQ1A 1SJIA 2EIQA 5ECHB 4MNNA 2IJYA 4ILFA 1WIKA 3ZITA 1HNBA 4DVCA 1PKZA 4HJMA 1Z6NA 3NZNA 3J7Yb 1ZOFA 4I5QA 3LGCA 1O7UA 3F6FA 4HDEA 2GZPA 3TGZA 2VUPA 2K8SA 2X8HA 4IJ3A 4EF0A 1NM3A 1F2EA 4KF9A 3TKPA 6GSUA 2YV9A 3MNGA 5D9XA 4LA1A 5AIXA 2B7JA 4E8EA 4USSA 1PX7A 4JEDA 6GSTA 2IMEA 1I9DA 4PX1A 3GKXA 4WEYA 1SJ6A 5IOWA 2OACA 4O7HA 5HFGA 1XOAA 1PN0A 4A5PA 1SKWB 2BJXA 2LNSA 2H8LA 4PQ1A 4IJIA 5F05A 5HR1A 3CRTA 2DKIA 2LJRA 4YH2A 3FR6A 4IP6A 5F07A 2HE3A 3L78A 2DJ2A 4ZL7A 3DGQA 1XFLA 2GQLA 5CREA 1EP7A 5BMUA 2GGTA 2WGRA 2WB9A 5CAXA 5J9CA 1G7OA 1AAZA 1CQHA 3EVIA 2F3MA 2H01A 5ID2B 4EIQA 4KCAA 2HT9A 1NHYA 1OKTA 5KOXA 4GWRA 4MH3A 3F4TA 4JBBA 1V58A 3FMWA 4ZBBA 1V9WA 2LRTA 1ABAA 2FWGA 2ZUPA 2R0GA 4OD7A 1T4YA 4PTSA 1ZYPA 5G2ZA 2IPAA 2LKUA 4EO3A 4PNGA 4OFMA 1YEPA 1T4ZA 1I5GA 1OC3A 4MP4A 3BOAA 4MZBA 2CAIA 4GCIA 2HZEB 3QMXA 1DE1A 1B8XA 1SK2A 2GSRA 3HXSA 4YAVA 2X8GA 4LL4B 1VGLA 4QL7A 4X43A 1WOUA 2JZTA 4ZXGA 2FA8A 3D5JA 4G2EA 4Q5NA 1XWBA 4K8MA 5DJMA 1GH2A 1QMVA 3I6AA 3UMAA 4BL7B 1SYXA 4L5OA 3E3EA 1M9AA 1UVZA 2DIYA 2HRKA 20GSA 3D0ZA 3EURA 5ELAA 3W8JA 3IRAA 2YWMA 3D4TA 3IR4A 1OAZA 4GTUA 1ERUA 3KH9A 5ECRB 2VCVA 1F6MC 3G9BA 3LORA 2I1UA 2OADA 3A5WA 4EL1A 1Z6MA 3TJKA 4X0XA 2CVBA 4KH7A 3HYPA 1XVWA 5IPGA 4WBRD 4G0IA 5LNKe 3GKNA 5D9WA 3FHKA 3GL5A 2DJ0A 2VAFA 1OKDA 1TRVA 2CVKA 1MD4A 1K0MA 2L4QA 4WKWA 4EUYA 1EV4A 5CRHA 3ME7A 2FNOA 4PXOA 3OR5A 4MJAA 2A4VA 3RBTA 2VLUA 2C3TA 4GSNA 1EGOA 3D21A 4OCFA 4YQVA 2K18A 3M1GA 4DEJA 4IN0A 2LS5A 1ZMAA 4FO5A 2L5OA 3ZIJA 1XWGA 1GLQA 5HFIA 5F0GA 2X99A 3TDGA 4ZB6A 2FWEA 2XPEA 4WR5A 1VF2A 1K3LA 5JCUA 4QL9A 2JSYA 2O87A 3GURA 1V40A 3GA4A 3C7MA 2WDUA 3QD9A 2VCWA 2CA8A 2HZFA 5IOXA 3TJFA 2H76A 1A8YA 4V2MA 3HDCA 5JWOB 2I81A 2PUKC 4I6XA 3LFLA 2NVLA 4XRDA 1U3IA 1GSYA 1TJDA 1B4QA 3R3EA 1QQ2A 2L6CA 3DYRA 2L5LA 3SBCA 1R4WA 2VL9A 1GTBA 5EPFA 3MIXA 3QAWA 1PQNA 3PR8A 4NAXA 4IHUA 1JLVA 5HR3A 1SK1A 3BJ5A 4RUVA 3FYGA 2C8UA 2EIRA 1OVNA 1EOHA 3LJRA 2OBKA 3GSSA 1MEKA 1W4VA 1RW1A 3UJ1A 5IO2A 1TI1A 4F0BA 2HXKA 5AIVA 3HKRA 3IBHA 1T3BA 3CSIA 1VF1A 2TRCP 3APSA 4EDZA 4OO5A 5DCHA 1M9BA 3APOA 5GZZB 3FK8A 2GS3A 2I4AA 1O81A 2CT6A 3PPUA 1M0UA 3MWHA 4ID0A 2OE0A 1GL8A 1ZYNA 2HRFA 2XHFA 4BVYB 4JZQA 5B6MA 2M72A 1PD21 1AUCA 3ZIVA 3IHGA 3UIWA 1E2YA 4KDYA 3GNJA 1UN2A 1GSDA 4K0NA 2H0HA 1ACVA 3LEFA 4N10A 2VCQA 1WMJA 2M80A 4OO4A 4MPGA 3QOUA 1O85A 3MSZA 3O6TA 2J23A 1X5DA 1JZRA 2DMLA 3A2WA 1FO5A 1XPVA 1W89A 1M99A 3CTFA 3QAVA 4ECCA 2YJHA 3KJYA 3TJJA 4I2UA 2E2MA 4F0CA 4YKFA 3EWLA 2MBSA 4MMMA 2R6KA 1TRSA 2F8FA 3FKFA 1PA3A 1R5PA 1XWCA 1XIYA 5GAND 2L4CA 3BD2A 5CRWA 3FZ4A 1HQOA 3I43A 3L9UA 1QUWA 5IMCA 1SL2B 1YY7A 2GSQA 3KMOA 5ID2A 1TRUA 4YAPA 3IV4A 2WJUA 1ZZYA 3WT2A 2RM6A 4MDCA 1FB6A 4HS1A 3HVVA 1A2JA 4K6XA 4BVXB 1EP8A 3GMFA 3H4KA 1SD9A 3ISOA 3Q74A 5ELGA 3ZFBA 5FT3A 4XS1A 1GLPA 1VRSD 2I9HA 2PN8A 4K1FA 3VWXA 2YWOA 1F9MA 1EV9A 12GSA 1FG4A 1BEDA 2FD3A 1XWKA 2Z9SA 3L4NA 4IP1A 5DALB 2OJLA 3HA9A 2MMZA 2C0GA 1X5CA 1TU8A 3GUSA 4GXZA 2MMAA 4XTSA 2A4HA 4NMUA 4ZIJA 4OMVA 3ZREA 2IFQB 2HZEA 1ST9A 1SL1B 4K2XA 2FLSA 4RI7A 2A2RA 4JRRA 5DQSA 4MABA 1WRYA 2PVOC 3VI7A 3E0UA 2C3QA 4ICYA 4GRFA 3ZFLA 4BL7A 5IMVA 2EIOA 3TCOA 5ECOB 1U3AA 2B5EA 5EVOA 1CQGA 2DC5A 2P0GA 2V1MA 2KUCA 2LRCA 3IC4A 2NBSA 4Q5RA 2B6MA 1K0BA 1M2BA 3NOFA 2LEGA 6GSYA 1THXA 3FZ5A 3I9V2 3P2AA 3ZVJA 1KEBA 3UL3A 3CYNA 5IIZA 5IPHA 3VWUA 2CV4A 1Y25A 4V2NA 3UOMA 3ERWA 1A24A 4ML1A 2K9FA 1OC9B 3ZLPA 3TKSA 1K0OA 1BYEA 2LSTA 1BG5A 3KTBA 2IMDA 2B5YA 2CVDA 3QPMA 1USBA 1YEXA 1A0FA 2AJQB 5FWGA 2DJ1A 2LJAA 3IHQA 3Q19A 4GQCA 5F06A 1T8EB 3PINA 4FYBA 5EY6A 3IAM2 2F9SA 2GVPA 1TDIA 3TKSE 4IQAA 4OCEA 2CAQA 5KN0A 4L5LA 2D2ZA 3P8WA 1YF1A 2VL2A 2YWIA 4O5UA 4Q5FA 3CTGA 1FB0A 2B1LA 2LQOA 2DIZA 5IM9A 1Q98A 3QFBC 4N0ZA 4HU9A 5ECQB 1KNGA 2RUEA 3K8NA 3RPPA 1THOA 4OFTA 2KHPA 2YPMA 4EVMA 2H0IA 1PKWA 1A2MA 2B3SA 2N5BA 1WWJA 2WZ9A 6GSVA 4MK3A 4NHZA 1LU4A 5KN2A 2DKHA 1GUKA 3UVHA 4EE0A 4NXIA 3GX8A 2DSAA 4LMWA 4WETA 3IK9A 2PERA 22GSA 3N9JA 1HNCA 2GTUA 2X49A 1YDKA 3M9KA 1YF0A 1GWCA 3LWAA 4HZ4A 2JACA 2H74A 2JSZA 4WXTA 4FYCA 4MZWA 4LMVA 1ZGNA 4NWYA 4AF2A 2PWJA 2FA4A 2FWFA 1ZCPA 19GSA 2YV7A 1GSFA 2ON7A 5E4WA 3H93A 4DSQA 2FY6A 3HZ4A 4WBJA 2IL3A 2WFCA 16GSA 5ECPB 4AJ8A 4J57E 5J41A 1PX6A 1DUGA 2OBIA 4BVYA 3HHVA 4KW6A 2IIYA 5ECKB 3TOTA 1MDIA 4TR1B 3GTUB 4V2LA 1ZL9A 3FR3A 1PL1A 1M7TA 3F63A 2C0EA 3VPQA 3VWVA 5A4WA 2KP1A 2PVQA 1ZYQB 2R0PA 5DVBA 4TXVA 2H71A 3BBYA 3F3QA 4KA0A 3MDKA 1G6YA 2XBIA 3IC8A 4K5RA 2YZUA 3KZQA 1TK5B 3NIVA 4XS4B 3DVXA 2H1GA 4JE1A 3ZYWA 5G30A 1F3BA 3J7Yk 5H5QA 2V6OA 3QDNA 3QCPA 4K7OA 1BX9A 4BA7A 2V32A 5FHIA 5B7CA 2MMNA 3VI5A 4HI7A 1TTZA 3IK7A 4ECIA 1FOVA 1Z7RA 1EEMA 1S3AA 2N5AA 3H8QA 4KSMA 3FW2A 4BWSA 1TI3A 4Z2TA 3U5RE 3AY8A 4L0WA 1FAAA 2IMKA 2HI7A 2P5RA 4IBPA 4IS0A 1AQVA 5D9TA 2NTOA 1VF4A 4I97A 2VM1A 4RQXA 1PSQA 1K0DA 1OC8A 4G0LA 1OE7A 5IMZA 4BVXA 1Z7PA 4HU7A 2VO4A 10GSA 2OA7A 3HZ8A 5CYYA 2RUFA 1SKSB 5DALA 2YJ7A 3GL3A 4K7NA 3D6IA 3TKQA 2H72A 4D73B 3IPZA 2IFQA 1X9SB 3QR6A 2RLIA 1JHBA 3FZ9A 3UBLA 3ZZXA 3KTLA 4YQMA 1GUHA 1S3CA 5COHA 2HRNA 4LLRA 5D96A 1J9BA 4YQUA 1TKDB 3KEBA 4X1UA 4TW5A 2UZ8A 1MTCA 1ON4A 2REMA 5CO3A 2MMOA 5JWQB 1YKCA 3QFAC 2E2GA 3LW9A 5JWRB 2RIIA 2GDRA 1GRXA 3M9JA 2O89A 3DMLA 2GZYA 3VK9A 11GSA 5ECIB 3L9VA 1ML6A 3C71A 5JCGA 3IA1A 5G5FA 1DSBA 2WS2A 1GNEA 1O6JA 3WYWA 4F82A 2LTKA 4HQSA 4ZL8A 2FWHA 3HJPA 4ZBDA 1OC9A 1GUMA 2P31A 3LXTA 1QK8A 1TU7A 3F4SA 1G6WA 4MJBA 3U6VA 1PRXA 2VL3A 4KB3A 1EZKA 2KLXA 5A5KA 2BTOT 2VLTA 3A3TA 4HJ2A 4XIHA 5H5SA 4I2TA 1X9WB 2ES7A 3FR9A 3TRQA 1XW5A 2H6YA 2IWTA 5EL8A 1MD3A 4ECJA 2R3XA 1XCCA 5BRTA 3ZL5A 4MH2A 1B9YC 4IKHA 3F0IA 4K5SA 4V1Ap 3PGTA 1XXUA 5DAKB 1M2AA 4KNDA 4E8HA 5B6NA 2RM5A 3G7YA 5IQYA 4K7IA 2M46A 2KP2A 2PBJA 4FQUA 4F9ZA 5HR0A 1URMA 1OE8A 4BPYA 1A2LA 1BQ7A 3QAGA 3RHBA 5B8AA 2F8AA 1SJZA 1SU9A 2GT6A 1SYRA 4ZB8A 1X5EA 1R5AA 3M0FA 4ZB9A 2VM2A 3KD0A 1XVQA 1S3DA 1JZDA 3IE3A 1U87A 2YNXA 5ECSA 3H79A 1JZOA 1EGRA 1B48A 1Z9HA 4ZILA 3E9JB 3EMPA 3ZTLA 3GYKA 1ERWA 4Z2UA 1Y6EA 2CZ3A 1T1VA 1DBYA 5LD0A 1BJXA 2MZCA 4G10A 3ZMKA 3GH6A 4N0VA 2GSTA 5DQYA 2J9HA 3D4MA 1WPIA 1BAYA 2NPBA 1UA5A 3EPTA 4HUAA 4TR3A 4GLTA 2GQMA 2HSYA 2N5FA 2QKEA 1RQMA 3TRXA 2PU9C 1TP9A 1XBSA 2HFDA 2ZNMA 3UVTA 2YP6A 1GNWA 2R0CA 5D73A 18GSA 2H6XA 4TR1A 3IDVA 1ILOA 3GTUA 4WR4A 5ENUA 3ED3A 1AW9A 3IXRA 1EOGA 2L57A 5HR2A 3CXGA 2YOIA 4G19A 2JL4A 2H75A 1TK8B 2F51A 4ML6A 3EINA 1Z5YE 1GULA 5G1KA 5AN1A 3O3TA 3CMIA 4XS4A 3I69A 4TXOB 3GIXA 1F37A 1VF3A 3WGXA 3LQ7A 3GN3A 1SK0A 1H4OA 4POLA 1NHOA 1X0RA 2G0FA 2YANA 5LCZA 2GLRA 3C8EA 4OWYA 2AAWA 3GKMA 5G1LA 2QA1A 4OFNA 2OE3A 2X4AA 4G9HA 4HQZA 3EE2A 3CRUA 2DJJA 2FUG2 4XHMA 14GSA 4H86A 2AYTA 1PGTA 3HY2A 3US3A 3P90A 1V57A 2E7PA 1E6BA 3ME8A 4L0UA 4ULXA 2GT5A 3KIJA 2E0QA 1G0TA 3GSTA 5AGYA 3N5OA 5G5EA 4MJCA 1V98A 5C00A 2VD0A 