3GRXA

Nmr structure of escherichia coli glutaredoxin 3-glutathione mixed disulfide complex, 20 structures
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
82
structure length
82
Chain Sequence
ANVEIYTKETCPYSHRAKALLSSKGVSFQELPIDGNAAKREEMIKRSGRTTVPQIFIDAQHIGGYDDLYALDARGGLDPLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords GLUTAREDOXIN 3
publication title NMR structure of Escherichia coli glutaredoxin 3-glutathione mixed disulfide complex: implications for the enzymatic mechanism.
pubmed doi rcsb
source organism Escherichia coli
total genus 23
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 1998-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3grxA00
3D4TA 2WULA 1VF4A 1A8YA 7GSSA 1A2JA 2GSQA 2FWHA 1Y6EA 6GSUA 5A4UA 1AW9A 1XBSA 2ES7A 2VCTA 3TGZA 1BYEA 4V2LA 2IMIA 3HZ4A 2C3NA 3P90A 4MZBA 2H1BA 2H0HA 3BCKA 4JRRA 1RQMA 1PMTA 4ZL9A 5JWRB 1OYJA 1TP9A 1E2YA 1EOHA 5DCHA 5IMDA 1ACVA 3BOAA 1FHEA 4MF7A 4J57E 2CAIA 3C8EA 3QCPA 1URMA 2YP6A 3R2QA 2VOCA 2L4QA 3F4RA 2YJHA 3GIXA 4WEYA 3O6TA 3E9JB 3PR8A 2MMAA 4ZB9A 2H01A 12GSA 4Z7XA 3QOUA 2MBSA 5DCGA 3HVXA 1HNBA 3PINA 2LKUA 3EVIA 3KP9A 5CRGA 5IMCA 4I8BA 2DJ3A 1AC1A 1ERUA 5FHIA 3DEXA 3VWVA 2NBSA 3ZYWA 3IOSA 2N5FA 2VLVA 5A5KA 1GP1A 2VL3A 2V32A 5AGYA 5F07A 4RI6A 1AQWA 1BJXA 5ECOB 2I4AA 4G19A 4TR1A 1FAAA 1FVKA 3VPQA 3IXRA 4HI7A 2KP2A 3ED3A 4IQAA 4OCFA 2R5GA 1T00A 1XZOA 3M8NA 3M9KA 2ZUPA 3FYGA 3HKRA 1O8XA 1HNAA 2OKAA 1N2AA 3GFKA 3EC3A 2C1YA 2C3QA 2I3YA 4K7IA 4KB3A 4QL7A 3TOUA 2DJJA 1FW1A 1R5AA 4P3YB 5HFGA 1EGRA 4V1Ap 1XWKA 5C00A 4TXVA 3KGKA 3HJPA 1MEKA 3GN3A 1PKZA 2JZSA 5CRWA 2C0EA 2QKEA 3MDKA 1NSWA 22GSA 2BMXA 2WZ9A 3ERWA 4X0XA 3IBHA 1G6YA 4V2MA 3UVTA 1SYXA 1GTIA 3F6FA 5ENUA 2OACA 2H8LA 4KW6A 1AIUA 1I5GA 3VFIA 1TJDA 2JSYA 3M9JA 4KCEA 5HR3A 1OE7A 3IAM2 2FUG2 3EURA 1J0FA 5D9WA 4MP4A 4BWQA 4DSRA 1T4YA 3LXZA 2F8AA 1OKDA 3G7YA 2L6DA 3FR9A 4HU7A 2OE1A 1MD3A 2JSZA 2YWOA 2FGXA 1U87A 4TKYA 1JZDA 2H75A 3GTUA 3L9UA 3HY2A 4RI7A 3EMXA 2ON7A 2GGTA 4HEA2 3EU3A 1O6JA 3LGCA 3A3TA 2VIMA 2DJKA 3APOA 3KCMA 2CVKA 3IRAA 5ID2A 1F9MA 1EOGA 2GZYA 2QSIA 3CTGA 5F8BA 2HFDA 4BA7A 4PURA 2G2QA 4JBBA 1X5EA 4RQRA 3C7MA 2H72A 4ML6A 3E3EA 4KE3A 4GRFA 2Z9SA 1Z5YE 3LEFA 4NXIA 2DSAA 1PA3A 5ECLB 5INYA 5ELGA 1SJIA 4ZB8A 4GCIA 2CVDA 3WGXA 4LL1B 4HJ2A 2L59A 1GSFA 2JL4A 2NVLA 2XBIA 2RM6A 3J7Yb 3KEBA 4XS1A 2LS5A 5DJMA 3MSZA 4GQCA 2CAQA 5EVOA 1O73A 3J7Yk 1PN9A 3W8JA 3FZAA 3I9V2 4EVMA 5IIZA 3OR5A 1EEMA 2D2ZA 4O5RA 2KOKA 2VUPA 3F9UA 4KX4A 2CT6A 5H5RA 5G1LA 3GYKA 2IMEA 4D73A 1PRXA 4GSTA 3IR4A 1S3AA 3HVVA 1GSDA 1K0OA 3IK7A 3IPZA 3SBCA 2R6KA 5GSSA 1U3IA 4HZ2A 4OD7A 2M72A 5AIVA 2I9HA 4TN8A 4NV2A 2L5LA 3CSHA 5HR0A 3ZLPA 3G9BA 2DIYA 2VCZA 2KHPA 2J23A 3QAVA 3TJJA 4EC0A 3GNJA 5HR2A 4FYBA 3ZIVA 4IS0A 1V2AA 3DYRA 4BWSA 1XWGA 4GXZA 2IWTA 4MJAA 3HXSA 3GSSA 3GMFA 5CRHA 5LNKe 2LJKA 3V1WA 5DAKA 1GTUA 5ECSA 1ST9A 2H0IA 4WKWA 2LUSA 4JR6A 1M99A 1FVJA 2C0DA 5F0GA 6GSVA 3DRNA 3ZIJA 4HJMA 4ILFA 1K3YA 2YANA 1GUMA 4MJCA 2DJ1A 5ECQB 1W89A 4OO5A 4MCUA 5CREA 1SJ6A 4IBPA 3UOMA 3TJBA 3TRQA 1M9BA 4F0BA 4EL1A 3F3RA 1ZMAA 4MJBA 8GSSA 4FIWA 4YAVA 3DXBA 5D9VA 3QAGA 2DMMA 2PGTA 3FR6A 2DIZA 3W8SA 3EYTA 3WT1A 2VAFA 4KNDA 2BTOT 1THXA 1TTZA 1C72A 3CMIA 5G1KA 2WS2A 4TRXA 1TRUA 3LXTA 3VI7A 3LJRA 3UJ1A 3VLNA 1QGVA 4WETA 4MA9A 2EIOA 4L0UA 4OFNA 4EO3A 1OKTA 2HXKA 3I43A 1F3AA 1WOUA 1GULA 5GSTA 1S3CA 3GHAA 4JR4A 1F37A 1AXDA 2C80A 4KDUA 5C04A 5G31A 1QUWA 3H79A 1UA5A 4G9HA 2EIQA 3TDGA 3C1SA 3Q6OA 4EDZA 1LBKA 4JEDA 1TXXA 4TOPA 3KP8A 1X5DA 4NV5A 9GSSA 2K9FA 3L9VA 5FT3A 4JU5A 1GSUA 2WGRA 2V41A 1TW9A 2ON5A 2ALBA 3W6GA 3QPMA 1Z6NA 1T8EB 3O3TA 4GWRA 1GLQA 2O87A 3L4NA 1LU4A 5F05A 1GSQA 1EEJA 4IP6A 1ZCPA 4LL4B 3Q18A 5JCWA 4EUYA 2IMKA 3CBUA 3IDVA 2HZFA 2VCVA 2OADA 5IPGA 5IOWA 1EWXA 5E4WA 3LSZA 4LMVA 2HZEB 2PU9C 5J4UA 1BX9A 1V98A 3ZREA 4MF5A 2OJLA 5DALB 1K0NA 4K9ZA 2CQ9A 1QQ2A 1V9WA 2B3SA 4L0WA 4GQFA 4K6XA 2LV3A 4V2NA 1KNGA 3TCOA 5B6NA 1THOA 1K0AA 2GDRA 4DSSA 3ZRDA 2IL3A 3UARA 3QFAC 1YKAA 1FB0A 4K0GA 4ECIA 2MMNA 2OBKA 2GZPA 3GX0A 4HOJA 1X9MB 4J56E 3KZQA 2WCIA 2AHEA 5DQYA 5G30A 3CSIA 3WGDA 3P2AA 4Q5NA 1XFLA 2GZZA 1WRYA 1PQNA 3FR3A 2H1DA 4NAXA 2MMOA 2C3TA 4XTSA 2CZ3A 4I2UA 1TU7A 2MBTA 1WJKA 2IJYA 3FZ4A 2FWEA 5DDLA 3HDCA 3K8NA 5IO0A 1XIYA 3PH9A 1AQVA 4DSQA 3TKQA 3RHBA 1RW1A 4ISDA 2H70A 4O32A 1U3AA 2R4VA 1ERTA 3FHKA 4I5QA 1SL1B 3LFLA 3PGTA 4IKHA 5GAND 4ZILA 3QD9A 1T4ZA 4CDOA 1F2EA 4WBJA 3GRXA 3FKFA 4HQSA 4YQVA 1GSEA 1JLVA 13GSA 2XHFA 3DVWA 2GT6A 3ZITA 1GSYA 4GTUA 2XPEA 1J9BA 5L71A 3VWXA 4WR4A 1KEBA 2H6XA 5KN0A 3CXGA 2YWMA 1PL1A 2QGVA 2BJXA 1YKCA 1BG5A 3GKMA 3LWAA 3U6VA 1GNWA 4LLRA 3A5WA 1K3LA 1U6TA 5IPHA 2P0GA 4ECJA 3KJYA 1M9AA 4CHSA 3ZZXA 2HE3A 2FY6A 2X8GA 2HI7A 1B9YC 3TRPA 3UBKA 2JZTA 4FH8A 2IFQB 2VCXA 3A2XA 3F63A 3F6DA 5IO2A 1TRSA 1RK4A 1O85A 4POBA 5DVBA 1VRSD 2IMFA 1I9DA 2VL9A 2FWFA 5KN2A 4PX1A 2B7JA 2GQMA 3TB2A 4O7HA 4ML1A 4ZXGA 1OC9A 4H86A 3ISOA 1NHOA 2JZRA 2GLRA 2VD1A 4ECBA 4EXJA 1TK8B 3QDNA 4AF2A 1BEDA 1SL2B 4YQUA 2O89A 3VWUA 17GSA 2GTUA 2N5BA 2VCQA 6GSWA 2TIRA 5CAXA 4NWYA 4WF4A 3GH9A 2LQOA 4XS4B 3EMPA 1TK0B 1CQGA 1B9XC 4K1FA 4POKA 1M2DA 3EWLA 4IP1A 3O76A 5IMAA 1O7UA 4L8EA 1GUHA 1K3OA 3HA9A 5D73A 4I97A 1GRXA 1G6WA 1SL0B 4KGIA 3ZVJA 2AYTA 1FB6A 6GSTA 2HSYA 2JU5A 1TRWA 1EGOA 1SD8A 2AAWA 3MWHA 3ZMKA 4K0NA 1EZKA 3GL5A 2X8HA 1K0MA 2H19A 1Z7RA 1GNEA 1QXHA 1CQHA 1ZGNA 3IAS2 4Q5QA 1GUKA 1K0BA 4MH3A 2LJAA 1SJZA 3GSTA 4N11A 5GZZB 1EP8A 2H1GA 2RUFA 4DVCA 2H6ZA 3KTLA 3G7JA 2OE3A 2NDOA 4ZB6A 4G2EA 3WYWA 5AN1A 5B6MA 4TXOB 1TKDB 3RBTA 1A2LA 1HD2A 5DBQA 1AQXA 1GLPA 2VLTA 2PERA 1H4OA 4CW9A 3L78A 1NW2A 1WPIA 2C4JA 5IMVA 2F8FA 2WDUA 1WIKA 1JZWA 14GSA 11GSA 3D5JA 3M0FA 2O7KA 5ECHB 2A2SA 4N30A 4MPGA 1MTCA 2HLSA 4G10A 2YZUA 1PX7A 4PQIA 2P5QA 3H1NA 5KN3A 3U5RE 2K18A 1OC8A 3UBLA 4IQ1A 5CRDA 4N0VA 1SK2A 1DUGA 2B6MA 16GSA 2FA8A 3DD3A 2PUKC 4XRDA 2GSSA 2YV9A 3D6IA 4YAPA 1X0RA 5F06A 5B8AA 2WRTA 1JZOA 3KIJA 1DE2A 3E0UA 4OFTA 5ECRB 4WF5A 2B7KA 4XHMA 3BJ5A 2F3MA 2LTKA 4AJ6A 2E7PA 1XW5A 4KDYA 4MABA 5ECMB 4GLTA 2B1KA 4POMA 4AJ8A 2DLXA 3KM6A 2CVBA 6GSSA 4RQXA 3HCZA 1KBNA 3TKSC 1PSQA 1Y25A 2YPMA 3EU4A 4MH2A 1PX6A 1SD9A 3NZNA 5A4WA 2RM5A 3FRCA 4Q5FA 2PN8A 3DIEA 4TR4A 3SWLA 4ACSA 3TRXA 2XC2A 1V40A 2YJ7A 3IHQA 2YV7A 3RPNA 4FYUA 1Q4JA 2FHEA 4TR3A 2YWIA 2NTOA 2CV4A 1J08A 4EF0A 4ZIJA 4IGJA 5HFIA 2ZCTA 2X64A 3TKSE 3RDWA 3HJOA 3UEMA 3VWWA 4TR1B 4XIHA 1GSSA 4PXOA 1AUCA 1Z9HA 4BL7A 5J9BA 1YEPA 4HDEA 5LCZA 2H0GA 1EP7A 3I6AA 2MYGA 1DBYA 4TW5A 5JWQB 1ILOA 2K8SA 1YY7A 5D9TA 2WFCA 20GSA 3ZL5A 3QFBC 3VPTA 3H4KA 3ZVJD 1YDKA 3FY7A 4POLA 5D9XA 1VGLA 4J2FA 2GQLA 5E59A 3HHVA 3N9JA 5IMZA 3LYKA 3NOFA 2KLXA 5FWGA 5COHA 3EINA 18GSA 2V1MA 2IN3A 4XCSA 4OO4A 1M2BA 1N8JA 2A2RA 2GS3A 4MDCA 4IHUA 4QQ7A 3IC4A 3KD0A 3UMAA 5DQSA 1PL2A 1Z6MA 1FOVA 1SKWB 1OC3A 2H1AA 3F4SA 3ZTLA 1ZYEA 2M80A 4NHZA 4MJEA 1IYHA 4OFMA 3KTBA 4AJ7A 4PQHA 3KXOA 3NIVA 5ECIB 1XXUA 2KP1A 2K8VA 4BVXA 1WE0A 3TJGA 1ZOFA 3IK9A 3KMOA 3D22A 1A24A 3H93A 2B5XA 1YQ1A 1T1VA 4F2IA 2VL2C 2HSHA 4XRAA 4HZ4A 3FZ5A 4IJ3A 2GQKA 3GX8A 3LG6A 5GAPD 2FCHA 2XBQA 5H5QA 3L0HA 3Q19A 4OCEA 1SKSB 4NMUA 4EDYA 5ABRA 1TDIA 2C0GA 3GTUB 3M1GA 4ZBAA 1QMVA 3ZMLA 3L9SA 4HU9A 1M0UA 2B1LA 3FEUA 2X8CA 3JCML 2L57A 5ID2B 1VF2A 1Q98A 3RPPA 4MZCA 2YOIA 4YH2A 4ZL7A 2C8UA 3TKRA 2H6YA 2V6KA 1A8LA 2H76A 1HNCA 4ID0A 2VD0A 4Q5RA 1YF1A 5JCUA 4F82A 1YZXA 2DBCA 5ECKB 3VURA 3MNGA 2CX4A 4KDXA 3TJFA 2WJUA 2GT5A 5AIXA 3ZFLA 2LRTA 3Q74A 4IW9A 2I81A 1UC7A 1TK5B 1S3DA 4MPFA 3AY8A 1XWAA 3CSJA 3CTFA 2DJ0A 3FZ9A 2L4CA 5ECNB 1WMJA 4F0CA 1TU8A 2LJRA 3GURA 4NPBA 1GWCA 2MMZA 5JCGA 1V57A 3CYNA 5AISA 4AGSA 2H74A 1OE8A 1XOAA 2AUVA 1MD4A 1DSBA 1OAZA 3UVHA 1V58A 2VL2A 2FWGA 3RHCA 4D73B 5IQYA 2X99A 1WP0A 1Z7PA 3LORA 2YN1A 3HD5A 4QL9A 2E2GA 1M7TA 4RUVA 4PGTA 1XPVA 2PWJA 3A2VA 5JWOB 1R4WA 2GSTA 3EE2A 1G7OA 2LNTA 1O8WA 3HZ8A 1A0FA 1JZRA 2PVQA 4PUFC 1DE1A 1QFNA 3ZFBA 1SKRB 2M46A 1U88A 3VK9A 1MDJA 1LJRA 3LQ7A 2F51A 3BCIA 4BVYA 2AV4A 1TRVA 4TVEA 1ZL9A 5DAKB 1GTAA 4KA0A 4EKZA 5EY6A 3HVSA 2OE0A 5IOXA 1ZYQB 1G0TA 3GKXA 5B8BA 3BBYA 1A2MA 1PD21 3APQA 3HJMA 3KMNA 1E6BA 2LQQA 2WB9A 1ABAA 4WBRD 4LMWA 2A4VA 5A4VA 3GKNA 4L5OA 1XCCA 2VCWA 5D8IA 2B5EA 1BQ7A 4KCAA 2J9HA 4ECCA 4MZWA 2FD3A 2E2MA 3WT2A 2L6CA 4WXTA 3APSA 4WR5A 5CO3A 3QAWA 2HZEA 6GSXA 3QMXA 2H71A 10GSA 2JACA 3S9FA 3CRTA 5DALA 2HYXA 3BD2A 3I69A 2PBJA 2G0FA 2L5OA 3F8UA 5KN1A 2DMLA 1SK0A 2TRCP 3GH6A 5G5FA 1NHYA 4ULXA 1G7EA 1JFUA 4X1UA 1Z3EA 1R5PA 2H73A 1F3BA 3HYPA 2CZ2A 3D4MA 1XVWA 1B4PA 1K0CA 1ZZYA 4DEJA 1H75A 1SK1A 4ZBBA 2IIYA 2EIRA 1OVNA 2I1UA 5CP1A 2FLSA 1W4VA 1ON4A 2N5AA 3MAKA 1TI1A 2PPTA 2O85A 4N0ZA 3H8QA 1R7HA 1EV4A 1EV9A 3DMLA 2R2JA 3DGQA 3UAPA 1XOBA 1QK8A 5DJLA 2LSTA 4PQ1A 3US3A 1VF3A 1T3BA 3FK8A 2YWNA 1HQOA 5D93A 2JADA 2VO4A 4KSMA 5IM9A 3F3QA 4EE0A 2HRFA 3C71A 2VM2A 1A0RP 4IN0A 3A2WA 4TR0A 4V1Ag 3KH7A 2F9SA 2LNSA 4HQZA 2AB6A 4MLYA 2VM1A 1PKWA 2DJ2A 4I2TA 2R37A 2CX3A 1AAZA 5J41A 4N10A 1XVQA 1X9WB 4F03A 5J5NA 3DKSA 3C1RA 3D0ZA 3DVXA 3P8WA 4IJIA 1T7PB 2V6OA 5J3RA 2O8VB 1X9SB 1UVZA 2KUCA 3C73A 3N5OA 1GH2A 2YNXA 2IPAA 1VF1A 4YQMA 4OMVA 1F6MC 3WD6A 1XW9A 3GA4A 5G2ZA 3F0IA 4O92A 1UN2A 4IVFA 3TKPA 1TI3A 3WGEA 3GL3A 3F4TA 4FO5A 4K7NA 5D96A 4HS1A 2DC5A 1TOFA 1KTEA 5HQPA 4OWYA 2CA8A 5ELAA 2OBIA 5J9CA 4E8EA 4MF6A 2R3XA 4BPYA 1R26A 4DSSB 2P5RA 2LEGA 2NPBA 1BAYA 1YEXA 1GTBA 4JZQA 2IFQA 3TUEA 6GSYA 1GL8A 2H66A 1SU9A 4I6XA 3ME8A 1FG4A 2FA4A 2LRNA 1M2AA 2P31A 4PNGA 5B7CA 2RIIA 5HFKA 5EPFA 5H5SA 1YF0A 3IV4A 2RUEA 2HRNA 1B48A 1XWBA 5CNWA 5ECPB 2VLUA 2OA7A 1MDIA 1JLWA 4JE1A 4K2DA 2B5YA 1B4QA 3ERGA 1ML6A 3QR6A 2YCDA 5HR1A 1MDKA 4E8HA 3UIWA 4K8MA 4LA1A 5G5EA 4MK3A 4XS4A 3IA1A 3ERFA 3ME7A 4ZL8A 3G7IA 4X43A 2ZNMA 3IE3A 1JHBA 4XS6A 4NHWA 2YZHA 2LRCA 4IELA 5CYYA 2MZCA 1PGTA 4HUAA 4KSOA 2H30A 4FYCA 3LYPA 2GSRA 5EL8A 4PUAA 1ERWA 2IMDA 1K0DA 1YJ6A 2EC4A 4F9ZA 3RAZA 4ZBDA 2K6VA 1IYIA 4PNFA 4GSNA 4KH7A 2E0QA 2QC7A 3FW2A 1XWCA 2REMA 2AJQB 1XW6A 1USBA 3TKSA 1A23A 3VI5A 4GSSA 3KH9A 1FO5A 2PMTA 2TRXA 3TOTA 3DWVA 3P7XA 3D21A 4L5LA 2V2GA 1X5CA 3CRUA 2PVOC 4TXOA 5LD0A 1O81A 2C0FA 2RLIA 3TJKA 1ERVA 1SYRA 3GUSA 19GSA 4GF0A 5KEJA 1B8XA 2FNOA 4K7OA 4KAEA 1HYUA 1SENA 2XPDA 3GV1A 4MMMA 5IMFA 4KUNA 1OC9B 2HT9A 3M3MA 1NM3A 2HNLA 3UL3A 2GVPA 3GKKA 1WWJA
