2QKEA

Wild type crystal structure of full length circadian clock protein kaib from thermosynechococcus elongatus bp-1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
98
structure length
98
Chain Sequence
MAPLRKTYVLKLYVAGNTPNSVRALKTLNNILEKEFKGVYALKVIDVLKNPQLAEEDKILATPTLAKVLPPPVRRIIGDLSNREKVLIGLDLLYEEIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Circadian clock protein kaiB
publication title Structural model of the circadian clock KaiB-KaiC complex and mechanism for modulation of KaiC phosphorylation.
pubmed doi rcsb
molecule tags Circadian clock protein
total genus 21
structure length 98
sequence length 98
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07689 KaiB KaiB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2qkeA00
1K0OA 2DIYA 5DAKB 4LL4B 2YZHA 3F6DA 5AIVA 3RBTA 3L4NA 1A2MA 2CAIA 2L57A 2R4VA 4G2EA 1B4PA 5EPFA 1PMTA 1SD8A 1PGTA 1A2JA 2NVLA 4MABA 1XW6A 1HNAA 4IN0A 2FA8A 4GF0A 5G5FA 3CSHA 3OR5A 3A2WA 1O73A 4JU5A 2VLUA 1ZZYA 3LG6A 4IHUA 2L5LA 1O8WA 3CBUA 3H4KA 1K0DA 2AAWA 1ERUA 2OADA 4ZBDA 3U6VA 3TJKA 1ZYEA 1ERTA 3QAGA 2B3SA 2H70A 1NW2A 5B8BA 5COHA 1PA3A 4IVFA 5C00A 3ZVJA 5ECOB 2L4CA 3J7Yk 1V57A 3JCML 3Q74A 1Z6MA 3CTGA 2IMFA 3KZQA 5JCGA 4TXVA 5ECNB 3VLNA 3EMXA 3D6IA 3N9JA 5F06A 4L5OA 4TR4A 3EYTA 2ZNMA 4GSTA 3FZ5A 2GTUA 4ML6A 2V1MA 4K9ZA 4EVMA 1XWAA 2ZCTA 5KN0A 1YY7A 1EV4A 3VURA 4PNFA 3TDGA 1JZDA 3IC4A 4OMVA 5J3RA 3DEXA 2LUSA 4PQIA 2H1AA 3APSA 4BL7A 4DSQA 4D73B 3IA1A 2H66A 3N5OA 4MP4A 2TRXA 6GSVA 2AYTA 1R7HA 2JZSA 4TRXA 4HQSA 2QGVA 1U6TA 2H72A 1FW1A 3QPMA 4V1Ap 5B8AA 3ZFLA 3UARA 2IPAA 2VL2C 5HR1A 5J9BA 5DALA 3Q19A 3L9VA 2ALBA 3ME7A 1GSFA 3LQ7A 2AJQB 2A2SA 2KP1A 2B1LA 2IMIA 3ZIVA 2ON5A 4TXOA 1G7EA 5DVBA 2F8AA 1NHOA 4GRFA 1OYJA 3HVVA 3WGXA 2FWGA 1SKSB 2H73A 2CA8A 4ZB6A 5E4WA 2PERA 4NWYA 2HFDA 1WJKA 2LRTA 4XS6A 2H1BA 1K0BA 3GTUA 1JZRA 4DVCA 2LS5A 4CW9A 5IMCA 3GUSA 5GSTA 3FR9A 4ULXA 3HHVA 4N30A 1XCCA 3RPNA 1QXHA 2VCQA 5IPHA 2WRTA 1EGOA 2FHEA 3TKSE 4PURA 1TRVA 1EOHA 2OBIA 1QMVA 2C1YA 4HZ4A 3O3TA 1PN9A 1T4YA 1OE7A 1XFLA 2K8SA 3FZ4A 1GSQA 3V1WA 3TJJA 4JE1A 1Z7RA 2OE0A 5FWGA 2O8VB 4NXIA 4RQXA 1I9DA 3IBHA 18GSA 2L6CA 3HJMA 1F9MA 4TVEA 4JR4A 4TR3A 1TW9A 1MEKA 1V9WA 4TW5A 1J0FA 1UVZA 1M2BA 