4IW9A 1EEJA 1SL0B 2CX3A 4IELA 3F4RA 4TVEA 2AUVA 4TR0A 3KMNA 1ERVA 2C1YA 3LYKA 6GSWA 4KX4A 2WCIA 3JCML 1HD2A 1J08A 2YCDA 3EMXA 3D22A 3F6DA 1YJ6A 1K0AA 4HZ2A 4V1Ag 3M8NA 4ZBAA 4MA9A 2FGXA 6GSSA 2LQQA 4POKA 4D73A 3ERFA 1GTAA 3KH7A 4PURA 2QSIA 3CSJA 4JR4A 1GTUA 3DKSA 3G7IA 13GSA 3HVXA 3GKKA 5ABRA 5ECNB 3P7XA 3R2QA 1N8JA 5IO0A 3EC3A 4MCUA 4XCSA 5CRDA 2H1AA 1FVKA 4ISDA 2DJKA 5IMDA 3MAKA 4KAEA 3A5IA 1PMTA 4PUAA 5ECLB 3FY7A 1TRWA 4K0GA 3EU3A 2ON5A 2V6KA 2BMXA 2XPDA 2QA2A 1WP0A 3UEMA 2YZHA 4FH8A 3VFIA 3TJGA 1F3AA 4MF5A 4KGIA 3C73A 1B4PA 4DSSB 2I3YA 3BCKA 2X64A 1GP1A 4EC0A 1V2AA 3L0HA 1HNAA 5D93A 4NV5A 1A23A 2HSHA 3EYTA 17GSA 2O85A 4AGSA 4KSOA 2CQ9A 2HSMA 2R37A 5AISA 3M3MA 3TKRA 3BCIA 1K3OA 1SKRB 2H6ZA 4MZCA 3HD5A 2X8CA 1ERTA 3DD3A 4Z2RA 1A0RP 4N30A 1AQWA 3Q18A 4GSTA 3PH9A 2C80A 3IOSA 4EKZA 3A2VA 2AB6A 2ZCTA 4FYUA 1IYIA 1T00A 4YKGA 3HCZA 2JU5A 1GSEA 4GSSA 1HYUA 1XW9A 2VCTA 2PPTA 4DSRA 4F2IA 2H30A 4IVFA 1ZYEA 2DMMA 4IGJA 3TRPA 2A2PA 3GX0A 4GQFA 3TOUA 4MF7A 5DAKA 4Z7XA 3ERGA 3APQA 3UBKA 2IMIA 4L8EA 4KE3A 4HOJA 5JCWA 2TIRA 1WE0A 3VLNA 1H75A 4K2DA 3EU4A 1UC7A 4NV2A 5E59A 1YZXA 5H5RA 4CW9A 3WT1A 1LBKA 4FIWA 1J0FA 4GF0A 5KOWA 2XBQA 1O8XA 3GV1A 2QGVA 5CNWA 1QXHA 3CSHA 2LRNA 3FZAA 3G7JA 5HFKA 3LSZA 3DIEA 5GSTA 3VPTA 1KBNA 5HQPA 1XOBA 2JADA 1YKAA 5D8IA 1T7PB 1Z3EA 4ZL9A 3KGKA 3W8SA 1JLWA 2DBCA 4RQRA 3DWVA 2LUSA 2JZRA 1TK0B 3KXOA 3L9SA 3F8UA 3W6GA 1X9MB 2O7KA 3C1RA 1FOHA 3KCMA 1TOFA 2VIMA 1NSWA 3ZRDA 2VOCA 2R4VA 3ZMLA 3KP9A 2B7KA 8GSSA 1XZOA 2P5QA 1TW9A 4WF4A 4NPBA 2R2JA 4J56E 2G2QA 4IQ1A 4I8BA 2YN1A 3DVWA 2K6VA 2OE1A 3UARA 4MF6A 4Q5QA 1IYHA 4CHSA 4N11A 3S9FA 2QC7A 2C3NA 1LJRA 4KDUA 5DJLA 1A8LA 1AXDA 3Q6OA 5A4VA 4TRXA 3HJMA 3GHAA 4RI6A 1GSQA 3O76A 3WGEA 2AV4A 5INYA 1OYJA 5DDLA 2L59A 3DRNA 5IMAA 4PNFA 2DLXA 3IAS2 4KCEA 3SWLA 2K8VA 5F8BA 3LG6A 4TXOA 2WRTA 1GSUA 3H1NA 2GQKA 4EDYA 3RDWA 4TOPA 2FCHA 4KUNA 7GSSA 1AQXA 2V2GA 3GH9A 3MYDA 4TN8A 1U88A 2HNLA 5GSSA 2FHEA 2HYXA 3KP8A 2KOKA 5KN3A 3GFKA 4TKYA 5DCGA 1K0CA 1K3YA 2MYGA 1XW6A 4EXJA 5CRGA 3DEXA 3RHCA 3VWWA 5CP1A 4JR6A 2CX4A 3V1WA 4QQ7A 5A4UA 2VD1A 6GSXA 2EC4A 3TJBA 1DE2A 5IMFA 4O92A 3RAZA 3DXBA 1FW1A 3A2XA 3F3RA 3RPNA 2H0GA 4XRAA 1O73A 2R5GA 4G0KA 4PQIA 2JZSA 1MDJA 2MBTA 4WF5A 3LYPA 4PQHA 4XS6A 2TRXA 5KN1A 3C1SA 2ALBA 2GZZA 3VURA 5C04A 4K9ZA 4F03A 2V41A 4O5QA 2VCZA 3HJOA 2OKAA 4AJ6A 3KM6A 2HRAA 4MPFA 2C0FA 2PMTA 2LV3A 1O8WA 3F9UA 2A2SA 1R26A 2H1BA 3TB2A 3TUEA 1AIUA 4KDXA 1TXXA 1MDKA 1C72A 1EWXA 3ZVJD 2LJKA 1G7EA 1M2DA 4X4JA 1AC1A 2H73A 4TR4A 1XWAA 5D9VA 5B8BA 5J5NA 2CZ2A 1QGVA 4DSSA 1QFNA 1R7HA 4NHWA 3HVSA 1FHEA 5ECMB 1RK4A 2B1KA 2VCXA 3FEUA 1N2AA 4P3YB 4AJ7A 1SD8A 1PL2A 4CDOA 2NDOA 4POBA 1JFUA 4O32A 4J2FA 1Q4JA 4ECBA 4EIPA 4ACSA 3TKSC 4O5RA 1GSSA 2H70A 3UAPA 3FRCA 2AHEA 1PN9A 3WGDA 4BWQA 2C0DA 5G31A 4CY8A 5J3RA 2B5XA 2IMFA 2H1DA 5DBQA 2GSSA 4MJEA 5KEJA 4HEA2 4MLYA 2L6DA 2IN3A 2VLVA 3LXZA 4LL1B 1KTEA 2YWNA 2DJ3A 3WD6A 4POMA 5L71A 2C4JA 1B9XC 1WJKA 4CY6A 2PGTA 1NW2A 2WULA 2HLSA 1K0NA 3GRXA 1JZWA 4PGTA 1GTIA 2O8VB 5J9BA 2VL2C 5J4UA 1FVJA 1U6TA 1SENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XC2 A;  3CBU A;  5GAP D;  4JU5 A;  9GSS A;  4PUF C;  2H19 A;  2LNT A;  2H66 A;  1YQ1 A;  1SJI A;  2EIQ A;  5ECH B;  2IJY A;  4ILF A;  1WIK A;  3ZIT A;  1HNB A;  4DVC A;  1PKZ A;  4HJM A;  1Z6N A;  3NZN A;  3J7Y b;  1ZOF A;  4I5Q A;  3LGC A;  1O7U A;  3F6F A;  4HDE A;  2GZP A;  3TGZ A;  2VUP A;  2K8S A;  2X8H A;  4IJ3 A;  4EF0 A;  1NM3 A;  1F2E A;  3TKP A;  6GSU A;  2YV9 A;  3MNG A;  5D9X A;  4LA1 A;  5AIX A;  2B7J A;  4E8E A;  1PX7 A;  4JED A;  6GST A;  2IME A;  1I9D A;  4PX1 A;  3GKX A;  4WEY A;  1SJ6 A;  5IOW A;  2OAC A;  4O7H A;  5HFG A;  1XOA A;  1SKW B;  2BJX A;  2LNS A;  2H8L A;  4PQ1 A;  4IJI A;  5F05 A;  5HR1 A;  3CRT A;  2LJR A;  4YH2 A;  3FR6 A;  4IP6 A;  5F07 A;  2HE3 A;  3L78 A;  2DJ2 A;  4ZL7 A;  3DGQ A;  1XFL A;  2GQL A;  5CRE A;  1EP7 A;  2GGT A;  2WGR A;  2WB9 A;  5CAX A;  5J9C A;  1G7O A;  1AAZ A;  1CQH A;  3EVI A;  2F3M A;  2H01 A;  5ID2 B;  4KCA A;  2HT9 A;  1NHY A;  1OKT A;  4GWR A;  4MH3 A;  3F4T A;  4JBB A;  1V58 A;  4ZBB A;  1V9W A;  2LRT A;  1ABA A;  2FWG A;  2ZUP A;  4OD7 A;  1T4Y A;  5G2Z A;  2IPA A;  2LKU A;  4EO3 A;  4PNG A;  4OFM A;  1YEP A;  1T4Z A;  1I5G A;  1OC3 A;  4MP4 A;  3BOA A;  4MZB A;  2CAI A;  4GCI A;  2HZE B;  3QMX A;  1DE1 A;  1B8X A;  1SK2 A;  2GSR A;  3HXS A;  4YAV A;  2X8G A;  4LL4 B;  1VGL A;  4QL7 A;  4X43 A;  1WOU A;  2JZT A;  4ZXG A;  2FA8 A;  3D5J A;  4G2E A;  4Q5N A;  1XWB A;  4K8M A;  5DJM A;  1GH2 A;  1QMV A;  3I6A A;  3UMA A;  1SYX A;  4L5O A;  3E3E A;  1M9A A;  1UVZ A;  2DIY A;  20GS A;  3D0Z A;  3EUR A;  5ELA A;  3W8J A;  3IRA A;  2YWM A;  3D4T A;  3IR4 A;  1OAZ A;  4GTU A;  1ERU A;  3KH9 A;  5ECR B;  2VCV A;  1F6M C;  3G9B A;  3LOR A;  2I1U A;  2OAD A;  3A5W A;  4EL1 A;  1Z6M A;  3TJK A;  4X0X A;  2CVB A;  4KH7 A;  3HYP A;  1XVW A;  5IPG A;  4WBR D;  5LNK e;  3GKN A;  5D9W A;  3FHK A;  3GL5 A;  2DJ0 A;  2VAF A;  1OKD A;  1TRV A;  2CVK A;  1MD4 A;  1K0M A;  2L4Q A;  4WKW A;  4EUY A;  1EV4 A;  5CRH A;  3ME7 A;  2FNO A;  4PXO A;  3OR5 A;  4MJA A;  2A4V A;  3RBT A;  2VLU A;  2C3T A;  4GSN A;  1EGO A;  3D21 A;  4OCF A;  4YQV A;  2K18 A;  3M1G A;  4DEJ A;  4IN0 A;  2LS5 A;  1ZMA A;  4FO5 A;  2L5O A;  3ZIJ A;  1XWG A;  1GLQ A;  5HFI A;  5F0G A;  2X99 A;  3TDG A;  4ZB6 A;  2FWE A;  2XPE A;  4WR5 A;  1VF2 A;  1K3L A;  5JCU A;  4QL9 A;  2JSY A;  2O87 A;  3GUR A;  1V40 A;  3GA4 A;  3C7M A;  2WDU A;  3QD9 A;  2VCW A;  2CA8 A;  2HZF A;  5IOX A;  3TJF A;  2H76 A;  1A8Y A;  4V2M A;  3HDC A;  5JWO B;  2I81 A;  2PUK C;  4I6X A;  3LFL A;  2NVL A;  4XRD A;  1U3I A;  1GSY A;  1TJD A;  1B4Q A;  1QQ2 A;  2L6C A;  3DYR A;  2L5L A;  3SBC A;  1R4W A;  2VL9 A;  1GTB A;  5EPF A;  3QAW A;  4NAX A;  1PQN A;  3PR8 A;  4IHU A;  1JLV A;  5HR3 A;  1SK1 A;  3BJ5 A;  4RUV A;  3FYG A;  2C8U A;  2EIR A;  1OVN A;  1EOH A;  3LJR A;  2OBK A;  3GSS A;  1MEK A;  1W4V A;  1RW1 A;  3UJ1 A;  5IO2 A;  1TI1 A;  4F0B A;  2HXK A;  5AIV A;  3HKR A;  3IBH A;  1T3B A;  3CSI A;  1VF1 A;  2TRC P;  3APS A;  4EDZ A;  4OO5 A;  5DCH A;  1M9B A;  3APO A;  5GZZ B;  3FK8 A;  2GS3 A;  2I4A A;  1O81 A;  2CT6 A;  4ID0 A;  1M0U A;  3MWH A;  2OE0 A;  1GL8 A;  2HRF A;  2XHF A;  4JZQ A;  5B6M A;  2M72 A;  1PD2 1;  1AUC A;  3ZIV A;  3UIW A;  1E2Y A;  4KDY A;  3GNJ A;  1UN2 A;  1GSD A;  4K0N A;  2H0H A;  1ACV A;  3LEF A;  4N10 A;  2VCQ A;  1WMJ A;  2M80 A;  4OO4 A;  4MPG A;  3QOU A;  1O85 A;  3MSZ A;  3O6T A;  2J23 A;  1X5D A;  1JZR A;  2DML A;  3A2W A;  1FO5 A;  1XPV A;  1W89 A;  1M99 A;  3CTF A;  3QAV A;  4ECC A;  2YJH A;  3KJY A;  3TJJ A;  4I2U A;  2E2M A;  4F0C A;  3EWL A;  2MBS A;  4MMM A;  2R6K A;  