chains in the Genus database with same CATH superfamily
3D4TA 2WULA 1VF4A 1A8YA 7GSSA 1A2JA 2GSQA 2FWHA 1Y6EA 6GSUA 5A4UA 1AW9A 1XBSA 2ES7A 2VCTA 3TGZA 1BYEA 4V2LA 2IMIA 3HZ4A 2C3NA 3P90A 4MZBA 2H1BA 2H0HA 3BCKA 4JRRA 1RQMA 1PMTA 4ZL9A 5KOWA 5JWRB 1OYJA 1TP9A 1E2YA 1EOHA 5DCHA 5IMDA 1ACVA 3BOAA 1FHEA 4MF7A 4J57E 2CAIA 3C8EA 3QCPA 3PPUA 1URMA 2YP6A 3R2QA 2VOCA 2L4QA 3F4RA 2YJHA 3GIXA 4WEYA 3O6TA 3E9JB 3PR8A 2MMAA 4ZB9A 2H01A 12GSA 4Z7XA 3QOUA 2MBSA 5DCGA 3HVXA 4BIKA 1HNBA 4X4JA 3PINA 2LKUA 3EVIA 3KP9A 5CRGA 5IMCA 4I8BA 2DJ3A 1AC1A 1ERUA 4MNNA 5FHIA 5KOXA 3DEXA 3VWVA 2NBSA 3ZYWA 3IOSA 2N5FA 2A2PA 2VLVA 5A5KA 1GP1A 2VL3A 2V32A 5AGYA 5F07A 4RI6A 1AQWA 1BJXA 5ECOB 2I4AA 4G19A 4TR1A 1FAAA 1FVKA 3VPQA 3IXRA 4HI7A 2KP2A 1S3RA 3ED3A 4IQAA 4OCFA 2R5GA 1T00A 1XZOA 3M8NA 3M9KA 2ZUPA 3FYGA 3HKRA 1O8XA 1HNAA 2OKAA 1N2AA 3GFKA 3EC3A 2C1YA 2C3QA 2I3YA 3R3EA 4K7IA 4G0LA 4KB3A 4QL7A 2QA2A 2DJJA 3TOUA 3LW9A 1FW1A 1R5AA 4P3YB 5HFGA 1EGRA 4V1Ap 1XWKA 5C00A 4TXVA 3KGKA 3HJPA 1MEKA 3GN3A 1PKZA 2JZSA 5CRWA 2C0EA 2QKEA 3MDKA 1NSWA 22GSA 2BMXA 2WZ9A 3ERWA 4X0XA 3IBHA 1G6YA 4V2MA 4K5SA 3UVTA 1SYXA 1GTIA 3F6FA 5ENUA 2OACA 2H8LA 4KW6A 1AIUA 1I5GA 3VFIA 1TJDA 2JSYA 3M9JA 4KCEA 5HR3A 1OE7A 3IAM2 2FUG2 3EURA 1J0FA 5D9WA 4MP4A 4BWQA 4DSRA 1T4YA 3LXZA 2F8AA 1OKDA 3G7YA 2L6DA 3FR9A 4HU7A 2OE1A 1MD3A 2JSZA 2YWOA 2FGXA 1U87A 4TKYA 1JZDA 2H75A 3GTUA 3L9UA 3HY2A 4RI7A 3EMXA 4BL7B 2ON7A 2X4AA 2GGTA 4HEA2 3EU3A 1O6JA 3LGCA 3A3TA 2VIMA 2DJKA 3APOA 3KCMA 2CVKA 3IRAA 5ID2A 1F9MA 1EOGA 2GZYA 2QSIA 3CTGA 4YKGA 5F8BA 2HFDA 4BA7A 4PURA 2G2QA 4JBBA 1X5EA 4RQRA 2HRAA 3C7MA 2H72A 4ML6A 3E3EA 4KE3A 4GRFA 2Z9SA 1Z5YE 3LEFA 4NXIA 2DSAA 1PA3A 5ECLB 5INYA 5ELGA 1SJIA 4ZB8A 4GCIA 2CVDA 3WGXA 4LL1B 4HJ2A 2L59A 1GSFA 2JL4A 2NVLA 2XBIA 2RM6A 3J7Yb 3KEBA 4XS1A 2LS5A 5DJMA 3MSZA 4GQCA 2CAQA 5EVOA 1O73A 3J7Yk 1PN9A 3W8JA 3FZAA 2R0GA 3I9V2 4EVMA 5IIZA 3OR5A 1EEMA 2D2ZA 4O5RA 2KOKA 2VUPA 3F9UA 4KX4A 2CT6A 5H5RA 5G1LA 3GYKA 2IMEA 4BVXB 4D73A 1PRXA 4GSTA 3IR4A 1S3AA 4CY6A 3HVVA 1GSDA 1K0OA 3IK7A 3IPZA 3SBCA 2R6KA 5GSSA 1U3IA 4HZ2A 4OD7A 2M72A 5AIVA 2I9HA 4TN8A 4NV2A 2L5LA 3CSHA 5HR0A 3ZLPA 3G9BA 2DIYA 2VCZA 2KHPA 2J23A 3QAVA 3TJJA 4EC0A 3GNJA 5HR2A 4FYBA 3ZIVA 4IS0A 1V2AA 3DYRA 4BWSA 1XWGA 4GXZA 2IWTA 4MJAA 3HXSA 3GSSA 3GMFA 5CRHA 5LNKe 2LJKA 3V1WA 5DAKA 1GTUA 5ECSA 1ST9A 2H0IA 4WKWA 2LUSA 4JR6A 1M99A 3A5IA 1FVJA 2C0DA 5F0GA 6GSVA 3DRNA 3ZIJA 4HJMA 4ILFA 1K3YA 2YANA 1GUMA 4MJCA 2DJ1A 5ECQB 1W89A 4OO5A 4MCUA 5CREA 1SJ6A 4IBPA 3UOMA 3TJBA 4EIPA 3TRQA 1M9BA 4F0BA 4EL1A 3F3RA 1ZMAA 4MJBA 8GSSA 4FIWA 4YAVA 3DXBA 2R0PA 5D9VA 3QAGA 2DMMA 2PGTA 3FR6A 2DIZA 3W8SA 3EYTA 3WT1A 1FOHA 2VAFA 4KNDA 2BTOT 1THXA 1TTZA 3EPTA 1C72A 3CMIA 5G1KA 2WS2A 4TRXA 1TRUA 3LXTA 3VI7A 3LJRA 3UJ1A 3VLNA 1QGVA 4WETA 4MA9A 2EIOA 4L0UA 4OFNA 4EO3A 1OKTA 2HXKA 3I43A 1F3AA 1WOUA 1GULA 5GSTA 1S3CA 3GHAA 4JR4A 1F37A 1AXDA 2C80A 4KDUA 4USSA 5G31A 5C04A 1QUWA 3H79A 1UA5A 4G9HA 2EIQA 3TDGA 3C1SA 3Q6OA 4EDZA 1LBKA 4JEDA 1TXXA 4TOPA 3KP8A 1X5DA 4NV5A 9GSSA 2K9FA 3L9VA 5FT3A 4JU5A 1GSUA 4BVYB 2WGRA 4YKFA 2V41A 1TW9A 2ON5A 2ALBA 3W6GA 3QPMA 1Z6NA 1T8EB 3O3TA 4GWRA 4K2XA 1GLQA 2O87A 3L4NA 1LU4A 5F05A 1GSQA 1EEJA 4IP6A 1ZCPA 4LL4B 3Q18A 5JCWA 4EUYA 2IMKA 3CBUA 3IDVA 2HZFA 2VCVA 2OADA 5IPGA 5IOWA 1EWXA 5E4WA 3LSZA 4LMVA 2HZEB 2PU9C 5J4UA 1BX9A 1V98A 3ZREA 4MF5A 2OJLA 5DALB 1K0NA 4K9ZA 2CQ9A 1QQ2A 1V9WA 2B3SA 4L0WA 4GQFA 4K6XA 2LV3A 4V2NA 1KNGA 3TCOA 5B6NA 1THOA 1K0AA 2GDRA 4DSSA 3ZRDA 2IL3A 3UARA 3QFAC 1YKAA 1FB0A 2R0CA 4Z2RA 4K0GA 4ECIA 2MMNA 2OBKA 1PN0A 2GZPA 3GX0A 4HOJA 1X9MB 4J56E 3KZQA 2WCIA 2AHEA 5DQYA 5G30A 4PTSA 3CSIA 3WGDA 3P2AA 4Q5NA 1XFLA 2GZZA 1WRYA 1PQNA 3FR3A 2H1DA 4NAXA 2MMOA 2C3TA 4XTSA 2CZ3A 4I2UA 1TU7A 1ZYNA 3MIXA 2MBTA 1WJKA 2IJYA 3FZ4A 2FWEA 5DDLA 3HDCA 3K8NA 5IO0A 1XIYA 3PH9A 1AQVA 4DSQA 3TKQA 3RHBA 1RW1A 4ISDA 2H70A 4O32A 1U3AA 2R4VA 1ERTA 3FHKA 4I5QA 1SL1B 3LFLA 3PGTA 4IKHA 5GAND 4ZILA 3QD9A 1T4ZA 4CDOA 1F2EA 4WBJA 3GRXA 3FKFA 4HQSA 4YQVA 1GSEA 1JLVA 13GSA 2XHFA 3DVWA 2GT6A 3ZITA 1GSYA 4GTUA 2XPEA 1J9BA 5L71A 3VWXA 4WR4A 1KEBA 2H6XA 5KN0A 3CXGA 2YWMA 1PL1A 2QGVA 2BJXA 1YKCA 1BG5A 3GKMA 3LWAA 3U6VA 1GNWA 4LLRA 3A5WA 1K3LA 1U6TA 5IPHA 2P0GA 4ECJA 3KJYA 1M9AA 4CHSA 3ZZXA 2HE3A 2FY6A 2X8GA 2HI7A 1B9YC 3TRPA 3UBKA 2JZTA 4FH8A 2IFQB 2VCXA 3A2XA 3F63A 3F6DA 5IO2A 1TRSA 1RK4A 1O85A 4POBA 5DVBA 1VRSD 2IMFA 1I9DA 2VL9A 2FWFA 5KN2A 4G0IA 3MYDA 4PX1A 2B7JA 2GQMA 3TB2A 4O7HA 4ML1A 4ZXGA 1OC9A 4H86A 4O5UA 3ISOA 2DKHA 1NHOA 2JZRA 2GLRA 2VD1A 4ECBA 4EXJA 1TK8B 3QDNA 4AF2A 1BEDA 4FQUA 1SL2B 4YQUA 2O89A 3VWUA 17GSA 2GTUA 2N5BA 2VCQA 6GSWA 2TIRA 5CAXA 4NWYA 4WF4A 3GH9A 2LQOA 4XS4B 3EMPA 1TK0B 1CQGA 1B9XC 4K1FA 4POKA 1M2DA 3EWLA 4IP1A 3O76A 5IMAA 1O7UA 4L8EA 1GUHA 1K3OA 3HA9A 5D73A 4I97A 1GRXA 1G6WA 1SL0B 4KGIA 3ZVJA 2AYTA 1FB6A 6GSTA 2HSYA 2JU5A 1TRWA 1EGOA 1SD8A 2UZ8A 2AAWA 3MWHA 3ZMKA 4K0NA 1EZKA 3GL5A 2X8HA 1K0MA 2H19A 1Z7RA 1GNEA 1QXHA 1CQHA 1ZGNA 3IAS2 4Q5QA 1GUKA 1K0BA 4MH3A 2LJAA 1SJZA 3GSTA 4N11A 5GZZB 1EP8A 2H1GA 2RUFA 4DVCA 2H6ZA 3KTLA 3G7JA 2OE3A 2NDOA 4ZB6A 4G2EA 3WYWA 5AN1A 5B6MA 4TXOB 1TKDB 3RBTA 1A2LA 1HD2A 5DBQA 1AQXA 1GLPA 2VLTA 2PERA 1H4OA 4CW9A 3L78A 1NW2A 1WPIA 2C4JA 5IMVA 2F8FA 2WDUA 1WIKA 1JZWA 14GSA 11GSA 3D5JA 3M0FA 2O7KA 5ECHB 2A2SA 4N30A 4MPGA 4A5PA 1MTCA 2HLSA 4G10A 2YZUA 1PX7A 4PQIA 2P5QA 3H1NA 5KN3A 3U5RE 2K18A 1OC8A 3UBLA 4IQ1A 5CRDA 4N0VA 1SK2A 1DUGA 2B6MA 16GSA 2FA8A 3DD3A 2PUKC 4XRDA 2GSSA 2YV9A 3D6IA 4YAPA 1X0RA 5F06A 5B8AA 2WRTA 1JZOA 3KIJA 1DE2A 3E0UA 4OFTA 5ECRB 4WF5A 2B7KA 4XHMA 3BJ5A 2F3MA 2LTKA 4AJ6A 2E7PA 1XW5A 4KDYA 4MABA 5ECMB 4GLTA 2B1KA 4POMA 4AJ8A 2DLXA 3KM6A 2CVBA 4K5RA 6GSSA 4G0KA 4RQXA 3HCZA 1KBNA 3TKSC 1PSQA 1Y25A 2YPMA 3EU4A 2HRKA 4MH2A 1PX6A 1SD9A 3NZNA 5A4WA 2RM5A 3FRCA 4Q5FA 2PN8A 3DIEA 4TR4A 3SWLA 4ACSA 3TRXA 2XC2A 1V40A 2YJ7A 3IHQA 2YV7A 3RPNA 4FYUA 1Q4JA 2FHEA 4TR3A 2YWIA 2NTOA 2CV4A 3IC8A 1J08A 4EF0A 4ZIJA 4IGJA 5HFIA 2ZCTA 2X64A 3TKSE 3RDWA 3HJOA 3UEMA 3VWWA 4TR1B 4XIHA 1GSSA 4PXOA 1AUCA 1Z9HA 4BL7A 5J9BA 1YEPA 4HDEA 5LCZA 2H0GA 1EP7A 3I6AA 2MYGA 1DBYA 4TW5A 5JWQB 1ILOA 2K8SA 1YY7A 1M3IA 5D9TA 2WFCA 20GSA 3ZL5A 3QFBC 3VPTA 3H4KA 3ZVJD 1YDKA 3FY7A 4POLA 5D9XA 1VGLA 4J2FA 2GQLA 5E59A 3HHVA 3N9JA 5IMZA 3LYKA 3NOFA 2KLXA 3CQFA 5FWGA 5COHA 3EINA 18GSA 2V1MA 2IN3A 4XCSA 4OO4A 1M2BA 1N8JA 2A2RA 2GS3A 4MDCA 4IHUA 4QQ7A 3IC4A 3KD0A 3UMAA 5DQSA 1PL2A 1Z6MA 1FOVA 1SKWB 1OC3A 2H1AA 3F4SA 3ZTLA 1ZYEA 2M80A 4NHZA 4MJEA 1IYHA 4OFMA 3KTBA 4AJ7A 4PQHA 3KXOA 3NIVA 5ECIB 1XXUA 2KP1A 2K8VA 4BVXA 1WE0A 3TJGA 4EIQA 1ZOFA 3IK9A 3KMOA 3D22A 1A24A 3H93A 2B5XA 1YQ1A 1T1VA 4F2IA 2VL2C 2HSHA 4XRAA 4HZ4A 3FZ5A 4IJ3A 2GQKA 3GX8A 3LG6A 5GAPD 2FCHA 2XBQA 5H5QA 3L0HA 3Q19A 4OCEA 1SKSB 4NMUA 4EDYA 5ABRA 1TDIA 2C0GA 3GTUB 3M1GA 4ZBAA 1QMVA 3ZMLA 3L9SA 4HU9A 1M0UA 2B1LA 3FEUA 2X8CA 3JCML 2L57A 5ID2B 2A4HA 1VF2A 1Q98A 3RPPA 4MZCA 2YOIA 4YH2A 4ZL7A 2C8UA 3TKRA 2H6YA 2V6KA 1A8LA 2H76A 1HNCA 4ID0A 2VD0A 4Q5RA 1YF1A 5JCUA 4F82A 1YZXA 3IHGA 2DBCA 5ECKB 3VURA 3MNGA 2CX4A 4KDXA 3TJFA 2WJUA 2GT5A 5AIXA 3ZFLA 4CY8A 2LRTA 3Q74A 4Z2UA 4IW9A 2I81A 1UC7A 1TK5B 1S3DA 3FMWA 4MPFA 3AY8A 1XWAA 3CSJA 3CTFA 4KF9A 2DJ0A 3FZ9A 2L4CA 5ECNB 1WMJA 4F0CA 1TU8A 2LJRA 3GURA 4NPBA 1GWCA 2MMZA 5JCGA 2X49A 1V57A 3CYNA 5AISA 4AGSA 2H74A 1OE8A 1XOAA 2AUVA 1MD4A 1DSBA 1OAZA 3UVHA 1V58A 2VL2A 2FWGA 3RHCA 4D73B 5IQYA 2X99A 1WP0A 1Z7PA 3LORA 2YN1A 3HD5A 4QL9A 2E2GA 1M7TA 4RUVA 4PGTA 1XPVA 2PWJA 3A2VA 4Z2TA 5JWOB 1R4WA 2GSTA 3EE2A 1G7OA 2LNTA 1O8WA 3HZ8A 1A0FA 1JZRA 2PVQA 4PUFC 1DE1A 1QFNA 3ZFBA 1SKRB 2M46A 1U88A 3VK9A 1MDJA 1LJRA 3LQ7A 1M3JA 2F51A 3BCIA 4BVYA 2AV4A 1TRVA 4TVEA 1ZL9A 5DAKB 1GTAA 4KA0A 4EKZA 5EY6A 3HVSA 2OE0A 2HSMA 5IOXA 1ZYQB 1G0TA 3GKXA 5B8BA 3BBYA 1A2MA 1PD21 3APQA 3HJMA 3KMNA 1E6BA 2LQQA 2WB9A 1ABAA 4WBRD 4LMWA 2A4VA 5A4VA 3GKNA 4L5OA 1XCCA 2VCWA 5D8IA 2B5EA 1BQ7A 4KCAA 2J9HA 4ECCA 4MZWA 2FD3A 2E2MA 3WT2A 2L6CA 4WXTA 3APSA 4WR5A 5CO3A 3QAWA 2HZEA 6GSXA 3QMXA 2H71A 10GSA 2JACA 3S9FA 3CRTA 5DALA 2HYXA 3BD2A 3I69A 2PBJA 2G0FA 2L5OA 3F8UA 5KN1A 2DMLA 1SK0A 2TRCP 3GH6A 5G5FA 1NHYA 4ULXA 1G7EA 1JFUA 4X1UA 1Z3EA 1R5PA 2H73A 1F3BA 3HYPA 2CZ2A 3D4MA 1XVWA 1B4PA 1K0CA 1ZZYA 4DEJA 1H75A 1SK1A 4ZBBA 2IIYA 2EIRA 1OVNA 2I1UA 5CP1A 2FLSA 1W4VA 1ON4A 2N5AA 3MAKA 1TI1A 2PPTA 2O85A 4N0ZA 3H8QA 1R7HA 1EV4A 1EV9A 3DMLA 2R2JA 3DGQA 3UAPA 1XOBA 1QK8A 