1AAZA

The structure of oxidized bacteriophage t4 glutaredoxin (thioredoxin)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
87
structure length
87
Chain Sequence
MFKVYGYDSNIHKCVYCDNAKRLLTVKKQPFEFINIMPEKGVFDDEKIAELLTKLGRDTQIGLTMPQVFAPDGSHIGGFDQLREYFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords GLUTAREDOXIN
publication title Structure of oxidized bacteriophage T4 glutaredoxin (thioredoxin). Refinement of native and mutant proteins.
pubmed doi rcsb
source organism Enterobacteria phage t4
total genus 19
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 1992-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1aazA00
4LLRA 1FHEA 4K0GA 1BYEA 1XWBA 1GSSA 2DBCA 1KNGA 2LJKA 3QPMA 3ZMLA 2ON5A 3J7Yk 1PL2A 5HFKA 1CQGA 2H6ZA 3RHCA 5DDLA 3ZMKA 4TR3A 4I2UA 3IV4A 3DIEA 4GSTA 2DJKA 3GIXA 1MDJA 1KTEA 2VCTA 4IHUA 3TJJA 3TJKA 1G6YA 1ZOFA 4KCAA 5CRWA 1SD9A 2FY6A 2XBIA 1XIYA 6GSYA 4NWYA 3C1SA 3VI5A 5DBQA 4K8MA 2HE3A 1QXHA 2PVOC 3HZ8A 3IAS2 3F3RA 3KMNA 3HKRA 1X9MB 2I81A 1SENA 1TOFA 1FO5A 1ERTA 3F0IA 1FG4A 1VF4A 2H0HA 1ST9A 5DCHA 1THXA 2K18A 1TXXA 5G31A 3DVWA 3LXTA 3SBCA 2LSTA 1Z7PA 2OACA 2O8VB 2M46A 2O85A 3GN3A 3RDWA 5IMZA 4PXOA 4K7IA 5G5EA 2O7KA 1PX6A 5ECHB 5D9WA 1PX7A 1R4WA 3BJ5A 2H73A 1GTIA 4MK3A 1SL1B 3ZYWA 4ACSA 2L5OA 1PL1A 1SD8A 4TR1B 1NM3A 3ME8A 4XCSA 4GTUA 4OFMA 2GZZA 3F6FA 1WP0A 4PUFC 4LA1A 5AIXA 2RM6A 2E2MA 4O92A 4MPGA 5H5RA 2LJRA 4PNGA 2RM5A 5J9CA 1S3CA 2LKUA 2LTKA 4RQRA 3D4MA 3LXZA 2Z9SA 1XWKA 4XS4A 4YAPA 2L4CA 1Z9HA 2GZYA 4HQZA 4KCEA 5DAKA 5COHA 1ZL9A 2KP1A 3UVTA 3ZIVA 1EEMA 1SJ6A 2GLRA 3LSZA 2D2ZA 3IAM2 1SK2A 5ECSA 5HR2A 4EO3A 4DVCA 3IPZA 2PGTA 1MD3A 3GX8A 3D4TA 2PBJA 3QMXA 2C8UA 5HR1A 1T7PB 2C0FA 2OE0A 1NHYA 2DSAA 2YNXA 2HRFA 1JLVA 1A24A 4XRAA 2GZPA 1PN9A 3GV1A 3MWHA 1O7UA 1OC3A 2VAFA 1X9WB 3DEXA 3HJMA 3W6GA 3TOUA 3LYPA 4GSSA 10GSA 3IOSA 4WXTA 3CRTA 3CSIA 4KNDA 3CRUA 2EIQA 4JR4A 4K7NA 1JHBA 2ZNMA 3US3A 3HA9A 2B5YA 2YOIA 4ZBBA 2CX4A 2HRNA 1OE7A 1UC7A 4X43A 2VD0A 3TKQA 3ME7A 2IMEA 2YN1A 3RPPA 4BWSA 2GSTA 2L6CA 2GT5A 4L5OA 4ML6A 1GLQA 4RUVA 4OCEA 3TJFA 1Z6MA 2CX3A 2M80A 5FT3A 3RHBA 3IDVA 2FUG2 3DWVA 2FLSA 3UAPA 5JWQB 1AIUA 1F3BA 4EE0A 3GKXA 1TRUA 2R3XA 2LRNA 2H1AA 3GURA 4BVYA 4POMA 5A4UA 3E9JB 4GQCA 1YDKA 1SYXA 5ECKB 1NHOA 1TU8A 5AN1A 3U5RE 4K1FA 2QGVA 3I6AA 6GSXA 5ELAA 1PSQA 1Y25A 2F3MA 2CVBA 2HZEA 3C1RA 3M8NA 2VLVA 2JSZA 2XHFA 1K3YA 2GTUA 4TR0A 3Q6OA 1GSQA 4BVXA 3WT1A 2XBQA 3LJRA 3Q74A 3W8SA 1YQ1A 1XW9A 1V57A 2VM1A 2OA7A 4QL7A 2DLXA 1VF1A 2C3NA 4J2FA 1TU7A 2JZRA 1TW9A 1JZWA 3ZFBA 1O6JA 5A4WA 4LMWA 1EOHA 1GSFA 3L0HA 1AC1A 1C72A 1K0NA 5KEJA 2ON7A 5FWGA 4AJ8A 3TUEA 1K0CA 3A3TA 1HNAA 2LUSA 2OJLA 2R5GA 3MAKA 2CV4A 1Y6EA 2XPEA 4PGTA 1QUWA 5GSSA 4CDOA 5F07A 1BG5A 1YF1A 2IL3A 1V2AA 2YCDA 1OE8A 1GL8A 1X9SB 2IMFA 4HQSA 2KLXA 4TKYA 2P0GA 2DIYA 2L57A 2WZ9A 3EYTA 2X99A 2O87A 1SJZA 4HU7A 4EXJA 1F6MC 3PGTA 2VCXA 3QAGA 1J0FA 1Z3EA 4F03A 3UARA 2AAWA 2PUKC 4TXVA 2P5QA 2YPMA 4EDYA 2ZCTA 4ML1A 4QL9A 4IP6A 5KN0A 4NMUA 2H74A 3TKRA 2MMZA 1YEXA 5ECNB 3QAVA 1TRSA 3DMLA 3C73A 3WT2A 3QAWA 1K0OA 3EMXA 2MBTA 4MJEA 5J4UA 3HYPA 2YV7A 5IMAA 2OBIA 4EUYA 4ZBAA 3A2XA 4Q5FA 4D73B 2HSYA 4TOPA 1X0RA 6GSUA 2GQKA 3TKSC 2RIIA 3O76A 1O8XA 3IHQA 2FHEA 4K0NA 1W4VA 3NIVA 5IIZA 5CRDA 1MTCA 4FYBA 1B9YC 1S3DA 2AHEA 5CREA 2PWJA 3P7XA 1TK0B 4Z7XA 4DSSA 4YH2A 5G1LA 3C8EA 3I43A 1K3LA 3KTBA 2C80A 4ZBDA 3ISOA 3FW2A 5D73A 4AF2A 2LEGA 3VFIA 2WRTA 1FOVA 1SKSB 7GSSA 5IMFA 4DSRA 4P3YB 4EC0A 3M3MA 2C0GA 3IBHA 3TJGA 3MDKA 1GSDA 2EIOA 3PINA 5INYA 3LWAA 4ID0A 4AJ7A 4MZBA 4Q5RA 3V1WA 1MDKA 2H71A 3UBKA 1LBKA 4JR6A 4KX4A 2X8CA 4KAEA 3U6VA 1O8WA 3EE2A 1XXUA 2AUVA 4J57E 4WF5A 3N9JA 3CSHA 5F06A 1V98A 4WF4A 2GGTA 1ZYEA 4OO4A 2DJ1A 2NPBA 2C0EA 1WPIA 2ZUPA 1GH2A 5JWOB 3F4RA 5ID2B 3LORA 1TDIA 3LQ7A 3UMAA 3FK8A 4N11A 4HJMA 3I9V2 2H1DA 2TRCP 4MJBA 1EWXA 1G6WA 1A2JA 1WWJA 2HYXA 3UJ1A 3EINA 3EWLA 1ML6A 4NAXA 1M99A 2EC4A 5EVOA 3N5OA 4ZL9A 1T1VA 1FVKA 1U88A 3ZZXA 3FKFA 3WGDA 5AGYA 1A8LA 5ECRB 1RW1A 4OCFA 2H6YA 2LS5A 4KSOA 5D96A 5DALB 1JZOA 4WEYA 2VL2A 1U3IA 1TK5B 2FWEA 4WR5A 1XWCA 3VWVA 2WCIA 2NTOA 3IK7A 4L8EA 4O7HA 2FCHA 4IJ3A 2FD3A 1XBSA 1FW1A 1LU4A 1MDIA 1F2EA 4BPYA 3Q19A 5CNWA 4ILFA 2X8HA 2CVKA 3BOAA 4ZB8A 4GSNA 4HEA2 2WS2A 1AUCA 3GX0A 2OE1A 3F9UA 1TI1A 5DJLA 3DD3A 5LNKe 1WOUA 3H1NA 3GL5A 2OADA 1YKAA 19GSA 1B9XC 5ECOB 1GNWA 1OC9B 4TN8A 4HI7A 1HD2A 1EEJA 5IO2A 2F8FA 3KD0A 4POKA 1X5CA 1Q4JA 4LMVA 4TXOB 2PU9C 2FWFA 1GSYA 3HY2A 3ZFLA 3G7IA 3JCML 5DJMA 4DSQA 1SKWB 3DXBA 4MJCA 4FYUA 3UEMA 2H75A 2VCVA 4MF7A 3KJYA 4MDCA 4JZQA 2HI7A 4KDYA 4MZCA 1A8YA 1JLWA 4G10A 1K0MA 2CZ3A 3NZNA 2PERA 1GSUA 3ZRDA 5A4VA 5LD0A 1N8JA 4OFTA 3A5WA 5ECIB 4KB3A 2OE3A 4LL1B 3HVVA 3S9FA 4ZL7A 4TRXA 4ECCA 12GSA 5KN1A 1O73A 4X0XA 3QOUA 2MMOA 2OKAA 2X8GA 5CRGA 2O89A 4POBA 3RAZA 2F9SA 1T8EB 5HR3A 2AV4A 5KN3A 4HS1A 4XIHA 1F9MA 1SJIA 4IGJA 4WR4A 1GUMA 1O81A 3KIJA 5HFIA 3UVHA 2G0FA 1E6BA 1AQWA 1YEPA 5D8IA 4YQMA 1BAYA 3I69A 2LRTA 3TB2A 3HDCA 4MABA 1WE0A 3ZVJA 4IVFA 2R4VA 1ABAA 2DMMA 4IN0A 3NOFA 2DIZA 4YAVA 5B6MA 3SWLA 3HD5A 4CHSA 2L4QA 1DE1A 4OWYA 2R37A 2TRXA 1EV4A 4I6XA 2PN8A 3CSJA 4MH2A 3EVIA 5F0GA 2VCZA 1YY7A 2YZUA 5EL8A 1PD21 4BA7A 1ERUA 2NBSA 1QMVA 1V40A 3WGEA 5EPFA 5AIVA 2YANA 5JWRB 2LQOA 1XWAA 5E59A 2V6OA 2HSHA 2K9FA 4XS4B 4MF6A 2YWMA 2B7KA 2EIRA 2KP2A 2I9HA 1TK8B 1BX9A 3VPQA 1NW2A 5G5FA 5B8AA 2GSQA 2MZCA 1V58A 3G9BA 3EMPA 1H4OA 1VF2A 4ULXA 3FRCA 5HFGA 1XW6A 3CYNA 3HJPA 2ALBA 1I9DA 1GTAA 4YQUA 4EF0A 5JCWA 1JZDA 1AQVA 1ON4A 2H76A 2KHPA 4PQHA 3LEFA 2DC5A 3HCZA 1TTZA 2AJQB 2JSYA 5IPGA 5DQSA 2B1KA 1PMTA 2YZHA 3KH7A 2CQ9A 5A5KA 1WMJA 4NV5A 3CTGA 5H5SA 3L9UA 2HNLA 1AQXA 2JADA 3KMOA 1B48A 4NHZA 3MSZA 4WKWA 1V9WA 1I5GA 3ZREA 2B7JA 3VWWA 1SL2B 2H70A 4OO5A 1WIKA 1MEKA 1QK8A 4K7OA 3C71A 1OAZA 1O85A 3GH9A 2FNOA 2H8LA 1F3AA 1IYHA 1K0BA 2VCWA 3D0ZA 1AXDA 3CTFA 2FGXA 3G7YA 2IFQA 1PA3A 2GQLA 3QD9A 1RQMA 1YZXA 5IMVA 1VGLA 2KUCA 3KEBA 1GULA 2YP6A 2GT6A 5ECPB 2XPDA 5J9BA 3L9VA 1XVWA 3DGQA 3F3QA 1T3BA 3ZTLA 11GSA 4XTSA 3H93A 3ERGA 2N5FA 1A0RP 2MMNA 3D5JA 5ELGA 4I2TA 3VK9A 5B7CA 3IRAA 2HZEB 2JL4A 2B3SA 3P90A 5IQYA 3CMIA 5J3RA 2G2QA 3QCPA 2C0DA 1R5PA 2BMXA 1G7EA 1M9BA 1PGTA 3IK9A 5IO0A 1DUGA 3WD6A 4EL1A 1B8XA 1U87A 3LG6A 1EOGA 2PMTA 5LCZA 3F4TA 3FZAA 3PR8A 5IOWA 4XS6A 1ILOA 3GKMA 2J9HA 2DJ3A 3CXGA 4OMVA 4ZILA 1SU9A 22GSA 1J08A 4DEJA 1SKRB 1BEDA 4L0WA 3KCMA 2PVQA 1DE2A 2R2JA 9GSSA 3QFAC 3L4NA 5F8BA 5J5NA 1B4PA 1SL0B 17GSA 3E3EA 4MMMA 3ERFA 2B1LA 3FEUA 13GSA 4JBBA 1GUHA 2A4VA 3BCIA 4GQFA 4IELA 4JE1A 4AGSA 5DALA 5GAND 5L71A 3VI7A 2WDUA 3HJOA 2FWGA 3FY7A 4NXIA 3FR9A 3GTUB 2H0GA 2F51A 5CRHA 1HNCA 3KGKA 4ECJA 1M7TA 5C04A 4PNFA 4NV2A 2H0IA 1GTBA 2I1UA 4TW5A 3TKPA 4ZXGA 2N5AA 4V2LA 3OR5A 4ISDA 2HT9A 4KUNA 1MD4A 1X5EA 2IN3A 5G30A 4BWQA 2GSSA 1G7OA 3FZ5A 2J23A 3QR6A 6GSSA 4G19A 4BL7A 3GYKA 3A2WA 2RUFA 4O32A 2B6MA 2C3QA 2H6XA 3HVSA 3H79A 3GHAA 1SK0A 4IW9A 1FAAA 5GZZB 2IMIA 3FYGA 3HZ4A 4TR1A 4MPFA 4N0VA 3GSSA 1KBNA 4TR4A 1UA5A 5CP1A 2V1MA 2JU5A 2WJUA 4V1Ag 1XVQA 1A2MA 1JZRA 2VO4A 3GH6A 3F4SA 1FB6A 3TGZA 2LV3A 2LNTA 3IR4A 4HJ2A 8GSSA 2WB9A 3APSA 1TRVA 3HVXA 2VCQA 4X1UA 3FR3A 5E4WA 2LJAA 2HLSA 3WGXA 5JCUA 4DSSB 3GRXA 1GTUA 2JZTA 3VLNA 5D9VA 4EVMA 2H72A 4WBJA 1TKDB 5D9XA 4N30A 1PKZA 1XOBA 1OKDA 3KM6A 3M9JA 4HU9A 3ZL5A 5H5QA 5F05A 3M0FA 5ECQB 4KA0A 5DCGA 2F8AA 3L78A 4RI6A 4FO5A 1SYRA 2JACA 3ZLPA 4ZB6A 2IMKA 3W8JA 3KXOA 4ZB9A 2L5LA 3UOMA 4IJIA 4K6XA 3APOA 1TI3A 2GQMA 4PQIA 2V32A 2YJHA 3TKSE 1SK1A 5B6NA 1ERWA 3UBLA 1USBA 4G2EA 3F8UA 3GKKA 3O3TA 5IM9A 3GUSA 4N10A 4KDUA 4KSMA 1EP8A 1EV9A 3ZIJA 4EKZA 4I8BA 2R6KA 2CAQA 4EDZA 1Z6NA 4FH8A 2C3TA 2C1YA 3LFLA 1IYIA 4KE3A 2CT6A 1ACVA 2L6DA 3GNJA 4LL4B 1ZMAA 3A2VA 3J7Yb 1ZGNA 1R5AA 1Q98A 3QDNA 2GSRA 4MH3A 3MNGA 1Z7RA 1U3AA 2WGRA 4PX1A 2IJYA 1JFUA 2I4AA 2KOKA 4NHWA 4JEDA 1AW9A 3E0UA 1QGVA 2N5BA 2FA4A 1A0FA 1T4YA 4MLYA 2YWOA 2I3YA 2YWNA 3C7MA 3VURA 1ZYQB 18GSA 4IKHA 5IMDA 2YJ7A 1M2BA 1S3AA 1QQ2A 2LRCA 4ZIJA 4GXZA 2DMLA 3RBTA 3H8QA 2H1GA 5GAPD 3DRNA 5B8BA 4XHMA 4KW6A 1M2DA 3QFBC 2RLIA 3EC3A 1H75A 1ZZYA 2CZ2A 3EURA 3VWXA 4YQVA 1RK4A 3GA4A 4AJ6A 2K8SA 1GUKA 3M9KA 3GL3A 4F82A 3CBUA 3DVXA 4GWRA 5CO3A 1A23A 4N0ZA 3KP9A 2A2SA 5G1KA 3WYWA 1GNEA 4V1Ap 2VL9A 5ECMB 4FYCA 1UN2A 2VOCA 2DJ0A 1UVZA 1HQOA 1GWCA 4ECIA 4O5RA 1W89A 2H01A 2QSIA 4XRDA 5IPHA 1OKTA 4RQXA 4XS1A 2V6KA 4MCUA 2VM2A 1E2YA 3TJBA 1T00A 1VF3A 6GSVA 4HOJA 16GSA 1ERVA 3FZ9A 5IOXA 1M2AA 3H4KA 4JRRA 2E2GA 1YF0A 4L0UA 3G7JA 3KZQA 1R7HA 4PUAA 3RPNA 1PRXA 5DAKB 3APQA 3FZ4A 1XW5A 2AB6A 3KTLA 2MBSA 1WRYA 4GCIA 1TP9A 6GSWA 2V41A 1XWGA 1EZKA 4F0BA 5ECLB 2DJ2A 5HQPA 5KN2A 1QFNA 4WETA 3IC4A 4KGIA 1HYUA 3VPTA 3TRQA 2VUPA 1Z5YE 2L59A 2VLTA 1XPVA 1FB0A 1HNBA 4Q5NA 2B5EA 1DSBA 4V2NA 1GSEA 3L9SA 4JU5A 2K8VA 1XCCA 2PPTA 1U6TA 3Q18A 1NSWA 1YKCA 4D73A 4ECBA 2IPAA 2TIRA 4WBRD 3HXSA 3ERWA 4MZWA 4G9HA 4RI7A 3UL3A 4PQ1A 2WFCA 2IMDA 2DJJA 14GSA 1T4ZA 1X5DA 2MYGA 5HR0A 4F0CA 3M1GA 4IQ1A 3F63A 2IIYA 2YV9A 3PH9A 2BJXA 2VD1A 3IA1A 4HZ4A 5ENUA 3FHKA 3D22A 3EU3A 2P31A 4NPBA 1LJRA 3TCOA 1XOAA 4GF0A 3GFKA 1XFLA 3D6IA 2GVPA 3HHVA 1TJDA 1AAZA 2IWTA 4KDXA 5EY6A 4QQ7A 1OYJA 2FWHA 3DYRA 2LQQA 5IMCA 3GTUA 2RUEA 1DBYA 3BCKA 5C00A 3KH9A 1GRXA 4GLTA 4L5LA 3TOTA 2WULA 5JCGA 1K0AA 3F6DA 4H86A 6GSTA 1N2AA 2QKEA 4F2IA 3ZVJD 4IBPA 2MMAA 3GMFA 2X64A 4IQAA 2QC7A 3P2AA 3O6TA 5ID2A 1KEBA 5ABRA 4I97A 2JZSA 4OD7A 2CA8A 2BTOT 1R26A 2CVDA 4Q5QA 2C4JA 5AISA 3TRPA 4MP4A 5CYYA 1K3OA 2AYTA 2GDRA 2E0QA 2H19A 3DKSA 4KH7A 4MA9A 2LNSA 1THOA 1BJXA 2FA8A 2REMA 2H30A 5GSTA 5CAXA 1URMA 2P5RA 1J9BA 1BQ7A 2OBKA 3R2QA 5D93A 1A2LA 1OC8A 4F9ZA 3GKNA 3FR6A 3KP8A 4TVEA 5D9TA 3UIWA 3TDGA 2ES7A 3D21A 4HDEA 4POLA 3BD2A 2A2RA 2E7PA 1M9AA 1VRSD 3ED3A 3TRXA 1B4QA 1WJKA 3TKSA 1M0UA 2YWIA 1EGOA 2M72A 4E8HA 4OFNA 1OVNA 2NDOA 4I5QA 4CW9A 1K0DA 4MF5A 1G0TA 3VWUA 4GRFA 3LYKA 2IFQB 3P8WA 2K6VA 4IS0A 2H66A 4PURA 5G2ZA 2HZFA 5DQYA 4HUAA 3BBYA 1ZCPA 1PKWA 4ZL8A 1YJ6A 2B5XA 2VIMA 5FHIA 2V2GA 20GSA 5DVBA 2VLUA 1XZOA 4FIWA 1CQHA 2HFDA 4E8EA 1F37A 2NVLA 4K9ZA 3ZITA 3EU4A 2XC2A 4J56E 4IP1A 3GSTA 1EP7A 4MJAA 3LGCA 3K8NA 4V2MA 1EGRA 1OC9A 2CAIA 1GP1A 1PQNA 5J41A 2VL3A 3IXRA 1FVJA 2HXKA 4TXOA 1TRWA 2GS3A 3AY8A 1GLPA 4HZ2A 2VL2C 4K2DA 2H1BA 3IE3A