1TRS A;  2F8F A;  3FKF A;  1PA3 A;  1R5P A;  1XWC A;  1XIY A;  5GAN D;  2L4C A;  3BD2 A;  5CRW A;  3FZ4 A;  1HQO A;  3I43 A;  3L9U A;  1QUW A;  5IMC A;  1SL2 B;  1YY7 A;  2GSQ A;  3KMO A;  5ID2 A;  1TRU A;  4YAP A;  3IV4 A;  2WJU A;  1ZZY A;  3WT2 A;  2RM6 A;  4MDC A;  1FB6 A;  4HS1 A;  3HVV A;  1A2J A;  4K6X A;  1EP8 A;  3GMF A;  3H4K A;  1SD9 A;  3ISO A;  3Q74 A;  5ELG A;  3ZFB A;  5FT3 A;  4XS1 A;  1GLP A;  1VRS D;  2I9H A;  2PN8 A;  4K1F A;  3VWX A;  2YWO A;  1F9M A;  1EV9 A;  12GS A;  1FG4 A;  1BED A;  2FD3 A;  1XWK A;  2Z9S A;  3L4N A;  4IP1 A;  5DAL B;  2OJL A;  3HA9 A;  2MMZ A;  2C0G A;  1X5C A;  1TU8 A;  3GUS A;  4GXZ A;  2MMA A;  4XTS A;  4NMU A;  4ZIJ A;  4OMV A;  3ZRE A;  2IFQ B;  2HZE A;  1ST9 A;  1SL1 B;  2FLS A;  4RI7 A;  2A2R A;  4JRR A;  5DQS A;  4MAB A;  1WRY A;  2PVO C;  3VI7 A;  3E0U A;  2C3Q A;  4GRF A;  3ZFL A;  4BL7 A;  5IMV A;  2EIO A;  3TCO A;  5ECO B;  1U3A A;  2B5E A;  5EVO A;  1CQG A;  2DC5 A;  2P0G A;  2V1M A;  2KUC A;  2LRC A;  3IC4 A;  2NBS A;  4Q5R A;  2B6M A;  1K0B A;  1M2B A;  3NOF A;  2LEG A;  6GSY A;  1THX A;  3FZ5 A;  3I9V 2;  3P2A A;  3ZVJ A;  1KEB A;  3UL3 A;  3CYN A;  5IIZ A;  5IPH A;  3VWU A;  2CV4 A;  1Y25 A;  4V2N A;  3UOM A;  3ERW A;  1A24 A;  4ML1 A;  2K9F A;  1OC9 B;  3ZLP A;  3TKS A;  1K0O A;  1BYE A;  2LST A;  1BG5 A;  3KTB A;  2IMD A;  2B5Y A;  2CVD A;  3QPM A;  1USB A;  1YEX A;  1A0F A;  2AJQ B;  5FWG A;  2DJ1 A;  2LJA A;  3IHQ A;  3Q19 A;  4GQC A;  5F06 A;  1T8E B;  3PIN A;  4FYB A;  5EY6 A;  3IAM 2;  2F9S A;  2GVP A;  1TDI A;  3TKS E;  4IQA A;  4OCE A;  2CAQ A;  5KN0 A;  4L5L A;  2D2Z A;  3P8W A;  1YF1 A;  2VL2 A;  2YWI A;  4Q5F A;  3CTG A;  1FB0 A;  2B1L A;  2LQO A;  2DIZ A;  5IM9 A;  1Q98 A;  3QFB C;  4N0Z A;  4HU9 A;  5ECQ B;  1KNG A;  2RUE A;  3K8N A;  3RPP A;  1THO A;  4OFT A;  2KHP A;  2YPM A;  4EVM A;  2H0I A;  1PKW A;  1A2M A;  2B3S A;  2N5B A;  1WWJ A;  2WZ9 A;  6GSV A;  4MK3 A;  4NHZ A;  1LU4 A;  5KN2 A;  1GUK A;  3UVH A;  4EE0 A;  4NXI A;  3GX8 A;  2DSA A;  4LMW A;  4WET A;  3IK9 A;  2PER A;  22GS A;  3N9J A;  1HNC A;  2GTU A;  1YDK A;  3M9K A;  1YF0 A;  1GWC A;  3LWA A;  4HZ4 A;  2JAC A;  2H74 A;  2JSZ A;  4WXT A;  4FYC A;  4MZW A;  4LMV A;  1ZGN A;  4NWY A;  4AF2 A;  2PWJ A;  2FA4 A;  2FWF A;  1ZCP A;  19GS A;  2YV7 A;  1GSF A;  2ON7 A;  5E4W A;  3H93 A;  4DSQ A;  2FY6 A;  3HZ4 A;  4WBJ A;  2IL3 A;  2WFC A;  16GS A;  5ECP B;  4AJ8 A;  4J57 E;  5J41 A;  1PX6 A;  1DUG A;  2OBI A;  4BVY A;  3HHV A;  4KW6 A;  2IIY A;  5ECK B;  3TOT A;  1MDI A;  4TR1 B;  3GTU B;  4V2L A;  1ZL9 A;  3FR3 A;  1PL1 A;  1M7T A;  3F63 A;  2C0E A;  3VPQ A;  3VWV A;  5A4W A;  2KP1 A;  2PVQ A;  1ZYQ B;  5DVB A;  4TXV A;  2H71 A;  3BBY A;  3F3Q A;  4KA0 A;  3MDK A;  1G6Y A;  2XBI A;  2YZU A;  3KZQ A;  1TK5 B;  3NIV A;  4XS4 B;  3DVX A;  2H1G A;  4JE1 A;  3ZYW A;  5G30 A;  1F3B A;  3J7Y k;  5H5Q A;  2V6O A;  3QDN A;  3QCP A;  4K7O A;  1BX9 A;  4BA7 A;  2V32 A;  5FHI A;  5B7C A;  2MMN A;  3VI5 A;  4HI7 A;  1TTZ A;  3IK7 A;  4ECI A;  1FOV A;  1Z7R A;  1EEM A;  1S3A A;  2N5A A;  3H8Q A;  4KSM A;  3FW2 A;  4BWS A;  1TI3 A;  3U5R E;  3AY8 A;  4L0W A;  1FAA A;  2IMK A;  2HI7 A;  2P5R A;  4IBP A;  4IS0 A;  1AQV A;  5D9T A;  2NTO A;  1VF4 A;  4I97 A;  2VM1 A;  4RQX A;  1PSQ A;  1K0D A;  1OC8 A;  1OE7 A;  5IMZ A;  4BVX A;  1Z7P A;  4HU7 A;  2VO4 A;  10GS A;  2OA7 A;  3HZ8 A;  5CYY A;  2RUF A;  1SKS B;  5DAL A;  2YJ7 A;  3GL3 A;  4K7N A;  3D6I A;  3TKQ A;  2H72 A;  4D73 B;  3IPZ A;  2IFQ A;  1X9S B;  3QR6 A;  2RLI A;  1JHB A;  3FZ9 A;  3UBL A;  3ZZX A;  3KTL A;  4YQM A;  1GUH A;  1S3C A;  5COH A;  2HRN A;  4LLR A;  5D96 A;  1J9B A;  4YQU A;  1TKD B;  3KEB A;  4X1U A;  4TW5 A;  1MTC A;  1ON4 A;  2REM A;  5CO3 A;  2MMO A;  5JWQ B;  1YKC A;  3QFA C;  2E2G A;  5JWR B;  2RII A;  2GDR A;  1GRX A;  3M9J A;  2O89 A;  3DML A;  2GZY A;  3VK9 A;  11GS A;  5ECI B;  3L9V A;  1ML6 A;  3C71 A;  5JCG A;  3IA1 A;  5G5F A;  1DSB A;  2WS2 A;  1GNE A;  1O6J A;  3WYW A;  4F82 A;  2LTK A;  4HQS A;  4ZL8 A;  2FWH A;  3HJP A;  4ZBD A;  1OC9 A;  1GUM A;  2P31 A;  3LXT A;  1QK8 A;  1TU7 A;  3F4S A;  1G6W A;  4MJB A;  3U6V A;  1PRX A;  2VL3 A;  4KB3 A;  1EZK A;  2KLX A;  5A5K A;  2BTO T;  2VLT A;  3A3T A;  4HJ2 A;  4XIH A;  5H5S A;  4I2T A;  1X9W B;  2ES7 A;  3FR9 A;  3TRQ A;  1XW5 A;  2H6Y A;  2IWT A;  5EL8 A;  1MD3 A;  4ECJ A;  2R3X A;  1XCC A;  3ZL5 A;  4MH2 A;  1B9Y C;  4IKH A;  3F0I A;  4V1A p;  3PGT A;  1XXU A;  5DAK B;  1M2A A;  4KND A;  4E8H A;  5B6N A;  2RM5 A;  3G7Y A;  5IQY A;  4K7I A;  2M46 A;  2KP2 A;  2PBJ A;  4F9Z A;  5HR0 A;  1URM A;  1OE8 A;  4BPY A;  1A2L A;  1BQ7 A;  3QAG A;  3RHB A;  5B8A A;  2F8A A;  1SJZ A;  1SU9 A;  2GT6 A;  1SYR A;  4ZB8 A;  1X5E A;  1R5A A;  3M0F A;  4ZB9 A;  2VM2 A;  3KD0 A;  1XVQ A;  1S3D A;  1JZD A;  3IE3 A;  1U87 A;  2YNX A;  5ECS A;  3H79 A;  1JZO A;  1EGR A;  1B48 A;  1Z9H A;  4ZIL A;  3E9J B;  3EMP A;  3ZTL A;  3GYK A;  1ERW A;  1Y6E A;  2CZ3 A;  1T1V A;  1DBY A;  5LD0 A;  1BJX A;  2MZC A;  4G10 A;  3ZMK A;  3GH6 A;  4N0V A;  2GST A;  5DQY A;  2J9H A;  3D4M A;  1WPI A;  1BAY A;  2NPB A;  1UA5 A;  4HUA A;  4TR3 A;  4GLT A;  2GQM A;  2HSY A;  2N5F A;  2QKE A;  1RQM A;  3TRX A;  2PU9 C;  1TP9 A;  1XBS A;  2HFD A;  2ZNM A;  3UVT A;  2YP6 A;  1GNW A;  5D73 A;  18GS A;  2H6X A;  4TR1 A;  3IDV A;  1ILO A;  3GTU A;  4WR4 A;  5ENU A;  3ED3 A;  1AW9 A;  3IXR A;  1EOG A;  2L57 A;  5HR2 A;  3CXG A;  2YOI A;  4G19 A;  2JL4 A;  2H75 A;  1TK8 B;  2F51 A;  4ML6 A;  3EIN A;  1Z5Y E;  1GUL A;  5G1K A;  5AN1 A;  3O3T A;  3CMI A;  4XS4 A;  3I69 A;  4TXO B;  3GIX A;  1F37 A;  1VF3 A;  3WGX A;  3LQ7 A;  3GN3 A;  1SK0 A;  1H4O A;  4POL A;  1NHO A;  1X0R A;  2G0F A;  2YAN A;  5LCZ A;  2GLR A;  3C8E A;  4OWY A;  2AAW A;  3GKM A;  5G1L A;  4OFN A;  2OE3 A;  4HQZ A;  4G9H A;  3EE2 A;  3CRU A;  2DJJ A;  2FUG 2;  4XHM A;  14GS A;  4H86 A;  2AYT A;  1PGT A;  3HY2 A;  3US3 A;  3P90 A;  1V57 A;  2E7P A;  1E6B A;  3ME8 A;  4L0U A;  4ULX A;  2GT5 A;  3KIJ A;  2E0Q A;  1G0T A;  3GST A;  5AGY A;  3N5O A;  5G5E A;  4MJC A;  1V98 A;  5C00 A;  2VD0 A;  4IW9 A;  1EEJ A;  1SL0 B;  2CX3 A;  4IEL A;  3F4R A;  4TVE A;  2AUV A;  4TR0 A;  3KMN A;  1ERV A;  2C1Y A;  3LYK A;  6GSW A;  4KX4 A;  2WCI A;  3JCM L;  1HD2 A;  1J08 A;  2YCD A;  3EMX A;  3D22 A;  3F6D A;  1YJ6 A;  1K0A A;  4HZ2 A;  4V1A g;  3M8N A;  4ZBA A;  4MA9 A;  2FGX A;  6GSS A;  2LQQ A;  4POK A;  4D73 A;  3ERF A;  1GTA A;  3KH7 A;  4PUR A;  2QSI A;  3CSJ A;  4JR4 A;  1GTU A;  3DKS A;  3G7I A;  13GS A;  3HVX A;  3GKK A;  5ABR A;  5ECN B;  3P7X A;  3R2Q A;  1N8J A;  5IO0 A;  3EC3 A;  4MCU A;  4XCS A;  5CRD A;  2H1A A;  1FVK A;  4ISD A;  2DJK A;  5IMD A;  