4BWQA

Crystal structure of u5-15kd in a complex with pqbp1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
134
structure length
134
Chain Sequence
MLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords THIOREDOXIN-LIKE PROTEIN 4A
publication title Mutations in the Pqbp1 Gene Prevent its Interaction with the Spliceosomal Protein U5-15Kd.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 134
sequence length 134
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02966 DIM1 Mitosis protein DIM1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4bwqA00
4MZCA 3IHQA 2GSTA 3RHBA 4K7OA 3HVVA 3VWVA 4HI7A 5AGYA 4WEYA 2TIRA 4V2LA 5KN1A 5DAKA 1X9WB 4EO3A 2PBJA 2VLVA 2GZZA 5DBQA 1J08A 1ABAA 4ZL7A 5DCHA 4KB3A 3ZREA 4IQAA 2VO4A 5IO2A 5CREA 2GQLA 5J3RA 4MF5A 2PUKC 3KMOA 4WF5A 5ID2B 2L5OA 1TK5B 2YWNA 3KD0A 5EY6A 4E8EA 5GAPD 3UMAA 2O85A 1N8JA 7GSSA 4L5OA 4I2TA 4DVCA 1BAYA 8GSSA 6GSYA 5D9VA 1JFUA 2IN3A 1JZWA 1B8XA 1NM3A 3FZ4A 4GRFA 3Q6OA 2GZYA 11GSA 3WT2A 3L78A 5G5EA 2DJ3A 3UOMA 5A5KA 1G0TA 3RPPA 5COHA 1OC9B 1F3AA 1HNCA 1MTCA 4NHZA 3UARA 2KHPA 4J56E 3IA1A 1PL2A 4J2FA 3IOSA 4HU7A 17GSA 1AQXA 2MMOA 1TDIA 3RPNA 4XHMA 1Z9HA 1U3IA 2P31A 3D4TA 1O85A 2H75A 2AAWA 3FZ5A 1SD8A 5DAKB 5CRWA 4MZWA 3TKSE 3IRAA 3TKSA 1EWXA 3UEMA 1M2BA 1QK8A 2YZUA 2YANA 1NHYA 1MEKA 3RBTA 4K9ZA 5F8BA 2OACA 4KCEA 4NV2A 1F3BA 4TRXA 3S9FA 3VWWA 3MAKA 4MK3A 4OMVA 3N5OA 4IGJA 4OFTA 4IJ3A 2VD0A 2H74A 1J9BA 2IMDA 3F0IA 3VPTA 1SL2B 2VCVA 4AJ8A 4QQ7A 1EOGA 3D21A 1NW2A 4PQHA 2GQKA 1K0MA 3IAS2 1JZOA 1JLVA 3DEXA 5B8AA 2HLSA 4IW9A 3FZ9A 1TU8A 3TJKA 5J9CA 1TW9A 2M46A 2PERA 3F3QA 5ECQB 5HFKA 3TRPA 5LNKe 2ON7A 2H66A 3EU4A 6GSXA 4JRRA 4CDOA 2DJ1A 1QXHA 5IMZA 5IPHA 1PKWA 1EP7A 1T00A 2MBTA 2XBIA 4PGTA 4ACSA 1SYXA 1KEBA 5C00A 2VIMA 1BJXA 3O3TA 1QUWA 4MMMA 2YZHA 4HJMA 2E7PA 3ED3A 1PSQA 2EIOA 3M8NA 3LYPA 3CYNA 3ERFA 4KDUA 1URMA 2VCQA 3ZVJA 3LORA 5FHIA 3F6FA 4MCUA 3WGXA 1EP8A 5B8BA 3UVTA 4JZQA 4L8EA 1OKDA 2IMIA 3A3TA 2HRFA 1UA5A 3F63A 4ZB6A 4RI6A 2K8SA 1BG5A 1G6WA 1X5CA 4KSOA 2WJUA 3HHVA 5HQPA 2H1BA 3E0UA 3GX0A 3ZIVA 5ECMB 5EL8A 1VF3A 3PGTA 2A2SA 2NDOA 1X0RA 3KCMA 4V2MA 1E2YA 1BEDA 3TRXA 2C3QA 1X9SB 4K0GA 2XPEA 1X9MB 1TTZA 3I69A 4Q5FA 3O6TA 2YWIA 2VLTA 4N30A 4ECBA 4J57E 4NMUA 3ZRDA 3QFBC 2GT5A 2VCZA 1B4PA 3J7Yk 3ZFLA 1I9DA 4TVEA 1SKSB 4CHSA 3G7YA 3OR5A 3GSTA 1V9WA 2LJKA 4TR0A 4PXOA 1XPVA 1YQ1A 5IMAA 4KW6A 5JCGA 3GL3A 1Z7PA 2FWFA 3L9SA 3ERGA 4ZB8A 4TN8A 1DBYA 2X99A 13GSA 4ZIJA 1KNGA 4HU9A 2HRNA 1FVJA 2C3NA 1K3LA 3SWLA 3LSZA 4O7HA 2WGRA 2AV4A 1TU7A 3L4NA 4BL7A 1ERTA 2ZUPA 2VM2A 1Z6NA 2IFQA 1XXUA 2NBSA 5J5NA 4PNFA 2BTOT 4WXTA 2HSYA 4P3YB 5HFIA 1XVQA 2IPAA 3CMIA 4BWSA 3ZMKA 4XIHA 1EGRA 6GSSA 4LA1A 5GSTA 4EF0A 3DVXA 2OJLA 1WWJA 4ISDA 14GSA 1Y25A 1M9AA 1PN9A 1XWAA 3HJOA 4GXZA 5G1LA 1Z5YE 4GCIA 1BQ7A 3GUSA 5LCZA 16GSA 3H93A 2RLIA 2BMXA 3MNGA 3TKQA 1V2AA 2NPBA 2JADA 5D9WA 2HZEB 1CQGA 4TXVA 1IYHA 2YCDA 3KMNA 3RAZA 3A2VA 1GL8A 5DALA 1A23A 3HCZA 4BPYA 4MJAA 4KDXA 5L71A 4AF2A 1FB0A 1T7PB 1DE1A 1AW9A 4MH3A 2H30A 1TOFA 3EWLA 1OKTA 2WCIA 4JR4A 3GH6A 4YQUA 3KP8A 2C4JA 1B4QA 2XPDA 1FHEA 4HQSA 1XOAA 1A0FA 1UC7A 4NWYA 4IS0A 5D9TA 5CRGA 3D4MA 1O73A 3EU3A 4X0XA 2EC4A 2FHEA 1JHBA 2DIZA 2E2GA 1X5DA 1OC8A 3D0ZA 5G5FA 2LEGA 3GV1A 2BJXA 1ZL9A 3APSA 1WOUA 3F6DA 1EZKA 2IWTA 2MYGA 2GSQA 1FG4A 3GL5A 4JBBA 3KEBA 4MLYA 3KGKA 2FA8A 1SK0A 3P7XA 5B7CA 5ECIB 2ALBA 1K0AA 2PGTA 4WBRD 1OVNA 5AN1A 5ECHB 2V32A 3IR4A 2CT6A 5DJMA 2MMZA 4DSRA 2OADA 2N5AA 3AY8A 22GSA 3QAVA 1GTAA 4DSSA 2L4QA 1B48A 4N10A 2IMKA 1CQHA 2GZPA 3M3MA 5CO3A 3KXOA 4MABA 1TI1A 2O7KA 4X43A 1AUCA 4EE0A 2CX3A 1RQMA 4GTUA 3FHKA 3VFIA 1SU9A 1T4YA 5D9XA 1WPIA 3GNJA 4TR4A 2FNOA 4I5QA 2GQMA 4HJ2A 3FW2A 1T1VA 3RHCA 3MSZA 1GSYA 1B9XC 4KCAA 2CZ2A 4PX1A 2YV7A 1TRVA 4QL9A 1O7UA 3ZYWA 1O8WA 1EGOA 3APOA 1XBSA 4BA7A 2DJ0A 2H71A 4FH8A 4IVFA 4OO4A 2OE0A 1ERVA 2O87A 1SKRB 1OE7A 4XRDA 4EVMA 1K0NA 4WF4A 5JWQB 4MP4A 2LRTA 18GSA 3DGQA 3F4TA 3N9JA 3VWXA 9GSSA 1TRUA 4ILFA 3EC3A 2V2GA 3Q19A 4YQVA 1R5PA 4I8BA 3TJFA 1XW9A 4XS6A 3JCML 3CTGA 1YEPA 4EKZA 2YV9A 3A5WA 4GLTA 3F8UA 6GSWA 3HA9A 4TR1B 2PU9C 1GSDA 2H70A 4PUFC 2F8AA 1ZYQB 2FLSA 1WRYA 1TRSA 2VUPA 5F05A 4GSTA 4TR3A 4ECIA 3IAM2 1AIUA 4OD7A 4RI7A 2TRXA 4Z7XA 2DC5A 5H5SA 3M9JA 4F0CA 4QL7A 1QQ2A 5A4WA 3U6VA 2RUFA 1U87A 2H73A 2YP6A 2MMNA 3EE2A 4HDEA 1SK1A 4ZXGA 2JZRA 3WGDA 1ERUA 2P5RA 1AC1A 4H86A 3IK9A 3TKPA 3UAPA 2H6XA 3QFAC 2N5BA 4XTSA 1K0DA 1XCCA 4Q5RA 3U5RE 2YJHA 3ME7A 2Z9SA 1GUHA 4TXOA 5IMVA 2F9SA 1GULA 3EVIA 2DSAA 5ENUA 3FY7A 3UL3A 2PPTA 1SJ6A 4MJCA 3LJRA 5G30A 2C0GA 3VI5A 3HYPA 1IYIA 3GIXA 3LFLA 5CRHA 1K3OA 1M2DA 6GSVA 5AIVA 4WBJA 2F51A 1ZYEA 3C7MA 1HNBA 5J41A 1OE8A 1W4VA 3GTUA 4OO5A 5JCWA 4IN0A 3ZMLA 1LBKA 2J23A 3C8EA 4NXIA 3DIEA 3KH7A 2B7JA 4K2DA 4K1FA 3VI7A 1M7TA 2JZTA 3DXBA 3NZNA 3H8QA 1I5GA 3C1RA 2R6KA 5F07A 2NTOA 2LSTA 3D6IA 4ID0A 3FK8A 1PMTA 3C1SA 2LNTA 4PURA 2I4AA 4K6XA 4HEA2 3LEFA 2PMTA 4HZ2A 3ZFBA 3O76A 4ZBDA 3QDNA 3HVXA 3ISOA 1FOVA 5CAXA 4POBA 3BBYA 3D22A 5DQYA 3FKFA 1YF1A 1VF1A 2IMFA 4GQCA 1GUKA 2MBSA 2FA4A 3A2XA 2KP1A 4FO5A 5JWOB 3C71A 4JR6A 2P5QA 4ML1A 1PGTA 2DIYA 2H6YA 4I2UA 1THOA 5DVBA 5C04A 3J7Yb 1EV9A 2O8VB 2LKUA 2PWJA 3P90A 5EVOA 2WULA 1MD4A 3FR6A 3HD5A 1K0OA 4X1UA 4LLRA 1AAZA 4WR5A 2H72A 2HFDA 4PNGA 2K9FA 5AISA 20GSA 2HI7A 5ECSA 5DDLA 4L0UA 1AQVA 2L4CA 3BCKA 2HE3A 4KDYA 1Q98A 2R5GA 2GSSA 2R37A 1QGVA 3KP9A 4OCEA 3TOUA 3VK9A 3GSSA 4LMWA 1Z7RA 2H76A 1PD21 1ON4A 2B5EA 3DMLA 2DLXA 3KIJA 3US3A 4F82A 5DCGA 2YOIA 2QC7A 5IPGA 1G7EA 3F4SA 5HFGA 4IHUA 4ZL9A 5J4UA 4YAVA 5CRDA 4BVYA 1SJZA 2M80A 1V57A 1WIKA 2B1KA 3DWVA 3R2QA 2LRCA 1EOHA 3NIVA 1FB6A 2H8LA 2C0EA 3MWHA 1A2LA 1Z3EA 1VF4A 5FWGA 3QD9A 2A2RA 3TOTA 1M9BA 3GKKA 3GKXA 2OE1A 5E59A 2VCWA 3EINA 4N11A 2IL3A 3GH9A 4FYCA 2R3XA 3HY2A 4F0BA 1TK8B 3HZ8A 1GWCA 1V58A 5D8IA 1YY7A 2I81A 2A4VA 5ECNB 1XVWA 5KN0A 1USBA 4G9HA 3FRCA 4F03A 1S3AA 1SENA 3G9BA 4D73A 2PN8A 3KZQA 4KGIA 2ON5A 3EURA 1FO5A 2QGVA 2VD1A 4XS4A 5ELGA 2IMEA 1DSBA 1F9MA 5IMFA 2JU5A 2WB9A 3APQA 4FYUA 1MDKA 1A0RP 1OYJA 1SYRA 2WRTA 2C1YA 4OWYA 2R2JA 4KUNA 1KTEA 4MZBA 3L9UA 3HVSA 3DD3A 3LYKA 1GLQA 1TRWA 3D5JA 4HS1A 2D2ZA 5HR3A 3UVHA 2KP2A 4RQRA 5GSSA 2C0DA 5A4VA 3CSIA 1X5EA 4AGSA 2P0GA 4KX4A 4TKYA 1QFNA 2LS5A 1H4OA 2WFCA 1XWCA 4OCFA 1GNEA 3TRQA 2LUSA 2IFQB 3EMPA 2LNSA 2V41A 2ES7A 4EL1A 2ZCTA 1PQNA 3GRXA 2GT6A 2RUEA 2I9HA 4I6XA 3CTFA 1YEXA 1YF0A 1M0UA 3GX8A 2L57A 4YQMA 3PR8A 5KN2A 2V6KA 3PINA 5IOWA 2M72A 5GAND 4LL4B 1SJIA 4ZILA 5ID2A 5A4UA 1Y6EA 2FY6A 5B6MA 5IIZA 1AXDA 1WE0A 2L6CA 1YDKA 3TJJA 5D93A 2DJJA 3DVWA 2VL2C 2MZCA 1LJRA 1GSFA 2JZSA 2E0QA 4MF6A 1GH2A 5CYYA 4XS4B 1UN2A 4KE3A 4JU5A 5DALB 1VRSD 1ERWA 3GA4A 4POMA 3LQ7A 3HJMA 5FT3A 2B5YA 4XRAA 1OC9A 3LXZA 2B1LA 2WDUA 4GQFA 4YAPA 2GVPA 4WR4A 2AHEA 4ULXA 1JZDA 1M99A 3QAWA 4HZ4A 3ME8A 3QR6A 2EIRA 3Q18A 4O92A 4KNDA 5ECOB 3KTBA 1TI3A 1HD2A 2C3TA 2NVLA 2HXKA 4G10A 4KSMA 1GTIA 2FWGA 4F9ZA 1R7HA 3W8JA 3HKRA 1F37A 2DJKA 3ZTLA 3SBCA 3A2WA 2VL3A 5DJLA 4CW9A 4IJIA 3G7IA 2OKAA 3IDVA 2DMLA 4L0WA 1RW1A 3FYGA 12GSA 3UBKA 1XW5A 3TB2A 5IOXA 4MJBA 4ECJA 2YWMA 4HQZA 1UVZA 3CSHA 3BD2A 3ZZXA 3RDWA 1EEJA 4NAXA 3ZL5A 4BVXA 1U3AA 5ECLB 1F2EA 3FZAA 1O6JA 5KN3A 1XWBA 4JE1A 2HZFA 3IPZA 3G7JA 4DSQA 1ZMAA 1ILOA 2L5LA 1HQOA 4ZBAA 2DBCA 1U88A 1DE2A 2K18A 3LG6A 4DSSB 4EXJA 3P8WA 2AUVA 4GWRA 1TP9A 2WZ9A 1WP0A 1XW6A 1C72A 1OAZA 5H5RA 3TJGA 5E4WA 5LD0A 2H1AA 3GKMA 2JL4A 2FWEA 3DYRA 3LWAA 1ACVA 5B6NA 2V6OA 1R4WA 2PVQA 3WT1A 4Q5QA 4G19A 2GTUA 3VURA 4GSSA 3EMXA 1DUGA 2H0IA 2VLUA 2KUCA 5ECRB 1FW1A 1PA3A 1VGLA 4YH2A 4POLA 6GSTA 1Z6MA 3E3EA 4ECCA 3GKNA 2H01A 2WS2A 5KEJA 1XOBA 2H1GA 5DQSA 2GGTA 4IP1A 2QKEA 5AIXA 1RK4A 2CZ3A 1WJKA 3H1NA 3CRUA 4HUAA 4O5RA 2FCHA 3KH9A 2VCTA 1YKCA 3F3RA 1GTUA 3C73A 3I43A 1GTBA 4IQ1A 1ZCPA 2CVKA 4NV5A 2CAQA 3EYTA 4K8MA 5D73A 3H79A 2JSZA 3IE3A 5IQYA 2C0FA 2L59A 1KBNA 3IBHA 3ZVJD 5GZZB 2CVBA 1K3YA 1BX9A 4MH2A 5ECKB 1PL1A 1ML6A 3KM6A 3Q74A 2H1DA 2CV4A 3BOAA 4EDYA 1W89A 4ZBBA 2X8CA 1XIYA 4MDCA 3FEUA 3CSJA 5J9BA 2PVOC 4IBPA 4AJ7A 2XBQA 3WD6A 1LU4A 2GS3A 3W8SA 3GMFA 2B3SA 2DMMA 4V2NA 2HYXA 4E8HA 5JWRB 1JZRA 4L5LA 4XCSA 3I9V2 2CAIA 4BWQA 1GSUA 1ZGNA 5HR2A 1V98A 2AJQB 2CVDA 1BYEA 1PKZA 2OA7A 1A8LA 1G7OA 2LJRA 1GSQA 2VM1A 3LXTA 2FGXA 2N5FA 2XHFA 4WKWA 4G2EA 2OBIA 3ZITA 3GURA 1PX6A 2H19A 2KLXA 2B6MA 4N0VA 5ECPB 1ZZYA 3HJPA 2QSIA 3VLNA 1TJDA 1K0CA 1S3DA 4K7NA 3WGEA 2H6ZA 2JSYA 6GSUA 1THXA 2HT9A 1J0FA 4KAEA 2L6DA 2GLRA 1EEMA 1XFLA 4TXOB 1A2JA 1XWGA 5F0GA 1MD3A 3CXGA 2G0FA 1GSEA 2LQQA 2CQ9A 2CX4A 3L9VA 1ST9A 3KJYA 1A2MA 5JCUA 2RM5A 3L0HA 4OFNA 1YZXA 4O32A 3ERWA 5HR0A 3W6GA 2AB6A 5CNWA 4KA0A 4K0NA 3HDCA 1EV4A 2VL2A 4MA9A 3GTUB 3K8NA 4KH7A 4EDZA 2H0HA 3PH9A 1K0BA 2HZEA 1FVKA 1GNWA 3QOUA 2H0GA 1NSWA 4RQXA 1T4ZA 4K7IA 2LRNA 4EC0A 2B5XA 3DRNA 1GUMA 5CP1A 5H5QA 2X8GA 5G1KA 2LJAA 1NHOA 3BJ5A 4IKHA 3UIWA 2YWOA 4ZL8A 4GF0A 4NPBA 3TUEA 2LQOA 1Q4JA 2J9HA 1E6BA 4HOJA 2FWHA 4F2IA 1GRXA 3WYWA 2VOCA 2C80A 2IJYA 3M9KA 2LTKA 3GFKA 5INYA 4AJ6A 1YKAA 1MDIA 3TKSC 4Q5NA 3F9UA 3I6AA 4IELA 1SL0B 5F06A 2CA8A 2O89A 3TDGA 3ZIJA 2LV3A 4IP6A 3IK7A 2B7KA 3FR9A 5ABRA 19GSA 1GSSA 1S3CA 2VCXA 3VPQA 2VL9A 2C8UA 1QMVA 2YJ7A 4LL1B 4ML6A 1U6TA 2KOKA 1VF2A 1WMJA 5D96A 1O8XA 1T3BA 2RM6A 3HZ4A 3UJ1A 1YJ6A 4WETA 1JLWA 2OE3A 3P2AA 3NOFA 4N0ZA 1F6MC 3F4RA 3TJBA 4I97A 3MDKA 2G2QA 1SD9A 2YPMA 2K6VA 3CRTA 1SKWB 2GSRA 4LMVA 3TKRA 1R5AA 3IXRA 1GP1A 2X64A 3GN3A 1T8EB 4V1Ap 2EIQA 4RUVA 10GSA 2TRCP 2X8HA 2MMAA 2ZNMA 4POKA 1M2AA 4DEJA 3QPMA 4PQ1A 3TGZA 2REMA 4MPFA 3ZLPA 1MDJA 2HNLA 4EUYA 1G6YA 1PRXA 4PUAA 1TXXA 5EPFA 2VAFA 1HYUA 2GDRA 2I1UA 3TCOA 2V1MA 2AYTA 1GLPA 4GSNA 1N2AA 2FD3A 4MF7A 1FAAA 3FR3A 4TW5A 3IV4A 1O81A 2JACA 2YNXA 1OC3A 3V1WA 2XC2A 1AQWA 2F8FA 1XZOA 1XWKA 3HXSA 5ELAA 2K8VA 4NHWA 4OFMA 3CBUA 2I3YA 3M1GA 4D73B 1HNAA 2YN1A 3E9JB 3QCPA 1H75A 5IMDA 2FUG2 2OBKA 3GYKA 1TK0B 1SL1B 3M0FA 3GHAA 4MJEA 4XS1A 5IMCA 5G31A 1V40A 2IIYA 1TKDB 2HSHA 4FYBA 3LGCA 2R4VA 2DJ2A 1SK2A 5IM9A 5G2ZA 3BCIA 4TR1A 5IO0A 1ZOFA 3QAGA 3DKSA 1A24A 1PX7A 3KTLA 4V1Ag 1R26A 3H4KA 2F3MA 4JEDA 4PQIA 3IC4A 2RIIA 4ZB9A 1A8YA 4FIWA 3QMXA 5HR1A 3UBLA 4MPGA 2E2MA 1B9YC 3VWUA 4TOPA