chains in the Genus database with same CATH superfamily
4LLRA 1FHEA 4K0GA 1BYEA 1XWBA 4KF9A 1GSSA 2DBCA 1KNGA 2LJKA 3QPMA 5KOWA 3ZMLA 2ON5A 3J7Yk 1PL2A 5HFKA 1CQGA 2H6ZA 3RHCA 1ZYNA 5DDLA 3ZMKA 4TR3A 4I2UA 3IV4A 3DIEA 4GSTA 2DJKA 3GIXA 1MDJA 4FQUA 1KTEA 2VCTA 4IHUA 3TJJA 3TJKA 1G6YA 1ZOFA 4KCAA 5CRWA 1SD9A 2FY6A 2XBIA 1XIYA 6GSYA 4NWYA 1M3IA 3C1SA 3VI5A 5DBQA 4K8MA 2HE3A 1QXHA 2PVOC 3HZ8A 3IAS2 4BIKA 3F3RA 3KMNA 3HKRA 1X9MB 2I81A 1SENA 1TOFA 1FO5A 1ERTA 3F0IA 1FG4A 1VF4A 2H0HA 1ST9A 5DCHA 1THXA 2K18A 1TXXA 5G31A 3DVWA 3LXTA 3SBCA 2LSTA 4BL7B 1Z7PA 2OACA 2O8VB 2M46A 2O85A 3GN3A 3RDWA 5IMZA 4PXOA 4K7IA 5G5EA 2O7KA 1PX6A 5ECHB 5D9WA 1PX7A 1R4WA 3BJ5A 2H73A 1GTIA 4MK3A 1SL1B 3ZYWA 4ACSA 2L5OA 1PL1A 1SD8A 2HRAA 4TR1B 1NM3A 3ME8A 4XCSA 4GTUA 4OFMA 2GZZA 3F6FA 1WP0A 4PUFC 4LA1A 5AIXA 2RM6A 2E2MA 4O92A 2A2PA 4MPGA 5H5RA 2LJRA 4PNGA 4G0KA 2RM5A 5J9CA 1S3CA 4Z2RA 2LKUA 2LTKA 4RQRA 3D4MA 3LXZA 2Z9SA 1XWKA 4XS4A 4YAPA 2L4CA 1Z9HA 2GZYA 4HQZA 4KCEA 5DAKA 5COHA 1ZL9A 2KP1A 3UVTA 3ZIVA 4A5PA 1EEMA 1SJ6A 2GLRA 3LSZA 2D2ZA 3IAM2 1SK2A 5ECSA 5HR2A 4EO3A 4DVCA 3IPZA 2PGTA 1MD3A 3GX8A 3D4TA 2PBJA 3QMXA 2C8UA 5HR1A 1T7PB 2C0FA 2OE0A 1NHYA 2DSAA 2YNXA 2HRFA 1JLVA 1A24A 4XRAA 2GZPA 1PN9A 3GV1A 3MWHA 1O7UA 1OC3A 2VAFA 1X9WB 3DEXA 3HJMA 3W6GA 3TOUA 3LYPA 4GSSA 10GSA 3IOSA 4WXTA 3CRTA 5BRTA 3CSIA 4KNDA 3CRUA 2EIQA 4JR4A 4K7NA 1JHBA 2ZNMA 3US3A 3HA9A 2B5YA 2YOIA 4ZBBA 2CX4A 2HRNA 1OE7A 1UC7A 4X43A 2VD0A 3TKQA 3ME7A 2IMEA 2YN1A 3RPPA 4BWSA 2GSTA 2L6CA 2GT5A 4L5OA 4ML6A 1GLQA 4RUVA 4OCEA 3TJFA 2QA2A 1Z6MA 2CX3A 2M80A 5FT3A 3RHBA 3IDVA 2FUG2 3DWVA 2FLSA 3UAPA 5JWQB 1AIUA 1F3BA 4EE0A 3GKXA 1TRUA 2R3XA 2LRNA 2H1AA 3GURA 4BVYA 4POMA 5A4UA 3E9JB 4GQCA 1YDKA 1SYXA 1TU8A 1NHOA 5ECKB 5AN1A 3U5RE 4K1FA 2QGVA 3I6AA 6GSXA 5ELAA 1PSQA 1Y25A 2F3MA 2CVBA 2HZEA 3C1RA 3M8NA 2X49A 2VLVA 2JSZA 2XHFA 1K3YA 2GTUA 4TR0A 3Q6OA 1GSQA 4BVXA 2R0GA 3WT1A 2XBQA 3LJRA 3Q74A 3W8SA 1YQ1A 1XW9A 1V57A 2VM1A 2OA7A 4QL7A 2DLXA 1VF1A 2C3NA 3FMWA 4J2FA 1TU7A 2JZRA 1TW9A 1JZWA 3ZFBA 1O6JA 5A4WA 4LMWA 1EOHA 1GSFA 3L0HA 1AC1A 1C72A 1K0NA 5KEJA 2ON7A 5FWGA 4AJ8A 3TUEA 1K0CA 3A3TA 1HNAA 2LUSA 2OJLA 2R5GA 3MAKA 2CV4A 1Y6EA 2XPEA 4PGTA 1QUWA 5GSSA 4CDOA 5F07A 1BG5A 1YF1A 2IL3A 1V2AA 2YCDA 1OE8A 1GL8A 1X9SB 2IMFA 4HQSA 2KLXA 4TKYA 3CQFA 2P0GA 2DIYA 2L57A 2WZ9A 2DKHA 3EYTA 2X99A 2O87A 1SJZA 4HU7A 4EXJA 1F6MC 3PGTA 2VCXA 3QAGA 1J0FA 1Z3EA 4F03A 3UARA 2AAWA 2PUKC 4TXVA 2P5QA 2YPMA 4EDYA 2ZCTA 4ML1A 4QL9A 4IP6A 5KN0A 4NMUA 2H74A 3TKRA 2MMZA 1YEXA 5ECNB 3QAVA 1TRSA 3DMLA 5KOXA 3C73A 3WT2A 3QAWA 1K0OA 3EMXA 2MBTA 4MJEA 5J4UA 3HYPA 2YV7A 5IMAA 2R0PA 2OBIA 4EUYA 4ZBAA 3A2XA 4Q5FA 4D73B 2HSYA 4TOPA 1X0RA 6GSUA 2GQKA 3TKSC 2RIIA 3O76A 1O8XA 3IHQA 2FHEA 4K0NA 1W4VA 3NIVA 5IIZA 5CRDA 1MTCA 4FYBA 1B9YC 1S3DA 2AHEA 5CREA 2PWJA 3P7XA 1TK0B 4Z7XA 4DSSA 4YH2A 5G1LA 3C8EA 3I43A 1K3LA 3KTBA 2C80A 4ZBDA 3ISOA 3FW2A 5D73A 4AF2A 2LEGA 3VFIA 2WRTA 1FOVA 1SKSB 7GSSA 5IMFA 4DSRA 4P3YB 4EC0A 3M3MA 2C0GA 3IBHA 3TJGA 3MDKA 1GSDA 2EIOA 3PINA 5INYA 3LWAA 4ID0A 4AJ7A 4MZBA 4Q5RA 3V1WA 1MDKA 2H71A 3UBKA 1LBKA 4JR6A 4KX4A 2X8CA 4KAEA 3U6VA 1O8WA 3EE2A 1XXUA 2AUVA 4J57E 4WF5A 3N9JA 3CSHA 5F06A 1V98A 4WF4A 2GGTA 1ZYEA 4OO4A 2DJ1A 2NPBA 2C0EA 4G0LA 1WPIA 2ZUPA 1GH2A 5JWOB 3F4RA 5ID2B 3LORA 1TDIA 3LQ7A 3UMAA 3FK8A 4ICYA 4N11A 4HJMA 3I9V2 2H1DA 2TRCP 4MJBA 1EWXA 1G6WA 1A2JA 1WWJA 2HYXA 3UJ1A 3EINA 3EWLA 1ML6A 4NAXA 1M99A 2EC4A 5EVOA 4K2XA 3N5OA 4ZL9A 1T1VA 1FVKA 1U88A 3ZZXA 3FKFA 3WGDA 5AGYA 1A8LA 5ECRB 1PFOA 1RW1A 4OCFA 2H6YA 2LS5A 4KSOA 5D96A 5DALB 1JZOA 4WEYA 2VL2A 1U3IA 1TK5B 2FWEA 4MNNA 4WR5A 1XWCA 3VWVA 2WCIA 2NTOA 3IK7A 4L8EA 4O7HA 2FCHA 4IJ3A 2FD3A 1XBSA 1FW1A 1LU4A 1MDIA 1F2EA 4BPYA 3Q19A 5CNWA 4ILFA 2X8HA 2CVKA 3BOAA 4ZB8A 4GSNA 4HEA2 2WS2A 1AUCA 3GX0A 2OE1A 3F9UA 1TI1A 5DJLA 3DD3A 5LNKe 1WOUA 3H1NA 3GL5A 2OADA 1YKAA 19GSA 1B9XC 5ECOB 1GNWA 1OC9B 4TN8A 4HI7A 1HD2A 1EEJA 5IO2A 2F8FA 3KD0A 4POKA 1X5CA 1Q4JA 4LMVA 4TXOB 4USSA 2PU9C 2FWFA 1GSYA 3HY2A 3ZFLA 3G7IA 3JCML 5DJMA 4DSQA 1SKWB 3DXBA 4MJCA 4FYUA 3UEMA 4Z2TA 2H75A 2VCVA 4MF7A 3KJYA 4MDCA 4JZQA 2HI7A 4KDYA 4MZCA 1A8YA 1JLWA 4G10A 1K0MA 2CZ3A 3MYDA 3NZNA 2PERA 1GSUA 3ZRDA 2R0CA 5A4VA 5LD0A 1N8JA 4OFTA 3A5WA 5ECIB 4KB3A 2OE3A 4LL1B 3HVVA 3S9FA 4ZL7A 4TRXA 4ECCA 12GSA 5KN1A 1O73A 4X0XA 3QOUA 2MMOA 2OKAA 4YKGA 2X8GA 2A4HA 5CRGA 2O89A 4POBA 3RAZA 2F9SA 1T8EB 5HR3A 2AV4A 5KN3A 4HS1A 4XIHA 1F9MA 1SJIA 4IGJA 4WR4A 1GUMA 1O81A 3KIJA 5HFIA 3UVHA 3R3EA 2G0FA 1E6BA 1AQWA 1YEPA 5D8IA 1ZYPA 4YQMA 1BAYA 3I69A 2LRTA 3TB2A 1S3RA 3HDCA 4MABA 1WE0A 3ZVJA 4IVFA 2R4VA 1ABAA 2DMMA 4IN0A 3NOFA 2DIZA 4YAVA 5B6MA 3SWLA 3HD5A 4CHSA 2L4QA 1DE1A 4OWYA 2R37A 2TRXA 1EV4A 4I6XA 2PN8A 3CSJA 4MH2A 3EVIA 5F0GA 2VCZA 1YY7A 2YZUA 5EL8A 1PD21 4BA7A 1ERUA 2NBSA 1QMVA 1V40A 3WGEA 5EPFA 5AIVA 2YANA 5JWRB 2LQOA 1XWAA 5E59A 2V6OA 2HSHA 2K9FA 4XS4B 4MF6A 2YWMA 2B7KA 2EIRA 2KP2A 2I9HA 1TK8B 1BX9A 3VPQA 1NW2A 5G5FA 5B8AA 2GSQA 2MZCA 1V58A 3G9BA 3EMPA 1H4OA 2X4AA 1VF2A 4ULXA 3FRCA 5HFGA 1XW6A 3CYNA 3HJPA 2ALBA 1I9DA 1GTAA 4YQUA 4EF0A 5JCWA 1JZDA 1AQVA 2HRKA 1ON4A 2H76A 2KHPA 4PQHA 3LEFA 2DC5A 3HCZA 1TTZA 2AJQB 2JSYA 5IPGA 5DQSA 2B1KA 1PMTA 2YZHA 3KH7A 2CQ9A 5A5KA 1WMJA 4NV5A 3CTGA 5H5SA 3L9UA 2HNLA 4O5QA 1AQXA 2JADA 3KMOA 1B48A 4NHZA 3MSZA 4WKWA 1V9WA 1I5GA 3ZREA 2B7JA 3VWWA 1SL2B 2H70A 4OO5A 1WIKA 1MEKA 1QK8A 4K7OA 3C71A 3HVNA 1OAZA 1O85A 3GH9A 2FNOA 2H8LA 1F3AA 1IYHA 1K0BA 2VCWA 3D0ZA 1AXDA 3CTFA 2FGXA 3G7YA 2IFQA 1PA3A 2GQLA 3QD9A 1RQMA 1YZXA 5IMVA 1VGLA 2KUCA 3KEBA 1GULA 2YP6A 2GT6A 5ECPB 2XPDA 5J9BA 3L9VA 1XVWA 3DGQA 3F3QA 1T3BA 3ZTLA 11GSA 4XTSA 4BVYB 3H93A 3ERGA 2N5FA 1A0RP 2MMNA 3D5JA 5ELGA 4I2TA 3VK9A 5B7CA 3IRAA 2HZEB 2JL4A 2B3SA 3P90A 5IQYA 3CMIA 5J3RA 5BMUA 2G2QA 3QCPA 2C0DA 1R5PA 2BMXA 1G7EA 1M9BA 1PGTA 3IK9A 5IO0A 1DUGA 3WD6A 4EL1A 1B8XA 1U87A 3LG6A 1EOGA 2PMTA 5LCZA 3F4TA 3FZAA 3PR8A 5IOWA 4XS6A 1ILOA 3GKMA 2J9HA 2DJ3A 3CXGA 4OMVA 4ZILA 1SU9A 22GSA 1J08A 3IHGA 4DEJA 1SKRB 1BEDA 4L0WA 3KCMA 2PVQA 1DE2A 2R2JA 9GSSA 3QFAC 3L4NA 5F8BA 5J5NA 1B4PA 1SL0B 17GSA 3E3EA 4MMMA 3ERFA 2B1LA 3FEUA 13GSA 4JBBA 1GUHA 2A4VA 3BCIA 4GQFA 4IELA 4JE1A 4AGSA 4O5UA 5DALA 5GAND 5L71A 3VI7A 2WDUA 3HJOA 2FWGA 3FY7A 4NXIA 3FR9A 3GTUB 2H0GA 2F51A 5CRHA 1HNCA 4G0IA 3KGKA 4ECJA 1M7TA 5C04A 4PNFA 4NV2A 2H0IA 1GTBA 2I1UA 4TW5A 3TKPA 4ZXGA 2N5AA 4V2LA 3OR5A 4ISDA 2HT9A 4KUNA 1MD4A 1X5EA 2IN3A 5G30A 4BWQA 2GSSA 1G7OA 3FZ5A 4YKFA 2J23A 3QR6A 6GSSA 4G19A 4BL7A 3A5IA 3GYKA 3A2WA 2RUFA 4O32A 2B6MA 2C3QA 2H6XA 3HVSA 3H79A 3GHAA 1SK0A 4IW9A 1FAAA 5GZZB 2IMIA 3FYGA 3HZ4A 4TR1A 4MPFA 4N0VA 3GSSA 1KBNA 4TR4A 1UA5A 5CP1A 2V1MA 2JU5A 2WJUA 4V1Ag 1XVQA 1A2MA 1JZRA 2VO4A 3GH6A 3F4SA 1FB6A 3TGZA 2LV3A 2LNTA 3IR4A 4HJ2A 8GSSA 2WB9A 3APSA 1TRVA 3HVXA 2VCQA 4X1UA 3FR3A 5E4WA 2LJAA 2HLSA 3WGXA 5JCUA 4DSSB 3GRXA 1GTUA 2JZTA 3VLNA 5D9VA 4EVMA 2H72A 4WBJA 1TKDB 5D9XA 4N30A 1PKZA 1XOBA 1OKDA 3KM6A 3M9JA 4HU9A 3ZL5A 5H5QA 5F05A 3M0FA 5ECQB 4KA0A 5DCGA 2F8AA 3L78A 4RI6A 4FO5A 1SYRA 2JACA 4HSCX 3ZLPA 4ZB6A 2IMKA 3W8JA 3KXOA 4ZB9A 2L5LA 3UOMA 4IJIA 4K6XA 3APOA 1TI3A 2GQMA 4PQIA 4EIQA 2V32A 4EIPA 2YJHA 3TKSE 1SK1A 5B6NA 1ERWA 3UBLA 1USBA 4G2EA 3F8UA 3GKKA 3O3TA 4X4JA 1XG8A 5IM9A 3GUSA 4N10A 4KDUA 4KSMA 1EP8A 1EV9A 3ZIJA 4EKZA 4I8BA 2R6KA 2CAQA 4EDZA 1Z6NA 4FH8A 2C3TA 2C1YA 3LFLA 1IYIA 4KE3A 2CT6A 1ACVA 2L6DA 3GNJA 4LL4B 1ZMAA 3A2VA 3J7Yb 1ZGNA 1R5AA 1Q98A 3QDNA 2GSRA 4MH3A 3MNGA 1Z7RA 1U3AA 2WGRA 4PX1A 2IJYA 1JFUA 2I4AA 2KOKA 4NHWA 4JEDA 1AW9A 3E0UA 1QGVA 2N5BA 2FA4A 1A0FA 1T4YA 4MLYA 2YWOA 2I3YA 2YWNA 3C7MA 3VURA 1ZYQB 18GSA 4IKHA 5IMDA 2YJ7A 1M2BA 1S3AA 1QQ2A 2LRCA 4ZIJA 4GXZA 2DMLA 3RBTA 3H8QA 1FOHA 3LW9A 2H1GA 5GAPD 3DRNA 5B8BA 4XHMA 4KW6A 1M2DA 3QFBC 2RLIA 3EC3A 1H75A 1ZZYA 2CZ2A 3EURA 3VWXA 4YQVA 1RK4A 4Z2UA 3GA4A 4AJ6A 2K8SA 1GUKA 3M9KA 3GL3A 4CY8A 4F82A 3CBUA 3DVXA 4GWRA 5CO3A 3EPTA 1A23A 4N0ZA 3KP9A 2A2SA 5G1KA 3WYWA 1GNEA 4V1Ap 2VL9A 5ECMB 4FYCA 1UN2A 2VOCA 2DJ0A 1UVZA 1HQOA 1GWCA 4ECIA 4O5RA 1W89A 2H01A 2QSIA 4XRDA 3IC8A 5IPHA 1OKTA 4RQXA 4XS1A 2V6KA 4MCUA 2VM2A 1E2YA 3TJBA 4CY6A 1T00A 1VF3A 6GSVA 4HOJA 16GSA 1ERVA 3FZ9A 5IOXA 1M2AA 3H4KA 4JRRA 2E2GA 1YF0A 4L0UA 3G7JA 3KZQA 1R7HA 4PUAA 3RPNA 1PRXA 5DAKB 3APQA 3FZ4A 1XW5A 2AB6A 3KTLA 2MBSA 1WRYA 4GCIA 1TP9A 6GSWA 2V41A 1XWGA 1EZKA 4F0BA 5ECLB 2DJ2A 5HQPA 5KN2A 1QFNA 4WETA 3MIXA 3IC4A 4KGIA 1HYUA 3VPTA 3TRQA 2VUPA 1Z5YE 2L59A 2VLTA 