3MAK A;  4KAE A;  1PMT A;  4PUA A;  5ECL B;  3FY7 A;  1TRW A;  4K0G A;  3EU3 A;  2ON5 A;  2V6K A;  2BMX A;  2XPD A;  1WP0 A;  3UEM A;  2YZH A;  4FH8 A;  3VFI A;  3TJG A;  1F3A A;  4MF5 A;  4KGI A;  3C73 A;  1B4P A;  4DSS B;  2I3Y A;  3BCK A;  2X64 A;  1GP1 A;  4EC0 A;  1V2A A;  3L0H A;  1HNA A;  5D93 A;  4NV5 A;  1A23 A;  2HSH A;  3EYT A;  17GS A;  2O85 A;  4AGS A;  4KSO A;  2CQ9 A;  2R37 A;  5AIS A;  3M3M A;  3TKR A;  3BCI A;  1K3O A;  1SKR B;  2H6Z A;  4MZC A;  3HD5 A;  2X8C A;  1ERT A;  3DD3 A;  1A0R P;  4N30 A;  1AQW A;  3Q18 A;  4GST A;  3PH9 A;  2C80 A;  3IOS A;  4EKZ A;  3A2V A;  2AB6 A;  2ZCT A;  4FYU A;  1IYI A;  1T00 A;  3HCZ A;  2JU5 A;  1GSE A;  4GSS A;  1HYU A;  1XW9 A;  2VCT A;  2PPT A;  4DSR A;  4F2I A;  2H30 A;  4IVF A;  1ZYE A;  2DMM A;  4IGJ A;  3TRP A;  3TOU A;  3GX0 A;  4GQF A;  4MF7 A;  5DAK A;  4Z7X A;  3ERG A;  3APQ A;  3UBK A;  2IMI A;  4L8E A;  4KE3 A;  4HOJ A;  5JCW A;  2TIR A;  1WE0 A;  3VLN A;  1H75 A;  4K2D A;  3EU4 A;  1UC7 A;  4NV2 A;  5E59 A;  1YZX A;  5H5R A;  4CW9 A;  3WT1 A;  1LBK A;  4FIW A;  1J0F A;  4GF0 A;  2XBQ A;  1O8X A;  3GV1 A;  2QGV A;  5CNW A;  1QXH A;  3CSH A;  2LRN A;  3FZA A;  3G7J A;  5HFK A;  3LSZ A;  3DIE A;  5GST A;  3VPT A;  1KBN A;  5HQP A;  1XOB A;  2JAD A;  1YKA A;  5D8I A;  1T7P B;  1Z3E A;  4ZL9 A;  3KGK A;  3W8S A;  1JLW A;  2DBC A;  4RQR A;  3DWV A;  2LUS A;  2JZR A;  1TK0 B;  3KXO A;  3L9S A;  3F8U A;  3W6G A;  1X9M B;  2O7K A;  3C1R A;  3KCM A;  1TOF A;  2VIM A;  1NSW A;  3ZRD A;  2VOC A;  2R4V A;  3ZML A;  3KP9 A;  2B7K A;  8GSS A;  1XZO A;  2P5Q A;  1TW9 A;  4WF4 A;  4NPB A;  2R2J A;  4J56 E;  2G2Q A;  4IQ1 A;  4I8B A;  2YN1 A;  3DVW A;  2K6V A;  2OE1 A;  3UAR A;  4MF6 A;  4Q5Q A;  1IYH A;  4CHS A;  4N11 A;  3S9F A;  2QC7 A;  2C3N A;  1LJR A;  4KDU A;  5DJL A;  1A8L A;  1AXD A;  3Q6O A;  5A4V A;  4TRX A;  3HJM A;  3GHA A;  4RI6 A;  1GSQ A;  3O76 A;  3WGE A;  2AV4 A;  5INY A;  1OYJ A;  5DDL A;  2L59 A;  3DRN A;  5IMA A;  4PNF A;  2DLX A;  3IAS 2;  4KCE A;  3SWL A;  2K8V A;  5F8B A;  3LG6 A;  4TXO A;  2WRT A;  1GSU A;  3H1N A;  2GQK A;  4EDY A;  3RDW A;  2FCH A;  4TOP A;  4KUN A;  7GSS A;  1AQX A;  2V2G A;  3GH9 A;  4TN8 A;  1U88 A;  2HNL A;  5GSS A;  2FHE A;  2HYX A;  3KP8 A;  2KOK A;  5KN3 A;  3GFK A;  4TKY A;  5DCG A;  1K0C A;  1K3Y A;  2MYG A;  1XW6 A;  4EXJ A;  5CRG A;  3DEX A;  3RHC A;  3VWW A;  5CP1 A;  4JR6 A;  2CX4 A;  3V1W A;  4QQ7 A;  5A4U A;  2VD1 A;  6GSX A;  2EC4 A;  3TJB A;  1DE2 A;  5IMF A;  4O92 A;  3RAZ A;  3DXB A;  1FW1 A;  3A2X A;  3F3R A;  3RPN A;  2H0G A;  4XRA A;  1O73 A;  2R5G A;  4PQI A;  2JZS A;  1MDJ A;  2MBT A;  4WF5 A;  3LYP A;  4PQH A;  4XS6 A;  2TRX A;  5KN1 A;  3C1S A;  2ALB A;  2GZZ A;  3VUR A;  5C04 A;  4K9Z A;  4F03 A;  2V41 A;  2VCZ A;  3HJO A;  2OKA A;  4AJ6 A;  3KM6 A;  4MPF A;  2C0F A;  2PMT A;  2LV3 A;  1O8W A;  3F9U A;  2A2S A;  1R26 A;  2H1B A;  3TB2 A;  3TUE A;  1AIU A;  4KDX A;  1TXX A;  1MDK A;  1C72 A;  1EWX A;  3ZVJ D;  2LJK A;  1G7E A;  1M2D A;  1AC1 A;  2H73 A;  4TR4 A;  1XWA A;  5D9V A;  5B8B A;  5J5N A;  2CZ2 A;  1QGV A;  4DSS A;  1QFN A;  1R7H A;  4NHW A;  3HVS A;  1FHE A;  5ECM B;  1RK4 A;  2B1K A;  2VCX A;  3FEU A;  1N2A A;  4P3Y B;  4AJ7 A;  1SD8 A;  1PL2 A;  4CDO A;  2NDO A;  4POB A;  1JFU A;  4O32 A;  4J2F A;  1Q4J A;  4ECB A;  4ACS A;  3TKS C;  4O5R A;  1GSS A;  2H70 A;  3UAP A;  3FRC A;  2AHE A;  1PN9 A;  3WGD A;  4BWQ A;  2C0D A;  5G31 A;  5J3R A;  2B5X A;  2IMF A;  2H1D A;  5DBQ A;  2GSS A;  4MJE A;  5KEJ A;  4HEA 2;  4MLY A;  2L6D A;  2IN3 A;  2VLV A;  3LXZ A;  4LL1 B;  1KTE A;  2YWN A;  2DJ3 A;  3WD6 A;  4POM A;  5L71 A;  2C4J A;  1B9X C;  1WJK A;  2PGT A;  1NW2 A;  2WUL A;  2HLS A;  1K0N A;  3GRX A;  1JZW A;  4PGT A;  1GTI A;  2O8V B;  5J9B A;  2VL2 C;  5J4U A;  1FVJ A;  1U6T A;  1SEN A; 
#chains in the Genus database with same CATH topology
 2XC2 A;  3CBU A;  5GAP D;  4JU5 A;  9GSS A;  4PUF C;  2H19 A;  2LNT A;  2H66 A;  1YQ1 A;  1SJI A;  2EIQ A;  5ECH B;  4MNN A;  2IJY A;  4ILF A;  1WIK A;  3ZIT A;  1HNB A;  4DVC A;  1PKZ A;  4HJM A;  1Z6N A;  3NZN A;  3J7Y b;  1ZOF A;  4I5Q A;  3LGC A;  1O7U A;  3F6F A;  4HDE A;  2GZP A;  3TGZ A;  2VUP A;  2K8S A;  2X8H A;  4IJ3 A;  4EF0 A;  1NM3 A;  1F2E A;  4KF9 A;  3TKP A;  6GSU A;  2YV9 A;  3MNG A;  5D9X A;  4LA1 A;  5AIX A;  2B7J A;  4E8E A;  4USS A;  1PX7 A;  4JED A;  6GST A;  2IME A;  1I9D A;  4PX1 A;  3GKX A;  4WEY A;  1SJ6 A;  5IOW A;  2OAC A;  4O7H A;  5HFG A;  1XOA A;  1PN0 A;  4A5P A;  1SKW B;  2BJX A;  2LNS A;  2H8L A;  4PQ1 A;  4IJI A;  5F05 A;  5HR1 A;  3CRT A;  2DKI A;  2LJR A;  4YH2 A;  3FR6 A;  4IP6 A;  5F07 A;  2HE3 A;  3L78 A;  2DJ2 A;  4ZL7 A;  3DGQ A;  1XFL A;  2GQL A;  5CRE A;  1EP7 A;  5BMU A;  2GGT A;  2WGR A;  2WB9 A;  5CAX A;  5J9C A;  1G7O A;  1AAZ A;  1CQH A;  3EVI A;  2F3M A;  2H01 A;  5ID2 B;  4EIQ A;  4KCA A;  2HT9 A;  1NHY A;  1OKT A;  5KOX A;  4GWR A;  4MH3 A;  3F4T A;  4JBB A;  1V58 A;  3FMW A;  4ZBB A;  1V9W A;  2LRT A;  1ABA A;  2FWG A;  2ZUP A;  2R0G A;  4OD7 A;  1T4Y A;  4PTS A;  1ZYP A;  5G2Z A;  2IPA A;  2LKU A;  4EO3 A;  4PNG A;  4OFM A;  1YEP A;  1T4Z A;  1I5G A;  1OC3 A;  4MP4 A;  3BOA A;  4MZB A;  2CAI A;  4GCI A;  2HZE B;  3QMX A;  1DE1 A;  1B8X A;  1SK2 A;  2GSR A;  3HXS A;  4YAV A;  2X8G A;  4LL4 B;  1VGL A;  4QL7 A;  4X43 A;  1WOU A;  2JZT A;  4ZXG A;  2FA8 A;  3D5J A;  4G2E A;  4Q5N A;  1XWB A;  4K8M A;  5DJM A;  1GH2 A;  1QMV A;  3I6A A;  3UMA A;  4BL7 B;  1SYX A;  4L5O A;  3E3E A;  1M9A A;  1UVZ A;  2DIY A;  2HRK A;  20GS A;  3D0Z A;  3EUR A;  5ELA A;  3W8J A;  3IRA A;  2YWM A;  3D4T A;  3IR4 A;  1OAZ A;  4GTU A;  1ERU A;  4BIK A;  3KH9 A;  5ECR B;  2VCV A;  1F6M C;  3HVN A;  3G9B A;  3LOR A;  2I1U A;  2OAD A;  3A5W A;  4EL1 A;  1Z6M A;  3TJK A;  4X0X A;  2CVB A;  4KH7 A;  3HYP A;  1XVW A;  5IPG A;  4WBR D;  4G0I A;  5LNK e;  3GKN A;  5D9W A;  3FHK A;  3GL5 A;  2DJ0 A;  2VAF A;  1OKD A;  1TRV A;  2CVK A;  1MD4 A;  1K0M A;  2L4Q A;  4WKW A;  4EUY A;  1EV4 A;  5CRH A;  3ME7 A;  2FNO A;  4PXO A;  3OR5 A;  4MJA A;  2A4V A;  3RBT A;  2VLU A;  2C3T A;  4GSN A;  1EGO A;  3D21 A;  4OCF A;  4YQV A;  2K18 A;  3M1G A;  4DEJ A;  4IN0 A;  2LS5 A;  1ZMA A;  4FO5 A;  2L5O A;  3ZIJ A;  1XWG A;  1GLQ A;  5HFI A;  5F0G A;  2X99 A;  3TDG A;  4ZB6 A;  2FWE A;  2XPE A;  4WR5 A;  1VF2 A;  1K3L A;  5JCU A;  4QL9 A;  2JSY A;  2O87 A;  3GUR A;  1V40 A;  3GA4 A;  3C7M A;  2WDU A;  3QD9 A;  2VCW A;  2CA8 A;  2HZF A;  5IOX A;  3TJF A;  2H76 A;  1A8Y A;  4V2M A;  3HDC A;  5JWO B;  2I81 A;  2PUK C;  4I6X A;  3LFL A;  2NVL A;  4XRD A;  1U3I A;  1GSY A;  1TJD A;  1B4Q A;  3R3E A;  1QQ2 A;  2L6C A;  3DYR A;  2L5L A;  3SBC A;  1R4W