3VWWA 2B1KA 3M1GA 4FYBA 3IR4A 3FZAA 2GS3A 3VWXA 1WIKA 5DJLA 2H0GA 5ECSA 1SYRA 2FGXA 3UEMA 1MDKA 4EDYA 4TOPA 3VPQA 2OE3A 3A2VA 3FYGA 2KHPA 2FWFA 4XS4B 4HI7A 2WS2A 3RAZA 2VM2A 2LRCA 2VCZA 3DVWA 2I9HA 2F9SA 3KTLA 4DSSB 2AUVA 5IMZA 1R5PA 3TCOA 3M9KA 2C3QA 2RIIA 3FHKA 3QAVA 1WOUA 4MH3A 1GSUA 5ID2A 1NSWA 1V2AA 3D21A 4MZWA 2MMOA 2YV9A 3EWLA 5A5KA 1O85A 2DJ2A 4TR1B 1VF4A 1M2DA 5FHIA 1GTUA 2QC7A 2WCIA 4KDXA 3HYPA 20GSA 4ZB9A 1ILOA 3F4TA 3HZ4A 2PMTA 2FCHA 3GYKA 2GLRA 5CYYA 1PQNA 2MBSA 1GNEA 3ZREA 2JADA 4BWSA 1SL0B 1EP8A 1SK2A 2V41A 1X5CA 1BG5A 1VGLA 3E0UA 4F9ZA 2WJUA 4JZQA 1AC1A 2P0GA 4KB3A 2FY6A 4ACSA 4J57E 3UVTA 1R26A 2R6KA 4BPYA 4I97A 2GDRA 4MDCA 5CRHA 3TGZA 1X9SB 3F6FA 4EXJA 12GSA 3VK9A 5LD0A 3NZNA 2H19A 2X8CA 1GLQA 5AGYA 2VCVA 22GSA 3LFLA 1AQWA 2GGTA 1AQXA 2E0QA 4KDYA 5HFKA 5KN3A 2KUCA 3LJRA 5AIXA 5IIZA 1KEBA 2K8VA 2HYXA 13GSA 3NIVA 3CRUA 1VF3A 4L0WA 2H6YA 3HVXA 9GSSA 3ERWA 1OC3A 6GSWA 1XW9A 2I4AA 4BVYA 4OWYA 4ID0A 5IOWA 1K0NA 2F8FA 4AJ6A 3QOUA 5D9WA 2I1UA 4EUYA 1T00A 1KTEA 2DJKA 2Z9SA 2IFQA 1E2YA 4O5RA 2IMEA 4BWQA 3TJGA 3G9BA 3EU3A 1O7UA 1SL2B 3FY7A 2A4VA 5CRGA 2J23A 3FW2A 3FZ9A 2LSTA 2L6DA 1GTAA 1AIUA 2JU5A 1W89A 2LJAA 4P3YB 4KGIA 2C4JA 3G7IA 2B6MA 3AY8A 2X64A 3SBCA 1VF1A 1ZL9A 1SD9A 4KW6A 1F6MC 3IXRA 4LMVA 5DDLA 2H6ZA 2H76A 5G5EA 3GN3A 5B7CA 1HD2A 1OAZA 4H86A 3TRQA 3HCZA 5C04A 4F0CA 1YKCA 4NAXA 2LTKA 1TXXA 1JLWA 3GX8A 3EE2A 4HEA2 6GSSA 5KEJA 1OVNA 4FIWA 3R2QA 3LXZA 4I8BA 1XWKA 3HD5A 2F3MA 2HZEA 4AGSA 4F82A 2JSZA 2G2QA 3D22A 3LORA 3CSJA 2H01A 3GURA 2RUFA 2AB6A 1BYEA 3GKNA 3TKPA 3ZZXA 4MK3A 1F3AA 2C3TA 3EMPA 2VL2A 2PU9C 2GVPA 2MMZA 1DUGA 4K0GA 2YPMA 4XTSA 2LNSA 2K6VA 3H1NA 1GUHA 1FVKA 1TK5B 1S3CA 2KP2A 4X1UA 1XWGA 2YJHA 2TIRA 4Q5RA 3P8WA 5JCWA 3HJOA 5F05A 2XBIA 3GL3A 1HYUA 2N5BA 1IYIA 2H75A 3L78A 1ST9A 2BJXA 3UIWA 2L5OA 6GSTA 4GQCA 5DQYA 5EL8A 3TKQA 2GSQA 2R5GA 3C7MA 2YZUA 3HVSA 4LLRA 4MMMA 5HFIA 4PUAA 3WGDA 3KMOA 7GSSA 1Z7PA 3W8SA 1X5DA 3QMXA 1OC8A 1XVQA 2GT5A 3BOAA 4G9HA 1T4ZA 5HR0A 1C72A 4MA9A 3P2AA 2FWHA 3LWAA 4ZL8A 1JLVA 3A2XA 4MPFA 3GH6A 8GSSA 5IMFA 1GSSA 4PUFC 3F4RA 5DAKA 4IBPA 1XVWA 2YN1A 1XPVA 4X0XA 1LBKA 3HY2A 2HLSA 5IO2A 1QGVA 1URMA 3PR8A 3ERFA 4CHSA 1Y25A 2RM6A 3EVIA 1AW9A 1OKTA 1M9AA 3IK7A 4XIHA 