1PN0A 1XPVA 1FB0A 1HNBA 4Q5NA 2B5EA 1DSBA 4V2NA 1GSEA 3L9SA 4JU5A 2K8VA 1XCCA 2PPTA 1U6TA 3Q18A 1NSWA 1YKCA 2DKIA 2UZ8A 4D73A 4ECBA 2IPAA 2TIRA 4WBRD 3HXSA 3ERWA 4MZWA 4G9HA 4RI7A 4K5SA 3UL3A 4PQ1A 2WFCA 2IMDA 2DJJA 14GSA 1M3JA 1T4ZA 1X5DA 2MYGA 5HR0A 4F0CA 3M1GA 4IQ1A 3F63A 2IIYA 2YV9A 3PH9A 2BJXA 2VD1A 3IA1A 4HZ4A 5ENUA 3FHKA 3D22A 3EU3A 2P31A 4NPBA 1LJRA 3TCOA 1XOAA 4GF0A 3GFKA 1XFLA 3D6IA 2GVPA 3HHVA 1TJDA 1AAZA 2IWTA 4KDXA 5EY6A 4QQ7A 1OYJA 2FWHA 3DYRA 2LQQA 5IMCA 3GTUA 2RUEA 1DBYA 3BCKA 5C00A 3KH9A 1GRXA 4GLTA 4L5LA 4K5RA 3TOTA 2WULA 5JCGA 1K0AA 3F6DA 3PPUA 4H86A 6GSTA 1N2AA 2QKEA 4F2IA 3ZVJD 4IBPA 2MMAA 3GMFA 4BVXB 2X64A 4IQAA 2QC7A 3P2AA 3O6TA 5ID2A 1KEBA 5ABRA 4I97A 2JZSA 4OD7A 2CA8A 2BTOT 1R26A 2CVDA 4Q5QA 2C4JA 5AISA 3TRPA 4MP4A 5CYYA 1K3OA 2AYTA 2GDRA 2E0QA 2H19A 3DKSA 4KH7A 4MA9A 2LNSA 1THOA 1BJXA 2FA8A 2REMA 2H30A 5GSTA 5CAXA 1URMA 2P5RA 1J9BA 1BQ7A 2OBKA 3R2QA 5D93A 1A2LA 1OC8A 4F9ZA 3GKNA 3FR6A 3KP8A 4TVEA 5D9TA 3UIWA 3TDGA 2ES7A 3D21A 4HDEA 4POLA 3BD2A 2A2RA 2E7PA 1M9AA 1VRSD 3ED3A 3TRXA 1B4QA 1WJKA 3TKSA 1M0UA 2YWIA 1EGOA 2M72A 4E8HA 4OFNA 1OVNA 2NDOA 4I5QA 4CW9A 1K0DA 4MF5A 1G0TA 3VWUA 4GRFA 3LYKA 2IFQB 3P8WA 2K6VA 4IS0A 2H66A 4PURA 4PTSA 5G2ZA 2HZFA 5DQYA 4HUAA 3BBYA 1ZCPA 1PKWA 4ZL8A 1YJ6A 2B5XA 2VIMA 5FHIA 2V2GA 20GSA 5DVBA 2VLUA 1XZOA 4FIWA 1CQHA 2HFDA 4E8EA 1F37A 2NVLA 4K9ZA 3ZITA 3EU4A 2XC2A 4J56E 4IP1A 2QA1A 3GSTA 1EP7A 4MJAA 3LGCA 2HSMA 3K8NA 4V2MA 1EGRA 1OC9A 2CAIA 1GP1A 1PQNA 5J41A 2VL3A 3IXRA 1FVJA 2HXKA 4TXOA 1TRWA 2GS3A 3AY8A 1GLPA 4HZ2A 2VL2C 4K2DA 2H1BA 3IE3A
chains in the Genus database with same CATH topology
4LLRA 1FHEA 4K0GA 1BYEA 1XWBA 4KF9A 1GSSA 2DBCA 1KNGA 2LJKA 3QPMA 5KOWA 3ZMLA 2ON5A 3J7Yk 1PL2A 5HFKA 1CQGA 2H6ZA 3RHCA 1ZYNA 5DDLA 3ZMKA 4TR3A 4I2UA 3IV4A 3DIEA 4GSTA 2DJKA 3GIXA 1MDJA 4FQUA 1KTEA 2VCTA 4IHUA 3TJJA 3TJKA 1G6YA 1ZOFA 4KCAA 5CRWA 1SD9A 2FY6A 2XBIA 1XIYA 6GSYA 4NWYA 3C1SA 3VI5A 5DBQA 4K8MA 2HE3A 1QXHA 2PVOC 3HZ8A 3IAS2 3F3RA 3KMNA 3HKRA 1X9MB 2I81A 1SENA 1TOFA 1FO5A 1ERTA 3F0IA 1FG4A 1VF4A 2H0HA 1ST9A 5DCHA 1THXA 2K18A 1TXXA 5G31A 3DVWA 3LXTA 3SBCA 2LSTA 4BL7B 1Z7PA 2OACA 2O8VB 2M46A 2O85A 3GN3A 3RDWA 5IMZA 4PXOA 4K7IA 5G5EA 2O7KA 1PX6A 5ECHB 5D9WA 1PX7A 1R4WA 3BJ5A 2H73A 1GTIA 4MK3A 1SL1B 3ZYWA 4ACSA 2L5OA 1PL1A 1SD8A 2HRAA 4TR1B 1NM3A 3ME8A 4XCSA 4GTUA 4OFMA 2GZZA 3F6FA 1WP0A 4PUFC 4LA1A 5AIXA 2RM6A 2E2MA 4O92A 2A2PA 4MPGA 5H5RA 2LJRA 4PNGA 4G0KA 2RM5A 5J9CA 1S3CA 4Z2RA 2LKUA 2LTKA 4RQRA 3D4MA 3LXZA 2Z9SA 1XWKA 4XS4A 4YAPA 2L4CA 1Z9HA 2GZYA 4HQZA 4KCEA 5DAKA 5COHA 1ZL9A 2KP1A 3UVTA 3ZIVA 4A5PA 1EEMA 1SJ6A 2GLRA 3LSZA 2D2ZA 3IAM2 1SK2A 5ECSA 5HR2A 4EO3A 4DVCA 3IPZA 2PGTA 1MD3A 3GX8A 3D4TA 2PBJA 3QMXA 2C8UA 5HR1A 1T7PB 2C0FA 2OE0A 1NHYA 2DSAA 2YNXA 2HRFA 1JLVA 1A24A 4XRAA 2GZPA 1PN9A 3GV1A 3MWHA 1O7UA 1OC3A 2VAFA 1X9WB 3DEXA 3HJMA 3W6GA 3TOUA 3LYPA 4GSSA 10GSA 3IOSA 4WXTA 3CRTA 5BRTA 3CSIA 4KNDA 3CRUA 2EIQA 4JR4A 4K7NA 1JHBA 2ZNMA 3US3A 3HA9A 2B5YA 2YOIA 4ZBBA 2CX4A 2HRNA 1OE7A 1UC7A 4X43A 2VD0A 3TKQA 3ME7A 2IMEA 2YN1A 3RPPA 4BWSA 2GSTA 2L6CA 2GT5A 4L5OA 4ML6A 1GLQA 4RUVA 4OCEA 3TJFA 2QA2A 1Z6MA 2CX3A 2M80A 5FT3A 3RHBA 3IDVA 2FUG2 3DWVA 2FLSA 3UAPA 5JWQB 1AIUA 1F3BA 4EE0A 3GKXA 1TRUA 2R3XA 2LRNA 2H1AA 3GURA 4BVYA 4POMA 5A4UA 3E9JB 4GQCA 1YDKA 1SYXA 1TU8A 1NHOA 5ECKB 5AN1A 3U5RE 4K1FA 2QGVA 3I6AA 6GSXA 5ELAA 1PSQA 1Y25A 2F3MA 2CVBA 2HZEA 3C1RA 3M8NA 2X49A 2VLVA 2JSZA 2XHFA 1K3YA 2GTUA 4TR0A 3Q6OA 1GSQA 4BVXA 2R0GA 3WT1A 2XBQA 3LJRA 3Q74A 3W8SA 1YQ1A 1XW9A 1V57A 2VM1A 2OA7A 4QL7A 2DLXA 1VF1A 2C3NA 3FMWA 4J2FA 1TU7A 2JZRA 1TW9A 1JZWA 3ZFBA 1O6JA 5A4WA 4LMWA 1EOHA 1GSFA 3L0HA 1AC1A 1C72A 1K0NA 5KEJA 2ON7A 5FWGA 4AJ8A 3TUEA 1K0CA 3A3TA 1HNAA 2LUSA 2OJLA 2R5GA 3MAKA 2CV4A 1Y6EA 2XPEA 4PGTA 1QUWA 5GSSA 4CDOA 5F07A 1BG5A 1YF1A 2IL3A 1V2AA 2YCDA 1OE8A 1GL8A 1X9SB 2IMFA 4HQSA 2KLXA 4TKYA 2P0GA 2DIYA 2L57A 2WZ9A 2DKHA 3EYTA 2X99A 2O87A 1SJZA 4HU7A 4EXJA 1F6MC 3PGTA 2VCXA 3QAGA 1J0FA 1Z3EA 4F03A 3UARA 2AAWA 2PUKC 4TXVA 2P5QA 2YPMA 4EDYA 2ZCTA 4ML1A 4QL9A 4IP6A 5KN0A 4NMUA 2H74A 3TKRA 2MMZA 1YEXA 5ECNB 3QAVA 1TRSA 3DMLA 5KOXA 3C73A 3WT2A 3QAWA 1K0OA 3EMXA 2MBTA 4MJEA 5J4UA 3HYPA 2YV7A 5IMAA 2R0PA 2OBIA 4EUYA 4ZBAA 3A2XA 4Q5FA 4D73B 2HSYA 4TOPA 1X0RA 6GSUA 2GQKA 3TKSC 2RIIA 3O76A 1O8XA 3IHQA 2FHEA 4K0NA 1W4VA 3NIVA 5IIZA 5CRDA 1MTCA 4FYBA 1B9YC 1S3DA 2AHEA 5CREA 2PWJA 3P7XA 1TK0B 4Z7XA 4DSSA 4YH2A 5G1LA 3C8EA 3I43A 1K3LA 3KTBA 2C80A 4ZBDA 3ISOA 3FW2A 5D73A 4AF2A 2LEGA 3VFIA 2WRTA 1FOVA 1SKSB 7GSSA 5IMFA 4DSRA 4P3YB 4EC0A 3M3MA 2C0GA 3IBHA 3TJGA 3MDKA 1GSDA 2EIOA 3PINA 5INYA 3LWAA 4ID0A 4AJ7A 4MZBA 4Q5RA 3V1WA 1MDKA 2H71A 3UBKA 1LBKA 4JR6A 4KX4A 2X8CA 4KAEA 3U6VA 1O8WA 3EE2A 1XXUA 2AUVA 4J57E 4WF5A 3N9JA 3CSHA 5F06A 1V98A 4WF4A 2GGTA 1ZYEA 4OO4A 2DJ1A 2NPBA 2C0EA 4G0LA 1WPIA 2ZUPA 1GH2A 5JWOB 3F4RA 5ID2B 3LORA 1TDIA 3LQ7A 3UMAA 3FK8A 4ICYA 4N11A 4HJMA 3I9V2 2H1DA 2TRCP 4MJBA 1EWXA 1G6WA 1A2JA 1WWJA 2HYXA 3UJ1A 3EINA 3EWLA 1ML6A 4NAXA 1M99A 2EC4A 5EVOA 4K2XA 3N5OA 4ZL9A 1T1VA 1FVKA 1U88A 3ZZXA 3FKFA 3WGDA 5AGYA 1A8LA 5ECRB 1RW1A 4OCFA 2H6YA 2LS5A 4KSOA 5D96A 5DALB 1JZOA 4WEYA 2VL2A 1U3IA 1TK5B 2FWEA 4MNNA 4WR5A 1XWCA 3VWVA 2WCIA 2NTOA 3IK7A 4L8EA 4O7HA 2FCHA 4IJ3A 2FD3A 1XBSA 1FW1A 1LU4A 1MDIA 1F2EA 4BPYA 3Q19A 5CNWA 4ILFA 2X8HA 2CVKA 3BOAA 4ZB8A 4GSNA 4HEA2 2WS2A 1AUCA 3GX0A 2OE1A 3F9UA 1TI1A 5DJLA 3DD3A 5LNKe 1WOUA 3H1NA 3GL5A 2OADA 1YKAA 19GSA 1B9XC 5ECOB 1GNWA 1OC9B 4TN8A 4HI7A 1HD2A 1EEJA 5IO2A 2F8FA 3KD0A 4POKA 1X5CA 1Q4JA 4LMVA 4TXOB 4USSA 2PU9C 2FWFA 1GSYA 3HY2A 3ZFLA 3G7IA 3JCML 5DJMA 4DSQA 1SKWB 3DXBA 4MJCA 4FYUA 3UEMA 4Z2TA 2H75A 2VCVA 4MF7A 3KJYA 4MDCA 4JZQA 2HI7A 4KDYA 4MZCA 1A8YA 1JLWA 4G10A 1K0MA 2CZ3A 3MYDA 3NZNA 2PERA 1GSUA 3ZRDA 2R0CA 5A4VA 5LD0A 1N8JA 4OFTA 3A5WA 5ECIB 4KB3A 2OE3A 4LL1B 3HVVA 3S9FA 4ZL7A 4TRXA 4ECCA 12GSA 5KN1A 1O73A 4X0XA 3QOUA 2MMOA 2OKAA 4YKGA 2X8GA 2A4HA 5CRGA 2O89A 4POBA 3RAZA 2F9SA 1T8EB 5HR3A 2AV4A 5KN3A 4HS1A 4XIHA 1F9MA 1SJIA 4IGJA 4WR4A 1GUMA 1O81A 3KIJA 5HFIA 3UVHA 3R3EA 2G0FA 1E6BA 1AQWA 1YEPA 5D8IA 1ZYPA 4YQMA 1BAYA 3I69A 2LRTA 3TB2A 3HDCA 4MABA 1WE0A 3ZVJA 4IVFA 2R4VA 1ABAA 2DMMA 4IN0A 3NOFA 2DIZA 4YAVA 5B6MA 3SWLA 3HD5A 4CHSA 2L4QA 1DE1A 4OWYA 2R37A 2TRXA 1EV4A 4I6XA 2PN8A 3CSJA 4MH2A 3EVIA 5F0GA 2VCZA 1YY7A 2YZUA 5EL8A 1PD21 4BA7A 1ERUA 2NBSA 1QMVA 1V40A 3WGEA 5EPFA 5AIVA 2YANA 5JWRB 2LQOA 1XWAA 5E59A 2V6OA 2HSHA 2K9FA 4XS4B 4MF6A 2YWMA 2B7KA 2EIRA 2KP2A 2I9HA 1TK8B 1BX9A 3VPQA 1NW2A 5G5FA 5B8AA 2GSQA 2MZCA 1V58A 3G9BA 3EMPA 1H4OA 2X4AA 1VF2A 4ULXA 3FRCA 5HFGA 1XW6A 3CYNA 3HJPA 2ALBA 1I9DA 1GTAA 4YQUA 4EF0A 5JCWA 1JZDA 1AQVA 2HRKA 1ON4A 2H76A 2KHPA 4PQHA 3LEFA 2DC5A 3HCZA 1TTZA 2AJQB 2JSYA 5IPGA 5DQSA 2B1KA 1PMTA 2YZHA 3KH7A 2CQ9A 5A5KA 1WMJA 4NV5A 3CTGA 5H5SA 3L9UA 2HNLA 4O5QA 1AQXA 2JADA 3KMOA 1B48A 4NHZA 3MSZA 4WKWA 1V9WA 1I5GA 3ZREA 2B7JA 3VWWA 1SL2B 2H70A 4OO5A 1WIKA 1MEKA 1QK8A 4K7OA 3C71A 1OAZA 1O85A 3GH9A 2FNOA 2H8LA 1F3AA 1IYHA 1K0BA 2VCWA 3D0ZA 1AXDA 3CTFA 2FGXA 3G7YA 2IFQA 1PA3A 2GQLA 3QD9A 1RQMA 1YZXA 5IMVA 1VGLA 2KUCA 3KEBA 1GULA 2YP6A 2GT6A 5ECPB 2XPDA 5J9BA 3L9VA 1XVWA 3DGQA 3F3QA 1T3BA 3ZTLA 11GSA 4XTSA 4BVYB 3H93A 3ERGA 2N5FA 1A0RP 2MMNA 3D5JA 5ELGA 4I2TA 3VK9A 5B7CA 3IRAA 2HZEB 2JL4A 2B3SA 3P90A 5IQYA 3CMIA 5J3RA 5BMUA 2G2QA 3QCPA 2C0DA 1R5PA 2BMXA 1G7EA 1M9BA 1PGTA 3IK9A 5IO0A 1DUGA 3WD6A 4EL1A 1B8XA 1U87A 3LG6A 1EOGA 2PMTA 5LCZA 3F4TA 3FZAA 3PR8A 5IOWA 4XS6A 1ILOA 3GKMA 2J9HA 2DJ3A 3CXGA 4OMVA 4ZILA 1SU9A 22GSA 1J08A 3IHGA 4DEJA 1SKRB 1BEDA 4L0WA 3KCMA 2PVQA 1DE2A 2R2JA 9GSSA 3QFAC 3L4NA 5F8BA 5J5NA 1B4PA 1SL0B 17GSA 3E3EA 4MMMA 3ERFA 2B1LA 3FEUA 13GSA 4JBBA 1GUHA 2A4VA 3BCIA 4GQFA 4IELA 4JE1A 4AGSA 4O5UA 5DALA 5GAND 5L71A 3VI7A 2WDUA 3HJOA 2FWGA 3FY7A 4NXIA 3FR9A 3GTUB 2H0GA 2F51A 5CRHA 1HNCA 4G0IA 3KGKA 4ECJA 1M7TA 5C04A 4PNFA 4NV2A 2H0IA 1GTBA 2I1UA 4TW5A 3TKPA 4ZXGA 2N5AA 4V2LA 3OR5A 4ISDA 2HT9A 4KUNA 1MD4A 1X5EA 2IN3A 5G30A 4BWQA 2GSSA 1G7OA 3FZ5A 4YKFA 2J23A 3QR6A 6GSSA 4G19A 4BL7A 3A5IA 3GYKA 3A2WA 2RUFA 4O32A 2B6MA 2C3QA 2H6XA 3HVSA 3H79A 3GHAA 1SK0A 4IW9A 1FAAA 5GZZB 2IMIA 3FYGA 3HZ4A 4TR1A 4MPFA 4N0VA 3GSSA 1KBNA 4TR4A 1UA5A 5CP1A 2V1MA 2JU5A 2WJUA 4V1Ag 1XVQA 1A2MA 1JZRA 2VO4A 3GH6A 3F4SA 1FB6A 3TGZA 2LV3A 2LNTA 3IR4A 4HJ2A 8GSSA 2WB9A 3APSA 1TRVA 3HVXA 2VCQA 4X1UA 3FR3A 5E4WA 2LJAA 2HLSA 3WGXA 5JCUA 4DSSB 3GRXA 1GTUA 2JZTA 3VLNA 5D9VA 4EVMA 2H72A 4WBJA 1TKDB 5D9XA 4N30A 1PKZA 1XOBA 1OKDA 3KM6A 3M9JA 4HU9A 3ZL5A 5H5QA 5F05A 3M0FA 5ECQB 4KA0A 5DCGA 2F8AA 3L78A 4RI6A 4FO5A 1SYRA 2JACA 3ZLPA 4ZB6A 2IMKA 3W8JA 3KXOA 4ZB9A 2L5LA 3UOMA 4IJIA 4K6XA 3APOA 1TI3A 2GQMA 4PQIA 4EIQA 2V32A 4EIPA 2YJHA 3TKSE 1SK1A 5B6NA 1ERWA 3UBLA 1USBA 4G2EA 3F8UA 3GKKA 3O3TA 4X4JA 5IM9A 3GUSA 4N10A 4KDUA 4KSMA 1EP8A 1EV9A 3ZIJA 4EKZA 4I8BA 2R6KA 2CAQA 4EDZA 1Z6NA 4FH8A 2C3TA 2C1YA 3LFLA 1IYIA 4KE3A 2CT6A 1ACVA 2L6DA 3GNJA 4LL4B 1ZMAA 3A2VA 3J7Yb 1ZGNA 1R5AA 1Q98A 3QDNA 2GSRA 4MH3A 3MNGA 1Z7RA 1U3AA 2WGRA 4PX1A 2IJYA 1JFUA 2I4AA 2KOKA 4NHWA 4JEDA 1AW9A 3E0UA 1QGVA 2N5BA 2FA4A 1A0FA 1T4YA 4MLYA 2YWOA 2I3YA 2YWNA 3C7MA 3VURA 1ZYQB 18GSA 4IKHA 5IMDA 2YJ7A 1M2BA 1S3AA 1QQ2A 2LRCA 4ZIJA 4GXZA 2DMLA 3RBTA 3H8QA 1FOHA 3LW9A 2H1GA 5GAPD 3DRNA 5B8BA 4XHMA 4KW6A 1M2DA 3QFBC 2RLIA 3EC3A 1H75A 1ZZYA 