A;  2VL9 A;  1GTB A;  5EPF A;  3MIX A;  3QAW A;  1PQN A;  3PR8 A;  4NAX A;  4IHU A;  1JLV A;  5HR3 A;  1SK1 A;  3BJ5 A;  4RUV A;  3FYG A;  2C8U A;  2EIR A;  1OVN A;  1EOH A;  3LJR A;  2OBK A;  3GSS A;  1MEK A;  1W4V A;  1RW1 A;  3UJ1 A;  5IO2 A;  1TI1 A;  4F0B A;  2HXK A;  5AIV A;  3HKR A;  3IBH A;  1T3B A;  3CSI A;  1VF1 A;  2TRC P;  3APS A;  4EDZ A;  4OO5 A;  5DCH A;  1M9B A;  3APO A;  5GZZ B;  3FK8 A;  2GS3 A;  2I4A A;  1O81 A;  2CT6 A;  3PPU A;  1M0U A;  3MWH A;  4ID0 A;  2OE0 A;  1GL8 A;  1ZYN A;  2HRF A;  2XHF A;  4BVY B;  4JZQ A;  5B6M A;  2M72 A;  1PD2 1;  1AUC A;  3ZIV A;  3IHG A;  3UIW A;  1E2Y A;  4KDY A;  3GNJ A;  1UN2 A;  1GSD A;  4K0N A;  2H0H A;  1ACV A;  3LEF A;  4N10 A;  2VCQ A;  1WMJ A;  2M80 A;  4OO4 A;  4MPG A;  3QOU A;  1O85 A;  3MSZ A;  3O6T A;  2J23 A;  1X5D A;  1JZR A;  2DML A;  3A2W A;  1FO5 A;  1XPV A;  1W89 A;  1M99 A;  3CTF A;  3QAV A;  4ECC A;  2YJH A;  3KJY A;  3TJJ A;  4I2U A;  2E2M A;  4F0C A;  4YKF A;  3EWL A;  2MBS A;  4MMM A;  2R6K A;  1TRS A;  2F8F A;  3FKF A;  1PA3 A;  1R5P A;  1XWC A;  1XIY A;  5GAN D;  2L4C A;  3BD2 A;  5CRW A;  3FZ4 A;  1HQO A;  3I43 A;  3L9U A;  4HSC X;  1QUW A;  5IMC A;  1SL2 B;  1YY7 A;  2GSQ A;  3KMO A;  5ID2 A;  1TRU A;  4YAP A;  3IV4 A;  2WJU A;  1ZZY A;  3WT2 A;  2RM6 A;  4MDC A;  1FB6 A;  4HS1 A;  3HVV A;  1A2J A;  4K6X A;  4BVX B;  1EP8 A;  3GMF A;  3H4K A;  1SD9 A;  3ISO A;  3Q74 A;  5ELG A;  3ZFB A;  5FT3 A;  4XS1 A;  1GLP A;  1VRS D;  2I9H A;  2PN8 A;  4K1F A;  3VWX A;  2YWO A;  1F9M A;  1EV9 A;  12GS A;  1FG4 A;  1BED A;  2FD3 A;  1XWK A;  2Z9S A;  3L4N A;  4IP1 A;  5DAL B;  2OJL A;  3HA9 A;  2MMZ A;  2C0G A;  1X5C A;  1TU8 A;  3GUS A;  4GXZ A;  2MMA A;  4XTS A;  2A4H A;  4NMU A;  4ZIJ A;  4OMV A;  3ZRE A;  2IFQ B;  2HZE A;  1ST9 A;  1SL1 B;  4K2X A;  2FLS A;  4RI7 A;  2A2R A;  4JRR A;  5DQS A;  4MAB A;  1WRY A;  2PVO C;  3VI7 A;  3E0U A;  2C3Q A;  4ICY A;  4GRF A;  3ZFL A;  4BL7 A;  5IMV A;  2EIO A;  3TCO A;  5ECO B;  1U3A A;  2B5E A;  5EVO A;  1CQG A;  2DC5 A;  2P0G A;  2V1M A;  2KUC A;  2LRC A;  3IC4 A;  2NBS A;  4Q5R A;  2B6M A;  1K0B A;  1M2B A;  3NOF A;  2LEG A;  6GSY A;  1THX A;  3FZ5 A;  3I9V 2;  3P2A A;  3ZVJ A;  1KEB A;  3UL3 A;  3CYN A;  5IIZ A;  5IPH A;  3VWU A;  2CV4 A;  1Y25 A;  4V2N A;  3UOM A;  3ERW A;  1A24 A;  4ML1 A;  2K9F A;  1OC9 B;  3ZLP A;  3TKS A;  1K0O A;  1BYE A;  2LST A;  1BG5 A;  3KTB A;  2IMD A;  2B5Y A;  2CVD A;  3QPM A;  1USB A;  1YEX A;  1A0F A;  2AJQ B;  5FWG A;  2DJ1 A;  2LJA A;  3IHQ A;  3Q19 A;  4GQC A;  5F06 A;  1T8E B;  3PIN A;  4FYB A;  5EY6 A;  3IAM 2;  2F9S A;  2GVP A;  1TDI A;  3TKS E;  4IQA A;  4OCE A;  2CAQ A;  5KN0 A;  4L5L A;  2D2Z A;  3P8W A;  1YF1 A;  2VL2 A;  2YWI A;  4O5U A;  4Q5F A;  3CTG A;  1FB0 A;  2B1L A;  2LQO A;  2DIZ A;  5IM9 A;  1Q98 A;  3QFB C;  4N0Z A;  4HU9 A;  5ECQ B;  1KNG A;  2RUE A;  3K8N A;  3RPP A;  1THO A;  4OFT A;  2KHP A;  2YPM A;  4EVM A;  2H0I A;  1PKW A;  1A2M A;  2B3S A;  2N5B A;  1WWJ A;  2WZ9 A;  6GSV A;  4MK3 A;  4NHZ A;  1LU4 A;  5KN2 A;  2DKH A;  1GUK A;  3UVH A;  4EE0 A;  4NXI A;  3GX8 A;  2DSA A;  4LMW A;  4WET A;  3IK9 A;  2PER A;  22GS A;  3N9J A;  1HNC A;  2GTU A;  2X49 A;  1YDK A;  3M9K A;  1YF0 A;  1GWC A;  3LWA A;  4HZ4 A;  2JAC A;  2H74 A;  2JSZ A;  4WXT A;  4FYC A;  4MZW A;  4LMV A;  1ZGN A;  4NWY A;  4AF2 A;  2PWJ A;  2FA4 A;  2FWF A;  1ZCP A;  19GS A;  2YV7 A;  1GSF A;  2ON7 A;  5E4W A;  3H93 A;  4DSQ A;  2FY6 A;  3HZ4 A;  4WBJ A;  2IL3 A;  2WFC A;  16GS A;  5ECP B;  4AJ8 A;  4J57 E;  5J41 A;  1PX6 A;  1DUG A;  2OBI A;  4BVY A;  3HHV A;  4KW6 A;  2IIY A;  5ECK B;  3TOT A;  1MDI A;  4TR1 B;  3GTU B;  4V2L A;  1ZL9 A;  3FR3 A;  1PL1 A;  1M7T A;  3F63 A;  2C0E A;  3VPQ A;  3VWV A;  5A4W A;  2KP1 A;  2PVQ A;  1ZYQ B;  2R0P A;  5DVB A;  4TXV A;  2H71 A;  3BBY A;  3F3Q A;  4KA0 A;  3MDK A;  1G6Y A;  2XBI A;  3IC8 A;  4K5R A;  2YZU A;  3KZQ A;  1TK5 B;  3NIV A;  4XS4 B;  3DVX A;  2H1G A;  4JE1 A;  3ZYW A;  5G30 A;  1F3B A;  3J7Y k;  5H5Q A;  2V6O A;  3QDN A;  3QCP A;  4K7O A;  1BX9 A;  4BA7 A;  2V32 A;  5FHI A;  5B7C A;  2MMN A;  3VI5 A;  4HI7 A;  1TTZ A;  3IK7 A;  4ECI A;  1FOV A;  1Z7R A;  1EEM A;  1S3A A;  2N5A A;  3H8Q A;  4KSM A;  3FW2 A;  4BWS A;  1TI3 A;  4Z2T A;  3U5R E;  3AY8 A;  4L0W A;  1FAA A;  2IMK A;  2HI7 A;  2P5R A;  4IBP A;  4IS0 A;  1AQV A;  5D9T A;  2NTO A;  1VF4 A;  4I97 A;  2VM1 A;  4RQX A;  1PSQ A;  1K0D A;  1OC8 A;  4G0L A;  1OE7 A;  5IMZ A;  4BVX A;  1Z7P A;  4HU7 A;  2VO4 A;  10GS A;  2OA7 A;  3HZ8 A;  5CYY A;  2RUF A;  1SKS B;  5DAL A;  2YJ7 A;  3GL3 A;  4K7N A;  3D6I A;  3TKQ A;  2H72 A;  4D73 B;  3IPZ A;  2IFQ A;  1X9S B;  3QR6 A;  2RLI A;  1JHB A;  3FZ9 A;  3UBL A;  3ZZX A;  3KTL A;  4YQM A;  1GUH A;  1S3C A;  5COH A;  2HRN A;  4LLR A;  5D96 A;  1J9B A;  4YQU A;  1TKD B;  3KEB A;  4X1U A;  4TW5 A;  2UZ8 A;  1MTC A;  1ON4 A;  2REM A;  5CO3 A;  2MMO A;  5JWQ B;  1YKC A;  3QFA C;  2E2G A;  3LW9 A;  5JWR B;  2RII A;  2GDR A;  1GRX A;  3M9J A;  2O89 A;  3DML A;  2GZY A;  3VK9 A;  11GS A;  5ECI B;  3L9V A;  1ML6 A;  3C71 A;  5JCG A;  3IA1 A;  5G5F A;  1DSB A;  2WS2 A;  1GNE A;  1O6J A;  3WYW A;  4F82 A;  2LTK A;  4HQS A;  4ZL8 A;  2FWH A;  3HJP A;  4ZBD A;  1OC9 A;  1GUM A;  2P31 A;  3LXT A;  1QK8 A;  1TU7 A;  3F4S A;  1G6W A;  4MJB A;  3U6V A;  1PRX A;  2VL3 A;  4KB3 A;  1EZK A;  2KLX A;  5A5K A;  2BTO T;  2VLT A;  3A3T A;  4HJ2 A;  4XIH A;  5H5S A;  4I2T A;  1X9W B;  2ES7 A;  3FR9 A;  3TRQ A;  1XW5 A;  2H6Y A;  2IWT A;  5EL8 A;  1MD3 A;  4ECJ A;  2R3X A;  1XCC A;  5BRT A;  3ZL5 A;  4MH2 A;  1B9Y C;  4IKH A;  3F0I A;  4K5S A;  4V1A p;  3PGT A;  1XXU A;  5DAK B;  1M2A A;  4KND A;  4E8H A;  5B6N A;  2RM5 A;  3G7Y A;  5IQY A;  4K7I A;  2M46 A;  2KP2 A;  2PBJ A;  4FQU A;  4F9Z A;  5HR0 A;  1URM A;  1OE8 A;  4BPY A;  1A2L A;  1BQ7 A;  3QAG A;  3RHB A;  5B8A A;  2F8A A;  1SJZ A;  1SU9 A;  2GT6 A;  1SYR A;  4ZB8 A;  1X5E A;  1R5A A;  3M0F A;  4ZB9 A;  2VM2 A;  3KD0 A;  1XVQ A;  1S3D A;  1JZD A;  3IE3 A;  1U87 A;  2YNX A;  5ECS A;  3H79 A;  1JZO A;  1EGR A;  1B48 A;  1Z9H A;  4ZIL A;  3E9J B;  3EMP A;  3ZTL A;  3GYK A;  1ERW A;  4Z2U A;  1Y6E A;  2CZ3 A;  1T1V A;  1DBY A;  5LD0 A;  1BJX A;  2MZC A;  4G10 A;  3ZMK A;  3GH6 A;  4N0V A;  2GST A;  5DQY A;  2J9H A;  3D4M A;  1WPI A;  1BAY A;  2NPB A;  1UA5 A;  3EPT A;  4HUA A;  4TR3 A;  4GLT A;  2GQM A;  2HSY A;  2N5F A;  1M3I A;  2QKE A;  3CQF A;  1RQM A;  3TRX A;  2PU9 C;  1TP9 A;  1XBS A;  2HFD A;  2ZNM A;  3UVT A;  2YP6 A;  1GNW A;  2R0C A;  5D73 A;  18GS A;  2H6X A;  4TR1 A;  3IDV A;  1ILO A;  3GTU A;  4WR4 A;  5ENU A;  3ED3 A;  1AW9 A;  3IXR A;  1EOG A;  2L57 A;  5HR2 A;  3CXG A;  2YOI A;  4G19 