4ZL8A

Crystal structure of pseudomonas aeruginosa dsba e82i: crystal ii
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
187
structure length
187
Chain Sequence
DYTAGKEYVELSSPVPVSQPGKIEVVELFWYGCPHCYAFEPTIVPWSEKLPADVHFVRLPALFGGIWNVHGQMFLTLISMGVEHDVHNAVFEAIHKEHKKLATPEEMADFLAGKGVDKEKFLSTYNSFAIKGQMEKAKKLAMAYQVTGVPTMVVNGKYRFDIGSAGGPEETLKLADYLIEKERAAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thiol:disulfide interchange protein DsbA
publication title Sent packing: protein engineering generates a new crystal form of Pseudomonas aeruginosa DsbA1 with increased catalytic surface accessibility.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 63
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2015-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4zl8A00
2OE0A 2JU5A 3HA9A 3GL3A 3C73A 1ACVA 1U3IA 4KX4A 3HXSA 4YAVA 2B1KA 4JR6A 1EWXA 3VWXA 4FYUA 1YDKA 4K2DA 5IOXA 2V2GA 2HZEB 5F06A 1FHEA 2HE3A 2HRFA 3A5WA 3GHAA 1PL2A 4L8EA 1DE2A 1NW2A 4IELA 4MZWA 1WIKA 2I9HA 4K7NA 2V32A 5DQSA 2I3YA 3TKSA 3RAZA 4GSSA 11GSA 2HZFA 3IBHA 5IMCA 1UA5A 16GSA 3SWLA 1ZOFA 2GSRA 2DJ3A 2H1BA 3LYKA 4OO4A 5J9BA 4EF0A 2IMFA 3LSZA 4I97A 4WEYA 2NDOA 4PX1A 1GULA 5B8AA 5B6MA 1TDIA 2CT6A 3ZFLA 1ERWA 3C8EA 5EY6A 4GWRA 2LQQA 4NV2A 3F9UA 4PQIA 2OE3A 1K0OA 1GUHA 5HR2A 5DAKA 2JZRA 3MNGA 4V1Ag 2YN1A 2K6VA 14GSA 1USBA 2C0GA 3QD9A 3TCOA 5IO2A 3UJ1A 1A0RP 5IQYA 2N5BA 1PKZA 3IK9A 4DVCA 2WCIA 2KOKA 2LNTA 1GNWA 3CSJA 3GRXA 3DEXA 4V1Ap 1OC9A 3DMLA 1IYHA 4K7OA 3G7IA 2I1UA 3GN3A 1CQGA 2TIRA 3F3QA 4QL9A 1XVWA 1XOBA 1F6MC 4EDYA 4DEJA 2K8VA 2VCZA 4F03A 1LU4A 4KCEA 4POLA 5A4UA 3ZIJA 2H66A 4JEDA 1DE1A 2AYTA 1PX6A 2VD1A 3L9SA 1B4PA 5J41A 1GSQA 2O87A 4RQRA 1OKTA 1YQ1A 2XPEA 3M8NA 3DIEA 5FHIA 3D4MA 3WGDA 1XZOA 1F3AA 4ZB8A 6GSVA 1Q98A 3V1WA 3EURA 1SJZA 1T3BA 4IW9A 5FT3A 4F82A 5CP1A 4GSTA 4V2LA 3LXTA 1YF0A 4NPBA 2VCTA 3TJKA 3W8JA 2OJLA 3RDWA 1MD4A 5DCGA 1HNCA 4Q5QA 4KAEA 2VLVA 1G7EA 1BYEA 2JACA 2FLSA 4IVFA 1XW9A 5ECKB 1NSWA 3C71A 3IA1A 2IN3A 3ZMLA 5ECSA 4POMA 2CZ3A 2L4CA 2GDRA 5J9CA 1ERTA 2XBQA 3PH9A 2O7KA 2LEGA 3FZ4A 1QUWA 3H4KA 4ZBBA 2V41A 1PX7A 2VO4A 2VCQA 5B7CA 1A24A 4YH2A 3HYPA 4RI7A 2B3SA 6GSTA 3KP8A 2YWMA 2EIRA 4BL7A 1YKAA 3FRCA 3LXZA 1VGLA 5D9TA 5CRWA 3TKQA 3I9V2 1OAZA 4NHWA 1JLVA 1W89A 4ISDA 1V98A 2GS3A 1GH2A 1FB6A 5GSTA 1M2DA 4TXVA 1W4VA 1H75A 3Q18A 1GTIA 1U3AA 1TK5B 2RUFA 3BBYA 1K3OA 3HVVA 2LRCA 2P0GA 4QQ7A 3QAGA 1DSBA 5IM9A 3L9VA 4MPGA 2G2QA 3QFBC 1ILOA 3IPZA 2ZNMA 2RM6A 5D9XA 4OFTA 3KTBA 4HZ4A 1TI1A 4L0UA 17GSA 2R3XA 4NAXA 2K18A 5HR3A 5CYYA 5D9VA 2GZYA 5CRGA 4ML1A 1O85A 2MMZA 3H93A 2LUSA 4KB3A 5EVOA 3UBLA 3N5OA 3UEMA 5B8BA 4MPFA 3GKKA 3GSTA 4OWYA 3VLNA 2CZ2A 4KDUA 4MF6A 3QCPA 1GUMA 2OE1A 3CBUA 1PKWA 2VCVA 3HJPA 3GURA 2L59A 4HQSA 1I9DA 1UVZA 1EZKA 5J4UA 1SK0A 3TJFA 3CTGA 4I5QA 1SD8A 3GUSA 1SK2A 1YEXA 2LJRA 2IFQA 2OADA 1K0CA 4L0WA 5ECQB 3BJ5A 4ZIJA 4XTSA 2B7KA 1BJXA 3EYTA 1ZMAA 1URMA 3HKRA 1UN2A 2KLXA 3APSA 3EMXA 1J0FA 4FYCA 2PBJA 4AJ8A 1GSFA 4ZL7A 1AXDA 2C80A 2MMAA 5JCGA 2VM1A 3GKNA 4OCFA 4JRRA 3E9JB 4CDOA 3FZ9A 2HZEA 4GQFA 1FVKA 2LKUA 5DQYA 3KMOA 1TJDA 3M9KA 2HT9A 1XIYA 1H4OA 3FR6A 3FK8A 2PVQA 2QSIA 1M9AA 1TP9A 5DJLA 3RHCA 3RPPA 3TDGA 1ZZYA 1S3DA 1ZYQB 2DIZA 5DVBA 1XWKA 2FD3A 3QR6A 5H5RA 3WGXA 3P90A 2AAWA 4F0CA 1PD21 2C1YA 4KDXA 1QFNA 1NHOA 2VLTA 1JHBA 2IMEA 2JZTA 2LRTA 1GSYA 3DWVA 3UAPA 5F07A 2FA8A 1ZGNA 2QC7A 1JZDA 4FH8A 4K8MA 3GSSA 3LYPA 1A23A 3GTUA 2FWGA 3GL5A 4HJMA 4XS4A 1BQ7A 3BCIA 1F9MA 2YV9A 3VWUA 1X9MB 1A2JA 4JE1A 4ZXGA 3TOTA 1ABAA 1SKSB 2B6MA 5ECOB 1WRYA 3VWWA 4GCIA 3L0HA 2XPDA 1T4YA 3GNJA 5F8BA 2YWOA 1SKWB 4HS1A 5LNKe 1EP8A 2O8VB 3F4RA 3EU4A 1OE8A 2FCHA 3NIVA 4YQMA 2F8AA 4TOPA 3KH7A 2HXKA 4G2EA 4X0XA 2EIQA 2H6YA 1GL8A 3UOMA 3TGZA 3KH9A 1Z7PA 4MMMA 4IHUA 3GH6A 2V6KA 1OC3A 3TUEA 2PVOC 1OVNA 4PURA 4IN0A 2HRNA 4ID0A 4L5OA 3DVWA 2YCDA 4MJEA 3P7XA 2C3QA 3G9BA 2R4VA 5G1LA 4JZQA 3VURA 3FZ5A 2DLXA 1B8XA 2MBSA 1M2AA 1F3BA 1SU9A 2GQLA 1O8XA 4O32A 1R5AA 5ECIB 4AJ6A 3ED3A 4O7HA 3IRAA 4TN8A 4TR1A 4N0VA 4ECCA 4HI7A 4IQ1A 1TI3A 3ZRDA 3ZVJA 5COHA 4MZCA 3CTFA 1FVJA 2WZ9A 1XWGA 1WWJA 3S9FA 2LQOA 2L5OA 1JFUA 5CRDA 3I43A 4DSSA 1G0TA 5A4WA 1VF2A 2F51A 3QOUA 4LMVA 3CXGA 2WS2A 2IJYA 2GQMA 4N10A 3UIWA 4KNDA 2M80A 1XPVA 2FWHA 2AHEA 2MZCA 2GSTA 3F3RA 1T8EB 1VF3A 1THOA 1VF1A 4AJ7A 1YEPA 5KN3A 4WF5A 5EL8A 1PSQA 2X8HA 3L4NA 5F05A 3WT2A 4IBPA 2IMKA 3TOUA 2YZHA 4D73A 3CRTA 1F2EA 4IP6A 4OD7A 4TVEA 4ACSA 2CVDA 3TKPA 2PPTA 4X43A 2DJ0A 5ID2B 3O6TA 2DMMA 3ZLPA 1Q4JA 5G30A 2HSHA 3HZ8A 4KSMA 2C3NA 2FWEA 4GTUA 1T4ZA 3WGEA 1EEMA 1TRSA 5L71A 2E0QA 2OBIA 3IAM2 2CVBA 2XHFA 1XW5A 1BG5A 3KJYA 5AN1A 2FGXA 5LCZA 2JSZA 4MF5A 3LQ7A 5ECRB 3WD6A 4IS0A 3ZITA 3FR3A 2PGTA 4LA1A 2LSTA 2P31A 2REMA 3A2XA 2PUKC 2R6KA 2JADA 4FYBA 3KMNA 3HVSA 3GA4A 4ZBAA 4G10A 2L57A 1WPIA 3IOSA 2ZUPA 4TR4A 1B9XC 4PGTA 1EGRA 4EL1A 1FW1A 4K7IA 2H8LA 3ZYWA 2B1LA 2WJUA 3KGKA 3U6VA 1G6YA 1Y25A 1GWCA 1MDIA 1OKDA 1Y6EA 4MLYA 5AIXA 2J23A 2X8GA 3APQA 2GT5A 4MZBA 4HZ2A 2M72A 3H8QA 4LL4B 2C3TA 5ECHB 3FHKA 3FYGA 3HY2A 2RM5A 3TKSE 2BMXA 5CREA 3KEBA 2H76A 2HSYA 2DC5A 4QL7A 3W6GA 1O8WA 3GH9A 5CAXA 2V6OA 3US3A 2H0GA 4RUVA 1JZRA 3C1SA 2DJ2A 5G5EA 1ZYEA 2F8FA 1SL1B 2GVPA 5DALA 5JWQB 3GX8A 3D22A 5H5SA 5HR0A 3IE3A 3Q19A 5J5NA 4TR3A 4NXIA 3MDKA 1XW6A 2KP2A 1XBSA 2CA8A 6GSYA 5ELGA 5ABRA 1ST9A 2A2SA 3Q74A 2YWIA 4GQCA 2P5QA 3LG6A 4ML6A 4X1UA 2R37A 4BWSA 3F4SA 5IPHA 2C8UA 4WBRD 4KGIA 1CQHA 1SJ6A 2QGVA 4ECBA 2G0FA 2DJKA 1TTZA 4N0ZA 3TJJA 3NOFA 1A0FA 3KXOA 1UC7A 1R26A 5GAND 3N9JA 1DUGA 1SENA 1J9BA 4OMVA 1OC9B 1MDKA 5FWGA 2VIMA 2VL3A 3WT1A 1S3AA 2VD0A 5ECMB 4N11A 1RQMA 4POBA 5IMDA 2I4AA 1YJ6A 3ME8A 2C0FA 3RPNA 2RUEA 2HLSA 2KUCA 4ECJA 3AY8A 4NHZA 1GSSA 3HJMA 2K8SA 2OBKA 9GSSA 2HYXA 1O73A 2ON7A 3F6DA 3ERWA 2OACA 2XBIA 4IJIA 5KN0A 1YY7A 4K0GA 2PU9C 1X5DA 4O92A 3F0IA 2H19A 4MF7A 1ERUA 2YJ7A 3GX0A 4ULXA 4LL1B 2ZCTA 3L9UA 2YPMA 1PQNA 1SYXA 2L6CA 2E2MA 3VI5A 4I8BA 3ZFBA 4HDEA 2YZUA 6GSSA 5CRHA 3O3TA 2WRTA 4TXOB 1Z7RA 2ON5A 2DJJA 1NHYA 3A3TA 1TRVA 1TK8B 2YNXA 4IGJA 1WMJA 4XHMA 5AIVA 5A4VA 3SBCA 4YQVA 1QMVA 1TRWA 2HFDA 1X0RA 3D0ZA 2LTKA 2YANA 3ME7A 1GTUA 4K0NA 1GUKA 2HI7A 3K8NA 1IYIA 4HUAA 1QXHA 2VLUA 3UBKA 4CHSA 1AW9A 3CSHA 1XWAA 3VK9A 1Z6NA 5GAPD 3M0FA 3IAS2 2FWFA 4JR4A 2DBCA 3WYWA 2VOCA 2GSSA 3F4TA 1YKCA 3TB2A 1ZCPA 1GLQA 1X9WB 2GQKA 2AJQB 1DBYA 3UL3A 6GSUA 1MDJA 2I81A 1ZL9A 4F9ZA 1B48A 3FKFA 1C72A 3EMPA 4HQZA 1O7UA 3E0UA 3FR9A 4ZBDA 1KNGA 1B9YC 1LBKA 1A2MA 3FEUA 1X5EA 5ECNB 4J57E 3M9JA 1PGTA 4EVMA 1OC8A 1V40A 1PA3A 2GSQA 2L4QA 1O81A 4MK3A 3O76A 5GSSA 2LJAA 4E8HA 1EOHA 1QQ2A 4AGSA 2YP6A 2N5AA 1SL2B 3LFLA 3MAKA 4BVYA 3FY7A 5IMVA 3D21A 1TKDB 4J2FA 3ZREA 3PINA 2CX4A 3A2WA 2FY6A 1T1VA 3QAWA 5AISA 2PMTA 4I2UA 1WOUA 1F37A 4XRAA 5EPFA 3KIJA 2Z9SA 1V2AA 5DJMA 3F8UA 2V1MA 3M3MA 5IMFA 1XVQA 5JCUA 4TR0A 1KBNA 1LJRA 1MTCA 4IJ3A 3TRQA 3UARA 3RBTA 1V9WA 1S3CA 1MEKA 1ERVA 2X99A 2YWNA 5D73A 4Q5FA 4WR5A 1TK0B 5IMZA 4MJAA 2H6ZA 1G6WA 3KTLA 1QK8A 4XRDA 3BD2A 2FHEA 1WJKA 2CVKA 4NMUA 2IMIA 1HD2A 2OKAA 12GSA 5B6NA 1K3YA 5CO3A 2IFQB 5D93A 3GMFA 1AQWA 1GTAA 1RW1A 4NV5A 13GSA 3GV1A 1XOAA 4MP4A 2H72A 2IIYA 4MJBA 1N2AA 5JCWA 3J7Yk 4JU5A 3PGTA 2LNSA 1EOGA 2OA7A 2A2RA 2RIIA 18GSA 3UVHA 1XCCA 1XWBA 1JZOA 1EP7A 4MABA 4KE3A 4HJ2A 1AC1A 22GSA 2PN8A 1B4QA 3EWLA 3IV4A 2BTOT 3NZNA 1E2YA 3HHVA 1GNEA 5JWOB 1PRXA 1R4WA 1U88A 2AV4A 1M9BA 1K0AA 5D9WA 2KHPA 5ECPB 19GSA 5HFKA 1ML6A 4OCEA 2CAIA 2M46A 2EC4A 2J9HA 4PUFC 2WB9A 1K0NA 2ES7A 3GKXA 4ILFA 5E59A 3ISOA 1EGOA 1TOFA 1XFLA 5G1KA 2AUVA 4EUYA 1YF1A 2H6XA 2VL2C 2MMNA 5IOWA 2YJHA 3UVTA 1I5GA 3F63A 3DD3A 4IQAA 1HQOA 3EE2A 4P3YB 5ENUA 1AAZA 3PR8A 3IR4A 3HD5A 2H71A 2L6DA 1AUCA 3G7YA 2P5RA 3VI7A 3GTUB 2IMDA 3MWHA 2H1DA 4XS4B 4LMWA 1FO5A 1FG4A 3VFIA 1GSEA 4FIWA 5HFGA 5AGYA 1SKRB 1G7OA 2DSAA 4ZL9A 5IMAA 4NWYA 4HEA2 3QDNA 2MMOA 1FAAA 2TRCP 3KZQA 2JSYA 1FOVA 1V57A 3I69A 5HR1A 3IC4A 1TRUA 3BCKA 3DVXA 3DRNA 1RK4A 1T00A 3ZZXA 3C7MA 3TJGA 2WFCA 5KEJA 5G5FA 3D4TA 2PERA 3LEFA 4BPYA 1X5CA 3IK7A 1SJIA 4F0BA 4PNGA 4FO5A 5HQPA 1A2LA 3LGCA 2GZPA 3GKMA 2CQ9A 4L5LA 2NPBA 3HCZA 2H01A 1EEJA 4EE0A 3GYKA 3FZAA 2NVLA 2MBTA 1TXXA 1GSDA 4N30A 4WETA 2LS5A 1AQXA 2VCWA 4TR1B 2LRNA 2QKEA 4WF4A 1K3LA 1U6TA 4Q5NA 3JCML 5J3RA 2C0DA 2O85A 4WKWA 2NTOA 1EV4A 1HNBA 2B7JA 1WE0A 4Q5RA 3CMIA 4DSSB 1TW9A 4TXOA 2IL3A 4MCUA 3GIXA 3ERFA 2DMLA 3HVXA 2GLRA 2KP1A 4EC0A 5C00A 4WR4A 3J7Yb 3C1RA 4DSQA 4PQ1A 4I6XA 3DYRA 4PQHA 1ON4A 2JZSA 2N5FA 5INYA 3P8WA 4IKHA 3LORA 2L5LA 4BWQA 2VCXA 2VL2A 1TU7A 4D73B 4XCSA 4XS1A 4KUNA 1KEBA 2F9SA 2IPAA 1SK1A 3CYNA 1GRXA 3IXRA 5DBQA 1VF4A 3D6IA 3HZ4A 5KN1A 4V2NA 5DAKB 7GSSA 6GSWA 3QPMA 2H30A 4I2TA 1FB0A 1MD3A 1JLWA 1BAYA 3U5RE 4XS6A 3LWAA 4DSRA 1PL1A 4G9HA 1AIUA 1WP0A 2H0HA 4ZL8A 1YZXA 2WULA 5H5QA 4MH3A 3QMXA 4J56E 1T7PB 4RI6A 5E4WA 4TRXA 2VUPA 1NM3A 2CAQA 4AF2A 1HYUA 3QAVA 2R5GA 6GSXA 2EIOA 5DDLA 4BA7A 3HDCA 4XIHA 5CNWA 4EXJA 2AB6A 2B5EA 1HNAA 4K1FA 1VRSD 4EO3A 3KM6A 4LLRA 5G2ZA 4TKYA 3IHQA 1M7TA 2FNOA 1V58A 2H70A 2H74A 1R7HA 3VPTA 2YOIA 1O6JA 3ERGA 1SL0B 1JZWA 5F0GA 3TJBA 3KCMA 2CX3A 3L78A 2A4VA 3ZL5A 5ELAA 3APOA 4O5RA 1GTBA 2GTUA 5GZZB 3KD0A 1EV9A 3EC3A 3UMAA 4K6XA 4WBJA 1TU8A 2H1GA 4ZB6A 1K0BA 1Z9HA 4MDCA 4G19A 2C4JA 1AQVA 2CV4A 2VL9A 4YAPA 2LJKA 2ALBA 4GF0A 3TKRA 3CRUA 2B5YA 1K0DA 2TRXA 5JWRB 2YV7A 2VAFA 4Z7XA 3H1NA 4KDYA 2FUG2 1A8LA 4F2IA 2H0IA 1XWCA 3E3EA 4KH7A 4MA9A 2GT6A 2H75A 4KSOA 4GRFA 4ECIA 4RQXA 1J08A 4POKA 3QFAC 4KCAA 3W8SA 5DALB 3H79A 1M2BA 1K0MA 2LV3A 3HJOA 4TW5A 1THXA 4BVXA 3ZIVA 4OO5A 4PXOA 1KTEA 4V2MA 2DJ1A 2GZZA 5A5KA 4YQUA 4HU7A 5D96A 5G31A 1GP1A 2D2ZA 4PNFA 4ZILA 2X64A 3Q6OA 2E7PA 3TKSC 3DKSA 4OFNA 2NBSA 1GSUA 2WDUA 3I6AA 1E6BA 1R5PA 5LD0A 1U87A 4PUAA 1QGVA 4JBBA 2GGTA 2WGRA 5ECLB 2FA4A 3M1GA 5KN2A 3F6FA 3MSZA 2MYGA 3VPQA 8GSSA 3R2QA 2PWJA 3ZTLA 3LJRA 1SYRA 1PMTA 2VM2A 5IO0A 2B5XA 2F3MA 4CW9A 1Z6MA 5ID2A 3EU3A 4GLTA 20GSA 3TRXA 4KW6A 2JL4A 1GLPA 2R2JA 3D5JA 4IP1A 4WXTA 4ZB9A 4HU9A 3KP9A 1X9SB 5D8IA 5C04A 1SD9A 1PN9A 2RLIA 4HOJA 1XXUA 4EDZA 3ZVJD 4GXZA 3EVIA 2C0EA 3GFKA 3IDVA 2XC2A 1M0UA 4H86A 4EKZA 2K9FA 5IIZA 2H1AA 4K9ZA 10GSA 1BX9A 3ZMKA 3A2VA 1Z3EA 4MH2A 1BEDA 2H73A 3EINA 3BOAA 3P2AA 4KA0A 2O89A 5IPGA 1OE7A 1A8YA 5HFIA 3G7JA 2HNLA 1M99A 1N8JA 3OR5A 3RHBA 3VWVA 2DIYA 4MJCA 5DCHA 3DGQA 2E2GA 3TRPA 1Z5YE 3FW2A 3DXBA 3CSIA 4OFMA 1OYJA 2IWTA 4GSNA 2BJXA 4E8EA 2X8CA