2CZ2A 3EURA 3VWXA 4YQVA 1RK4A 4Z2UA 3GA4A 4AJ6A 2K8SA 1GUKA 3M9KA 3GL3A 4CY8A 4F82A 3CBUA 3DVXA 4GWRA 5CO3A 3EPTA 1A23A 4N0ZA 3KP9A 2A2SA 5G1KA 3WYWA 1GNEA 4V1Ap 2VL9A 5ECMB 4FYCA 1UN2A 2VOCA 2DJ0A 1UVZA 1HQOA 1GWCA 4ECIA 4O5RA 1W89A 2H01A 2QSIA 4XRDA 3IC8A 5IPHA 1OKTA 4RQXA 4XS1A 2V6KA 4MCUA 2VM2A 1E2YA 3TJBA 4CY6A 1T00A 1VF3A 6GSVA 4HOJA 16GSA 1ERVA 3FZ9A 5IOXA 1M2AA 3H4KA 4JRRA 2E2GA 1YF0A 4L0UA 3G7JA 3KZQA 1R7HA 4PUAA 3RPNA 1PRXA 5DAKB 3APQA 3FZ4A 1XW5A 2AB6A 3KTLA 2MBSA 1WRYA 4GCIA 1TP9A 6GSWA 2V41A 1XWGA 1EZKA 4F0BA 5ECLB 2DJ2A 5HQPA 5KN2A 1QFNA 4WETA 3MIXA 3IC4A 4KGIA 1HYUA 3VPTA 3TRQA 2VUPA 1Z5YE 2L59A 2VLTA 1PN0A 1XPVA 1FB0A 1HNBA 4Q5NA 2B5EA 1DSBA 4V2NA 1GSEA 3L9SA 4JU5A 2K8VA 1XCCA 2PPTA 1U6TA 3Q18A 1NSWA 1YKCA 2DKIA 2UZ8A 4D73A 4ECBA 2IPAA 2TIRA 4WBRD 3HXSA 3ERWA 4MZWA 4G9HA 4RI7A 4K5SA 3UL3A 4PQ1A 2WFCA 2IMDA 2DJJA 14GSA 1T4ZA 1X5DA 2MYGA 5HR0A 4F0CA 3M1GA 4IQ1A 3F63A 2IIYA 2YV9A 3PH9A 2BJXA 2VD1A 3IA1A 4HZ4A 5ENUA 3FHKA 3D22A 3EU3A 2P31A 4NPBA 1LJRA 3TCOA 1XOAA 4GF0A 3GFKA 1XFLA 3D6IA 2GVPA 3HHVA 1TJDA 1AAZA 2IWTA 4KDXA 5EY6A 4QQ7A 1OYJA 2FWHA 3DYRA 2LQQA 5IMCA 3GTUA 2RUEA 1DBYA 3BCKA 5C00A 3KH9A 1GRXA 4GLTA 4L5LA 4K5RA 3TOTA 2WULA 5JCGA 1K0AA 3F6DA 3PPUA 4H86A 6GSTA 1N2AA 2QKEA 4F2IA 3ZVJD 4IBPA 2MMAA 3GMFA 4BVXB 2X64A 4IQAA 2QC7A 3P2AA 3O6TA 5ID2A 1KEBA 5ABRA 4I97A 2JZSA 4OD7A 2CA8A 2BTOT 1R26A 2CVDA 4Q5QA 2C4JA 5AISA 3TRPA 4MP4A 5CYYA 1K3OA 2AYTA 2GDRA 2E0QA 2H19A 3DKSA 4KH7A 4MA9A 2LNSA 1THOA 1BJXA 2FA8A 2REMA 2H30A 5GSTA 5CAXA 1URMA 2P5RA 1J9BA 1BQ7A 2OBKA 3R2QA 5D93A 1A2LA 1OC8A 4F9ZA 3GKNA 3FR6A 3KP8A 4TVEA 5D9TA 3UIWA 3TDGA 2ES7A 3D21A 4HDEA 4POLA 3BD2A 2A2RA 2E7PA 1M9AA 1VRSD 3ED3A 3TRXA 1B4QA 1WJKA 3TKSA 1M0UA 2YWIA 1EGOA 2M72A 4E8HA 4OFNA 1OVNA 2NDOA 4I5QA 4CW9A 1K0DA 4MF5A 1G0TA 3VWUA 4GRFA 3LYKA 2IFQB 3P8WA 2K6VA 4IS0A 2H66A 4PURA 4PTSA 5G2ZA 2HZFA 5DQYA 4HUAA 3BBYA 1ZCPA 1PKWA 4ZL8A 1YJ6A 2B5XA 2VIMA 5FHIA 2V2GA 20GSA 5DVBA 2VLUA 1XZOA 4FIWA 1CQHA 2HFDA 4E8EA 1F37A 2NVLA 4K9ZA 3ZITA 3EU4A 2XC2A 4J56E 4IP1A 2QA1A 3GSTA 1EP7A 4MJAA 3LGCA 2HSMA 3K8NA 4V2MA 1EGRA 1OC9A 2CAIA 1GP1A 1PQNA 5J41A 2VL3A 3IXRA 1FVJA 2HXKA 4TXOA 1TRWA 2GS3A 3AY8A 1GLPA 4HZ2A 2VL2C 4K2DA 2H1BA 3IE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LLR A;  1FHE A;  4K0G A;  1BYE A;  1XWB A;  1GSS A;  2DBC A;  1KNG A;  2LJK A;  3QPM A;  3ZML A;  2ON5 A;  3J7Y k;  1PL2 A;  5HFK A;  1CQG A;  2H6Z A;  3RHC A;  5DDL A;  3ZMK A;  4TR3 A;  4I2U A;  3IV4 A;  3DIE A;  4GST A;  2DJK A;  3GIX A;  1MDJ A;  1KTE A;  2VCT A;  4IHU A;  3TJJ A;  3TJK A;  1G6Y A;  1ZOF A;  4KCA A;  5CRW A;  1SD9 A;  2FY6 A;  2XBI A;  1XIY A;  6GSY A;  4NWY A;  3C1S A;  3VI5 A;  5DBQ A;  4K8M A;  2HE3 A;  1QXH A;  2PVO C;  3HZ8 A;  3IAS 2;  3F3R A;  3KMN A;  3HKR A;  1X9M B;  2I81 A;  1SEN A;  1TOF A;  1FO5 A;  1ERT A;  3F0I A;  1FG4 A;  1VF4 A;  2H0H A;  1ST9 A;  5DCH A;  1THX A;  2K18 A;  1TXX A;  5G31 A;  3DVW A;  3LXT A;  3SBC A;  2LST A;  1Z7P A;  2OAC A;  2O8V B;  2M46 A;  2O85 A;  3GN3 A;  3RDW A;  5IMZ A;  4PXO A;  4K7I A;  5G5E A;  2O7K A;  1PX6 A;  5ECH B;  5D9W A;  1PX7 A;  1R4W A;  3BJ5 A;  2H73 A;  1GTI A;  4MK3 A;  1SL1 B;  3ZYW A;  4ACS A;  2L5O A;  1PL1 A;  1SD8 A;  4TR1 B;  1NM3 A;  3ME8 A;  4XCS A;  4GTU A;  4OFM A;  2GZZ A;  3F6F A;  1WP0 A;  4PUF C;  4LA1 A;  5AIX A;  2RM6 A;  2E2M A;  4O92 A;  4MPG A;  5H5R A;  2LJR A;  4PNG A;  2RM5 A;  5J9C A;  1S3C A;  2LKU A;  2LTK A;  4RQR A;  3D4M A;  3LXZ A;  2Z9S A;  1XWK A;  4XS4 A;  4YAP A;  2L4C A;  1Z9H A;  2GZY A;  4HQZ A;  4KCE A;  5DAK A;  5COH A;  1ZL9 A;  2KP1 A;  3UVT A;  3ZIV A;  1EEM A;  1SJ6 A;  2GLR A;  3LSZ A;  2D2Z A;  3IAM 2;  1SK2 A;  5ECS A;  5HR2 A;  4EO3 A;  4DVC A;  3IPZ A;  2PGT A;  1MD3 A;  3GX8 A;  3D4T A;  2PBJ A;  3QMX A;  2C8U A;  5HR1 A;  1T7P B;  2C0F A;  2OE0 A;  1NHY A;  2DSA A;  2YNX A;  2HRF A;  1JLV A;  1A24 A;  4XRA A;  2GZP A;  1PN9 A;  3GV1 A;  3MWH A;  1O7U A;  1OC3 A;  2VAF A;  1X9W B;  3DEX A;  3HJM A;  3W6G A;  3TOU A;  3LYP A;  4GSS A;  10GS A;  3IOS A;  4WXT A;  3CRT A;  3CSI A;  4KND A;  3CRU A;  2EIQ A;  4JR4 A;  4K7N A;  1JHB A;  2ZNM A;  3US3 A;  3HA9 A;  2B5Y A;  2YOI A;  4ZBB A;  2CX4 A;  2HRN A;  1OE7 A;  1UC7 A;  4X43 A;  2VD0 A;  3TKQ A;  3ME7 A;  2IME A;  2YN1 A;  3RPP A;  4BWS A;  2GST A;  2L6C A;  2GT5 A;  4L5O A;  4ML6 A;  1GLQ A;  4RUV A;  4OCE A;  3TJF A;  1Z6M A;  2CX3 A;  2M80 A;  5FT3 A;  3RHB A;  3IDV A;  2FUG 2;  3DWV A;  2FLS A;  3UAP A;  5JWQ B;  1AIU A;  1F3B A;  4EE0 A;  3GKX A;  1TRU A;  2R3X A;  2LRN A;  2H1A A;  3GUR A;  4BVY A;  4POM A;  5A4U A;  3E9J B;  4GQC A;  1YDK A;  1SYX A;  5ECK B;  1NHO A;  1TU8 A;  5AN1 A;  3U5R E;  4K1F A;  2QGV A;  3I6A A;  6GSX A;  5ELA A;  1PSQ A;  1Y25 A;  2F3M A;  2CVB A;  2HZE A;  3C1R A;  3M8N A;  2VLV A;  2JSZ A;  2XHF A;  1K3Y A;  2GTU A;  4TR0 A;  3Q6O A;  1GSQ A;  4BVX A;  3WT1 A;  2XBQ A;  3LJR A;  3Q74 A;  3W8S A;  1YQ1 A;  1XW9 A;  1V57 A;  2VM1 A;  2OA7 A;  4QL7 A;  2DLX A;  1VF1 A;  2C3N A;  4J2F A;  1TU7 A;  2JZR A;  1TW9 A;  1JZW A;  3ZFB A;  1O6J A;  5A4W A;  4LMW A;  1EOH A;  1GSF A;  3L0H A;  1AC1 A;  1C72 A;  1K0N A;  5KEJ A;  2ON7 A;  5FWG A;  4AJ8 A;  3TUE A;  1K0C A;  3A3T A;  1HNA A;  2LUS A;  2OJL A;  2R5G A;  3MAK A;  2CV4 A;  1Y6E A;  2XPE A;  4PGT A;  1QUW A;  5GSS A;  4CDO A;  5F07 A;  1BG5 A;  1YF1 A;  2IL3 A;  1V2A A;  2YCD A;  1OE8 A;  1GL8 A;  1X9S B;  2IMF A;  4HQS A;  2KLX A;  4TKY A;  2P0G A;  2DIY A;  2L57 A;  2WZ9 A;  3EYT A;  2X99 A;  2O87 A;  1SJZ A;  4HU7 A;  4EXJ A;  1F6M C;  3PGT A;  2VCX A;  3QAG A;  1J0F A;  1Z3E A;  4F03 A;  3UAR A;  2AAW A;  2PUK C;  4TXV A;  2P5Q A;  2YPM A;  4EDY A;  2ZCT A;  4ML1 A;  4QL9 A;  4IP6 A;  5KN0 A;  4NMU A;  2H74 A;  3TKR A;  2MMZ A;  1YEX A;  5ECN B;  3QAV A;  1TRS A;  3DML A;  3C73 A;  3WT2 A;  3QAW A;  1K0O A;  3EMX A;  2MBT A;  4MJE A;  5J4U A;  3HYP A;  2YV7 A;  5IMA A;  2OBI A;  4EUY A;  4ZBA A;  3A2X A;  4Q5F A;  4D73 B;  2HSY A;  4TOP A;  1X0R A;  6GSU A;  2GQK A;  3TKS C;  2RII A;  3O76 A;  1O8X A;  3IHQ A;  2FHE A;  4K0N A;  1W4V A;  3NIV A;  5IIZ A;  5CRD A;  1MTC A;  4FYB A;  1B9Y C;  1S3D A;  2AHE A;  5CRE A;  2PWJ A;  3P7X A;  1TK0 B;  4Z7X A;  4DSS A;  4YH2 A;  5G1L A;  3C8E A;  3I43 A;  1K3L A;  3KTB A;  2C80 A;  4ZBD A;  3ISO A;  3FW2 A;  5D73 A;  4AF2 A;  2LEG A;  3VFI A;  2WRT A;  1FOV A;  1SKS B;  7GSS A;  5IMF A;  4DSR A;  4P3Y B;  4EC0 A;  3M3M A;  2C0G A;  3IBH A;  3TJG A;  3MDK A;  1GSD A;  2EIO A;  3PIN A;  5INY A;  3LWA A;  4ID0 A;  4AJ7 A;  4MZB A;  4Q5R A;  3V1W A;  1MDK A;  2H71 A;  3UBK A;  1LBK A;  4JR6 A;  4KX4 A;  2X8C A;  4KAE A;  3U6V A;  1O8W A;  3EE2 A;  1XXU A;  2AUV A;  4J57 E;  4WF5 A;  3N9J A;  3CSH A;  5F06 A;  1V98 A;  4WF4 A;  2GGT A;  1ZYE A;  4OO4 A;  2DJ1 A;  2NPB A;  2C0E A;  1WPI A;  2ZUP A;  1GH2 A;  5JWO B;  3F4R A;  5ID2 B;  3LOR A;  1TDI A;  3LQ7 A;  3UMA A;  3FK8 A;  4N11 A;  4HJM A;  3I9V 2;  2H1D A;  2TRC P;  4MJB A;  1EWX A;  1G6W A;  1A2J A;  1WWJ A;  2HYX A;  3UJ1 A;  3EIN A;  3EWL A;  1ML6 A;  4NAX A;  1M99 A;  2EC4 A;  5EVO A;  3N5O A;  4ZL9 A;  1T1V A;  1FVK A;  1U88 A;  3ZZX A;  3FKF A;  3WGD A;  5AGY A;  1A8L A;  5ECR B;  1RW1 A;  4OCF A;  2H6Y A;  2LS5 A;  4KSO A;  5D96 A;  5DAL B;  1JZO A;  4WEY A;  2VL2 A;  1U3I A;  1TK5 B;  2FWE A;  4WR5 A;  1XWC A;  3VWV A;  2WCI A;  2NTO A;  3IK7 A;  4L8E A;  4O7H A;  2FCH A;  4IJ3 A;  2FD3 A;  1XBS A;  1FW1 A;  1LU4 A;  1MDI A;  1F2E A;  4BPY A;  3Q19 A;  5CNW A;  4ILF A;  2X8H A;  2CVK A;  3BOA A;  4ZB8 A;  4GSN A;  4HEA 2;  2WS2 A;  1AUC A;  3GX0 A;  2OE1 A;  3F9U A;  1TI1 A;  5DJL A;  3DD3 A;  5LNK e;  1WOU A;  3H1N A;  3GL5 A;  2OAD A;  1YKA A;  19GS A;  1B9X C;  5ECO B;  1GNW A;  1OC9 B;  4TN8 A;  4HI7 A;  1HD2 A;  1EEJ A;  5IO2 A;  2F8F A;  3KD0 A;  4POK A;  1X5C A;  1Q4J A;  4LMV A;  4TXO B;  2PU9 C;  2FWF A;  1GSY A;  3HY2 A;  3ZFL A;  3G7I A;  3JCM L;  5DJM A;  4DSQ A;  1SKW B;  3DXB A;  4MJC A;  4FYU A;  3UEM A;  2H75 A;  2VCV A;  4MF7 A;  3KJY A;  4MDC A;  4JZQ A;  2HI7 A;  4KDY A;  4MZC A;  1A8Y A;  1JLW A;  4G10 A;  1K0M A;  2CZ3 A;  3NZN A;  2PER A;  1GSU A;  3ZRD A;  5A4V A;  5LD0 A;  1N8J A;  4OFT A;  3A5W A;  5ECI B;  4KB3 A;  2OE3 A;  4LL1 B;  3HVV A;  3S9F A;  4ZL7 A;  4TRX A;  4ECC A;  12GS A;  5KN1 A;  1O73 A;  4X0X A;  3QOU A;  2MMO A;  2OKA A;  2X8G A;  5CRG A;  2O89 A;  4POB A;  3RAZ A;  2F9S A;  1T8E B;  5HR3 A;  2AV4 A;  5KN3 A;  4HS1 A;  4XIH A;  1F9M A;  1SJI A;  4IGJ A;  4WR4 A;  1GUM A;  1O81 A;  3KIJ A;  5HFI A;  3UVH A;  2G0F A;  1E6B A;  1AQW A;  1YEP A;  5D8I A;  4YQM A;  1BAY A;  3I69 A;  2LRT A;  3TB2 A;  3HDC A;  4MAB A;  1WE0 A;  3ZVJ A;  4IVF A;  2R4V A;  1ABA A;  2DMM A;  4IN0 A;  3NOF A;  2DIZ A;  4YAV A;  5B6M A;  3SWL A;  3HD5 A;  4CHS A;  2L4Q A;  1DE1 A;  4OWY A;  2R37 A;  2TRX A;  1EV4 A;  4I6X A;  2PN8 A;  3CSJ A;  4MH2 A;  3EVI A;  5F0G A;  2VCZ A;  1YY7 A;  2YZU A;  5EL8 A;  1PD2 1;  4BA7 A;  1ERU A;  2NBS A;  1QMV A;  1V40 A;  3WGE A;  5EPF A;  5AIV A;  2YAN A;  5JWR B;  2LQO A;  1XWA A;  5E59 A;  2V6O A;  2HSH A;  2K9F A;  4XS4 B;  4MF6 A;  2YWM A;  2B7K A;  2EIR A;  2KP2 A;  2I9H A;  1TK8 B;  1BX9 A;  3VPQ A;  1NW2 A;  