1PFOA 5DJLA 2LSTA 4PQ1A 3US3A 1VF3A 1T3BA 3FK8A 2YWNA 1HQOA 5D93A 2DKIA 2JADA 2VO4A 4KSMA 5IM9A 3F3QA 4EE0A 2HRFA 3C71A 2VM2A 1A0RP 4IN0A 3A2WA 4TR0A 4V1Ag 3KH7A 2F9SA 2LNSA 4HQZA 2AB6A 4MLYA 2VM1A 1PKWA 2DJ2A 4I2TA 2R37A 2CX3A 1AAZA 5J41A 4N10A 1XVQA 1X9WB 4F03A 5J5NA 4ICYA 3DKSA 3C1RA 3D0ZA 2QA1A 3DVXA 3P8WA 4IJIA 1T7PB 2V6OA 5J3RA 2O8VB 1X9SB 1UVZA 2KUCA 3C73A 3N5OA 1GH2A 4HSCX 2YNXA 2IPAA 1VF1A 4YQMA 4OMVA 1F6MC 3WD6A 1XW9A 3GA4A 5G2ZA 3F0IA 4O92A 1UN2A 4IVFA 3TKPA 1TI3A 3WGEA 3GL3A 3F4TA 4FO5A 4K7NA 5D96A 4HS1A 2DC5A 1TOFA 1KTEA 5HQPA 4OWYA 2CA8A 5ELAA 2OBIA 5J9CA 4E8EA 4MF6A 2R3XA 4BPYA 1R26A 4DSSB 2P5RA 2LEGA 2NPBA 1BAYA 1YEXA 1GTBA 4JZQA 2IFQA 3TUEA 6GSYA 1GL8A 2H66A 1SU9A 4I6XA 3ME8A 1FG4A 2FA4A 2LRNA 1M2AA 2P31A 4PNGA 5B7CA 2RIIA 5HFKA 5EPFA 5H5SA 1YF0A 3IV4A 2RUEA 2HRNA 1B48A 1XWBA 5CNWA 5ECPB 1ZYPA 2VLUA 2OA7A 1MDIA 1JLWA 4JE1A 4K2DA 2B5YA 1B4QA 3ERGA 1ML6A 3QR6A 2YCDA 5HR1A 3HVNA 1MDKA 4E8HA 3UIWA 5BRTA 4K8MA 4LA1A 5G5EA 4MK3A 4XS4A 3IA1A 3ERFA 3ME7A 4ZL8A 3G7IA 4X43A 2ZNMA 3IE3A 1JHBA 4XS6A 4NHWA 2YZHA 2LRCA 4IELA 2MZCA 5CYYA 1PGTA 4HUAA 5BMUA 4KSOA 2H30A 4FYCA 3LYPA 2GSRA 5EL8A 4PUAA 1ERWA 2IMDA 1K0DA 1YJ6A 2EC4A 4F9ZA 3RAZA 1XG8A 4ZBDA 2K6VA 1IYIA 4PNFA 4GSNA 4KH7A 2E0QA 2QC7A 3FW2A 1XWCA 2REMA 2AJQB 1XW6A 1USBA 3TKSA 1A23A 3VI5A 4GSSA 3KH9A 1FO5A 2PMTA 2TRXA 3TOTA 3DWVA 3P7XA 3D21A 4L5LA 2V2GA 1X5CA 3CRUA 2PVOC 4O5QA 4TXOA 5LD0A 1O81A 2C0FA 2RLIA 3TJKA 1ERVA 1SYRA 3GUSA 19GSA 4GF0A 5KEJA 1B8XA 2FNOA 4K7OA 4KAEA 1HYUA 1SENA 2XPDA 3GV1A 4MMMA 5IMFA 4KUNA 1OC9B 2HT9A 3M3MA 1NM3A 2HNLA 3UL3A 2GVPA 3GKKA 1WWJA
chains in the Genus database with same CATH topology
3D4TA 2WULA 1VF4A 1A8YA 7GSSA 1A2JA 2GSQA 2FWHA 1Y6EA 6GSUA 5A4UA 1AW9A 1XBSA 2ES7A 2VCTA 3TGZA 1BYEA 4V2LA 2IMIA 3HZ4A 2C3NA 3P90A 4MZBA 2H1BA 2H0HA 3BCKA 4JRRA 1RQMA 1PMTA 4ZL9A 5KOWA 5JWRB 1OYJA 1TP9A 1E2YA 1EOHA 5DCHA 5IMDA 1ACVA 3BOAA 1FHEA 4MF7A 4J57E 2CAIA 3C8EA 3QCPA 3PPUA 1URMA 2YP6A 3R2QA 2VOCA 2L4QA 3F4RA 2YJHA 3GIXA 4WEYA 3O6TA 3E9JB 3PR8A 2MMAA 4ZB9A 2H01A 12GSA 4Z7XA 3QOUA 2MBSA 5DCGA 3HVXA 1HNBA 4X4JA 3PINA 2LKUA 3EVIA 3KP9A 5CRGA 5IMCA 4I8BA 2DJ3A 1AC1A 1ERUA 4MNNA 5FHIA 5KOXA 3DEXA 3VWVA 2NBSA 3ZYWA 3IOSA 2N5FA 2A2PA 2VLVA 5A5KA 1GP1A 2VL3A 2V32A 5AGYA 5F07A 4RI6A 1AQWA 1BJXA 5ECOB 2I4AA 4G19A 4TR1A 1FAAA 1FVKA 3VPQA 3IXRA 4HI7A 2KP2A 3ED3A 4IQAA 4OCFA 2R5GA 1T00A 1XZOA 3M8NA 3M9KA 2ZUPA 3FYGA 3HKRA 1O8XA 1HNAA 2OKAA 1N2AA 3GFKA 3EC3A 2C1YA 2C3QA 2I3YA 3R3EA 4K7IA 4G0LA 4KB3A 4QL7A 2QA2A 2DJJA 3TOUA 3LW9A 1FW1A 1R5AA 4P3YB 5HFGA 1EGRA 4V1Ap 1XWKA 5C00A 4TXVA 3KGKA 3HJPA 1MEKA 3GN3A 1PKZA 2JZSA 5CRWA 2C0EA 2QKEA 3MDKA 1NSWA 22GSA 2BMXA 2WZ9A 3ERWA 4X0XA 3IBHA 1G6YA 4V2MA 4K5SA 3UVTA 1SYXA 1GTIA 3F6FA 5ENUA 2OACA 2H8LA 4KW6A 1AIUA 1I5GA 3VFIA 1TJDA 2JSYA 3M9JA 4KCEA 5HR3A 1OE7A 3IAM2 2FUG2 3EURA 1J0FA 5D9WA 4MP4A 4BWQA 4DSRA 1T4YA 3LXZA 2F8AA 1OKDA 3G7YA 2L6DA 3FR9A 4HU7A 2OE1A 1MD3A 2JSZA 2YWOA 2FGXA 1U87A 4TKYA 1JZDA 2H75A 3GTUA 3L9UA 3HY2A 4RI7A 3EMXA 4BL7B 2ON7A 2X4AA 2GGTA 4HEA2 3EU3A 1O6JA 3LGCA 3A3TA 2VIMA 2DJKA 3APOA 3KCMA 2CVKA 3IRAA 5ID2A 1F9MA 1EOGA 2GZYA 2QSIA 3CTGA 4YKGA 5F8BA 2HFDA 4BA7A 4PURA 2G2QA 4JBBA 1X5EA 4RQRA 2HRAA 3C7MA 2H72A 4ML6A 3E3EA 4KE3A 4GRFA 2Z9SA 1Z5YE 3LEFA 4NXIA 2DSAA 1PA3A 5ECLB 5INYA 5ELGA 1SJIA 4ZB8A 4GCIA 2CVDA 3WGXA 4LL1B 4HJ2A 2L59A 1GSFA 2JL4A 2NVLA 2XBIA 2RM6A 3J7Yb 3KEBA 4XS1A 2LS5A 5DJMA 3MSZA 4GQCA 2CAQA 5EVOA 1O73A 3J7Yk 1PN9A 3W8JA 3FZAA 2R0GA 3I9V2 4EVMA 5IIZA 3OR5A 1EEMA 2D2ZA 4O5RA 2KOKA 2VUPA 3F9UA 4KX4A 2CT6A 5H5RA 5G1LA 3GYKA 2IMEA 4BVXB 4D73A 1PRXA 4GSTA 3IR4A 1S3AA 4CY6A 3HVVA 1GSDA 1K0OA 3IK7A 3IPZA 3SBCA 2R6KA 5GSSA 1U3IA 4HZ2A 4OD7A 2M72A 5AIVA 2I9HA 4TN8A 4NV2A 2L5LA 3CSHA 5HR0A 3ZLPA 3G9BA 2DIYA 2VCZA 2KHPA 2J23A 3QAVA 3TJJA 4EC0A 3GNJA 5HR2A 4FYBA 3ZIVA 4IS0A 1V2AA 3DYRA 4BWSA 1XWGA 4GXZA 2IWTA 4MJAA 3HXSA 3GSSA 3GMFA 5CRHA 5LNKe 2LJKA 3V1WA 5DAKA 1GTUA 5ECSA 1ST9A 2H0IA 4WKWA 2LUSA 4JR6A 1M99A 3A5IA 1FVJA 2C0DA 5F0GA 6GSVA 3DRNA 3ZIJA 4HJMA 4ILFA 1K3YA 2YANA 1GUMA 4MJCA 2DJ1A 5ECQB 1W89A 4OO5A 4MCUA 5CREA 1SJ6A 4IBPA 3UOMA 3TJBA 4EIPA 3TRQA 1M9BA 4F0BA 4EL1A 3F3RA 1ZMAA 4MJBA 8GSSA 4FIWA 4YAVA 3DXBA 2R0PA 5D9VA 3QAGA 2DMMA 2PGTA 3FR6A 2DIZA 3W8SA 3EYTA 3WT1A 1FOHA 2VAFA 4KNDA 2BTOT 1THXA 1TTZA 3EPTA 1C72A 3CMIA 5G1KA 2WS2A 4TRXA 1TRUA 3LXTA 3VI7A 3LJRA 3UJ1A 3VLNA 1QGVA 4WETA 4MA9A 2EIOA 4L0UA 4OFNA 4EO3A 1OKTA 2HXKA 3I43A 1F3AA 1WOUA 1GULA 5GSTA 1S3CA 3GHAA 4JR4A 1F37A 1AXDA 2C80A 4KDUA 4USSA 5G31A 5C04A 1QUWA 3H79A 1UA5A 4G9HA 2EIQA 3TDGA 3C1SA 3Q6OA 4EDZA 1LBKA 4JEDA 1TXXA 4TOPA 3KP8A 1X5DA 4NV5A 9GSSA 2K9FA 3L9VA 5FT3A 4JU5A 1GSUA 4BVYB 2WGRA 4YKFA 2V41A 1TW9A 2ON5A 2ALBA 3W6GA 3QPMA 1Z6NA 1T8EB 3O3TA 4GWRA 4K2XA 1GLQA 2O87A 3L4NA 1LU4A 5F05A 1GSQA 1EEJA 4IP6A 1ZCPA 4LL4B 3Q18A 5JCWA 4EUYA 2IMKA 3CBUA 3IDVA 2HZFA 2VCVA 2OADA 5IPGA 5IOWA 1EWXA 5E4WA 3LSZA 4LMVA 2HZEB 2PU9C 5J4UA 1BX9A 1V98A 3ZREA 4MF5A 2OJLA 5DALB 1K0NA 4K9ZA 2CQ9A 1QQ2A 1V9WA 2B3SA 4L0WA 4GQFA 4K6XA 2LV3A 4V2NA 1KNGA 3TCOA 5B6NA 1THOA 1K0AA 2GDRA 4DSSA 3ZRDA 2IL3A 3UARA 3QFAC 1YKAA 1FB0A 2R0CA 4Z2RA 4K0GA 4ECIA 2MMNA 2OBKA 1PN0A 2GZPA 3GX0A 4HOJA 1X9MB 4J56E 3KZQA 2WCIA 2AHEA 5DQYA 5G30A 4PTSA 3CSIA 3WGDA 3P2AA 4Q5NA 1XFLA 2GZZA 1WRYA 1PQNA 3FR3A 2H1DA 4NAXA 2MMOA 2C3TA 4XTSA 2CZ3A 4I2UA 1TU7A 1ZYNA 3MIXA 2MBTA 1WJKA 2IJYA 3FZ4A 2FWEA 5DDLA 3HDCA 3K8NA 5IO0A 1XIYA 3PH9A 1AQVA 4DSQA 3TKQA 3RHBA 1RW1A 4ISDA 2H70A 4O32A 1U3AA 2R4VA 1ERTA 3FHKA 4I5QA 1SL1B 3LFLA 3PGTA 4IKHA 5GAND 4ZILA 3QD9A 1T4ZA 4CDOA 1F2EA 4WBJA 3GRXA 3FKFA 4HQSA 4YQVA 1GSEA 1JLVA 13GSA 2XHFA 3DVWA 2GT6A 3ZITA 1GSYA 4GTUA 2XPEA 1J9BA 5L71A 3VWXA 4WR4A 1KEBA 2H6XA 5KN0A 3CXGA 2YWMA 1PL1A 2QGVA 2BJXA 1YKCA 1BG5A 3GKMA 3LWAA 3U6VA 1GNWA 4LLRA 3A5WA 1K3LA 1U6TA 5IPHA 2P0GA 4ECJA 3KJYA 1M9AA 4CHSA 3ZZXA 2HE3A 2FY6A 2X8GA 2HI7A 1B9YC 3TRPA 3UBKA 2JZTA 4FH8A 2IFQB 2VCXA 3A2XA 3F63A 3F6DA 5IO2A 1TRSA 1RK4A 1O85A 4POBA 5DVBA 1VRSD 2IMFA 1I9DA 2VL9A 2FWFA 5KN2A 4G0IA 3MYDA 4PX1A 2B7JA 2GQMA 3TB2A 4O7HA 4ML1A 4ZXGA 1OC9A 4H86A 4O5UA 3ISOA 2DKHA 1NHOA 2JZRA 2GLRA 2VD1A 4ECBA 4EXJA 1TK8B 3QDNA 4AF2A 1BEDA 4FQUA 1SL2B 4YQUA 2O89A 3VWUA 17GSA 2GTUA 2N5BA 2VCQA 6GSWA 2TIRA 5CAXA 4NWYA 4WF4A 3GH9A 2LQOA 4XS4B 3EMPA 1TK0B 1CQGA 1B9XC 4K1FA 4POKA 1M2DA 3EWLA 4IP1A 3O76A 5IMAA 1O7UA 4L8EA 1GUHA 1K3OA 3HA9A 5D73A 4I97A 1GRXA 1G6WA 1SL0B 4KGIA 3ZVJA 2AYTA 1FB6A 6GSTA 2HSYA 2JU5A 1TRWA 1EGOA 1SD8A 2UZ8A 2AAWA 3MWHA 3ZMKA 4K0NA 1EZKA 3GL5A 2X8HA 1K0MA 2H19A 1Z7RA 1GNEA 1QXHA 1CQHA 1ZGNA 3IAS2 4Q5QA 1GUKA 1K0BA 4MH3A 2LJAA 1SJZA 3GSTA 4N11A 5GZZB 1EP8A 2H1GA 2RUFA 4DVCA 2H6ZA 3KTLA 3G7JA 2OE3A 2NDOA 4ZB6A 4G2EA 3WYWA 5AN1A 5B6MA 4TXOB 1TKDB 3RBTA 1A2LA 1HD2A 5DBQA 1AQXA 1GLPA 2VLTA 2PERA 1H4OA 4CW9A 3L78A 1NW2A 1WPIA 2C4JA 5IMVA 2F8FA 2WDUA 1WIKA 1JZWA 14GSA 11GSA 3D5JA 3M0FA 2O7KA 5ECHB 2A2SA 4N30A 4MPGA 4A5PA 1MTCA 2HLSA 4G10A 2YZUA 1PX7A 4PQIA 2P5QA 3H1NA 5KN3A 3U5RE 2K18A 1OC8A 3UBLA 4IQ1A 5CRDA 4N0VA 1SK2A 1DUGA 2B6MA 16GSA 2FA8A 3DD3A 2PUKC 4XRDA 2GSSA 2YV9A 3D6IA 4YAPA 1X0RA 5F06A 5B8AA 2WRTA 1JZOA 3KIJA 1DE2A 3E0UA 4OFTA 5ECRB 4WF5A 2B7KA 4XHMA 3BJ5A 2F3MA 2LTKA 4AJ6A 2E7PA 1XW5A 4KDYA 4MABA 5ECMB 4GLTA 2B1KA 4POMA 4AJ8A 2DLXA 3KM6A 2CVBA 4K5RA 6GSSA 4G0KA 4RQXA 3HCZA 1KBNA 3TKSC 1PSQA 1Y25A 2YPMA 3EU4A 2HRKA 4MH2A 1PX6A 1SD9A 3NZNA 5A4WA 2RM5A 3FRCA 4Q5FA 2PN8A 3DIEA 4TR4A 3SWLA 4ACSA 3TRXA 2XC2A 1V40A 2YJ7A 3IHQA 2YV7A 3RPNA 4FYUA 1Q4JA 2FHEA 4TR3A 2YWIA 2NTOA 2CV4A 3IC8A 1J08A 4EF0A 4ZIJA 4IGJA 5HFIA 2ZCTA 2X64A 3TKSE 3RDWA 3HJOA 3UEMA 3VWWA 4TR1B 4XIHA 1GSSA 4PXOA 1AUCA 1Z9HA 4BL7A 5J9BA 1YEPA 4HDEA 5LCZA 2H0GA 1EP7A 3I6AA 2MYGA 1DBYA 4TW5A 5JWQB 1ILOA 2K8SA 1YY7A 5D9TA 2WFCA 20GSA 3ZL5A 3QFBC 3VPTA 3H4KA 3ZVJD 1YDKA 3FY7A 4POLA 5D9XA 1VGLA 4J2FA 2GQLA 5E59A 3HHVA 3N9JA 5IMZA 3LYKA 3NOFA 2KLXA 5FWGA 5COHA 3EINA 18GSA 2V1MA 2IN3A 4XCSA 4OO4A 1M2BA 1N8JA 2A2RA 2GS3A 4MDCA 4IHUA 4QQ7A 3IC4A 3KD0A 3UMAA 5DQSA 1PL2A 1Z6MA 1FOVA 1SKWB 1OC3A 2H1AA 3F4SA 3ZTLA 1ZYEA 2M80A 4NHZA 4MJEA 1IYHA 4OFMA 3KTBA 4AJ7A 4PQHA 3KXOA 3NIVA 5ECIB 1XXUA 2KP1A 2K8VA 4BVXA 1WE0A 3TJGA 4EIQA 1ZOFA 3IK9A 3KMOA 3D22A 1A24A 3H93A 2B5XA 1YQ1A 1T1VA 4F2IA 2VL2C 2HSHA 4XRAA 4HZ4A 3FZ5A 4IJ3A 2GQKA 3GX8A 3LG6A 5GAPD 2FCHA 2XBQA 5H5QA 3L0HA 3Q19A 4OCEA 1SKSB 4NMUA 4EDYA 5ABRA 1TDIA 2C0GA 3GTUB 3M1GA 4ZBAA 1QMVA 3ZMLA 3L9SA 4HU9A 1M0UA 2B1LA 3FEUA 2X8CA 3JCML 2L57A 5ID2B 2A4HA 1VF2A 1Q98A 3RPPA 4MZCA 2YOIA 4YH2A 4ZL7A 2C8UA 3TKRA 2H6YA 2V6KA 1A8LA 2H76A 1HNCA 4ID0A 2VD0A 4Q5RA 1YF1A 5JCUA 4F82A 1YZXA 3IHGA 2DBCA 5ECKB 3VURA 3MNGA 2CX4A 4KDXA 3TJFA 2WJUA 2GT5A 5AIXA 3ZFLA 4CY8A 2LRTA 3Q74A 4Z2UA 4IW9A 2I81A 1UC7A 1TK5B 1S3DA 3FMWA 4MPFA 3AY8A 1XWAA 3CSJA 3CTFA 4KF9A 2DJ0A 3FZ9A 2L4CA 5ECNB 1WMJA 4F0CA 1TU8A 2LJRA 3GURA 4NPBA 1GWCA 2MMZA 5JCGA 2X49A 1V57A 3CYNA 5AISA 4AGSA 2H74A 1OE8A 1XOAA 2AUVA 1MD4A 1DSBA 1OAZA 3UVHA 1V58A 2VL2A 2FWGA 3RHCA 4D73B 5IQYA 2X99A 1WP0A 1Z7PA 3LORA 2YN1A 3HD5A 4QL9A 2E2GA 1M7TA 4RUVA 4PGTA 1XPVA 2PWJA 3A2VA 4Z2TA 5JWOB 1R4WA 2GSTA 3EE2A 1G7OA 2LNTA 1O8WA 3HZ8A 1A0FA 1JZRA 2PVQA 4PUFC 1DE1A 1QFNA 3ZFBA 1SKRB 2M46A 1U88A 3VK9A 1MDJA 1LJRA 3LQ7A 2F51A 3BCIA 4BVYA 2AV4A 1TRVA 4TVEA 1ZL9A 5DAKB 1GTAA 4KA0A 4EKZA 5EY6A 3HVSA 2OE0A 