chains in the Genus database with same CATH superfamily
4MZCA 3IHQA 2GSTA 3RHBA 4K7OA 3HVVA 3VWVA 4HI7A 5AGYA 4WEYA 2TIRA 4V2LA 5KN1A 5DAKA 1X9WB 4EO3A 2PBJA 2VLVA 2GZZA 5DBQA 1J08A 1ABAA 4ZL7A 5DCHA 4KB3A 3ZREA 4IQAA 2VO4A 3EPTA 5IO2A 5CREA 2GQLA 5J3RA 4MF5A 2PUKC 3KMOA 4WF5A 5ID2B 2L5OA 1TK5B 2YWNA 3KD0A 2DKIA 5EY6A 4E8EA 5GAPD 4Z2UA 3UMAA 2O85A 1N8JA 7GSSA 4L5OA 4I2TA 4DVCA 1BAYA 8GSSA 6GSYA 5D9VA 1JFUA 2IN3A 1JZWA 1B8XA 1NM3A 3FZ4A 4GRFA 3PPUA 3Q6OA 2GZYA 11GSA 3WT2A 3L78A 5G5EA 2DJ3A 3UOMA 5A5KA 1G0TA 3RPPA 5COHA 1OC9B 1F3AA 1HNCA 1MTCA 4NHZA 3UARA 2KHPA 4J56E 5KOXA 3IA1A 1PL2A 4J2FA 2HSMA 3IOSA 4HU7A 17GSA 1AQXA 2MMOA 1TDIA 3RPNA 4XHMA 1Z9HA 1U3IA 2P31A 3D4TA 1O85A 2H75A 2AAWA 3FZ5A 1SD8A 5DAKB 5CRWA 4MZWA 3TKSE 3IRAA 3TKSA 1EWXA 3UEMA 1M2BA 1QK8A 2YZUA 2YANA 1NHYA 1MEKA 3RBTA 4KF9A 4K9ZA 3CQFA 5F8BA 2OACA 2R0CA 4KCEA 4NV2A 1F3BA 4TRXA 3S9FA 4FQUA 3VWWA 3MAKA 4MK3A 4OMVA 3N5OA 4IGJA 4OFTA 4IJ3A 2VD0A 4PTSA 4BVXB 2H74A 1J9BA 2IMDA 3F0IA 3VPTA 1SL2B 2VCVA 4AJ8A 4QQ7A 1EOGA 3D21A 1NW2A 4PQHA 2GQKA 1K0MA 3IAS2 1JZOA 1JLVA 3DEXA 5B8AA 2HLSA 4IW9A 3FZ9A 1TU8A 3TJKA 5J9CA 1TW9A 2M46A 2PERA 3F3QA 5ECQB 5HFKA 3TRPA 5LNKe 2ON7A 2H66A 3EU4A 6GSXA 4JRRA 4CDOA 2DJ1A 1QXHA 5IMZA 5IPHA 1PKWA 1EP7A 1T00A 2MBTA 2XBIA 4PGTA 4ACSA 1SYXA 1KEBA 5C00A 2VIMA 1BJXA 3O3TA 1QUWA 4MMMA 2YZHA 4HJMA 2E7PA 4K5RA 3ED3A 1PSQA 2EIOA 3M8NA 3LYPA 3CYNA 3ERFA 4KDUA 1URMA 2VCQA 3ZVJA 3LORA 5FHIA 3F6FA 4MCUA 3WGXA 1EP8A 5B8BA 3UVTA 2HRAA 4JZQA 4L8EA 1OKDA 5KOWA 2IMIA 3A3TA 2HRFA 1UA5A 3F63A 4ZB6A 4RI6A 2K8SA 1BG5A 1G6WA 1X5CA 4KSOA 2WJUA 3HHVA 5HQPA 2H1BA 2R0GA 3E0UA 3GX0A 3ZIVA 5ECMB 5EL8A 1VF3A 3PGTA 2A2SA 2NDOA 1X0RA 1M3JA 3KCMA 4V2MA 1E2YA 1BEDA 3TRXA 2C3QA 1X9SB 4K0GA 2XPEA 1X9MB 1TTZA 3I69A 4Q5FA 3O6TA 2YWIA 2VLTA 4N30A 4ECBA 3IC8A 4J57E 4NMUA 3ZRDA 3QFBC 2GT5A 2VCZA 1B4PA 3J7Yk 3ZFLA 1I9DA 4TVEA 1SKSB 4CHSA 3G7YA 3OR5A 3GSTA 1V9WA 2LJKA 4TR0A 4PXOA 1XPVA 1YQ1A 5IMAA 4KW6A 5JCGA 3GL3A 1Z7PA 2FWFA 3L9SA 3ERGA 4ZB8A 4TN8A 1DBYA 2X99A 1FOHA 13GSA 4ZIJA 1KNGA 4HU9A 2HRNA 1FVJA 2C3NA 1K3LA 4YKGA 3SWLA 3LSZA 4O7HA 2WGRA 2AV4A 1TU7A 3L4NA 4BL7A 1ERTA 2ZUPA 2VM2A 1Z6NA 2IFQA 1XXUA 2NBSA 5J5NA 4PNFA 2BTOT 4WXTA 2HSYA 4P3YB 5HFIA 1XVQA 2IPAA 3CMIA 4BWSA 3ZMKA 4XIHA 1EGRA 6GSSA 4LA1A 5GSTA 4EF0A 3DVXA 2OJLA 1WWJA 4ISDA 4EIPA 14GSA 1Y25A 1M9AA 1PN9A 1XWAA 3HJOA 4GXZA 5G1LA 1Z5YE 4GCIA 1BQ7A 3GUSA 5LCZA 16GSA 3H93A 2RLIA 2BMXA 3MNGA 3TKQA 1V2AA 2A4HA 2NPBA 2JADA 5D9WA 2HZEB 1CQGA 4TXVA 1IYHA 2YCDA 3KMNA 3RAZA 3A2VA 1GL8A 5DALA 1A23A 3HCZA 4BPYA 4MJAA 4KDXA 5L71A 4AF2A 1FB0A 1T7PB 4K5SA 5BMUA 1DE1A 3IHGA 1AW9A 4MH3A 2H30A 1TOFA 3EWLA 1OKTA 2WCIA 4JR4A 3GH6A 4YQUA 3KP8A 2C4JA 1B4QA 2XPDA 1FHEA 2QA1A 4HQSA 1XOAA 1A0FA 1UC7A 4NWYA 4IS0A 5D9TA 5CRGA 3D4MA 1O73A 3EU3A 4X0XA 2EC4A 2FHEA 1JHBA 2DIZA 2E2GA 1X5DA 1OC8A 3D0ZA 5G5FA 2LEGA 3GV1A 2BJXA 1ZL9A 3APSA 1WOUA 3F6DA 1EZKA 2IWTA 2MYGA 2GSQA 1FG4A 3GL5A 4JBBA 3KEBA 4MLYA 4G0LA 3KGKA 2FA8A 1SK0A 3P7XA 5B7CA 5ECIB 2ALBA 1K0AA 2PGTA 4WBRD 1OVNA 5AN1A 5ECHB 2V32A 3IR4A 2CT6A 5DJMA 2MMZA 4DSRA 2OADA 2N5AA 3AY8A 22GSA 3QAVA 4CY8A 1GTAA 4DSSA 2L4QA 1B48A 4N10A 2IMKA 1CQHA 2GZPA 3M3MA 5CO3A 3KXOA 4MABA 1TI1A 2O7KA 4X43A 1AUCA 4EE0A 2CX3A 1RQMA 4GTUA 3FHKA 3VFIA 1SU9A 4Z2RA 1T4YA 5D9XA 1WPIA 3GNJA 4TR4A 2FNOA 4I5QA 2GQMA 4USSA 4HJ2A 4O5QA 3FW2A 1T1VA 3RHCA 3MSZA 1GSYA 1B9XC 4KCAA 2CZ2A 4PX1A 2YV7A 1TRVA 4QL9A 1O7UA 3ZYWA 1O8WA 1EGOA 3APOA 1XBSA 4BA7A 2DJ0A 2H71A 4FH8A 4IVFA 4OO4A 2OE0A 1ERVA 2O87A 1SKRB 1OE7A 4XRDA 4EVMA 1K0NA 4WF4A 5JWQB 4MP4A 2LRTA 2UZ8A 18GSA 3DGQA 3F4TA 3N9JA 3VWXA 9GSSA 1TRUA 4ILFA 3EC3A 2V2GA 3Q19A 4YQVA 1R5PA 4I8BA 3TJFA 1XW9A 4XS6A 3JCML 3CTGA 1YEPA 4EKZA 2YV9A 3A5WA 4GLTA 3F8UA 6GSWA 3HA9A 4TR1B 2PU9C 1GSDA 2H70A 4PUFC 2F8AA 1ZYQB 2FLSA 1WRYA 1TRSA 2VUPA 5F05A 4GSTA 4TR3A 4ECIA 3IAM2 1AIUA 4OD7A 4RI7A 2TRXA 3FMWA 4Z7XA 2DC5A 5H5SA 3M9JA 4F0CA 4QL7A 1QQ2A 5A4WA 3U6VA 2RUFA 1U87A 2H73A 2YP6A 2MMNA 3EE2A 4HDEA 1SK1A 4ZXGA 2JZRA 3WGDA 1ERUA 2P5RA 1AC1A 4H86A 3IK9A 3TKPA 3UAPA 2H6XA 3QFAC 2N5BA 4XTSA 1K0DA 1XCCA 4Q5RA 3U5RE 2YJHA 3ME7A 2Z9SA 1GUHA 4TXOA 5IMVA 2F9SA 1GULA 3EVIA 2DSAA 5ENUA 4CY6A 3FY7A 3UL3A 2PPTA 1SJ6A 4MJCA 3LJRA 5G30A 2C0GA 3VI5A 1ZYNA 3HYPA 1XG8A 1IYIA 3GIXA 3LFLA 5CRHA 1K3OA 1M2DA 6GSVA 5AIVA 4WBJA 2F51A 1ZYEA 3C7MA 1HNBA 5J41A 1OE8A 2X49A 1W4VA 3GTUA 4OO5A 5JCWA 4IN0A 3ZMLA 1LBKA 2J23A 3C8EA 4NXIA 3DIEA 3KH7A 2B7JA 4K2DA 4K1FA 3VI7A 1M7TA 2JZTA 3DXBA 3NZNA 3H8QA 1I5GA 3C1RA 2R6KA 5F07A 2NTOA 2LSTA 3D6IA 4ID0A 3FK8A 1PMTA 3C1SA 2LNTA 4PURA 4Z2TA 2I4AA 4K6XA 4HEA2 3LEFA 2PMTA 4HZ2A 3ZFBA 3O76A 4ZBDA 3QDNA 3HVXA 3ISOA 1FOVA 5CAXA 4POBA 3BBYA 3D22A 5DQYA 3FKFA 1YF1A 1VF1A 2IMFA 4GQCA 1GUKA 2MBSA 2FA4A 3A2XA 2KP1A 4FO5A 5JWOB 3C71A 4JR6A 2P5QA 4ML1A 4EIQA 1PGTA 2DIYA 2H6YA 4I2UA 1THOA 5DVBA 5C04A 3J7Yb 1EV9A 2O8VB 2LKUA 2PWJA 3P90A 2WULA 5EVOA 1MD4A 3FR6A 3HD5A 1K0OA 4X1UA 4LLRA 1AAZA 4WR5A 2H72A 2HFDA 4PNGA 2K9FA 5AISA 20GSA 2HI7A 5ECSA 5DDLA 4YKFA 4L0UA 1AQVA 2DKHA 2L4CA 3BCKA 2HE3A 4KDYA 1Q98A 2R5GA 2GSSA 2R37A 1QGVA 3KP9A 4OCEA 3TOUA 3VK9A 3GSSA 4LMWA 1Z7RA 2H76A 1PD21 1ON4A 2B5EA 3DMLA 2DLXA 3KIJA 3US3A 4F82A 5DCGA 2YOIA 2QC7A 5IPGA 1G7EA 3F4SA 5HFGA 4IHUA 4ZL9A 5J4UA 4YAVA 5CRDA 5BRTA 4BVYA 1SJZA 2M80A 1V57A 1WIKA 2B1KA 3DWVA 3R2QA 2LRCA 1EOHA 3NIVA 1FB6A 2H8LA 2C0EA 3MWHA 1A2LA 1Z3EA 1VF4A 5FWGA 3QD9A 2A2RA 3TOTA 1M9BA 3GKKA 3GKXA 2OE1A 5E59A 2VCWA 3EINA 4N11A 2IL3A 3GH9A 4FYCA 2R3XA 3HY2A 4F0BA 1TK8B 3HZ8A 1GWCA 1V58A 5D8IA 1YY7A 3A5IA 2I81A 2A4VA 5ECNB 1XVWA 5KN0A 1USBA 4G9HA 3FRCA 4F03A 1S3AA 1SENA 3G9BA 4D73A 2PN8A 3KZQA 4KGIA 2ON5A 3EURA 1FO5A 2QGVA 2VD1A 4XS4A 5ELGA 2IMEA 1DSBA 1F9MA 5IMFA 2JU5A 2WB9A 3APQA 4FYUA 1MDKA 1A0RP 1OYJA 1SYRA 2WRTA 2C1YA 4OWYA 2R2JA 4KUNA 4HSCX 1KTEA 4MZBA 3L9UA 3HVSA 3DD3A 3LYKA 1GLQA 1TRWA 3D5JA 4HS1A 2D2ZA 5HR3A 3UVHA 2KP2A 4RQRA 5GSSA 2C0DA 5A4VA 3CSIA 1X5EA 4AGSA 2P0GA 4KX4A 4TKYA 4BVYB 1QFNA 2LS5A 1H4OA 2WFCA 1XWCA 4OCFA 4BL7B 1GNEA 3TRQA 2LUSA 2IFQB 3EMPA 2LNSA 2V41A 2ES7A 4EL1A 2ZCTA 1PQNA 3GRXA 2GT6A 2RUEA 2I9HA 4I6XA 3CTFA 1YEXA 1YF0A 1M0UA 3GX8A 2L57A 4YQMA 3PR8A 5KN2A 2V6KA 3PINA 5IOWA 2M72A 5GAND 4LL4B 1SJIA 4ZILA 5ID2A 5A4UA 1Y6EA 2FY6A 5B6MA 5IIZA 1AXDA 1WE0A 2L6CA 1YDKA 3TJJA 5D93A 2DJJA 3DVWA 2VL2C 2MZCA 1LJRA 1GSFA 2JZSA 2E0QA 4MF6A 1GH2A 5CYYA 4XS4B 1UN2A 4KE3A 4JU5A 5DALB 1VRSD 1ERWA 3GA4A 4POMA 3LQ7A 3HJMA 5FT3A 2B5YA 4XRAA 1OC9A 3LXZA 2B1LA 2WDUA 4GQFA 4YAPA 2GVPA 4WR4A 2AHEA 4ULXA 1JZDA 1M99A 1M3IA 3QAWA 4HZ4A 3ME8A 3QR6A 2EIRA 3Q18A 4O92A 4KNDA 5ECOB 1PN0A 3KTBA 1TI3A 1HD2A 2C3TA 2NVLA 2HXKA 4G10A 4KSMA 1GTIA 2FWGA 4F9ZA 1R7HA 3W8JA 3HKRA 1F37A 2DJKA 3ZTLA 3SBCA 3A2WA 2VL3A 5DJLA 4CW9A 4IJIA 3G7IA 2OKAA 1PFOA 3HVNA 3IDVA 2DMLA 4L0WA 1RW1A 3FYGA 12GSA 3UBKA 1XW5A 3TB2A 5IOXA 4MJBA 4ECJA 2YWMA 4HQZA 1UVZA 3CSHA 3BD2A 3ZZXA 3RDWA 1EEJA 4NAXA 3ZL5A 4BVXA 1U3AA 5ECLB 1F2EA 3FZAA 1O6JA 5KN3A 1XWBA 4JE1A 2HZFA 3IPZA 3G7JA 4DSQA 1ZMAA 1ILOA 2L5LA 1HQOA 4ZBAA 2DBCA 1U88A 1DE2A 2K18A 3LG6A 4DSSB 4EXJA 3MYDA 3P8WA 2AUVA 4GWRA 1TP9A 2WZ9A 1WP0A 1XW6A 1C72A 1OAZA 5H5RA 3TJGA 2QA2A 5E4WA 5LD0A 2H1AA 3GKMA 2JL4A 2FWEA 3DYRA 3LWAA 1ACVA 5B6NA 2V6OA 1R4WA 2PVQA 3WT1A 4Q5QA 4G19A 2GTUA 3VURA 4MNNA 4GSSA 3EMXA 1DUGA 2H0IA 2VLUA 2KUCA 5ECRB 1FW1A 1PA3A 1VGLA 4YH2A 4POLA 6GSTA 1Z6MA 3E3EA 4ECCA 3GKNA 2H01A 2WS2A 5KEJA 1XOBA 2H1GA 5DQSA 2GGTA 4IP1A 2QKEA 5AIXA 1RK4A 2CZ3A 1WJKA 3H1NA 3CRUA 4HUAA 4O5RA 2FCHA 3KH9A 2VCTA 1YKCA 3F3RA 1GTUA 3C73A 3I43A 1GTBA 4IQ1A 1ZCPA 2CVKA 4NV5A 2CAQA 3EYTA 4K8MA 5D73A 3H79A 2JSZA 3IE3A 5IQYA 2C0FA 2L59A 1KBNA 3IBHA 3ZVJD 5GZZB 2CVBA 1K3YA 1BX9A 4MH2A 5ECKB 1PL1A 1ML6A 3KM6A 3Q74A 2H1DA 2CV4A 3BOAA 4EDYA 1W89A 4ZBBA 2X8CA 1XIYA 4MDCA 3FEUA 3CSJA 5J9BA 2PVOC 4IBPA 4AJ7A 2XBQA 3WD6A 1LU4A 2GS3A 3W8SA 3GMFA 2B3SA 2DMMA 4V2NA 2HYXA 4E8HA 5JWRB 1JZRA 4L5LA 4XCSA 3I9V2 2CAIA 4BWQA 1GSUA 1ZGNA 5HR2A 3MIXA 1V98A 2AJQB 2CVDA 1BYEA 1PKZA 2OA7A 1A8LA 1G7OA 4G0KA 2LJRA 1GSQA 2VM1A 3LXTA 2FGXA 2N5FA 2XHFA 4WKWA 4G2EA 2OBIA 3ZITA 3GURA 1PX6A 4X4JA 2H19A 2KLXA 2A2PA 2B6MA 4N0VA 5ECPB 1ZZYA 3HJPA 2QSIA 3VLNA 1TJDA 1K0CA 1S3DA 4K7NA 3WGEA 2H6ZA 2JSYA 6GSUA 1THXA 2HT9A 1J0FA 4KAEA 2L6DA 2GLRA 1EEMA 1XFLA 4TXOB 1A2JA 1XWGA 5F0GA 1MD3A 3CXGA 2G0FA 1GSEA 2LQQA 2CQ9A 2CX4A 3L9VA 1ST9A 3KJYA 1A2MA 5JCUA 2RM5A 3L0HA 4OFNA 4G0IA 1ZYPA 1YZXA 4O32A 3ERWA 5HR0A 3W6GA 2AB6A 5CNWA 4KA0A 4K0NA 3HDCA 1EV4A 2VL2A 3R3EA 4MA9A 3GTUB 