5G5F A;  5B8A A;  2GSQ A;  2MZC A;  1V58 A;  3G9B A;  3EMP A;  1H4O A;  1VF2 A;  4ULX A;  3FRC A;  5HFG A;  1XW6 A;  3CYN A;  3HJP A;  2ALB A;  1I9D A;  1GTA A;  4YQU A;  4EF0 A;  5JCW A;  1JZD A;  1AQV A;  1ON4 A;  2H76 A;  2KHP A;  4PQH A;  3LEF A;  2DC5 A;  3HCZ A;  1TTZ A;  2AJQ B;  2JSY A;  5IPG A;  5DQS A;  2B1K A;  1PMT A;  2YZH A;  3KH7 A;  2CQ9 A;  5A5K A;  1WMJ A;  4NV5 A;  3CTG A;  5H5S A;  3L9U A;  2HNL A;  1AQX A;  2JAD A;  3KMO A;  1B48 A;  4NHZ A;  3MSZ A;  4WKW A;  1V9W A;  1I5G A;  3ZRE A;  2B7J A;  3VWW A;  1SL2 B;  2H70 A;  4OO5 A;  1WIK A;  1MEK A;  1QK8 A;  4K7O A;  3C71 A;  1OAZ A;  1O85 A;  3GH9 A;  2FNO A;  2H8L A;  1F3A A;  1IYH A;  1K0B A;  2VCW A;  3D0Z A;  1AXD A;  3CTF A;  2FGX A;  3G7Y A;  2IFQ A;  1PA3 A;  2GQL A;  3QD9 A;  1RQM A;  1YZX A;  5IMV A;  1VGL A;  2KUC A;  3KEB A;  1GUL A;  2YP6 A;  2GT6 A;  5ECP B;  2XPD A;  5J9B A;  3L9V A;  1XVW A;  3DGQ A;  3F3Q A;  1T3B A;  3ZTL A;  11GS A;  4XTS A;  3H93 A;  3ERG A;  2N5F A;  1A0R P;  2MMN A;  3D5J A;  5ELG A;  4I2T A;  3VK9 A;  5B7C A;  3IRA A;  2HZE B;  2JL4 A;  2B3S A;  3P90 A;  5IQY A;  3CMI A;  5J3R A;  2G2Q A;  3QCP A;  2C0D A;  1R5P A;  2BMX A;  1G7E A;  1M9B A;  1PGT A;  3IK9 A;  5IO0 A;  1DUG A;  3WD6 A;  4EL1 A;  1B8X A;  1U87 A;  3LG6 A;  1EOG A;  2PMT A;  5LCZ A;  3F4T A;  3FZA A;  3PR8 A;  5IOW A;  4XS6 A;  1ILO A;  3GKM A;  2J9H A;  2DJ3 A;  3CXG A;  4OMV A;  4ZIL A;  1SU9 A;  22GS A;  1J08 A;  4DEJ A;  1SKR B;  1BED A;  4L0W A;  3KCM A;  2PVQ A;  1DE2 A;  2R2J A;  9GSS A;  3QFA C;  3L4N A;  5F8B A;  5J5N A;  1B4P A;  1SL0 B;  17GS A;  3E3E A;  4MMM A;  3ERF A;  2B1L A;  3FEU A;  13GS A;  4JBB A;  1GUH A;  2A4V A;  3BCI A;  4GQF A;  4IEL A;  4JE1 A;  4AGS A;  5DAL A;  5GAN D;  5L71 A;  3VI7 A;  2WDU A;  3HJO A;  2FWG A;  3FY7 A;  4NXI A;  3FR9 A;  3GTU B;  2H0G A;  2F51 A;  5CRH A;  1HNC A;  3KGK A;  4ECJ A;  1M7T A;  5C04 A;  4PNF A;  4NV2 A;  2H0I A;  1GTB A;  2I1U A;  4TW5 A;  3TKP A;  4ZXG A;  2N5A A;  4V2L A;  3OR5 A;  4ISD A;  2HT9 A;  4KUN A;  1MD4 A;  1X5E A;  2IN3 A;  5G30 A;  4BWQ A;  2GSS A;  1G7O A;  3FZ5 A;  2J23 A;  3QR6 A;  6GSS A;  4G19 A;  4BL7 A;  3GYK A;  3A2W A;  2RUF A;  4O32 A;  2B6M A;  2C3Q A;  2H6X A;  3HVS A;  3H79 A;  3GHA A;  1SK0 A;  4IW9 A;  1FAA A;  5GZZ B;  2IMI A;  3FYG A;  3HZ4 A;  4TR1 A;  4MPF A;  4N0V A;  3GSS A;  1KBN A;  4TR4 A;  1UA5 A;  5CP1 A;  2V1M A;  2JU5 A;  2WJU A;  4V1A g;  1XVQ A;  1A2M A;  1JZR A;  2VO4 A;  3GH6 A;  3F4S A;  1FB6 A;  3TGZ A;  2LV3 A;  2LNT A;  3IR4 A;  4HJ2 A;  8GSS A;  2WB9 A;  3APS A;  1TRV A;  3HVX A;  2VCQ A;  4X1U A;  3FR3 A;  5E4W A;  2LJA A;  2HLS A;  3WGX A;  5JCU A;  4DSS B;  3GRX A;  1GTU A;  2JZT A;  3VLN A;  5D9V A;  4EVM A;  2H72 A;  4WBJ A;  1TKD B;  5D9X A;  4N30 A;  1PKZ A;  1XOB A;  1OKD A;  3KM6 A;  3M9J A;  4HU9 A;  3ZL5 A;  5H5Q A;  5F05 A;  3M0F A;  5ECQ B;  4KA0 A;  5DCG A;  2F8A A;  3L78 A;  4RI6 A;  4FO5 A;  1SYR A;  2JAC A;  3ZLP A;  4ZB6 A;  2IMK A;  3W8J A;  3KXO A;  4ZB9 A;  2L5L A;  3UOM A;  4IJI A;  4K6X A;  3APO A;  1TI3 A;  2GQM A;  4PQI A;  2V32 A;  2YJH A;  3TKS E;  1SK1 A;  5B6N A;  1ERW A;  3UBL A;  1USB A;  4G2E A;  3F8U A;  3GKK A;  3O3T A;  5IM9 A;  3GUS A;  4N10 A;  4KDU A;  4KSM A;  1EP8 A;  1EV9 A;  3ZIJ A;  4EKZ A;  4I8B A;  2R6K A;  2CAQ A;  4EDZ A;  1Z6N A;  4FH8 A;  2C3T A;  2C1Y A;  3LFL A;  1IYI A;  4KE3 A;  2CT6 A;  1ACV A;  2L6D A;  3GNJ A;  4LL4 B;  1ZMA A;  3A2V A;  3J7Y b;  1ZGN A;  1R5A A;  1Q98 A;  3QDN A;  2GSR A;  4MH3 A;  3MNG A;  1Z7R A;  1U3A A;  2WGR A;  4PX1 A;  2IJY A;  1JFU A;  2I4A A;  2KOK A;  4NHW A;  4JED A;  1AW9 A;  3E0U A;  1QGV A;  2N5B A;  2FA4 A;  1A0F A;  1T4Y A;  4MLY A;  2YWO A;  2I3Y A;  2YWN A;  3C7M A;  3VUR A;  1ZYQ B;  18GS A;  4IKH A;  5IMD A;  2YJ7 A;  1M2B A;  1S3A A;  1QQ2 A;  2LRC A;  4ZIJ A;  4GXZ A;  2DML A;  3RBT A;  3H8Q A;  2H1G A;  5GAP D;  3DRN A;  5B8B A;  4XHM A;  4KW6 A;  1M2D A;  3QFB C;  2RLI A;  3EC3 A;  1H75 A;  1ZZY A;  2CZ2 A;  3EUR A;  3VWX A;  4YQV A;  1RK4 A;  3GA4 A;  4AJ6 A;  2K8S A;  1GUK A;  3M9K A;  3GL3 A;  4F82 A;  3CBU A;  3DVX A;  4GWR A;  5CO3 A;  1A23 A;  4N0Z A;  3KP9 A;  2A2S A;  5G1K A;  3WYW A;  1GNE A;  4V1A p;  2VL9 A;  5ECM B;  4FYC A;  1UN2 A;  2VOC A;  2DJ0 A;  1UVZ A;  1HQO A;  1GWC A;  4ECI A;  4O5R A;  1W89 A;  2H01 A;  2QSI A;  4XRD A;  5IPH A;  1OKT A;  4RQX A;  4XS1 A;  2V6K A;  4MCU A;  2VM2 A;  1E2Y A;  3TJB A;  1T00 A;  1VF3 A;  6GSV A;  4HOJ A;  16GS A;  1ERV A;  3FZ9 A;  5IOX A;  1M2A A;  3H4K A;  4JRR A;  2E2G A;  1YF0 A;  4L0U A;  3G7J A;  3KZQ A;  1R7H A;  4PUA A;  3RPN A;  1PRX A;  5DAK B;  3APQ A;  3FZ4 A;  1XW5 A;  2AB6 A;  3KTL A;  2MBS A;  1WRY A;  4GCI A;  1TP9 A;  6GSW A;  2V41 A;  1XWG A;  1EZK A;  4F0B A;  5ECL B;  2DJ2 A;  5HQP A;  5KN2 A;  1QFN A;  4WET A;  3IC4 A;  4KGI A;  1HYU A;  3VPT A;  3TRQ A;  2VUP A;  1Z5Y E;  2L59 A;  2VLT A;  1XPV A;  1FB0 A;  1HNB A;  4Q5N A;  2B5E A;  1DSB A;  4V2N A;  1GSE A;  3L9S A;  4JU5 A;  2K8V A;  1XCC A;  2PPT A;  1U6T A;  3Q18 A;  1NSW A;  1YKC A;  4D73 A;  4ECB A;  2IPA A;  2TIR A;  4WBR D;  3HXS A;  3ERW A;  4MZW A;  4G9H A;  4RI7 A;  3UL3 A;  4PQ1 A;  2WFC A;  2IMD A;  2DJJ A;  14GS A;  1T4Z A;  1X5D A;  2MYG A;  5HR0 A;  4F0C A;  3M1G A;  4IQ1 A;  3F63 A;  2IIY A;  2YV9 A;  3PH9 A;  2BJX A;  2VD1 A;  3IA1 A;  4HZ4 A;  5ENU A;  3FHK A;  3D22 A;  3EU3 A;  2P31 A;  4NPB A;  1LJR A;  3TCO A;  1XOA A;  4GF0 A;  3GFK A;  1XFL A;  3D6I A;  2GVP A;  3HHV A;  1TJD A;  1AAZ A;  2IWT A;  4KDX A;  5EY6 A;  4QQ7 A;  1OYJ A;  2FWH A;  3DYR A;  2LQQ A;  5IMC A;  3GTU A;  2RUE A;  1DBY A;  3BCK A;  5C00 A;  3KH9 A;  1GRX A;  4GLT A;  4L5L A;  3TOT A;  2WUL A;  5JCG A;  1K0A A;  3F6D A;  4H86 A;  6GST A;  1N2A A;  2QKE A;  4F2I A;  3ZVJ D;  4IBP A;  2MMA A;  3GMF A;  2X64 A;  4IQA A;  2QC7 A;  3P2A A;  3O6T A;  5ID2 A;  1KEB A;  5ABR A;  4I97 A;  2JZS A;  4OD7 A;  2CA8 A;  2BTO T;  1R26 A;  2CVD A;  4Q5Q A;  2C4J A;  5AIS A;  3TRP A;  4MP4 A;  5CYY A;  1K3O A;  2AYT A;  2GDR A;  2E0Q A;  2H19 A;  3DKS A;  4KH7 A;  4MA9 A;  2LNS A;  1THO A;  1BJX A;  2FA8 A;  2REM A;  2H30 A;  5GST A;  5CAX A;  1URM A;  2P5R A;  1J9B A;  1BQ7 A;  2OBK A;  3R2Q A;  5D93 A;  1A2L A;  1OC8 A;  4F9Z A;  3GKN A;  3FR6 A;  3KP8 A;  4TVE A;  5D9T A;  3UIW A;  3TDG A;  2ES7 A;  3D21 A;  4HDE A;  4POL A;  3BD2 A;  2A2R A;  2E7P A;  1M9A A;  1VRS D;  3ED3 A;  3TRX A;  1B4Q A;  1WJK A;  3TKS A;  1M0U A;  2YWI A;  1EGO A;  2M72 A;  4E8H A;  4OFN A;  1OVN A;  2NDO A;  4I5Q A;  4CW9 A;  1K0D A;  4MF5 A;  1G0T A;  3VWU A;  4GRF A;  3LYK A;  2IFQ B;  3P8W A;  2K6V A;  4IS0 A;  2H66 A;  4PUR A;  5G2Z A;  2HZF A;  5DQY A;  4HUA A;  3BBY A;  1ZCP A;  1PKW A;  4ZL8 A;  1YJ6 A;  2B5X A;  2VIM A;  5FHI A;  2V2G A;  20GS A;  5DVB A;  2VLU A;  1XZO A;  4FIW A;  1CQH A;  2HFD A;  4E8E A;  1F37 A;  2NVL A;  4K9Z A;  3ZIT A;  3EU4 A;  2XC2 A;  4J56 E;  4IP1 A;  3GST A;  1EP7 A;  4MJA A;  3LGC A;  3K8N A;  4V2M A;  1EGR A;  1OC9 A;  2CAI A;  1GP1 A;  1PQN A;  5J41 A;  2VL3 A;  3IXR A;  1FVJ A;  2HXK A;  4TXO A;  1TRW A;  2GS3 A;  3AY8 A;  1GLP A;  4HZ2 A;  2VL2 C;  4K2D A;  2H1B A;  3IE3 A; 
#chains in the Genus database with same CATH topology
 4LLR A;  1FHE A;  4K0G A;  1BYE A;  1XWB A;  4KF9 A;  1GSS A;  2DBC A;  1KNG A;  2LJK A;  3QPM A;  5KOW A;  3ZML A;  2ON5 A;  3J7Y k;  1PL2 A;  5HFK A;  1CQG A;  2H6Z A;  3RHC A;  1ZYN A;  5DDL A;  3ZMK A;  4TR3 A;  4I2U A;  3IV4 A;  3DIE A;  4GST A;  2DJK A;  3GIX A;  1MDJ A;  4FQU A;  1KTE A;  2VCT A;  4IHU A;  3TJJ A;  3TJK A;  1G6Y A;  1ZOF A;  4KCA A;  5CRW A;  1SD9 A;  2FY6 A;  2XBI A;  1XIY A;  6GSY A;  4NWY A;  1M3I A;  3C1S A;  3VI5 A;  5DBQ A;  4K8M A;  2HE3 A;  1QXH A;  2PVO C;  3HZ8 A;  3IAS 2;  4BIK A;  3F3R A;  3KMN A;  3HKR A;  1X9M B;  2I81 A;  1SEN A;  1TOF A;  1FO5 A;  1ERT A;  3F0I A;  1FG4 A;  1VF4 A;  2H0H A;  1ST9 A;  5DCH A;  1THX A;  2K18 A;  1TXX A;  5G31 A;  3DVW A;  3LXT A;  3SBC A;  2LST A;  4BL7 B;  1Z7P A;  2OAC A;  2O8V B;  2M46 A;  2O85 A;  3GN3 A;  3RDW A;  5IMZ A;  4PXO A;  4K7I A;  5G5E A;  2O7K A;  1PX6 A;  5ECH B;  5D9W A;  1PX7 A;  1R4W A;  3BJ5 A;  2H73 A;  1GTI A;  4MK3 A;  1SL1 B;  3ZYW A;  4ACS A;  2L5O A;  1PL1 A;  1SD8 A;  2HRA A;  4TR1 B;  1NM3 A;  3ME8 A;  4XCS A;  4GTU A;  4OFM A;  2GZZ A;  3F6F A;  1WP0 A;  4PUF C;  4LA1 A;  5AIX A;  2RM6 A;  2E2M A;  4O92 A;  2A2P A;  4MPG A;  5H5R A;  2LJR A;  4PNG A;  4G0K A;  2RM5 A;  5J9C A;  1S3C A;  4Z2R A;  2LKU A;  2LTK A;  4RQR A;  3D4M A;  3LXZ A;  2Z9S A;  1XWK A;  4XS4 A;  4YAP A;  2L4C A;  1Z9H A;  2GZY A;  4HQZ A;  4KCE A;  5DAK A;  5COH A;  1ZL9 A;  2KP1 A;  3UVT A;  3ZIV A;  4A5P A;  1EEM A;  1SJ6 A;  2GLR A;  3LSZ A;  2D2Z A;  3IAM 2;  1SK2 A;  5ECS A;  5HR2 A;  4EO3 A;  4DVC A;  3IPZ A;  2PGT A;  1MD3 A;  3GX8 A;  3D4T A;  2PBJ A;  3QMX A;  2C8U A;  5HR1 A;  1T7P B;  2C0F A;  2OE0 A;  1NHY A;  2DSA A;  2YNX A;  2HRF A;  1JLV A;  1A24 A;  4XRA A;  2GZP A;  1PN9 A;  3GV1 A;  3MWH A;  1O7U A;  1OC3 A;  2VAF A;  1X9W B;  3DEX A;  3HJM A;  3W6G A;  3TOU A;  3LYP A;  4GSS A;  10GS A;  3IOS A;  4WXT A;  3CRT A;  5BRT A;  3CSI A;  4KND A;  3CRU A;  2EIQ A;  