2OA7A 1TJDA 3DYRA 4TN8A 5ELAA 5A4VA 2QKEA 1XBSA 2H6XA 4NPBA 2VL3A 5JCUA 4KSOA 3TJBA 4GSSA 4K0NA 1F3BA 5HQPA 2FNOA 1RQMA 1XWCA 2VCWA 3F8UA 1WPIA 4GSNA 2GQMA 3ZFBA 5A4WA 4MH2A 4EL1A 1MD3A 4ECIA 5HFGA 3EURA 3FK8A 1M99A 4EKZA 3I69A 3ZITA 3GNJA 3IPZA 4JR6A 2IMKA 4TXOB 1U3IA 4GLTA 3F3QA 1B48A 2XPDA 4KSMA 3L0HA 4KAEA 1Z6NA 3ZIJA 3PGTA 1GULA 1Z3EA 1EEMA 4ECJA 1FG4A 2DJ3A 3GA4A 2LQOA 5D93A 3GX0A 3KXOA 1SK1A 3GH9A 3C73A 5J41A 3GTUB 4N11A 2IN3A 3H79A 4KCAA 4K8MA 2YANA 1YDKA 3EU4A 3ZRDA 1GWCA 2WZ9A 1E6BA 1DBYA 1GLPA 2LV3A 1DE1A 1LU4A 3C1RA 2VCXA 3GSTA 1THOA 1AXDA 5F07A 3ZVJD 2PWJA 1PKWA 4WF4A 3HZ8A 4ZILA 3UVHA 2DC5A 4KDUA 2RM5A 1SENA 4V2LA 3TKRA 4KH7A 3VI5A 2X8GA 2VOCA 1N8JA 5GZZB 3G7JA 2MBTA 2OACA 1THXA 3UJ1A 1Q4JA 4F03A 4O32A 1U88A 4IQ1A 5IMDA 1A0RP 3W8JA 1PKZA 4PXOA 5IMAA 1TU8A 3FEUA 1SKRB 3DMLA 2REMA 3F3RA 5DCHA 3KMNA 1UN2A 4GTUA 3F63A 3E3EA 4TR0A 1GRXA 5ECLB 4WBRD 4ECBA 3VWUA 1HNCA 4GWRA 2KLXA 5H5SA 3QAWA 4MLYA 1MTCA 2NDOA 2FUG2 4OO5A 4OD7A 4KX4A 3KP8A 2LJRA 2OE1A 1X0RA 2DLXA 2IWTA 2LEGA 4HUAA 3WT2A 3MSZA 1PD21 3O6TA 2HRFA 4PQHA 1JHBA 1QQ2A 1K3YA 1M2AA 5D9TA 2VLVA 5J4UA 1SU9A 5ABRA 4NMUA 3D4TA 3DVXA 3TJFA 3C1SA 2B7JA 2CVDA 3I9V2 2DSAA 2PGTA 3CSIA 1M0UA 2HE3A 1B4QA 2IL3A 2VCTA 1KNGA 4WETA 2IIYA 3CRTA 1EEJA 4EF0A 3QFBC 14GSA 3C8EA 3F4SA 4IKHA 4NV2A 1GUMA 3ISOA 3TOTA 2TRCP 5G1KA 4MZCA 1M9BA 2V32A 4MF5A 3GSSA 4XS4A 2FWEA 4IS0A 3KM6A 1DE2A 4K7NA 2HT9A 3A3TA 2I81A 2FLSA 3DKSA 2J9HA 1V98A 2XPEA 3IK9A 4YQVA 4NV5A 5IQYA 2JACA 2HXKA 2JSYA 4PQ1A 3UBKA 1A24A 1X9MB 1GSYA 2IJYA 2B5EA 4TR1A 3VFIA 2C0DA 11GSA 2WDUA 3QDNA 4OCFA 3ZMLA 2R3XA 2IFQB 1GUKA 4RUVA 3LXTA 4IQAA 4V1Ag 5ECPB 2DJ1A 2GZYA 1TP9A 2WGRA 1Q98A 3D4MA 2DIZA 3HJPA 1GL8A 4MPGA 4Q5NA 2R37A 1VRSD 1BX9A 4ZBAA 3I6AA 1QUWA 1H4OA 1T7PB 2DMLA 2M72A 3TOUA 5F0GA 3GIXA 1XXUA 1G7OA 4EDZA 3KH7A 1YQ1A 5AISA 2PBJA 4KA0A 5CP1A 1GSDA 3MDKA 1A8YA 2FD3A 1R5AA 3BD2A 2VD0A 4WBJA 3J7Yb 2P31A 2B5XA 2PVOC 2C0GA 5EY6A 2LQQA 2JL4A 2C0EA 1QFNA 2YCDA 4IELA 1ZCPA 2HZEB 5DQSA 5ECQB 5F8BA 4GXZA 4L5LA 2GZPA 3CYNA 4QL7A 3LGCA 1K3OA 3H93A 4ZIJA 4Q5FA 4FYUA 3ED3A 4NHZA 2BMXA 2DJJA 1F2EA 4I6XA 2YWNA 3EINA 3RDWA 5ECKB 2KOKA 2H1DA 1YF1A 1R4WA 4Z7XA 4MZBA 5IPGA 2H30A 1XOBA 1ZYQB 2RUEA 2PPTA 3UAPA 2MYGA 