A;  2JL4 A;  2H75 A;  1TK8 B;  2F51 A;  4ML6 A;  3EIN A;  1Z5Y E;  1GUL A;  5G1K A;  1M3J A;  5AN1 A;  3O3T A;  3CMI A;  4XS4 A;  3I69 A;  4TXO B;  3GIX A;  1F37 A;  1VF3 A;  3WGX A;  3LQ7 A;  3GN3 A;  1SK0 A;  1H4O A;  4POL A;  1NHO A;  1X0R A;  2G0F A;  2YAN A;  5LCZ A;  2GLR A;  3C8E A;  4OWY A;  2AAW A;  3GKM A;  5G1L A;  2QA1 A;  4OFN A;  2OE3 A;  2X4A A;  4G9H A;  4HQZ A;  3EE2 A;  3CRU A;  2DJJ A;  2FUG 2;  4XHM A;  14GS A;  4H86 A;  2AYT A;  1PGT A;  3HY2 A;  3US3 A;  3P90 A;  1V57 A;  2E7P A;  1E6B A;  3ME8 A;  4L0U A;  4ULX A;  2GT5 A;  3KIJ A;  2E0Q A;  1G0T A;  3GST A;  5AGY A;  3N5O A;  5G5E A;  4MJC A;  1V98 A;  5C00 A;  2VD0 A;  4IW9 A;  1EEJ A;  1SL0 B;  2CX3 A;  4IEL A;  3F4R A;  4TVE A;  2AUV A;  4TR0 A;  3KMN A;  1ERV A;  2C1Y A;  3LYK A;  6GSW A;  4KX4 A;  2WCI A;  3JCM L;  1HD2 A;  1J08 A;  2YCD A;  3EMX A;  3D22 A;  3F6D A;  1YJ6 A;  1K0A A;  4HZ2 A;  4V1A g;  3M8N A;  4ZBA A;  4MA9 A;  2FGX A;  6GSS A;  2LQQ A;  4POK A;  4D73 A;  3ERF A;  1GTA A;  3KH7 A;  4PUR A;  2QSI A;  3CSJ A;  4JR4 A;  1GTU A;  3DKS A;  3G7I A;  13GS A;  3HVX A;  3GKK A;  5ABR A;  5ECN B;  3P7X A;  3R2Q A;  1N8J A;  5IO0 A;  3EC3 A;  4MCU A;  4XCS A;  5CRD A;  2H1A A;  1FVK A;  4ISD A;  2DJK A;  5IMD A;  3MAK A;  4KAE A;  3A5I A;  1PMT A;  4PUA A;  5ECL B;  3FY7 A;  1TRW A;  4K0G A;  3EU3 A;  2ON5 A;  2V6K A;  2BMX A;  2XPD A;  2QA2 A;  1WP0 A;  3UEM A;  2YZH A;  4FH8 A;  3VFI A;  3TJG A;  1F3A A;  4MF5 A;  4KGI A;  3C73 A;  1B4P A;  4DSS B;  2I3Y A;  3BCK A;  2X64 A;  1GP1 A;  4EC0 A;  1V2A A;  3L0H A;  1HNA A;  5D93 A;  4NV5 A;  1A23 A;  2HSH A;  3EYT A;  17GS A;  2O85 A;  4AGS A;  4KSO A;  2CQ9 A;  2HSM A;  2R37 A;  5AIS A;  3M3M A;  3TKR A;  3BCI A;  1K3O A;  1SKR B;  2H6Z A;  4MZC A;  3HD5 A;  2X8C A;  1ERT A;  3DD3 A;  4Z2R A;  1A0R P;  4N30 A;  1AQW A;  3Q18 A;  4GST A;  3PH9 A;  2C80 A;  3IOS A;  4EKZ A;  3A2V A;  2AB6 A;  2ZCT A;  4FYU A;  1IYI A;  1T00 A;  4YKG A;  3HCZ A;  2JU5 A;  1GSE A;  4GSS A;  1HYU A;  1XW9 A;  2VCT A;  2PPT A;  4DSR A;  4F2I A;  2H30 A;  4IVF A;  1ZYE A;  2DMM A;  4IGJ A;  3TRP A;  2A2P A;  3GX0 A;  4GQF A;  3TOU A;  4MF7 A;  5DAK A;  4Z7X A;  3ERG A;  3APQ A;  3UBK A;  2IMI A;  4L8E A;  4KE3 A;  4HOJ A;  5JCW A;  2TIR A;  1WE0 A;  3VLN A;  1H75 A;  4K2D A;  3EU4 A;  1UC7 A;  4NV2 A;  5E59 A;  1YZX A;  5H5R A;  4CW9 A;  3WT1 A;  1LBK A;  4FIW A;  1J0F A;  4GF0 A;  5KOW A;  2XBQ A;  1O8X A;  3GV1 A;  2QGV A;  5CNW A;  1QXH A;  3CSH A;  2LRN A;  3FZA A;  3G7J A;  5HFK A;  3LSZ A;  3DIE A;  5GST A;  3VPT A;  1KBN A;  5HQP A;  1XOB A;  2JAD A;  1YKA A;  5D8I A;  1T7P B;  1Z3E A;  4ZL9 A;  3KGK A;  3W8S A;  1JLW A;  2DBC A;  4RQR A;  3DWV A;  2LUS A;  2JZR A;  1TK0 B;  1XG8 A;  3KXO A;  3L9S A;  3F8U A;  3W6G A;  1X9M B;  2O7K A;  3C1R A;  1FOH A;  3KCM A;  1TOF A;  2VIM A;  1NSW A;  3ZRD A;  2VOC A;  2R4V A;  3ZML A;  3KP9 A;  2B7K A;  8GSS A;  1XZO A;  2P5Q A;  1TW9 A;  4WF4 A;  4NPB A;  2R2J A;  4J56 E;  2G2Q A;  4IQ1 A;  4I8B A;  2YN1 A;  3DVW A;  2K6V A;  2OE1 A;  3UAR A;  4MF6 A;  4Q5Q A;  1IYH A;  4CHS A;  4N11 A;  3S9F A;  2QC7 A;  2C3N A;  1LJR A;  4KDU A;  5DJL A;  1A8L A;  1S3R A;  1AXD A;  3Q6O A;  5A4V A;  4TRX A;  3HJM A;  3GHA A;  4RI6 A;  1GSQ A;  3O76 A;  3WGE A;  2AV4 A;  5INY A;  1OYJ A;  5DDL A;  2L59 A;  3DRN A;  5IMA A;  4PNF A;  2DLX A;  3IAS 2;  4KCE A;  3SWL A;  2K8V A;  5F8B A;  3LG6 A;  4TXO A;  2WRT A;  1GSU A;  3H1N A;  2GQK A;  4EDY A;  3RDW A;  4TOP A;  2FCH A;  4KUN A;  7GSS A;  1AQX A;  2V2G A;  3GH9 A;  3MYD A;  4TN8 A;  1U88 A;  2HNL A;  5GSS A;  2FHE A;  2HYX A;  3KP8 A;  2KOK A;  5KN3 A;  3GFK A;  4TKY A;  5DCG A;  1K0C A;  1K3Y A;  2MYG A;  1XW6 A;  4EXJ A;  5CRG A;  3DEX A;  3RHC A;  3VWW A;  5CP1 A;  4JR6 A;  2CX4 A;  3V1W A;  4QQ7 A;  5A4U A;  2VD1 A;  6GSX A;  2EC4 A;  3TJB A;  1DE2 A;  5IMF A;  4O92 A;  3RAZ A;  3DXB A;  1FW1 A;  3A2X A;  3F3R A;  3RPN A;  2H0G A;  4XRA A;  1O73 A;  2R5G A;  4G0K A;  4PQI A;  2JZS A;  1MDJ A;  2MBT A;  4WF5 A;  3LYP A;  4PQH A;  4XS6 A;  2TRX A;  5KN1 A;  3C1S A;  2ALB A;  2GZZ A;  3VUR A;  5C04 A;  4K9Z A;  4F03 A;  2V41 A;  4O5Q A;  2VCZ A;  3HJO A;  2OKA A;  4AJ6 A;  3KM6 A;  2HRA A;  4MPF A;  2C0F A;  2PMT A;  2LV3 A;  1O8W A;  3F9U A;  2A2S A;  1R26 A;  2H1B A;  3TB2 A;  3TUE A;  1AIU A;  4KDX A;  1TXX A;  1MDK A;  1C72 A;  1EWX A;  3ZVJ D;  2LJK A;  1G7E A;  1M2D A;  4X4J A;  1AC1 A;  2H73 A;  4TR4 A;  1XWA A;  5D9V A;  5B8B A;  5J5N A;  2CZ2 A;  1QGV A;  4DSS A;  1QFN A;  1R7H A;  4NHW A;  3HVS A;  1FHE A;  5ECM B;  1RK4 A;  2B1K A;  2VCX A;  3FEU A;  1N2A A;  4P3Y B;  4AJ7 A;  1SD8 A;  1PL2 A;  4CDO A;  2NDO A;  4POB A;  1JFU A;  4O32 A;  4J2F A;  1Q4J A;  4ECB A;  4EIP A;  4ACS A;  3TKS C;  4O5R A;  1GSS A;  2H70 A;  3UAP A;  3FRC A;  2AHE A;  1PN9 A;  3WGD A;  4BWQ A;  2C0D A;  5G31 A;  4CY8 A;  5J3R A;  2B5X A;  2IMF A;  2H1D A;  5DBQ A;  2GSS A;  4MJE A;  5KEJ A;  4HEA 2;  4MLY A;  2L6D A;  2IN3 A;  2VLV A;  3LXZ A;  4LL1 B;  1KTE A;  2YWN A;  2DJ3 A;  3WD6 A;  4POM A;  5L71 A;  2C4J A;  1B9X C;  1WJK A;  4CY6 A;  2PGT A;  1NW2 A;  2WUL A;  2HLS A;  1K0N A;  3GRX A;  1JZW A;  1PFO A;  4PGT A;  1GTI A;  2O8V B;  5J9B A;  2VL2 C;  5J4U A;  1FVJ A;  1U6T A;  1SEN A; 
#chains in the Genus database with same CATH homology
 2XC2 A;  3CBU A;  5GAP D;  4JU5 A;  9GSS A;  4PUF C;  2H19 A;  2LNT A;  2H66 A;  1YQ1 A;  1SJI A;  2EIQ A;  5ECH B;  4MNN A;  2IJY A;  4ILF A;  1WIK A;  3ZIT A;  1HNB A;  4DVC A;  1PKZ A;  4HJM A;  1Z6N A;  3NZN A;  3J7Y b;  1ZOF A;  4I5Q A;  3LGC A;  1O7U A;  3F6F A;  4HDE A;  2GZP A;  3TGZ A;  2VUP A;  2K8S A;  2X8H A;  4IJ3 A;  4EF0 A;  1NM3 A;  1F2E A;  4KF9 A;  3TKP A;  6GSU A;  2YV9 A;  3MNG A;  5D9X A;  4LA1 A;  5AIX A;  2B7J A;  4E8E A;  4USS A;  1PX7 A;  4JED A;  6GST A;  2IME A;  1I9D A;  4PX1 A;  3GKX A;  4WEY A;  1SJ6 A;  5IOW A;  2OAC A;  4O7H A;  5HFG A;  1XOA A;  1PN0 A;  4A5P A;  1SKW B;  2BJX A;  2LNS A;  2H8L A;  4PQ1 A;  4IJI A;  5F05 A;  5HR1 A;  3CRT A;  2DKI A;  2LJR A;  4YH2 A;  3FR6 A;  4IP6 A;  5F07 A;  2HE3 A;  3L78 A;  2DJ2 A;  4ZL7 A;  3DGQ A;  1XFL A;  2GQL A;  5CRE A;  1EP7 A;  5BMU A;  2GGT A;  2WGR A;  2WB9 A;  5CAX A;  5J9C A;  1G7O A;  1AAZ A;  1CQH A;  3EVI A;  2F3M A;  2H01 A;  5ID2 B;  4EIQ A;  4KCA A;  2HT9 A;  1NHY A;  1OKT A;  5KOX A;  4GWR A;  4MH3 A;  3F4T A;  4JBB A;  1V58 A;  3FMW A;  4ZBB A;  1V9W A;  2LRT A;  1ABA A;  2FWG A;  2ZUP A;  2R0G A;  4OD7 A;  1T4Y A;  4PTS A;  1ZYP A;  5G2Z A;  2IPA A;  2LKU A;  4EO3 A;  4PNG A;  4OFM A;  1YEP A;  1T4Z A;  1I5G A;  1OC3 A;  4MP4 A;  3BOA A;  4MZB A;  2CAI A;  4GCI A;  2HZE B;  3QMX A;  1DE1 A;  