3K8NA 4KH7A 4EDZA 2H0HA 3PH9A 1K0BA 2HZEA 1FVKA 1GNWA 3QOUA 2H0GA 1NSWA 4RQXA 1T4ZA 4K7IA 2LRNA 4BIKA 4EC0A 2B5XA 3DRNA 1GUMA 5CP1A 5H5QA 2X8GA 5G1KA 2LJAA 1NHOA 3BJ5A 4IKHA 3UIWA 2YWOA 4ZL8A 4GF0A 4NPBA 3TUEA 2LQOA 1Q4JA 2J9HA 1E6BA 4HOJA 1S3RA 2FWHA 4F2IA 1GRXA 3WYWA 2VOCA 2C80A 2IJYA 3LW9A 3M9KA 2LTKA 3GFKA 5INYA 4AJ6A 1YKAA 1MDIA 3TKSC 4Q5NA 3F9UA 3I6AA 4IELA 1SL0B 5F06A 2CA8A 2O89A 3TDGA 3ZIJA 2LV3A 4IP6A 3IK7A 2B7KA 3FR9A 5ABRA 19GSA 1GSSA 1S3CA 2VCXA 3VPQA 2HRKA 2VL9A 2C8UA 1QMVA 2YJ7A 4LL1B 4ML6A 1U6TA 4ICYA 2KOKA 1VF2A 1WMJA 5D96A 1O8XA 1T3BA 2RM6A 3HZ4A 3UJ1A 2X4AA 1YJ6A 4WETA 1JLWA 2OE3A 4A5PA 3P2AA 3NOFA 4N0ZA 1F6MC 3F4RA 3TJBA 4I97A 3MDKA 2G2QA 1SD9A 2YPMA 2K6VA 3CRTA 1SKWB 2GSRA 4LMVA 3TKRA 1R5AA 3IXRA 1GP1A 2X64A 3GN3A 4O5UA 4V1Ap 1T8EB 2EIQA 2R0PA 4RUVA 10GSA 2TRCP 2X8HA 2MMAA 2ZNMA 4POKA 1M2AA 4DEJA 3QPMA 4PQ1A 3TGZA 2REMA 4MPFA 3ZLPA 1MDJA 2HNLA 4EUYA 1G6YA 1PRXA 4PUAA 1TXXA 5EPFA 2VAFA 1HYUA 2GDRA 2I1UA 3TCOA 2V1MA 2AYTA 1GLPA 4GSNA 1N2AA 2FD3A 4MF7A 1FAAA 3FR3A 4TW5A 3IV4A 1O81A 2JACA 2YNXA 1OC3A 3V1WA 2XC2A 1AQWA 2F8FA 1XZOA 1XWKA 3HXSA 5ELAA 2K8VA 4NHWA 4OFMA 3CBUA 2I3YA 3M1GA 4D73B 1HNAA 2YN1A 3E9JB 3QCPA 1H75A 5IMDA 2FUG2 2OBKA 3GYKA 1TK0B 1SL1B 3M0FA 3GHAA 4MJEA 4XS1A 5IMCA 5G31A 1V40A 2IIYA 1TKDB 2HSHA 4FYBA 3LGCA 2R4VA 2DJ2A 1SK2A 5IM9A 5G2ZA 3BCIA 4TR1A 5IO0A 4K2XA 1ZOFA 3QAGA 3DKSA 1A24A 1PX7A 3KTLA 4V1Ag 1R26A 3H4KA 2F3MA 4JEDA 4PQIA 3IC4A 2RIIA 4ZB9A 1A8YA 4FIWA 3QMXA 5HR1A 3UBLA 4MPGA 2E2MA 1B9YC 3VWUA 4TOPA
chains in the Genus database with same CATH topology
4MZCA 3IHQA 2GSTA 3RHBA 4K7OA 3HVVA 3VWVA 4HI7A 5AGYA 4WEYA 2TIRA 4V2LA 5KN1A 5DAKA 1X9WB 4EO3A 2PBJA 2VLVA 2GZZA 5DBQA 1J08A 1ABAA 4ZL7A 5DCHA 4KB3A 3ZREA 4IQAA 2VO4A 3EPTA 5IO2A 5CREA 2GQLA 5J3RA 4MF5A 2PUKC 3KMOA 4WF5A 5ID2B 2L5OA 1TK5B 2YWNA 3KD0A 2DKIA 5EY6A 4E8EA 5GAPD 4Z2UA 3UMAA 2O85A 1N8JA 7GSSA 4L5OA 4I2TA 4DVCA 1BAYA 8GSSA 6GSYA 5D9VA 1JFUA 2IN3A 1JZWA 1B8XA 1NM3A 3FZ4A 4GRFA 3PPUA 3Q6OA 2GZYA 11GSA 3WT2A 3L78A 5G5EA 2DJ3A 3UOMA 5A5KA 1G0TA 3RPPA 5COHA 1OC9B 1F3AA 1HNCA 1MTCA 4NHZA 3UARA 2KHPA 4J56E 5KOXA 3IA1A 1PL2A 4J2FA 2HSMA 3IOSA 4HU7A 17GSA 1AQXA 2MMOA 1TDIA 3RPNA 4XHMA 1Z9HA 1U3IA 2P31A 3D4TA 1O85A 2H75A 2AAWA 3FZ5A 1SD8A 5DAKB 5CRWA 4MZWA 3TKSE 3IRAA 3TKSA 1EWXA 3UEMA 1M2BA 1QK8A 2YZUA 2YANA 1NHYA 1MEKA 3RBTA 4KF9A 4K9ZA 5F8BA 2OACA 2R0CA 4KCEA 4NV2A 1F3BA 4TRXA 3S9FA 4FQUA 3VWWA 3MAKA 4MK3A 4OMVA 3N5OA 4IGJA 4OFTA 4IJ3A 2VD0A 4PTSA 4BVXB 2H74A 1J9BA 2IMDA 3F0IA 3VPTA 1SL2B 2VCVA 4AJ8A 4QQ7A 1EOGA 3D21A 1NW2A 4PQHA 2GQKA 1K0MA 3IAS2 1JZOA 1JLVA 3DEXA 5B8AA 2HLSA 4IW9A 3FZ9A 1TU8A 3TJKA 5J9CA 1TW9A 2M46A 2PERA 3F3QA 5ECQB 5HFKA 3TRPA 5LNKe 2ON7A 2H66A 3EU4A 6GSXA 4JRRA 4CDOA 2DJ1A 1QXHA 5IMZA 5IPHA 1PKWA 1EP7A 1T00A 2MBTA 2XBIA 4PGTA 4ACSA 1SYXA 1KEBA 5C00A 2VIMA 1BJXA 3O3TA 1QUWA 4MMMA 2YZHA 4HJMA 2E7PA 4K5RA 3ED3A 1PSQA 2EIOA 3M8NA 3LYPA 3CYNA 3ERFA 4KDUA 1URMA 2VCQA 3ZVJA 3LORA 5FHIA 3F6FA 4MCUA 3WGXA 1EP8A 5B8BA 3UVTA 2HRAA 4JZQA 4L8EA 1OKDA 5KOWA 2IMIA 3A3TA 2HRFA 1UA5A 3F63A 4ZB6A 4RI6A 2K8SA 1BG5A 1G6WA 1X5CA 4KSOA 2WJUA 3HHVA 5HQPA 2H1BA 2R0GA 3E0UA 3GX0A 3ZIVA 5ECMB 5EL8A 1VF3A 3PGTA 2A2SA 2NDOA 1X0RA 3KCMA 4V2MA 1E2YA 1BEDA 3TRXA 2C3QA 1X9SB 4K0GA 2XPEA 1X9MB 1TTZA 3I69A 4Q5FA 3O6TA 2YWIA 2VLTA 4N30A 4ECBA 3IC8A 4J57E 4NMUA 3ZRDA 3QFBC 2GT5A 2VCZA 1B4PA 3J7Yk 3ZFLA 1I9DA 4TVEA 1SKSB 4CHSA 3G7YA 3OR5A 3GSTA 1V9WA 2LJKA 4TR0A 4PXOA 1XPVA 1YQ1A 5IMAA 4KW6A 5JCGA 3GL3A 1Z7PA 2FWFA 3L9SA 3ERGA 4ZB8A 4TN8A 1DBYA 2X99A 1FOHA 13GSA 4ZIJA 1KNGA 4HU9A 2HRNA 1FVJA 2C3NA 1K3LA 4YKGA 3SWLA 3LSZA 4O7HA 2WGRA 2AV4A 1TU7A 3L4NA 4BL7A 1ERTA 2ZUPA 2VM2A 1Z6NA 2IFQA 1XXUA 2NBSA 5J5NA 4PNFA 2BTOT 4WXTA 2HSYA 4P3YB 5HFIA 1XVQA 2IPAA 3CMIA 4BWSA 3ZMKA 4XIHA 1EGRA 6GSSA 4LA1A 5GSTA 4EF0A 3DVXA 2OJLA 1WWJA 4ISDA 4EIPA 14GSA 1Y25A 1M9AA 1PN9A 1XWAA 3HJOA 4GXZA 5G1LA 1Z5YE 4GCIA 1BQ7A 3GUSA 5LCZA 16GSA 3H93A 2RLIA 2BMXA 3MNGA 3TKQA 1V2AA 2A4HA 2NPBA 2JADA 5D9WA 2HZEB 1CQGA 4TXVA 1IYHA 2YCDA 3KMNA 3RAZA 3A2VA 1GL8A 5DALA 1A23A 3HCZA 4BPYA 4MJAA 4KDXA 5L71A 4AF2A 1FB0A 1T7PB 4K5SA 5BMUA 1DE1A 3IHGA 1AW9A 4MH3A 2H30A 1TOFA 3EWLA 1OKTA 2WCIA 4JR4A 3GH6A 4YQUA 3KP8A 2C4JA 1B4QA 2XPDA 1FHEA 2QA1A 4HQSA 1XOAA 1A0FA 1UC7A 4NWYA 4IS0A 5D9TA 5CRGA 3D4MA 1O73A 3EU3A 4X0XA 2EC4A 2FHEA 1JHBA 2DIZA 2E2GA 1X5DA 1OC8A 3D0ZA 5G5FA 2LEGA 3GV1A 2BJXA 1ZL9A 3APSA 1WOUA 3F6DA 1EZKA 2IWTA 2MYGA 2GSQA 1FG4A 3GL5A 4JBBA 3KEBA 4MLYA 4G0LA 3KGKA 2FA8A 1SK0A 3P7XA 5B7CA 5ECIB 2ALBA 1K0AA 2PGTA 4WBRD 1OVNA 5AN1A 5ECHB 2V32A 3IR4A 2CT6A 5DJMA 2MMZA 4DSRA 2OADA 2N5AA 3AY8A 22GSA 3QAVA 4CY8A 1GTAA 4DSSA 2L4QA 1B48A 4N10A 2IMKA 1CQHA 2GZPA 3M3MA 5CO3A 3KXOA 4MABA 1TI1A 2O7KA 4X43A 1AUCA 4EE0A 2CX3A 1RQMA 4GTUA 3FHKA 3VFIA 1SU9A 4Z2RA 1T4YA 5D9XA 1WPIA 3GNJA 4TR4A 2FNOA 4I5QA 2GQMA 4USSA 4HJ2A 4O5QA 3FW2A 1T1VA 3RHCA 3MSZA 1GSYA 1B9XC 4KCAA 2CZ2A 4PX1A 2YV7A 1TRVA 4QL9A 1O7UA 3ZYWA 1O8WA 1EGOA 3APOA 1XBSA 4BA7A 2DJ0A 2H71A 4FH8A 4IVFA 4OO4A 2OE0A 1ERVA 2O87A 1SKRB 1OE7A 4XRDA 4EVMA 1K0NA 4WF4A 5JWQB 4MP4A 2LRTA 2UZ8A 18GSA 3DGQA 3F4TA 3N9JA 3VWXA 9GSSA 1TRUA 4ILFA 3EC3A 2V2GA 3Q19A 4YQVA 1R5PA 4I8BA 3TJFA 1XW9A 4XS6A 3JCML 3CTGA 1YEPA 4EKZA 2YV9A 3A5WA 4GLTA 3F8UA 6GSWA 3HA9A 4TR1B 2PU9C 1GSDA 2H70A 4PUFC 2F8AA 1ZYQB 2FLSA 1WRYA 1TRSA 2VUPA 5F05A 4GSTA 4TR3A 4ECIA 3IAM2 1AIUA 4OD7A 4RI7A 2TRXA 3FMWA 4Z7XA 2DC5A 5H5SA 3M9JA 4F0CA 4QL7A 1QQ2A 5A4WA 3U6VA 2RUFA 1U87A 2H73A 2YP6A 2MMNA 3EE2A 4HDEA 1SK1A 4ZXGA 2JZRA 3WGDA 1ERUA 2P5RA 1AC1A 4H86A 3IK9A 3TKPA 3UAPA 2H6XA 3QFAC 2N5BA 4XTSA 1K0DA 1XCCA 4Q5RA 3U5RE 2YJHA 3ME7A 2Z9SA 1GUHA 4TXOA 5IMVA 2F9SA 1GULA 3EVIA 2DSAA 5ENUA 4CY6A 3FY7A 3UL3A 2PPTA 1SJ6A 4MJCA 3LJRA 5G30A 2C0GA 3VI5A 1ZYNA 3HYPA 1IYIA 3GIXA 3LFLA 5CRHA 1K3OA 1M2DA 6GSVA 5AIVA 4WBJA 2F51A 1ZYEA 3C7MA 1HNBA 5J41A 1OE8A 2X49A 1W4VA 3GTUA 4OO5A 5JCWA 4IN0A 3ZMLA 1LBKA 2J23A 3C8EA 4NXIA 3DIEA 3KH7A 2B7JA 4K2DA 4K1FA 3VI7A 1M7TA 2JZTA 3DXBA 3NZNA 3H8QA 1I5GA 3C1RA 2R6KA 5F07A 2NTOA 2LSTA 3D6IA 4ID0A 3FK8A 1PMTA 3C1SA 2LNTA 4PURA 4Z2TA 2I4AA 4K6XA 4HEA2 3LEFA 2PMTA 4HZ2A 3ZFBA 3O76A 4ZBDA 3QDNA 3HVXA 3ISOA 1FOVA 5CAXA 4POBA 3BBYA 3D22A 5DQYA 3FKFA 1YF1A 1VF1A 2IMFA 4GQCA 1GUKA 2MBSA 2FA4A 3A2XA 2KP1A 4FO5A 5JWOB 3C71A 4JR6A 2P5QA 4ML1A 4EIQA 1PGTA 2DIYA 2H6YA 4I2UA 1THOA 5DVBA 5C04A 3J7Yb 1EV9A 2O8VB 2LKUA 2PWJA 3P90A 2WULA 5EVOA 1MD4A 3FR6A 3HD5A 1K0OA 4X1UA 4LLRA 1AAZA 4WR5A 2H72A 2HFDA 4PNGA 2K9FA 5AISA 20GSA 2HI7A 5ECSA 5DDLA 4YKFA 4L0UA 1AQVA 2DKHA 2L4CA 3BCKA 2HE3A 4KDYA 1Q98A 2R5GA 2GSSA 2R37A 1QGVA 3KP9A 4OCEA 3TOUA 3VK9A 3GSSA 4LMWA 1Z7RA 2H76A 1PD21 1ON4A 2B5EA 3DMLA 2DLXA 3KIJA 3US3A 4F82A 5DCGA 2YOIA 2QC7A 5IPGA 1G7EA 3F4SA 5HFGA 4IHUA 4ZL9A 5J4UA 4YAVA 5CRDA 5BRTA 4BVYA 1SJZA 2M80A 1V57A 1WIKA 2B1KA 3DWVA 3R2QA 2LRCA 1EOHA 3NIVA 1FB6A 2H8LA 2C0EA 3MWHA 1A2LA 1Z3EA 1VF4A 5FWGA 3QD9A 2A2RA 3TOTA 1M9BA 3GKKA 3GKXA 2OE1A 5E59A 2VCWA 3EINA 4N11A 2IL3A 3GH9A 4FYCA 2R3XA 3HY2A 4F0BA 1TK8B 3HZ8A 1GWCA 1V58A 5D8IA 1YY7A 3A5IA 2I81A 2A4VA 5ECNB 1XVWA 5KN0A 1USBA 4G9HA 3FRCA 4F03A 1S3AA 1SENA 3G9BA 4D73A 2PN8A 3KZQA 4KGIA 2ON5A 3EURA 1FO5A 2QGVA 2VD1A 4XS4A 5ELGA 2IMEA 1DSBA 1F9MA 5IMFA 2JU5A 2WB9A 3APQA 4FYUA 1MDKA 1A0RP 1OYJA 1SYRA 2WRTA 2C1YA 4OWYA 2R2JA 4KUNA 1KTEA 4MZBA 3L9UA 3HVSA 3DD3A 3LYKA 1GLQA 1TRWA 3D5JA 4HS1A 2D2ZA 5HR3A 3UVHA 2KP2A 4RQRA 5GSSA 2C0DA 5A4VA 3CSIA 1X5EA 4AGSA 2P0GA 4KX4A 4TKYA 4BVYB 1QFNA 2LS5A 1H4OA 2WFCA 1XWCA 4OCFA 4BL7B 1GNEA 3TRQA 2LUSA 2IFQB 3EMPA 2LNSA 2V41A 2ES7A 4EL1A 2ZCTA 1PQNA 3GRXA 2GT6A 2RUEA 2I9HA 4I6XA 3CTFA 1YEXA 1YF0A 1M0UA 3GX8A 2L57A 4YQMA 3PR8A 5KN2A 2V6KA 3PINA 5IOWA 2M72A 5GAND 4LL4B 1SJIA 4ZILA 5ID2A 5A4UA 1Y6EA 2FY6A 5B6MA 5IIZA 1AXDA 1WE0A 2L6CA 1YDKA 3TJJA 5D93A 2DJJA 3DVWA 2VL2C 2MZCA 1LJRA 1GSFA 2JZSA 2E0QA 4MF6A 1GH2A 5CYYA 4XS4B 1UN2A 4KE3A 4JU5A 5DALB 1VRSD 1ERWA 3GA4A 4POMA 3LQ7A 3HJMA 5FT3A 2B5YA 4XRAA 1OC9A 3LXZA 2B1LA 2WDUA 4GQFA 4YAPA 2GVPA 4WR4A 2AHEA 4ULXA 1JZDA 1M99A 3QAWA 4HZ4A 3ME8A 3QR6A 2EIRA 3Q18A 4O92A 4KNDA 5ECOB 1PN0A 3KTBA 1TI3A 1HD2A 2C3TA 2NVLA 2HXKA 4G10A 4KSMA 1GTIA 2FWGA 4F9ZA 1R7HA 3W8JA 3HKRA 1F37A 2DJKA 3ZTLA 3SBCA 3A2WA 2VL3A 5DJLA 4CW9A 4IJIA 3G7IA 2OKAA 3IDVA 2DMLA 4L0WA 1RW1A 3FYGA 12GSA 3UBKA 1XW5A 3TB2A 5IOXA 4MJBA 4ECJA 2YWMA 4HQZA 1UVZA 3CSHA 3BD2A 3ZZXA 3RDWA 1EEJA 4NAXA 3ZL5A 4BVXA 1U3AA 5ECLB 1F2EA 3FZAA 1O6JA 5KN3A 1XWBA 4JE1A 2HZFA 3IPZA 3G7JA 4DSQA 1ZMAA 1ILOA 2L5LA 1HQOA 4ZBAA 2DBCA 1U88A 1DE2A 2K18A 3LG6A 4DSSB 4EXJA 3MYDA 3P8WA 2AUVA 4GWRA 1TP9A 2WZ9A 1WP0A 1XW6A 1C72A 1OAZA 5H5RA 3TJGA 2QA2A 5E4WA 5LD0A 2H1AA 3GKMA 2JL4A 2FWEA 3DYRA 3LWAA 1ACVA 5B6NA 2V6OA 1R4WA 2PVQA 3WT1A 4Q5QA 4G19A 2GTUA 3VURA 4MNNA 4GSSA 3EMXA 1DUGA 2H0IA 2VLUA 2KUCA 5ECRB 1FW1A 1PA3A 1VGLA 4YH2A 4POLA 6GSTA 1Z6MA 3E3EA 4ECCA 3GKNA 2H01A 2WS2A 5KEJA 1XOBA 2H1GA 5DQSA 2GGTA 4IP1A 2QKEA 5AIXA 1RK4A 2CZ3A 1WJKA 3H1NA 3CRUA 4HUAA 4O5RA 2FCHA 3KH9A 2VCTA 1YKCA 3F3RA 1GTUA 3C73A 3I43A 1GTBA 4IQ1A 1ZCPA 2CVKA 4NV5A 2CAQA 3EYTA 4K8MA 5D73A 3H79A 2JSZA 3IE3A 5IQYA 2C0FA 2L59A 1KBNA 3IBHA 3ZVJD 5GZZB 2CVBA 1K3YA 1BX9A 4MH2A 5ECKB 1PL1A 1ML6A 3KM6A 3Q74A 2H1DA 2CV4A 3BOAA 4EDYA 1W89A 4ZBBA 2X8CA 1XIYA 4MDCA 3FEUA 3CSJA 5J9BA 2PVOC 4IBPA 4AJ7A 