chains in the Genus database with same CATH superfamily
2OE0A 2JU5A 3HA9A 3GL3A 3C73A 1ACVA 1U3IA 4KX4A 3HXSA 4YAVA 2B1KA 4JR6A 1EWXA 3VWXA 4FYUA 1YDKA 4K2DA 5IOXA 2HSMA 2HZEB 2V2GA 5F06A 1FHEA 2HE3A 4USSA 2HRFA 3A5WA 3GHAA 1PL2A 4L8EA 1DE2A 1NW2A 4IELA 4MZWA 1WIKA 2I9HA 4K7NA 2V32A 5DQSA 2I3YA 3TKSA 3RAZA 4GSSA 11GSA 2HZFA 3IBHA 5IMCA 1UA5A 5KOWA 16GSA 3SWLA 1ZOFA 2GSRA 2DJ3A 2H1BA 3LYKA 4OO4A 5J9BA 4EF0A 2IMFA 3LSZA 4A5PA 4I97A 4WEYA 2NDOA 4PX1A 1GULA 5B8AA 4CY8A 5B6MA 1TDIA 4ICYA 2CT6A 3ZFLA 1ERWA 3C8EA 5EY6A 4GWRA 2LQQA 4NV2A 3F9UA 4HSCX 4PQIA 2OE3A 1K0OA 1GUHA 5HR2A 5DAKA 2JZRA 3MNGA 4V1Ag 2YN1A 2K6VA 14GSA 1USBA 2C0GA 3QD9A 3TCOA 5IO2A 3UJ1A 1A0RP 5IQYA 2N5BA 1PKZA 3IK9A 4DVCA 2WCIA 2KOKA 2LNTA 1GNWA 3CSJA 3GRXA 2A2PA 3DEXA 4V1Ap 1OC9A 3DMLA 1IYHA 4K7OA 3G7IA 2I1UA 3GN3A 1CQGA 2TIRA 3F3QA 4QL9A 1XVWA 1XOBA 1F6MC 4EDYA 4DEJA 2K8VA 2VCZA 4F03A 1LU4A 4KCEA 4POLA 5A4UA 3ZIJA 2H66A 4JEDA 1DE1A 2AYTA 1PX6A 2VD1A 3L9SA 1B4PA 5J41A 1GSQA 2O87A 4RQRA 1OKTA 1YQ1A 2XPEA 3M8NA 3DIEA 5FHIA 3D4MA 3WGDA 1XZOA 1F3AA 4ZB8A 6GSVA 2R0GA 1Q98A 3V1WA 3EURA 1SJZA 1T3BA 4IW9A 5FT3A 4F82A 5CP1A 4GSTA 4V2LA 3LXTA 1YF0A 4NPBA 2VCTA 3TJKA 3W8JA 2OJLA 3RDWA 1MD4A 5DCGA 1HNCA 4Q5QA 4KAEA 2VLVA 1G7EA 1BYEA 2JACA 2FLSA 4IVFA 1XW9A 5ECKB 1NSWA 3C71A 3IA1A 2IN3A 3ZMLA 5ECSA 4POMA 2CZ3A 4EIPA 2L4CA 2GDRA 5J9CA 1ERTA 2XBQA 3PH9A 2O7KA 3CQFA 2LEGA 3FZ4A 1QUWA 3H4KA 4ZBBA 2V41A 1PX7A 2VO4A 2VCQA 5B7CA 1A24A 2UZ8A 4YH2A 3HYPA 4RI7A 2B3SA 6GSTA 3KP8A 2YWMA 2EIRA 4BL7A 1YKAA 3FRCA 3LXZA 1VGLA 5D9TA 5CRWA 3TKQA 3FMWA 3I9V2 1OAZA 4NHWA 1JLVA 1W89A 4ISDA 1V98A 2GS3A 1GH2A 1FB6A 5GSTA 1M2DA 4TXVA 1W4VA 1H75A 3Q18A 1GTIA 1U3AA 4FQUA 1TK5B 2RUFA 3HVNA 3BBYA 1K3OA 3HVVA 2LRCA 2P0GA 4QQ7A 3QAGA 1DSBA 5IM9A 3L9VA 4MPGA 2G2QA 3QFBC 1ILOA 3IPZA 2ZNMA 2RM6A 5D9XA 4OFTA 3KTBA 4HZ4A 1TI1A 4L0UA 17GSA 3LW9A 2R3XA 4NAXA 2K18A 5HR3A 5CYYA 5D9VA 2GZYA 5CRGA 4ML1A 1O85A 2MMZA 3H93A 2LUSA 4KB3A 5EVOA 3UBLA 4EIQA 3N5OA 3UEMA 5B8BA 4MPFA 3GKKA 3GSTA 4OWYA 3VLNA 2CZ2A 4KDUA 4MF6A 3QCPA 4X4JA 1GUMA 2OE1A 3CBUA 3PPUA 1PKWA 2VCVA 3HJPA 3GURA 2L59A 4HQSA 1I9DA 1UVZA 1EZKA 5J4UA 1SK0A 3TJFA 3CTGA 4I5QA 1SD8A 3GUSA 4G0LA 1SK2A 1YEXA 2LJRA 2IFQA 2OADA 1K0CA 4L0WA 2X49A 5ECQB 3BJ5A 4ZIJA 4XTSA 2R0PA 2B7KA 1BJXA 3EYTA 1ZMAA 1URMA 3HKRA 1UN2A 2KLXA 3APSA 3EMXA 1J0FA 4FYCA 2PBJA 4AJ8A 1GSFA 4ZL7A 1AXDA 2C80A 2MMAA 5JCGA 2VM1A 3GKNA 4OCFA 4JRRA 3E9JB 4CDOA 3FZ9A 2HZEA 4GQFA 1FVKA 2LKUA 5DQYA 3KMOA 1TJDA 3M9KA 2HT9A 1XIYA 1H4OA 3FR6A 3FK8A 2PVQA 2QSIA 1M9AA 1TP9A 5DJLA 3RHCA 3RPPA 3TDGA 1ZZYA 1S3DA 1ZYQB 2DIZA 5DVBA 1XWKA 2FD3A 3QR6A 5H5RA 3WGXA 3P90A 2AAWA 4F0CA 1PD21 2C1YA 4KDXA 1QFNA 1NHOA 2VLTA 1JHBA 2IMEA 2JZTA 2LRTA 1GSYA 3DWVA 3UAPA 5F07A 2FA8A 1ZGNA 2QC7A 1JZDA 4FH8A 4K8MA 3GSSA 3LYPA 1A23A 3GTUA 2FWGA 3GL5A 4HJMA 4XS4A 1BQ7A 3BCIA 1F9MA 2YV9A 3VWUA 1X9MB 1A2JA 4JE1A 4ZXGA 3TOTA 1ABAA 1SKSB 2B6MA 5ECOB 1WRYA 3VWWA 4GCIA 3L0HA 2XPDA 1T4YA 3GNJA 5F8BA 2YWOA 1SKWB 4HS1A 5LNKe 1EP8A 1S3RA 2O8VB 3F4RA 3EU4A 1OE8A 2FCHA 3NIVA 4YQMA 2F8AA 4TOPA 3KH7A 2HXKA 4G2EA 4X0XA 2EIQA 2H6YA 1GL8A 3UOMA 1PN0A 3TGZA 3KH9A 1Z7PA 4MMMA 4IHUA 3GH6A 2V6KA 1OC3A 3TUEA 2PVOC 1OVNA 4PURA 4IN0A 2HRNA 4ID0A 4L5OA 3DVWA 2YCDA 4MJEA 3P7XA 2C3QA 3G9BA 2R4VA 5G1LA 4JZQA 3VURA 3FZ5A 2DLXA 1B8XA 2MBSA 1M2AA 1F3BA 1SU9A 2GQLA 1O8XA 4O32A 1R5AA 5ECIB 4AJ6A 3ED3A 4O7HA 3IRAA 4TN8A 4TR1A 4N0VA 1ZYPA 4ECCA 4HI7A 4IQ1A 1TI3A 3ZRDA 3ZVJA 5COHA 4MZCA 3CTFA 1FVJA 2WZ9A 1XWGA 1WWJA 3S9FA 2LQOA 2L5OA 1JFUA 5CRDA 3I43A 4DSSA 1G0TA 5A4WA 1VF2A 2F51A 3QOUA 4LMVA 3CXGA 2WS2A 2IJYA 2GQMA 4N10A 3UIWA 4KNDA 2M80A 1XPVA 2FWHA 2AHEA 2MZCA 2GSTA 3F3RA 1T8EB 1VF3A 1THOA 1VF1A 4AJ7A 1YEPA 5KN3A 4WF5A 5EL8A 1PSQA 2X8HA 3L4NA 5F05A 3WT2A 4IBPA 2IMKA 3IHGA 3TOUA 2YZHA 4D73A 3CRTA 1F2EA 4IP6A 4OD7A 4TVEA 4ACSA 2CVDA 3TKPA 2PPTA 4X43A 2DJ0A 4BVYB 5ID2B 3O6TA 2DMMA 1XG8A 3ZLPA 4O5UA 1Q4JA 5G30A 2HSHA 3HZ8A 4KSMA 2C3NA 2FWEA 4GTUA 1T4ZA 3WGEA 1EEMA 1TRSA 5L71A 2E0QA 2OBIA 3IAM2 2CVBA 2XHFA 1XW5A 1BG5A 3KJYA 2FGXA 5AN1A 5LCZA 2JSZA 4MF5A 3LQ7A 5ECRB 3WD6A 4IS0A 3ZITA 3FR3A 2PGTA 4LA1A 2LSTA 2P31A 2REMA 3A2XA 2PUKC 2R6KA 2JADA 4FYBA 3KMNA 3HVSA 3GA4A 4ZBAA 4G10A 2L57A 1WPIA 3IOSA 2ZUPA 4TR4A 4PGTA 1B9XC 1EGRA 4EL1A 1FW1A 4K7IA 2H8LA 3ZYWA 2B1LA 2WJUA 3KGKA 3U6VA 1G6YA 1Y25A 1GWCA 1MDIA 1OKDA 4K5SA 1Y6EA 4MLYA 5AIXA 2J23A 2X8GA 4CY6A 3APQA 2GT5A 4MZBA 4HZ2A 2M72A 3H8QA 4LL4B 2C3TA 5ECHB 3FHKA 3FYGA 3HY2A 2RM5A 3TKSE 2BMXA 5CREA 3KEBA 2H76A 2HSYA 1M3JA 2DC5A 4QL7A 3W6GA 1O8WA 3GH9A 5CAXA 2V6OA 3US3A 2H0GA 4RUVA 1JZRA 3C1SA 2DJ2A 5G5EA 1ZYEA 2F8FA 1SL1B 2GVPA 5DALA 5JWQB 3GX8A 3D22A 5H5SA 5HR0A 3IE3A 3Q19A 5J5NA 4TR3A 4NXIA 3MDKA 1XW6A 2KP2A 1XBSA 2CA8A 6GSYA 5ELGA 5ABRA 1ST9A 2A2SA 3Q74A 2YWIA 4GQCA 2P5QA 3LG6A 4ML6A 4X1UA 2R37A 4BWSA 3F4SA 5IPHA 2C8UA 4WBRD 4KGIA 4Z2UA 1CQHA 1SJ6A 2QGVA 4ECBA 2G0FA 2DJKA 1TTZA 4N0ZA 3TJJA 3NOFA 1A0FA 3KXOA 1UC7A 1R26A 5GAND 3N9JA 1DUGA 1SENA 1J9BA 4OMVA 1OC9B 1MDKA 5FWGA 2VIMA 2VL3A 3WT1A 1S3AA 2VD0A 5ECMB 4N11A 1RQMA 4POBA 5IMDA 2I4AA 1YJ6A 3ME8A 2C0FA 3RPNA 2RUEA 2HLSA 2KUCA 4ECJA 3AY8A 4NHZA 1GSSA 3HJMA 2K8SA 2OBKA 9GSSA 2HYXA 1O73A 2ON7A 3F6DA 3ERWA 2OACA 2XBIA 4IJIA 5KN0A 1YY7A 4K0GA 2PU9C 1X5DA 4O92A 3F0IA 2H19A 4MF7A 1ERUA 2YJ7A 3GX0A 4ULXA 4LL1B 2ZCTA 3L9UA 2YPMA 1PQNA 1SYXA 2L6CA 2E2MA 3VI5A 4I8BA 3ZFBA 4HDEA 2YZUA 3R3EA 6GSSA 5CRHA 3O3TA 2WRTA 4TXOB 1Z7RA 4YKFA 2ON5A 2DJJA 1NHYA 3A3TA 1TRVA 1TK8B 2YNXA 4IGJA 1WMJA 4XHMA 5AIVA 5A4VA 3SBCA 4YQVA 1QMVA 1TRWA 2HFDA 1X0RA 3D0ZA 2LTKA 2YANA 3ME7A 1GTUA 4K0NA 1GUKA 2QA1A 2HI7A 3K8NA 1IYIA 4HUAA 1QXHA 2VLUA 3UBKA 4CHSA 1AW9A 3CSHA 1XWAA 3VK9A 1Z6NA 5GAPD 3M0FA 4KF9A 3IAS2 2FWFA 4JR4A 2DBCA 3WYWA 2VOCA 2GSSA 3F4TA 1YKCA 3TB2A 1ZCPA 1GLQA 1X9WB 2GQKA 2AJQB 1DBYA 3UL3A 6GSUA 1MDJA 2I81A 1ZL9A 4F9ZA 1PFOA 1B48A 3FKFA 1C72A 3EMPA 4HQZA 1O7UA 3E0UA 3FR9A 4ZBDA 1KNGA 1B9YC 1LBKA 1A2MA 3FEUA 1X5EA 5ECNB 4J57E 3M9JA 1PGTA 4EVMA 2HRAA 1OC8A 1V40A 1PA3A 2GSQA 2L4QA 1O81A 4MK3A 3O76A 5GSSA 2LJAA 4E8HA 4BIKA 1EOHA 1QQ2A 4AGSA 2YP6A 2N5AA 1SL2B 2DKIA 3LFLA 3MAKA 4BVYA 3FY7A 5IMVA 3D21A 1TKDB 4J2FA 3ZREA 3PINA 2CX4A 3A2WA 2FY6A 1T1VA 3QAWA 5AISA 2PMTA 4I2UA 1WOUA 1F37A 4XRAA 5EPFA 3KIJA 2Z9SA 1V2AA 5DJMA 3F8UA 2V1MA 3M3MA 5IMFA 1XVQA 5JCUA 4TR0A 1KBNA 1LJRA 1MTCA 4O5QA 4IJ3A 3TRQA 3UARA 3RBTA 1V9WA 1S3CA 1MEKA 1ERVA 2X99A 2YWNA 5D73A 4Q5FA 4WR5A 1TK0B 5IMZA 4MJAA 2H6ZA 1G6WA 2R0CA 3KTLA 1QK8A 4XRDA 3BD2A 2FHEA 1WJKA 2CVKA 4NMUA 2IMIA 1HD2A 2OKAA 12GSA 5B6NA 1K3YA 5CO3A 2IFQB 5D93A 3GMFA 1AQWA 1GTAA 2A4HA 1RW1A 4NV5A 13GSA 3GV1A 5BRTA 4G0IA 1XOAA 4MP4A 2H72A 2IIYA 4MJBA 1N2AA 5JCWA 3J7Yk 4JU5A 3PGTA 2LNSA 1EOGA 2OA7A 2A2RA 2RIIA 4BVXB 18GSA 3UVHA 1XCCA 1XWBA 1JZOA 1EP7A 4MABA 4KE3A 4HJ2A 1AC1A 22GSA 2PN8A 1B4QA 3EWLA 3IV4A 2BTOT 3NZNA 1E2YA 3HHVA 1GNEA 5JWOB 1PRXA 1R4WA 1U88A 2AV4A 1M9BA 1K0AA 5D9WA 2KHPA 5ECPB 19GSA 5HFKA 1ML6A 4OCEA 2CAIA 2M46A 2EC4A 2J9HA 4PUFC 2WB9A 1K0NA 2ES7A 3GKXA 4ILFA 5E59A 4YKGA 3ISOA 1EGOA 1TOFA 1XFLA 5G1KA 4K2XA 2AUVA 4EUYA 1YF1A 2H6XA 2VL2C 2MMNA 5IOWA 2YJHA 3UVTA 1I5GA 3F63A 3DD3A 4IQAA 1HQOA 3EE2A 4P3YB 5ENUA 1AAZA 3PR8A 3IR4A 3HD5A 2H71A 2L6DA 1AUCA 3G7YA 2P5RA 3VI7A 3GTUB 2IMDA 3MWHA 2H1DA 4XS4B 4LMWA 1FO5A 1FG4A 3VFIA 1GSEA 4FIWA 5HFGA 5AGYA 1SKRB 1G7OA 2DSAA 4ZL9A 5IMAA 4NWYA 4HEA2 3QDNA 2HRKA 2MMOA 1FAAA 2TRCP 3KZQA 2JSYA 1FOVA 1V57A 3I69A 5HR1A 3IC4A 1TRUA 3BCKA 3DVXA 3DRNA 1RK4A 1T00A 3ZZXA 3C7MA 3TJGA 2WFCA 5KEJA 5G5FA 3D4TA 2PERA 3LEFA 4BPYA 1X5CA 3IK7A 1SJIA 1M3IA 4F0BA 4PNGA 4FO5A 5HQPA 1A2LA 3LGCA 2GZPA 3GKMA 2CQ9A 4L5LA 2NPBA 3HCZA 2H01A 1EEJA 4EE0A 3GYKA 3FZAA 2NVLA 2MBTA 1TXXA 1GSDA 4N30A 4WETA 5BMUA 2LS5A 1AQXA 2VCWA 4TR1B 2LRNA 2QKEA 4WF4A 1K3LA 1U6TA 4Q5NA 3JCML 5J3RA 2C0DA 2O85A 4WKWA 2NTOA 1EV4A 1HNBA 2B7JA 1WE0A 4Q5RA 3CMIA 4DSSB 1TW9A 4TXOA 2IL3A 4MCUA 3GIXA 4MNNA 3ERFA 2DMLA 3HVXA 2GLRA 2KP1A 4EC0A 5C00A 2X4AA 4WR4A 3J7Yb 3C1RA 4DSQA 4PQ1A 4I6XA 3DYRA 4PQHA 1ON4A 2JZSA 2N5FA 5INYA 3P8WA 4IKHA 3LORA 2L5LA 4BWQA 2VCXA 2VL2A 1TU7A 4D73B 4XCSA 4XS1A 4KUNA 1KEBA 2F9SA 2IPAA 1SK1A 3CYNA 1GRXA 3IXRA 5DBQA 1VF4A 3D6IA 3HZ4A 5KN1A 4V2NA 5DAKB 7GSSA 6GSWA 3QPMA 4PTSA 2H30A 4I2TA 1FB0A 1MD3A 1JLWA 1BAYA 3U5RE 4XS6A 3LWAA 4DSRA 1PL1A 4G9HA 1AIUA 1WP0A 2H0HA 4ZL8A 1YZXA 