4JR4 A;  4K7N A;  1JHB A;  2ZNM A;  3US3 A;  3HA9 A;  2B5Y A;  2YOI A;  4ZBB A;  2CX4 A;  2HRN A;  1OE7 A;  1UC7 A;  4X43 A;  2VD0 A;  3TKQ A;  3ME7 A;  2IME A;  2YN1 A;  3RPP A;  4BWS A;  2GST A;  2L6C A;  2GT5 A;  4L5O A;  4ML6 A;  1GLQ A;  4RUV A;  4OCE A;  3TJF A;  2QA2 A;  1Z6M A;  2CX3 A;  2M80 A;  5FT3 A;  3RHB A;  3IDV A;  2FUG 2;  3DWV A;  2FLS A;  3UAP A;  5JWQ B;  1AIU A;  1F3B A;  4EE0 A;  3GKX A;  1TRU A;  2R3X A;  2LRN A;  2H1A A;  3GUR A;  4BVY A;  4POM A;  5A4U A;  3E9J B;  4GQC A;  1YDK A;  1SYX A;  1TU8 A;  1NHO A;  5ECK B;  5AN1 A;  3U5R E;  4K1F A;  2QGV A;  3I6A A;  6GSX A;  5ELA A;  1PSQ A;  1Y25 A;  2F3M A;  2CVB A;  2HZE A;  3C1R A;  3M8N A;  2X49 A;  2VLV A;  2JSZ A;  2XHF A;  1K3Y A;  2GTU A;  4TR0 A;  3Q6O A;  1GSQ A;  4BVX A;  2R0G A;  3WT1 A;  2XBQ A;  3LJR A;  3Q74 A;  3W8S A;  1YQ1 A;  1XW9 A;  1V57 A;  2VM1 A;  2OA7 A;  4QL7 A;  2DLX A;  1VF1 A;  2C3N A;  3FMW A;  4J2F A;  1TU7 A;  2JZR A;  1TW9 A;  1JZW A;  3ZFB A;  1O6J A;  5A4W A;  4LMW A;  1EOH A;  1GSF A;  3L0H A;  1AC1 A;  1C72 A;  1K0N A;  5KEJ A;  2ON7 A;  5FWG A;  4AJ8 A;  3TUE A;  1K0C A;  3A3T A;  1HNA A;  2LUS A;  2OJL A;  2R5G A;  3MAK A;  2CV4 A;  1Y6E A;  2XPE A;  4PGT A;  1QUW A;  5GSS A;  4CDO A;  5F07 A;  1BG5 A;  1YF1 A;  2IL3 A;  1V2A A;  2YCD A;  1OE8 A;  1GL8 A;  1X9S B;  2IMF A;  4HQS A;  2KLX A;  4TKY A;  3CQF A;  2P0G A;  2DIY A;  2L57 A;  2WZ9 A;  2DKH A;  3EYT A;  2X99 A;  2O87 A;  1SJZ A;  4HU7 A;  4EXJ A;  1F6M C;  3PGT A;  2VCX A;  3QAG A;  1J0F A;  1Z3E A;  4F03 A;  3UAR A;  2AAW A;  2PUK C;  4TXV A;  2P5Q A;  2YPM A;  4EDY A;  2ZCT A;  4ML1 A;  4QL9 A;  4IP6 A;  5KN0 A;  4NMU A;  2H74 A;  3TKR A;  2MMZ A;  1YEX A;  5ECN B;  3QAV A;  1TRS A;  3DML A;  5KOX A;  3C73 A;  3WT2 A;  3QAW A;  1K0O A;  3EMX A;  2MBT A;  4MJE A;  5J4U A;  3HYP A;  2YV7 A;  5IMA A;  2R0P A;  2OBI A;  4EUY A;  4ZBA A;  3A2X A;  4Q5F A;  4D73 B;  2HSY A;  4TOP A;  1X0R A;  6GSU A;  2GQK A;  3TKS C;  2RII A;  3O76 A;  1O8X A;  3IHQ A;  2FHE A;  4K0N A;  1W4V A;  3NIV A;  5IIZ A;  5CRD A;  1MTC A;  4FYB A;  1B9Y C;  1S3D A;  2AHE A;  5CRE A;  2PWJ A;  3P7X A;  1TK0 B;  4Z7X A;  4DSS A;  4YH2 A;  5G1L A;  3C8E A;  3I43 A;  1K3L A;  3KTB A;  2C80 A;  4ZBD A;  3ISO A;  3FW2 A;  5D73 A;  4AF2 A;  2LEG A;  3VFI A;  2WRT A;  1FOV A;  1SKS B;  7GSS A;  5IMF A;  4DSR A;  4P3Y B;  4EC0 A;  3M3M A;  2C0G A;  3IBH A;  3TJG A;  3MDK A;  1GSD A;  2EIO A;  3PIN A;  5INY A;  3LWA A;  4ID0 A;  4AJ7 A;  4MZB A;  4Q5R A;  3V1W A;  1MDK A;  2H71 A;  3UBK A;  1LBK A;  4JR6 A;  4KX4 A;  2X8C A;  4KAE A;  3U6V A;  1O8W A;  3EE2 A;  1XXU A;  2AUV A;  4J57 E;  4WF5 A;  3N9J A;  3CSH A;  5F06 A;  1V98 A;  4WF4 A;  2GGT A;  1ZYE A;  4OO4 A;  2DJ1 A;  2NPB A;  2C0E A;  4G0L A;  1WPI A;  2ZUP A;  1GH2 A;  5JWO B;  3F4R A;  5ID2 B;  3LOR A;  1TDI A;  3LQ7 A;  3UMA A;  3FK8 A;  4ICY A;  4N11 A;  4HJM A;  3I9V 2;  2H1D A;  2TRC P;  4MJB A;  1EWX A;  1G6W A;  1A2J A;  1WWJ A;  2HYX A;  3UJ1 A;  3EIN A;  3EWL A;  1ML6 A;  4NAX A;  1M99 A;  2EC4 A;  5EVO A;  4K2X A;  3N5O A;  4ZL9 A;  1T1V A;  1FVK A;  1U88 A;  3ZZX A;  3FKF A;  3WGD A;  5AGY A;  1A8L A;  5ECR B;  1PFO A;  1RW1 A;  4OCF A;  2H6Y A;  2LS5 A;  4KSO A;  5D96 A;  5DAL B;  1JZO A;  4WEY A;  2VL2 A;  1U3I A;  1TK5 B;  2FWE A;  4MNN A;  4WR5 A;  1XWC A;  3VWV A;  2WCI A;  2NTO A;  3IK7 A;  4L8E A;  4O7H A;  2FCH A;  4IJ3 A;  2FD3 A;  1XBS A;  1FW1 A;  1LU4 A;  1MDI A;  1F2E A;  4BPY A;  3Q19 A;  5CNW A;  4ILF A;  2X8H A;  2CVK A;  3BOA A;  4ZB8 A;  4GSN A;  4HEA 2;  2WS2 A;  1AUC A;  3GX0 A;  2OE1 A;  3F9U A;  1TI1 A;  5DJL A;  3DD3 A;  5LNK e;  1WOU A;  3H1N A;  3GL5 A;  2OAD A;  1YKA A;  19GS A;  1B9X C;  5ECO B;  1GNW A;  1OC9 B;  4TN8 A;  4HI7 A;  1HD2 A;  1EEJ A;  5IO2 A;  2F8F A;  3KD0 A;  4POK A;  1X5C A;  1Q4J A;  4LMV A;  4TXO B;  4USS A;  2PU9 C;  2FWF A;  1GSY A;  3HY2 A;  3ZFL A;  3G7I A;  3JCM L;  5DJM A;  4DSQ A;  1SKW B;  3DXB A;  4MJC A;  4FYU A;  3UEM A;  4Z2T A;  2H75 A;  2VCV A;  4MF7 A;  3KJY A;  4MDC A;  4JZQ A;  2HI7 A;  4KDY A;  4MZC A;  1A8Y A;  1JLW A;  4G10 A;  1K0M A;  2CZ3 A;  3MYD A;  3NZN A;  2PER A;  1GSU A;  3ZRD A;  2R0C A;  5A4V A;  5LD0 A;  1N8J A;  4OFT A;  3A5W A;  5ECI B;  4KB3 A;  2OE3 A;  4LL1 B;  3HVV A;  3S9F A;  4ZL7 A;  4TRX A;  4ECC A;  12GS A;  5KN1 A;  1O73 A;  4X0X A;  3QOU A;  2MMO A;  2OKA A;  4YKG A;  2X8G A;  2A4H A;  5CRG A;  2O89 A;  4POB A;  3RAZ A;  2F9S A;  1T8E B;  5HR3 A;  2AV4 A;  5KN3 A;  4HS1 A;  4XIH A;  1F9M A;  1SJI A;  4IGJ A;  4WR4 A;  1GUM A;  1O81 A;  3KIJ A;  5HFI A;  3UVH A;  3R3E A;  2G0F A;  1E6B A;  1AQW A;  1YEP A;  5D8I A;  1ZYP A;  4YQM A;  1BAY A;  3I69 A;  2LRT A;  3TB2 A;  1S3R A;  3HDC A;  4MAB A;  1WE0 A;  3ZVJ A;  4IVF A;  2R4V A;  1ABA A;  2DMM A;  4IN0 A;  3NOF A;  2DIZ A;  4YAV A;  5B6M A;  3SWL A;  3HD5 A;  4CHS A;  2L4Q A;  1DE1 A;  4OWY A;  2R37 A;  2TRX A;  1EV4 A;  4I6X A;  2PN8 A;  3CSJ A;  4MH2 A;  3EVI A;  5F0G A;  2VCZ A;  1YY7 A;  2YZU A;  5EL8 A;  1PD2 1;  4BA7 A;  1ERU A;  2NBS A;  1QMV A;  1V40 A;  3WGE A;  5EPF A;  5AIV A;  2YAN A;  5JWR B;  2LQO A;  1XWA A;  5E59 A;  2V6O A;  2HSH A;  2K9F A;  4XS4 B;  4MF6 A;  2YWM A;  2B7K A;  2EIR A;  2KP2 A;  2I9H A;  1TK8 B;  1BX9 A;  3VPQ A;  1NW2 A;  5G5F A;  5B8A A;  2GSQ A;  2MZC A;  1V58 A;  3G9B A;  3EMP A;  1H4O A;  2X4A A;  1VF2 A;  4ULX A;  3FRC A;  5HFG A;  1XW6 A;  3CYN A;  3HJP A;  2ALB A;  1I9D A;  1GTA A;  4YQU A;  4EF0 A;  5JCW A;  1JZD A;  1AQV A;  2HRK A;  1ON4 A;  2H76 A;  2KHP A;  4PQH A;  3LEF A;  2DC5 A;  3HCZ A;  1TTZ A;  2AJQ B;  2JSY A;  5IPG A;  5DQS A;  2B1K A;  1PMT A;  2YZH A;  3KH7 A;  2CQ9 A;  5A5K A;  1WMJ A;  4NV5 A;  3CTG A;  5H5S A;  3L9U A;  2HNL A;  4O5Q A;  1AQX A;  2JAD A;  3KMO A;  1B48 A;  4NHZ A;  3MSZ A;  4WKW A;  1V9W A;  1I5G A;  3ZRE A;  2B7J A;  3VWW A;  1SL2 B;  2H70 A;  4OO5 A;  1WIK A;  1MEK A;  1QK8 A;  4K7O A;  3C71 A;  3HVN A;  1OAZ A;  1O85 A;  3GH9 A;  2FNO A;  2H8L A;  1F3A A;  1IYH A;  1K0B A;  2VCW A;  3D0Z A;  1AXD A;  3CTF A;  2FGX A;  3G7Y A;  2IFQ A;  1PA3 A;  2GQL A;  3QD9 A;  1RQM A;  1YZX A;  5IMV A;  1VGL A;  2KUC A;  3KEB A;  1GUL A;  2YP6 A;  2GT6 A;  5ECP B;  2XPD A;  5J9B A;  3L9V A;  1XVW A;  3DGQ A;  3F3Q A;  1T3B A;  3ZTL A;  11GS A;  4XTS A;  4BVY B;  3H93 A;  3ERG A;  2N5F A;  1A0R P;  2MMN A;  3D5J A;  5ELG A;  4I2T A;  3VK9 A;  5B7C A;  3IRA A;  2HZE B;  2JL4 A;  2B3S A;  3P90 A;  5IQY A;  3CMI A;  5J3R A;  5BMU A;  2G2Q A;  3QCP A;  2C0D A;  1R5P A;  2BMX A;  1G7E A;  1M9B A;  1PGT A;  3IK9 A;  5IO0 A;  1DUG A;  3WD6 A;  4EL1 A;  1B8X A;  1U87 A;  3LG6 A;  1EOG A;  2PMT A;  5LCZ A;  3F4T A;  3FZA A;  3PR8 A;  5IOW A;  4XS6 A;  1ILO A;  3GKM A;  2J9H A;  2DJ3 A;  3CXG A;  4OMV A;  4ZIL A;  1SU9 A;  22GS A;  1J08 A;  3IHG A;  4DEJ A;  1SKR B;  1BED A;  4L0W A;  3KCM A;  2PVQ A;  1DE2 A;  2R2J A;  9GSS A;  3QFA C;  3L4N A;  5F8B A;  5J5N A;  1B4P A;  1SL0 B;  17GS A;  3E3E A;  4MMM A;  3ERF A;  2B1L A;  3FEU A;  13GS A;  4JBB A;  1GUH A;  2A4V A;  3BCI A;  4GQF A;  4IEL A;  4JE1 A;  4AGS A;  4O5U A;  5DAL A;  5GAN D;  5L71 A;  3VI7 A;  2WDU A;  3HJO A;  2FWG A;  3FY7 A;  4NXI A;  3FR9 A;  3GTU B;  2H0G A;  2F51 A;  5CRH A;  1HNC A;  4G0I A;  3KGK A;  4ECJ A;  1M7T A;  5C04 A;  4PNF A;  4NV2 A;  2H0I A;  1GTB A;  2I1U A;  4TW5 A;  3TKP A;  4ZXG A;  2N5A A;  4V2L A;  3OR5 A;  4ISD A;  2HT9 A;  4KUN A;  1MD4 A;  1X5E A;  2IN3 A;  5G30 A;  4BWQ A;  2GSS A;  1G7O A;  3FZ5 A;  4YKF A;  2J23 A;  3QR6 A;  6GSS A;  4G19 A;  4BL7 A;  3A5I A;  3GYK A;  3A2W A;  2RUF A;  4O32 A;  2B6M A;  2C3Q A;  2H6X A;  3HVS A;  3H79 A;  3GHA A;  1SK0 A;  4IW9 A;  1FAA A;  5GZZ B;  2IMI A;  3FYG A;  3HZ4 A;  4TR1 A;  4MPF A;  4N0V A;  3GSS A;  1KBN A;  4TR4 A;  1UA5 A;  5CP1 A;  2V1M A;  2JU5 A;  2WJU A;  4V1A g;  1XVQ A;  1A2M A;  1JZR A;  2VO4 A;  3GH6 A;  3F4S A;  1FB6 A;  3TGZ A;  2LV3 A;  2LNT A;  3IR4 A;  4HJ2 A;  8GSS A;  2WB9 A;  3APS A;  1TRV A;  3HVX A;  2VCQ A;  4X1U A;  3FR3 A;  5E4W A;  2LJA A;  2HLS A;  3WGX A;  5JCU A;  4DSS B;  3GRX A;  1GTU A;  2JZT A;  3VLN A;  5D9V A;  4EVM A;  2H72 A;  4WBJ A;  1TKD B;  5D9X A;  4N30 A;  1PKZ A;  1XOB A;  1OKD A;  3KM6 A;  3M9J A;  4HU9 A;  3ZL5 A;  5H5Q A;  5F05 A;  3M0F A;  5ECQ B;  4KA0 A;  5DCG A;  2F8A A;  3L78 A;  4RI6 A;  4FO5 A;  1SYR A;  2JAC A;  4HSC X;  3ZLP A;  4ZB6 A;  2IMK A;  3W8J A;  3KXO A;  4ZB9 A;  2L5L A;  3UOM A;  4IJI A;  4K6X A;  3APO A;  1TI3 A;  2GQM A;  4PQI A;  4EIQ A;  2V32 A;  4EIP A;  2YJH A;  3TKS E;  1SK1 A;  5B6N A;  1ERW A;  3UBL A;  1USB A;  4G2E A;  3F8U A;  3GKK A;  3O3T A;  4X4J A;  1XG8 A;  5IM9 A;  3GUS A;  4N10 A;  4KDU A;  4KSM A;  1EP8 A;  1EV9 A;  3ZIJ A;  4EKZ A;  4I8B A;  2R6K A;  2CAQ A;  4EDZ A;  1Z6N A;  4FH8 A;  2C3T A;  2C1Y A;  3LFL A;  1IYI A;  4KE3 A;  2CT6 A;  1ACV A;  2L6D A;  3GNJ A;  4LL4 B;  1ZMA A;  3A2V A;  3J7Y b;  1ZGN A;  1R5A A;  1Q98 A;  3QDN A;  2GSR A;  4MH3 A;  3MNG A;  1Z7R A;  1U3A A;  2WGR A;  4PX1 A;  2IJY A;  1JFU A;  2I4A A;  2KOK A;  4NHW A;  4JED A;  1AW9 A;  3E0U A;  1QGV A;  2N5B A;  2FA4 A;  1A0F A;  1T4Y A;  4MLY A;  2YWO A;  2I3Y A;  2YWN A;  3C7M A;  3VUR