2XBQA 3WD6A 1LU4A 2GS3A 3W8SA 3GMFA 2B3SA 2DMMA 4V2NA 2HYXA 4E8HA 5JWRB 1JZRA 4L5LA 4XCSA 3I9V2 2CAIA 4BWQA 1GSUA 1ZGNA 5HR2A 3MIXA 1V98A 2AJQB 2CVDA 1BYEA 1PKZA 2OA7A 1A8LA 1G7OA 4G0KA 2LJRA 1GSQA 2VM1A 3LXTA 2FGXA 2N5FA 2XHFA 4WKWA 4G2EA 2OBIA 3ZITA 3GURA 1PX6A 4X4JA 2H19A 2KLXA 2A2PA 2B6MA 4N0VA 5ECPB 1ZZYA 3HJPA 2QSIA 3VLNA 1TJDA 1K0CA 1S3DA 4K7NA 3WGEA 2H6ZA 2JSYA 6GSUA 1THXA 2HT9A 1J0FA 4KAEA 2L6DA 2GLRA 1EEMA 1XFLA 4TXOB 1A2JA 1XWGA 5F0GA 1MD3A 3CXGA 2G0FA 1GSEA 2LQQA 2CQ9A 2CX4A 3L9VA 1ST9A 3KJYA 1A2MA 5JCUA 2RM5A 3L0HA 4OFNA 4G0IA 1ZYPA 1YZXA 4O32A 3ERWA 5HR0A 3W6GA 2AB6A 5CNWA 4KA0A 4K0NA 3HDCA 1EV4A 2VL2A 3R3EA 4MA9A 3GTUB 3K8NA 4KH7A 4EDZA 2H0HA 3PH9A 1K0BA 2HZEA 1FVKA 1GNWA 3QOUA 2H0GA 1NSWA 4RQXA 1T4ZA 4K7IA 2LRNA 4EC0A 2B5XA 3DRNA 1GUMA 5CP1A 5H5QA 2X8GA 5G1KA 2LJAA 1NHOA 3BJ5A 4IKHA 3UIWA 2YWOA 4ZL8A 4GF0A 4NPBA 3TUEA 2LQOA 1Q4JA 2J9HA 1E6BA 4HOJA 2FWHA 4F2IA 1GRXA 3WYWA 2VOCA 2C80A 2IJYA 3LW9A 3M9KA 2LTKA 3GFKA 5INYA 4AJ6A 1YKAA 1MDIA 3TKSC 4Q5NA 3F9UA 3I6AA 4IELA 1SL0B 5F06A 2CA8A 2O89A 3TDGA 3ZIJA 2LV3A 4IP6A 3IK7A 2B7KA 3FR9A 5ABRA 19GSA 1GSSA 1S3CA 2VCXA 3VPQA 2HRKA 2VL9A 2C8UA 1QMVA 2YJ7A 4LL1B 4ML6A 1U6TA 4ICYA 2KOKA 1VF2A 1WMJA 5D96A 1O8XA 1T3BA 2RM6A 3HZ4A 3UJ1A 2X4AA 1YJ6A 4WETA 1JLWA 2OE3A 4A5PA 3P2AA 3NOFA 4N0ZA 1F6MC 3F4RA 3TJBA 4I97A 3MDKA 2G2QA 1SD9A 2YPMA 2K6VA 3CRTA 1SKWB 2GSRA 4LMVA 3TKRA 1R5AA 3IXRA 1GP1A 2X64A 3GN3A 4O5UA 4V1Ap 1T8EB 2EIQA 2R0PA 4RUVA 10GSA 2TRCP 2X8HA 2MMAA 2ZNMA 4POKA 1M2AA 4DEJA 3QPMA 4PQ1A 3TGZA 2REMA 4MPFA 3ZLPA 1MDJA 2HNLA 4EUYA 1G6YA 1PRXA 4PUAA 1TXXA 5EPFA 2VAFA 1HYUA 2GDRA 2I1UA 3TCOA 2V1MA 2AYTA 1GLPA 4GSNA 1N2AA 2FD3A 4MF7A 1FAAA 3FR3A 4TW5A 3IV4A 1O81A 2JACA 2YNXA 1OC3A 3V1WA 2XC2A 1AQWA 2F8FA 1XZOA 1XWKA 3HXSA 5ELAA 2K8VA 4NHWA 4OFMA 3CBUA 2I3YA 3M1GA 4D73B 1HNAA 2YN1A 3E9JB 3QCPA 1H75A 5IMDA 2FUG2 2OBKA 3GYKA 1TK0B 1SL1B 3M0FA 3GHAA 4MJEA 4XS1A 5IMCA 5G31A 1V40A 2IIYA 1TKDB 2HSHA 4FYBA 3LGCA 2R4VA 2DJ2A 1SK2A 5IM9A 5G2ZA 3BCIA 4TR1A 5IO0A 4K2XA 1ZOFA 3QAGA 3DKSA 1A24A 1PX7A 3KTLA 4V1Ag 1R26A 3H4KA 2F3MA 4JEDA 4PQIA 3IC4A 2RIIA 4ZB9A 1A8YA 4FIWA 3QMXA 5HR1A 3UBLA 4MPGA 2E2MA 1B9YC 3VWUA 4TOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MZC A;  3IHQ A;  2GST A;  3RHB A;  4K7O A;  3HVV A;  3VWV A;  4HI7 A;  5AGY A;  4WEY A;  2TIR A;  4V2L A;  5KN1 A;  5DAK A;  1X9W B;  4EO3 A;  2PBJ A;  2VLV A;  2GZZ A;  5DBQ A;  1J08 A;  1ABA A;  4ZL7 A;  5DCH A;  4KB3 A;  3ZRE A;  4IQA A;  2VO4 A;  5IO2 A;  5CRE A;  2GQL A;  5J3R A;  4MF5 A;  2PUK C;  3KMO A;  4WF5 A;  5ID2 B;  2L5O A;  1TK5 B;  2YWN A;  3KD0 A;  5EY6 A;  4E8E A;  5GAP D;  3UMA A;  2O85 A;  1N8J A;  7GSS A;  4L5O A;  4I2T A;  4DVC A;  1BAY A;  8GSS A;  6GSY A;  5D9V A;  1JFU A;  2IN3 A;  1JZW A;  1B8X A;  1NM3 A;  3FZ4 A;  4GRF A;  3Q6O A;  2GZY A;  11GS A;  3WT2 A;  3L78 A;  5G5E A;  2DJ3 A;  3UOM A;  5A5K A;  1G0T A;  3RPP A;  5COH A;  1OC9 B;  1F3A A;  1HNC A;  1MTC A;  4NHZ A;  3UAR A;  2KHP A;  4J56 E;  3IA1 A;  1PL2 A;  4J2F A;  3IOS A;  4HU7 A;  17GS A;  1AQX A;  2MMO A;  1TDI A;  3RPN A;  4XHM A;  1Z9H A;  1U3I A;  2P31 A;  3D4T A;  1O85 A;  2H75 A;  2AAW A;  3FZ5 A;  1SD8 A;  5DAK B;  5CRW A;  4MZW A;  3TKS E;  3IRA A;  3TKS A;  1EWX A;  3UEM A;  1M2B A;  1QK8 A;  2YZU A;  2YAN A;  1NHY A;  1MEK A;  3RBT A;  4K9Z A;  5F8B A;  2OAC A;  4KCE A;  4NV2 A;  1F3B A;  4TRX A;  3S9F A;  3VWW A;  3MAK A;  4MK3 A;  4OMV A;  3N5O A;  4IGJ A;  4OFT A;  4IJ3 A;  2VD0 A;  2H74 A;  1J9B A;  2IMD A;  3F0I A;  3VPT A;  1SL2 B;  2VCV A;  4AJ8 A;  4QQ7 A;  1EOG A;  3D21 A;  1NW2 A;  4PQH A;  2GQK A;  1K0M A;  3IAS 2;  1JZO A;  1JLV A;  3DEX A;  5B8A A;  2HLS A;  4IW9 A;  3FZ9 A;  1TU8 A;  3TJK A;  5J9C A;  1TW9 A;  2M46 A;  2PER A;  3F3Q A;  5ECQ B;  5HFK A;  3TRP A;  5LNK e;  2ON7 A;  2H66 A;  3EU4 A;  6GSX A;  4JRR A;  4CDO A;  2DJ1 A;  1QXH A;  5IMZ A;  5IPH A;  1PKW A;  1EP7 A;  1T00 A;  2MBT A;  2XBI A;  4PGT A;  4ACS A;  1SYX A;  1KEB A;  5C00 A;  2VIM A;  1BJX A;  3O3T A;  1QUW A;  4MMM A;  2YZH A;  4HJM A;  2E7P A;  3ED3 A;  1PSQ A;  2EIO A;  3M8N A;  3LYP A;  3CYN A;  3ERF A;  4KDU A;  1URM A;  2VCQ A;  3ZVJ A;  3LOR A;  5FHI A;  3F6F A;  4MCU A;  3WGX A;  1EP8 A;  5B8B A;  3UVT A;  4JZQ A;  4L8E A;  1OKD A;  2IMI A;  3A3T A;  2HRF A;  1UA5 A;  3F63 A;  4ZB6 A;  4RI6 A;  2K8S A;  1BG5 A;  1G6W A;  1X5C A;  4KSO A;  2WJU A;  3HHV A;  5HQP A;  2H1B A;  3E0U A;  3GX0 A;  3ZIV A;  5ECM B;  5EL8 A;  1VF3 A;  3PGT A;  2A2S A;  2NDO A;  1X0R A;  3KCM A;  4V2M A;  1E2Y A;  1BED A;  3TRX A;  2C3Q A;  1X9S B;  4K0G A;  2XPE A;  1X9M B;  1TTZ A;  3I69 A;  4Q5F A;  3O6T A;  2YWI A;  2VLT A;  4N30 A;  4ECB A;  4J57 E;  4NMU A;  3ZRD A;  3QFB C;  2GT5 A;  2VCZ A;  1B4P A;  3J7Y k;  3ZFL A;  1I9D A;  4TVE A;  1SKS B;  4CHS A;  3G7Y A;  3OR5 A;  3GST A;  1V9W A;  2LJK A;  4TR0 A;  4PXO A;  1XPV A;  1YQ1 A;  5IMA A;  4KW6 A;  5JCG A;  3GL3 A;  1Z7P A;  2FWF A;  3L9S A;  3ERG A;  4ZB8 A;  4TN8 A;  1DBY A;  2X99 A;  13GS A;  4ZIJ A;  1KNG A;  4HU9 A;  2HRN A;  1FVJ A;  2C3N A;  1K3L A;  3SWL A;  3LSZ A;  4O7H A;  2WGR A;  2AV4 A;  1TU7 A;  3L4N A;  4BL7 A;  1ERT A;  2ZUP A;  2VM2 A;  1Z6N A;  2IFQ A;  1XXU A;  2NBS A;  5J5N A;  4PNF A;  2BTO T;  4WXT A;  2HSY A;  4P3Y B;  5HFI A;  1XVQ A;  2IPA A;  3CMI A;  4BWS A;  3ZMK A;  4XIH A;  1EGR A;  6GSS A;  4LA1 A;  5GST A;  4EF0 A;  3DVX A;  2OJL A;  1WWJ A;  4ISD A;  14GS A;  1Y25 A;  1M9A A;  1PN9 A;  1XWA A;  3HJO A;  4GXZ A;  5G1L A;  1Z5Y E;  4GCI A;  1BQ7 A;  3GUS A;  5LCZ A;  16GS A;  3H93 A;  2RLI A;  2BMX A;  3MNG A;  3TKQ A;  1V2A A;  2NPB A;  2JAD A;  5D9W A;  2HZE B;  1CQG A;  4TXV A;  1IYH A;  2YCD A;  3KMN A;  3RAZ A;  3A2V A;  1GL8 A;  5DAL A;  1A23 A;  3HCZ A;  4BPY A;  4MJA A;  4KDX A;  5L71 A;  4AF2 A;  1FB0 A;  1T7P B;  1DE1 A;  1AW9 A;  4MH3 A;  2H30 A;  1TOF A;  3EWL A;  1OKT A;  2WCI A;  4JR4 A;  3GH6 A;  4YQU A;  3KP8 A;  2C4J A;  1B4Q A;  2XPD A;  1FHE A;  4HQS A;  1XOA A;  1A0F A;  1UC7 A;  4NWY A;  4IS0 A;  5D9T A;  5CRG A;  3D4M A;  1O73 A;  3EU3 A;  4X0X A;  2EC4 A;  2FHE A;  1JHB A;  2DIZ A;  2E2G A;  1X5D A;  1OC8 A;  3D0Z A;  5G5F A;  2LEG A;  3GV1 A;  2BJX A;  1ZL9 A;  3APS A;  1WOU A;  3F6D A;  1EZK A;  2IWT A;  2MYG A;  2GSQ A;  1FG4 A;  3GL5 A;  4JBB A;  3KEB A;  4MLY A;  3KGK A;  2FA8 A;  1SK0 A;  3P7X A;  5B7C A;  5ECI B;  2ALB A;  1K0A A;  2PGT A;  4WBR D;  1OVN A;  5AN1 A;  5ECH B;  2V32 A;  3IR4 A;  2CT6 A;  5DJM A;  2MMZ A;  4DSR A;  2OAD A;  2N5A A;  3AY8 A;  22GS A;  3QAV A;  1GTA A;  4DSS A;  2L4Q A;  1B48 A;  4N10 A;  2IMK A;  1CQH A;  2GZP A;  3M3M A;  5CO3 A;  3KXO A;  4MAB A;  1TI1 A;  2O7K A;  4X43 A;  1AUC A;  4EE0 A;  2CX3 A;  1RQM A;  4GTU A;  3FHK A;  3VFI A;  1SU9 A;  1T4Y A;  5D9X A;  1WPI A;  3GNJ A;  4TR4 A;  2FNO A;  4I5Q A;  2GQM A;  4HJ2 A;  3FW2 A;  1T1V A;  3RHC A;  3MSZ A;  1GSY A;  1B9X C;  4KCA A;  2CZ2 A;  4PX1 A;  2YV7 A;  1TRV A;  4QL9 A;  1O7U A;  3ZYW A;  1O8W A;  1EGO A;  3APO A;  1XBS A;  4BA7 A;  2DJ0 A;  2H71 A;  4FH8 A;  4IVF A;  4OO4 A;  2OE0 A;  1ERV A;  2O87 A;  1SKR B;  1OE7 A;  4XRD A;  4EVM A;  1K0N A;  4WF4 A;  5JWQ B;  4MP4 A;  2LRT A;  18GS A;  3DGQ A;  3F4T A;  3N9J A;  3VWX A;  9GSS A;  1TRU A;  4ILF A;  3EC3 A;  2V2G A;  3Q19 A;  4YQV A;  1R5P A;  4I8B A;  3TJF A;  1XW9 A;  4XS6 A;  3JCM L;  3CTG A;  1YEP A;  4EKZ A;  2YV9 A;  3A5W A;  4GLT A;  3F8U A;  6GSW A;  3HA9 A;  4TR1 B;  2PU9 C;  1GSD A;  2H70 A;  4PUF C;  2F8A A;  1ZYQ B;  2FLS A;  1WRY A;  1TRS A;  2VUP A;  5F05 A;  4GST A;  4TR3 A;  4ECI A;  3IAM 2;  1AIU A;  4OD7 A;  4RI7 A;  2TRX A;  4Z7X A;  2DC5 A;  5H5S A;  3M9J A;  4F0C A;  4QL7 A;  1QQ2 A;  5A4W A;  3U6V A;  2RUF A;  1U87 A;  2H73 A;  2YP6 A;  2MMN A;  3EE2 A;  4HDE A;  1SK1 A;  4ZXG A;  2JZR A;  3WGD A;  1ERU A;  2P5R A;  1AC1 A;  4H86 A;  3IK9 A;  3TKP A;  3UAP A;  2H6X A;  3QFA C;  2N5B A;  4XTS A;  1K0D A;  1XCC A;  4Q5R A;  3U5R E;  2YJH A;  3ME7 A;  2Z9S A;  1GUH A;  4TXO A;  5IMV A;  2F9S A;  1GUL A;  3EVI A;  2DSA A;  5ENU A;  3FY7 A;  3UL3 A;  2PPT A;  1SJ6 A;  4MJC A;  3LJR A;  5G30 A;  2C0G A;  3VI5 A;  3HYP A;  1IYI A;  3GIX A;  3LFL A;  5CRH A;  1K3O A;  1M2D A;  6GSV A;  5AIV A;  4WBJ A;  2F51 A;  1ZYE A;  3C7M A;  1HNB A;  5J41 A;  1OE8 A;  1W4V A;  3GTU A;  4OO5 A;  5JCW A;  4IN0 A;  3ZML A;  1LBK A;  2J23 A;  3C8E A;  4NXI A;  3DIE A;  3KH7 A;  2B7J A;  4K2D A;  4K1F A;  3VI7 A;  1M7T A;  2JZT A;  3DXB A;  3NZN A;  3H8Q A;  1I5G A;  3C1R A;  2R6K A;  5F07 A;  2NTO A;  2LST A;  3D6I A;  4ID0 A;  3FK8 A;  1PMT A;  3C1S A;  2LNT A;  4PUR A;  2I4A A;  4K6X A;  4HEA 2;  3LEF A;  2PMT A;  4HZ2 A;  3ZFB A;  3O76 A;  4ZBD A;  3QDN A;  3HVX A;  3ISO A;  1FOV A;  5CAX A;  4POB A;  3BBY A;  3D22 A;  5DQY A;  3FKF A;  1YF1 A;  1VF1 A;  2IMF A;  4GQC A;  1GUK A;  2MBS A;  2FA4 A;  3A2X A;  2KP1 A;  4FO5 A;  5JWO B;  3C71 A;  4JR6 A;  2P5Q A;  4ML1 A;  1PGT A;  2DIY A;  2H6Y A;  4I2U A;  1THO A;  5DVB A;  5C04 A;  3J7Y b;  1EV9 A;  2O8V B;  2LKU A;  2PWJ A;  3P90 A;  5EVO A;  2WUL A;  1MD4 A;  3FR6 A;  3HD5 A;  1K0O A;  4X1U A;  4LLR A;  1AAZ A;  4WR5 A;  2H72 A;  2HFD A;  4PNG A;  2K9F A;  5AIS A;  20GS A;  2HI7 A;  