2HSMA 5IOXA 1ZYQB 1G0TA 3GKXA 5B8BA 3BBYA 1A2MA 1PD21 3APQA 3HJMA 3KMNA 1E6BA 2LQQA 2WB9A 1ABAA 4WBRD 4LMWA 2A4VA 5A4VA 3GKNA 4L5OA 1XCCA 2VCWA 5D8IA 2B5EA 1BQ7A 4KCAA 2J9HA 4ECCA 4MZWA 2FD3A 2E2MA 3WT2A 2L6CA 4WXTA 3APSA 4WR5A 5CO3A 3QAWA 2HZEA 6GSXA 3QMXA 2H71A 10GSA 2JACA 3S9FA 3CRTA 5DALA 2HYXA 3BD2A 3I69A 2PBJA 2G0FA 2L5OA 3F8UA 5KN1A 2DMLA 1SK0A 2TRCP 3GH6A 5G5FA 1NHYA 4ULXA 1G7EA 1JFUA 4X1UA 1Z3EA 1R5PA 2H73A 1F3BA 3HYPA 2CZ2A 3D4MA 1XVWA 1B4PA 1K0CA 1ZZYA 4DEJA 1H75A 1SK1A 4ZBBA 2IIYA 2EIRA 1OVNA 2I1UA 5CP1A 2FLSA 1W4VA 1ON4A 2N5AA 3MAKA 1TI1A 2PPTA 2O85A 4N0ZA 3H8QA 1R7HA 1EV4A 1EV9A 3DMLA 2R2JA 3DGQA 3UAPA 1XOBA 1QK8A 5DJLA 2LSTA 4PQ1A 3US3A 1VF3A 1T3BA 3FK8A 2YWNA 1HQOA 5D93A 2DKIA 2JADA 2VO4A 4KSMA 5IM9A 3F3QA 4EE0A 2HRFA 3C71A 2VM2A 1A0RP 4IN0A 3A2WA 4TR0A 4V1Ag 3KH7A 2F9SA 2LNSA 4HQZA 2AB6A 4MLYA 2VM1A 1PKWA 2DJ2A 4I2TA 2R37A 2CX3A 1AAZA 5J41A 4N10A 1XVQA 1X9WB 4F03A 5J5NA 4ICYA 3DKSA 3C1RA 3D0ZA 2QA1A 3DVXA 3P8WA 4IJIA 1T7PB 2V6OA 5J3RA 2O8VB 1X9SB 1UVZA 2KUCA 3C73A 3N5OA 1GH2A 2YNXA 2IPAA 1VF1A 4YQMA 4OMVA 1F6MC 3WD6A 1XW9A 3GA4A 5G2ZA 3F0IA 4O92A 1UN2A 4IVFA 3TKPA 1TI3A 3WGEA 3GL3A 3F4TA 4FO5A 4K7NA 5D96A 4HS1A 2DC5A 1TOFA 1KTEA 5HQPA 4OWYA 2CA8A 5ELAA 2OBIA 5J9CA 4E8EA 4MF6A 2R3XA 4BPYA 1R26A 4DSSB 2P5RA 2LEGA 2NPBA 1BAYA 1YEXA 1GTBA 4JZQA 2IFQA 3TUEA 6GSYA 1GL8A 2H66A 1SU9A 4I6XA 3ME8A 1FG4A 2FA4A 2LRNA 1M2AA 2P31A 4PNGA 5B7CA 2RIIA 5HFKA 5EPFA 5H5SA 1YF0A 3IV4A 2RUEA 2HRNA 1B48A 1XWBA 5CNWA 5ECPB 1ZYPA 2VLUA 2OA7A 1MDIA 1JLWA 4JE1A 4K2DA 2B5YA 1B4QA 3ERGA 1ML6A 3QR6A 2YCDA 5HR1A 1MDKA 4E8HA 3UIWA 5BRTA 4K8MA 4LA1A 5G5EA 4MK3A 4XS4A 3IA1A 3ERFA 3ME7A 4ZL8A 3G7IA 4X43A 2ZNMA 3IE3A 1JHBA 4XS6A 4NHWA 2YZHA 2LRCA 4IELA 5CYYA 2MZCA 1PGTA 4HUAA 5BMUA 4KSOA 2H30A 4FYCA 3LYPA 2GSRA 5EL8A 4PUAA 1ERWA 2IMDA 1K0DA 1YJ6A 2EC4A 4F9ZA 3RAZA 4ZBDA 2K6VA 1IYIA 4PNFA 4GSNA 4KH7A 2E0QA 2QC7A 3FW2A 1XWCA 2REMA 2AJQB 1XW6A 1USBA 3TKSA 1A23A 3VI5A 4GSSA 3KH9A 1FO5A 2PMTA 2TRXA 3TOTA 3DWVA 3P7XA 3D21A 4L5LA 2V2GA 1X5CA 3CRUA 2PVOC 4O5QA 4TXOA 5LD0A 1O81A 2C0FA 2RLIA 3TJKA 1ERVA 1SYRA 3GUSA 19GSA 4GF0A 5KEJA 1B8XA 2FNOA 4K7OA 4KAEA 1HYUA 1SENA 2XPDA 3GV1A 4MMMA 5IMFA 4KUNA 1OC9B 2HT9A 3M3MA 1NM3A 2HNLA 3UL3A 2GVPA 3GKKA 1WWJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D4T A;  2WUL A;  1VF4 A;  1A8Y A;  7GSS A;  1A2J A;  2GSQ A;  2FWH A;  1Y6E A;  6GSU A;  5A4U A;  1AW9 A;  1XBS A;  2ES7 A;  2VCT A;  3TGZ A;  1BYE A;  4V2L A;  2IMI A;  3HZ4 A;  2C3N A;  3P90 A;  4MZB A;  2H1B A;  2H0H A;  3BCK A;  4JRR A;  1RQM A;  1PMT A;  4ZL9 A;  5JWR B;  1OYJ A;  1TP9 A;  1E2Y A;  1EOH A;  5DCH A;  5IMD A;  1ACV A;  3BOA A;  1FHE A;  4MF7 A;  4J57 E;  2CAI A;  3C8E A;  3QCP A;  1URM A;  2YP6 A;  3R2Q A;  2VOC A;  2L4Q A;  3F4R A;  2YJH A;  3GIX A;  4WEY A;  3O6T A;  3E9J B;  3PR8 A;  2MMA A;  4ZB9 A;  2H01 A;  12GS A;  4Z7X A;  3QOU A;  2MBS A;  5DCG A;  3HVX A;  1HNB A;  3PIN A;  2LKU A;  3EVI A;  3KP9 A;  5CRG A;  5IMC A;  4I8B A;  2DJ3 A;  1AC1 A;  1ERU A;  5FHI A;  3DEX A;  3VWV A;  2NBS A;  3ZYW A;  3IOS A;  2N5F A;  2VLV A;  5A5K A;  1GP1 A;  2VL3 A;  2V32 A;  5AGY A;  5F07 A;  4RI6 A;  1AQW A;  1BJX A;  5ECO B;  2I4A A;  4G19 A;  4TR1 A;  1FAA A;  1FVK A;  3VPQ A;  3IXR A;  4HI7 A;  2KP2 A;  3ED3 A;  4IQA A;  4OCF A;  2R5G A;  1T00 A;  1XZO A;  3M8N A;  3M9K A;  2ZUP A;  3FYG A;  3HKR A;  1O8X A;  1HNA A;  2OKA A;  1N2A A;  3GFK A;  3EC3 A;  2C1Y A;  2C3Q A;  2I3Y A;  4K7I A;  4KB3 A;  4QL7 A;  3TOU A;  2DJJ A;  1FW1 A;  1R5A A;  4P3Y B;  5HFG A;  1EGR A;  4V1A p;  1XWK A;  5C00 A;  4TXV A;  3KGK A;  3HJP A;  1MEK A;  3GN3 A;  1PKZ A;  2JZS A;  5CRW A;  2C0E A;  2QKE A;  3MDK A;  1NSW A;  22GS A;  2BMX A;  2WZ9 A;  3ERW A;  4X0X A;  3IBH A;  1G6Y A;  4V2M A;  3UVT A;  1SYX A;  1GTI A;  3F6F A;  5ENU A;  2OAC A;  2H8L A;  4KW6 A;  1AIU A;  1I5G A;  3VFI A;  1TJD A;  2JSY A;  3M9J A;  4KCE A;  5HR3 A;  1OE7 A;  3IAM 2;  2FUG 2;  3EUR A;  1J0F A;  5D9W A;  4MP4 A;  4BWQ A;  4DSR A;  1T4Y A;  3LXZ A;  2F8A A;  1OKD A;  3G7Y A;  2L6D A;  3FR9 A;  4HU7 A;  2OE1 A;  1MD3 A;  2JSZ A;  2YWO A;  2FGX A;  1U87 A;  4TKY A;  1JZD A;  2H75 A;  3GTU A;  3L9U A;  3HY2 A;  4RI7 A;  3EMX A;  2ON7 A;  2GGT A;  4HEA 2;  3EU3 A;  1O6J A;  3LGC A;  3A3T A;  2VIM A;  2DJK A;  3APO A;  3KCM A;  2CVK A;  3IRA A;  5ID2 A;  1F9M A;  1EOG A;  2GZY A;  2QSI A;  3CTG A;  5F8B A;  2HFD A;  4BA7 A;  4PUR A;  2G2Q A;  4JBB A;  1X5E A;  4RQR A;  3C7M A;  2H72 A;  4ML6 A;  3E3E A;  4KE3 A;  4GRF A;  2Z9S A;  1Z5Y E;  3LEF A;  4NXI A;  2DSA A;  1PA3 A;  5ECL B;  5INY A;  5ELG A;  1SJI A;  4ZB8 A;  4GCI A;  2CVD A;  3WGX A;  4LL1 B;  4HJ2 A;  2L59 A;  1GSF A;  2JL4 A;  2NVL A;  2XBI A;  2RM6 A;  3J7Y b;  3KEB A;  4XS1 A;  2LS5 A;  5DJM A;  3MSZ A;  4GQC A;  2CAQ A;  5EVO A;  1O73 A;  3J7Y k;  1PN9 A;  3W8J A;  3FZA A;  3I9V 2;  4EVM A;  5IIZ A;  3OR5 A;  1EEM A;  2D2Z A;  4O5R A;  2KOK A;  2VUP A;  3F9U A;  4KX4 A;  2CT6 A;  5H5R A;  5G1L A;  3GYK A;  2IME A;  4D73 A;  1PRX A;  4GST A;  3IR4 A;  1S3A A;  3HVV A;  1GSD A;  1K0O A;  3IK7 A;  3IPZ A;  3SBC A;  2R6K A;  5GSS A;  1U3I A;  4HZ2 A;  4OD7 A;  2M72 A;  5AIV A;  2I9H A;  4TN8 A;  4NV2 A;  2L5L A;  3CSH A;  5HR0 A;  3ZLP A;  3G9B A;  2DIY A;  2VCZ A;  2KHP A;  2J23 A;  3QAV A;  3TJJ A;  4EC0 A;  3GNJ A;  5HR2 A;  4FYB A;  3ZIV A;  4IS0 A;  1V2A A;  3DYR A;  4BWS A;  1XWG A;  4GXZ A;  2IWT A;  4MJA A;  3HXS A;  3GSS A;  3GMF A;  5CRH A;  5LNK e;  2LJK A;  3V1W A;  5DAK A;  1GTU A;  5ECS A;  1ST9 A;  2H0I A;  4WKW A;  2LUS A;  4JR6 A;  1M99 A;  1FVJ A;  2C0D A;  5F0G A;  6GSV A;  3DRN A;  3ZIJ A;  4HJM A;  4ILF A;  1K3Y A;  2YAN A;  1GUM A;  4MJC A;  2DJ1 A;  5ECQ B;  1W89 A;  4OO5 A;  4MCU A;  5CRE A;  1SJ6 A;  4IBP A;  3UOM A;  3TJB A;  3TRQ A;  1M9B A;  4F0B A;  4EL1 A;  3F3R A;  1ZMA A;  4MJB A;  8GSS A;  4FIW A;  4YAV A;  3DXB A;  5D9V A;  3QAG A;  2DMM A;  2PGT A;  3FR6 A;  2DIZ A;  3W8S A;  3EYT A;  3WT1 A;  2VAF A;  4KND A;  2BTO T;  1THX A;  1TTZ A;  1C72 A;  3CMI A;  5G1K A;  2WS2 A;  4TRX A;  1TRU A;  3LXT A;  3VI7 A;  3LJR A;  3UJ1 A;  3VLN A;  1QGV A;  4WET A;  4MA9 A;  2EIO A;  4L0U A;  4OFN A;  4EO3 A;  1OKT A;  2HXK A;  3I43 A;  1F3A A;  1WOU A;  1GUL A;  5GST A;  1S3C A;  3GHA A;  4JR4 A;  1F37 A;  1AXD A;  2C80 A;  4KDU A;  5C04 A;  5G31 A;  1QUW A;  3H79 A;  1UA5 A;  4G9H A;  2EIQ A;  3TDG A;  3C1S A;  3Q6O A;  4EDZ A;  1LBK A;  4JED A;  1TXX A;  4TOP A;  3KP8 A;  1X5D A;  4NV5 A;  9GSS A;  2K9F A;  3L9V A;  5FT3 A;  4JU5 A;  1GSU A;  2WGR A;  2V41 A;  1TW9 A;  2ON5 A;  2ALB A;  3W6G A;  3QPM A;  1Z6N A;  1T8E B;  3O3T A;  4GWR A;  1GLQ A;  2O87 A;  3L4N A;  1LU4 A;  5F05 A;  1GSQ A;  1EEJ A;  4IP6 A;  1ZCP A;  4LL4 B;  3Q18 A;  5JCW A;  4EUY A;  2IMK A;  3CBU A;  3IDV A;  2HZF A;  2VCV A;  2OAD A;  5IPG A;  5IOW A;  1EWX A;  5E4W A;  3LSZ A;  4LMV A;  2HZE B;  2PU9 C;  5J4U A;  1BX9 A;  1V98 A;  3ZRE A;  4MF5 A;  2OJL A;  5DAL B;  1K0N A;  4K9Z A;  2CQ9 A;  1QQ2 A;  1V9W A;  2B3S A;  4L0W A;  4GQF A;  4K6X A;  2LV3 A;  4V2N A;  1KNG A;  3TCO A;  5B6N A;  1THO A;  1K0A A;  2GDR A;  4DSS A;  3ZRD A;  2IL3 A;  3UAR A;  3QFA C;  1YKA A;  1FB0 A;  4K0G A;  4ECI A;  2MMN A;  2OBK A;  2GZP A;  3GX0 A;  4HOJ A;  1X9M B;  4J56 E;  3KZQ A;  2WCI A;  2AHE A;  5DQY A;  5G30 A;  3CSI A;  3WGD A;  3P2A A;  4Q5N A;  1XFL A;  2GZZ A;  1WRY A;  1PQN A;  3FR3 A;  2H1D A;  4NAX A;  2MMO A;  2C3T A;  4XTS A;  2CZ3 A;  4I2U A;  1TU7 A;  2MBT A;  1WJK A;  2IJY A;  3FZ4 A;  2FWE A;  5DDL A;  3HDC A;  3K8N A;  5IO0 A;  1XIY A;  3PH9 A;  1AQV A;  4DSQ A;  3TKQ A;  3RHB A;  1RW1 A;  4ISD A;  2H70 A;  4O32 A;  1U3A A;  2R4V A;  1ERT A;  3FHK A;  4I5Q A;  1SL1 B;  3LFL A;  3PGT A;  4IKH A;  5GAN D;  4ZIL A;  3QD9 A;  1T4Z A;  4CDO A;  1F2E A;  4WBJ A;  3GRX A;  3FKF A;  4HQS A;  4YQV A;  1GSE A;  1JLV A;  13GS A;  2XHF A;  3DVW A;  2GT6 A;  3ZIT A;  1GSY A;  4GTU A;  2XPE A;  1J9B A;  5L71 A;  3VWX A;  4WR4 A;  1KEB A;  2H6X A;  5KN0 A;  3CXG A;  2YWM A;  1PL1 A;  2QGV A;  2BJX A;  1YKC A;  1BG5 A;  3GKM A;  3LWA A;  3U6V A;  1GNW A;  4LLR A;  3A5W A;  1K3L A;  1U6T A;  5IPH A;  2P0G A;  4ECJ A;  3KJY A;  1M9A A;  4CHS A;  3ZZX A;  2HE3 A;  2FY6 A;  2X8G A;  2HI7 A;  1B9Y C;  3TRP A;  3UBK A;  2JZT A;  4FH8 A;  2IFQ B;  2VCX A;  3A2X A;  3F63 A;  3F6D A;  5IO2 A;  1TRS A;  1RK4 A;  1O85 A;  4POB A;  5DVB A;  1VRS D;  2IMF A;  1I9D A;  2VL9 A;  2FWF A;  5KN2 A;  4PX1 A;  2B7J A;  2GQM A;  3TB2 A;  4O7H A;  4ML1 A;  4ZXG A;  1OC9 A;  4H86 A;  3ISO A;  1NHO A;  2JZR A;  2GLR A;  2VD1 A;  4ECB A;  4EXJ A;  1TK8 B;  3QDN A;  4AF2 A;  1BED A;  1SL2 B;  4YQU A;  2O89 A;  3VWU A;  17GS A;  2GTU A;  2N5B A;  2VCQ A;  6GSW A;  2TIR A;  5CAX A;  4NWY A;  4WF4 A;  3GH9 A;  2LQO A;  4XS4 B;  3EMP A;  1TK0 B;  1CQG A;  1B9X C;  4K1F A;  4POK A;  1M2D A;  3EWL A;  4IP1 A;  3O76 A;  5IMA A;  1O7U A;  4L8E A;  1GUH A;  1K3O A;  3HA9 A;  5D73 A;  4I97 A;  1GRX A;  1G6W A;  1SL0 B;  4KGI A;  3ZVJ A;  2AYT A;  1FB6 A;  6GST A;  2HSY A;  2JU5 A;  1TRW A;  1EGO A;  1SD8 A;  2AAW A;  3MWH A;  3ZMK A;  4K0N A;  1EZK A;  3GL5 A;  2X8H A;  1K0M A;  2H19 A;  1Z7R A;  1GNE A;  1QXH A;  1CQH A;  1ZGN A;  