4E8HA 1NM3A 2C80A 1EGRA 5HR3A 3MNGA 3LYKA 1B9YC 2YJ7A 3BJ5A 4N0VA 4AJ7A 1O8XA 2E7PA 4J2FA 3DRNA 1OC9A 3L9SA 3US3A 2VIMA 1WMJA 1ABAA 4HZ2A 1T3BA 1TI1A 4GCIA 1W4VA 1YJ6A 2ES7A 4G19A 2GZZA 2LJKA 1TKDB 1ML6A 3GKXA 2O7KA 5J5NA 2XHFA 3BBYA 5AN1A 5CREA 2HSYA 3KEBA 4I2TA 1H75A 1Z9HA 5E59A 1PL1A 2VL9A 4KUNA 4CDOA 2CAQA 3M9JA 2GSTA 2JZRA 1UC7A 4O92A 1NHYA 1V58A 4YQUA 4IW9A 3GFKA 3CMIA 5CO3A 4X43A 2YOIA 4IP6A 1AUCA 4HJ2A 4E8EA 1B9XC 5CNWA 1SJ6A 1GTIA 4IP1A 2OBKA 4V2MA 2H8LA 2LKUA 2F51A 1HNBA 4RI7A 4MJCA 5CRDA 2CX3A 4F0BA 4MJAA 3DXBA 2EIRA 1ZOFA 17GSA 2H1GA 2RLIA 2CVBA 4KCEA 1SKWB 1MD4A 4MCUA 3M0FA 1EOGA 3GRXA 2DMMA 1ZMAA 2JZTA 5G1LA 5ELGA 2DBCA 2P5RA 1LJRA 4K7IA 3UBLA 2WFCA 2B5YA 3KCMA 2HSHA 1OE8A 2WB9A 2HRNA 1GNWA 5FT3A 1TRUA 3WT1A 1EZKA 1JZOA 5KN1A 2M46A 1V40A 2MMAA 1TOFA 3LEFA 1FOVA 4WEYA 1GTBA 4BA7A 3FR6A 2ZUPA 4ZL9A 4LMWA 2CVKA 1XW5A 1UA5A 1XIYA 2N5AA 4XS1A 1TRWA 1XOAA 3L9UA 4MJBA 4YQMA 5DALB 3P90A 1CQHA 4POKA 6GSUA 2VM1A 4N0ZA 3LSZA 5D9VA 2O87A 1BJXA 3IRAA 2EIQA 4J56E 4YAPA 5ECMB 5B6NA 3DIEA 1G6WA 1Y6EA 1IYHA 5HR2A 4JRRA 4MJEA 5G2ZA 4K2DA 4FYCA 3CTFA 4ECCA 3TKSC 3RHBA 2NPBA 1WRYA 3H8QA 4WR5A 3RHCA 3BCIA 4WKWA 1TDIA 3ME8A 2M80A 3CXGA 3IAS2 1PRXA 3KIJA 5ECRB 3TRPA 2GSSA 3O76A 1AQVA 3SWLA 5H5QA 4EE0A 4ISDA 3HDCA 4WXTA 4EO3A 3Q18A 4D73A 3D5JA 1FVJA 1MDJA 4F2IA 1QK8A 2WULA 3KJYA 2V2GA 3IOSA 1J08A 1G0TA 3VWVA 4RI6A 3PH9A 5GAPD 1B8XA 1PL2A 3VPTA 2VAFA 1PSQA 2CQ9A 2MZCA 1U3AA 2CT6A 3APOA 5INYA 4RQRA 1ZGNA 2VO4A 2BTOT 2CZ2A 4HDEA 1AAZA 3U5RE 1TK8B 1TTZA 4KNDA 3TB2A 3QD9A 5IO0A 4K6XA 2X99A 2I3YA 1SK0A 1J9BA 3P7XA 3KGKA 3IHQA 4QL9A 1FO5A 3K8NA 5ECHB 4LL1B 1TK0B 2K9FA 3UL3A 4QQ7A 2YWOA 3EC3A 4WF5A 2H0HA 1O6JA 3GL5A 2H0IA 4V2NA 2E2MA 2H74A 3ZMKA 4XRDA 5LCZA 1T1VA 5ID2B 2C8UA 5A4UA 1PX7A 3TUEA 1A2LA 4MF6A 1TU7A 5IOXA 2E2GA 2VD1A 3G7YA 2K18A 4PNGA 1YKAA 1FHEA 2YWIA 4IJ3A 4BVXA 3WYWA 3QCPA 5DJMA 4HU9A 3ZTLA 1K0AA 2H71A 3IDVA 1XZOA 1PX6A 2PUKC 3M8NA 1BQ7A 4ZXGA 1BAYA 3D0ZA 4ML1A 4OFTA 5ECIB 4PGTA 2X8HA 1I5GA 1ERWA 2AV4A 2CZ3A 3A5WA 3IE3A 3I43A 2FA4A 3BCKA 4POBA 5G31A 3C71A 1EV9A 2NTOA 1G6YA 3ZL5A 3APQA 3KD0A 4MF7A 5D96A 1X5EA 5DCGA 5GSSA 2MMNA 3E9JB 4K1FA 4Q5QA 4ILFA 1N2AA 4XHMA 5D9XA 1CQGA 1SL1B 4DSRA 4OFNA 1M7TA 3ZLPA 2OJLA 3NOFA 4I5QA 5L71A 3GKMA 4ZBBA 2G0FA 2QSIA 1WP0A 1RW1A 1VF2A 3QR6A 1SJIA 5JWOB 4DSSA 2YNXA 1RK4A 2GQLA 2LNTA 4KE3A 3QFAC 4EC0A 4AF2A 5D8IA 2DJ0A 3RPPA 1FB6A 5JWQB 1USBA 4IJIA 2N5FA 2B7KA 3GV1A 2GQKA 4XCSA 2XBQA 3W6GA 1K0MA 3WD6A 1FAAA 1EWXA 5DBQA 5EVOA 4YAVA 4AJ8A 1ACVA 4PX1A 3PINA 5J9CA 2L4QA 1S3DA 4HOJA 1TRSA 4POMA 3IAM2 6GSXA 1KBNA 1XWBA 1TI3A 4HU7A 2HI7A 1F37A 3MAKA 1U87A 1A8LA 1WWJA 16GSA 1FB0A 2O89A 1SYXA 1K3LA 1YEXA 1ON4A 4TKYA 2EIOA 1DSBA 3DGQA 19GSA 1HQOA 1A0FA 3GMFA 3M3MA 4YH2A 2EC4A 2CX4A 2YV7A 3MWHA 5CRWA 2CV4A 1X9WB 5H5RA 5KN2A 3HXSA 2XC2A 2GT6A 2IMDA 2HZFA 3HA9A 5D73A 4G10A 2C0FA 5G30A 4DEJA 1S3AA 2D2ZA 4K7OA 3ERGA 2NBSA 3LYPA 1OC9B 2R2JA 1BEDA 5CAXA 1YEPA 1O81A 3ZYWA 2PN8A 3KP9A 10GSA 4OO4A 2GSRA 3IV4A 4WR4A 3TRXA 1SJZA 2V6OA 2YP6A 3DWVA 4HJMA 4NHWA 1Z5YE 3VI7A 1T8EB 5IM9A 4N10A 4OFMA 5IMVA 5GAND 2P5QA 1EP7A 4JBBA 4XRAA 3FKFA 1YF0A 2ON7A 3GHAA 4FO5A 3DD3A 2YWMA 1GP1A 3FR3A 2LRNA 2VLTA 4HS1A 4POLA 2PVQA 2HNLA 5JWRB 3TKSA 3F9UA 3KTBA 4LA1A 3WGEA 2L59A 5B6MA 1A23A 4ZL7A 2A2RA 4HQZA 4OCEA 2VUPA 4FH8A 4I2UA 2AHEA 2V6KA 4JEDA 2OKAA 4GQFA 3F0IA 5LNKe 3GKKA 1ERVA 3UOMA 1GSEA 1JFUA 4O7HA 3KH9A 1JZWA 1OKDA 3HKRA 1WE0A 1K0CA 1MDIA 4ZB8A 4IGJA 1YZXA 2O85A 3S9FA 3UMAA 2C3NA 1GH2A 4L8EA 3Q6OA 5ENUA 4L0UA 6GSYA 3FRCA
chains in the Genus database with same CATH superfamily
1K0OA 2DIYA 5DAKB 4LL4B 2YZHA 3F6DA 5AIVA 3RBTA 3L4NA 1A2MA 2CAIA 2L57A 2R4VA 4G2EA 1B4PA 5EPFA 2HRAA 1PMTA 1SD8A 1PGTA 1A2JA 2NVLA 4MABA 1XW6A 1HNAA 4IN0A 2FA8A 4GF0A 5G5FA 5BMUA 3CSHA 3OR5A 3A2WA 1O73A 4JU5A 2VLUA 1ZZYA 3LG6A 4IHUA 2L5LA 1O8WA 3CBUA 3H4KA 2A2PA 1K0DA 2AAWA 1ERUA 2OADA 4ZBDA 3U6VA 3TJKA 1ZYEA 1ERTA 3QAGA 2B3SA 2H70A 1NW2A 5B8BA 5COHA 1PA3A 4IVFA 5C00A 3ZVJA 5ECOB 2L4CA 3J7Yk 1V57A 3JCML 3Q74A 1Z6MA 3CTGA 2IMFA 3KZQA 5JCGA 4TXVA 5ECNB 1S3RA 3VLNA 3EMXA 3D6IA 3N9JA 5F06A 4L5OA 4TR4A 3EYTA 2ZNMA 4GSTA 3FZ5A 2GTUA 4Z2RA 4ML6A 2V1MA 4K9ZA 4EVMA 1XWAA 2ZCTA 5KN0A 1YY7A 1EV4A 3VURA 4PNFA 3TDGA 1JZDA 3IC4A 4OMVA 5J3RA 3DEXA 2LUSA 4PQIA 2H1AA 3APSA 4BL7A 4DSQA 4D73B 3IA1A 2H66A 3N5OA 5BRTA 4MP4A 2TRXA 6GSVA 2AYTA 1R7HA 2JZSA 4TRXA 4HQSA 2QGVA 1U6TA 2H72A 1FW1A 3QPMA 4V1Ap 5B8AA 3ZFLA 3UARA 2IPAA 2VL2C 5HR1A 5J9BA 5DALA 3Q19A 3L9VA 