5ECS A;  5DDL A;  4L0U A;  1AQV A;  2L4C A;  3BCK A;  2HE3 A;  4KDY A;  1Q98 A;  2R5G A;  2GSS A;  2R37 A;  1QGV A;  3KP9 A;  4OCE A;  3TOU A;  3VK9 A;  3GSS A;  4LMW A;  1Z7R A;  2H76 A;  1PD2 1;  1ON4 A;  2B5E A;  3DML A;  2DLX A;  3KIJ A;  3US3 A;  4F82 A;  5DCG A;  2YOI A;  2QC7 A;  5IPG A;  1G7E A;  3F4S A;  5HFG A;  4IHU A;  4ZL9 A;  5J4U A;  4YAV A;  5CRD A;  4BVY A;  1SJZ A;  2M80 A;  1V57 A;  1WIK A;  2B1K A;  3DWV A;  3R2Q A;  2LRC A;  1EOH A;  3NIV A;  1FB6 A;  2H8L A;  2C0E A;  3MWH A;  1A2L A;  1Z3E A;  1VF4 A;  5FWG A;  3QD9 A;  2A2R A;  3TOT A;  1M9B A;  3GKK A;  3GKX A;  2OE1 A;  5E59 A;  2VCW A;  3EIN A;  4N11 A;  2IL3 A;  3GH9 A;  4FYC A;  2R3X A;  3HY2 A;  4F0B A;  1TK8 B;  3HZ8 A;  1GWC A;  1V58 A;  5D8I A;  1YY7 A;  2I81 A;  2A4V A;  5ECN B;  1XVW A;  5KN0 A;  1USB A;  4G9H A;  3FRC A;  4F03 A;  1S3A A;  1SEN A;  3G9B A;  4D73 A;  2PN8 A;  3KZQ A;  4KGI A;  2ON5 A;  3EUR A;  1FO5 A;  2QGV A;  2VD1 A;  4XS4 A;  5ELG A;  2IME A;  1DSB A;  1F9M A;  5IMF A;  2JU5 A;  2WB9 A;  3APQ A;  4FYU A;  1MDK A;  1A0R P;  1OYJ A;  1SYR A;  2WRT A;  2C1Y A;  4OWY A;  2R2J A;  4KUN A;  1KTE A;  4MZB A;  3L9U A;  3HVS A;  3DD3 A;  3LYK A;  1GLQ A;  1TRW A;  3D5J A;  4HS1 A;  2D2Z A;  5HR3 A;  3UVH A;  2KP2 A;  4RQR A;  5GSS A;  2C0D A;  5A4V A;  3CSI A;  1X5E A;  4AGS A;  2P0G A;  4KX4 A;  4TKY A;  1QFN A;  2LS5 A;  1H4O A;  2WFC A;  1XWC A;  4OCF A;  1GNE A;  3TRQ A;  2LUS A;  2IFQ B;  3EMP A;  2LNS A;  2V41 A;  2ES7 A;  4EL1 A;  2ZCT A;  1PQN A;  3GRX A;  2GT6 A;  2RUE A;  2I9H A;  4I6X A;  3CTF A;  1YEX A;  1YF0 A;  1M0U A;  3GX8 A;  2L57 A;  4YQM A;  3PR8 A;  5KN2 A;  2V6K A;  3PIN A;  5IOW A;  2M72 A;  5GAN D;  4LL4 B;  1SJI A;  4ZIL A;  5ID2 A;  5A4U A;  1Y6E A;  2FY6 A;  5B6M A;  5IIZ A;  1AXD A;  1WE0 A;  2L6C A;  1YDK A;  3TJJ A;  5D93 A;  2DJJ A;  3DVW A;  2VL2 C;  2MZC A;  1LJR A;  1GSF A;  2JZS A;  2E0Q A;  4MF6 A;  1GH2 A;  5CYY A;  4XS4 B;  1UN2 A;  4KE3 A;  4JU5 A;  5DAL B;  1VRS D;  1ERW A;  3GA4 A;  4POM A;  3LQ7 A;  3HJM A;  5FT3 A;  2B5Y A;  4XRA A;  1OC9 A;  3LXZ A;  2B1L A;  2WDU A;  4GQF A;  4YAP A;  2GVP A;  4WR4 A;  2AHE A;  4ULX A;  1JZD A;  1M99 A;  3QAW A;  4HZ4 A;  3ME8 A;  3QR6 A;  2EIR A;  3Q18 A;  4O92 A;  4KND A;  5ECO B;  3KTB A;  1TI3 A;  1HD2 A;  2C3T A;  2NVL A;  2HXK A;  4G10 A;  4KSM A;  1GTI A;  2FWG A;  4F9Z A;  1R7H A;  3W8J A;  3HKR A;  1F37 A;  2DJK A;  3ZTL A;  3SBC A;  3A2W A;  2VL3 A;  5DJL A;  4CW9 A;  4IJI A;  3G7I A;  2OKA A;  3IDV A;  2DML A;  4L0W A;  1RW1 A;  3FYG A;  12GS A;  3UBK A;  1XW5 A;  3TB2 A;  5IOX A;  4MJB A;  4ECJ A;  2YWM A;  4HQZ A;  1UVZ A;  3CSH A;  3BD2 A;  3ZZX A;  3RDW A;  1EEJ A;  4NAX A;  3ZL5 A;  4BVX A;  1U3A A;  5ECL B;  1F2E A;  3FZA A;  1O6J A;  5KN3 A;  1XWB A;  4JE1 A;  2HZF A;  3IPZ A;  3G7J A;  4DSQ A;  1ZMA A;  1ILO A;  2L5L A;  1HQO A;  4ZBA A;  2DBC A;  1U88 A;  1DE2 A;  2K18 A;  3LG6 A;  4DSS B;  4EXJ A;  3P8W A;  2AUV A;  4GWR A;  1TP9 A;  2WZ9 A;  1WP0 A;  1XW6 A;  1C72 A;  1OAZ A;  5H5R A;  3TJG A;  5E4W A;  5LD0 A;  2H1A A;  3GKM A;  2JL4 A;  2FWE A;  3DYR A;  3LWA A;  1ACV A;  5B6N A;  2V6O A;  1R4W A;  2PVQ A;  3WT1 A;  4Q5Q A;  4G19 A;  2GTU A;  3VUR A;  4GSS A;  3EMX A;  1DUG A;  2H0I A;  2VLU A;  2KUC A;  5ECR B;  1FW1 A;  1PA3 A;  1VGL A;  4YH2 A;  4POL A;  6GST A;  1Z6M A;  3E3E A;  4ECC A;  3GKN A;  2H01 A;  2WS2 A;  5KEJ A;  1XOB A;  2H1G A;  5DQS A;  2GGT A;  4IP1 A;  2QKE A;  5AIX A;  1RK4 A;  2CZ3 A;  1WJK A;  3H1N A;  3CRU A;  4HUA A;  4O5R A;  2FCH A;  3KH9 A;  2VCT A;  1YKC A;  3F3R A;  1GTU A;  3C73 A;  3I43 A;  1GTB A;  4IQ1 A;  1ZCP A;  2CVK A;  4NV5 A;  2CAQ A;  3EYT A;  4K8M A;  5D73 A;  3H79 A;  2JSZ A;  3IE3 A;  5IQY A;  2C0F A;  2L59 A;  1KBN A;  3IBH A;  3ZVJ D;  5GZZ B;  2CVB A;  1K3Y A;  1BX9 A;  4MH2 A;  5ECK B;  1PL1 A;  1ML6 A;  3KM6 A;  3Q74 A;  2H1D A;  2CV4 A;  3BOA A;  4EDY A;  1W89 A;  4ZBB A;  2X8C A;  1XIY A;  4MDC A;  3FEU A;  3CSJ A;  5J9B A;  2PVO C;  4IBP A;  4AJ7 A;  2XBQ A;  3WD6 A;  1LU4 A;  2GS3 A;  3W8S A;  3GMF A;  2B3S A;  2DMM A;  4V2N A;  2HYX A;  4E8H A;  5JWR B;  1JZR A;  4L5L A;  4XCS A;  3I9V 2;  2CAI A;  4BWQ A;  1GSU A;  1ZGN A;  5HR2 A;  1V98 A;  2AJQ B;  2CVD A;  1BYE A;  1PKZ A;  2OA7 A;  1A8L A;  1G7O A;  2LJR A;  1GSQ A;  2VM1 A;  3LXT A;  2FGX A;  2N5F A;  2XHF A;  4WKW A;  4G2E A;  2OBI A;  3ZIT A;  3GUR A;  1PX6 A;  2H19 A;  2KLX A;  2B6M A;  4N0V A;  5ECP B;  1ZZY A;  3HJP A;  2QSI A;  3VLN A;  1TJD A;  1K0C A;  1S3D A;  4K7N A;  3WGE A;  2H6Z A;  2JSY A;  6GSU A;  1THX A;  2HT9 A;  1J0F A;  4KAE A;  2L6D A;  2GLR A;  1EEM A;  1XFL A;  4TXO B;  1A2J A;  1XWG A;  5F0G A;  1MD3 A;  3CXG A;  2G0F A;  1GSE A;  2LQQ A;  2CQ9 A;  2CX4 A;  3L9V A;  1ST9 A;  3KJY A;  1A2M A;  5JCU A;  2RM5 A;  3L0H A;  4OFN A;  1YZX A;  4O32 A;  3ERW A;  5HR0 A;  3W6G A;  2AB6 A;  5CNW A;  4KA0 A;  4K0N A;  3HDC A;  1EV4 A;  2VL2 A;  4MA9 A;  3GTU B;  3K8N A;  4KH7 A;  4EDZ A;  2H0H A;  3PH9 A;  1K0B A;  2HZE A;  1FVK A;  1GNW A;  3QOU A;  2H0G A;  1NSW A;  4RQX A;  1T4Z A;  4K7I A;  2LRN A;  4EC0 A;  2B5X A;  3DRN A;  1GUM A;  5CP1 A;  5H5Q A;  2X8G A;  5G1K A;  2LJA A;  1NHO A;  3BJ5 A;  4IKH A;  3UIW A;  2YWO A;  4ZL8 A;  4GF0 A;  4NPB A;  3TUE A;  2LQO A;  1Q4J A;  2J9H A;  1E6B A;  4HOJ A;  2FWH A;  4F2I A;  1GRX A;  3WYW A;  2VOC A;  2C80 A;  2IJY A;  3M9K A;  2LTK A;  3GFK A;  5INY A;  4AJ6 A;  1YKA A;  1MDI A;  3TKS C;  4Q5N A;  3F9U A;  3I6A A;  4IEL A;  1SL0 B;  5F06 A;  2CA8 A;  2O89 A;  3TDG A;  3ZIJ A;  2LV3 A;  4IP6 A;  3IK7 A;  2B7K A;  3FR9 A;  5ABR A;  19GS A;  1GSS A;  1S3C A;  2VCX A;  3VPQ A;  2VL9 A;  2C8U A;  1QMV A;  2YJ7 A;  4LL1 B;  4ML6 A;  1U6T A;  2KOK A;  1VF2 A;  1WMJ A;  5D96 A;  1O8X A;  1T3B A;  2RM6 A;  3HZ4 A;  3UJ1 A;  1YJ6 A;  4WET A;  1JLW A;  2OE3 A;  3P2A A;  3NOF A;  4N0Z A;  1F6M C;  3F4R A;  3TJB A;  4I97 A;  3MDK A;  2G2Q A;  1SD9 A;  2YPM A;  2K6V A;  3CRT A;  1SKW B;  2GSR A;  4LMV A;  3TKR A;  1R5A A;  3IXR A;  1GP1 A;  2X64 A;  3GN3 A;  1T8E B;  4V1A p;  2EIQ A;  4RUV A;  10GS A;  2TRC P;  2X8H A;  2MMA A;  2ZNM A;  4POK A;  1M2A A;  4DEJ A;  3QPM A;  4PQ1 A;  3TGZ A;  2REM A;  4MPF A;  3ZLP A;  1MDJ A;  2HNL A;  4EUY A;  1G6Y A;  1PRX A;  4PUA A;  1TXX A;  5EPF A;  2VAF A;  1HYU A;  2GDR A;  2I1U A;  3TCO A;  2V1M A;  2AYT A;  1GLP A;  4GSN A;  1N2A A;  2FD3 A;  4MF7 A;  1FAA A;  3FR3 A;  4TW5 A;  3IV4 A;  1O81 A;  2JAC A;  2YNX A;  1OC3 A;  3V1W A;  2XC2 A;  1AQW A;  2F8F A;  1XZO A;  1XWK A;  3HXS A;  5ELA A;  2K8V A;  4NHW A;  4OFM A;  3CBU A;  2I3Y A;  3M1G A;  4D73 B;  1HNA A;  2YN1 A;  3E9J B;  3QCP A;  1H75 A;  5IMD A;  2FUG 2;  2OBK A;  3GYK A;  1TK0 B;  1SL1 B;  3M0F A;  3GHA A;  4MJE A;  4XS1 A;  5IMC A;  5G31 A;  1V40 A;  2IIY A;  1TKD B;  2HSH A;  4FYB A;  3LGC A;  2R4V A;  2DJ2 A;  1SK2 A;  5IM9 A;  5G2Z A;  3BCI A;  4TR1 A;  5IO0 A;  1ZOF A;  3QAG A;  3DKS A;  1A24 A;  1PX7 A;  3KTL A;  4V1A g;  1R26 A;  3H4K A;  2F3M A;  4JED A;  4PQI A;  3IC4 A;  2RII A;  4ZB9 A;  1A8Y A;  4FIW A;  3QMX A;  5HR1 A;  3UBL A;  4MPG A;  2E2M A;  1B9Y C;  3VWU A;  4TOP A; 
#chains in the Genus database with same CATH topology
 4MZC A;  3IHQ A;  2GST A;  3RHB A;  4K7O A;  3HVV A;  3VWV A;  4HI7 A;  5AGY A;  4WEY A;  2TIR A;  4V2L A;  5KN1 A;  5DAK A;  1X9W B;  4EO3 A;  2PBJ A;  2VLV A;  2GZZ A;  5DBQ A;  1J08 A;  1ABA A;  4ZL7 A;  5DCH A;  4KB3 A;  3ZRE A;  4IQA A;  2VO4 A;  3EPT A;  5IO2 A;  5CRE A;  2GQL A;  5J3R A;  4MF5 A;  2PUK C;  3KMO A;  4WF5 A;  5ID2 B;  2L5O A;  1TK5 B;  2YWN A;  3KD0 A;  2DKI A;  5EY6 A;  4E8E A;  5GAP D;  4Z2U A;  3UMA A;  2O85 A;  1N8J A;  7GSS A;  4L5O A;  4I2T A;  4DVC A;  1BAY A;  8GSS A;  6GSY A;  5D9V A;  1JFU A;  2IN3 A;  1JZW A;  1B8X A;  1NM3 A;  3FZ4 A;  4GRF A;  3PPU A;  3Q6O A;  2GZY A;  11GS A;  3WT2 A;  3L78 A;  5G5E A;  2DJ3 A;  3UOM A;  5A5K A;  1G0T A;  3RPP A;  5COH A;  1OC9 B;  1F3A A;  1HNC A;  1MTC A;  4NHZ A;  3UAR A;  2KHP A;  4J56 E;  5KOX A;  3IA1 A;  1PL2 A;  4J2F A;  2HSM A;  3IOS A;  4HU7 A;  17GS A;  1AQX A;  2MMO A;  1TDI A;  3RPN A;  4XHM A;  1Z9H A;  1U3I A;  2P31 A;  3D4T A;  1O85 A;  2H75 A;  2AAW A;  3FZ5 A;  1SD8 A;  5DAK B;  5CRW A;  4MZW A;  3TKS E;  3IRA A;  3TKS A;  1EWX A;  3UEM A;  1M2B A;  1QK8 A;  2YZU A;  2YAN A;  1NHY A;  1MEK A;  3RBT A;  4KF9 A;  4K9Z A;  3CQF A;  5F8B A;  2OAC A;  2R0C A;  4KCE A;  4NV2 A;  1F3B A;  4TRX A;  3S9F A;  4FQU A;  3VWW A;  3MAK A;  4MK3 A;  4OMV A;  3N5O A;  4IGJ A;  4OFT A;  4IJ3 A;  2VD0 A;  4PTS A;  4BVX B;  2H74 A;  1J9B A;  2IMD A;  3F0I A;  3VPT A;  1SL2 B;  2VCV A;  4AJ8 A;  4QQ7 A;  1EOG A;  3D21 A;  1NW2 A;  4PQH A;  2GQK A;  1K0M A;  3IAS 2;  1JZO A;  1JLV A;  3DEX A;  5B8A A;  2HLS A;  4IW9 A;  3FZ9 A;  1TU8 A;  3TJK A;  5J9C A;  1TW9 A;  2M46 A;  2PER A;  3F3Q A;  5ECQ B;  5HFK A;  3TRP A;  5LNK e;  2ON7 A;  2H66 A;  3EU4 A;  6GSX A;  4JRR A;  4CDO A;  2DJ1 A;  1QXH A;  5IMZ A;  5IPH A;  1PKW A;  1EP7 A;  1T00 A;  2MBT A;  2XBI A;  4PGT A;  4ACS A;  1SYX A;  1KEB A;  5C00 A;  2VIM A;  1BJX A;  3O3T A;  1QUW A;  4MMM A;  2YZH A;  4HJM A;  2E7P A;  4K5R A;  3ED3 A;  1PSQ A;  2EIO A;  