1B8X A;  1SK2 A;  2GSR A;  3HXS A;  4YAV A;  2X8G A;  4LL4 B;  1VGL A;  4QL7 A;  4X43 A;  1WOU A;  2JZT A;  4ZXG A;  2FA8 A;  3D5J A;  4G2E A;  4Q5N A;  1XWB A;  4K8M A;  5DJM A;  1GH2 A;  1QMV A;  3I6A A;  3UMA A;  4BL7 B;  1SYX A;  4L5O A;  3E3E A;  1M9A A;  1UVZ A;  2DIY A;  2HRK A;  20GS A;  3D0Z A;  3EUR A;  5ELA A;  3W8J A;  3IRA A;  2YWM A;  3D4T A;  3IR4 A;  1OAZ A;  4GTU A;  1ERU A;  3KH9 A;  5ECR B;  2VCV A;  1F6M C;  3G9B A;  3LOR A;  2I1U A;  2OAD A;  3A5W A;  4EL1 A;  1Z6M A;  3TJK A;  4X0X A;  2CVB A;  4KH7 A;  3HYP A;  1XVW A;  5IPG A;  4WBR D;  4G0I A;  5LNK e;  3GKN A;  5D9W A;  3FHK A;  3GL5 A;  2DJ0 A;  2VAF A;  1OKD A;  1TRV A;  2CVK A;  1MD4 A;  1K0M A;  2L4Q A;  4WKW A;  4EUY A;  1EV4 A;  5CRH A;  3ME7 A;  2FNO A;  4PXO A;  3OR5 A;  4MJA A;  2A4V A;  3RBT A;  2VLU A;  2C3T A;  4GSN A;  1EGO A;  3D21 A;  4OCF A;  4YQV A;  2K18 A;  3M1G A;  4DEJ A;  4IN0 A;  2LS5 A;  1ZMA A;  4FO5 A;  2L5O A;  3ZIJ A;  1XWG A;  1GLQ A;  5HFI A;  5F0G A;  2X99 A;  3TDG A;  4ZB6 A;  2FWE A;  2XPE A;  4WR5 A;  1VF2 A;  1K3L A;  5JCU A;  4QL9 A;  2JSY A;  2O87 A;  3GUR A;  1V40 A;  3GA4 A;  3C7M A;  2WDU A;  3QD9 A;  2VCW A;  2CA8 A;  2HZF A;  5IOX A;  3TJF A;  2H76 A;  1A8Y A;  4V2M A;  3HDC A;  5JWO B;  2I81 A;  2PUK C;  4I6X A;  3LFL A;  2NVL A;  4XRD A;  1U3I A;  1GSY A;  1TJD A;  1B4Q A;  3R3E A;  1QQ2 A;  2L6C A;  3DYR A;  2L5L A;  3SBC A;  1R4W A;  2VL9 A;  1GTB A;  5EPF A;  3MIX A;  3QAW A;  1PQN A;  3PR8 A;  4NAX A;  4IHU A;  1JLV A;  5HR3 A;  1SK1 A;  3BJ5 A;  4RUV A;  3FYG A;  2C8U A;  2EIR A;  1OVN A;  1EOH A;  3LJR A;  2OBK A;  3GSS A;  1MEK A;  1W4V A;  1RW1 A;  3UJ1 A;  5IO2 A;  1TI1 A;  4F0B A;  2HXK A;  5AIV A;  3HKR A;  3IBH A;  1T3B A;  3CSI A;  1VF1 A;  2TRC P;  3APS A;  4EDZ A;  4OO5 A;  5DCH A;  1M9B A;  3APO A;  5GZZ B;  3FK8 A;  2GS3 A;  2I4A A;  1O81 A;  2CT6 A;  3PPU A;  1M0U A;  3MWH A;  4ID0 A;  2OE0 A;  1GL8 A;  1ZYN A;  2HRF A;  2XHF A;  4BVY B;  4JZQ A;  5B6M A;  2M72 A;  1PD2 1;  1AUC A;  3ZIV A;  3IHG A;  3UIW A;  1E2Y A;  4KDY A;  3GNJ A;  1UN2 A;  1GSD A;  4K0N A;  2H0H A;  1ACV A;  3LEF A;  4N10 A;  2VCQ A;  1WMJ A;  2M80 A;  4OO4 A;  4MPG A;  3QOU A;  1O85 A;  3MSZ A;  3O6T A;  2J23 A;  1X5D A;  1JZR A;  2DML A;  3A2W A;  1FO5 A;  1XPV A;  1W89 A;  1M99 A;  3CTF A;  3QAV A;  4ECC A;  2YJH A;  3KJY A;  3TJJ A;  4I2U A;  2E2M A;  4F0C A;  4YKF A;  3EWL A;  2MBS A;  4MMM A;  2R6K A;  1TRS A;  2F8F A;  3FKF A;  1PA3 A;  1R5P A;  1XWC A;  1XIY A;  5GAN D;  2L4C A;  3BD2 A;  5CRW A;  3FZ4 A;  1HQO A;  3I43 A;  3L9U A;  1QUW A;  5IMC A;  1SL2 B;  1YY7 A;  2GSQ A;  3KMO A;  5ID2 A;  1TRU A;  4YAP A;  3IV4 A;  2WJU A;  1ZZY A;  3WT2 A;  2RM6 A;  4MDC A;  1FB6 A;  4HS1 A;  3HVV A;  1A2J A;  4K6X A;  4BVX B;  1EP8 A;  3GMF A;  3H4K A;  1SD9 A;  3ISO A;  3Q74 A;  5ELG A;  3ZFB A;  5FT3 A;  4XS1 A;  1GLP A;  1VRS D;  2I9H A;  2PN8 A;  4K1F A;  3VWX A;  2YWO A;  1F9M A;  1EV9 A;  12GS A;  1FG4 A;  1BED A;  2FD3 A;  1XWK A;  2Z9S A;  3L4N A;  4IP1 A;  5DAL B;  2OJL A;  3HA9 A;  2MMZ A;  2C0G A;  1X5C A;  1TU8 A;  3GUS A;  4GXZ A;  2MMA A;  4XTS A;  2A4H A;  4NMU A;  4ZIJ A;  4OMV A;  3ZRE A;  2IFQ B;  2HZE A;  1ST9 A;  1SL1 B;  4K2X A;  2FLS A;  4RI7 A;  2A2R A;  4JRR A;  5DQS A;  4MAB A;  1WRY A;  2PVO C;  3VI7 A;  3E0U A;  2C3Q A;  4ICY A;  4GRF A;  3ZFL A;  4BL7 A;  5IMV A;  2EIO A;  3TCO A;  5ECO B;  1U3A A;  2B5E A;  5EVO A;  1CQG A;  2DC5 A;  2P0G A;  2V1M A;  2KUC A;  2LRC A;  3IC4 A;  2NBS A;  4Q5R A;  2B6M A;  1K0B A;  1M2B A;  3NOF A;  2LEG A;  6GSY A;  1THX A;  3FZ5 A;  3I9V 2;  3P2A A;  3ZVJ A;  1KEB A;  3UL3 A;  3CYN A;  5IIZ A;  5IPH A;  3VWU A;  2CV4 A;  1Y25 A;  4V2N A;  3UOM A;  3ERW A;  1A24 A;  4ML1 A;  2K9F A;  1OC9 B;  3ZLP A;  3TKS A;  1K0O A;  1BYE A;  2LST A;  1BG5 A;  3KTB A;  2IMD A;  2B5Y A;  2CVD A;  3QPM A;  1USB A;  1YEX A;  1A0F A;  2AJQ B;  5FWG A;  2DJ1 A;  2LJA A;  3IHQ A;  3Q19 A;  4GQC A;  5F06 A;  1T8E B;  3PIN A;  4FYB A;  5EY6 A;  3IAM 2;  2F9S A;  2GVP A;  1TDI A;  3TKS E;  4IQA A;  4OCE A;  2CAQ A;  5KN0 A;  4L5L A;  2D2Z A;  3P8W A;  1YF1 A;  2VL2 A;  2YWI A;  4O5U A;  4Q5F A;  3CTG A;  1FB0 A;  2B1L A;  2LQO A;  2DIZ A;  5IM9 A;  1Q98 A;  3QFB C;  4N0Z A;  4HU9 A;  5ECQ B;  1KNG A;  2RUE A;  3K8N A;  3RPP A;  1THO A;  4OFT A;  2KHP A;  2YPM A;  4EVM A;  2H0I A;  1PKW A;  1A2M A;  2B3S A;  2N5B A;  1WWJ A;  2WZ9 A;  6GSV A;  4MK3 A;  4NHZ A;  1LU4 A;  5KN2 A;  2DKH A;  1GUK A;  3UVH A;  4EE0 A;  4NXI A;  3GX8 A;  2DSA A;  4LMW A;  4WET A;  3IK9 A;  2PER A;  22GS A;  3N9J A;  1HNC A;  2GTU A;  2X49 A;  1YDK A;  3M9K A;  1YF0 A;  1GWC A;  3LWA A;  4HZ4 A;  2JAC A;  2H74 A;  2JSZ A;  4WXT A;  4FYC A;  4MZW A;  4LMV A;  1ZGN A;  4NWY A;  4AF2 A;  2PWJ A;  2FA4 A;  2FWF A;  1ZCP A;  19GS A;  2YV7 A;  1GSF A;  2ON7 A;  5E4W A;  3H93 A;  4DSQ A;  2FY6 A;  3HZ4 A;  4WBJ A;  2IL3 A;  2WFC A;  16GS A;  5ECP B;  4AJ8 A;  4J57 E;  5J41 A;  1PX6 A;  1DUG A;  2OBI A;  4BVY A;  3HHV A;  4KW6 A;  2IIY A;  5ECK B;  3TOT A;  1MDI A;  4TR1 B;  3GTU B;  4V2L A;  1ZL9 A;  3FR3 A;  1PL1 A;  1M7T A;  3F63 A;  2C0E A;  3VPQ A;  3VWV A;  5A4W A;  2KP1 A;  2PVQ A;  1ZYQ B;  2R0P A;  5DVB A;  4TXV A;  2H71 A;  3BBY A;  3F3Q A;  4KA0 A;  3MDK A;  1G6Y A;  2XBI A;  3IC8 A;  4K5R A;  2YZU A;  3KZQ A;  1TK5 B;  3NIV A;  4XS4 B;  3DVX A;  2H1G A;  4JE1 A;  3ZYW A;  5G30 A;  1F3B A;  3J7Y k;  5H5Q A;  2V6O A;  3QDN A;  3QCP A;  4K7O A;  1BX9 A;  4BA7 A;  2V32 A;  5FHI A;  5B7C A;  2MMN A;  3VI5 A;  4HI7 A;  1TTZ A;  3IK7 A;  4ECI A;  1FOV A;  1Z7R A;  1EEM A;  1S3A A;  2N5A A;  3H8Q A;  4KSM A;  3FW2 A;  4BWS A;  1TI3 A;  4Z2T A;  3U5R E;  3AY8 A;  4L0W A;  1FAA A;  2IMK A;  2HI7 A;  2P5R A;  4IBP A;  4IS0 A;  1AQV A;  5D9T A;  2NTO A;  1VF4 A;  4I97 A;  2VM1 A;  4RQX A;  1PSQ A;  1K0D A;  1OC8 A;  4G0L A;  1OE7 A;  5IMZ A;  4BVX A;  1Z7P A;  4HU7 A;  2VO4 A;  10GS A;  2OA7 A;  3HZ8 A;  5CYY A;  2RUF A;  1SKS B;  5DAL A;  2YJ7 A;  3GL3 A;  4K7N A;  3D6I A;  3TKQ A;  2H72 A;  4D73 B;  3IPZ A;  2IFQ A;  1X9S B;  3QR6 A;  2RLI A;  1JHB A;  3FZ9 A;  3UBL A;  3ZZX A;  3KTL A;  4YQM A;  1GUH A;  1S3C A;  5COH A;  2HRN A;  4LLR A;  5D96 A;  1J9B A;  4YQU A;  1TKD B;  3KEB A;  4X1U A;  4TW5 A;  2UZ8 A;  1MTC A;  1ON4 A;  2REM A;  5CO3 A;  2MMO A;  5JWQ B;  1YKC A;  3QFA C;  2E2G A;  3LW9 A;  5JWR B;  2RII A;  2GDR A;  1GRX A;  3M9J A;  2O89 A;  3DML A;  2GZY A;  3VK9 A;  11GS A;  5ECI B;  3L9V A;  1ML6 A;  3C71 A;  5JCG A;  3IA1 A;  5G5F A;  1DSB A;  2WS2 A;  1GNE A;  1O6J A;  3WYW A;  4F82 A;  2LTK A;  4HQS A;  4ZL8 A;  2FWH A;  3HJP A;  4ZBD A;  1OC9 A;  1GUM A;  2P31 A;  3LXT A;  1QK8 A;  