2ALBA 3ME7A 1GSFA 3LQ7A 4CY8A 2AJQB 2A2SA 2KP1A 2B1LA 2IMIA 3ZIVA 2ON5A 4TXOA 1G7EA 5DVBA 2F8AA 1NHOA 4GRFA 1OYJA 3HVVA 3WGXA 2FWGA 1SKSB 2H73A 2CA8A 1PN0A 4ZB6A 2DKHA 5E4WA 2PERA 4NWYA 2HFDA 1WJKA 2LRTA 4XS6A 5KOWA 2H1BA 1K0BA 3GTUA 1JZRA 4DVCA 2LS5A 4CW9A 5IMCA 3GUSA 5GSTA 3FR9A 4ULXA 3HHVA 4N30A 1XCCA 3RPNA 1QXHA 2VCQA 5IPHA 2WRTA 1EGOA 2FHEA 3TKSE 4PURA 1TRVA 1EOHA 2OBIA 1QMVA 2C1YA 4HZ4A 3O3TA 1PN9A 1T4YA 1OE7A 1XFLA 2K8SA 3FZ4A 1GSQA 3V1WA 3TJJA 4JE1A 1Z7RA 2OE0A 4Z2UA 5FWGA 2O8VB 4NXIA 3HVNA 4RQXA 1I9DA 3IBHA 18GSA 2L6CA 3HJMA 1F9MA 4TVEA 4JR4A 4TR3A 1TW9A 1MEKA 1V9WA 4TW5A 1J0FA 1UVZA 1M2BA 3VWWA 2B1KA 3M1GA 4FYBA 3IR4A 3FZAA 2GS3A 3VWXA 1WIKA 5DJLA 2H0GA 5ECSA 1SYRA 2FGXA 3UEMA 1MDKA 4EDYA 4TOPA 3VPQA 2OE3A 3A2VA 3FYGA 2KHPA 2FWFA 4XS4B 4HI7A 2WS2A 3RAZA 2VM2A 2LRCA 2VCZA 3DVWA 2I9HA 2F9SA 3KTLA 4DSSB 2AUVA 5IMZA 1R5PA 3TCOA 3M9KA 2C3QA 2RIIA 3FHKA 3QAVA 1WOUA 4MH3A 1GSUA 5ID2A 1NSWA 1V2AA 3D21A 4MZWA 2MMOA 2YV9A 3EWLA 5A5KA 1O85A 2DJ2A 4TR1B 1VF4A 1M2DA 5FHIA 1GTUA 2QC7A 2WCIA 4KDXA 3HYPA 20GSA 4ZB9A 1ILOA 3F4TA 3HZ4A 2PMTA 2FCHA 3GYKA 2GLRA 5CYYA 1PQNA 2MBSA 1GNEA 3ZREA 2JADA 4BWSA 1SL0B 1EP8A 1SK2A 2V41A 1X5CA 1BG5A 1VGLA 3E0UA 4F9ZA 2WJUA 4JZQA 1AC1A 2P0GA 4KB3A 2FY6A 4ACSA 4J57E 3UVTA 1R26A 2R6KA 4BPYA 4I97A 2GDRA 4MDCA 5CRHA 3TGZA 1X9SB 3F6FA 4EXJA 12GSA 3VK9A 5LD0A 3NZNA 2H19A 2X8CA 4G0IA 1GLQA 5AGYA 2VCVA 22GSA 3LFLA 4G0KA 1AQWA 2GGTA 1AQXA 2E0QA 4KDYA 5HFKA 5KN3A 2KUCA 3LJRA 5AIXA 5IIZA 1KEBA 2K8VA 2HYXA 13GSA 3NIVA 3CRUA 1VF3A 4L0WA 2H6YA 3HVXA 9GSSA 3ERWA 1OC3A 6GSWA 1XW9A 2I4AA 4BVYA 4OWYA 4ID0A 5IOWA 1K0NA 2F8FA 3EPTA 4AJ6A 3QOUA 5D9WA 2I1UA 4EUYA 1T00A 1KTEA 2DJKA 2Z9SA 2IFQA 1E2YA 4O5RA 2IMEA 4BWQA 3TJGA 3G9BA 3EU3A 1O7UA 1SL2B 3FY7A 2A4VA 3LW9A 5CRGA 2J23A 3FW2A 3FZ9A 2LSTA 2L6DA 1GTAA 1AIUA 2JU5A 1W89A 2LJAA 4P3YB 4KGIA 2C4JA 3G7IA 2B6MA 3AY8A 2X64A 3SBCA 1VF1A 1ZL9A 1SD9A 4KW6A 4O5QA 1F6MC 3IXRA 4LMVA 5DDLA 2H6ZA 2H76A 5G5EA 3GN3A 5B7CA 1HD2A 1OAZA 4H86A 3TRQA 3HCZA 5C04A 4F0CA 1YKCA 4NAXA 2LTKA 1TXXA 2R0PA 3MIXA 1JLWA 3GX8A 3EE2A 4HEA2 6GSSA 5KEJA 1ZYNA 1OVNA 4FIWA 3R2QA 3LXZA 4I8BA 1XWKA 3HD5A 2F3MA 2HZEA 4AGSA 4F82A 2JSZA 2G2QA 3D22A 3LORA 3CSJA 2H01A 4YKFA 3GURA 2RUFA 2AB6A 