2WULA 3MIXA 5H5QA 4MH3A 3QMXA 4J56E 1T7PB 4RI6A 5E4WA 4TRXA 2VUPA 1NM3A 2CAQA 4AF2A 1HYUA 3QAVA 2R5GA 6GSXA 2EIOA 5DDLA 4BA7A 3HDCA 4XIHA 5CNWA 4EXJA 2AB6A 2B5EA 1HNAA 4K1FA 1VRSD 4EO3A 3KM6A 4LLRA 5G2ZA 4TKYA 3IHQA 1M7TA 2FNOA 4Z2TA 1V58A 2H70A 2H74A 1R7HA 3VPTA 2YOIA 1O6JA 3ERGA 1SL0B 1JZWA 5F0GA 3TJBA 3KCMA 2CX3A 3L78A 2A4VA 3ZL5A 5ELAA 3APOA 4O5RA 1GTBA 2GTUA 5GZZB 3KD0A 1EV9A 3EC3A 3UMAA 4G0KA 4K6XA 4WBJA 1TU8A 2H1GA 4ZB6A 1K0BA 1Z9HA 4MDCA 4G19A 2C4JA 1AQVA 2CV4A 2VL9A 4YAPA 2LJKA 2ALBA 4GF0A 3TKRA 3CRUA 2B5YA 1K0DA 2TRXA 5JWRB 2YV7A 5KOXA 2VAFA 4Z7XA 3H1NA 4KDYA 2FUG2 1A8LA 4F2IA 2H0IA 1XWCA 3E3EA 4KH7A 4MA9A 2GT6A 3MYDA 2H75A 4KSOA 4GRFA 4Z2RA 4ECIA 4RQXA 1J08A 4POKA 3QFAC 4KCAA 3W8SA 5DALB 3H79A 1M2BA 1K0MA 2LV3A 3HJOA 4TW5A 1THXA 4BVXA 3ZIVA 4PXOA 4OO5A 1KTEA 4V2MA 2DJ1A 2GZZA 5A5KA 3A5IA 3EPTA 4YQUA 4HU7A 5D96A 5G31A 1GP1A 2D2ZA 4PNFA 4ZILA 2X64A 3Q6OA 2E7PA 3TKSC 3DKSA 4OFNA 2NBSA 1GSUA 2DKHA 4BL7B 2WDUA 3I6AA 1E6BA 1R5PA 5LD0A 1U87A 4PUAA 1QGVA 1ZYNA 4JBBA 2GGTA 2WGRA 5ECLB 2FA4A 3M1GA 5KN2A 3F6FA 3MSZA 2MYGA 3VPQA 8GSSA 3R2QA 2PWJA 3ZTLA 3LJRA 1SYRA 1PMTA 2VM2A 5IO0A 2B5XA 2F3MA 4CW9A 1Z6MA 5ID2A 3EU3A 4GLTA 20GSA 3TRXA 4KW6A 2JL4A 1GLPA 2R2JA 3D5JA 4IP1A 4WXTA 4ZB9A 4HU9A 3KP9A 1X9SB 5D8IA 5C04A 1SD9A 2QA2A 1PN9A 2RLIA 4HOJA 1XXUA 4EDZA 1FOHA 3ZVJD 4GXZA 3EVIA 2C0EA 3GFKA 3IDVA 2XC2A 1M0UA 4H86A 4EKZA 2K9FA 5IIZA 2H1AA 4K9ZA 10GSA 1BX9A 3ZMKA 3A2VA 1Z3EA 4MH2A 1BEDA 2H73A 3EINA 3BOAA 3P2AA 4KA0A 2O89A 5IPGA 1OE7A 1A8YA 5HFIA 3G7JA 2HNLA 1M99A 1N8JA 3OR5A 3RHBA 3VWVA 2DIYA 4MJCA 5DCHA 3DGQA 2E2GA 3TRPA 1Z5YE 3FW2A 3DXBA 4K5RA 3CSIA 3IC8A 4OFMA 1OYJA 2IWTA 4GSNA 2BJXA 4E8EA 2X8CA
chains in the Genus database with same CATH topology
2OE0A 2JU5A 3HA9A 3GL3A 3C73A 1ACVA 1U3IA 4KX4A 3HXSA 4YAVA 2B1KA 4JR6A 1EWXA 3VWXA 4FYUA 1YDKA 4K2DA 5IOXA 2HSMA 2HZEB 2V2GA 5F06A 1FHEA 2HE3A 4USSA 2HRFA 3A5WA 3GHAA 1PL2A 4L8EA 1DE2A 1NW2A 4IELA 4MZWA 1WIKA 2I9HA 4K7NA 2V32A 5DQSA 2I3YA 3TKSA 3RAZA 4GSSA 11GSA 2HZFA 3IBHA 5IMCA 1UA5A 5KOWA 16GSA 3SWLA 1ZOFA 2GSRA 2DJ3A 2H1BA 3LYKA 4OO4A 5J9BA 4EF0A 2IMFA 3LSZA 4A5PA 4I97A 4WEYA 2NDOA 4PX1A 1GULA 5B8AA 4CY8A 5B6MA 1TDIA 4ICYA 2CT6A 3ZFLA 1ERWA 3C8EA 5EY6A 4GWRA 2LQQA 4NV2A 3F9UA 4PQIA 2OE3A 1K0OA 1GUHA 5HR2A 5DAKA 2JZRA 3MNGA 4V1Ag 2YN1A 2K6VA 14GSA 1USBA 2C0GA 3QD9A 3TCOA 5IO2A 3UJ1A 1A0RP 5IQYA 2N5BA 1PKZA 3IK9A 4DVCA 2WCIA 2KOKA 2LNTA 1GNWA 3CSJA 3GRXA 2A2PA 3DEXA 4V1Ap 1OC9A 3DMLA 1IYHA 4K7OA 3G7IA 2I1UA 3GN3A 1CQGA 2TIRA 3F3QA 4QL9A 1XVWA 1XOBA 1F6MC 4EDYA 4DEJA 2K8VA 2VCZA 4F03A 1LU4A 4KCEA 4POLA 5A4UA 3ZIJA 2H66A 4JEDA 1DE1A 2AYTA 1PX6A 2VD1A 3L9SA 1B4PA 5J41A 1GSQA 2O87A 4RQRA 1OKTA 1YQ1A 2XPEA 3M8NA 3DIEA 5FHIA 3D4MA 3WGDA 1XZOA 1F3AA 4ZB8A 6GSVA 2R0GA 1Q98A 3V1WA 3EURA 1SJZA 1T3BA 4IW9A 5FT3A 4F82A 5CP1A 4GSTA 4V2LA 3LXTA 1YF0A 4NPBA 2VCTA 3TJKA 3W8JA 2OJLA 3RDWA 1MD4A 5DCGA 1HNCA 4Q5QA 4KAEA 2VLVA 1G7EA 1BYEA 2JACA 2FLSA 4IVFA 1XW9A 5ECKB 1NSWA 3C71A 3IA1A 2IN3A 3ZMLA 5ECSA 4POMA 2CZ3A 4EIPA 2L4CA 2GDRA 5J9CA 1ERTA 2XBQA 3PH9A 2O7KA 2LEGA 3FZ4A 1QUWA 3H4KA 4ZBBA 2V41A 1PX7A 2VO4A 2VCQA 5B7CA 1A24A 2UZ8A 4YH2A 3HYPA 4RI7A 2B3SA 6GSTA 3KP8A 2YWMA 2EIRA 4BL7A 1YKAA 3FRCA 3LXZA 1VGLA 5D9TA 5CRWA 3TKQA 3FMWA 3I9V2 1OAZA 4NHWA 1JLVA 1W89A 4ISDA 1V98A 2GS3A 1GH2A 1FB6A 5GSTA 1M2DA 4TXVA 1W4VA 1H75A 3Q18A 1GTIA 1U3AA 4FQUA 1TK5B 2RUFA 3BBYA 1K3OA 3HVVA 2LRCA 2P0GA 4QQ7A 3QAGA 1DSBA 5IM9A 3L9VA 4MPGA 2G2QA 3QFBC 1ILOA 3IPZA 2ZNMA 2RM6A 5D9XA 4OFTA 3KTBA 4HZ4A 1TI1A 4L0UA 17GSA 3LW9A 2R3XA 4NAXA 2K18A 5HR3A 5CYYA 5D9VA 2GZYA 5CRGA 4ML1A 1O85A 2MMZA 3H93A 2LUSA 4KB3A 5EVOA 3UBLA 4EIQA 3N5OA 3UEMA 5B8BA 4MPFA 3GKKA 3GSTA 4OWYA 3VLNA 2CZ2A 4KDUA 4MF6A 3QCPA 4X4JA 1GUMA 2OE1A 3CBUA 3PPUA 1PKWA 2VCVA 3HJPA 3GURA 2L59A 4HQSA 1I9DA 1UVZA 1EZKA 5J4UA 1SK0A 3TJFA 3CTGA 4I5QA 1SD8A 3GUSA 4G0LA 1SK2A 1YEXA 2LJRA 2IFQA 2OADA 1K0CA 4L0WA 2X49A 5ECQB 3BJ5A 4ZIJA 4XTSA 2R0PA 2B7KA 1BJXA 3EYTA 1ZMAA 1URMA 3HKRA 1UN2A 2KLXA 3APSA 3EMXA 1J0FA 4FYCA 2PBJA 4AJ8A 1GSFA 4ZL7A 1AXDA 2C80A 2MMAA 5JCGA 2VM1A 3GKNA 4OCFA 4JRRA 3E9JB 4CDOA 3FZ9A 2HZEA 4GQFA 1FVKA 2LKUA 5DQYA 3KMOA 1TJDA 3M9KA 2HT9A 1XIYA 1H4OA 3FR6A 3FK8A 2PVQA 2QSIA 1M9AA 1TP9A 5DJLA 3RHCA 3RPPA 3TDGA 1ZZYA 1S3DA 1ZYQB 2DIZA 5DVBA 1XWKA 2FD3A 3QR6A 5H5RA 3WGXA 3P90A 2AAWA 4F0CA 1PD21 2C1YA 4KDXA 1QFNA 1NHOA 2VLTA 1JHBA 2IMEA 2JZTA 2LRTA 1GSYA 3DWVA 3UAPA 5F07A 2FA8A 1ZGNA 2QC7A 1JZDA 4FH8A 4K8MA 3GSSA 3LYPA 1A23A 3GTUA 2FWGA 3GL5A 4HJMA 4XS4A 1BQ7A 3BCIA 1F9MA 2YV9A 3VWUA 1X9MB 1A2JA 4JE1A 4ZXGA 3TOTA 1ABAA 1SKSB 2B6MA 5ECOB 1WRYA 3VWWA 4GCIA 3L0HA 2XPDA 1T4YA 3GNJA 5F8BA 2YWOA 1SKWB 4HS1A 5LNKe 1EP8A 2O8VB 3F4RA 3EU4A 1OE8A 2FCHA 3NIVA 4YQMA 2F8AA 4TOPA 3KH7A 2HXKA 4G2EA 4X0XA 2EIQA 2H6YA 1GL8A 3UOMA 1PN0A 3TGZA 3KH9A 1Z7PA 4MMMA 4IHUA 3GH6A 2V6KA 1OC3A 3TUEA 2PVOC 1OVNA 4PURA 4IN0A 2HRNA 4ID0A 4L5OA 3DVWA 2YCDA 4MJEA 3P7XA 2C3QA 3G9BA 2R4VA 5G1LA 4JZQA 3VURA 3FZ5A 2DLXA 1B8XA 2MBSA 1M2AA 1F3BA 1SU9A 2GQLA 1O8XA 4O32A 1R5AA 5ECIB 4AJ6A 3ED3A 4O7HA 3IRAA 4TN8A 4TR1A 4N0VA 1ZYPA 4ECCA 4HI7A 4IQ1A 1TI3A 3ZRDA 3ZVJA 5COHA 4MZCA 3CTFA 1FVJA 2WZ9A 1XWGA 1WWJA 3S9FA 2LQOA 2L5OA 1JFUA 5CRDA 3I43A 4DSSA 1G0TA 5A4WA 1VF2A 2F51A 3QOUA 4LMVA 3CXGA 2WS2A 2IJYA 2GQMA 4N10A 3UIWA 4KNDA 2M80A 1XPVA 2FWHA 2AHEA 2MZCA 2GSTA 3F3RA 1T8EB 1VF3A 1THOA 1VF1A 4AJ7A 1YEPA 5KN3A 4WF5A 5EL8A 1PSQA 2X8HA 3L4NA 5F05A 3WT2A 4IBPA 2IMKA 3IHGA 3TOUA 2YZHA 4D73A 3CRTA 1F2EA 4IP6A 4OD7A 4TVEA 4ACSA 2CVDA 3TKPA 2PPTA 4X43A 2DJ0A 4BVYB 5ID2B 3O6TA 2DMMA 3ZLPA 4O5UA 1Q4JA 5G30A 2HSHA 3HZ8A 4KSMA 2C3NA 2FWEA 4GTUA 1T4ZA 3WGEA 1EEMA 1TRSA 5L71A 2E0QA 2OBIA 3IAM2 2CVBA 2XHFA 1XW5A 1BG5A 3KJYA 2FGXA 5AN1A 5LCZA 2JSZA 4MF5A 3LQ7A 5ECRB 3WD6A 4IS0A 3ZITA 3FR3A 2PGTA 4LA1A 2LSTA 2P31A 2REMA 3A2XA 2PUKC 2R6KA 2JADA 4FYBA 3KMNA 3HVSA 3GA4A 4ZBAA 4G10A 2L57A 1WPIA 3IOSA 2ZUPA 4TR4A 4PGTA 1B9XC 1EGRA 4EL1A 1FW1A 4K7IA 2H8LA 3ZYWA 2B1LA 2WJUA 3KGKA 3U6VA 1G6YA 1Y25A 1GWCA 1MDIA 1OKDA 4K5SA 1Y6EA 4MLYA 5AIXA 2J23A 2X8GA 4CY6A 3APQA 2GT5A 4MZBA 4HZ2A 2M72A 3H8QA 4LL4B 2C3TA 5ECHB 3FHKA 3FYGA 3HY2A 2RM5A 3TKSE 2BMXA 5CREA 3KEBA 2H76A 2HSYA 2DC5A 4QL7A 3W6GA 1O8WA 3GH9A 5CAXA 2V6OA 3US3A 2H0GA 4RUVA 1JZRA 3C1SA 2DJ2A 5G5EA 1ZYEA 2F8FA 1SL1B 2GVPA 5DALA 5JWQB 3GX8A 3D22A 5H5SA 5HR0A 3IE3A 3Q19A 5J5NA 4TR3A 4NXIA 3MDKA 1XW6A 2KP2A 1XBSA 2CA8A 6GSYA 5ELGA 5ABRA 1ST9A 2A2SA 3Q74A 2YWIA 4GQCA 2P5QA 3LG6A 4ML6A 4X1UA 2R37A 4BWSA 3F4SA 5IPHA 2C8UA 4WBRD 4KGIA 4Z2UA 1CQHA 1SJ6A 2QGVA 4ECBA 2G0FA 2DJKA 1TTZA 4N0ZA 3TJJA 3NOFA 1A0FA 3KXOA 1UC7A 1R26A 5GAND 3N9JA 1DUGA 1SENA 1J9BA 4OMVA 1OC9B 1MDKA 5FWGA 2VIMA 2VL3A 3WT1A 1S3AA 2VD0A 5ECMB 4N11A 1RQMA 4POBA 5IMDA 2I4AA 1YJ6A 3ME8A 2C0FA 3RPNA 2RUEA 2HLSA 2KUCA 4ECJA 3AY8A 4NHZA 1GSSA 3HJMA 2K8SA 2OBKA 9GSSA 2HYXA 1O73A 2ON7A 3F6DA 3ERWA 2OACA 2XBIA 4IJIA 5KN0A 1YY7A 4K0GA 2PU9C 1X5DA 4O92A 3F0IA 2H19A 4MF7A 1ERUA 2YJ7A 3GX0A 4ULXA 4LL1B 2ZCTA 3L9UA 2YPMA 1PQNA 1SYXA 2L6CA 2E2MA 3VI5A 4I8BA 3ZFBA 4HDEA 2YZUA 3R3EA 6GSSA 5CRHA 3O3TA 2WRTA 4TXOB 1Z7RA 4YKFA 2ON5A 2DJJA 1NHYA 3A3TA 1TRVA 1TK8B 2YNXA 4IGJA 1WMJA 4XHMA 5AIVA 5A4VA 3SBCA 4YQVA 1QMVA 1TRWA 2HFDA 1X0RA 3D0ZA 2LTKA 2YANA 3ME7A 1GTUA 4K0NA 1GUKA 2QA1A 2HI7A 3K8NA 1IYIA 4HUAA 1QXHA 2VLUA 3UBKA 4CHSA 1AW9A 3CSHA 1XWAA 3VK9A 1Z6NA 5GAPD 3M0FA 4KF9A 3IAS2 2FWFA 4JR4A 2DBCA 3WYWA 2VOCA 2GSSA 3F4TA 1YKCA 3TB2A 1ZCPA 1GLQA 1X9WB 2GQKA 2AJQB 1DBYA 3UL3A 6GSUA 1MDJA 2I81A 1ZL9A 4F9ZA 1B48A 3FKFA 1C72A 3EMPA 4HQZA 1O7UA 3E0UA 3FR9A 4ZBDA 1KNGA 1B9YC 1LBKA 1A2MA 3FEUA 1X5EA 5ECNB 4J57E 3M9JA 1PGTA 4EVMA 2HRAA 1OC8A 1V40A 1PA3A 2GSQA 2L4QA 1O81A 4MK3A 3O76A 5GSSA 2LJAA 4E8HA 1EOHA 1QQ2A 4AGSA 2YP6A 2N5AA 1SL2B 2DKIA 3LFLA 3MAKA 4BVYA 3FY7A 5IMVA 3D21A 1TKDB 4J2FA 3ZREA 3PINA 2CX4A 3A2WA 2FY6A 1T1VA 3QAWA 5AISA 2PMTA 4I2UA 1WOUA 1F37A 4XRAA 5EPFA 3KIJA 2Z9SA 1V2AA 5DJMA 3F8UA 2V1MA 3M3MA 5IMFA 1XVQA 5JCUA 4TR0A 1KBNA 1LJRA 1MTCA 4O5QA 4IJ3A 3TRQA 3UARA 3RBTA 1V9WA 1S3CA 1MEKA 1ERVA 2X99A 2YWNA 5D73A 4Q5FA 4WR5A 1TK0B 5IMZA 4MJAA 2H6ZA 1G6WA 2R0CA 3KTLA 1QK8A 4XRDA 3BD2A 2FHEA 1WJKA 2CVKA 4NMUA 2IMIA 1HD2A 2OKAA 12GSA 5B6NA 1K3YA 5CO3A 2IFQB 5D93A 3GMFA 1AQWA 1GTAA 2A4HA 1RW1A 4NV5A 13GSA 3GV1A 5BRTA 4G0IA 1XOAA 4MP4A 2H72A 2IIYA 4MJBA 1N2AA 5JCWA 3J7Yk 4JU5A 3PGTA 2LNSA 1EOGA 2OA7A 2A2RA 2RIIA 4BVXB 18GSA 3UVHA 1XCCA 1XWBA 1JZOA 1EP7A 4MABA 4KE3A 4HJ2A 1AC1A 22GSA 2PN8A 1B4QA 3EWLA 3IV4A 2BTOT 3NZNA 1E2YA 3HHVA 1GNEA 5JWOB 1PRXA 1R4WA 1U88A 2AV4A 1M9BA 1K0AA 5D9WA 2KHPA 5ECPB 19GSA 5HFKA 1ML6A 4OCEA 2CAIA 2M46A 2EC4A 2J9HA 4PUFC 2WB9A 1K0NA 2ES7A 3GKXA 4ILFA 5E59A 4YKGA 3ISOA 1EGOA 1TOFA 1XFLA 5G1KA 4K2XA 2AUVA 4EUYA 1YF1A 2H6XA 2VL2C 2MMNA 5IOWA 2YJHA 3UVTA 1I5GA 3F63A 3DD3A 4IQAA 1HQOA 3EE2A 4P3YB 5ENUA 1AAZA 3PR8A 3IR4A 3HD5A 2H71A 2L6DA 1AUCA 3G7YA 2P5RA 3VI7A 3GTUB 2IMDA 3MWHA 2H1DA 4XS4B 4LMWA 1FO5A 1FG4A 3VFIA 1GSEA 4FIWA 5HFGA 5AGYA 1SKRB 1G7OA 2DSAA 4ZL9A 5IMAA 4NWYA 4HEA2 3QDNA 2HRKA 2MMOA 1FAAA 2TRCP 3KZQA 2JSYA 1FOVA 1V57A 3I69A 5HR1A 3IC4A 1TRUA 3BCKA 3DVXA 3DRNA 1RK4A 1T00A 3ZZXA 3C7MA 3TJGA 2WFCA 5KEJA 5G5FA 3D4TA 2PERA 3LEFA 4BPYA 1X5CA 3IK7A 1SJIA 4F0BA 4PNGA 4FO5A 5HQPA 1A2LA 3LGCA 2GZPA 3GKMA 2CQ9A 4L5LA 2NPBA 3HCZA 2H01A 1EEJA 4EE0A 3GYKA 3FZAA 2NVLA 2MBTA 