3M8N A;  3LYP A;  3CYN A;  3ERF A;  4KDU A;  1URM A;  2VCQ A;  3ZVJ A;  3LOR A;  5FHI A;  3F6F A;  4MCU A;  3WGX A;  1EP8 A;  5B8B A;  3UVT A;  2HRA A;  4JZQ A;  4L8E A;  1OKD A;  5KOW A;  2IMI A;  3A3T A;  2HRF A;  1UA5 A;  3F63 A;  4ZB6 A;  4RI6 A;  2K8S A;  1BG5 A;  1G6W A;  1X5C A;  4KSO A;  2WJU A;  3HHV A;  5HQP A;  2H1B A;  2R0G A;  3E0U A;  3GX0 A;  3ZIV A;  5ECM B;  5EL8 A;  1VF3 A;  3PGT A;  2A2S A;  2NDO A;  1X0R A;  1M3J A;  3KCM A;  4V2M A;  1E2Y A;  1BED A;  3TRX A;  2C3Q A;  1X9S B;  4K0G A;  2XPE A;  1X9M B;  1TTZ A;  3I69 A;  4Q5F A;  3O6T A;  2YWI A;  2VLT A;  4N30 A;  4ECB A;  3IC8 A;  4J57 E;  4NMU A;  3ZRD A;  3QFB C;  2GT5 A;  2VCZ A;  1B4P A;  3J7Y k;  3ZFL A;  1I9D A;  4TVE A;  1SKS B;  4CHS A;  3G7Y A;  3OR5 A;  3GST A;  1V9W A;  2LJK A;  4TR0 A;  4PXO A;  1XPV A;  1YQ1 A;  5IMA A;  4KW6 A;  5JCG A;  3GL3 A;  1Z7P A;  2FWF A;  3L9S A;  3ERG A;  4ZB8 A;  4TN8 A;  1DBY A;  2X99 A;  1FOH A;  13GS A;  4ZIJ A;  1KNG A;  4HU9 A;  2HRN A;  1FVJ A;  2C3N A;  1K3L A;  4YKG A;  3SWL A;  3LSZ A;  4O7H A;  2WGR A;  2AV4 A;  1TU7 A;  3L4N A;  4BL7 A;  1ERT A;  2ZUP A;  2VM2 A;  1Z6N A;  2IFQ A;  1XXU A;  2NBS A;  5J5N A;  4PNF A;  2BTO T;  4WXT A;  2HSY A;  4P3Y B;  5HFI A;  1XVQ A;  2IPA A;  3CMI A;  4BWS A;  3ZMK A;  4XIH A;  1EGR A;  6GSS A;  4LA1 A;  5GST A;  4EF0 A;  3DVX A;  2OJL A;  1WWJ A;  4ISD A;  4EIP A;  14GS A;  1Y25 A;  1M9A A;  1PN9 A;  1XWA A;  3HJO A;  4GXZ A;  5G1L A;  1Z5Y E;  4GCI A;  1BQ7 A;  3GUS A;  5LCZ A;  16GS A;  3H93 A;  2RLI A;  2BMX A;  3MNG A;  3TKQ A;  1V2A A;  2A4H A;  2NPB A;  2JAD A;  5D9W A;  2HZE B;  1CQG A;  4TXV A;  1IYH A;  2YCD A;  3KMN A;  3RAZ A;  3A2V A;  1GL8 A;  5DAL A;  1A23 A;  3HCZ A;  4BPY A;  4MJA A;  4KDX A;  5L71 A;  4AF2 A;  1FB0 A;  1T7P B;  4K5S A;  5BMU A;  1DE1 A;  3IHG A;  1AW9 A;  4MH3 A;  2H30 A;  1TOF A;  3EWL A;  1OKT A;  2WCI A;  4JR4 A;  3GH6 A;  4YQU A;  3KP8 A;  2C4J A;  1B4Q A;  2XPD A;  1FHE A;  2QA1 A;  4HQS A;  1XOA A;  1A0F A;  1UC7 A;  4NWY A;  4IS0 A;  5D9T A;  5CRG A;  3D4M A;  1O73 A;  3EU3 A;  4X0X A;  2EC4 A;  2FHE A;  1JHB A;  2DIZ A;  2E2G A;  1X5D A;  1OC8 A;  3D0Z A;  5G5F A;  2LEG A;  3GV1 A;  2BJX A;  1ZL9 A;  3APS A;  1WOU A;  3F6D A;  1EZK A;  2IWT A;  2MYG A;  2GSQ A;  1FG4 A;  3GL5 A;  4JBB A;  3KEB A;  4MLY A;  4G0L A;  3KGK A;  2FA8 A;  1SK0 A;  3P7X A;  5B7C A;  5ECI B;  2ALB A;  1K0A A;  2PGT A;  4WBR D;  1OVN A;  5AN1 A;  5ECH B;  2V32 A;  3IR4 A;  2CT6 A;  5DJM A;  2MMZ A;  4DSR A;  2OAD A;  2N5A A;  3AY8 A;  22GS A;  3QAV A;  4CY8 A;  1GTA A;  4DSS A;  2L4Q A;  1B48 A;  4N10 A;  2IMK A;  1CQH A;  2GZP A;  3M3M A;  5CO3 A;  3KXO A;  4MAB A;  1TI1 A;  2O7K A;  4X43 A;  1AUC A;  4EE0 A;  2CX3 A;  1RQM A;  4GTU A;  3FHK A;  3VFI A;  1SU9 A;  4Z2R A;  1T4Y A;  5D9X A;  1WPI A;  3GNJ A;  4TR4 A;  2FNO A;  4I5Q A;  2GQM A;  4USS A;  4HJ2 A;  4O5Q A;  3FW2 A;  1T1V A;  3RHC A;  3MSZ A;  1GSY A;  1B9X C;  4KCA A;  2CZ2 A;  4PX1 A;  2YV7 A;  1TRV A;  4QL9 A;  1O7U A;  3ZYW A;  1O8W A;  1EGO A;  3APO A;  1XBS A;  4BA7 A;  2DJ0 A;  2H71 A;  4FH8 A;  4IVF A;  4OO4 A;  2OE0 A;  1ERV A;  2O87 A;  1SKR B;  1OE7 A;  4XRD A;  4EVM A;  1K0N A;  4WF4 A;  5JWQ B;  4MP4 A;  2LRT A;  2UZ8 A;  18GS A;  3DGQ A;  3F4T A;  3N9J A;  3VWX A;  9GSS A;  1TRU A;  4ILF A;  3EC3 A;  2V2G A;  3Q19 A;  4YQV A;  1R5P A;  4I8B A;  3TJF A;  1XW9 A;  4XS6 A;  3JCM L;  3CTG A;  1YEP A;  4EKZ A;  2YV9 A;  3A5W A;  4GLT A;  3F8U A;  6GSW A;  3HA9 A;  4TR1 B;  2PU9 C;  1GSD A;  2H70 A;  4PUF C;  2F8A A;  1ZYQ B;  2FLS A;  1WRY A;  1TRS A;  2VUP A;  5F05 A;  4GST A;  4TR3 A;  4ECI A;  3IAM 2;  1AIU A;  4OD7 A;  4RI7 A;  2TRX A;  3FMW A;  4Z7X A;  2DC5 A;  5H5S A;  3M9J A;  4F0C A;  4QL7 A;  1QQ2 A;  5A4W A;  3U6V A;  2RUF A;  1U87 A;  2H73 A;  2YP6 A;  2MMN A;  3EE2 A;  4HDE A;  1SK1 A;  4ZXG A;  2JZR A;  3WGD A;  1ERU A;  2P5R A;  1AC1 A;  4H86 A;  3IK9 A;  3TKP A;  3UAP A;  2H6X A;  3QFA C;  2N5B A;  4XTS A;  1K0D A;  1XCC A;  4Q5R A;  3U5R E;  2YJH A;  3ME7 A;  2Z9S A;  1GUH A;  4TXO A;  5IMV A;  2F9S A;  1GUL A;  3EVI A;  2DSA A;  5ENU A;  4CY6 A;  3FY7 A;  3UL3 A;  2PPT A;  1SJ6 A;  4MJC A;  3LJR A;  5G30 A;  2C0G A;  3VI5 A;  1ZYN A;  3HYP A;  1XG8 A;  1IYI A;  3GIX A;  3LFL A;  5CRH A;  1K3O A;  1M2D A;  6GSV A;  5AIV A;  4WBJ A;  2F51 A;  1ZYE A;  3C7M A;  1HNB A;  5J41 A;  1OE8 A;  2X49 A;  1W4V A;  3GTU A;  4OO5 A;  5JCW A;  4IN0 A;  3ZML A;  1LBK A;  2J23 A;  3C8E A;  4NXI A;  3DIE A;  3KH7 A;  2B7J A;  4K2D A;  4K1F A;  3VI7 A;  1M7T A;  2JZT A;  3DXB A;  3NZN A;  3H8Q A;  1I5G A;  3C1R A;  2R6K A;  5F07 A;  2NTO A;  2LST A;  3D6I A;  4ID0 A;  3FK8 A;  1PMT A;  3C1S A;  2LNT A;  4PUR A;  4Z2T A;  2I4A A;  4K6X A;  4HEA 2;  3LEF A;  2PMT A;  4HZ2 A;  3ZFB A;  3O76 A;  4ZBD A;  3QDN A;  3HVX A;  3ISO A;  1FOV A;  5CAX A;  4POB A;  3BBY A;  3D22 A;  5DQY A;  3FKF A;  1YF1 A;  1VF1 A;  2IMF A;  4GQC A;  1GUK A;  2MBS A;  2FA4 A;  3A2X A;  2KP1 A;  4FO5 A;  5JWO B;  3C71 A;  4JR6 A;  2P5Q A;  4ML1 A;  4EIQ A;  1PGT A;  2DIY A;  2H6Y A;  4I2U A;  1THO A;  5DVB A;  5C04 A;  3J7Y b;  1EV9 A;  2O8V B;  2LKU A;  2PWJ A;  3P90 A;  2WUL A;  5EVO A;  1MD4 A;  3FR6 A;  3HD5 A;  1K0O A;  4X1U A;  4LLR A;  1AAZ A;  4WR5 A;  2H72 A;  2HFD A;  4PNG A;  2K9F A;  5AIS A;  20GS A;  2HI7 A;  5ECS A;  5DDL A;  4YKF A;  4L0U A;  1AQV A;  2DKH A;  2L4C A;  3BCK A;  2HE3 A;  4KDY A;  1Q98 A;  2R5G A;  2GSS A;  2R37 A;  1QGV A;  3KP9 A;  4OCE A;  3TOU A;  3VK9 A;  3GSS A;  4LMW A;  1Z7R A;  2H76 A;  1PD2 1;  1ON4 A;  2B5E A;  3DML A;  2DLX A;  3KIJ A;  3US3 A;  4F82 A;  5DCG A;  2YOI A;  2QC7 A;  5IPG A;  1G7E A;  3F4S A;  5HFG A;  4IHU A;  4ZL9 A;  5J4U A;  4YAV A;  5CRD A;  5BRT A;  4BVY A;  1SJZ A;  2M80 A;  1V57 A;  1WIK A;  2B1K A;  3DWV A;  3R2Q A;  2LRC A;  1EOH A;  3NIV A;  1FB6 A;  2H8L A;  2C0E A;  3MWH A;  1A2L A;  1Z3E A;  1VF4 A;  5FWG A;  3QD9 A;  2A2R A;  3TOT A;  1M9B A;  3GKK A;  3GKX A;  2OE1 A;  5E59 A;  2VCW A;  3EIN A;  4N11 A;  2IL3 A;  3GH9 A;  4FYC A;  2R3X A;  3HY2 A;  4F0B A;  1TK8 B;  3HZ8 A;  1GWC A;  1V58 A;  5D8I A;  1YY7 A;  3A5I A;  2I81 A;  2A4V A;  5ECN B;  1XVW A;  5KN0 A;  1USB A;  4G9H A;  3FRC A;  4F03 A;  1S3A A;  1SEN A;  3G9B A;  4D73 A;  2PN8 A;  3KZQ A;  4KGI A;  2ON5 A;  3EUR A;  1FO5 A;  2QGV A;  2VD1 A;  4XS4 A;  5ELG A;  2IME A;  1DSB A;  1F9M A;  5IMF A;  2JU5 A;  2WB9 A;  3APQ A;  4FYU A;  1MDK A;  1A0R P;  1OYJ A;  1SYR A;  2WRT A;  2C1Y A;  4OWY A;  2R2J A;  4KUN A;  4HSC X;  1KTE A;  4MZB A;  3L9U A;  3HVS A;  3DD3 A;  3LYK A;  1GLQ A;  1TRW A;  3D5J A;  4HS1 A;  2D2Z A;  5HR3 A;  3UVH A;  2KP2 A;  4RQR A;  5GSS A;  2C0D A;  5A4V A;  3CSI A;  1X5E A;  4AGS A;  2P0G A;  4KX4 A;  4TKY A;  4BVY B;  1QFN A;  2LS5 A;  1H4O A;  2WFC A;  1XWC A;  4OCF A;  4BL7 B;  1GNE A;  3TRQ A;  2LUS A;  2IFQ B;  3EMP A;  2LNS A;  2V41 A;  2ES7 A;  4EL1 A;  2ZCT A;  1PQN A;  3GRX A;  2GT6 A;  2RUE A;  2I9H A;  4I6X A;  3CTF A;  1YEX A;  1YF0 A;  1M0U A;  3GX8 A;  2L57 A;  4YQM A;  3PR8 A;  5KN2 A;  2V6K A;  3PIN A;  5IOW A;  2M72 A;  5GAN D;  4LL4 B;  1SJI A;  4ZIL A;  5ID2 A;  5A4U A;  1Y6E A;  2FY6 A;  5B6M A;  5IIZ A;  1AXD A;  1WE0 A;  2L6C A;  1YDK A;  3TJJ A;  5D93 A;  2DJJ A;  3DVW A;  2VL2 C;  2MZC A;  1LJR A;  1GSF A;  2JZS A;  2E0Q A;  4MF6 A;  1GH2 A;  5CYY A;  4XS4 B;  1UN2 A;  4KE3 A;  4JU5 A;  5DAL B;  1VRS D;  1ERW A;  3GA4 A;  4POM A;  3LQ7 A;  3HJM A;  5FT3 A;  2B5Y A;  4XRA A;  1OC9 A;  3LXZ A;  2B1L A;  2WDU A;  4GQF A;  4YAP A;  2GVP A;  4WR4 A;  2AHE A;  4ULX A;  1JZD A;  1M99 A;  1M3I A;  3QAW A;  4HZ4 A;  3ME8 A;  3QR6 A;  2EIR A;  3Q18 A;  4O92 A;  4KND A;  5ECO B;  1PN0 A;  3KTB A;  1TI3 A;  1HD2 A;  2C3T A;  2NVL A;  2HXK A;  4G10 A;  4KSM A;  1GTI A;  2FWG A;  4F9Z A;  1R7H A;  3W8J A;  3HKR A;  1F37 A;  2DJK A;  3ZTL A;  3SBC A;  3A2W A;  2VL3 A;  5DJL A;  4CW9 A;  4IJI A;  3G7I A;  2OKA A;  1PFO A;  3HVN A;  3IDV A;  2DML A;  4L0W A;  1RW1 A;  3FYG A;  12GS A;  3UBK A;  1XW5 A;  3TB2 A;  5IOX A;  4MJB A;  4ECJ A;  2YWM A;  4HQZ A;  1UVZ A;  3CSH A;  3BD2 A;  3ZZX A;  3RDW A;  1EEJ A;  4NAX A;  3ZL5 A;  4BVX A;  1U3A A;  5ECL B;  1F2E A;  3FZA A;  1O6J A;  5KN3 A;  1XWB A;  4JE1 A;  2HZF A;  3IPZ A;  3G7J A;  4DSQ A;  1ZMA A;  1ILO A;  2L5L A;  1HQO A;  4ZBA A;  2DBC A;  1U88 A;  1DE2 A;  2K18 A;  3LG6 A;  4DSS B;  4EXJ A;  3MYD A;  3P8W A;  2AUV A;  4GWR A;  1TP9 A;  2WZ9 A;  1WP0 A;  1XW6 A;  1C72 A;  1OAZ A;  5H5R A;  3TJG A;  2QA2 A;  5E4W A;  5LD0 A;  2H1A A;  3GKM A;  2JL4 A;  2FWE A;  3DYR A;  3LWA A;  1ACV A;  5B6N A;  2V6O A;  1R4W A;  2PVQ A;  3WT1 A;  4Q5Q A;  4G19 A;  2GTU A;  3VUR A;  4MNN A;  4GSS A;  3EMX A;  1DUG A;  2H0I A;  2VLU A;  2KUC A;  5ECR B;  1FW1 A;  1PA3 A;  1VGL A;  4YH2 A;  4POL A;  6GST A;  1Z6M A;  3E3E A;  4ECC A;  3GKN A;  2H01 A;  2WS2 A;  5KEJ A;  1XOB A;  2H1G A;  5DQS A;  2GGT A;  4IP1 A;  2QKE A;  5AIX A;  1RK4 A;  2CZ3 A;  1WJK A;  3H1N A;  3CRU A;  4HUA A;  4O5R A;  2FCH A;  3KH9 A;  2VCT A;  1YKC A;  3F3R A;  1GTU A;  3C73 A;  3I43 A;  1GTB A;  4IQ1 A;  1ZCP A;  2CVK A;  4NV5 A;  2CAQ A;  3EYT A;  4K8M A;  5D73 A;  3H79 A;  2JSZ A;  3IE3 A;  5IQY A;  2C0F A;  2L59 A;  1KBN A;  3IBH A;  3ZVJ D;  5GZZ B;  2CVB A;  1K3Y A;  1BX9 A;  4MH2 A;  5ECK B;  1PL1 A;  1ML6 A;  3KM6 A;  3Q74 A;  2H1D A;  2CV4 A;  3BOA A;  4EDY A;  1W89 A;  4ZBB A;  2X8C A;  1XIY A;  4MDC A;  3FEU A;  3CSJ A;  5J9B A;  2PVO C;  4IBP A;  4AJ7 A;  2XBQ A;  3WD6 A;  1LU4 A;  2GS3 A;  3W8S A;  3GMF A;  2B3S A;  2DMM A;  4V2N A;  2HYX A;  4E8H A;  5JWR B;  1JZR A;  4L5L A;  4XCS A;  3I9V 2;  2CAI A;  4BWQ A;  1GSU A;  1ZGN A;  5HR2 A;  3MIX A;  1V98 A;  2AJQ B;  2CVD A;  1BYE A;  1PKZ A;  2OA7 A;  1A8L A;  1G7O A;  4G0K A;  2LJR A;  1GSQ A;  2VM1 A;  3LXT A;  2FGX A;  2N5F A;  2XHF A;  4WKW A;  4G2E A;  2OBI A;  3ZIT A;  3GUR A;  1PX6 A;  4X4J A;  2H19 A;  2KLX A;  2A2P A;  2B6M A;  4N0V A;  5ECP B;  1ZZY A;  3HJP A;  2QSI A;  3VLN A;  1TJD A;  1K0C A;  1S3D A;  4K7N A;  3WGE A;  2H6Z A;  2JSY A;  6GSU A;  1THX A;  2HT9 A;  1J0F A;  4KAE A;  2L6D A;  2GLR A;  1EEM A;  1XFL A;  4TXO B;  1A2J A;  1XWG A;  5F0G A;  1MD3 A;  3CXG A;  2G0F A;  1GSE A;  2LQQ A;  2CQ9 A;  2CX4 A;  3L9V A;  1ST9 A;  3KJY A;  1A2M A;  5JCU A;  2RM5 A;  3L0H A;  4OFN A;  4G0I A;  1ZYP A;  1YZX A;  4O32 A;  3ERW A;  5HR0 A;  3W6G A;  2AB6 A;  5CNW A;  4KA0 A;  4K0N A;  3HDC A;  1EV4 A;  2VL2 A;  3R3E A;  4MA9 A;  3GTU B;  3K8N A;  4KH7 A;  4EDZ A;  2H0H A;  3PH9 A;  1K0B A;  2HZE A;  1FVK A;  1GNW A;  3QOU A;  2H0G A;  1NSW A;  4RQX A;  1T4Z A;  4K7I A;  2LRN A;  4BIK A;  4EC0 A;  2B5X A;  3DRN A;  1GUM A;  5CP1 A;  5H5Q A;  2X8G A;  5G1K A;  2LJA A;  1NHO A;  3BJ5 A;  4IKH A;  3UIW A;  2YWO A;  4ZL8 A;  4GF0 A;  4NPB A;  3TUE A;  2LQO A;  1Q4J A;  2J9H A;  1E6B A;  4HOJ A;  1S3R A;  2FWH A;  4F2I A;  1GRX A;  3WYW A;  2VOC A;  2C80 A;  2IJY A;  3LW9 A;  3M9K A;  2LTK A;  3GFK A;  5INY A;  4AJ6 A;  1YKA A;  1MDI A;  3TKS C;  4Q5N A;  3F9U A;  3I6A A;  4IEL A;  1SL0 B;  5F06 A;  2CA8 A;  2O89 A;  3TDG A;  3ZIJ A;  2LV3 A;  4IP6 A;  3IK7 A;  2B7K A;  3FR9 A;  5ABR A;  19GS A;  1GSS A;  1S3C A;  2VCX A;  3VPQ A;  2HRK A;  2VL9 A;  2C8U A;  1QMV A;  2YJ7 A;  4LL1 B;  4ML6 A;  1U6T A;  4ICY A;  2KOK A;  1VF2 A;  1WMJ A;  5D96 A;  1O8X A;  1T3B A;  2RM6 A;  3HZ4 A;  3UJ1 A;  2X4A A;  1YJ6 A;  4WET A;  1JLW A;  2OE3 A;  4A5P A;  3P2A A;  3NOF A;  4N0Z A;  1F6M C;  3F4R A;  3TJB A;  4I97 A;  3MDK A;  2G2Q A;  1SD9 A;  2YPM A;  2K6V A;  3CRT A;  1SKW B;  2GSR A;  4LMV A;  3TKR A;  1R5A A;  3IXR A;  1GP1 A;  2X64 A;  3GN3 A;  4O5U A;  4V1A p;  1T8E B;  2EIQ A;  2R0P A;  4RUV A;  10GS A;  2TRC P;  2X8H A;  2MMA A;  2ZNM A;  4POK A;  1M2A A;  4DEJ A;  3QPM A;  4PQ1 A;  3TGZ A;  2REM A;  4MPF A;  3ZLP A;  1MDJ A;  2HNL A;  4EUY A;  1G6Y A;  1PRX A;  4PUA A;  1TXX A;  5EPF A;  2VAF A;  1HYU A;  2GDR A;  2I1U A;  3TCO A;  2V1M A;  2AYT A;  1GLP A;  4GSN A;  1N2A A;  2FD3 A;  4MF7 A;  1FAA A;  3FR3 A;  4TW5 A;  3IV4 A;  1O81 A;  2JAC A;  2YNX A;  1OC3 A;  3V1W A;  2XC2 A;  1AQW A;  2F8F A;  1XZO A;  1XWK A;  3HXS A;  5ELA A;  2K8V A;  4NHW A;  4OFM A;  3CBU A;  2I3Y A;  3M1G A;  4D73 B;  1HNA A;  2YN1 A;  3E9J B;  3QCP A;  1H75 A;  5IMD A;  2FUG 2;  2OBK A;  3GYK A;  1TK0 B;  1SL1 B;  3M0F A;  3GHA A;  4MJE A;  4XS1 A;  5IMC A;  5G31 A;  1V40 A;  2IIY A;  1TKD B;  2HSH A;  4FYB A;  3LGC A;  2R4V A;  2DJ2 A;  1SK2 A;  5IM9 A;  5G2Z A;  3BCI A;  4TR1 A;  5IO0 A;  4K2X A;  1ZOF A;  3QAG A;  3DKS A;  1A24 A;  1PX7 A;  3KTL A;  4V1A g;  1R26 A;  3H4K A;  2F3M A;  4JED A;  4PQI A;  3IC4 A;  2RII A;  4ZB9 A;  1A8Y A;  4FIW A;  3QMX A;  5HR1 A;  3UBL A;  4MPG A;  2E2M A;  1B9Y C;  3VWU A;  4TOP A; 
#chains in the Genus database with same CATH homology
 4MZC A;  3IHQ A;  2GST A;  3RHB A;  4K7O A;  3HVV A;  3VWV A;  4HI7 A;  5AGY A;  4WEY A;  2TIR A;  4V2L A;  5KN1 A;  5DAK A;  1X9W B;  4EO3 A;  2PBJ A;  2VLV A;  2GZZ A;  5DBQ A;  1J08 A;  1ABA A;  4ZL7 A;  5DCH A;  4KB3 A;  3ZRE A;  4IQA A;  2VO4 A;  3EPT A;  5IO2 A;  5CRE A;  2GQL A;  5J3R A;  4MF5 A;  2PUK C;  3KMO A;  4WF5 A;  5ID2 B;  2L5O A;  1TK5 B;  2YWN A;  3KD0 A;  2DKI A;  5EY6 A;  4E8E A;  5GAP D;  4Z2U A;  3UMA A;  2O85 A;  1N8J A;  7GSS A;  4L5O A;  4I2T A;  4DVC A;  1BAY A;  8GSS A;  6GSY A;  5D9V A;  1JFU A;  2IN3 A;  1JZW A;  1B8X A;  1NM3 A;  3FZ4 A;  4GRF A;  3PPU A;  3Q6O A;  2GZY A;  11GS A;  3WT2 A;  3L78 A;  5G5E A;  2DJ3 A;  3UOM A;  5A5K A;  1G0T A;  3RPP A;  5COH A;  1OC9 B;  1F3A A;  1HNC A;  1MTC A;  4NHZ A;  3UAR A;  2KHP A;  4J56 E;  5KOX A;  3IA1 A;  1PL2 A;  4J2F A;  2HSM A;  3IOS A;  4HU7 A;  17GS A;  1AQX A;  2MMO A;  1TDI A;  3RPN A;  4XHM A;  1Z9H A;  1U3I A;  2P31 A;  3D4T A;  1O85 A;  2H75 A;  2AAW A;  3FZ5 A;  1SD8 A;  5DAK B;  5CRW A;  4MZW A;  3TKS E;  3IRA A;  3TKS A;  1EWX A;  3UEM A;  1M2B A;  1QK8 A;  2YZU A;  2YAN A;  1NHY A;  1MEK A;  3RBT A;  4KF9 A;  4K9Z A;  5F8B A;  2OAC A;  2R0C A;  4KCE A;  4NV2 A;  1F3B A;  4TRX A;  3S9F A;  4FQU A;  3VWW A;  3MAK A;  4MK3 A;  4OMV A;  3N5O A;  4IGJ A;  4OFT A;  4IJ3 A;  2VD0 A;  4PTS A;  4BVX B;  2H74 A;  1J9B A;  2IMD A;  3F0I A;  3VPT A;  1SL2 B;  2VCV A;  4AJ8 A;  4QQ7 A;  1EOG A;  3D21 A;  1NW2 A;  4PQH A;  2GQK A;  1K0M A;  3IAS 2;  1JZO A;  1JLV A;  3DEX A;  5B8A A;  2HLS A;  4IW9 A;  3FZ9 A;  1TU8 A;  3TJK A;  5J9C A;  1TW9 A;  2M46 A;  2PER A;  3F3Q A;  5ECQ B;  5HFK A;  3TRP A;  5LNK e;  2ON7 A;  2H66 A;  3EU4 A;  6GSX A;  4JRR A;  4CDO A;  2DJ1 A;  1QXH A;  5IMZ A;  5IPH A;  1PKW A;  1EP7 A;  1T00 A;  2MBT A;  2XBI A;  4PGT A;  4ACS A;  1SYX A;  1KEB A;  5C00 A;  2VIM A;  1BJX A;  3O3T A;  1QUW A;  4MMM A;  2YZH A;  4HJM A;  2E7P A;  4K5R A;  3ED3 A;  1PSQ A;  2EIO A;  3M8N A;  3LYP A;  3CYN A;  3ERF A;  4KDU A;  1URM A;  2VCQ A;  3ZVJ A;  3LOR A;  5FHI A;  3F6F A;  4MCU A;  3WGX A;  1EP8 A;  5B8B A;  3UVT A;  2HRA A;  4JZQ A;  4L8E A;  1OKD A;  5KOW A;  2IMI A;  3A3T A;  2HRF A;  1UA5 A;  3F63 A;  4ZB6 A;  4RI6 A;  2K8S A;  1BG5 A;  1G6W A;  1X5C A;  4KSO A;  2WJU A;  3HHV A;  5HQP A;  2H1B A;  2R0G A;  3E0U A;  3GX0 A;  3ZIV A;  5ECM B;  5EL8 A;  1VF3 A;  3PGT A;  2A2S A;  2NDO A;  1X0R A;  3KCM A;  4V2M A;  1E2Y A;  1BED A;  3TRX A;  2C3Q A;  1X9S B;  4K0G A;  2XPE A;  1X9M B;  1TTZ A;  3I69 A;  4Q5F A;  3O6T A;  2YWI A;  2VLT A;  4N30 A;  4ECB A;  3IC8 A;  4J57 E;  4NMU A;  3ZRD A;  3QFB C;  2GT5 A;  2VCZ A;  1B4P A;  3J7Y k;  3ZFL A;  1I9D A;  4TVE A;  1SKS B;  4CHS A;  3G7Y A;  3OR5 A;  3GST A;  1V9W A;  2LJK A;  4TR0 A;  4PXO A;  1XPV A;  1YQ1 A;  5IMA A;  4KW6 A;  5JCG A;  3GL3 A;  1Z7P A;  2FWF A;  3L9S A;  3ERG A;  4ZB8 A;  4TN8 A;  1DBY A;  2X99 A;  1FOH A;  13GS A;  4ZIJ A;  1KNG A;  4HU9 A;  2HRN A;  1FVJ A;  2C3N A;  1K3L A;  4YKG A;  3SWL A;  3LSZ A;  4O7H A;  2WGR A;  2AV4 A;  1TU7 A;  3L4N A;  4BL7 A;  1ERT A;  2ZUP A;  2VM2 A;  1Z6N A;  2IFQ A;  1XXU A;  2NBS A;  5J5N A;  4PNF A;  2BTO T;  4WXT A;  2HSY A;  4P3Y B;  5HFI A;  1XVQ A;  2IPA A;  3CMI A;  4BWS A;  3ZMK A;  4XIH A;  1EGR A;  6GSS A;  4LA1 A;  5GST A;  4EF0 A;  3DVX A;  2OJL A;  1WWJ A;  4ISD A;  4EIP A;  14GS A;  1Y25 A;  1M9A A;  1PN9 A;  1XWA A;  3HJO A;  4GXZ A;  5G1L A;  1Z5Y E;  4GCI A;  1BQ7 A;  3GUS A;  5LCZ A;  16GS A;  3H93 A;  2RLI A;  2BMX A;  3MNG A;  3TKQ A;  1V2A A;  2A4H A;  2NPB A;  2JAD A;  5D9W A;  2HZE B;  1CQG A;  4TXV A;  1IYH A;  2YCD A;  3KMN A;  3RAZ A;  3A2V A;  1GL8 A;  5DAL A;  1A23 A;  3HCZ A;  4BPY A;  4MJA A;  4KDX A;  5L71 A;  4AF2 A;  1FB0 A;  1T7P B;  4K5S A;  5BMU A;  1DE1 A;  3IHG A;  1AW9 A;  4MH3 A;  2H30 A;  1TOF A;  3EWL A;  1OKT A;  2WCI A;  4JR4 A;  3GH6 A;  4YQU A;  3KP8 A;  2C4J A;  1B4Q A;  2XPD A;  1FHE A;  2QA1 A;  4HQS A;  1XOA A;  1A0F A;  1UC7 A;  4NWY A;  4IS0 A;  5D9T A;  5CRG A;  3D4M A;  1O73 A;  3EU3 A;  4X0X A;  2EC4 A;  2FHE A;  1JHB A;  2DIZ A;  2E2G A;  1X5D A;  1OC8 A;  3D0Z A;  5G5F A;  2LEG A;  3GV1 A;  2BJX A;  1ZL9 A;  3APS A;  1WOU A;  3F6D A;  1EZK A;  2IWT A;  2MYG A;  2GSQ A;  1FG4 A;  3GL5 A;  4JBB A;  3KEB A;  4MLY A;  4G0L A;  3KGK A;  2FA8 A;  1SK0 A;  3P7X A;  5B7C A;  5ECI B;  2ALB A;  1K0A A;  2PGT A;  4WBR D;  1OVN A;  5AN1 A;  5ECH B;  2V32 A;  3IR4 A;  2CT6 A;  5DJM A;  2MMZ A;  4DSR A;  2OAD A;  2N5A A;  3AY8 A;  22GS A;  3QAV A;  4CY8 A;  1GTA A;  4DSS A;  2L4Q A;  1B48 A;  4N10 A;  2IMK A;  1CQH A;  2GZP A;  3M3M A;  5CO3 A;  3KXO A;  4MAB A;  1TI1 A;  2O7K A;  4X43 A;  1AUC A;  4EE0 A;  2CX3 A;  1RQM A;  4GTU A;  3FHK A;  3VFI A;  1SU9 A;  4Z2R A;  1T4Y A;  5D9X A;  1WPI A;  3GNJ A;  4TR4 A;  2FNO A;  4I5Q A;  2GQM A;  4USS A;  4HJ2 A;  4O5Q A;  3FW2 A;  1T1V A;  3RHC A;  3MSZ A;  1GSY A;  1B9X C;  4KCA A;  2CZ2 A;  4PX1 A;  2YV7 A;  1TRV A;  4QL9 A;  1O7U A;  3ZYW A;  1O8W A;  1EGO A;  3APO A;  1XBS A;  4BA7 A;  2DJ0 A;  2H71 A;  4FH8 A;  4IVF A;  4OO4 A;  2OE0 A;  1ERV A;  2O87 A;  1SKR B;  1OE7 A;  4XRD A;  4EVM A;  1K0N A;  4WF4 A;  5JWQ B;  4MP4 A;  2LRT A;  2UZ8 A;  18GS A;  3DGQ A;  3F4T A;  3N9J A;  3VWX A;  9GSS A;  1TRU A;  4ILF A;  3EC3 A;  2V2G A;  3Q19 A;  4YQV A;  1R5P A;  4I8B A;  3TJF A;  1XW9 A;  4XS6 A;  3JCM L;  3CTG A;  1YEP A;  4EKZ A;  2YV9 A;  3A5W A;  4GLT A;  3F8U A;  6GSW A;  3HA9 A;  4TR1 B;  2PU9 C;  1GSD A;  2H70 A;  4PUF C;  2F8A A;  1ZYQ B;  2FLS