1BYEA 3GKNA 3TKPA 3ZZXA 4MK3A 1F3AA 2C3TA 3EMPA 3PPUA 2VL2A 2PU9C 2GVPA 2MMZA 1DUGA 4K0GA 2YPMA 4XTSA 2LNSA 2K6VA 3H1NA 1GUHA 1FVKA 1TK5B 1S3CA 2KP2A 4X1UA 1XWGA 2YJHA 2TIRA 4Q5RA 3P8WA 4EIPA 5JCWA 3HJOA 5F05A 2XBIA 3GL3A 3R3EA 1HYUA 2N5BA 1IYIA 2H75A 3L78A 1ST9A 2BJXA 3UIWA 2L5OA 6GSTA 4GQCA 5DQYA 5EL8A 3TKQA 2GSQA 2R5GA 3C7MA 2YZUA 3HVSA 4LLRA 4USSA 4MMMA 5HFIA 4PUAA 3WGDA 3KMOA 7GSSA 1Z7PA 3W8SA 1X5DA 3QMXA 1OC8A 1XVQA 2GT5A 3BOAA 4G9HA 1T4ZA 5HR0A 1C72A 4MA9A 3P2AA 2FWHA 3LWAA 4ZL8A 1JLVA 3A2XA 4MPFA 3GH6A 8GSSA 4EIQA 5IMFA 1GSSA 4PUFC 3F4RA 5DAKA 4IBPA 1XVWA 2YN1A 1XPVA 4X0XA 1LBKA 3HY2A 2HLSA 5IO2A 1QGVA 1URMA 3PR8A 3ERFA 4CHSA 1Y25A 2RM6A 3EVIA 1AW9A 1OKTA 1M9AA 4MNNA 3IK7A 4XIHA 2OA7A 1TJDA 5KOXA 3DYRA 4TN8A 5ELAA 5A4VA 2QKEA 1XBSA 2H6XA 4NPBA 2VL3A 5JCUA 4KSOA 3TJBA 4GSSA 4K0NA 1F3BA 5HQPA 2FNOA 1RQMA 1XWCA 2VCWA 3F8UA 1WPIA 4GSNA 2GQMA 3ZFBA 5A4WA 2QA2A 4MH2A 4EL1A 1MD3A 4ECIA 5HFGA 2A4HA 3EURA 3FK8A 1M99A 4EKZA 3I69A 3ZITA 3GNJA 3IPZA 4JR6A 2IMKA 4TXOB 1U3IA 4GLTA 3F3QA 1B48A 2XPDA 4KSMA 3L0HA 2DKIA 4KAEA 1Z6NA 3ZIJA 3PGTA 1GULA 1Z3EA 1EEMA 4ECJA 1FG4A 2DJ3A 3GA4A 2LQOA 5D93A 3GX0A 3KXOA 1SK1A 3GH9A 3C73A 5J41A 3GTUB 4N11A 2IN3A 3H79A 4KCAA 4K8MA 2YANA 1YDKA 3EU4A 3ZRDA 1GWCA 2WZ9A 1E6BA 1DBYA 1GLPA 2LV3A 1DE1A 1LU4A 3C1RA 2VCXA 3GSTA 4K5SA 1THOA 1AXDA 1FOHA 5F07A 3ZVJD 2PWJA 1PKWA 4WF4A 3HZ8A 4ZILA 3UVHA 2DC5A 4KDUA 2RM5A 1SENA 4V2LA 3TKRA 4YKGA 4KH7A 3VI5A 2X8GA 2VOCA 1N8JA 5GZZB 3G7JA 2MBTA 2OACA 1THXA 4K2XA 3UJ1A 1Q4JA 4F03A 4O32A 1U88A 4IQ1A 5IMDA 1A0RP 3W8JA 1PKZA 4BVXB 4PXOA 5IMAA 1TU8A 3FEUA 1SKRB 3DMLA 2REMA 3F3RA 5DCHA 3KMNA 1UN2A 4GTUA 3F63A 3E3EA 4TR0A 1GRXA 5ECLB 4WBRD 4ECBA 3VWUA 1HNCA 4GWRA 2KLXA 5H5SA 3QAWA 4MLYA 1MTCA 2NDOA 2FUG2 4OO5A 4OD7A 4KX4A 3KP8A 2LJRA 2OE1A 1X0RA 2DLXA 2IWTA 2LEGA 4HUAA 3WT2A 3MSZA 1XG8A 1PD21 3O6TA 2HRFA 4PQHA 1JHBA 1QQ2A 1K3YA 1M2AA 5D9TA 2VLVA 5J4UA 1SU9A 5ABRA 4NMUA 3D4TA 3DVXA 3TJFA 3C1SA 2B7JA 2CVDA 3I9V2 2DSAA 3IC8A 2PGTA 3CSIA 1M0UA 2HE3A 1B4QA 2IL3A 2VCTA 1KNGA 4WETA 2IIYA 3CRTA 1EEJA 4EF0A 3QFBC 2X4AA 14GSA 3C8EA 3F4SA 4IKHA 4NV2A 1GUMA 3ISOA 3TOTA 2TRCP 5G1KA 4MZCA 1M9BA 2V32A 4MF5A 3GSSA 4XS4A 2FWEA 4IS0A 3KM6A 1DE2A 4K7NA 2HT9A 3A3TA 2I81A 