1TXXA 1GSDA 4N30A 4WETA 5BMUA 2LS5A 1AQXA 2VCWA 4TR1B 2LRNA 2QKEA 4WF4A 1K3LA 1U6TA 4Q5NA 3JCML 5J3RA 2C0DA 2O85A 4WKWA 2NTOA 1EV4A 1HNBA 2B7JA 1WE0A 4Q5RA 3CMIA 4DSSB 1TW9A 4TXOA 2IL3A 4MCUA 3GIXA 4MNNA 3ERFA 2DMLA 3HVXA 2GLRA 2KP1A 4EC0A 5C00A 2X4AA 4WR4A 3J7Yb 3C1RA 4DSQA 4PQ1A 4I6XA 3DYRA 4PQHA 1ON4A 2JZSA 2N5FA 5INYA 3P8WA 4IKHA 3LORA 2L5LA 4BWQA 2VCXA 2VL2A 1TU7A 4D73B 4XCSA 4XS1A 4KUNA 1KEBA 2F9SA 2IPAA 1SK1A 3CYNA 1GRXA 3IXRA 5DBQA 1VF4A 3D6IA 3HZ4A 5KN1A 4V2NA 5DAKB 7GSSA 6GSWA 3QPMA 4PTSA 2H30A 4I2TA 1FB0A 1MD3A 1JLWA 1BAYA 3U5RE 4XS6A 3LWAA 4DSRA 1PL1A 4G9HA 1AIUA 1WP0A 2H0HA 4ZL8A 1YZXA 2WULA 3MIXA 5H5QA 4MH3A 3QMXA 4J56E 1T7PB 4RI6A 5E4WA 4TRXA 2VUPA 1NM3A 2CAQA 4AF2A 1HYUA 3QAVA 2R5GA 6GSXA 2EIOA 5DDLA 4BA7A 3HDCA 4XIHA 5CNWA 4EXJA 2AB6A 2B5EA 1HNAA 4K1FA 1VRSD 4EO3A 3KM6A 4LLRA 5G2ZA 4TKYA 3IHQA 1M7TA 2FNOA 4Z2TA 1V58A 2H70A 2H74A 1R7HA 3VPTA 2YOIA 1O6JA 3ERGA 1SL0B 1JZWA 5F0GA 3TJBA 3KCMA 2CX3A 3L78A 2A4VA 3ZL5A 5ELAA 3APOA 4O5RA 1GTBA 2GTUA 5GZZB 3KD0A 1EV9A 3EC3A 3UMAA 4G0KA 4K6XA 4WBJA 1TU8A 2H1GA 4ZB6A 1K0BA 1Z9HA 4MDCA 4G19A 2C4JA 1AQVA 2CV4A 2VL9A 4YAPA 2LJKA 2ALBA 4GF0A 3TKRA 3CRUA 2B5YA 1K0DA 2TRXA 5JWRB 2YV7A 5KOXA 2VAFA 4Z7XA 3H1NA 4KDYA 2FUG2 1A8LA 4F2IA 2H0IA 1XWCA 3E3EA 4KH7A 4MA9A 2GT6A 3MYDA 2H75A 4KSOA 4GRFA 4Z2RA 4ECIA 4RQXA 1J08A 4POKA 3QFAC 4KCAA 3W8SA 5DALB 3H79A 1M2BA 1K0MA 2LV3A 3HJOA 4TW5A 1THXA 4BVXA 3ZIVA 4PXOA 4OO5A 1KTEA 4V2MA 2DJ1A 2GZZA 5A5KA 3A5IA 3EPTA 4YQUA 4HU7A 5D96A 5G31A 1GP1A 2D2ZA 4PNFA 4ZILA 2X64A 3Q6OA 2E7PA 3TKSC 3DKSA 4OFNA 2NBSA 1GSUA 2DKHA 4BL7B 2WDUA 3I6AA 1E6BA 1R5PA 5LD0A 1U87A 4PUAA 1QGVA 1ZYNA 4JBBA 2GGTA 2WGRA 5ECLB 2FA4A 3M1GA 5KN2A 3F6FA 3MSZA 2MYGA 3VPQA 8GSSA 3R2QA 2PWJA 3ZTLA 3LJRA 1SYRA 1PMTA 2VM2A 5IO0A 2B5XA 2F3MA 4CW9A 1Z6MA 5ID2A 3EU3A 4GLTA 20GSA 3TRXA 4KW6A 2JL4A 1GLPA 2R2JA 3D5JA 4IP1A 4WXTA 4ZB9A 4HU9A 3KP9A 1X9SB 5D8IA 5C04A 1SD9A 2QA2A 1PN9A 2RLIA 4HOJA 1XXUA 4EDZA 1FOHA 3ZVJD 4GXZA 3EVIA 2C0EA 3GFKA 3IDVA 2XC2A 1M0UA 4H86A 4EKZA 2K9FA 5IIZA 2H1AA 4K9ZA 10GSA 1BX9A 3ZMKA 3A2VA 1Z3EA 4MH2A 1BEDA 2H73A 3EINA 3BOAA 3P2AA 4KA0A 2O89A 5IPGA 1OE7A 1A8YA 5HFIA 3G7JA 2HNLA 1M99A 1N8JA 3OR5A 3RHBA 3VWVA 2DIYA 4MJCA 5DCHA 3DGQA 2E2GA 3TRPA 1Z5YE 3FW2A 3DXBA 4K5RA 3CSIA 3IC8A 4OFMA 1OYJA 2IWTA 4GSNA 2BJXA 4E8EA 2X8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OE0 A;  2JU5 A;  3HA9 A;  3GL3 A;  3C73 A;  1ACV A;  1U3I A;  4KX4 A;  3HXS A;  4YAV A;  2B1K A;  4JR6 A;  1EWX A;  3VWX A;  4FYU A;  1YDK A;  4K2D A;  5IOX A;  2V2G A;  2HZE B;  5F06 A;  1FHE A;  2HE3 A;  2HRF A;  3A5W A;  3GHA A;  1PL2 A;  4L8E A;  1DE2 A;  1NW2 A;  4IEL A;  4MZW A;  1WIK A;  2I9H A;  4K7N A;  2V32 A;  5DQS A;  2I3Y A;  3TKS A;  3RAZ A;  4GSS A;  11GS A;  2HZF A;  3IBH A;  5IMC A;  1UA5 A;  16GS A;  3SWL A;  1ZOF A;  2GSR A;  2DJ3 A;  2H1B A;  3LYK A;  4OO4 A;  5J9B A;  4EF0 A;  2IMF A;  3LSZ A;  4I97 A;  4WEY A;  2NDO A;  4PX1 A;  1GUL A;  5B8A A;  5B6M A;  1TDI A;  2CT6 A;  3ZFL A;  1ERW A;  3C8E A;  5EY6 A;  4GWR A;  2LQQ A;  4NV2 A;  3F9U A;  4PQI A;  2OE3 A;  1K0O A;  1GUH A;  5HR2 A;  5DAK A;  2JZR A;  3MNG A;  4V1A g;  2YN1 A;  2K6V A;  14GS A;  1USB A;  2C0G A;  3QD9 A;  3TCO A;  5IO2 A;  3UJ1 A;  1A0R P;  5IQY A;  2N5B A;  1PKZ A;  3IK9 A;  4DVC A;  2WCI A;  2KOK A;  2LNT A;  1GNW A;  3CSJ A;  3GRX A;  3DEX A;  4V1A p;  1OC9 A;  3DML A;  1IYH A;  4K7O A;  3G7I A;  2I1U A;  3GN3 A;  1CQG A;  2TIR A;  3F3Q A;  4QL9 A;  1XVW A;  1XOB A;  1F6M C;  4EDY A;  4DEJ A;  2K8V A;  2VCZ A;  4F03 A;  1LU4 A;  4KCE A;  4POL A;  5A4U A;  3ZIJ A;  2H66 A;  4JED A;  1DE1 A;  2AYT A;  1PX6 A;  2VD1 A;  3L9S A;  1B4P A;  5J41 A;  1GSQ A;  2O87 A;  4RQR A;  1OKT A;  1YQ1 A;  2XPE A;  3M8N A;  3DIE A;  5FHI A;  3D4M A;  3WGD A;  1XZO A;  1F3A A;  4ZB8 A;  6GSV A;  1Q98 A;  3V1W A;  3EUR A;  1SJZ A;  1T3B A;  4IW9 A;  5FT3 A;  4F82 A;  5CP1 A;  4GST A;  4V2L A;  3LXT A;  1YF0 A;  4NPB A;  2VCT A;  3TJK A;  3W8J A;  2OJL A;  3RDW A;  1MD4 A;  5DCG A;  1HNC A;  4Q5Q A;  4KAE A;  2VLV A;  1G7E A;  1BYE A;  2JAC A;  2FLS A;  4IVF A;  1XW9 A;  5ECK B;  1NSW A;  3C71 A;  3IA1 A;  2IN3 A;  3ZML A;  5ECS A;  4POM A;  2CZ3 A;  2L4C A;  2GDR A;  5J9C A;  1ERT A;  2XBQ A;  3PH9 A;  2O7K A;  2LEG A;  3FZ4 A;  1QUW A;  3H4K A;  4ZBB A;  2V41 A;  1PX7 A;  2VO4 A;  2VCQ A;  5B7C A;  1A24 A;  4YH2 A;  3HYP A;  4RI7 A;  2B3S A;  6GST A;  3KP8 A;  2YWM A;  2EIR A;  4BL7 A;  1YKA A;  3FRC A;  3LXZ A;  1VGL A;  5D9T A;  5CRW A;  3TKQ A;  3I9V 2;  1OAZ A;  4NHW A;  1JLV A;  1W89 A;  4ISD A;  1V98 A;  2GS3 A;  1GH2 A;  1FB6 A;  5GST A;  1M2D A;  4TXV A;  1W4V A;  1H75 A;  3Q18 A;  1GTI A;  1U3A A;  1TK5 B;  2RUF A;  3BBY A;  1K3O A;  3HVV A;  2LRC A;  2P0G A;  4QQ7 A;  3QAG A;  1DSB A;  5IM9 A;  3L9V A;  4MPG A;  2G2Q A;  3QFB C;  1ILO A;  3IPZ A;  2ZNM A;  2RM6 A;  5D9X A;  4OFT A;  3KTB A;  4HZ4 A;  1TI1 A;  4L0U A;  17GS A;  2R3X A;  4NAX A;  2K18 A;  5HR3 A;  5CYY A;  5D9V A;  2GZY A;  5CRG A;  4ML1 A;  1O85 A;  2MMZ A;  3H93 A;  2LUS A;  4KB3 A;  5EVO A;  3UBL A;  3N5O A;  3UEM A;  5B8B A;  4MPF A;  3GKK A;  3GST A;  4OWY A;  3VLN A;  2CZ2 A;  4KDU A;  4MF6 A;  3QCP A;  1GUM A;  2OE1 A;  3CBU A;  1PKW A;  2VCV A;  3HJP A;  3GUR A;  2L59 A;  4HQS A;  1I9D A;  1UVZ A;  1EZK A;  5J4U A;  1SK0 A;  3TJF A;  3CTG A;  4I5Q A;  1SD8 A;  3GUS A;  1SK2 A;  1YEX A;  2LJR A;  2IFQ A;  2OAD A;  1K0C A;  4L0W A;  5ECQ B;  3BJ5 A;  4ZIJ A;  4XTS A;  2B7K A;  1BJX A;  3EYT A;  1ZMA A;  1URM A;  3HKR A;  1UN2 A;  2KLX A;  3APS A;  3EMX A;  1J0F A;  4FYC A;  2PBJ A;  4AJ8 A;  1GSF A;  4ZL7 A;  1AXD A;  2C80 A;  2MMA A;  5JCG A;  2VM1 A;  3GKN A;  4OCF A;  4JRR A;  3E9J B;  4CDO A;  3FZ9 A;  2HZE A;  4GQF A;  1FVK A;  2LKU A;  5DQY A;  3KMO A;  1TJD A;  3M9K A;  2HT9 A;  1XIY A;  1H4O A;  3FR6 A;  3FK8 A;  2PVQ A;  2QSI A;  1M9A A;  1TP9 A;  5DJL A;  3RHC A;  3RPP A;  3TDG A;  1ZZY A;  1S3D A;  1ZYQ B;  2DIZ A;  5DVB A;  1XWK A;  2FD3 A;  3QR6 A;  5H5R A;  3WGX A;  3P90 A;  2AAW A;  4F0C A;  1PD2 1;  2C1Y A;  4KDX A;  1QFN A;  1NHO A;  2VLT A;  1JHB A;  2IME A;  2JZT A;  2LRT A;  1GSY A;  3DWV A;  3UAP A;  5F07 A;  2FA8 A;  1ZGN A;  2QC7 A;  1JZD A;  4FH8 A;  4K8M A;  3GSS A;  3LYP A;  1A23 A;  3GTU A;  2FWG A;  3GL5 A;  4HJM A;  4XS4 A;  1BQ7 A;  3BCI A;  1F9M A;  2YV9 A;  3VWU A;  1X9M B;  1A2J A;  4JE1 A;  4ZXG A;  3TOT A;  1ABA A;  1SKS B;  2B6M A;  5ECO B;  1WRY A;  3VWW A;  4GCI A;  3L0H A;  2XPD A;  1T4Y A;  3GNJ A;  5F8B A;  2YWO A;  1SKW B;  4HS1 A;  5LNK e;  1EP8 A;  2O8V B;  3F4R A;  3EU4 A;  1OE8 A;  2FCH A;  3NIV A;  4YQM A;  2F8A A;  4TOP A;  3KH7 A;  2HXK A;  4G2E A;  4X0X A;  2EIQ A;  2H6Y A;  1GL8 A;  3UOM A;  3TGZ A;  3KH9 A;  1Z7P A;  4MMM A;  4IHU A;  3GH6 A;  2V6K A;  1OC3 A;  3TUE A;  2PVO C;  1OVN A;  4PUR A;  4IN0 A;  2HRN A;  4ID0 A;  4L5O A;  3DVW A;  2YCD A;  4MJE A;  3P7X A;  2C3Q A;  3G9B A;  2R4V A;  5G1L A;  4JZQ A;  3VUR A;  3FZ5 A;  2DLX A;  1B8X A;  2MBS A;  1M2A A;  1F3B A;  1SU9 A;  2GQL A;  1O8X A;  4O32 A;  1R5A A;  5ECI B;  4AJ6 A;  3ED3 A;  4O7H A;  3IRA A;  4TN8 A;  4TR1 A;  4N0V A;  4ECC A;  4HI7 A;  4IQ1 A;  1TI3 A;  3ZRD A;  3ZVJ A;  5COH A;  4MZC A;  3CTF A;  1FVJ A;  2WZ9 A;  1XWG A;  1WWJ A;  3S9F A;  2LQO A;  2L5O A;  1JFU A;  5CRD A;  3I43 A;  4DSS A;  1G0T A;  5A4W A;  1VF2 A;  2F51 A;  3QOU A;  4LMV A;  3CXG A;  2WS2 A;  2IJY A;  2GQM A;  4N10 A;  3UIW A;  4KND A;  2M80 A;  1XPV A;  2FWH A;  2AHE A;  2MZC A;  2GST A;  3F3R A;  1T8E B;  1VF3 A;  1THO A;  1VF1 A;  4AJ7 A;  1YEP A;  5KN3 A;  4WF5 A;  5EL8 A;  1PSQ A;  2X8H A;  3L4N A;  5F05 A;  3WT2 A;  4IBP A;  2IMK A;  3TOU A;  2YZH A;  4D73 A;  3CRT A;  1F2E A;  4IP6 A;  4OD7 A;  4TVE A;  4ACS A;  2CVD A;  3TKP A;  2PPT A;  4X43 A;  2DJ0 A;  5ID2 B;  3O6T A;  2DMM A;  3ZLP A;  1Q4J A;  5G30 A;  2HSH A;  3HZ8 A;  4KSM A;  2C3N A;  2FWE A;  4GTU A;  1T4Z A;  3WGE A;  1EEM A;  1TRS A;  5L71 A;  2E0Q A;  2OBI A;  3IAM 2;  2CVB A;  2XHF A;  1XW5 A;  1BG5 A;  3KJY A;  5AN1 A;  2FGX A;  5LCZ A;  2JSZ A;  4MF5 A;  3LQ7 A;  5ECR B;  3WD6 A;  4IS0 A;  3ZIT A;  3FR3 A;  2PGT A;  4LA1 A;  2LST A;  2P31 A;  2REM A;  3A2X A;  2PUK C;  2R6K A;  2JAD A;  4FYB A;  3KMN A;  3HVS A;  3GA4 A;  4ZBA A;  4G10 A;  2L57 A;  1WPI A;  3IOS A;  2ZUP A;  4TR4 A;  1B9X C;  4PGT A;  1EGR A;  4EL1 A;  1FW1 A;  4K7I A;  2H8L A;  3ZYW A;  2B1L A;  2WJU A;  3KGK A;  3U6V A;  1G6Y A;  1Y25 A;  1GWC A;  1MDI A;  1OKD A;  1Y6E A;  4MLY A;  5AIX A;  2J23 A;  2X8G A;  3APQ A;  2GT5 A;  4MZB A;  4HZ2 A;  2M72 A;  3H8Q A;  4LL4 B;  2C3T A;  5ECH B;  3FHK A;  3FYG A;  3HY2 A;  2RM5 A;  3TKS E;  2BMX A;  5CRE A;  3KEB A;  2H76 A;  2HSY A;  2DC5 A;  4QL7 A;  3W6G A;  1O8W A;  3GH9 A;  5CAX A;  2V6O A;  3US3 A;  2H0G A;  4RUV A;  1JZR A;  3C1S A;  2DJ2 A;  5G5E A;  1ZYE A;  2F8F A;  1SL1 B;  2GVP A;  5DAL A;  5JWQ B;  3GX8 A;  3D22 A;  5H5S A;  5HR0 A;  3IE3 A;  3Q19 A;  5J5N A;  4TR3 A;  4NXI A;  3MDK A;  1XW6 A;  2KP2 A;  1XBS A;  2CA8 A;  6GSY A;  5ELG A;  5ABR A;  1ST9 A;  2A2S A;  3Q74 A;  2YWI A;  4GQC A;  2P5Q A;  3LG6 A;  4ML6 A;  4X1U A;  2R37 A;  4BWS A;  3F4S A;  5IPH A;  2C8U A;  4WBR D;  4KGI A;  1CQH A;  1SJ6 A;  2QGV A;  4ECB