3IAS 2;  4Q5Q A;  1GUK A;  1K0B A;  4MH3 A;  2LJA A;  1SJZ A;  3GST A;  4N11 A;  5GZZ B;  1EP8 A;  2H1G A;  2RUF A;  4DVC A;  2H6Z A;  3KTL A;  3G7J A;  2OE3 A;  2NDO A;  4ZB6 A;  4G2E A;  3WYW A;  5AN1 A;  5B6M A;  4TXO B;  1TKD B;  3RBT A;  1A2L A;  1HD2 A;  5DBQ A;  1AQX A;  1GLP A;  2VLT A;  2PER A;  1H4O A;  4CW9 A;  3L78 A;  1NW2 A;  1WPI A;  2C4J A;  5IMV A;  2F8F A;  2WDU A;  1WIK A;  1JZW A;  14GS A;  11GS A;  3D5J A;  3M0F A;  2O7K A;  5ECH B;  2A2S A;  4N30 A;  4MPG A;  1MTC A;  2HLS A;  4G10 A;  2YZU A;  1PX7 A;  4PQI A;  2P5Q A;  3H1N A;  5KN3 A;  3U5R E;  2K18 A;  1OC8 A;  3UBL A;  4IQ1 A;  5CRD A;  4N0V A;  1SK2 A;  1DUG A;  2B6M A;  16GS A;  2FA8 A;  3DD3 A;  2PUK C;  4XRD A;  2GSS A;  2YV9 A;  3D6I A;  4YAP A;  1X0R A;  5F06 A;  5B8A A;  2WRT A;  1JZO A;  3KIJ A;  1DE2 A;  3E0U A;  4OFT A;  5ECR B;  4WF5 A;  2B7K A;  4XHM A;  3BJ5 A;  2F3M A;  2LTK A;  4AJ6 A;  2E7P A;  1XW5 A;  4KDY A;  4MAB A;  5ECM B;  4GLT A;  2B1K A;  4POM A;  4AJ8 A;  2DLX A;  3KM6 A;  2CVB A;  6GSS A;  4RQX A;  3HCZ A;  1KBN A;  3TKS C;  1PSQ A;  1Y25 A;  2YPM A;  3EU4 A;  4MH2 A;  1PX6 A;  1SD9 A;  3NZN A;  5A4W A;  2RM5 A;  3FRC A;  4Q5F A;  2PN8 A;  3DIE A;  4TR4 A;  3SWL A;  4ACS A;  3TRX A;  2XC2 A;  1V40 A;  2YJ7 A;  3IHQ A;  2YV7 A;  3RPN A;  4FYU A;  1Q4J A;  2FHE A;  4TR3 A;  2YWI A;  2NTO A;  2CV4 A;  1J08 A;  4EF0 A;  4ZIJ A;  4IGJ A;  5HFI A;  2ZCT A;  2X64 A;  3TKS E;  3RDW A;  3HJO A;  3UEM A;  3VWW A;  4TR1 B;  4XIH A;  1GSS A;  4PXO A;  1AUC A;  1Z9H A;  4BL7 A;  5J9B A;  1YEP A;  4HDE A;  5LCZ A;  2H0G A;  1EP7 A;  3I6A A;  2MYG A;  1DBY A;  4TW5 A;  5JWQ B;  1ILO A;  2K8S A;  1YY7 A;  5D9T A;  2WFC A;  20GS A;  3ZL5 A;  3QFB C;  3VPT A;  3H4K A;  3ZVJ D;  1YDK A;  3FY7 A;  4POL A;  5D9X A;  1VGL A;  4J2F A;  2GQL A;  5E59 A;  3HHV A;  3N9J A;  5IMZ A;  3LYK A;  3NOF A;  2KLX A;  5FWG A;  5COH A;  3EIN A;  18GS A;  2V1M A;  2IN3 A;  4XCS A;  4OO4 A;  1M2B A;  1N8J A;  2A2R A;  2GS3 A;  4MDC A;  4IHU A;  4QQ7 A;  3IC4 A;  3KD0 A;  3UMA A;  5DQS A;  1PL2 A;  1Z6M A;  1FOV A;  1SKW B;  1OC3 A;  2H1A A;  3F4S A;  3ZTL A;  1ZYE A;  2M80 A;  4NHZ A;  4MJE A;  1IYH A;  4OFM A;  3KTB A;  4AJ7 A;  4PQH A;  3KXO A;  3NIV A;  5ECI B;  1XXU A;  2KP1 A;  2K8V A;  4BVX A;  1WE0 A;  3TJG A;  1ZOF A;  3IK9 A;  3KMO A;  3D22 A;  1A24 A;  3H93 A;  2B5X A;  1YQ1 A;  1T1V A;  4F2I A;  2VL2 C;  2HSH A;  4XRA A;  4HZ4 A;  3FZ5 A;  4IJ3 A;  2GQK A;  3GX8 A;  3LG6 A;  5GAP D;  2FCH A;  2XBQ A;  5H5Q A;  3L0H A;  3Q19 A;  4OCE A;  1SKS B;  4NMU A;  4EDY A;  5ABR A;  1TDI A;  2C0G A;  3GTU B;  3M1G A;  4ZBA A;  1QMV A;  3ZML A;  3L9S A;  4HU9 A;  1M0U A;  2B1L A;  3FEU A;  2X8C A;  3JCM L;  2L57 A;  5ID2 B;  1VF2 A;  1Q98 A;  3RPP A;  4MZC A;  2YOI A;  4YH2 A;  4ZL7 A;  2C8U A;  3TKR A;  2H6Y A;  2V6K A;  1A8L A;  2H76 A;  1HNC A;  4ID0 A;  2VD0 A;  4Q5R A;  1YF1 A;  5JCU A;  4F82 A;  1YZX A;  2DBC A;  5ECK B;  3VUR A;  3MNG A;  2CX4 A;  4KDX A;  3TJF A;  2WJU A;  2GT5 A;  5AIX A;  3ZFL A;  2LRT A;  3Q74 A;  4IW9 A;  2I81 A;  1UC7 A;  1TK5 B;  1S3D A;  4MPF A;  3AY8 A;  1XWA A;  3CSJ A;  3CTF A;  2DJ0 A;  3FZ9 A;  2L4C A;  5ECN B;  1WMJ A;  4F0C A;  1TU8 A;  2LJR A;  3GUR A;  4NPB A;  1GWC A;  2MMZ A;  5JCG A;  1V57 A;  3CYN A;  5AIS A;  4AGS A;  2H74 A;  1OE8 A;  1XOA A;  2AUV A;  1MD4 A;  1DSB A;  1OAZ A;  3UVH A;  1V58 A;  2VL2 A;  2FWG A;  3RHC A;  4D73 B;  5IQY A;  2X99 A;  1WP0 A;  1Z7P A;  3LOR A;  2YN1 A;  3HD5 A;  4QL9 A;  2E2G A;  1M7T A;  4RUV A;  4PGT A;  1XPV A;  2PWJ A;  3A2V A;  5JWO B;  1R4W A;  2GST A;  3EE2 A;  1G7O A;  2LNT A;  1O8W A;  3HZ8 A;  1A0F A;  1JZR A;  2PVQ A;  4PUF C;  1DE1 A;  1QFN A;  3ZFB A;  1SKR B;  2M46 A;  1U88 A;  3VK9 A;  1MDJ A;  1LJR A;  3LQ7 A;  2F51 A;  3BCI A;  4BVY A;  2AV4 A;  1TRV A;  4TVE A;  1ZL9 A;  5DAK B;  1GTA A;  4KA0 A;  4EKZ A;  5EY6 A;  3HVS A;  2OE0 A;  5IOX A;  1ZYQ B;  1G0T A;  3GKX A;  5B8B A;  3BBY A;  1A2M A;  1PD2 1;  3APQ A;  3HJM A;  3KMN A;  1E6B A;  2LQQ A;  2WB9 A;  1ABA A;  4WBR D;  4LMW A;  2A4V A;  5A4V A;  3GKN A;  4L5O A;  1XCC A;  2VCW A;  5D8I A;  2B5E A;  1BQ7 A;  4KCA A;  2J9H A;  4ECC A;  4MZW A;  2FD3 A;  2E2M A;  3WT2 A;  2L6C A;  4WXT A;  3APS A;  4WR5 A;  5CO3 A;  3QAW A;  2HZE A;  6GSX A;  3QMX A;  2H71 A;  10GS A;  2JAC A;  3S9F A;  3CRT A;  5DAL A;  2HYX A;  3BD2 A;  3I69 A;  2PBJ A;  2G0F A;  2L5O A;  3F8U A;  5KN1 A;  2DML A;  1SK0 A;  2TRC P;  3GH6 A;  5G5F A;  1NHY A;  4ULX A;  1G7E A;  1JFU A;  4X1U A;  1Z3E A;  1R5P A;  2H73 A;  1F3B A;  3HYP A;  2CZ2 A;  3D4M A;  1XVW A;  1B4P A;  1K0C A;  1ZZY A;  4DEJ A;  1H75 A;  1SK1 A;  4ZBB A;  2IIY A;  2EIR A;  1OVN A;  2I1U A;  5CP1 A;  2FLS A;  1W4V A;  1ON4 A;  2N5A A;  3MAK A;  1TI1 A;  2PPT A;  2O85 A;  4N0Z A;  3H8Q A;  1R7H A;  1EV4 A;  1EV9 A;  3DML A;  2R2J A;  3DGQ A;  3UAP A;  1XOB A;  1QK8 A;  5DJL A;  2LST A;  4PQ1 A;  3US3 A;  1VF3 A;  1T3B A;  3FK8 A;  2YWN A;  1HQO A;  5D93 A;  2JAD A;  2VO4 A;  4KSM A;  5IM9 A;  3F3Q A;  4EE0 A;  2HRF A;  3C71 A;  2VM2 A;  1A0R P;  4IN0 A;  3A2W A;  4TR0 A;  4V1A g;  3KH7 A;  2F9S A;  2LNS A;  4HQZ A;  2AB6 A;  4MLY A;  2VM1 A;  1PKW A;  2DJ2 A;  4I2T A;  2R37 A;  2CX3 A;  1AAZ A;  5J41 A;  4N10 A;  1XVQ A;  1X9W B;  4F03 A;  5J5N A;  3DKS A;  3C1R A;  3D0Z A;  3DVX A;  3P8W A;  4IJI A;  1T7P B;  2V6O A;  5J3R A;  2O8V B;  1X9S B;  1UVZ A;  2KUC A;  3C73 A;  3N5O A;  1GH2 A;  2YNX A;  2IPA A;  1VF1 A;  4YQM A;  4OMV A;  1F6M C;  3WD6 A;  1XW9 A;  3GA4 A;  5G2Z A;  3F0I A;  4O92 A;  1UN2 A;  4IVF A;  3TKP A;  1TI3 A;  3WGE A;  3GL3 A;  3F4T A;  4FO5 A;  4K7N A;  5D96 A;  4HS1 A;  2DC5 A;  1TOF A;  1KTE A;  5HQP A;  4OWY A;  2CA8 A;  5ELA A;  2OBI A;  5J9C A;  4E8E A;  4MF6 A;  2R3X A;  4BPY A;  1R26 A;  4DSS B;  2P5R A;  2LEG A;  2NPB A;  1BAY A;  1YEX A;  1GTB A;  4JZQ A;  2IFQ A;  3TUE A;  6GSY A;  1GL8 A;  2H66 A;  1SU9 A;  4I6X A;  3ME8 A;  1FG4 A;  2FA4 A;  2LRN A;  1M2A A;  2P31 A;  4PNG A;  5B7C A;  2RII A;  5HFK A;  5EPF A;  5H5S A;  1YF0 A;  3IV4 A;  2RUE A;  2HRN A;  1B48 A;  1XWB A;  5CNW A;  5ECP B;  2VLU A;  2OA7 A;  1MDI A;  1JLW A;  4JE1 A;  4K2D A;  2B5Y A;  1B4Q A;  3ERG A;  1ML6 A;  3QR6 A;  2YCD A;  5HR1 A;  1MDK A;  4E8H A;  3UIW A;  4K8M A;  4LA1 A;  5G5E A;  4MK3 A;  4XS4 A;  3IA1 A;  3ERF A;  3ME7 A;  4ZL8 A;  3G7I A;  4X43 A;  2ZNM A;  3IE3 A;  1JHB A;  4XS6 A;  4NHW A;  2YZH A;  2LRC A;  4IEL A;  5CYY A;  2MZC A;  1PGT A;  4HUA A;  4KSO A;  2H30 A;  4FYC A;  3LYP A;  2GSR A;  5EL8 A;  4PUA A;  1ERW A;  2IMD A;  1K0D A;  1YJ6 A;  2EC4 A;  4F9Z A;  3RAZ A;  4ZBD A;  2K6V A;  1IYI A;  4PNF A;  4GSN A;  4KH7 A;  2E0Q A;  2QC7 A;  3FW2 A;  1XWC A;  2REM A;  2AJQ B;  1XW6 A;  1USB A;  3TKS A;  1A23 A;  3VI5 A;  4GSS A;  3KH9 A;  1FO5 A;  2PMT A;  2TRX A;  3TOT A;  3DWV A;  3P7X A;  3D21 A;  4L5L A;  2V2G A;  1X5C A;  3CRU A;  2PVO C;  4TXO A;  5LD0 A;  1O81 A;  2C0F A;  2RLI A;  3TJK A;  1ERV A;  1SYR A;  3GUS A;  19GS A;  4GF0 A;  5KEJ A;  1B8X A;  2FNO A;  4K7O A;  4KAE A;  1HYU A;  1SEN A;  2XPD A;  3GV1 A;  4MMM A;  5IMF A;  4KUN A;  1OC9 B;  2HT9 A;  3M3M A;  1NM3 A;  2HNL A;  3UL3 A;  2GVP A;  3GKK A;  1WWJ A; 
#chains in the Genus database with same CATH topology
 3D4T A;  2WUL A;  1VF4 A;  1A8Y A;  7GSS A;  1A2J A;  2GSQ A;  2FWH A;  1Y6E A;  6GSU A;  5A4U A;  1AW9 A;  1XBS A;  2ES7 A;  2VCT A;  3TGZ A;  1BYE A;  4V2L A;  2IMI A;  3HZ4 A;  2C3N A;  3P90 A;  4MZB A;  2H1B A;  2H0H A;  3BCK A;  4JRR A;  1RQM A;  1PMT A;  4ZL9 A;  5KOW A;  5JWR B;  1OYJ A;  1TP9 A;  1E2Y A;  1EOH A;  5DCH A;  5IMD A;  1ACV A;  3BOA A;  1FHE A;  4MF7 A;  4J57 E;  2CAI A;  3C8E A;  3QCP A;  3PPU A;  1URM A;  2YP6 A;  3R2Q A;  2VOC A;  2L4Q A;  3F4R A;  2YJH A;  3GIX A;  4WEY A;  3O6T A;  3E9J B;  3PR8 A;  2MMA A;  4ZB9 A;  2H01 A;  12GS A;  4Z7X A;  3QOU A;  2MBS A;  5DCG A;  3HVX A;  4BIK A;  1HNB A;  4X4J A;  3PIN A;  2LKU A;  3EVI A;  3KP9 A;  5CRG A;  5IMC A;  4I8B A;  2DJ3 A;  1AC1 A;  1ERU A;  4MNN A;  5FHI A;  5KOX A;  3DEX A;  3VWV A;  2NBS A;  3ZYW A;  3IOS A;  2N5F A;  2A2P A;  2VLV A;  5A5K A;  1GP1 A;  2VL3 A;  2V32 A;  5AGY A;  5F07 A;  4RI6 A;  1AQW A;  1BJX A;  5ECO B;  2I4A A;  4G19 A;  4TR1 A;  1FAA A;  1FVK A;  3VPQ A;  3IXR A;  4HI7 A;  2KP2 A;  1S3R A;  3ED3 A;  4IQA A;  4OCF A;  2R5G A;  1T00 A;  1XZO A;  3M8N A;  3M9K A;  2ZUP A;  3FYG A;  3HKR A;  1O8X A;  1HNA A;  2OKA A;  1N2A A;  3GFK A;  3EC3 A;  2C1Y A;  2C3Q A;  2I3Y A;  3R3E A;  4K7I A;  4G0L A;  4KB3 A;  4QL7 A;  2QA2 A;  2DJJ A;  3TOU A;  3LW9 A;  1FW1 A;  1R5A A;  4P3Y B;  5HFG A;  1EGR A;  4V1A p;  1XWK A;  5C00 A;  4TXV A;  3KGK A;  3HJP A;  1MEK A;  3GN3 A;  1PKZ A;  2JZS A;  5CRW A;  2C0E A;  2QKE A;  3MDK A;  1NSW A;  22GS A;  2BMX A;  2WZ9 A;  3ERW A;  4X0X A;  3IBH A;  1G6Y A;  4V2M A;  4K5S A;  3UVT A;  1SYX A;  1GTI A;  3F6F A;  5ENU A;  2OAC A;  2H8L A;  4KW6 A;  1AIU A;  1I5G A;  3VFI A;  1TJD A;  2JSY A;  3M9J A;  4KCE A;  5HR3 A;  1OE7 A;  3IAM 2;  2FUG 2;  3EUR A;  1J0F A;  5D9W A;  4MP4 A;  4BWQ A;  4DSR A;  1T4Y A;  3LXZ A;  2F8A A;  1OKD A;  3G7Y A;  2L6D A;  3FR9 A;  4HU7 A;  2OE1 A;  1MD3 A;  2JSZ A;  2YWO A;  2FGX