1TU7 A;  3F4S A;  1G6W A;  4MJB A;  3U6V A;  1PRX A;  2VL3 A;  4KB3 A;  1EZK A;  2KLX A;  5A5K A;  2BTO T;  2VLT A;  3A3T A;  4HJ2 A;  4XIH A;  5H5S A;  4I2T A;  1X9W B;  2ES7 A;  3FR9 A;  3TRQ A;  1XW5 A;  2H6Y A;  2IWT A;  5EL8 A;  1MD3 A;  4ECJ A;  2R3X A;  1XCC A;  5BRT A;  3ZL5 A;  4MH2 A;  1B9Y C;  4IKH A;  3F0I A;  4K5S A;  4V1A p;  3PGT A;  1XXU A;  5DAK B;  1M2A A;  4KND A;  4E8H A;  5B6N A;  2RM5 A;  3G7Y A;  5IQY A;  4K7I A;  2M46 A;  2KP2 A;  2PBJ A;  4FQU A;  4F9Z A;  5HR0 A;  1URM A;  1OE8 A;  4BPY A;  1A2L A;  1BQ7 A;  3QAG A;  3RHB A;  5B8A A;  2F8A A;  1SJZ A;  1SU9 A;  2GT6 A;  1SYR A;  4ZB8 A;  1X5E A;  1R5A A;  3M0F A;  4ZB9 A;  2VM2 A;  3KD0 A;  1XVQ A;  1S3D A;  1JZD A;  3IE3 A;  1U87 A;  2YNX A;  5ECS A;  3H79 A;  1JZO A;  1EGR A;  1B48 A;  1Z9H A;  4ZIL A;  3E9J B;  3EMP A;  3ZTL A;  3GYK A;  1ERW A;  4Z2U A;  1Y6E A;  2CZ3 A;  1T1V A;  1DBY A;  5LD0 A;  1BJX A;  2MZC A;  4G10 A;  3ZMK A;  3GH6 A;  4N0V A;  2GST A;  5DQY A;  2J9H A;  3D4M A;  1WPI A;  1BAY A;  2NPB A;  1UA5 A;  3EPT A;  4HUA A;  4TR3 A;  4GLT A;  2GQM A;  2HSY A;  2N5F A;  2QKE A;  1RQM A;  3TRX A;  2PU9 C;  1TP9 A;  1XBS A;  2HFD A;  2ZNM A;  3UVT A;  2YP6 A;  1GNW A;  2R0C A;  5D73 A;  18GS A;  2H6X A;  4TR1 A;  3IDV A;  1ILO A;  3GTU A;  4WR4 A;  5ENU A;  3ED3 A;  1AW9 A;  3IXR A;  1EOG A;  2L57 A;  5HR2 A;  3CXG A;  2YOI A;  4G19 A;  2JL4 A;  2H75 A;  1TK8 B;  2F51 A;  4ML6 A;  3EIN A;  1Z5Y E;  1GUL A;  5G1K A;  5AN1 A;  3O3T A;  3CMI A;  4XS4 A;  3I69 A;  4TXO B;  3GIX A;  1F37 A;  1VF3 A;  3WGX A;  3LQ7 A;  3GN3 A;  1SK0 A;  1H4O A;  4POL A;  1NHO A;  1X0R A;  2G0F A;  2YAN A;  5LCZ A;  2GLR A;  3C8E A;  4OWY A;  2AAW A;  3GKM A;  5G1L A;  2QA1 A;  4OFN A;  2OE3 A;  2X4A A;  4G9H A;  4HQZ A;  3EE2 A;  3CRU A;  2DJJ A;  2FUG 2;  4XHM A;  14GS A;  4H86 A;  2AYT A;  1PGT A;  3HY2 A;  3US3 A;  3P90 A;  1V57 A;  2E7P A;  1E6B A;  3ME8 A;  4L0U A;  4ULX A;  2GT5 A;  3KIJ A;  2E0Q A;  1G0T A;  3GST A;  5AGY A;  3N5O A;  5G5E A;  4MJC A;  1V98 A;  5C00 A;  2VD0 A;  4IW9 A;  1EEJ A;  1SL0 B;  2CX3 A;  4IEL A;  3F4R A;  4TVE A;  2AUV A;  4TR0 A;  3KMN A;  1ERV A;  2C1Y A;  3LYK A;  6GSW A;  4KX4 A;  2WCI A;  3JCM L;  1HD2 A;  1J08 A;  2YCD A;  3EMX A;  3D22 A;  3F6D A;  1YJ6 A;  1K0A A;  4HZ2 A;  4V1A g;  3M8N A;  4ZBA A;  4MA9 A;  2FGX A;  6GSS A;  2LQQ A;  4POK A;  4D73 A;  3ERF A;  1GTA A;  3KH7 A;  4PUR A;  2QSI A;  3CSJ A;  4JR4 A;  1GTU A;  3DKS A;  3G7I A;  13GS A;  3HVX A;  3GKK A;  5ABR A;  5ECN B;  3P7X A;  3R2Q A;  1N8J A;  5IO0 A;  3EC3 A;  4MCU A;  4XCS A;  5CRD A;  2H1A A;  1FVK A;  4ISD A;  2DJK A;  5IMD A;  3MAK A;  4KAE A;  3A5I A;  1PMT A;  4PUA A;  5ECL B;  3FY7 A;  1TRW A;  4K0G A;  3EU3 A;  2ON5 A;  2V6K A;  2BMX A;  2XPD A;  2QA2 A;  1WP0 A;  3UEM A;  2YZH A;  4FH8 A;  3VFI A;  3TJG A;  1F3A A;  4MF5 A;  4KGI A;  3C73 A;  1B4P A;  4DSS B;  2I3Y A;  3BCK A;  2X64 A;  1GP1 A;  4EC0 A;  1V2A A;  3L0H A;  1HNA A;  5D93 A;  4NV5 A;  1A23 A;  2HSH A;  3EYT A;  17GS A;  2O85 A;  4AGS A;  4KSO A;  2CQ9 A;  2HSM A;  2R37 A;  5AIS A;  3M3M A;  3TKR A;  3BCI A;  1K3O A;  1SKR B;  2H6Z A;  4MZC A;  3HD5 A;  2X8C A;  1ERT A;  3DD3 A;  4Z2R A;  1A0R P;  4N30 A;  1AQW A;  3Q18 A;  4GST A;  3PH9 A;  2C80 A;  3IOS A;  4EKZ A;  3A2V A;  2AB6 A;  2ZCT A;  4FYU A;  1IYI A;  1T00 A;  4YKG A;  3HCZ A;  2JU5 A;  1GSE A;  4GSS A;  1HYU A;  1XW9 A;  2VCT A;  2PPT A;  4DSR A;  4F2I A;  2H30 A;  4IVF A;  1ZYE A;  2DMM A;  4IGJ A;  3TRP A;  2A2P A;  3GX0 A;  4GQF A;  3TOU A;  4MF7 A;  5DAK A;  4Z7X A;  3ERG A;  3APQ A;  3UBK A;  2IMI A;  4L8E A;  4KE3 A;  4HOJ A;  5JCW A;  2TIR A;  1WE0 A;  3VLN A;  1H75 A;  4K2D A;  3EU4 A;  1UC7 A;  4NV2 A;  5E59 A;  1YZX A;  5H5R A;  4CW9 A;  3WT1 A;  1LBK A;  4FIW A;  1J0F A;  4GF0 A;  5KOW A;  2XBQ A;  1O8X A;  3GV1 A;  2QGV A;  5CNW A;  1QXH A;  3CSH A;  2LRN A;  3FZA A;  3G7J A;  5HFK A;  3LSZ A;  3DIE A;  5GST A;  3VPT A;  1KBN A;  5HQP A;  1XOB A;  2JAD A;  1YKA A;  5D8I A;  1T7P B;  1Z3E A;  4ZL9 A;  3KGK A;  3W8S A;  1JLW A;  2DBC A;  4RQR A;  3DWV A;  2LUS A;  2JZR A;  1TK0 B;  3KXO A;  3L9S A;  3F8U A;  3W6G A;  1X9M B;  2O7K A;  3C1R A;  1FOH A;  3KCM A;  1TOF A;  2VIM A;  1NSW A;  3ZRD A;  2VOC A;  2R4V A;  3ZML A;  3KP9 A;  2B7K A;  8GSS A;  1XZO A;  2P5Q A;  1TW9 A;  4WF4 A;  4NPB A;  2R2J A;  4J56 E;  2G2Q A;  4IQ1 A;  4I8B A;  2YN1 A;  3DVW A;  2K6V A;  2OE1 A;  3UAR A;  4MF6 A;  4Q5Q A;  1IYH A;  4CHS A;  4N11 A;  3S9F A;  2QC7 A;  2C3N A;  1LJR A;  4KDU A;  5DJL A;  1A8L A;  1AXD A;  3Q6O A;  5A4V A;  4TRX A;  3HJM A;  3GHA A;  4RI6 A;  1GSQ A;  3O76 A;  3WGE A;  2AV4 A;  5INY A;  1OYJ A;  5DDL A;  2L59 A;  3DRN A;  5IMA A;  4PNF A;  2DLX A;  3IAS 2;  4KCE A;  3SWL A;  2K8V A;  5F8B A;  3LG6 A;  4TXO A;  2WRT A;  1GSU A;  3H1N A;  2GQK A;  4EDY A;  3RDW A;  4TOP A;  2FCH A;  4KUN A;  7GSS A;  1AQX A;  2V2G A;  3GH9 A;  3MYD A;  4TN8 A;  1U88 A;  2HNL A;  5GSS A;  2FHE A;  2HYX A;  3KP8 A;  2KOK A;  5KN3 A;  3GFK A;  4TKY A;  5DCG A;  1K0C A;  1K3Y A;  2MYG A;  1XW6 A;  4EXJ A;  5CRG A;  3DEX A;  3RHC A;  3VWW A;  5CP1 A;  4JR6 A;  2CX4 A;  3V1W A;  4QQ7 A;  5A4U A;  2VD1 A;  6GSX A;  2EC4 A;  3TJB A;  1DE2 A;  5IMF A;  4O92 A;  3RAZ A;  3DXB A;  1FW1 A;  3A2X A;  3F3R A;  3RPN A;  2H0G A;  4XRA A;  1O73 A;  2R5G A;  4G0K A;  4PQI A;  2JZS A;  1MDJ A;  2MBT A;  4WF5 A;  3LYP A;  4PQH A;  4XS6 A;  2TRX A;  5KN1 A;  3C1S A;  2ALB A;  2GZZ A;  3VUR A;  5C04 A;  4K9Z A;  4F03 A;  2V41 A;  4O5Q A;  2VCZ A;  3HJO A;  2OKA A;  4AJ6 A;  3KM6 A;  2HRA A;  4MPF A;  2C0F A;  2PMT A;  2LV3 A;  1O8W A;  3F9U A;  2A2S A;  1R26 A;  2H1B A;  3TB2 A;  3TUE A;  1AIU A;  4KDX A;  1TXX A;  1MDK A;  1C72 A;  1EWX A;  3ZVJ D;  2LJK A;  1G7E A;  1M2D A;  4X4J A;  1AC1 A;  2H73 A;  4TR4 A;  1XWA A;  5D9V A;  5B8B A;  5J5N A;  2CZ2 A;  1QGV A;  4DSS A;  1QFN A;  1R7H A;  4NHW A;  3HVS A;  1FHE A;  5ECM B;  1RK4 A;  2B1K A;  2VCX A;  3FEU A;  1N2A A;  4P3Y B;  4AJ7 A;  1SD8 A;  1PL2 A;  4CDO A;  2NDO A;  4POB A;  1JFU A;  4O32 A;  4J2F A;  1Q4J A;  4ECB A;  4EIP A;  4ACS A;  3TKS C;  4O5R A;  1GSS A;  2H70 A;  3UAP A;  3FRC A;  2AHE A;  1PN9 A;  3WGD A;  4BWQ A;  2C0D A;  5G31 A;  4CY8 A;  5J3R A;  2B5X A;  2IMF A;  2H1D A;  5DBQ A;  2GSS A;  4MJE A;  5KEJ A;  4HEA 2;  4MLY A;  2L6D A;  2IN3 A;  2VLV A;  3LXZ A;  4LL1 B;  1KTE A;  2YWN A;  2DJ3 A;  3WD6 A;  4POM A;  5L71 A;  2C4J A;  1B9X C;  1WJK A;  4CY6 A;  2PGT A;  1NW2 A;  2WUL A;  2HLS A;  1K0N A;  3GRX A;  1JZW A;  4PGT A;  1GTI A;  2O8V B;  5J9B A;  2VL2 C;  5J4U A;  1FVJ A;  1U6T A;  1SEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...