A;  2G0F A;  2DJK A;  1TTZ A;  4N0Z A;  3TJJ A;  3NOF A;  1A0F A;  3KXO A;  1UC7 A;  1R26 A;  5GAN D;  3N9J A;  1DUG A;  1SEN A;  1J9B A;  4OMV A;  1OC9 B;  1MDK A;  5FWG A;  2VIM A;  2VL3 A;  3WT1 A;  1S3A A;  2VD0 A;  5ECM B;  4N11 A;  1RQM A;  4POB A;  5IMD A;  2I4A A;  1YJ6 A;  3ME8 A;  2C0F A;  3RPN A;  2RUE A;  2HLS A;  2KUC A;  4ECJ A;  3AY8 A;  4NHZ A;  1GSS A;  3HJM A;  2K8S A;  2OBK A;  9GSS A;  2HYX A;  1O73 A;  2ON7 A;  3F6D A;  3ERW A;  2OAC A;  2XBI A;  4IJI A;  5KN0 A;  1YY7 A;  4K0G A;  2PU9 C;  1X5D A;  4O92 A;  3F0I A;  2H19 A;  4MF7 A;  1ERU A;  2YJ7 A;  3GX0 A;  4ULX A;  4LL1 B;  2ZCT A;  3L9U A;  2YPM A;  1PQN A;  1SYX A;  2L6C A;  2E2M A;  3VI5 A;  4I8B A;  3ZFB A;  4HDE A;  2YZU A;  6GSS A;  5CRH A;  3O3T A;  2WRT A;  4TXO B;  1Z7R A;  2ON5 A;  2DJJ A;  1NHY A;  3A3T A;  1TRV A;  1TK8 B;  2YNX A;  4IGJ A;  1WMJ A;  4XHM A;  5AIV A;  5A4V A;  3SBC A;  4YQV A;  1QMV A;  1TRW A;  2HFD A;  1X0R A;  3D0Z A;  2LTK A;  2YAN A;  3ME7 A;  1GTU A;  4K0N A;  1GUK A;  2HI7 A;  3K8N A;  1IYI A;  4HUA A;  1QXH A;  2VLU A;  3UBK A;  4CHS A;  1AW9 A;  3CSH A;  1XWA A;  3VK9 A;  1Z6N A;  5GAP D;  3M0F A;  3IAS 2;  2FWF A;  4JR4 A;  2DBC A;  3WYW A;  2VOC A;  2GSS A;  3F4T A;  1YKC A;  3TB2 A;  1ZCP A;  1GLQ A;  1X9W B;  2GQK A;  2AJQ B;  1DBY A;  3UL3 A;  6GSU A;  1MDJ A;  2I81 A;  1ZL9 A;  4F9Z A;  1B48 A;  3FKF A;  1C72 A;  3EMP A;  4HQZ A;  1O7U A;  3E0U A;  3FR9 A;  4ZBD A;  1KNG A;  1B9Y C;  1LBK A;  1A2M A;  3FEU A;  1X5E A;  5ECN B;  4J57 E;  3M9J A;  1PGT A;  4EVM A;  1OC8 A;  1V40 A;  1PA3 A;  2GSQ A;  2L4Q A;  1O81 A;  4MK3 A;  3O76 A;  5GSS A;  2LJA A;  4E8H A;  1EOH A;  1QQ2 A;  4AGS A;  2YP6 A;  2N5A A;  1SL2 B;  3LFL A;  3MAK A;  4BVY A;  3FY7 A;  5IMV A;  3D21 A;  1TKD B;  4J2F A;  3ZRE A;  3PIN A;  2CX4 A;  3A2W A;  2FY6 A;  1T1V A;  3QAW A;  5AIS A;  2PMT A;  4I2U A;  1WOU A;  1F37 A;  4XRA A;  5EPF A;  3KIJ A;  2Z9S A;  1V2A A;  5DJM A;  3F8U A;  2V1M A;  3M3M A;  5IMF A;  1XVQ A;  5JCU A;  4TR0 A;  1KBN A;  1LJR A;  1MTC A;  4IJ3 A;  3TRQ A;  3UAR A;  3RBT A;  1V9W A;  1S3C A;  1MEK A;  1ERV A;  2X99 A;  2YWN A;  5D73 A;  4Q5F A;  4WR5 A;  1TK0 B;  5IMZ A;  4MJA A;  2H6Z A;  1G6W A;  3KTL A;  1QK8 A;  4XRD A;  3BD2 A;  2FHE A;  1WJK A;  2CVK A;  4NMU A;  2IMI A;  1HD2 A;  2OKA A;  12GS A;  5B6N A;  1K3Y A;  5CO3 A;  2IFQ B;  5D93 A;  3GMF A;  1AQW A;  1GTA A;  1RW1 A;  4NV5 A;  13GS A;  3GV1 A;  1XOA A;  4MP4 A;  2H72 A;  2IIY A;  4MJB A;  1N2A A;  5JCW A;  3J7Y k;  4JU5 A;  3PGT A;  2LNS A;  1EOG A;  2OA7 A;  2A2R A;  2RII A;  18GS A;  3UVH A;  1XCC A;  1XWB A;  1JZO A;  1EP7 A;  4MAB A;  4KE3 A;  4HJ2 A;  1AC1 A;  22GS A;  2PN8 A;  1B4Q A;  3EWL A;  3IV4 A;  2BTO T;  3NZN A;  1E2Y A;  3HHV A;  1GNE A;  5JWO B;  1PRX A;  1R4W A;  1U88 A;  2AV4 A;  1M9B A;  1K0A A;  5D9W A;  2KHP A;  5ECP B;  19GS A;  5HFK A;  1ML6 A;  4OCE A;  2CAI A;  2M46 A;  2EC4 A;  2J9H A;  4PUF C;  2WB9 A;  1K0N A;  2ES7 A;  3GKX A;  4ILF A;  5E59 A;  3ISO A;  1EGO A;  1TOF A;  1XFL A;  5G1K A;  2AUV A;  4EUY A;  1YF1 A;  2H6X A;  2VL2 C;  2MMN A;  5IOW A;  2YJH A;  3UVT A;  1I5G A;  3F63 A;  3DD3 A;  4IQA A;  1HQO A;  3EE2 A;  4P3Y B;  5ENU A;  1AAZ A;  3PR8 A;  3IR4 A;  3HD5 A;  2H71 A;  2L6D A;  1AUC A;  3G7Y A;  2P5R A;  3VI7 A;  3GTU B;  2IMD A;  3MWH A;  2H1D A;  4XS4 B;  4LMW A;  1FO5 A;  1FG4 A;  3VFI A;  1GSE A;  4FIW A;  5HFG A;  5AGY A;  1SKR B;  1G7O A;  2DSA A;  4ZL9 A;  5IMA A;  4NWY A;  4HEA 2;  3QDN A;  2MMO A;  1FAA A;  2TRC P;  3KZQ A;  2JSY A;  1FOV A;  1V57 A;  3I69 A;  5HR1 A;  3IC4 A;  1TRU A;  3BCK A;  3DVX A;  3DRN A;  1RK4 A;  1T00 A;  3ZZX A;  3C7M A;  3TJG A;  2WFC A;  5KEJ A;  5G5F A;  3D4T A;  2PER A;  3LEF A;  4BPY A;  1X5C A;  3IK7 A;  1SJI A;  4F0B A;  4PNG A;  4FO5 A;  5HQP A;  1A2L A;  3LGC A;  2GZP A;  3GKM A;  2CQ9 A;  4L5L A;  2NPB A;  3HCZ A;  2H01 A;  1EEJ A;  4EE0 A;  3GYK A;  3FZA A;  2NVL A;  2MBT A;  1TXX A;  1GSD A;  4N30 A;  4WET A;  2LS5 A;  1AQX A;  2VCW A;  4TR1 B;  2LRN A;  2QKE A;  4WF4 A;  1K3L A;  1U6T A;  4Q5N A;  3JCM L;  5J3R A;  2C0D A;  2O85 A;  4WKW A;  2NTO A;  1EV4 A;  1HNB A;  2B7J A;  1WE0 A;  4Q5R A;  3CMI A;  4DSS B;  1TW9 A;  4TXO A;  2IL3 A;  4MCU A;  3GIX A;  3ERF A;  2DML A;  3HVX A;  2GLR A;  2KP1 A;  4EC0 A;  5C00 A;  4WR4 A;  3J7Y b;  3C1R A;  4DSQ A;  4PQ1 A;  4I6X A;  3DYR A;  4PQH A;  1ON4 A;  2JZS A;  2N5F A;  5INY A;  3P8W A;  4IKH A;  3LOR A;  2L5L A;  4BWQ A;  2VCX A;  2VL2 A;  1TU7 A;  4D73 B;  4XCS A;  4XS1 A;  4KUN A;  1KEB A;  2F9S A;  2IPA A;  1SK1 A;  3CYN A;  1GRX A;  3IXR A;  5DBQ A;  1VF4 A;  3D6I A;  3HZ4 A;  5KN1 A;  4V2N A;  5DAK B;  7GSS A;  6GSW A;  3QPM A;  2H30 A;  4I2T A;  1FB0 A;  1MD3 A;  1JLW A;  1BAY A;  3U5R E;  4XS6 A;  3LWA A;  4DSR A;  1PL1 A;  4G9H A;  1AIU A;  1WP0 A;  2H0H A;  4ZL8 A;  1YZX A;  2WUL A;  5H5Q A;  4MH3 A;  3QMX A;  4J56 E;  1T7P B;  4RI6 A;  5E4W A;  4TRX A;  2VUP A;  1NM3 A;  2CAQ A;  4AF2 A;  1HYU A;  3QAV A;  2R5G A;  6GSX A;  2EIO A;  5DDL A;  4BA7 A;  3HDC A;  4XIH A;  5CNW A;  4EXJ A;  2AB6 A;  2B5E A;  1HNA A;  4K1F A;  1VRS D;  4EO3 A;  3KM6 A;  4LLR A;  5G2Z A;  4TKY A;  3IHQ A;  1M7T A;  2FNO A;  1V58 A;  2H70 A;  2H74 A;  1R7H A;  3VPT A;  2YOI A;  1O6J A;  3ERG A;  1SL0 B;  1JZW A;  5F0G A;  3TJB A;  3KCM A;  2CX3 A;  3L78 A;  2A4V A;  3ZL5 A;  5ELA A;  3APO A;  4O5R A;  1GTB A;  2GTU A;  5GZZ B;  3KD0 A;  1EV9 A;  3EC3 A;  3UMA A;  4K6X A;  4WBJ A;  1TU8 A;  2H1G A;  4ZB6 A;  1K0B A;  1Z9H A;  4MDC A;  4G19 A;  2C4J A;  1AQV A;  2CV4 A;  2VL9 A;  4YAP A;  2LJK A;  2ALB A;  4GF0 A;  3TKR A;  3CRU A;  2B5Y A;  1K0D A;  2TRX A;  5JWR B;  2YV7 A;  2VAF A;  4Z7X A;  3H1N A;  4KDY A;  2FUG 2;  1A8L A;  4F2I A;  2H0I A;  1XWC A;  3E3E A;  4KH7 A;  4MA9 A;  2GT6 A;  2H75 A;  4KSO A;  4GRF A;  4ECI A;  4RQX A;  1J08 A;  4POK A;  3QFA C;  4KCA A;  3W8S A;  5DAL B;  3H79 A;  1M2B A;  1K0M A;  2LV3 A;  3HJO A;  4TW5 A;  1THX A;  4BVX A;  3ZIV A;  4OO5 A;  4PXO A;  1KTE A;  4V2M A;  2DJ1 A;  2GZZ A;  5A5K A;  4YQU A;  4HU7 A;  5D96 A;  5G31 A;  1GP1 A;  2D2Z A;  4PNF A;  4ZIL A;  2X64 A;  3Q6O A;  2E7P A;  3TKS C;  3DKS A;  4OFN A;  2NBS A;  1GSU A;  2WDU A;  3I6A A;  1E6B A;  1R5P A;  5LD0 A;  1U87 A;  4PUA A;  1QGV A;  4JBB A;  2GGT A;  2WGR A;  5ECL B;  2FA4 A;  3M1G A;  5KN2 A;  3F6F A;  3MSZ A;  2MYG A;  3VPQ A;  8GSS A;  3R2Q A;  2PWJ A;  3ZTL A;  3LJR A;  1SYR A;  1PMT A;  2VM2 A;  5IO0 A;  2B5X A;  2F3M A;  4CW9 A;  1Z6M A;  5ID2 A;  3EU3 A;  4GLT A;  20GS A;  3TRX A;  4KW6 A;  2JL4 A;  1GLP A;  2R2J A;  3D5J A;  4IP1 A;  4WXT A;  4ZB9 A;  4HU9 A;  3KP9 A;  1X9S B;  5D8I A;  5C04 A;  1SD9 A;  1PN9 A;  2RLI A;  4HOJ A;  1XXU A;  4EDZ A;  3ZVJ D;  4GXZ A;  3EVI A;  2C0E A;  3GFK A;  3IDV A;  2XC2 A;  1M0U A;  4H86 A;  4EKZ A;  2K9F A;  5IIZ A;  2H1A A;  4K9Z A;  10GS A;  1BX9 A;  3ZMK A;  3A2V A;  1Z3E A;  4MH2 A;  1BED A;  2H73 A;  3EIN A;  3BOA A;  3P2A A;  4KA0 A;  2O89 A;  5IPG A;  1OE7 A;  1A8Y A;  5HFI A;  3G7J A;  2HNL A;  1M99 A;  1N8J A;  3OR5 A;  3RHB A;  3VWV A;  2DIY A;  4MJC A;  5DCH A;  3DGQ A;  2E2G A;  3TRP A;  1Z5Y E;  3FW2 A;  3DXB A;  3CSI A;  4OFM A;  1OYJ A;  2IWT A;  4GSN A;  2BJX A;  4E8E A;  2X8C A; 
#chains in the Genus database with same CATH topology
 2OE0 A;  2JU5 A;  3HA9 A;  3GL3 A;  3C73 A;  1ACV A;  1U3I A;  4KX4 A;  3HXS A;  4YAV A;  2B1K A;  4JR6 A;  1EWX A;  3VWX A;  4FYU A;  1YDK A;  4K2D A;  5IOX A;  2HSM A;  2HZE B;  2V2G A;  5F06 A;  1FHE A;  2HE3 A;  4USS A;  2HRF A;  3A5W A;  3GHA A;  1PL2 A;  4L8E A;  1DE2 A;  1NW2 A;  4IEL A;  4MZW A;  1WIK A;  2I9H A;  4K7N A;  2V32 A;  5DQS A;  2I3Y A;  3TKS A;  3RAZ A;  4GSS A;  11GS A;  2HZF A;  3IBH A;  5IMC A;  1UA5 A;  5KOW A;  16GS A;  3SWL A;  1ZOF A;  2GSR A;  2DJ3 A;  2H1B A;  3LYK A;  4OO4 A;  5J9B A;  4EF0 A;  2IMF A;  3LSZ A;  4A5P A;  4I97 A;  4WEY A;  2NDO A;  4PX1 A;  1GUL A;  5B8A A;  4CY8 A;  5B6M A;  1TDI A;  4ICY A;  2CT6 A;  3ZFL A;  1ERW A;  3C8E A;  5EY6 A;  4GWR A;  2LQQ A;  4NV2 A;  3F9U A;  4HSC X;  4PQI A;  2OE3 A;  1K0O A;  1GUH A;  5HR2 A;  5DAK A;  2JZR A;  3MNG A;  4V1A g;  2YN1 A;  2K6V A;  14GS A;  1USB A;  2C0G A;  3QD9 A;  3TCO A;  5IO2 A;  3UJ1 A;  1A0R P;  5IQY A;  2N5B A;  1PKZ A;  3IK9 A;  4DVC A;  2WCI A;  2KOK A;  2LNT A;  1GNW A;  3CSJ A;  3GRX A;  2A2P A;  3DEX A;  4V1A p;  1OC9 A;  3DML A;  1IYH A;  4K7O A;  3G7I A;  2I1U A;  3GN3 A;  1CQG A;  2TIR A;  3F3Q A;  4QL9 A;  1XVW A;  1XOB A;  1F6M C;  4EDY A;  4DEJ A;  2K8V A;  2VCZ A;  4F03 A;  1LU4 A;  4KCE A;  4POL A;  5A4U A;  3ZIJ A;  2H66 A;  4JED A;  1DE1 A;  2AYT A;  1PX6 A;  2VD1 A;  3L9S A;  1B4P A;  5J41 A;  1GSQ A;  2O87 A;  4RQR A;  1OKT A;  1YQ1 A;  2XPE A;  3M8N A;  3DIE A;  5FHI A;  3D4M A;  3WGD A;  1XZO A;  1F3A A;  4ZB8 A;  6GSV A;  2R0G A;  1Q98 A;  3V1W A;  3EUR A;  1SJZ A;  1T3B A;  4IW9 A;  5FT3 A;  4F82 A;  5CP1 A;  4GST A;  4V2L A;  3LXT A;  1YF0 A;  4NPB A;  2VCT A;  3TJK A;  3W8J A;  2OJL A;  3RDW A;  1MD4 A;  5DCG A;  1HNC A;  4Q5Q A;  4KAE A;  2VLV A;  1G7E A;  1BYE A;  2JAC A;  2FLS A;  4IVF A;  1XW9 A;  5ECK B;  1NSW A;  3C71 A;  3IA1 A;  2IN3 A;  3ZML A;  5ECS A;  4POM A;  2CZ3 