A;  1U87 A;  4TKY A;  1JZD A;  2H75 A;  3GTU A;  3L9U A;  3HY2 A;  4RI7 A;  3EMX A;  4BL7 B;  2ON7 A;  2X4A A;  2GGT A;  4HEA 2;  3EU3 A;  1O6J A;  3LGC A;  3A3T A;  2VIM A;  2DJK A;  3APO A;  3KCM A;  2CVK A;  3IRA A;  5ID2 A;  1F9M A;  1EOG A;  2GZY A;  2QSI A;  3CTG A;  4YKG A;  5F8B A;  2HFD A;  4BA7 A;  4PUR A;  2G2Q A;  4JBB A;  1X5E A;  4RQR A;  2HRA A;  3C7M A;  2H72 A;  4ML6 A;  3E3E A;  4KE3 A;  4GRF A;  2Z9S A;  1Z5Y E;  3LEF A;  4NXI A;  2DSA A;  1PA3 A;  5ECL B;  5INY A;  5ELG A;  1SJI A;  4ZB8 A;  4GCI A;  2CVD A;  3WGX A;  4LL1 B;  4HJ2 A;  2L59 A;  1GSF A;  2JL4 A;  2NVL A;  2XBI A;  2RM6 A;  3J7Y b;  3KEB A;  4XS1 A;  2LS5 A;  5DJM A;  3MSZ A;  4GQC A;  2CAQ A;  5EVO A;  1O73 A;  3J7Y k;  1PN9 A;  3W8J A;  3FZA A;  2R0G A;  3I9V 2;  4EVM A;  5IIZ A;  3OR5 A;  1EEM A;  2D2Z A;  4O5R A;  2KOK A;  2VUP A;  3F9U A;  4KX4 A;  2CT6 A;  5H5R A;  5G1L A;  3GYK A;  2IME A;  4BVX B;  4D73 A;  1PRX A;  4GST A;  3IR4 A;  1S3A A;  4CY6 A;  3HVV A;  1GSD A;  1K0O A;  3IK7 A;  3IPZ A;  3SBC A;  2R6K A;  5GSS A;  1U3I A;  4HZ2 A;  4OD7 A;  2M72 A;  5AIV A;  2I9H A;  4TN8 A;  4NV2 A;  2L5L A;  3CSH A;  5HR0 A;  3ZLP A;  3G9B A;  2DIY A;  2VCZ A;  2KHP A;  2J23 A;  3QAV A;  3TJJ A;  4EC0 A;  3GNJ A;  5HR2 A;  4FYB A;  3ZIV A;  4IS0 A;  1V2A A;  3DYR A;  4BWS A;  1XWG A;  4GXZ A;  2IWT A;  4MJA A;  3HXS A;  3GSS A;  3GMF A;  5CRH A;  5LNK e;  2LJK A;  3V1W A;  5DAK A;  1GTU A;  5ECS A;  1ST9 A;  2H0I A;  4WKW A;  2LUS A;  4JR6 A;  1M99 A;  3A5I A;  1FVJ A;  2C0D A;  5F0G A;  6GSV A;  3DRN A;  3ZIJ A;  4HJM A;  4ILF A;  1K3Y A;  2YAN A;  1GUM A;  4MJC A;  2DJ1 A;  5ECQ B;  1W89 A;  4OO5 A;  4MCU A;  5CRE A;  1SJ6 A;  4IBP A;  3UOM A;  3TJB A;  4EIP A;  3TRQ A;  1M9B A;  4F0B A;  4EL1 A;  3F3R A;  1ZMA A;  4MJB A;  8GSS A;  4FIW A;  4YAV A;  3DXB A;  2R0P A;  5D9V A;  3QAG A;  2DMM A;  2PGT A;  3FR6 A;  2DIZ A;  3W8S A;  3EYT A;  3WT1 A;  1FOH A;  2VAF A;  4KND A;  2BTO T;  1THX A;  1TTZ A;  3EPT A;  1C72 A;  3CMI A;  5G1K A;  2WS2 A;  4TRX A;  1TRU A;  3LXT A;  3VI7 A;  3LJR A;  3UJ1 A;  3VLN A;  1QGV A;  4WET A;  4MA9 A;  2EIO A;  4L0U A;  4OFN A;  4EO3 A;  1OKT A;  2HXK A;  3I43 A;  1F3A A;  1WOU A;  1GUL A;  5GST A;  1S3C A;  3GHA A;  4JR4 A;  1F37 A;  1AXD A;  2C80 A;  4KDU A;  4USS A;  5G31 A;  5C04 A;  1QUW A;  3H79 A;  1UA5 A;  4G9H A;  2EIQ A;  3TDG A;  3C1S A;  3Q6O A;  4EDZ A;  1LBK A;  4JED A;  1TXX A;  4TOP A;  3KP8 A;  1X5D A;  4NV5 A;  9GSS A;  2K9F A;  3L9V A;  5FT3 A;  4JU5 A;  1GSU A;  4BVY B;  2WGR A;  4YKF A;  2V41 A;  1TW9 A;  2ON5 A;  2ALB A;  3W6G A;  3QPM A;  1Z6N A;  1T8E B;  3O3T A;  4GWR A;  4K2X A;  1GLQ A;  2O87 A;  3L4N A;  1LU4 A;  5F05 A;  1GSQ A;  1EEJ A;  4IP6 A;  1ZCP A;  4LL4 B;  3Q18 A;  5JCW A;  4EUY A;  2IMK A;  3CBU A;  3IDV A;  2HZF A;  2VCV A;  2OAD A;  5IPG A;  5IOW A;  1EWX A;  5E4W A;  3LSZ A;  4LMV A;  2HZE B;  2PU9 C;  5J4U A;  1BX9 A;  1V98 A;  3ZRE A;  4MF5 A;  2OJL A;  5DAL B;  1K0N A;  4K9Z A;  2CQ9 A;  1QQ2 A;  1V9W A;  2B3S A;  4L0W A;  4GQF A;  4K6X A;  2LV3 A;  4V2N A;  1KNG A;  3TCO A;  5B6N A;  1THO A;  1K0A A;  2GDR A;  4DSS A;  3ZRD A;  2IL3 A;  3UAR A;  3QFA C;  1YKA A;  1FB0 A;  2R0C A;  4Z2R A;  4K0G A;  4ECI A;  2MMN A;  2OBK A;  1PN0 A;  2GZP A;  3GX0 A;  4HOJ A;  1X9M B;  4J56 E;  3KZQ A;  2WCI A;  2AHE A;  5DQY A;  5G30 A;  4PTS A;  3CSI A;  3WGD A;  3P2A A;  4Q5N A;  1XFL A;  2GZZ A;  1WRY A;  1PQN A;  3FR3 A;  2H1D A;  4NAX A;  2MMO A;  2C3T A;  4XTS A;  2CZ3 A;  4I2U A;  1TU7 A;  1ZYN A;  3MIX A;  2MBT A;  1WJK A;  2IJY A;  3FZ4 A;  2FWE A;  5DDL A;  3HDC A;  3K8N A;  5IO0 A;  1XIY A;  3PH9 A;  1AQV A;  4DSQ A;  3TKQ A;  3RHB A;  1RW1 A;  4ISD A;  2H70 A;  4O32 A;  1U3A A;  2R4V A;  1ERT A;  3FHK A;  4I5Q A;  1SL1 B;  3LFL A;  3PGT A;  4IKH A;  5GAN D;  4ZIL A;  3QD9 A;  1T4Z A;  4CDO A;  1F2E A;  4WBJ A;  3GRX A;  3FKF A;  4HQS A;  4YQV A;  1GSE A;  1JLV A;  13GS A;  2XHF A;  3DVW A;  2GT6 A;  3ZIT A;  1GSY A;  4GTU A;  2XPE A;  1J9B A;  5L71 A;  3VWX A;  4WR4 A;  1KEB A;  2H6X A;  5KN0 A;  3CXG A;  2YWM A;  1PL1 A;  2QGV A;  2BJX A;  1YKC A;  1BG5 A;  3GKM A;  3LWA A;  3U6V A;  1GNW A;  4LLR A;  3A5W A;  1K3L A;  1U6T A;  5IPH A;  2P0G A;  4ECJ A;  3KJY A;  1M9A A;  4CHS A;  3ZZX A;  2HE3 A;  2FY6 A;  2X8G A;  2HI7 A;  1B9Y C;  3TRP A;  3UBK A;  2JZT A;  4FH8 A;  2IFQ B;  2VCX A;  3A2X A;  3F63 A;  3F6D A;  5IO2 A;  1TRS A;  1RK4 A;  1O85 A;  4POB A;  5DVB A;  1VRS D;  2IMF A;  1I9D A;  2VL9 A;  2FWF A;  5KN2 A;  4G0I A;  3MYD A;  4PX1 A;  2B7J A;  2GQM A;  3TB2 A;  4O7H A;  4ML1 A;  4ZXG A;  1OC9 A;  4H86 A;  4O5U A;  3ISO A;  2DKH A;  1NHO A;  2JZR A;  2GLR A;  2VD1 A;  4ECB A;  4EXJ A;  1TK8 B;  3QDN A;  4AF2 A;  1BED A;  4FQU A;  1SL2 B;  4YQU A;  2O89 A;  3VWU A;  17GS A;  2GTU A;  2N5B A;  2VCQ A;  6GSW A;  2TIR A;  5CAX A;  4NWY A;  4WF4 A;  3GH9 A;  2LQO A;  4XS4 B;  3EMP A;  1TK0 B;  1CQG A;  1B9X C;  4K1F A;  4POK A;  1M2D A;  3EWL A;  4IP1 A;  3O76 A;  5IMA A;  1O7U A;  4L8E A;  1GUH A;  1K3O A;  3HA9 A;  5D73 A;  4I97 A;  1GRX A;  1G6W A;  1SL0 B;  4KGI A;  3ZVJ A;  2AYT A;  1FB6 A;  6GST A;  2HSY A;  2JU5 A;  1TRW A;  1EGO A;  1SD8 A;  2UZ8 A;  2AAW A;  3MWH A;  3ZMK A;  4K0N A;  1EZK A;  3GL5 A;  2X8H A;  1K0M A;  2H19 A;  1Z7R A;  1GNE A;  1QXH A;  1CQH A;  1ZGN A;  3IAS 2;  4Q5Q A;  1GUK A;  1K0B A;  4MH3 A;  2LJA A;  1SJZ A;  3GST A;  4N11 A;  5GZZ B;  1EP8 A;  2H1G A;  2RUF A;  4DVC A;  2H6Z A;  3KTL A;  3G7J A;  2OE3 A;  2NDO A;  4ZB6 A;  4G2E A;  3WYW A;  5AN1 A;  5B6M A;  4TXO B;  1TKD B;  3RBT A;  1A2L A;  1HD2 A;  5DBQ A;  1AQX A;  1GLP A;  2VLT A;  2PER A;  1H4O A;  4CW9 A;  3L78 A;  1NW2 A;  1WPI A;  2C4J A;  5IMV A;  2F8F A;  2WDU A;  1WIK A;  1JZW A;  14GS A;  11GS A;  3D5J A;  3M0F A;  2O7K A;  5ECH B;  2A2S A;  4N30 A;  4MPG A;  4A5P A;  1MTC A;  2HLS A;  4G10 A;  2YZU A;  1PX7 A;  4PQI A;  2P5Q A;  3H1N A;  5KN3 A;  3U5R E;  2K18 A;  1OC8 A;  3UBL A;  4IQ1 A;  5CRD A;  4N0V A;  1SK2 A;  1DUG A;  2B6M A;  16GS A;  2FA8 A;  3DD3 A;  2PUK C;  4XRD A;  2GSS A;  2YV9 A;  3D6I A;  4YAP A;  1X0R A;  5F06 A;  5B8A A;  2WRT A;  1JZO A;  3KIJ A;  1DE2 A;  3E0U A;  4OFT A;  5ECR B;  4WF5 A;  2B7K A;  4XHM A;  3BJ5 A;  2F3M A;  2LTK A;  4AJ6 A;  2E7P A;  1XW5 A;  4KDY A;  4MAB A;  5ECM B;  4GLT A;  2B1K A;  4POM A;  4AJ8 A;  2DLX A;  3KM6 A;  2CVB A;  4K5R A;  6GSS A;  4G0K A;  4RQX A;  3HCZ A;  1KBN A;  3TKS C;  1PSQ A;  1Y25 A;  2YPM A;  3EU4 A;  2HRK A;  4MH2 A;  1PX6 A;  1SD9 A;  3NZN A;  5A4W A;  2RM5 A;  3FRC A;  4Q5F A;  2PN8 A;  3DIE A;  4TR4 A;  3SWL A;  4ACS A;  3TRX A;  2XC2 A;  1V40 A;  2YJ7 A;  3IHQ A;  2YV7 A;  3RPN A;  4FYU A;  1Q4J A;  2FHE A;  4TR3 A;  2YWI A;  2NTO A;  2CV4 A;  3IC8 A;  1J08 A;  4EF0 A;  4ZIJ A;  4IGJ A;  5HFI A;  2ZCT A;  2X64 A;  3TKS E;  3RDW A;  3HJO A;  3UEM A;  3VWW A;  4TR1 B;  4XIH A;  1GSS A;  4PXO A;  1AUC A;  1Z9H A;  4BL7 A;  5J9B A;  1YEP A;  4HDE A;  5LCZ A;  2H0G A;  1EP7 A;  3I6A A;  2MYG A;  1DBY A;  4TW5 A;  5JWQ B;  1ILO A;  2K8S A;  1YY7 A;  1M3I A;  5D9T A;  2WFC A;  20GS A;  3ZL5 A;  3QFB C;  3VPT A;  3H4K A;  3ZVJ D;  1YDK A;  3FY7 A;  4POL A;  5D9X A;  1VGL A;  4J2F A;  2GQL A;  5E59 A;  3HHV A;  3N9J A;  5IMZ A;  3LYK A;  3NOF A;  2KLX A;  3CQF A;  5FWG A;  5COH A;  3EIN A;  18GS A;  2V1M A;  2IN3 A;  4XCS A;  4OO4 A;  1M2B A;  1N8J A;  2A2R A;  2GS3 A;  4MDC A;  4IHU A;  4QQ7 A;  3IC4 A;  3KD0 A;  3UMA A;  5DQS A;  1PL2 A;  1Z6M A;  1FOV A;  1SKW B;  1OC3 A;  2H1A A;  3F4S A;  3ZTL A;  1ZYE A;  2M80 A;  4NHZ A;  4MJE A;  1IYH A;  4OFM A;  3KTB A;  4AJ7 A;  4PQH A;  3KXO A;  3NIV A;  5ECI B;  1XXU A;  2KP1 A;  2K8V A;  4BVX A;  1WE0 A;  3TJG A;  4EIQ A;  1ZOF A;  3IK9 A;  3KMO A;  3D22 A;  1A24 A;  3H93 A;  2B5X A;  1YQ1 A;  1T1V A;  4F2I A;  2VL2 C;  2HSH A;  4XRA A;  4HZ4 A;  3FZ5 A;  4IJ3 A;  2GQK A;  3GX8 A;  3LG6 A;  5GAP D;  2FCH A;  2XBQ A;  5H5Q A;  3L0H A;  3Q19 A;  4OCE A;  1SKS B;  4NMU A;  4EDY A;  5ABR A;  1TDI A;  2C0G A;  3GTU B;  3M1G A;  4ZBA A;  1QMV A;  3ZML A;  3L9S A;  4HU9 A;  1M0U A;  2B1L A;  3FEU A;  2X8C A;  3JCM L;  2L57 A;  5ID2 B;  2A4H A;  1VF2 A;  1Q98 A;  3RPP A;  4MZC A;  2YOI A;  4YH2 A;  4ZL7 A;  2C8U A;  3TKR A;  2H6Y A;  2V6K A;  1A8L A;  2H76 A;  1HNC A;  4ID0 A;  2VD0 A;  4Q5R A;  1YF1 A;  5JCU A;  4F82 A;  1YZX A;  3IHG A;  2DBC A;  5ECK B;  3VUR A;  3MNG A;  2CX4 A;  4KDX A;  3TJF A;  2WJU A;  2GT5 A;  5AIX A;  3ZFL A;  4CY8 A;  2LRT A;  3Q74 A;  4Z2U A;  4IW9 A;  2I81 A;  1UC7 A;  1TK5 B;  1S3D A;  3FMW A;  4MPF A;  3AY8 A;  1XWA A;  3CSJ A;  3CTF A;  4KF9 A;  2DJ0 A;  3FZ9 A;  2L4C A;  5ECN B;  1WMJ A;  4F0C A;  1TU8 A;  2LJR A;  3GUR A;  4NPB A;  1GWC A;  2MMZ A;  5JCG A;  2X49 A;  1V57 A;  3CYN A;  5AIS A;  4AGS A;  2H74 A;  1OE8 A;  1XOA A;  2AUV A;  1MD4 A;  1DSB A;  1OAZ A;  3UVH A;  1V58 A;  2VL2 A;  2FWG A;  3RHC A;  4D73 B;  5IQY A;  2X99 A;  1WP0 A;  1Z7P A;  3LOR A;  2YN1 A;  3HD5 A;  4QL9 A;  2E2G A;  1M7T A;  4RUV A;  4PGT A;  1XPV A;  2PWJ A;  3A2V A;  4Z2T A;  5JWO B;  1R4W A;  2GST A;  3EE2 A;  1G7O A;  2LNT A;  1O8W A;  3HZ8 A;  1A0F A;  1JZR A;  2PVQ A;  4PUF C;  1DE1 A;  1QFN A;  3ZFB