A;  1WRY A;  1TRS A;  2VUP A;  5F05 A;  4GST A;  4TR3 A;  4ECI A;  3IAM 2;  1AIU A;  4OD7 A;  4RI7 A;  2TRX A;  3FMW A;  4Z7X A;  2DC5 A;  5H5S A;  3M9J A;  4F0C A;  4QL7 A;  1QQ2 A;  5A4W A;  3U6V A;  2RUF A;  1U87 A;  2H73 A;  2YP6 A;  2MMN A;  3EE2 A;  4HDE A;  1SK1 A;  4ZXG A;  2JZR A;  3WGD A;  1ERU A;  2P5R A;  1AC1 A;  4H86 A;  3IK9 A;  3TKP A;  3UAP A;  2H6X A;  3QFA C;  2N5B A;  4XTS A;  1K0D A;  1XCC A;  4Q5R A;  3U5R E;  2YJH A;  3ME7 A;  2Z9S A;  1GUH A;  4TXO A;  5IMV A;  2F9S A;  1GUL A;  3EVI A;  2DSA A;  5ENU A;  4CY6 A;  3FY7 A;  3UL3 A;  2PPT A;  1SJ6 A;  4MJC A;  3LJR A;  5G30 A;  2C0G A;  3VI5 A;  1ZYN A;  3HYP A;  1IYI A;  3GIX A;  3LFL A;  5CRH A;  1K3O A;  1M2D A;  6GSV A;  5AIV A;  4WBJ A;  2F51 A;  1ZYE A;  3C7M A;  1HNB A;  5J41 A;  1OE8 A;  2X49 A;  1W4V A;  3GTU A;  4OO5 A;  5JCW A;  4IN0 A;  3ZML A;  1LBK A;  2J23 A;  3C8E A;  4NXI A;  3DIE A;  3KH7 A;  2B7J A;  4K2D A;  4K1F A;  3VI7 A;  1M7T A;  2JZT A;  3DXB A;  3NZN A;  3H8Q A;  1I5G A;  3C1R A;  2R6K A;  5F07 A;  2NTO A;  2LST A;  3D6I A;  4ID0 A;  3FK8 A;  1PMT A;  3C1S A;  2LNT A;  4PUR A;  4Z2T A;  2I4A A;  4K6X A;  4HEA 2;  3LEF A;  2PMT A;  4HZ2 A;  3ZFB A;  3O76 A;  4ZBD A;  3QDN A;  3HVX A;  3ISO A;  1FOV A;  5CAX A;  4POB A;  3BBY A;  3D22 A;  5DQY A;  3FKF A;  1YF1 A;  1VF1 A;  2IMF A;  4GQC A;  1GUK A;  2MBS A;  2FA4 A;  3A2X A;  2KP1 A;  4FO5 A;  5JWO B;  3C71 A;  4JR6 A;  2P5Q A;  4ML1 A;  4EIQ A;  1PGT A;  2DIY A;  2H6Y A;  4I2U A;  1THO A;  5DVB A;  5C04 A;  3J7Y b;  1EV9 A;  2O8V B;  2LKU A;  2PWJ A;  3P90 A;  2WUL A;  5EVO A;  1MD4 A;  3FR6 A;  3HD5 A;  1K0O A;  4X1U A;  4LLR A;  1AAZ A;  4WR5 A;  2H72 A;  2HFD A;  4PNG A;  2K9F A;  5AIS A;  20GS A;  2HI7 A;  5ECS A;  5DDL A;  4YKF A;  4L0U A;  1AQV A;  2DKH A;  2L4C A;  3BCK A;  2HE3 A;  4KDY A;  1Q98 A;  2R5G A;  2GSS A;  2R37 A;  1QGV A;  3KP9 A;  4OCE A;  3TOU A;  3VK9 A;  3GSS A;  4LMW A;  1Z7R A;  2H76 A;  1PD2 1;  1ON4 A;  2B5E A;  3DML A;  2DLX A;  3KIJ A;  3US3 A;  4F82 A;  5DCG A;  2YOI A;  2QC7 A;  5IPG A;  1G7E A;  3F4S A;  5HFG A;  4IHU A;  4ZL9 A;  5J4U A;  4YAV A;  5CRD A;  5BRT A;  4BVY A;  1SJZ A;  2M80 A;  1V57 A;  1WIK A;  2B1K A;  3DWV A;  3R2Q A;  2LRC A;  1EOH A;  3NIV A;  1FB6 A;  2H8L A;  2C0E A;  3MWH A;  1A2L A;  1Z3E A;  1VF4 A;  5FWG A;  3QD9 A;  2A2R A;  3TOT A;  1M9B A;  3GKK A;  3GKX A;  2OE1 A;  5E59 A;  2VCW A;  3EIN A;  4N11 A;  2IL3 A;  3GH9 A;  4FYC A;  2R3X A;  3HY2 A;  4F0B A;  1TK8 B;  3HZ8 A;  1GWC A;  1V58 A;  5D8I A;  1YY7 A;  3A5I A;  2I81 A;  2A4V A;  5ECN B;  1XVW A;  5KN0 A;  1USB A;  4G9H A;  3FRC A;  4F03 A;  1S3A A;  1SEN A;  3G9B A;  4D73 A;  2PN8 A;  3KZQ A;  4KGI A;  2ON5 A;  3EUR A;  1FO5 A;  2QGV A;  2VD1 A;  4XS4 A;  5ELG A;  2IME A;  1DSB A;  1F9M A;  5IMF A;  2JU5 A;  2WB9 A;  3APQ A;  4FYU A;  1MDK A;  1A0R P;  1OYJ A;  1SYR A;  2WRT A;  2C1Y A;  4OWY A;  2R2J A;  4KUN A;  1KTE A;  4MZB A;  3L9U A;  3HVS A;  3DD3 A;  3LYK A;  1GLQ A;  1TRW A;  3D5J A;  4HS1 A;  2D2Z A;  5HR3 A;  3UVH A;  2KP2 A;  4RQR A;  5GSS A;  2C0D A;  5A4V A;  3CSI A;  1X5E A;  4AGS A;  2P0G A;  4KX4 A;  4TKY A;  4BVY B;  1QFN A;  2LS5 A;  1H4O A;  2WFC A;  1XWC A;  4OCF A;  4BL7 B;  1GNE A;  3TRQ A;  2LUS A;  2IFQ B;  3EMP A;  2LNS A;  2V41 A;  2ES7 A;  4EL1 A;  2ZCT A;  1PQN A;  3GRX A;  2GT6 A;  2RUE A;  2I9H A;  4I6X A;  3CTF A;  1YEX A;  1YF0 A;  1M0U A;  3GX8 A;  2L57 A;  4YQM A;  3PR8 A;  5KN2 A;  2V6K A;  3PIN A;  5IOW A;  2M72 A;  5GAN D;  4LL4 B;  1SJI A;  4ZIL A;  5ID2 A;  5A4U A;  1Y6E A;  2FY6 A;  5B6M A;  5IIZ A;  1AXD A;  1WE0 A;  2L6C A;  1YDK A;  3TJJ A;  5D93 A;  2DJJ A;  3DVW A;  2VL2 C;  2MZC A;  1LJR A;  1GSF A;  2JZS A;  2E0Q A;  4MF6 A;  1GH2 A;  5CYY A;  4XS4 B;  1UN2 A;  4KE3 A;  4JU5 A;  5DAL B;  1VRS D;  1ERW A;  3GA4 A;  4POM A;  3LQ7 A;  3HJM A;  5FT3 A;  2B5Y A;  4XRA A;  1OC9 A;  3LXZ A;  2B1L A;  2WDU A;  4GQF A;  4YAP A;  2GVP A;  4WR4 A;  2AHE A;  4ULX A;  1JZD A;  1M99 A;  3QAW A;  4HZ4 A;  3ME8 A;  3QR6 A;  2EIR A;  3Q18 A;  4O92 A;  4KND A;  5ECO B;  1PN0 A;  3KTB A;  1TI3 A;  1HD2 A;  2C3T A;  2NVL A;  2HXK A;  4G10 A;  4KSM A;  1GTI A;  2FWG A;  4F9Z A;  1R7H A;  3W8J A;  3HKR A;  1F37 A;  2DJK A;  3ZTL A;  3SBC A;  3A2W A;  2VL3 A;  5DJL A;  4CW9 A;  4IJI A;  3G7I A;  2OKA A;  3IDV A;  2DML A;  4L0W A;  1RW1 A;  3FYG A;  12GS A;  3UBK A;  1XW5 A;  3TB2 A;  5IOX A;  4MJB A;  4ECJ A;  2YWM A;  4HQZ A;  1UVZ A;  3CSH A;  3BD2 A;  3ZZX A;  3RDW A;  1EEJ A;  4NAX A;  3ZL5 A;  4BVX A;  1U3A A;  5ECL B;  1F2E A;  3FZA A;  1O6J A;  5KN3 A;  1XWB A;  4JE1 A;  2HZF A;  3IPZ A;  3G7J A;  4DSQ A;  1ZMA A;  1ILO A;  2L5L A;  1HQO A;  4ZBA A;  2DBC A;  1U88 A;  1DE2 A;  2K18 A;  3LG6 A;  4DSS B;  4EXJ A;  3MYD A;  3P8W A;  2AUV A;  4GWR A;  1TP9 A;  2WZ9 A;  1WP0 A;  1XW6 A;  1C72 A;  1OAZ A;  5H5R A;  3TJG A;  2QA2 A;  5E4W A;  5LD0 A;  2H1A A;  3GKM A;  2JL4 A;  2FWE A;  3DYR A;  3LWA A;  1ACV A;  5B6N A;  2V6O A;  1R4W A;  2PVQ A;  3WT1 A;  4Q5Q A;  4G19 A;  2GTU A;  3VUR A;  4MNN A;  4GSS A;  3EMX A;  1DUG A;  2H0I A;  2VLU A;  2KUC A;  5ECR B;  1FW1 A;  1PA3 A;  1VGL A;  4YH2 A;  4POL A;  6GST A;  1Z6M A;  3E3E A;  4ECC A;  3GKN A;  2H01 A;  2WS2 A;  5KEJ A;  1XOB A;  2H1G A;  5DQS A;  2GGT A;  4IP1 A;  2QKE A;  5AIX A;  1RK4 A;  2CZ3 A;  1WJK A;  3H1N A;  3CRU A;  4HUA A;  4O5R A;  2FCH A;  3KH9 A;  2VCT A;  1YKC A;  3F3R A;  1GTU A;  3C73 A;  3I43 A;  1GTB A;  4IQ1 A;  1ZCP A;  2CVK A;  4NV5 A;  2CAQ A;  3EYT A;  4K8M A;  5D73 A;  3H79 A;  2JSZ A;  3IE3 A;  5IQY A;  2C0F A;  2L59 A;  1KBN A;  3IBH A;  3ZVJ D;  5GZZ B;  2CVB A;  1K3Y A;  1BX9 A;  4MH2 A;  5ECK B;  1PL1 A;  1ML6 A;  3KM6 A;  3Q74 A;  2H1D A;  2CV4 A;  3BOA A;  4EDY A;  1W89 A;  4ZBB A;  2X8C A;  1XIY A;  4MDC A;  3FEU A;  3CSJ A;  5J9B A;  2PVO C;  4IBP A;  4AJ7 A;  2XBQ A;  3WD6 A;  1LU4 A;  2GS3 A;  3W8S A;  3GMF A;  2B3S A;  2DMM A;  4V2N A;  2HYX A;  4E8H A;  5JWR B;  1JZR A;  4L5L A;  4XCS A;  3I9V 2;  2CAI A;  4BWQ A;  1GSU A;  1ZGN A;  5HR2 A;  3MIX A;  1V98 A;  2AJQ B;  2CVD A;  1BYE A;  1PKZ A;  2OA7 A;  1A8L A;  1G7O A;  4G0K A;  2LJR A;  1GSQ A;  2VM1 A;  3LXT A;  2FGX A;  2N5F A;  2XHF A;  4WKW A;  4G2E A;  2OBI A;  3ZIT A;  3GUR A;  1PX6 A;  4X4J A;  2H19 A;  2KLX A;  2A2P A;  2B6M A;  4N0V A;  5ECP B;  1ZZY A;  3HJP A;  2QSI A;  3VLN A;  1TJD A;  1K0C A;  1S3D A;  4K7N A;  3WGE A;  2H6Z A;  2JSY A;  6GSU A;  1THX A;  2HT9 A;  1J0F A;  4KAE A;  2L6D A;  2GLR A;  1EEM A;  1XFL A;  4TXO B;  1A2J A;  1XWG A;  5F0G A;  1MD3 A;  3CXG A;  2G0F A;  1GSE A;  2LQQ A;  2CQ9 A;  2CX4 A;  3L9V A;  1ST9 A;  3KJY A;  1A2M A;  5JCU A;  2RM5 A;  3L0H A;  4OFN A;  4G0I A;  1ZYP A;  1YZX A;  4O32 A;  3ERW A;  5HR0 A;  3W6G A;  2AB6 A;  5CNW A;  4KA0 A;  4K0N A;  3HDC A;  1EV4 A;  2VL2 A;  3R3E A;  4MA9 A;  3GTU B;  3K8N A;  4KH7 A;  4EDZ A;  2H0H A;  3PH9 A;  1K0B A;  2HZE A;  1FVK A;  1GNW A;  3QOU A;  2H0G A;  1NSW A;  4RQX A;  1T4Z A;  4K7I A;  2LRN A;  4EC0 A;  2B5X A;  3DRN A;  1GUM A;  5CP1 A;  5H5Q A;  2X8G A;  5G1K A;  2LJA A;  1NHO A;  3BJ5 A;  4IKH A;  3UIW A;  2YWO A;  4ZL8 A;  4GF0 A;  4NPB A;  3TUE A;  2LQO A;  1Q4J A;  2J9H A;  1E6B A;  4HOJ A;  2FWH A;  4F2I A;  1GRX A;  3WYW A;  2VOC A;  2C80 A;  2IJY A;  3LW9 A;  3M9K A;  2LTK A;  3GFK A;  5INY A;  4AJ6 A;  1YKA A;  1MDI A;  3TKS C;  4Q5N A;  3F9U A;  3I6A A;  4IEL A;  1SL0 B;  5F06 A;  2CA8 A;  2O89 A;  3TDG A;  3ZIJ A;  2LV3 A;  4IP6 A;  3IK7 A;  2B7K A;  3FR9 A;  5ABR A;  19GS A;  1GSS A;  1S3C A;  2VCX A;  3VPQ A;  2HRK A;  2VL9 A;  2C8U A;  1QMV A;  2YJ7 A;  4LL1 B;  4ML6 A;  1U6T A;  4ICY A;  2KOK A;  1VF2 A;  1WMJ A;  5D96 A;  1O8X A;  1T3B A;  2RM6 A;  3HZ4 A;  3UJ1 A;  2X4A A;  1YJ6 A;  4WET A;  1JLW A;  2OE3 A;  4A5P A;  3P2A A;  3NOF A;  4N0Z A;  1F6M C;  3F4R A;  3TJB A;  4I97 A;  3MDK A;  2G2Q A;  1SD9 A;  2YPM A;  2K6V A;  3CRT A;  1SKW B;  2GSR A;  4LMV A;  3TKR A;  1R5A A;  3IXR A;  1GP1 A;  2X64 A;  3GN3 A;  4O5U A;  4V1A p;  1T8E B;  2EIQ A;  2R0P A;  4RUV A;  10GS A;  2TRC P;  2X8H A;  2MMA A;  2ZNM A;  4POK A;  1M2A A;  4DEJ A;  3QPM A;  4PQ1 A;  3TGZ A;  2REM A;  4MPF A;  3ZLP A;  1MDJ A;  2HNL A;  4EUY A;  1G6Y A;  1PRX A;  4PUA A;  1TXX A;  5EPF A;  2VAF A;  1HYU A;  2GDR A;  2I1U A;  3TCO A;  2V1M A;  2AYT A;  1GLP A;  4GSN A;  1N2A A;  2FD3 A;  4MF7 A;  1FAA A;  3FR3 A;  4TW5 A;  3IV4 A;  1O81 A;  2JAC A;  2YNX A;  1OC3 A;  3V1W A;  2XC2 A;  1AQW A;  2F8F A;  1XZO A;  1XWK A;  3HXS A;  5ELA A;  2K8V A;  4NHW A;  4OFM A;  3CBU A;  2I3Y A;  3M1G A;  4D73 B;  1HNA A;  2YN1 A;  3E9J B;  3QCP A;  1H75 A;  5IMD A;  2FUG 2;  2OBK A;  3GYK A;  1TK0 B;  1SL1 B;  3M0F A;  3GHA A;  4MJE A;  4XS1 A;  5IMC A;  5G31 A;  1V40 A;  2IIY A;  1TKD B;  2HSH A;  4FYB A;  3LGC A;  2R4V A;  2DJ2 A;  1SK2 A;  5IM9 A;  5G2Z A;  3BCI A;  4TR1 A;  5IO0 A;  4K2X A;  1ZOF A;  3QAG A;  3DKS A;  1A24 A;  1PX7 A;  3KTL A;  4V1A g;  1R26 A;  3H4K A;  2F3M A;  4JED A;  4PQI A;  3IC4 A;  2RII A;  4ZB9 A;  1A8Y A;  4FIW A;  3QMX A;  5HR1 A;  3UBL A;  4MPG A;  2E2M A;  1B9Y C;  3VWU A;  4TOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...