A;  4EIP A;  2L4C A;  2GDR A;  5J9C A;  1ERT A;  2XBQ A;  3PH9 A;  2O7K A;  3CQF A;  2LEG A;  3FZ4 A;  1QUW A;  3H4K A;  4ZBB A;  2V41 A;  1PX7 A;  2VO4 A;  2VCQ A;  5B7C A;  1A24 A;  2UZ8 A;  4YH2 A;  3HYP A;  4RI7 A;  2B3S A;  6GST A;  3KP8 A;  2YWM A;  2EIR A;  4BL7 A;  1YKA A;  3FRC A;  3LXZ A;  1VGL A;  5D9T A;  5CRW A;  3TKQ A;  3FMW A;  3I9V 2;  1OAZ A;  4NHW A;  1JLV A;  1W89 A;  4ISD A;  1V98 A;  2GS3 A;  1GH2 A;  1FB6 A;  5GST A;  1M2D A;  4TXV A;  1W4V A;  1H75 A;  3Q18 A;  1GTI A;  1U3A A;  4FQU A;  1TK5 B;  2RUF A;  3HVN A;  3BBY A;  1K3O A;  3HVV A;  2LRC A;  2P0G A;  4QQ7 A;  3QAG A;  1DSB A;  5IM9 A;  3L9V A;  4MPG A;  2G2Q A;  3QFB C;  1ILO A;  3IPZ A;  2ZNM A;  2RM6 A;  5D9X A;  4OFT A;  3KTB A;  4HZ4 A;  1TI1 A;  4L0U A;  17GS A;  3LW9 A;  2R3X A;  4NAX A;  2K18 A;  5HR3 A;  5CYY A;  5D9V A;  2GZY A;  5CRG A;  4ML1 A;  1O85 A;  2MMZ A;  3H93 A;  2LUS A;  4KB3 A;  5EVO A;  3UBL A;  4EIQ A;  3N5O A;  3UEM A;  5B8B A;  4MPF A;  3GKK A;  3GST A;  4OWY A;  3VLN A;  2CZ2 A;  4KDU A;  4MF6 A;  3QCP A;  4X4J A;  1GUM A;  2OE1 A;  3CBU A;  3PPU A;  1PKW A;  2VCV A;  3HJP A;  3GUR A;  2L59 A;  4HQS A;  1I9D A;  1UVZ A;  1EZK A;  5J4U A;  1SK0 A;  3TJF A;  3CTG A;  4I5Q A;  1SD8 A;  3GUS A;  4G0L A;  1SK2 A;  1YEX A;  2LJR A;  2IFQ A;  2OAD A;  1K0C A;  4L0W A;  2X49 A;  5ECQ B;  3BJ5 A;  4ZIJ A;  4XTS A;  2R0P A;  2B7K A;  1BJX A;  3EYT A;  1ZMA A;  1URM A;  3HKR A;  1UN2 A;  2KLX A;  3APS A;  3EMX A;  1J0F A;  4FYC A;  2PBJ A;  4AJ8 A;  1GSF A;  4ZL7 A;  1AXD A;  2C80 A;  2MMA A;  5JCG A;  2VM1 A;  3GKN A;  4OCF A;  4JRR A;  3E9J B;  4CDO A;  3FZ9 A;  2HZE A;  4GQF A;  1FVK A;  2LKU A;  5DQY A;  3KMO A;  1TJD A;  3M9K A;  2HT9 A;  1XIY A;  1H4O A;  3FR6 A;  3FK8 A;  2PVQ A;  2QSI A;  1M9A A;  1TP9 A;  5DJL A;  3RHC A;  3RPP A;  3TDG A;  1ZZY A;  1S3D A;  1ZYQ B;  2DIZ A;  5DVB A;  1XWK A;  2FD3 A;  3QR6 A;  5H5R A;  3WGX A;  3P90 A;  2AAW A;  4F0C A;  1PD2 1;  2C1Y A;  4KDX A;  1QFN A;  1NHO A;  2VLT A;  1JHB A;  2IME A;  2JZT A;  2LRT A;  1GSY A;  3DWV A;  3UAP A;  5F07 A;  2FA8 A;  1ZGN A;  2QC7 A;  1JZD A;  4FH8 A;  4K8M A;  3GSS A;  3LYP A;  1A23 A;  3GTU A;  2FWG A;  3GL5 A;  4HJM A;  4XS4 A;  1BQ7 A;  3BCI A;  1F9M A;  2YV9 A;  3VWU A;  1X9M B;  1A2J A;  4JE1 A;  4ZXG A;  3TOT A;  1ABA A;  1SKS B;  2B6M A;  5ECO B;  1WRY A;  3VWW A;  4GCI A;  3L0H A;  2XPD A;  1T4Y A;  3GNJ A;  5F8B A;  2YWO A;  1SKW B;  4HS1 A;  5LNK e;  1EP8 A;  1S3R A;  2O8V B;  3F4R A;  3EU4 A;  1OE8 A;  2FCH A;  3NIV A;  4YQM A;  2F8A A;  4TOP A;  3KH7 A;  2HXK A;  4G2E A;  4X0X A;  2EIQ A;  2H6Y A;  1GL8 A;  3UOM A;  1PN0 A;  3TGZ A;  3KH9 A;  1Z7P A;  4MMM A;  4IHU A;  3GH6 A;  2V6K A;  1OC3 A;  3TUE A;  2PVO C;  1OVN A;  4PUR A;  4IN0 A;  2HRN A;  4ID0 A;  4L5O A;  3DVW A;  2YCD A;  4MJE A;  3P7X A;  2C3Q A;  3G9B A;  2R4V A;  5G1L A;  4JZQ A;  3VUR A;  3FZ5 A;  2DLX A;  1B8X A;  2MBS A;  1M2A A;  1F3B A;  1SU9 A;  2GQL A;  1O8X A;  4O32 A;  1R5A A;  5ECI B;  4AJ6 A;  3ED3 A;  4O7H A;  3IRA A;  4TN8 A;  4TR1 A;  4N0V A;  1ZYP A;  4ECC A;  4HI7 A;  4IQ1 A;  1TI3 A;  3ZRD A;  3ZVJ A;  5COH A;  4MZC A;  3CTF A;  1FVJ A;  2WZ9 A;  1XWG A;  1WWJ A;  3S9F A;  2LQO A;  2L5O A;  1JFU A;  5CRD A;  3I43 A;  4DSS A;  1G0T A;  5A4W A;  1VF2 A;  2F51 A;  3QOU A;  4LMV A;  3CXG A;  2WS2 A;  2IJY A;  2GQM A;  4N10 A;  3UIW A;  4KND A;  2M80 A;  1XPV A;  2FWH A;  2AHE A;  2MZC A;  2GST A;  3F3R A;  1T8E B;  1VF3 A;  1THO A;  1VF1 A;  4AJ7 A;  1YEP A;  5KN3 A;  4WF5 A;  5EL8 A;  1PSQ A;  2X8H A;  3L4N A;  5F05 A;  3WT2 A;  4IBP A;  2IMK A;  3IHG A;  3TOU A;  2YZH A;  4D73 A;  3CRT A;  1F2E A;  4IP6 A;  4OD7 A;  4TVE A;  4ACS A;  2CVD A;  3TKP A;  2PPT A;  4X43 A;  2DJ0 A;  4BVY B;  5ID2 B;  3O6T A;  2DMM A;  1XG8 A;  3ZLP A;  4O5U A;  1Q4J A;  5G30 A;  2HSH A;  3HZ8 A;  4KSM A;  2C3N A;  2FWE A;  4GTU A;  1T4Z A;  3WGE A;  1EEM A;  1TRS A;  5L71 A;  2E0Q A;  2OBI A;  3IAM 2;  2CVB A;  2XHF A;  1XW5 A;  1BG5 A;  3KJY A;  2FGX A;  5AN1 A;  5LCZ A;  2JSZ A;  4MF5 A;  3LQ7 A;  5ECR B;  3WD6 A;  4IS0 A;  3ZIT A;  3FR3 A;  2PGT A;  4LA1 A;  2LST A;  2P31 A;  2REM A;  3A2X A;  2PUK C;  2R6K A;  2JAD A;  4FYB A;  3KMN A;  3HVS A;  3GA4 A;  4ZBA A;  4G10 A;  2L57 A;  1WPI A;  3IOS A;  2ZUP A;  4TR4 A;  4PGT A;  1B9X C;  1EGR A;  4EL1 A;  1FW1 A;  4K7I A;  2H8L A;  3ZYW A;  2B1L A;  2WJU A;  3KGK A;  3U6V A;  1G6Y A;  1Y25 A;  1GWC A;  1MDI A;  1OKD A;  4K5S A;  1Y6E A;  4MLY A;  5AIX A;  2J23 A;  2X8G A;  4CY6 A;  3APQ A;  2GT5 A;  4MZB A;  4HZ2 A;  2M72 A;  3H8Q A;  4LL4 B;  2C3T A;  5ECH B;  3FHK A;  3FYG A;  3HY2 A;  2RM5 A;  3TKS E;  2BMX A;  5CRE A;  3KEB A;  2H76 A;  2HSY A;  1M3J A;  2DC5 A;  4QL7 A;  3W6G A;  1O8W A;  3GH9 A;  5CAX A;  2V6O A;  3US3 A;  2H0G A;  4RUV A;  1JZR A;  3C1S A;  2DJ2 A;  5G5E A;  1ZYE A;  2F8F A;  1SL1 B;  2GVP A;  5DAL A;  5JWQ B;  3GX8 A;  3D22 A;  5H5S A;  5HR0 A;  3IE3 A;  3Q19 A;  5J5N A;  4TR3 A;  4NXI A;  3MDK A;  1XW6 A;  2KP2 A;  1XBS A;  2CA8 A;  6GSY A;  5ELG A;  5ABR A;  1ST9 A;  2A2S A;  3Q74 A;  2YWI A;  4GQC A;  2P5Q A;  3LG6 A;  4ML6 A;  4X1U A;  2R37 A;  4BWS A;  3F4S A;  5IPH A;  2C8U A;  4WBR D;  4KGI A;  4Z2U A;  1CQH A;  1SJ6 A;  2QGV A;  4ECB A;  2G0F A;  2DJK A;  1TTZ A;  4N0Z A;  3TJJ A;  3NOF A;  1A0F A;  3KXO A;  1UC7 A;  1R26 A;  5GAN D;  3N9J A;  1DUG A;  1SEN A;  1J9B A;  4OMV A;  1OC9 B;  1MDK A;  5FWG A;  2VIM A;  2VL3 A;  3WT1 A;  1S3A A;  2VD0 A;  5ECM B;  4N11 A;  1RQM A;  4POB A;  5IMD A;  2I4A A;  1YJ6 A;  3ME8 A;  2C0F A;  3RPN A;  2RUE A;  2HLS A;  2KUC A;  4ECJ A;  3AY8 A;  4NHZ A;  1GSS A;  3HJM A;  2K8S A;  2OBK A;  9GSS A;  2HYX A;  1O73 A;  2ON7 A;  3F6D A;  3ERW A;  2OAC A;  2XBI A;  4IJI A;  5KN0 A;  1YY7 A;  4K0G A;  2PU9 C;  1X5D A;  4O92 A;  3F0I A;  2H19 A;  4MF7 A;  1ERU A;  2YJ7 A;  3GX0 A;  4ULX A;  4LL1 B;  2ZCT A;  3L9U A;  2YPM A;  1PQN A;  1SYX A;  2L6C A;  2E2M A;  3VI5 A;  4I8B A;  3ZFB A;  4HDE A;  2YZU A;  3R3E A;  6GSS A;  5CRH A;  3O3T A;  2WRT A;  4TXO B;  1Z7R A;  4YKF A;  2ON5 A;  2DJJ A;  1NHY A;  3A3T A;  1TRV A;  1TK8 B;  2YNX A;  4IGJ A;  1WMJ A;  4XHM A;  5AIV A;  5A4V A;  3SBC A;  4YQV A;  1QMV A;  1TRW A;  2HFD A;  1X0R A;  3D0Z A;  2LTK A;  2YAN A;  3ME7 A;  1GTU A;  4K0N A;  1GUK A;  2QA1 A;  2HI7 A;  3K8N A;  1IYI A;  4HUA A;  1QXH A;  2VLU A;  3UBK A;  4CHS A;  1AW9 A;  3CSH A;  1XWA A;  3VK9 A;  1Z6N A;  5GAP D;  3M0F A;  4KF9 A;  3IAS 2;  2FWF A;  4JR4 A;  2DBC A;  3WYW A;  2VOC A;  2GSS A;  3F4T A;  1YKC A;  3TB2 A;  1ZCP A;  1GLQ A;  1X9W B;  2GQK A;  2AJQ B;  1DBY A;  3UL3 A;  6GSU A;  1MDJ A;  2I81 A;  1ZL9 A;  4F9Z A;  1PFO A;  1B48 A;  3FKF A;  1C72 A;  3EMP A;  4HQZ A;  1O7U A;  3E0U A;  3FR9 A;  4ZBD A;  1KNG A;  1B9Y C;  1LBK A;  1A2M A;  3FEU A;  1X5E A;  5ECN B;  4J57 E;  3M9J A;  1PGT A;  4EVM A;  2HRA A;  1OC8 A;  1V40 A;  1PA3 A;  2GSQ A;  2L4Q A;  1O81 A;  4MK3 A;  3O76 A;  5GSS A;  2LJA A;  4E8H A;  4BIK A;  1EOH A;  1QQ2 A;  4AGS A;  2YP6 A;  2N5A A;  1SL2 B;  2DKI A;  3LFL A;  3MAK A;  4BVY A;  3FY7 A;  5IMV A;  3D21 A;  1TKD B;  4J2F A;  3ZRE A;  3PIN A;  2CX4 A;  3A2W A;  2FY6 A;  1T1V A;  3QAW A;  5AIS A;  2PMT A;  4I2U A;  1WOU A;  1F37 A;  4XRA A;  5EPF A;  3KIJ A;  2Z9S A;  1V2A A;  5DJM A;  3F8U A;  2V1M A;  3M3M A;  5IMF A;  1XVQ A;  5JCU A;  4TR0 A;  1KBN A;  1LJR A;  1MTC A;  4O5Q A;  4IJ3 A;  3TRQ A;  3UAR A;  3RBT A;  1V9W A;  1S3C A;  1MEK A;  1ERV A;  2X99 A;  2YWN A;  5D73 A;  4Q5F A;  4WR5 A;  1TK0 B;  5IMZ A;  4MJA A;  2H6Z A;  1G6W A;  2R0C A;  3KTL A;  1QK8 A;  4XRD A;  3BD2 A;  2FHE A;  1WJK A;  2CVK A;  4NMU A;  2IMI A;  1HD2 A;  2OKA A;  12GS A;  5B6N A;  1K3Y A;  5CO3 A;  2IFQ B;  5D93 A;  3GMF A;  1AQW A;  1GTA A;  2A4H A;  1RW1 A;  4NV5 A;  13GS A;  3GV1 A;  5BRT A;  4G0I A;  1XOA A;  4MP4 A;  2H72 A;  2IIY A;  4MJB A;  1N2A A;  5JCW A;  3J7Y k;  4JU5 A;  3PGT A;  2LNS A;  1EOG A;  2OA7 A;  2A2R A;  2RII A;  4BVX B;  18GS A;  3UVH A;  1XCC A;  1XWB A;  1JZO A;  1EP7 A;  4MAB A;  4KE3 A;  4HJ2 A;  1AC1 A;  22GS A;  2PN8 A;  1B4Q A;  3EWL A;  3IV4 A;  2BTO T;  3NZN A;  1E2Y A;  3HHV A;  1GNE A;  5JWO B;  1PRX A;  1R4W A;  1U88 A;  2AV4 A;  1M9B A;  1K0A A;  5D9W A;  2KHP A;  5ECP B;  19GS A;  5HFK A;  1ML6 A;  4OCE A;  2CAI A;  2M46 A;  2EC4 A;  2J9H A;  4PUF C;  2WB9 A;  1K0N A;  2ES7 A;  3GKX A;  4ILF A;  5E59 A;  4YKG A;  3ISO A;  1EGO A;  1TOF A;  1XFL A;  5G1K A;  4K2X A;  2AUV A;  4EUY A;  1YF1 A;  2H6X A;  2VL2 C;  2MMN A;  5IOW A;  2YJH A;  3UVT A;  1I5G A;  3F63 A;  3DD3 A;  4IQA A;  1HQO A;  3EE2 A;  4P3Y B;  5ENU A;  1AAZ A;  3PR8 A;  3IR4 A;  3HD5 A;  2H71 A;  2L6D A;  1AUC A;  3G7Y A;  2P5R A;  3VI7 A;  3GTU B;  2IMD A;  3MWH A;  2H1D A;  4XS4 B;  4LMW A;  1FO5 A;  1FG4 A;  3VFI A;  1GSE A;  4FIW A;  5HFG A;  5AGY A;  1SKR B;  1G7O A;  2DSA A;  4ZL9 A;  5IMA A;  4NWY A;  4HEA 2;  3QDN A;  2HRK A;  2MMO A;  1FAA A;  2TRC P;  3KZQ A;  2JSY A;  1FOV A;  1V57 A;  3I69 A;  5HR1 A;  3IC4 A;  1TRU A;  3BCK A;  3DVX A;  3DRN A;  1RK4 A;  1T00 A;  3ZZX A;  3C7M A;  3TJG A;  2WFC A;  5KEJ A;  5G5F A;  3D4T A;  2PER A;  3LEF A;  4BPY A;  1X5C A;  3IK7 A;  1SJI A;  1M3I A;  4F0B