A;  1SKR B;  2M46 A;  1U88 A;  3VK9 A;  1MDJ A;  1LJR A;  3LQ7 A;  1M3J A;  2F51 A;  3BCI A;  4BVY A;  2AV4 A;  1TRV A;  4TVE A;  1ZL9 A;  5DAK B;  1GTA A;  4KA0 A;  4EKZ A;  5EY6 A;  3HVS A;  2OE0 A;  2HSM A;  5IOX A;  1ZYQ B;  1G0T A;  3GKX A;  5B8B A;  3BBY A;  1A2M A;  1PD2 1;  3APQ A;  3HJM A;  3KMN A;  1E6B A;  2LQQ A;  2WB9 A;  1ABA A;  4WBR D;  4LMW A;  2A4V A;  5A4V A;  3GKN A;  4L5O A;  1XCC A;  2VCW A;  5D8I A;  2B5E A;  1BQ7 A;  4KCA A;  2J9H A;  4ECC A;  4MZW A;  2FD3 A;  2E2M A;  3WT2 A;  2L6C A;  4WXT A;  3APS A;  4WR5 A;  5CO3 A;  3QAW A;  2HZE A;  6GSX A;  3QMX A;  2H71 A;  10GS A;  2JAC A;  3S9F A;  3CRT A;  5DAL A;  2HYX A;  3BD2 A;  3I69 A;  2PBJ A;  2G0F A;  2L5O A;  3F8U A;  5KN1 A;  2DML A;  1SK0 A;  2TRC P;  3GH6 A;  5G5F A;  1NHY A;  4ULX A;  1G7E A;  1JFU A;  4X1U A;  1Z3E A;  1R5P A;  2H73 A;  1F3B A;  3HYP A;  2CZ2 A;  3D4M A;  1XVW A;  1B4P A;  1K0C A;  1ZZY A;  4DEJ A;  1H75 A;  1SK1 A;  4ZBB A;  2IIY A;  2EIR A;  1OVN A;  2I1U A;  5CP1 A;  2FLS A;  1W4V A;  1ON4 A;  2N5A A;  3MAK A;  1TI1 A;  2PPT A;  2O85 A;  4N0Z A;  3H8Q A;  1R7H A;  1EV4 A;  1EV9 A;  3DML A;  2R2J A;  3DGQ A;  3UAP A;  1XOB A;  1QK8 A;  1PFO A;  5DJL A;  2LST A;  4PQ1 A;  3US3 A;  1VF3 A;  1T3B A;  3FK8 A;  2YWN A;  1HQO A;  5D93 A;  2DKI A;  2JAD A;  2VO4 A;  4KSM A;  5IM9 A;  3F3Q A;  4EE0 A;  2HRF A;  3C71 A;  2VM2 A;  1A0R P;  4IN0 A;  3A2W A;  4TR0 A;  4V1A g;  3KH7 A;  2F9S A;  2LNS A;  4HQZ A;  2AB6 A;  4MLY A;  2VM1 A;  1PKW A;  2DJ2 A;  4I2T A;  2R37 A;  2CX3 A;  1AAZ A;  5J41 A;  4N10 A;  1XVQ A;  1X9W B;  4F03 A;  5J5N A;  4ICY A;  3DKS A;  3C1R A;  3D0Z A;  2QA1 A;  3DVX A;  3P8W A;  4IJI A;  1T7P B;  2V6O A;  5J3R A;  2O8V B;  1X9S B;  1UVZ A;  2KUC A;  3C73 A;  3N5O A;  1GH2 A;  4HSC X;  2YNX A;  2IPA A;  1VF1 A;  4YQM A;  4OMV A;  1F6M C;  3WD6 A;  1XW9 A;  3GA4 A;  5G2Z A;  3F0I A;  4O92 A;  1UN2 A;  4IVF A;  3TKP A;  1TI3 A;  3WGE A;  3GL3 A;  3F4T A;  4FO5 A;  4K7N A;  5D96 A;  4HS1 A;  2DC5 A;  1TOF A;  1KTE A;  5HQP A;  4OWY A;  2CA8 A;  5ELA A;  2OBI A;  5J9C A;  4E8E A;  4MF6 A;  2R3X A;  4BPY A;  1R26 A;  4DSS B;  2P5R A;  2LEG A;  2NPB A;  1BAY A;  1YEX A;  1GTB A;  4JZQ A;  2IFQ A;  3TUE A;  6GSY A;  1GL8 A;  2H66 A;  1SU9 A;  4I6X A;  3ME8 A;  1FG4 A;  2FA4 A;  2LRN A;  1M2A A;  2P31 A;  4PNG A;  5B7C A;  2RII A;  5HFK A;  5EPF A;  5H5S A;  1YF0 A;  3IV4 A;  2RUE A;  2HRN A;  1B48 A;  1XWB A;  5CNW A;  5ECP B;  1ZYP A;  2VLU A;  2OA7 A;  1MDI A;  1JLW A;  4JE1 A;  4K2D A;  2B5Y A;  1B4Q A;  3ERG A;  1ML6 A;  3QR6 A;  2YCD A;  5HR1 A;  3HVN A;  1MDK A;  4E8H A;  3UIW A;  5BRT A;  4K8M A;  4LA1 A;  5G5E A;  4MK3 A;  4XS4 A;  3IA1 A;  3ERF A;  3ME7 A;  4ZL8 A;  3G7I A;  4X43 A;  2ZNM A;  3IE3 A;  1JHB A;  4XS6 A;  4NHW A;  2YZH A;  2LRC A;  4IEL A;  2MZC A;  5CYY A;  1PGT A;  4HUA A;  5BMU A;  4KSO A;  2H30 A;  4FYC A;  3LYP A;  2GSR A;  5EL8 A;  4PUA A;  1ERW A;  2IMD A;  1K0D A;  1YJ6 A;  2EC4 A;  4F9Z A;  3RAZ A;  1XG8 A;  4ZBD A;  2K6V A;  1IYI A;  4PNF A;  4GSN A;  4KH7 A;  2E0Q A;  2QC7 A;  3FW2 A;  1XWC A;  2REM A;  2AJQ B;  1XW6 A;  1USB A;  3TKS A;  1A23 A;  3VI5 A;  4GSS A;  3KH9 A;  1FO5 A;  2PMT A;  2TRX A;  3TOT A;  3DWV A;  3P7X A;  3D21 A;  4L5L A;  2V2G A;  1X5C A;  3CRU A;  2PVO C;  4O5Q A;  4TXO A;  5LD0 A;  1O81 A;  2C0F A;  2RLI A;  3TJK A;  1ERV A;  1SYR A;  3GUS A;  19GS A;  4GF0 A;  5KEJ A;  1B8X A;  2FNO A;  4K7O A;  4KAE A;  1HYU A;  1SEN A;  2XPD A;  3GV1 A;  4MMM A;  5IMF A;  4KUN A;  1OC9 B;  2HT9 A;  3M3M A;  1NM3 A;  2HNL A;  3UL3 A;  2GVP A;  3GKK A;  1WWJ A; 
#chains in the Genus database with same CATH homology
 3D4T A;  2WUL A;  1VF4 A;  1A8Y A;  7GSS A;  1A2J A;  2GSQ A;  2FWH A;  1Y6E A;  6GSU A;  5A4U A;  1AW9 A;  1XBS A;  2ES7 A;  2VCT A;  3TGZ A;  1BYE A;  4V2L A;  2IMI A;  3HZ4 A;  2C3N A;  3P90 A;  4MZB A;  2H1B A;  2H0H A;  3BCK A;  4JRR A;  1RQM A;  1PMT A;  4ZL9 A;  5KOW A;  5JWR B;  1OYJ A;  1TP9 A;  1E2Y A;  1EOH A;  5DCH A;  5IMD A;  1ACV A;  3BOA A;  1FHE A;  4MF7 A;  4J57 E;  2CAI A;  3C8E A;  3QCP A;  3PPU A;  1URM A;  2YP6 A;  3R2Q A;  2VOC A;  2L4Q A;  3F4R A;  2YJH A;  3GIX A;  4WEY A;  3O6T A;  3E9J B;  3PR8 A;  2MMA A;  4ZB9 A;  2H01 A;  12GS A;  4Z7X A;  3QOU A;  2MBS A;  5DCG A;  3HVX A;  1HNB A;  4X4J A;  3PIN A;  2LKU A;  3EVI A;  3KP9 A;  5CRG A;  5IMC A;  4I8B A;  2DJ3 A;  1AC1 A;  1ERU A;  4MNN A;  5FHI A;  5KOX A;  3DEX A;  3VWV A;  2NBS A;  3ZYW A;  3IOS A;  2N5F A;  2A2P A;  2VLV A;  5A5K A;  1GP1 A;  2VL3 A;  2V32 A;  5AGY A;  5F07 A;  4RI6 A;  1AQW A;  1BJX A;  5ECO B;  2I4A A;  4G19 A;  4TR1 A;  1FAA A;  1FVK A;  3VPQ A;  3IXR A;  4HI7 A;  2KP2 A;  3ED3 A;  4IQA A;  4OCF A;  2R5G A;  1T00 A;  1XZO A;  3M8N A;  3M9K A;  2ZUP A;  3FYG A;  3HKR A;  1O8X A;  1HNA A;  2OKA A;  1N2A A;  3GFK A;  3EC3 A;  2C1Y A;  2C3Q A;  2I3Y A;  3R3E A;  4K7I A;  4G0L A;  4KB3 A;  4QL7 A;  2QA2 A;  2DJJ A;  3TOU A;  3LW9 A;  1FW1 A;  1R5A A;  4P3Y B;  5HFG A;  1EGR A;  4V1A p;  1XWK A;  5C00 A;  4TXV A;  3KGK A;  3HJP A;  1MEK A;  3GN3 A;  1PKZ A;  2JZS A;  5CRW A;  2C0E A;  2QKE A;  3MDK A;  1NSW A;  22GS A;  2BMX A;  2WZ9 A;  3ERW A;  4X0X A;  3IBH A;  1G6Y A;  4V2M A;  4K5S A;  3UVT A;  1SYX A;  1GTI A;  3F6F A;  5ENU A;  2OAC A;  2H8L A;  4KW6 A;  1AIU A;  1I5G A;  3VFI A;  1TJD A;  2JSY A;  3M9J A;  4KCE A;  5HR3 A;  1OE7 A;  3IAM 2;  2FUG 2;  3EUR A;  1J0F A;  5D9W A;  4MP4 A;  4BWQ A;  4DSR A;  1T4Y A;  3LXZ A;  2F8A A;  1OKD A;  3G7Y A;  2L6D A;  3FR9 A;  4HU7 A;  2OE1 A;  1MD3 A;  2JSZ A;  2YWO A;  2FGX A;  1U87 A;  4TKY A;  1JZD A;  2H75 A;  3GTU A;  3L9U A;  3HY2 A;  4RI7 A;  3EMX A;  4BL7 B;  2ON7 A;  2X4A A;  2GGT A;  4HEA 2;  3EU3 A;  1O6J A;  3LGC A;  3A3T A;  2VIM A;  2DJK A;  3APO A;  3KCM A;  2CVK A;  3IRA A;  5ID2 A;  1F9M A;  1EOG A;  2GZY A;  2QSI A;  3CTG A;  4YKG A;  5F8B A;  2HFD A;  4BA7 A;  4PUR A;  2G2Q A;  4JBB A;  1X5E A;  4RQR A;  2HRA A;  3C7M A;  2H72 A;  4ML6 A;  3E3E A;  4KE3 A;  4GRF A;  2Z9S A;  1Z5Y E;  3LEF A;  4NXI A;  2DSA A;  1PA3 A;  5ECL B;  5INY A;  5ELG A;  1SJI A;  4ZB8 A;  4GCI A;  2CVD A;  3WGX A;  4LL1 B;  4HJ2 A;  2L59 A;  1GSF A;  2JL4 A;  2NVL A;  2XBI A;  2RM6 A;  3J7Y b;  3KEB A;  4XS1 A;  2LS5 A;  5DJM A;  3MSZ A;  4GQC A;  2CAQ A;  5EVO A;  1O73 A;  3J7Y k;  1PN9 A;  3W8J A;  3FZA A;  2R0G A;  3I9V 2;  4EVM A;  5IIZ A;  3OR5 A;  1EEM A;  2D2Z A;  4O5R A;  2KOK A;  2VUP A;  3F9U A;  4KX4 A;  2CT6 A;  5H5R A;  5G1L A;  3GYK A;  2IME A;  4BVX B;  4D73 A;  1PRX A;  4GST A;  3IR4 A;  1S3A A;  4CY6 A;  3HVV A;  1GSD A;  1K0O A;  3IK7 A;  3IPZ A;  3SBC A;  2R6K A;  5GSS A;  1U3I A;  4HZ2 A;  4OD7 A;  2M72 A;  5AIV A;  2I9H A;  4TN8 A;  4NV2 A;  2L5L A;  3CSH A;  5HR0 A;  3ZLP A;  3G9B A;  2DIY A;  2VCZ A;  2KHP A;  2J23 A;  3QAV A;  3TJJ A;  4EC0 A;  3GNJ A;  5HR2 A;  4FYB A;  3ZIV A;  4IS0 A;  1V2A A;  3DYR A;  4BWS A;  1XWG A;  4GXZ A;  2IWT A;  4MJA A;  3HXS A;  3GSS A;  3GMF A;  5CRH A;  5LNK e;  2LJK A;  3V1W A;  5DAK A;  1GTU A;  5ECS A;  1ST9 A;  2H0I A;  4WKW A;  2LUS A;  4JR6 A;  1M99 A;  3A5I A;  1FVJ A;  2C0D A;  5F0G A;  6GSV A;  3DRN A;  3ZIJ A;  4HJM A;  4ILF A;  1K3Y A;  2YAN A;  1GUM A;  4MJC A;  2DJ1 A;  5ECQ B;  1W89 A;  4OO5 A;  4MCU A;  5CRE A;  1SJ6 A;  4IBP A;  3UOM A;  3TJB A;  4EIP A;  3TRQ A;  1M9B A;  4F0B A;  4EL1 A;  3F3R A;  1ZMA A;  4MJB A;  8GSS A;  4FIW A;  4YAV A;  3DXB A;  2R0P A;  5D9V A;  3QAG A;  2DMM A;  2PGT A;  3FR6 A;  2DIZ A;  3W8S A;  3EYT A;  3WT1 A;  1FOH A;  2VAF A;  4KND A;  2BTO T;  1THX A;  1TTZ A;  3EPT A;  1C72 A;  3CMI A;  5G1K A;  2WS2 A;  4TRX A;  1TRU A;  3LXT A;  3VI7 A;  3LJR A;  3UJ1 A;  3VLN A;  1QGV A;  4WET A;  4MA9 A;  2EIO A;  4L0U A;  4OFN A;  4EO3 A;  1OKT A;  2HXK A;  3I43 A;  1F3A A;  1WOU A;  1GUL A;  5GST A;  1S3C A;  3GHA A;  4JR4 A;  1F37 A;  1AXD A;  2C80 A;  4KDU A;  4USS A;  5G31 A;  5C04 A;  1QUW A;  3H79 A;  1UA5 A;  4G9H A;  2EIQ A;  3TDG A;  3C1S A;  3Q6O A;  4EDZ A;  1LBK A;  4JED A;  1TXX A;  4TOP A;  3KP8 A;  1X5D A;  4NV5 A;  9GSS A;  2K9F A;  3L9V A;  5FT3 A;  4JU5 A;  1GSU A;  4BVY B;  2WGR A;  4YKF A;  2V41 A;  1TW9 A;  2ON5 A;  2ALB A;  3W6G A;  3QPM A;  1Z6N A;  1T8E B;  3O3T A;  4GWR A;  4K2X A;  1GLQ A;  2O87 A;  3L4N A;  1LU4 A;  5F05 A;  1GSQ A;  1EEJ A;  4IP6 A;  1ZCP A;  4LL4 B;  3Q18 A;  5JCW A;  4EUY A;  2IMK A;  3CBU A;  3IDV A;  2HZF A;  2VCV A;  2OAD A;  5IPG A;  5IOW A;  1EWX A;  5E4W A;  3LSZ A;  4LMV A;  2HZE B;  2PU9 C;  5J4U A;  1BX9 A;  1V98 A;  3ZRE A;  4MF5 A;  2OJL A;  5DAL B;  1K0N A;  4K9Z A;  2CQ9 A;  1QQ2 A;  1V9W A;  2B3S A;  4L0W A;  4GQF A;  4K6X A;  2LV3 A;  4V2N A;  1KNG A;  3TCO A;  5B6N A;  1THO A;  1K0A A;  2GDR A;  4DSS A;  3ZRD A;  2IL3 A;  3UAR A;  3QFA C;  1YKA A;  1FB0 A;  2R0C A;  4Z2R A;  4K0G A;  4ECI A;  2MMN A;  2OBK A;  1PN0 A;  2GZP A;  3GX0 A;  4HOJ A;  1X9M B;  4J56 E;  3KZQ A;  2WCI A;  2AHE A;  5DQY A;  5G30 A;  4PTS A;  3CSI A;  3WGD A;  3P2A A;  4Q5N A;  1XFL A;  2GZZ A;  1WRY A;  1PQN A;  3FR3 A;  2H1D A;  4NAX A;  2MMO A;  2C3T A;  4XTS A;  2CZ3 A;  4I2U A;  1TU7 A;  1ZYN A;  3MIX A;  2MBT A;  1WJK A;  2IJY A;  3FZ4 A;  2FWE A;  