A;  1ZYQ B;  18GS A;  4IKH A;  5IMD A;  2YJ7 A;  1M2B A;  1S3A A;  1QQ2 A;  2LRC A;  4ZIJ A;  4GXZ A;  2DML A;  3RBT A;  3H8Q A;  1FOH A;  3LW9 A;  2H1G A;  5GAP D;  3DRN A;  5B8B A;  4XHM A;  4KW6 A;  1M2D A;  3QFB C;  2RLI A;  3EC3 A;  1H75 A;  1ZZY A;  2CZ2 A;  3EUR A;  3VWX A;  4YQV A;  1RK4 A;  4Z2U A;  3GA4 A;  4AJ6 A;  2K8S A;  1GUK A;  3M9K A;  3GL3 A;  4CY8 A;  4F82 A;  3CBU A;  3DVX A;  4GWR A;  5CO3 A;  3EPT A;  1A23 A;  4N0Z A;  3KP9 A;  2A2S A;  5G1K A;  3WYW A;  1GNE A;  4V1A p;  2VL9 A;  5ECM B;  4FYC A;  1UN2 A;  2VOC A;  2DJ0 A;  1UVZ A;  1HQO A;  1GWC A;  4ECI A;  4O5R A;  1W89 A;  2H01 A;  2QSI A;  4XRD A;  3IC8 A;  5IPH A;  1OKT A;  4RQX A;  4XS1 A;  2V6K A;  4MCU A;  2VM2 A;  1E2Y A;  3TJB A;  4CY6 A;  1T00 A;  1VF3 A;  6GSV A;  4HOJ A;  16GS A;  1ERV A;  3FZ9 A;  5IOX A;  1M2A A;  3H4K A;  4JRR A;  2E2G A;  1YF0 A;  4L0U A;  3G7J A;  3KZQ A;  1R7H A;  4PUA A;  3RPN A;  1PRX A;  5DAK B;  3APQ A;  3FZ4 A;  1XW5 A;  2AB6 A;  3KTL A;  2MBS A;  1WRY A;  4GCI A;  1TP9 A;  6GSW A;  2V41 A;  1XWG A;  1EZK A;  4F0B A;  5ECL B;  2DJ2 A;  5HQP A;  5KN2 A;  1QFN A;  4WET A;  3MIX A;  3IC4 A;  4KGI A;  1HYU A;  3VPT A;  3TRQ A;  2VUP A;  1Z5Y E;  2L59 A;  2VLT A;  1PN0 A;  1XPV A;  1FB0 A;  1HNB A;  4Q5N A;  2B5E A;  1DSB A;  4V2N A;  1GSE A;  3L9S A;  4JU5 A;  2K8V A;  1XCC A;  2PPT A;  1U6T A;  3Q18 A;  1NSW A;  1YKC A;  2DKI A;  2UZ8 A;  4D73 A;  4ECB A;  2IPA A;  2TIR A;  4WBR D;  3HXS A;  3ERW A;  4MZW A;  4G9H A;  4RI7 A;  4K5S A;  3UL3 A;  4PQ1 A;  2WFC A;  2IMD A;  2DJJ A;  14GS A;  1M3J A;  1T4Z A;  1X5D A;  2MYG A;  5HR0 A;  4F0C A;  3M1G A;  4IQ1 A;  3F63 A;  2IIY A;  2YV9 A;  3PH9 A;  2BJX A;  2VD1 A;  3IA1 A;  4HZ4 A;  5ENU A;  3FHK A;  3D22 A;  3EU3 A;  2P31 A;  4NPB A;  1LJR A;  3TCO A;  1XOA A;  4GF0 A;  3GFK A;  1XFL A;  3D6I A;  2GVP A;  3HHV A;  1TJD A;  1AAZ A;  2IWT A;  4KDX A;  5EY6 A;  4QQ7 A;  1OYJ A;  2FWH A;  3DYR A;  2LQQ A;  5IMC A;  3GTU A;  2RUE A;  1DBY A;  3BCK A;  5C00 A;  3KH9 A;  1GRX A;  4GLT A;  4L5L A;  4K5R A;  3TOT A;  2WUL A;  5JCG A;  1K0A A;  3F6D A;  3PPU A;  4H86 A;  6GST A;  1N2A A;  2QKE A;  4F2I A;  3ZVJ D;  4IBP A;  2MMA A;  3GMF A;  4BVX B;  2X64 A;  4IQA A;  2QC7 A;  3P2A A;  3O6T A;  5ID2 A;  1KEB A;  5ABR A;  4I97 A;  2JZS A;  4OD7 A;  2CA8 A;  2BTO T;  1R26 A;  2CVD A;  4Q5Q A;  2C4J A;  5AIS A;  3TRP A;  4MP4 A;  5CYY A;  1K3O A;  2AYT A;  2GDR A;  2E0Q A;  2H19 A;  3DKS A;  4KH7 A;  4MA9 A;  2LNS A;  1THO A;  1BJX A;  2FA8 A;  2REM A;  2H30 A;  5GST A;  5CAX A;  1URM A;  2P5R A;  1J9B A;  1BQ7 A;  2OBK A;  3R2Q A;  5D93 A;  1A2L A;  1OC8 A;  4F9Z A;  3GKN A;  3FR6 A;  3KP8 A;  4TVE A;  5D9T A;  3UIW A;  3TDG A;  2ES7 A;  3D21 A;  4HDE A;  4POL A;  3BD2 A;  2A2R A;  2E7P A;  1M9A A;  1VRS D;  3ED3 A;  3TRX A;  1B4Q A;  1WJK A;  3TKS A;  1M0U A;  2YWI A;  1EGO A;  2M72 A;  4E8H A;  4OFN A;  1OVN A;  2NDO A;  4I5Q A;  4CW9 A;  1K0D A;  4MF5 A;  1G0T A;  3VWU A;  4GRF A;  3LYK A;  2IFQ B;  3P8W A;  2K6V A;  4IS0 A;  2H66 A;  4PUR A;  4PTS A;  5G2Z A;  2HZF A;  5DQY A;  4HUA A;  3BBY A;  1ZCP A;  1PKW A;  4ZL8 A;  1YJ6 A;  2B5X A;  2VIM A;  5FHI A;  2V2G A;  20GS A;  5DVB A;  2VLU A;  1XZO A;  4FIW A;  1CQH A;  2HFD A;  4E8E A;  1F37 A;  2NVL A;  4K9Z A;  3ZIT A;  3EU4 A;  2XC2 A;  4J56 E;  4IP1 A;  2QA1 A;  3GST A;  1EP7 A;  4MJA A;  3LGC A;  2HSM A;  3K8N A;  4V2M A;  1EGR A;  1OC9 A;  2CAI A;  1GP1 A;  1PQN A;  5J41 A;  2VL3 A;  3IXR A;  1FVJ A;  2HXK A;  4TXO A;  1TRW A;  2GS3 A;  3AY8 A;  1GLP A;  4HZ2 A;  2VL2 C;  4K2D A;  2H1B A;  3IE3 A; 
#chains in the Genus database with same CATH homology
 4LLR A;  1FHE A;  4K0G A;  1BYE A;  1XWB A;  4KF9 A;  1GSS A;  2DBC A;  1KNG A;  2LJK A;  3QPM A;  5KOW A;  3ZML A;  2ON5 A;  3J7Y k;  1PL2 A;  5HFK A;  1CQG A;  2H6Z A;  3RHC A;  1ZYN A;  5DDL A;  3ZMK A;  4TR3 A;  4I2U A;  3IV4 A;  3DIE A;  4GST A;  2DJK A;  3GIX A;  1MDJ A;  4FQU A;  1KTE A;  2VCT A;  4IHU A;  3TJJ A;  3TJK A;  1G6Y A;  1ZOF A;  4KCA A;  5CRW A;  1SD9 A;  2FY6 A;  2XBI A;  1XIY A;  6GSY A;  4NWY A;  3C1S A;  3VI5 A;  5DBQ A;  4K8M A;  2HE3 A;  1QXH A;  2PVO C;  3HZ8 A;  3IAS 2;  3F3R A;  3KMN A;  3HKR A;  1X9M B;  2I81 A;  1SEN A;  1TOF A;  1FO5 A;  1ERT A;  3F0I A;  1FG4 A;  1VF4 A;  2H0H A;  1ST9 A;  5DCH A;  1THX A;  2K18 A;  1TXX A;  5G31 A;  3DVW A;  3LXT A;  3SBC A;  2LST A;  4BL7 B;  1Z7P A;  2OAC A;  2O8V B;  2M46 A;  2O85 A;  3GN3 A;  3RDW A;  5IMZ A;  4PXO A;  4K7I A;  5G5E A;  2O7K A;  1PX6 A;  5ECH B;  5D9W A;  1PX7 A;  1R4W A;  3BJ5 A;  2H73 A;  1GTI A;  4MK3 A;  1SL1 B;  3ZYW A;  4ACS A;  2L5O A;  1PL1 A;  1SD8 A;  2HRA A;  4TR1 B;  1NM3 A;  3ME8 A;  4XCS A;  4GTU A;  4OFM A;  2GZZ A;  3F6F A;  1WP0 A;  4PUF C;  4LA1 A;  5AIX A;  2RM6 A;  2E2M A;  4O92 A;  2A2P A;  4MPG A;  5H5R A;  2LJR A;  4PNG A;  4G0K A;  2RM5 A;  5J9C A;  1S3C A;  4Z2R A;  2LKU A;  2LTK A;  4RQR A;  3D4M A;  3LXZ A;  2Z9S A;  1XWK A;  4XS4 A;  4YAP A;  2L4C A;  1Z9H A;  2GZY A;  4HQZ A;  4KCE A;  5DAK A;  5COH A;  1ZL9 A;  2KP1 A;  3UVT A;  3ZIV A;  4A5P A;  1EEM A;  1SJ6 A;  2GLR A;  3LSZ A;  2D2Z A;  3IAM 2;  1SK2 A;  5ECS A;  5HR2 A;  4EO3 A;  4DVC A;  3IPZ A;  2PGT A;  1MD3 A;  3GX8 A;  3D4T A;  2PBJ A;  3QMX A;  2C8U A;  5HR1 A;  1T7P B;  2C0F A;  2OE0 A;  1NHY A;  2DSA A;  2YNX A;  2HRF A;  1JLV A;  1A24 A;  4XRA A;  2GZP A;  1PN9 A;  3GV1 A;  3MWH A;  1O7U A;  1OC3 A;  2VAF A;  1X9W B;  3DEX A;  3HJM A;  3W6G A;  3TOU A;  3LYP A;  4GSS A;  10GS A;  3IOS A;  4WXT A;  3CRT A;  5BRT A;  3CSI A;  4KND A;  3CRU A;  2EIQ A;  4JR4 A;  4K7N A;  1JHB A;  2ZNM A;  3US3 A;  3HA9 A;  2B5Y A;  2YOI A;  4ZBB A;  2CX4 A;  2HRN A;  1OE7 A;  1UC7 A;  4X43 A;  2VD0 A;  3TKQ A;  3ME7 A;  2IME A;  2YN1 A;  3RPP A;  4BWS A;  2GST A;  2L6C A;  2GT5 A;  4L5O A;  4ML6 A;  1GLQ A;  4RUV A;  4OCE A;  3TJF A;  2QA2 A;  1Z6M A;  2CX3 A;  2M80 A;  5FT3 A;  3RHB A;  3IDV A;  2FUG 2;  3DWV A;  2FLS A;  3UAP A;  5JWQ B;  1AIU A;  1F3B A;  4EE0 A;  3GKX A;  1TRU A;  2R3X A;  2LRN A;  2H1A A;  3GUR A;  4BVY A;  4POM A;  5A4U A;  3E9J B;  4GQC A;  1YDK A;  1SYX A;  1TU8 A;  1NHO A;  5ECK B;  5AN1 A;  3U5R E;  4K1F A;  2QGV A;  3I6A A;  6GSX A;  5ELA A;  1PSQ A;  1Y25 A;  2F3M A;  2CVB A;  2HZE A;  3C1R A;  3M8N A;  2X49 A;  2VLV A;  2JSZ A;  2XHF A;  1K3Y A;  2GTU A;  4TR0 A;  3Q6O A;  1GSQ A;  4BVX A;  2R0G A;  3WT1 A;  2XBQ A;  3LJR A;  3Q74 A;  3W8S A;  1YQ1 A;  1XW9 A;  1V57 A;  2VM1 A;  2OA7 A;  4QL7 A;  2DLX A;  1VF1 A;  2C3N A;  3FMW A;  4J2F A;  1TU7 A;  2JZR A;  1TW9 A;  1JZW A;  3ZFB A;  1O6J A;  5A4W A;  4LMW A;  1EOH A;  1GSF A;  3L0H A;  1AC1 A;  1C72 A;  1K0N A;  5KEJ A;  2ON7 A;  5FWG A;  4AJ8 A;  3TUE A;  1K0C A;  3A3T A;  1HNA A;  2LUS A;  2OJL A;  2R5G A;  3MAK A;  2CV4 A;  1Y6E A;  2XPE A;  4PGT A;  1QUW A;  5GSS A;  4CDO A;  5F07 A;  1BG5 A;  1YF1 A;  2IL3 A;  1V2A A;  2YCD A;  1OE8 A;  1GL8 A;  1X9S B;  2IMF A;  4HQS A;  2KLX A;  4TKY A;  2P0G A;  2DIY A;  2L57 A;  2WZ9 A;  2DKH A;  3EYT A;  2X99 A;  2O87 A;  1SJZ A;  4HU7 A;  4EXJ A;  1F6M C;  3PGT A;  2VCX A;  3QAG A;  1J0F A;  1Z3E A;  4F03 A;  3UAR A;  2AAW A;  2PUK C;  4TXV A;  2P5Q A;  2YPM A;  4EDY A;  2ZCT A;  4ML1 A;  4QL9 A;  4IP6 A;  5KN0 A;  4NMU A;  2H74 A;  3TKR A;  2MMZ A;  1YEX A;  5ECN B;  3QAV A;  1TRS A;  3DML A;  5KOX A;  3C73 A;  3WT2 A;  3QAW A;  1K0O A;  3EMX A;  2MBT A;  4MJE A;  5J4U A;  3HYP A;  2YV7 A;  5IMA A;  2R0P A;  2OBI A;  4EUY A;  4ZBA A;  3A2X A;  4Q5F A;  4D73 B;  2HSY A;  4TOP A;  1X0R A;  6GSU A;  2GQK A;  3TKS C;  2RII A;  3O76 A;  1O8X A;  3IHQ A;  2FHE A;  4K0N A;  1W4V A;  3NIV A;  5IIZ A;  5CRD A;  1MTC A;  4FYB A;  1B9Y C;  1S3D A;  2AHE A;  5CRE A;  2PWJ A;  3P7X A;  1TK0 B;  4Z7X A;  4DSS A;  4YH2 A;  5G1L A;  3C8E A;  3I43 A;  1K3L A;  3KTB A;  2C80 A;  4ZBD A;  3ISO A;  3FW2 A;  5D73 A;  4AF2 A;  2LEG A;  3VFI A;  2WRT A;  1FOV A;  1SKS B;  7GSS A;  5IMF A;  4DSR A;  4P3Y B;  4EC0 A;  3M3M A;  2C0G A;  3IBH A;  3TJG A;  3MDK A;  1GSD A;  2EIO A;  3PIN A;  5INY A;  3LWA A;  4ID0 A;  4AJ7 A;  4MZB A;  4Q5R A;  3V1W A;  1MDK A;  2H71 A;  3UBK A;  1LBK A;  4JR6 A;  4KX4 A;  2X8C A;  4KAE A;  3U6V A;  1O8W A;  3EE2 A;  1XXU A;  2AUV A;  4J57 E;  4WF5 A;  3N9J A;  3CSH A;  5F06 A;  1V98 A;  4WF4 A;  2GGT A;  1ZYE A;  4OO4 A;  2DJ1 A;  2NPB A;  2C0E A;  4G0L A;  1WPI A;  2ZUP A;  1GH2 A;  5JWO B;  3F4R A;  5ID2 B;  3LOR A;  1TDI A;  3LQ7 A;  3UMA A;  3FK8 A;  4ICY A;  4N11 A;  4HJM A;  3I9V 2;  2H1D A;  2TRC P;  4MJB A;  1EWX A;  1G6W A;  1A2J A;  1WWJ A;  2HYX A;  3UJ1 A;  3EIN A;  3EWL A;  1ML6 A;  4NAX A;  1M99 A;  2EC4 A;  5EVO A;  4K2X A;  3N5O A;  4ZL9 A;  1T1V A;  1FVK A;  1U88 A;  3ZZX A;  3FKF A;  3WGD A;  5AGY A;  1A8L A;  5ECR B;  1RW1 A;  4OCF A;  2H6Y A;  2LS5 A;  4KSO A;  5D96 A;  5DAL B;  1JZO A;  4WEY A;  2VL2 A;  1U3I A;  1TK5 B;  2FWE A;  4MNN A;  4WR5 A;  1XWC A;  3VWV A;  2WCI A;  2NTO A;  3IK7 A;  4L8E A;  4O7H A;  2FCH A;  4IJ3 A;  2FD3 A;  1XBS A;  1FW1 A;  1LU4 A;  1MDI A;  1F2E A;  4BPY A;  3Q19 A;  5CNW A;  4ILF A;  2X8H A;  2CVK A;  3BOA A;  4ZB8 A;  4GSN A;  4HEA 2;  2WS2 A;  1AUC A;  3GX0 A;  2OE1 A;  3F9U