A;  4PNG A;  4FO5 A;  5HQP A;  1A2L A;  3LGC A;  2GZP A;  3GKM A;  2CQ9 A;  4L5L A;  2NPB A;  3HCZ A;  2H01 A;  1EEJ A;  4EE0 A;  3GYK A;  3FZA A;  2NVL A;  2MBT A;  1TXX A;  1GSD A;  4N30 A;  4WET A;  5BMU A;  2LS5 A;  1AQX A;  2VCW A;  4TR1 B;  2LRN A;  2QKE A;  4WF4 A;  1K3L A;  1U6T A;  4Q5N A;  3JCM L;  5J3R A;  2C0D A;  2O85 A;  4WKW A;  2NTO A;  1EV4 A;  1HNB A;  2B7J A;  1WE0 A;  4Q5R A;  3CMI A;  4DSS B;  1TW9 A;  4TXO A;  2IL3 A;  4MCU A;  3GIX A;  4MNN A;  3ERF A;  2DML A;  3HVX A;  2GLR A;  2KP1 A;  4EC0 A;  5C00 A;  2X4A A;  4WR4 A;  3J7Y b;  3C1R A;  4DSQ A;  4PQ1 A;  4I6X A;  3DYR A;  4PQH A;  1ON4 A;  2JZS A;  2N5F A;  5INY A;  3P8W A;  4IKH A;  3LOR A;  2L5L A;  4BWQ A;  2VCX A;  2VL2 A;  1TU7 A;  4D73 B;  4XCS A;  4XS1 A;  4KUN A;  1KEB A;  2F9S A;  2IPA A;  1SK1 A;  3CYN A;  1GRX A;  3IXR A;  5DBQ A;  1VF4 A;  3D6I A;  3HZ4 A;  5KN1 A;  4V2N A;  5DAK B;  7GSS A;  6GSW A;  3QPM A;  4PTS A;  2H30 A;  4I2T A;  1FB0 A;  1MD3 A;  1JLW A;  1BAY A;  3U5R E;  4XS6 A;  3LWA A;  4DSR A;  1PL1 A;  4G9H A;  1AIU A;  1WP0 A;  2H0H A;  4ZL8 A;  1YZX A;  2WUL A;  3MIX A;  5H5Q A;  4MH3 A;  3QMX A;  4J56 E;  1T7P B;  4RI6 A;  5E4W A;  4TRX A;  2VUP A;  1NM3 A;  2CAQ A;  4AF2 A;  1HYU A;  3QAV A;  2R5G A;  6GSX A;  2EIO A;  5DDL A;  4BA7 A;  3HDC A;  4XIH A;  5CNW A;  4EXJ A;  2AB6 A;  2B5E A;  1HNA A;  4K1F A;  1VRS D;  4EO3 A;  3KM6 A;  4LLR A;  5G2Z A;  4TKY A;  3IHQ A;  1M7T A;  2FNO A;  4Z2T A;  1V58 A;  2H70 A;  2H74 A;  1R7H A;  3VPT A;  2YOI A;  1O6J A;  3ERG A;  1SL0 B;  1JZW A;  5F0G A;  3TJB A;  3KCM A;  2CX3 A;  3L78 A;  2A4V A;  3ZL5 A;  5ELA A;  3APO A;  4O5R A;  1GTB A;  2GTU A;  5GZZ B;  3KD0 A;  1EV9 A;  3EC3 A;  3UMA A;  4G0K A;  4K6X A;  4WBJ A;  1TU8 A;  2H1G A;  4ZB6 A;  1K0B A;  1Z9H A;  4MDC A;  4G19 A;  2C4J A;  1AQV A;  2CV4 A;  2VL9 A;  4YAP A;  2LJK A;  2ALB A;  4GF0 A;  3TKR A;  3CRU A;  2B5Y A;  1K0D A;  2TRX A;  5JWR B;  2YV7 A;  5KOX A;  2VAF A;  4Z7X A;  3H1N A;  4KDY A;  2FUG 2;  1A8L A;  4F2I A;  2H0I A;  1XWC A;  3E3E A;  4KH7 A;  4MA9 A;  2GT6 A;  3MYD A;  2H75 A;  4KSO A;  4GRF A;  4Z2R A;  4ECI A;  4RQX A;  1J08 A;  4POK A;  3QFA C;  4KCA A;  3W8S A;  5DAL B;  3H79 A;  1M2B A;  1K0M A;  2LV3 A;  3HJO A;  4TW5 A;  1THX A;  4BVX A;  3ZIV A;  4PXO A;  4OO5 A;  1KTE A;  4V2M A;  2DJ1 A;  2GZZ A;  5A5K A;  3A5I A;  3EPT A;  4YQU A;  4HU7 A;  5D96 A;  5G31 A;  1GP1 A;  2D2Z A;  4PNF A;  4ZIL A;  2X64 A;  3Q6O A;  2E7P A;  3TKS C;  3DKS A;  4OFN A;  2NBS A;  1GSU A;  2DKH A;  4BL7 B;  2WDU A;  3I6A A;  1E6B A;  1R5P A;  5LD0 A;  1U87 A;  4PUA A;  1QGV A;  1ZYN A;  4JBB A;  2GGT A;  2WGR A;  5ECL B;  2FA4 A;  3M1G A;  5KN2 A;  3F6F A;  3MSZ A;  2MYG A;  3VPQ A;  8GSS A;  3R2Q A;  2PWJ A;  3ZTL A;  3LJR A;  1SYR A;  1PMT A;  2VM2 A;  5IO0 A;  2B5X A;  2F3M A;  4CW9 A;  1Z6M A;  5ID2 A;  3EU3 A;  4GLT A;  20GS A;  3TRX A;  4KW6 A;  2JL4 A;  1GLP A;  2R2J A;  3D5J A;  4IP1 A;  4WXT A;  4ZB9 A;  4HU9 A;  3KP9 A;  1X9S B;  5D8I A;  5C04 A;  1SD9 A;  2QA2 A;  1PN9 A;  2RLI A;  4HOJ A;  1XXU A;  4EDZ A;  1FOH A;  3ZVJ D;  4GXZ A;  3EVI A;  2C0E A;  3GFK A;  3IDV A;  2XC2 A;  1M0U A;  4H86 A;  4EKZ A;  2K9F A;  5IIZ A;  2H1A A;  4K9Z A;  10GS A;  1BX9 A;  3ZMK A;  3A2V A;  1Z3E A;  4MH2 A;  1BED A;  2H73 A;  3EIN A;  3BOA A;  3P2A A;  4KA0 A;  2O89 A;  5IPG A;  1OE7 A;  1A8Y A;  5HFI A;  3G7J A;  2HNL A;  1M99 A;  1N8J A;  3OR5 A;  3RHB A;  3VWV A;  2DIY A;  4MJC A;  5DCH A;  3DGQ A;  2E2G A;  3TRP A;  1Z5Y E;  3FW2 A;  3DXB A;  4K5R A;  3CSI A;  3IC8 A;  4OFM A;  1OYJ A;  2IWT A;  4GSN A;  2BJX A;  4E8E A;  2X8C A; 
#chains in the Genus database with same CATH homology
 2OE0 A;  2JU5 A;  3HA9 A;  3GL3 A;  3C73 A;  1ACV A;  1U3I A;  4KX4 A;  3HXS A;  4YAV A;  2B1K A;  4JR6 A;  1EWX A;  3VWX A;  4FYU A;  1YDK A;  4K2D A;  5IOX A;  2HSM A;  2HZE B;  2V2G A;  5F06 A;  1FHE A;  2HE3 A;  4USS A;  2HRF A;  3A5W A;  3GHA A;  1PL2 A;  4L8E A;  1DE2 A;  1NW2 A;  4IEL A;  4MZW A;  1WIK A;  2I9H A;  4K7N A;  2V32 A;  5DQS A;  2I3Y A;  3TKS A;  3RAZ A;  4GSS A;  11GS A;  2HZF A;  3IBH A;  5IMC A;  1UA5 A;  5KOW A;  16GS A;  3SWL A;  1ZOF A;  2GSR A;  2DJ3 A;  2H1B A;  3LYK A;  4OO4 A;  5J9B A;  4EF0 A;  2IMF A;  3LSZ A;  4A5P A;  4I97 A;  4WEY A;  2NDO A;  4PX1 A;  1GUL A;  5B8A A;  4CY8 A;  5B6M A;  1TDI A;  4ICY A;  2CT6 A;  3ZFL A;  1ERW A;  3C8E A;  5EY6 A;  4GWR A;  2LQQ A;  4NV2 A;  3F9U A;  4PQI A;  2OE3 A;  1K0O A;  1GUH A;  5HR2 A;  5DAK A;  2JZR A;  3MNG A;  4V1A g;  2YN1 A;  2K6V A;  14GS A;  1USB A;  2C0G A;  3QD9 A;  3TCO A;  5IO2 A;  3UJ1 A;  1A0R P;  5IQY A;  2N5B A;  1PKZ A;  3IK9 A;  4DVC A;  2WCI A;  2KOK A;  2LNT A;  1GNW A;  3CSJ A;  3GRX A;  2A2P A;  3DEX A;  4V1A p;  1OC9 A;  3DML A;  1IYH A;  4K7O A;  3G7I A;  2I1U A;  3GN3 A;  1CQG A;  2TIR A;  3F3Q A;  4QL9 A;  1XVW A;  1XOB A;  1F6M C;  4EDY A;  4DEJ A;  2K8V A;  2VCZ A;  4F03 A;  1LU4 A;  4KCE A;  4POL A;  5A4U A;  3ZIJ A;  2H66 A;  4JED A;  1DE1 A;  2AYT A;  1PX6 A;  2VD1 A;  3L9S A;  1B4P A;  5J41 A;  1GSQ A;  2O87 A;  4RQR A;  1OKT A;  1YQ1 A;  2XPE A;  3M8N A;  3DIE A;  5FHI A;  3D4M A;  3WGD A;  1XZO A;  1F3A A;  4ZB8 A;  6GSV A;  2R0G A;  1Q98 A;  3V1W A;  3EUR A;  1SJZ A;  1T3B A;  4IW9 A;  5FT3 A;  4F82 A;  5CP1 A;  4GST A;  4V2L A;  3LXT A;  1YF0 A;  4NPB A;  2VCT A;  3TJK A;  3W8J A;  2OJL A;  3RDW A;  1MD4 A;  5DCG A;  1HNC A;  4Q5Q A;  4KAE A;  2VLV A;  1G7E A;  1BYE A;  2JAC A;  2FLS A;  4IVF A;  1XW9 A;  5ECK B;  1NSW A;  3C71 A;  3IA1 A;  2IN3 A;  3ZML A;  5ECS A;  4POM A;  2CZ3 A;  4EIP A;  2L4C A;  2GDR A;  5J9C A;  1ERT A;  2XBQ A;  3PH9 A;  2O7K A;  2LEG A;  3FZ4 A;  1QUW A;  3H4K A;  4ZBB A;  2V41 A;  1PX7 A;  2VO4 A;  2VCQ A;  5B7C A;  1A24 A;  2UZ8 A;  4YH2 A;  3HYP A;  4RI7 A;  2B3S A;  6GST A;  3KP8 A;  2YWM A;  2EIR A;  4BL7 A;  1YKA A;  3FRC A;  3LXZ A;  1VGL A;  5D9T A;  5CRW A;  3TKQ A;  3FMW A;  3I9V 2;  1OAZ A;  4NHW A;  1JLV A;  1W89 A;  4ISD A;  1V98 A;  2GS3 A;  1GH2 A;  1FB6 A;  5GST A;  1M2D A;  4TXV A;  1W4V A;  1H75 A;  3Q18 A;  1GTI A;  1U3A A;  4FQU A;  1TK5 B;  2RUF A;  3BBY A;  1K3O A;  3HVV A;  2LRC A;  2P0G A;  4QQ7 A;  3QAG A;  1DSB A;  5IM9 A;  3L9V A;  4MPG A;  2G2Q A;  3QFB C;  1ILO A;  3IPZ A;  2ZNM A;  2RM6 A;  5D9X A;  4OFT A;  3KTB A;  4HZ4 A;  1TI1 A;  4L0U A;  17GS A;  3LW9 A;  2R3X A;  4NAX A;  2K18 A;  5HR3 A;  5CYY A;  5D9V A;  2GZY A;  5CRG A;  4ML1 A;  1O85 A;  2MMZ A;  3H93 A;  2LUS A;  4KB3 A;  5EVO A;  3UBL A;  4EIQ A;  3N5O A;  3UEM A;  5B8B A;  4MPF A;  3GKK A;  3GST A;  4OWY A;  3VLN A;  2CZ2 A;  4KDU A;  4MF6 A;  3QCP A;  4X4J A;  1GUM A;  2OE1 A;  3CBU A;  3PPU A;  1PKW A;  2VCV A;  3HJP A;  3GUR A;  2L59 A;  4HQS A;  1I9D A;  1UVZ A;  1EZK A;  5J4U A;  1SK0 A;  3TJF A;  3CTG A;  4I5Q A;  1SD8 A;  3GUS A;  4G0L A;  1SK2 A;  1YEX A;  2LJR A;  2IFQ A;  2OAD A;  1K0C A;  4L0W A;  2X49 A;  5ECQ B;  3BJ5 A;  4ZIJ A;  4XTS A;  2R0P A;  2B7K A;  1BJX A;  3EYT A;  1ZMA A;  1URM A;  3HKR A;  1UN2 A;  2KLX A;  3APS A;  3EMX A;  1J0F A;  4FYC A;  2PBJ A;  4AJ8 A;  1GSF A;  4ZL7 A;  1AXD A;  2C80 A;  2MMA A;  5JCG A;  2VM1 A;  3GKN A;  4OCF A;  4JRR A;  3E9J B;  4CDO A;  3FZ9 A;  2HZE A;  4GQF A;  1FVK A;  2LKU A;  5DQY A;  3KMO A;  1TJD A;  3M9K A;  2HT9 A;  1XIY A;  1H4O A;  3FR6 A;  3FK8 A;  2PVQ A;  2QSI A;  1M9A A;  1TP9 A;  5DJL A;  3RHC A;  3RPP A;  3TDG A;  1ZZY A;  1S3D A;  1ZYQ B;  2DIZ A;  5DVB A;  1XWK A;  2FD3 A;  3QR6 A;  5H5R A;  3WGX A;  3P90 A;  2AAW A;  4F0C A;  1PD2 1;  2C1Y A;  4KDX A;  1QFN A;  1NHO A;  2VLT A;  1JHB A;  2IME A;  2JZT A;  2LRT A;  1GSY A;  3DWV A;  3UAP A;  5F07 A;  2FA8 A;  1ZGN A;  2QC7 A;  1JZD A;  4FH8 A;  4K8M A;  3GSS A;  3LYP A;  1A23 A;  3GTU A;  2FWG A;  3GL5 A;  4HJM A;  4XS4 A;  1BQ7 A;  3BCI A;  1F9M A;  2YV9 A;  3VWU A;  1X9M B;  1A2J A;  4JE1 A;  4ZXG A;  3TOT A;  1ABA A;  1SKS B;  2B6M A;  5ECO B;  1WRY A;  3VWW A;  4GCI A;  3L0H A;  2XPD A;  1T4Y A;  3GNJ A;  5F8B A;  2YWO A;  1SKW B;  4HS1 A;  5LNK e;  1EP8 A;  2O8V B;  3F4R A;  3EU4 A;  1OE8 A;  2FCH A;  3NIV A;  4YQM A;  2F8A A;  4TOP A;  3KH7 A;  2HXK A;  4G2E A;  4X0X A;  2EIQ A;  2H6Y A;  1GL8 A;  3UOM A;  1PN0 A;  3TGZ A;  3KH9 A;  1Z7P A;  4MMM A;  4IHU A;  3GH6 A;  2V6K A;  1OC3 A;  3TUE A;  2PVO C;  1OVN A;  4PUR A;  4IN0 A;  2HRN A;  4ID0 A;  4L5O A;  3DVW A;  2YCD A;  4MJE A;  3P7X A;  2C3Q A;  3G9B A;  2R4V A;  5G1L A;  4JZQ A;  3VUR A;  3FZ5 A;  2DLX A;  1B8X A;  2MBS A;  1M2A A;  1F3B A;  1SU9 A;  2GQL A;  1O8X A;  4O32 A;  1R5A A;  5ECI B;  4AJ6 A;  3ED3 A;  4O7H A;  3IRA A;  4TN8 A;  4TR1 A;  4N0V A;  1ZYP A;  4ECC A;  4HI7 A;  4IQ1 A;  1TI3 A;  3ZRD A;  3ZVJ A;  5COH A;  4MZC A;  3CTF A;  1FVJ A;  2WZ9 A;  1XWG A;  1WWJ A;  3S9F A;  2LQO A;  2L5O A;  1JFU A;  5CRD A;  3I43 A;  4DSS A;  1G0T A;  5A4W A;  1VF2 A;  2F51 A;  3QOU A;  4LMV A;  3CXG A;  2WS2 A;  2IJY A;  2GQM A;  4N10 A;  3UIW A;  4KND A;  2M80 A;  1XPV A;  2FWH A;  2AHE A;  2MZC A;  2GST A;  3F3R A;  1T8E B;  1VF3 A;  1THO A;  1VF1 A;  4AJ7 A;  1YEP A;  5KN3 A;  4WF5 A;  5EL8 A;  1PSQ A;  2X8H A;  3L4N A;  5F05 A;  3WT2 A;  4IBP A;  2IMK A;  3IHG A;  3TOU A;  2YZH A;  4D73 