5DDL A;  3HDC A;  3K8N A;  5IO0 A;  1XIY A;  3PH9 A;  1AQV A;  4DSQ A;  3TKQ A;  3RHB A;  1RW1 A;  4ISD A;  2H70 A;  4O32 A;  1U3A A;  2R4V A;  1ERT A;  3FHK A;  4I5Q A;  1SL1 B;  3LFL A;  3PGT A;  4IKH A;  5GAN D;  4ZIL A;  3QD9 A;  1T4Z A;  4CDO A;  1F2E A;  4WBJ A;  3GRX A;  3FKF A;  4HQS A;  4YQV A;  1GSE A;  1JLV A;  13GS A;  2XHF A;  3DVW A;  2GT6 A;  3ZIT A;  1GSY A;  4GTU A;  2XPE A;  1J9B A;  5L71 A;  3VWX A;  4WR4 A;  1KEB A;  2H6X A;  5KN0 A;  3CXG A;  2YWM A;  1PL1 A;  2QGV A;  2BJX A;  1YKC A;  1BG5 A;  3GKM A;  3LWA A;  3U6V A;  1GNW A;  4LLR A;  3A5W A;  1K3L A;  1U6T A;  5IPH A;  2P0G A;  4ECJ A;  3KJY A;  1M9A A;  4CHS A;  3ZZX A;  2HE3 A;  2FY6 A;  2X8G A;  2HI7 A;  1B9Y C;  3TRP A;  3UBK A;  2JZT A;  4FH8 A;  2IFQ B;  2VCX A;  3A2X A;  3F63 A;  3F6D A;  5IO2 A;  1TRS A;  1RK4 A;  1O85 A;  4POB A;  5DVB A;  1VRS D;  2IMF A;  1I9D A;  2VL9 A;  2FWF A;  5KN2 A;  4G0I A;  3MYD A;  4PX1 A;  2B7J A;  2GQM A;  3TB2 A;  4O7H A;  4ML1 A;  4ZXG A;  1OC9 A;  4H86 A;  4O5U A;  3ISO A;  2DKH A;  1NHO A;  2JZR A;  2GLR A;  2VD1 A;  4ECB A;  4EXJ A;  1TK8 B;  3QDN A;  4AF2 A;  1BED A;  4FQU A;  1SL2 B;  4YQU A;  2O89 A;  3VWU A;  17GS A;  2GTU A;  2N5B A;  2VCQ A;  6GSW A;  2TIR A;  5CAX A;  4NWY A;  4WF4 A;  3GH9 A;  2LQO A;  4XS4 B;  3EMP A;  1TK0 B;  1CQG A;  1B9X C;  4K1F A;  4POK A;  1M2D A;  3EWL A;  4IP1 A;  3O76 A;  5IMA A;  1O7U A;  4L8E A;  1GUH A;  1K3O A;  3HA9 A;  5D73 A;  4I97 A;  1GRX A;  1G6W A;  1SL0 B;  4KGI A;  3ZVJ A;  2AYT A;  1FB6 A;  6GST A;  2HSY A;  2JU5 A;  1TRW A;  1EGO A;  1SD8 A;  2UZ8 A;  2AAW A;  3MWH A;  3ZMK A;  4K0N A;  1EZK A;  3GL5 A;  2X8H A;  1K0M A;  2H19 A;  1Z7R A;  1GNE A;  1QXH A;  1CQH A;  1ZGN A;  3IAS 2;  4Q5Q A;  1GUK A;  1K0B A;  4MH3 A;  2LJA A;  1SJZ A;  3GST A;  4N11 A;  5GZZ B;  1EP8 A;  2H1G A;  2RUF A;  4DVC A;  2H6Z A;  3KTL A;  3G7J A;  2OE3 A;  2NDO A;  4ZB6 A;  4G2E A;  3WYW A;  5AN1 A;  5B6M A;  4TXO B;  1TKD B;  3RBT A;  1A2L A;  1HD2 A;  5DBQ A;  1AQX A;  1GLP A;  2VLT A;  2PER A;  1H4O A;  4CW9 A;  3L78 A;  1NW2 A;  1WPI A;  2C4J A;  5IMV A;  2F8F A;  2WDU A;  1WIK A;  1JZW A;  14GS A;  11GS A;  3D5J A;  3M0F A;  2O7K A;  5ECH B;  2A2S A;  4N30 A;  4MPG A;  4A5P A;  1MTC A;  2HLS A;  4G10 A;  2YZU A;  1PX7 A;  4PQI A;  2P5Q A;  3H1N A;  5KN3 A;  3U5R E;  2K18 A;  1OC8 A;  3UBL A;  4IQ1 A;  5CRD A;  4N0V A;  1SK2 A;  1DUG A;  2B6M A;  16GS A;  2FA8 A;  3DD3 A;  2PUK C;  4XRD A;  2GSS A;  2YV9 A;  3D6I A;  4YAP A;  1X0R A;  5F06 A;  5B8A A;  2WRT A;  1JZO A;  3KIJ A;  1DE2 A;  3E0U A;  4OFT A;  5ECR B;  4WF5 A;  2B7K A;  4XHM A;  3BJ5 A;  2F3M A;  2LTK A;  4AJ6 A;  2E7P A;  1XW5 A;  4KDY A;  4MAB A;  5ECM B;  4GLT A;  2B1K A;  4POM A;  4AJ8 A;  2DLX A;  3KM6 A;  2CVB A;  4K5R A;  6GSS A;  4G0K A;  4RQX A;  3HCZ A;  1KBN A;  3TKS C;  1PSQ A;  1Y25 A;  2YPM A;  3EU4 A;  2HRK A;  4MH2 A;  1PX6 A;  1SD9 A;  3NZN A;  5A4W A;  2RM5 A;  3FRC A;  4Q5F A;  2PN8 A;  3DIE A;  4TR4 A;  3SWL A;  4ACS A;  3TRX A;  2XC2 A;  1V40 A;  2YJ7 A;  3IHQ A;  2YV7 A;  3RPN A;  4FYU A;  1Q4J A;  2FHE A;  4TR3 A;  2YWI A;  2NTO A;  2CV4 A;  3IC8 A;  1J08 A;  4EF0 A;  4ZIJ A;  4IGJ A;  5HFI A;  2ZCT A;  2X64 A;  3TKS E;  3RDW A;  3HJO A;  3UEM A;  3VWW A;  4TR1 B;  4XIH A;  1GSS A;  4PXO A;  1AUC A;  1Z9H A;  4BL7 A;  5J9B A;  1YEP A;  4HDE A;  5LCZ A;  2H0G A;  1EP7 A;  3I6A A;  2MYG A;  1DBY A;  4TW5 A;  5JWQ B;  1ILO A;  2K8S A;  1YY7 A;  5D9T A;  2WFC A;  20GS A;  3ZL5 A;  3QFB C;  3VPT A;  3H4K A;  3ZVJ D;  1YDK A;  3FY7 A;  4POL A;  5D9X A;  1VGL A;  4J2F A;  2GQL A;  5E59 A;  3HHV A;  3N9J A;  5IMZ A;  3LYK A;  3NOF A;  2KLX A;  5FWG A;  5COH A;  3EIN A;  18GS A;  2V1M A;  2IN3 A;  4XCS A;  4OO4 A;  1M2B A;  1N8J A;  2A2R A;  2GS3 A;  4MDC A;  4IHU A;  4QQ7 A;  3IC4 A;  3KD0 A;  3UMA A;  5DQS A;  1PL2 A;  1Z6M A;  1FOV A;  1SKW B;  1OC3 A;  2H1A A;  3F4S A;  3ZTL A;  1ZYE A;  2M80 A;  4NHZ A;  4MJE A;  1IYH A;  4OFM A;  3KTB A;  4AJ7 A;  4PQH A;  3KXO A;  3NIV A;  5ECI B;  1XXU A;  2KP1 A;  2K8V A;  4BVX A;  1WE0 A;  3TJG A;  4EIQ A;  1ZOF A;  3IK9 A;  3KMO A;  3D22 A;  1A24 A;  3H93 A;  2B5X A;  1YQ1 A;  1T1V A;  4F2I A;  2VL2 C;  2HSH A;  4XRA A;  4HZ4 A;  3FZ5 A;  4IJ3 A;  2GQK A;  3GX8 A;  3LG6 A;  5GAP D;  2FCH A;  2XBQ A;  5H5Q A;  3L0H A;  3Q19 A;  4OCE A;  1SKS B;  4NMU A;  4EDY A;  5ABR A;  1TDI A;  2C0G A;  3GTU B;  3M1G A;  4ZBA A;  1QMV A;  3ZML A;  3L9S A;  4HU9 A;  1M0U A;  2B1L A;  3FEU A;  2X8C A;  3JCM L;  2L57 A;  5ID2 B;  2A4H A;  1VF2 A;  1Q98 A;  3RPP A;  4MZC A;  2YOI A;  4YH2 A;  4ZL7 A;  2C8U A;  3TKR A;  2H6Y A;  2V6K A;  1A8L A;  2H76 A;  1HNC A;  4ID0 A;  2VD0 A;  4Q5R A;  1YF1 A;  5JCU A;  4F82 A;  1YZX A;  3IHG A;  2DBC A;  5ECK B;  3VUR A;  3MNG A;  2CX4 A;  4KDX A;  3TJF A;  2WJU A;  2GT5 A;  5AIX A;  3ZFL A;  4CY8 A;  2LRT A;  3Q74 A;  4Z2U A;  4IW9 A;  2I81 A;  1UC7 A;  1TK5 B;  1S3D A;  3FMW A;  4MPF A;  3AY8 A;  1XWA A;  3CSJ A;  3CTF A;  4KF9 A;  2DJ0 A;  3FZ9 A;  2L4C A;  5ECN B;  1WMJ A;  4F0C A;  1TU8 A;  2LJR A;  3GUR A;  4NPB A;  1GWC A;  2MMZ A;  5JCG A;  2X49 A;  1V57 A;  3CYN A;  5AIS A;  4AGS A;  2H74 A;  1OE8 A;  1XOA A;  2AUV A;  1MD4 A;  1DSB A;  1OAZ A;  3UVH A;  1V58 A;  2VL2 A;  2FWG A;  3RHC A;  4D73 B;  5IQY A;  2X99 A;  1WP0 A;  1Z7P A;  3LOR A;  2YN1 A;  3HD5 A;  4QL9 A;  2E2G A;  1M7T A;  4RUV A;  4PGT A;  1XPV A;  2PWJ A;  3A2V A;  4Z2T A;  5JWO B;  1R4W A;  2GST A;  3EE2 A;  1G7O A;  2LNT A;  1O8W A;  3HZ8 A;  1A0F A;  1JZR A;  2PVQ A;  4PUF C;  1DE1 A;  1QFN A;  3ZFB A;  1SKR B;  2M46 A;  1U88 A;  3VK9 A;  1MDJ A;  1LJR A;  3LQ7 A;  2F51 A;  3BCI A;  4BVY A;  2AV4 A;  1TRV A;  4TVE A;  1ZL9 A;  5DAK B;  1GTA A;  4KA0 A;  4EKZ A;  5EY6 A;  3HVS A;  2OE0 A;  2HSM A;  5IOX A;  1ZYQ B;  1G0T A;  3GKX A;  5B8B A;  3BBY A;  1A2M A;  1PD2 1;  3APQ A;  3HJM A;  3KMN A;  1E6B A;  2LQQ A;  2WB9 A;  1ABA A;  4WBR D;  4LMW A;  2A4V A;  5A4V A;  3GKN A;  4L5O A;  1XCC A;  2VCW A;  5D8I A;  2B5E A;  1BQ7 A;  4KCA A;  2J9H A;  4ECC A;  4MZW A;  2FD3 A;  2E2M A;  3WT2 A;  2L6C A;  4WXT A;  3APS A;  4WR5 A;  5CO3 A;  3QAW A;  2HZE A;  6GSX A;  3QMX A;  2H71 A;  10GS A;  2JAC A;  3S9F A;  3CRT A;  5DAL A;  2HYX A;  3BD2 A;  3I69 A;  2PBJ A;  2G0F A;  2L5O A;  3F8U A;  5KN1 A;  2DML A;  1SK0 A;  2TRC P;  3GH6 A;  5G5F A;  1NHY A;  4ULX A;  1G7E A;  1JFU A;  4X1U A;  1Z3E A;  1R5P A;  2H73 A;  1F3B A;  3HYP A;  2CZ2 A;  3D4M A;  1XVW A;  1B4P A;  1K0C A;  1ZZY A;  4DEJ A;  1H75 A;  1SK1 A;  4ZBB A;  2IIY A;  2EIR A;  1OVN A;  2I1U A;  5CP1 A;  2FLS A;  1W4V A;  1ON4 A;  2N5A A;  3MAK A;  1TI1 A;  2PPT A;  2O85 A;  4N0Z A;  3H8Q A;  1R7H A;  1EV4 A;  1EV9 A;  3DML A;  2R2J A;  3DGQ A;  3UAP A;  1XOB A;  1QK8 A;  5DJL A;  2LST A;  4PQ1 A;  3US3 A;  1VF3 A;  1T3B A;  3FK8 A;  2YWN A;  1HQO A;  5D93 A;  2DKI A;  2JAD A;  2VO4 A;  4KSM A;  5IM9 A;  3F3Q A;  4EE0 A;  2HRF A;  3C71 A;  2VM2 A;  1A0R P;  4IN0 A;  3A2W A;  4TR0 A;  4V1A g;  3KH7 A;  2F9S A;  2LNS A;  4HQZ A;  2AB6 A;  4MLY A;  2VM1 A;  1PKW A;  2DJ2 A;  4I2T A;  2R37 A;  2CX3 A;  1AAZ A;  5J41 A;  4N10 A;  1XVQ A;  1X9W B;  4F03 A;  5J5N A;  4ICY A;  3DKS A;  3C1R A;  3D0Z A;  2QA1 A;  3DVX A;  3P8W A;  4IJI A;  1T7P B;  2V6O A;  5J3R A;  2O8V B;  1X9S B;  1UVZ A;  2KUC A;  3C73 A;  3N5O A;  1GH2 A;  2YNX A;  2IPA A;  1VF1 A;  4YQM A;  4OMV A;  1F6M C;  3WD6 A;  1XW9 A;  3GA4 A;  5G2Z A;  3F0I A;  4O92 A;  1UN2 A;  4IVF A;  3TKP A;  1TI3 A;  3WGE A;  3GL3 A;  3F4T A;  4FO5 A;  4K7N A;  5D96 A;  4HS1 A;  2DC5 A;  1TOF A;  1KTE A;  5HQP A;  4OWY A;  2CA8 A;  5ELA A;  2OBI A;  5J9C A;  4E8E A;  4MF6 A;  2R3X A;  4BPY A;  1R26 A;  4DSS B;  2P5R A;  2LEG A;  2NPB A;  1BAY A;  1YEX A;  1GTB A;  4JZQ A;  2IFQ A;  3TUE A;  6GSY A;  1GL8 A;  2H66 A;  1SU9 A;  4I6X A;  3ME8 A;  1FG4 A;  2FA4 A;  2LRN A;  1M2A A;  2P31 A;  4PNG A;  5B7C A;  2RII A;  5HFK A;  5EPF A;  5H5S A;  1YF0 A;  3IV4 A;  2RUE A;  2HRN A;  1B48 A;  1XWB A;  5CNW A;  5ECP B;  1ZYP A;  2VLU A;  2OA7 A;  1MDI A;  1JLW A;  4JE1 A;  4K2D A;  2B5Y A;  1B4Q A;  3ERG A;  1ML6 A;  3QR6 A;  2YCD A;  5HR1 A;  1MDK A;  4E8H A;  3UIW A;  5BRT A;  4K8M A;  4LA1 A;  5G5E A;  4MK3 A;  4XS4 A;  3IA1 A;  3ERF A;  3ME7 A;  4ZL8 A;  3G7I A;  4X43 A;  2ZNM A;  3IE3 A;  1JHB A;  4XS6 A;  4NHW A;  2YZH A;  2LRC A;  4IEL A;  5CYY A;  2MZC A;  1PGT A;  4HUA A;  5BMU A;  4KSO A;  2H30 A;  4FYC A;  3LYP A;  2GSR A;  5EL8 A;  4PUA A;  1ERW A;  2IMD A;  1K0D A;  1YJ6 A;  2EC4 A;  4F9Z A;  3RAZ A;  4ZBD A;  2K6V A;  1IYI A;  4PNF A;  4GSN A;  4KH7 A;  2E0Q A;  2QC7 A;  3FW2 A;  1XWC A;  2REM A;  2AJQ B;  1XW6 A;  1USB A;  3TKS A;  1A23 A;  3VI5 A;  4GSS A;  3KH9 A;  1FO5 A;  2PMT A;  2TRX A;  3TOT A;  3DWV A;  3P7X A;  3D21 A;  4L5L A;  2V2G A;  1X5C A;  3CRU A;  2PVO C;  4O5Q A;  4TXO A;  5LD0 A;  1O81 A;  2C0F A;  2RLI A;  3TJK A;  1ERV A;  1SYR A;  3GUS A;  19GS A;  4GF0 A;  5KEJ A;  1B8X A;  2FNO A;  4K7O A;  4KAE A;  1HYU A;  1SEN A;  2XPD A;  3GV1 A;  4MMM A;  5IMF A;  4KUN A;  1OC9 B;  2HT9 A;  3M3M A;  1NM3 A;  2HNL A;  3UL3 A;  2GVP A;  3GKK A;  1WWJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...