A;  1TI1 A;  5DJL A;  3DD3 A;  5LNK e;  1WOU A;  3H1N A;  3GL5 A;  2OAD A;  1YKA A;  19GS A;  1B9X C;  5ECO B;  1GNW A;  1OC9 B;  4TN8 A;  4HI7 A;  1HD2 A;  1EEJ A;  5IO2 A;  2F8F A;  3KD0 A;  4POK A;  1X5C A;  1Q4J A;  4LMV A;  4TXO B;  4USS A;  2PU9 C;  2FWF A;  1GSY A;  3HY2 A;  3ZFL A;  3G7I A;  3JCM L;  5DJM A;  4DSQ A;  1SKW B;  3DXB A;  4MJC A;  4FYU A;  3UEM A;  4Z2T A;  2H75 A;  2VCV A;  4MF7 A;  3KJY A;  4MDC A;  4JZQ A;  2HI7 A;  4KDY A;  4MZC A;  1A8Y A;  1JLW A;  4G10 A;  1K0M A;  2CZ3 A;  3MYD A;  3NZN A;  2PER A;  1GSU A;  3ZRD A;  2R0C A;  5A4V A;  5LD0 A;  1N8J A;  4OFT A;  3A5W A;  5ECI B;  4KB3 A;  2OE3 A;  4LL1 B;  3HVV A;  3S9F A;  4ZL7 A;  4TRX A;  4ECC A;  12GS A;  5KN1 A;  1O73 A;  4X0X A;  3QOU A;  2MMO A;  2OKA A;  4YKG A;  2X8G A;  2A4H A;  5CRG A;  2O89 A;  4POB A;  3RAZ A;  2F9S A;  1T8E B;  5HR3 A;  2AV4 A;  5KN3 A;  4HS1 A;  4XIH A;  1F9M A;  1SJI A;  4IGJ A;  4WR4 A;  1GUM A;  1O81 A;  3KIJ A;  5HFI A;  3UVH A;  3R3E A;  2G0F A;  1E6B A;  1AQW A;  1YEP A;  5D8I A;  1ZYP A;  4YQM A;  1BAY A;  3I69 A;  2LRT A;  3TB2 A;  3HDC A;  4MAB A;  1WE0 A;  3ZVJ A;  4IVF A;  2R4V A;  1ABA A;  2DMM A;  4IN0 A;  3NOF A;  2DIZ A;  4YAV A;  5B6M A;  3SWL A;  3HD5 A;  4CHS A;  2L4Q A;  1DE1 A;  4OWY A;  2R37 A;  2TRX A;  1EV4 A;  4I6X A;  2PN8 A;  3CSJ A;  4MH2 A;  3EVI A;  5F0G A;  2VCZ A;  1YY7 A;  2YZU A;  5EL8 A;  1PD2 1;  4BA7 A;  1ERU A;  2NBS A;  1QMV A;  1V40 A;  3WGE A;  5EPF A;  5AIV A;  2YAN A;  5JWR B;  2LQO A;  1XWA A;  5E59 A;  2V6O A;  2HSH A;  2K9F A;  4XS4 B;  4MF6 A;  2YWM A;  2B7K A;  2EIR A;  2KP2 A;  2I9H A;  1TK8 B;  1BX9 A;  3VPQ A;  1NW2 A;  5G5F A;  5B8A A;  2GSQ A;  2MZC A;  1V58 A;  3G9B A;  3EMP A;  1H4O A;  2X4A A;  1VF2 A;  4ULX A;  3FRC A;  5HFG A;  1XW6 A;  3CYN A;  3HJP A;  2ALB A;  1I9D A;  1GTA A;  4YQU A;  4EF0 A;  5JCW A;  1JZD A;  1AQV A;  2HRK A;  1ON4 A;  2H76 A;  2KHP A;  4PQH A;  3LEF A;  2DC5 A;  3HCZ A;  1TTZ A;  2AJQ B;  2JSY A;  5IPG A;  5DQS A;  2B1K A;  1PMT A;  2YZH A;  3KH7 A;  2CQ9 A;  5A5K A;  1WMJ A;  4NV5 A;  3CTG A;  5H5S A;  3L9U A;  2HNL A;  4O5Q A;  1AQX A;  2JAD A;  3KMO A;  1B48 A;  4NHZ A;  3MSZ A;  4WKW A;  1V9W A;  1I5G A;  3ZRE A;  2B7J A;  3VWW A;  1SL2 B;  2H70 A;  4OO5 A;  1WIK A;  1MEK A;  1QK8 A;  4K7O A;  3C71 A;  1OAZ A;  1O85 A;  3GH9 A;  2FNO A;  2H8L A;  1F3A A;  1IYH A;  1K0B A;  2VCW A;  3D0Z A;  1AXD A;  3CTF A;  2FGX A;  3G7Y A;  2IFQ A;  1PA3 A;  2GQL A;  3QD9 A;  1RQM A;  1YZX A;  5IMV A;  1VGL A;  2KUC A;  3KEB A;  1GUL A;  2YP6 A;  2GT6 A;  5ECP B;  2XPD A;  5J9B A;  3L9V A;  1XVW A;  3DGQ A;  3F3Q A;  1T3B A;  3ZTL A;  11GS A;  4XTS A;  4BVY B;  3H93 A;  3ERG A;  2N5F A;  1A0R P;  2MMN A;  3D5J A;  5ELG A;  4I2T A;  3VK9 A;  5B7C A;  3IRA A;  2HZE B;  2JL4 A;  2B3S A;  3P90 A;  5IQY A;  3CMI A;  5J3R A;  5BMU A;  2G2Q A;  3QCP A;  2C0D A;  1R5P A;  2BMX A;  1G7E A;  1M9B A;  1PGT A;  3IK9 A;  5IO0 A;  1DUG A;  3WD6 A;  4EL1 A;  1B8X A;  1U87 A;  3LG6 A;  1EOG A;  2PMT A;  5LCZ A;  3F4T A;  3FZA A;  3PR8 A;  5IOW A;  4XS6 A;  1ILO A;  3GKM A;  2J9H A;  2DJ3 A;  3CXG A;  4OMV A;  4ZIL A;  1SU9 A;  22GS A;  1J08 A;  3IHG A;  4DEJ A;  1SKR B;  1BED A;  4L0W A;  3KCM A;  2PVQ A;  1DE2 A;  2R2J A;  9GSS A;  3QFA C;  3L4N A;  5F8B A;  5J5N A;  1B4P A;  1SL0 B;  17GS A;  3E3E A;  4MMM A;  3ERF A;  2B1L A;  3FEU A;  13GS A;  4JBB A;  1GUH A;  2A4V A;  3BCI A;  4GQF A;  4IEL A;  4JE1 A;  4AGS A;  4O5U A;  5DAL A;  5GAN D;  5L71 A;  3VI7 A;  2WDU A;  3HJO A;  2FWG A;  3FY7 A;  4NXI A;  3FR9 A;  3GTU B;  2H0G A;  2F51 A;  5CRH A;  1HNC A;  4G0I A;  3KGK A;  4ECJ A;  1M7T A;  5C04 A;  4PNF A;  4NV2 A;  2H0I A;  1GTB A;  2I1U A;  4TW5 A;  3TKP A;  4ZXG A;  2N5A A;  4V2L A;  3OR5 A;  4ISD A;  2HT9 A;  4KUN A;  1MD4 A;  1X5E A;  2IN3 A;  5G30 A;  4BWQ A;  2GSS A;  1G7O A;  3FZ5 A;  4YKF A;  2J23 A;  3QR6 A;  6GSS A;  4G19 A;  4BL7 A;  3A5I A;  3GYK A;  3A2W A;  2RUF A;  4O32 A;  2B6M A;  2C3Q A;  2H6X A;  3HVS A;  3H79 A;  3GHA A;  1SK0 A;  4IW9 A;  1FAA A;  5GZZ B;  2IMI A;  3FYG A;  3HZ4 A;  4TR1 A;  4MPF A;  4N0V A;  3GSS A;  1KBN A;  4TR4 A;  1UA5 A;  5CP1 A;  2V1M A;  2JU5 A;  2WJU A;  4V1A g;  1XVQ A;  1A2M A;  1JZR A;  2VO4 A;  3GH6 A;  3F4S A;  1FB6 A;  3TGZ A;  2LV3 A;  2LNT A;  3IR4 A;  4HJ2 A;  8GSS A;  2WB9 A;  3APS A;  1TRV A;  3HVX A;  2VCQ A;  4X1U A;  3FR3 A;  5E4W A;  2LJA A;  2HLS A;  3WGX A;  5JCU A;  4DSS B;  3GRX A;  1GTU A;  2JZT A;  3VLN A;  5D9V A;  4EVM A;  2H72 A;  4WBJ A;  1TKD B;  5D9X A;  4N30 A;  1PKZ A;  1XOB A;  1OKD A;  3KM6 A;  3M9J A;  4HU9 A;  3ZL5 A;  5H5Q A;  5F05 A;  3M0F A;  5ECQ B;  4KA0 A;  5DCG A;  2F8A A;  3L78 A;  4RI6 A;  4FO5 A;  1SYR A;  2JAC A;  3ZLP A;  4ZB6 A;  2IMK A;  3W8J A;  3KXO A;  4ZB9 A;  2L5L A;  3UOM A;  4IJI A;  4K6X A;  3APO A;  1TI3 A;  2GQM A;  4PQI A;  4EIQ A;  2V32 A;  4EIP A;  2YJH A;  3TKS E;  1SK1 A;  5B6N A;  1ERW A;  3UBL A;  1USB A;  4G2E A;  3F8U A;  3GKK A;  3O3T A;  4X4J A;  5IM9 A;  3GUS A;  4N10 A;  4KDU A;  4KSM A;  1EP8 A;  1EV9 A;  3ZIJ A;  4EKZ A;  4I8B A;  2R6K A;  2CAQ A;  4EDZ A;  1Z6N A;  4FH8 A;  2C3T A;  2C1Y A;  3LFL A;  1IYI A;  4KE3 A;  2CT6 A;  1ACV A;  2L6D A;  3GNJ A;  4LL4 B;  1ZMA A;  3A2V A;  3J7Y b;  1ZGN A;  1R5A A;  1Q98 A;  3QDN A;  2GSR A;  4MH3 A;  3MNG A;  1Z7R A;  1U3A A;  2WGR A;  4PX1 A;  2IJY A;  1JFU A;  2I4A A;  2KOK A;  4NHW A;  4JED A;  1AW9 A;  3E0U A;  1QGV A;  2N5B A;  2FA4 A;  1A0F A;  1T4Y A;  4MLY A;  2YWO A;  2I3Y A;  2YWN A;  3C7M A;  3VUR A;  1ZYQ B;  18GS A;  4IKH A;  5IMD A;  2YJ7 A;  1M2B A;  1S3A A;  1QQ2 A;  2LRC A;  4ZIJ A;  4GXZ A;  2DML A;  3RBT A;  3H8Q A;  1FOH A;  3LW9 A;  2H1G A;  5GAP D;  3DRN A;  5B8B A;  4XHM A;  4KW6 A;  1M2D A;  3QFB C;  2RLI A;  3EC3 A;  1H75 A;  1ZZY A;  2CZ2 A;  3EUR A;  3VWX A;  4YQV A;  1RK4 A;  4Z2U A;  3GA4 A;  4AJ6 A;  2K8S A;  1GUK A;  3M9K A;  3GL3 A;  4CY8 A;  4F82 A;  3CBU A;  3DVX A;  4GWR A;  5CO3 A;  3EPT A;  1A23 A;  4N0Z A;  3KP9 A;  2A2S A;  5G1K A;  3WYW A;  1GNE A;  4V1A p;  2VL9 A;  5ECM B;  4FYC A;  1UN2 A;  2VOC A;  2DJ0 A;  1UVZ A;  1HQO A;  1GWC A;  4ECI A;  4O5R A;  1W89 A;  2H01 A;  2QSI A;  4XRD A;  3IC8 A;  5IPH A;  1OKT A;  4RQX A;  4XS1 A;  2V6K A;  4MCU A;  2VM2 A;  1E2Y A;  3TJB A;  4CY6 A;  1T00 A;  1VF3 A;  6GSV A;  4HOJ A;  16GS A;  1ERV A;  3FZ9 A;  5IOX A;  1M2A A;  3H4K A;  4JRR A;  2E2G A;  1YF0 A;  4L0U A;  3G7J A;  3KZQ A;  1R7H A;  4PUA A;  3RPN A;  1PRX A;  5DAK B;  3APQ A;  3FZ4 A;  1XW5 A;  2AB6 A;  3KTL A;  2MBS A;  1WRY A;  4GCI A;  1TP9 A;  6GSW A;  2V41 A;  1XWG A;  1EZK A;  4F0B A;  5ECL B;  2DJ2 A;  5HQP A;  5KN2 A;  1QFN A;  4WET A;  3MIX A;  3IC4 A;  4KGI A;  1HYU A;  3VPT A;  3TRQ A;  2VUP A;  1Z5Y E;  2L59 A;  2VLT A;  1PN0 A;  1XPV A;  1FB0 A;  1HNB A;  4Q5N A;  2B5E A;  1DSB A;  4V2N A;  1GSE A;  3L9S A;  4JU5 A;  2K8V A;  1XCC A;  2PPT A;  1U6T A;  3Q18 A;  1NSW A;  1YKC A;  2DKI A;  2UZ8 A;  4D73 A;  4ECB A;  2IPA A;  2TIR A;  4WBR D;  3HXS A;  3ERW A;  4MZW A;  4G9H A;  4RI7 A;  4K5S A;  3UL3 A;  4PQ1 A;  2WFC A;  2IMD A;  2DJJ A;  14GS A;  1T4Z A;  1X5D A;  2MYG A;  5HR0 A;  4F0C A;  3M1G A;  4IQ1 A;  3F63 A;  2IIY A;  2YV9 A;  3PH9 A;  2BJX A;  2VD1 A;  3IA1 A;  4HZ4 A;  5ENU A;  3FHK A;  3D22 A;  3EU3 A;  2P31 A;  4NPB A;  1LJR A;  3TCO A;  1XOA A;  4GF0 A;  3GFK A;  1XFL A;  3D6I A;  2GVP A;  3HHV A;  1TJD A;  1AAZ A;  2IWT A;  4KDX A;  5EY6 A;  4QQ7 A;  1OYJ A;  2FWH A;  3DYR A;  2LQQ A;  5IMC A;  3GTU A;  2RUE A;  1DBY A;  3BCK A;  5C00 A;  3KH9 A;  1GRX A;  4GLT A;  4L5L A;  4K5R A;  3TOT A;  2WUL A;  5JCG A;  1K0A A;  3F6D A;  3PPU A;  4H86 A;  6GST A;  1N2A A;  2QKE A;  4F2I A;  3ZVJ D;  4IBP A;  2MMA A;  3GMF A;  4BVX B;  2X64 A;  4IQA A;  2QC7 A;  3P2A A;  3O6T A;  5ID2 A;  1KEB A;  5ABR A;  4I97 A;  2JZS A;  4OD7 A;  2CA8 A;  2BTO T;  1R26 A;  2CVD A;  4Q5Q A;  2C4J A;  5AIS A;  3TRP A;  4MP4 A;  5CYY A;  1K3O A;  2AYT A;  2GDR A;  2E0Q A;  2H19 A;  3DKS A;  4KH7 A;  4MA9 A;  2LNS A;  1THO A;  1BJX A;  2FA8 A;  2REM A;  2H30 A;  5GST A;  5CAX A;  1URM A;  2P5R A;  1J9B A;  1BQ7 A;  2OBK A;  3R2Q A;  5D93 A;  1A2L A;  1OC8 A;  4F9Z A;  3GKN A;  3FR6 A;  3KP8 A;  4TVE A;  5D9T A;  3UIW A;  3TDG A;  2ES7 A;  3D21 A;  4HDE A;  4POL A;  3BD2 A;  2A2R A;  2E7P A;  1M9A A;  1VRS D;  3ED3 A;  3TRX A;  1B4Q A;  1WJK A;  3TKS A;  1M0U A;  2YWI A;  1EGO A;  2M72 A;  4E8H A;  4OFN A;  1OVN A;  2NDO A;  4I5Q A;  4CW9 A;  1K0D A;  4MF5 A;  1G0T A;  3VWU A;  4GRF A;  3LYK A;  2IFQ B;  3P8W A;  2K6V A;  4IS0 A;  2H66 A;  4PUR A;  4PTS A;  5G2Z A;  2HZF A;  5DQY A;  4HUA A;  3BBY A;  1ZCP A;  1PKW A;  4ZL8 A;  1YJ6 A;  2B5X A;  2VIM A;  5FHI A;  2V2G A;  20GS A;  5DVB A;  2VLU A;  1XZO A;  4FIW A;  1CQH A;  2HFD A;  4E8E A;  1F37 A;  2NVL A;  4K9Z A;  3ZIT A;  3EU4 A;  2XC2 A;  4J56 E;  4IP1 A;  2QA1 A;  3GST A;  1EP7 A;  4MJA A;  3LGC A;  2HSM A;  3K8N A;  4V2M A;  1EGR A;  1OC9 A;  2CAI A;  1GP1 A;  1PQN A;  5J41 A;  2VL3 A;  3IXR A;  1FVJ A;  2HXK A;  4TXO A;  1TRW A;  2GS3 A;  3AY8 A;  1GLP A;  4HZ2 A;  2VL2 C;  4K2D A;  2H1B A;  3IE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...