A;  3CRT A;  1F2E A;  4IP6 A;  4OD7 A;  4TVE A;  4ACS A;  2CVD A;  3TKP A;  2PPT A;  4X43 A;  2DJ0 A;  4BVY B;  5ID2 B;  3O6T A;  2DMM A;  3ZLP A;  4O5U A;  1Q4J A;  5G30 A;  2HSH A;  3HZ8 A;  4KSM A;  2C3N A;  2FWE A;  4GTU A;  1T4Z A;  3WGE A;  1EEM A;  1TRS A;  5L71 A;  2E0Q A;  2OBI A;  3IAM 2;  2CVB A;  2XHF A;  1XW5 A;  1BG5 A;  3KJY A;  2FGX A;  5AN1 A;  5LCZ A;  2JSZ A;  4MF5 A;  3LQ7 A;  5ECR B;  3WD6 A;  4IS0 A;  3ZIT A;  3FR3 A;  2PGT A;  4LA1 A;  2LST A;  2P31 A;  2REM A;  3A2X A;  2PUK C;  2R6K A;  2JAD A;  4FYB A;  3KMN A;  3HVS A;  3GA4 A;  4ZBA A;  4G10 A;  2L57 A;  1WPI A;  3IOS A;  2ZUP A;  4TR4 A;  4PGT A;  1B9X C;  1EGR A;  4EL1 A;  1FW1 A;  4K7I A;  2H8L A;  3ZYW A;  2B1L A;  2WJU A;  3KGK A;  3U6V A;  1G6Y A;  1Y25 A;  1GWC A;  1MDI A;  1OKD A;  4K5S A;  1Y6E A;  4MLY A;  5AIX A;  2J23 A;  2X8G A;  4CY6 A;  3APQ A;  2GT5 A;  4MZB A;  4HZ2 A;  2M72 A;  3H8Q A;  4LL4 B;  2C3T A;  5ECH B;  3FHK A;  3FYG A;  3HY2 A;  2RM5 A;  3TKS E;  2BMX A;  5CRE A;  3KEB A;  2H76 A;  2HSY A;  2DC5 A;  4QL7 A;  3W6G A;  1O8W A;  3GH9 A;  5CAX A;  2V6O A;  3US3 A;  2H0G A;  4RUV A;  1JZR A;  3C1S A;  2DJ2 A;  5G5E A;  1ZYE A;  2F8F A;  1SL1 B;  2GVP A;  5DAL A;  5JWQ B;  3GX8 A;  3D22 A;  5H5S A;  5HR0 A;  3IE3 A;  3Q19 A;  5J5N A;  4TR3 A;  4NXI A;  3MDK A;  1XW6 A;  2KP2 A;  1XBS A;  2CA8 A;  6GSY A;  5ELG A;  5ABR A;  1ST9 A;  2A2S A;  3Q74 A;  2YWI A;  4GQC A;  2P5Q A;  3LG6 A;  4ML6 A;  4X1U A;  2R37 A;  4BWS A;  3F4S A;  5IPH A;  2C8U A;  4WBR D;  4KGI A;  4Z2U A;  1CQH A;  1SJ6 A;  2QGV A;  4ECB A;  2G0F A;  2DJK A;  1TTZ A;  4N0Z A;  3TJJ A;  3NOF A;  1A0F A;  3KXO A;  1UC7 A;  1R26 A;  5GAN D;  3N9J A;  1DUG A;  1SEN A;  1J9B A;  4OMV A;  1OC9 B;  1MDK A;  5FWG A;  2VIM A;  2VL3 A;  3WT1 A;  1S3A A;  2VD0 A;  5ECM B;  4N11 A;  1RQM A;  4POB A;  5IMD A;  2I4A A;  1YJ6 A;  3ME8 A;  2C0F A;  3RPN A;  2RUE A;  2HLS A;  2KUC A;  4ECJ A;  3AY8 A;  4NHZ A;  1GSS A;  3HJM A;  2K8S A;  2OBK A;  9GSS A;  2HYX A;  1O73 A;  2ON7 A;  3F6D A;  3ERW A;  2OAC A;  2XBI A;  4IJI A;  5KN0 A;  1YY7 A;  4K0G A;  2PU9 C;  1X5D A;  4O92 A;  3F0I A;  2H19 A;  4MF7 A;  1ERU A;  2YJ7 A;  3GX0 A;  4ULX A;  4LL1 B;  2ZCT A;  3L9U A;  2YPM A;  1PQN A;  1SYX A;  2L6C A;  2E2M A;  3VI5 A;  4I8B A;  3ZFB A;  4HDE A;  2YZU A;  3R3E A;  6GSS A;  5CRH A;  3O3T A;  2WRT A;  4TXO B;  1Z7R A;  4YKF A;  2ON5 A;  2DJJ A;  1NHY A;  3A3T A;  1TRV A;  1TK8 B;  2YNX A;  4IGJ A;  1WMJ A;  4XHM A;  5AIV A;  5A4V A;  3SBC A;  4YQV A;  1QMV A;  1TRW A;  2HFD A;  1X0R A;  3D0Z A;  2LTK A;  2YAN A;  3ME7 A;  1GTU A;  4K0N A;  1GUK A;  2QA1 A;  2HI7 A;  3K8N A;  1IYI A;  4HUA A;  1QXH A;  2VLU A;  3UBK A;  4CHS A;  1AW9 A;  3CSH A;  1XWA A;  3VK9 A;  1Z6N A;  5GAP D;  3M0F A;  4KF9 A;  3IAS 2;  2FWF A;  4JR4 A;  2DBC A;  3WYW A;  2VOC A;  2GSS A;  3F4T A;  1YKC A;  3TB2 A;  1ZCP A;  1GLQ A;  1X9W B;  2GQK A;  2AJQ B;  1DBY A;  3UL3 A;  6GSU A;  1MDJ A;  2I81 A;  1ZL9 A;  4F9Z A;  1B48 A;  3FKF A;  1C72 A;  3EMP A;  4HQZ A;  1O7U A;  3E0U A;  3FR9 A;  4ZBD A;  1KNG A;  1B9Y C;  1LBK A;  1A2M A;  3FEU A;  1X5E A;  5ECN B;  4J57 E;  3M9J A;  1PGT A;  4EVM A;  2HRA A;  1OC8 A;  1V40 A;  1PA3 A;  2GSQ A;  2L4Q A;  1O81 A;  4MK3 A;  3O76 A;  5GSS A;  2LJA A;  4E8H A;  1EOH A;  1QQ2 A;  4AGS A;  2YP6 A;  2N5A A;  1SL2 B;  2DKI A;  3LFL A;  3MAK A;  4BVY A;  3FY7 A;  5IMV A;  3D21 A;  1TKD B;  4J2F A;  3ZRE A;  3PIN A;  2CX4 A;  3A2W A;  2FY6 A;  1T1V A;  3QAW A;  5AIS A;  2PMT A;  4I2U A;  1WOU A;  1F37 A;  4XRA A;  5EPF A;  3KIJ A;  2Z9S A;  1V2A A;  5DJM A;  3F8U A;  2V1M A;  3M3M A;  5IMF A;  1XVQ A;  5JCU A;  4TR0 A;  1KBN A;  1LJR A;  1MTC A;  4O5Q A;  4IJ3 A;  3TRQ A;  3UAR A;  3RBT A;  1V9W A;  1S3C A;  1MEK A;  1ERV A;  2X99 A;  2YWN A;  5D73 A;  4Q5F A;  4WR5 A;  1TK0 B;  5IMZ A;  4MJA A;  2H6Z A;  1G6W A;  2R0C A;  3KTL A;  1QK8 A;  4XRD A;  3BD2 A;  2FHE A;  1WJK A;  2CVK A;  4NMU A;  2IMI A;  1HD2 A;  2OKA A;  12GS A;  5B6N A;  1K3Y A;  5CO3 A;  2IFQ B;  5D93 A;  3GMF A;  1AQW A;  1GTA A;  2A4H A;  1RW1 A;  4NV5 A;  13GS A;  3GV1 A;  5BRT A;  4G0I A;  1XOA A;  4MP4 A;  2H72 A;  2IIY A;  4MJB A;  1N2A A;  5JCW A;  3J7Y k;  4JU5 A;  3PGT A;  2LNS A;  1EOG A;  2OA7 A;  2A2R A;  2RII A;  4BVX B;  18GS A;  3UVH A;  1XCC A;  1XWB A;  1JZO A;  1EP7 A;  4MAB A;  4KE3 A;  4HJ2 A;  1AC1 A;  22GS A;  2PN8 A;  1B4Q A;  3EWL A;  3IV4 A;  2BTO T;  3NZN A;  1E2Y A;  3HHV A;  1GNE A;  5JWO B;  1PRX A;  1R4W A;  1U88 A;  2AV4 A;  1M9B A;  1K0A A;  5D9W A;  2KHP A;  5ECP B;  19GS A;  5HFK A;  1ML6 A;  4OCE A;  2CAI A;  2M46 A;  2EC4 A;  2J9H A;  4PUF C;  2WB9 A;  1K0N A;  2ES7 A;  3GKX A;  4ILF A;  5E59 A;  4YKG A;  3ISO A;  1EGO A;  1TOF A;  1XFL A;  5G1K A;  4K2X A;  2AUV A;  4EUY A;  1YF1 A;  2H6X A;  2VL2 C;  2MMN A;  5IOW A;  2YJH A;  3UVT A;  1I5G A;  3F63 A;  3DD3 A;  4IQA A;  1HQO A;  3EE2 A;  4P3Y B;  5ENU A;  1AAZ A;  3PR8 A;  3IR4 A;  3HD5 A;  2H71 A;  2L6D A;  1AUC A;  3G7Y A;  2P5R A;  3VI7 A;  3GTU B;  2IMD A;  3MWH A;  2H1D A;  4XS4 B;  4LMW A;  1FO5 A;  1FG4 A;  3VFI A;  1GSE A;  4FIW A;  5HFG A;  5AGY A;  1SKR B;  1G7O A;  2DSA A;  4ZL9 A;  5IMA A;  4NWY A;  4HEA 2;  3QDN A;  2HRK A;  2MMO A;  1FAA A;  2TRC P;  3KZQ A;  2JSY A;  1FOV A;  1V57 A;  3I69 A;  5HR1 A;  3IC4 A;  1TRU A;  3BCK A;  3DVX A;  3DRN A;  1RK4 A;  1T00 A;  3ZZX A;  3C7M A;  3TJG A;  2WFC A;  5KEJ A;  5G5F A;  3D4T A;  2PER A;  3LEF A;  4BPY A;  1X5C A;  3IK7 A;  1SJI A;  4F0B A;  4PNG A;  4FO5 A;  5HQP A;  1A2L A;  3LGC A;  2GZP A;  3GKM A;  2CQ9 A;  4L5L A;  2NPB A;  3HCZ A;  2H01 A;  1EEJ A;  4EE0 A;  3GYK A;  3FZA A;  2NVL A;  2MBT A;  1TXX A;  1GSD A;  4N30 A;  4WET A;  5BMU A;  2LS5 A;  1AQX A;  2VCW A;  4TR1 B;  2LRN A;  2QKE A;  4WF4 A;  1K3L A;  1U6T A;  4Q5N A;  3JCM L;  5J3R A;  2C0D A;  2O85 A;  4WKW A;  2NTO A;  1EV4 A;  1HNB A;  2B7J A;  1WE0 A;  4Q5R A;  3CMI A;  4DSS B;  1TW9 A;  4TXO A;  2IL3 A;  4MCU A;  3GIX A;  4MNN A;  3ERF A;  2DML A;  3HVX A;  2GLR A;  2KP1 A;  4EC0 A;  5C00 A;  2X4A A;  4WR4 A;  3J7Y b;  3C1R A;  4DSQ A;  4PQ1 A;  4I6X A;  3DYR A;  4PQH A;  1ON4 A;  2JZS A;  2N5F A;  5INY A;  3P8W A;  4IKH A;  3LOR A;  2L5L A;  4BWQ A;  2VCX A;  2VL2 A;  1TU7 A;  4D73 B;  4XCS A;  4XS1 A;  4KUN A;  1KEB A;  2F9S A;  2IPA A;  1SK1 A;  3CYN A;  1GRX A;  3IXR A;  5DBQ A;  1VF4 A;  3D6I A;  3HZ4 A;  5KN1 A;  4V2N A;  5DAK B;  7GSS A;  6GSW A;  3QPM A;  4PTS A;  2H30 A;  4I2T A;  1FB0 A;  1MD3 A;  1JLW A;  1BAY A;  3U5R E;  4XS6 A;  3LWA A;  4DSR A;  1PL1 A;  4G9H A;  1AIU A;  1WP0 A;  2H0H A;  4ZL8 A;  1YZX A;  2WUL A;  3MIX A;  5H5Q A;  4MH3 A;  3QMX A;  4J56 E;  1T7P B;  4RI6 A;  5E4W A;  4TRX A;  2VUP A;  1NM3 A;  2CAQ A;  4AF2 A;  1HYU A;  3QAV A;  2R5G A;  6GSX A;  2EIO A;  5DDL A;  4BA7 A;  3HDC A;  4XIH A;  5CNW A;  4EXJ A;  2AB6 A;  2B5E A;  1HNA A;  4K1F A;  1VRS D;  4EO3 A;  3KM6 A;  4LLR A;  5G2Z A;  4TKY A;  3IHQ A;  1M7T A;  2FNO A;  4Z2T A;  1V58 A;  2H70 A;  2H74 A;  1R7H A;  3VPT A;  2YOI A;  1O6J A;  3ERG A;  1SL0 B;  1JZW A;  5F0G A;  3TJB A;  3KCM A;  2CX3 A;  3L78 A;  2A4V A;  3ZL5 A;  5ELA A;  3APO A;  4O5R A;  1GTB A;  2GTU A;  5GZZ B;  3KD0 A;  1EV9 A;  3EC3 A;  3UMA A;  4G0K A;  4K6X A;  4WBJ A;  1TU8 A;  2H1G A;  4ZB6 A;  1K0B A;  1Z9H A;  4MDC A;  4G19 A;  2C4J A;  1AQV A;  2CV4 A;  2VL9 A;  4YAP A;  2LJK A;  2ALB A;  4GF0 A;  3TKR A;  3CRU A;  2B5Y A;  1K0D A;  2TRX A;  5JWR B;  2YV7 A;  5KOX A;  2VAF A;  4Z7X A;  3H1N A;  4KDY A;  2FUG 2;  1A8L A;  4F2I A;  2H0I A;  1XWC A;  3E3E A;  4KH7 A;  4MA9 A;  2GT6 A;  3MYD A;  2H75 A;  4KSO A;  4GRF A;  4Z2R A;  4ECI A;  4RQX A;  1J08 A;  4POK A;  3QFA C;  4KCA A;  3W8S A;  5DAL B;  3H79 A;  1M2B A;  1K0M A;  2LV3 A;  3HJO A;  4TW5 A;  1THX A;  4BVX A;  3ZIV A;  4PXO A;  4OO5 A;  1KTE A;  4V2M A;  2DJ1 A;  2GZZ A;  5A5K A;  3A5I A;  3EPT A;  4YQU A;  4HU7 A;  5D96 A;  5G31 A;  1GP1 A;  2D2Z A;  4PNF A;  4ZIL A;  2X64 A;  3Q6O A;  2E7P A;  3TKS C;  3DKS A;  4OFN A;  2NBS A;  1GSU A;  2DKH A;  4BL7 B;  2WDU A;  3I6A A;  1E6B A;  1R5P A;  5LD0 A;  1U87 A;  4PUA A;  1QGV A;  1ZYN A;  4JBB A;  2GGT A;  2WGR A;  5ECL B;  2FA4 A;  3M1G A;  5KN2 A;  3F6F A;  3MSZ A;  2MYG A;  3VPQ A;  8GSS A;  3R2Q A;  2PWJ A;  3ZTL A;  3LJR A;  1SYR A;  1PMT A;  2VM2 A;  5IO0 A;  2B5X A;  2F3M A;  4CW9 A;  1Z6M A;  5ID2 A;  3EU3 A;  4GLT A;  20GS A;  3TRX A;  4KW6 A;  2JL4 A;  1GLP A;  2R2J A;  3D5J A;  4IP1 A;  4WXT A;  4ZB9 A;  4HU9 A;  3KP9 A;  1X9S B;  5D8I A;  5C04 A;  1SD9 A;  2QA2 A;  1PN9 A;  2RLI A;  4HOJ A;  1XXU A;  4EDZ A;  1FOH A;  3ZVJ D;  4GXZ A;  3EVI A;  2C0E A;  3GFK A;  3IDV A;  2XC2 A;  1M0U A;  4H86 A;  4EKZ A;  2K9F A;  5IIZ A;  2H1A A;  4K9Z A;  10GS A;  1BX9 A;  3ZMK A;  3A2V A;  1Z3E A;  4MH2 A;  1BED A;  2H73 A;  3EIN A;  3BOA A;  3P2A A;  4KA0 A;  2O89 A;  5IPG A;  1OE7 A;  1A8Y A;  5HFI A;  3G7J A;  2HNL A;  1M99 A;  1N8J A;  3OR5 A;  3RHB A;  3VWV A;  2DIY A;  4MJC A;  5DCH A;  3DGQ A;  2E2G A;  3TRP A;  1Z5Y E;  3FW2 A;  3DXB A;  4K5R A;  3CSI A;  3IC8 A;  4OFM A;  1OYJ A;  2IWT A;  4GSN A;  2BJX A;  4E8E A;  2X8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...