2FLSA 3DKSA 3A5IA 2J9HA 1V98A 2XPEA 3IK9A 4YQVA 4NV5A 5IQYA 2JACA 2HXKA 2JSYA 4PQ1A 2UZ8A 3UBKA 1A24A 1X9MB 1GSYA 2IJYA 4BVYB 2B5EA 4TR1A 3VFIA 2C0DA 11GSA 2WDUA 3QDNA 4OCFA 3ZMLA 2R3XA 2IFQB 1GUKA 4RUVA 3LXTA 4IQAA 4V1Ag 5ECPB 2DJ1A 2GZYA 1TP9A 2WGRA 1Q98A 3D4MA 2DIZA 3HJPA 1GL8A 4MPGA 4Q5NA 2R37A 1VRSD 1BX9A 4ZBAA 3I6AA 1QUWA 1H4OA 1T7PB 2DMLA 2M72A 3TOUA 5F0GA 3GIXA 1XXUA 1G7OA 4EDZA 3KH7A 1YQ1A 5AISA 2PBJA 3MYDA 4KA0A 5CP1A 1GSDA 3MDKA 1A8YA 2FD3A 1R5AA 3BD2A 2VD0A 4WBJA 3J7Yb 2P31A 2B5XA 2PVOC 2C0GA 5EY6A 2LQQA 2X49A 2JL4A 2C0EA 1QFNA 2YCDA 4IELA 1ZCPA 2HZEB 5DQSA 5ECQB 5F8BA 4CY6A 4GXZA 4L5LA 2GZPA 3CYNA 4QL7A 1ZYPA 3LGCA 1K3OA 3H93A 4ZIJA 4Q5FA 4FYUA 3ED3A 4NHZA 2BMXA 2DJJA 1F2EA 4I6XA 2YWNA 3EINA 3RDWA 5ECKB 2KOKA 2H1DA 1YF1A 1R4WA 4Z7XA 4MZBA 5IPGA 1M3JA 2H30A 1XOBA 1ZYQB 2RUEA 2PPTA 3UAPA 4FQUA 2MYGA 4E8HA 1NM3A 2C80A 1EGRA 5HR3A 3MNGA 3LYKA 1B9YC 2YJ7A 3BJ5A 4N0VA 4AJ7A 1O8XA 2E7PA 4J2FA 3DRNA 1OC9A 3L9SA 3US3A 2VIMA 1WMJA 1ABAA 4HZ2A 1T3BA 1TI1A 4GCIA 1W4VA 1YJ6A 2ES7A 4G19A 2GZZA 2LJKA 1TKDB 1ML6A 3GKXA 2O7KA 5J5NA 2XHFA 3BBYA 5AN1A 5CREA 2HSYA 3KEBA 4I2TA 1H75A 1Z9HA 5E59A 1PL1A 2VL9A 4KUNA 4CDOA 2CAQA 4Z2TA 3M9JA 2GSTA 2JZRA 1UC7A 4O92A 1NHYA 1V58A 4YQUA 4IW9A 3GFKA 3CMIA 5CO3A 4A5PA 4X43A 2YOIA 4IP6A 1AUCA 4HJ2A 4E8EA 1B9XC 5CNWA 1SJ6A 1GTIA 4IP1A 2OBKA 4V2MA 2H8LA 2LKUA 2F51A 1HNBA 4RI7A 3FMWA 4MJCA 5CRDA 2CX3A 4F0BA 4MJAA 3DXBA 2EIRA 1ZOFA 17GSA 2H1GA 2RLIA 2CVBA 4KCEA 1SKWB 1MD4A 4MCUA 3M0FA 1EOGA 3GRXA 2DMMA 1ZMAA 2JZTA 5G1LA 5ELGA 2DBCA 2P5RA 1LJRA 4K7IA 3UBLA 2WFCA 2B5YA 3KCMA 2HSHA 1OE8A 2WB9A 2HRNA 4BL7B 1GNWA 4O5UA 5FT3A 4KF9A 1TRUA 3WT1A 1EZKA 1JZOA 5KN1A 2M46A 1V40A 2MMAA 1TOFA 3LEFA 1FOVA 4WEYA 1GTBA 4BA7A 3FR6A 2ZUPA 4ZL9A 4LMWA 2CVKA 1XW5A 1UA5A 1XIYA 2N5AA 4XS1A 1TRWA 1XOAA 3L9UA 4MJBA 4YQMA 5DALB 3P90A 1CQHA 4POKA 6GSUA 2VM1A 4N0ZA 3LSZA 5D9VA 2O87A 1BJXA 3IRAA 2EIQA 4J56E 2R0GA 4YAPA 5ECMB 5B6NA 3DIEA 1G6WA 1Y6EA 1IYHA 5HR2A 4JRRA 4MJEA 5G2ZA 4K2DA 4FYCA 3CTFA 4ECCA 3TKSC 3RHBA 2NPBA 1WRYA 3H8QA 4WR5A 3RHCA 3BCIA 4WKWA 1TDIA 3ME8A 2M80A 3CXGA 3IAS2 1PRXA 3KIJA 5ECRB 3TRPA 2GSSA 3O76A 1AQVA 3SWLA 5H5QA 4EE0A 4ISDA 3HDCA 4WXTA 4EO3A 3Q18A 4D73A 3D5JA 1FVJA 1MDJA 4F2IA 1QK8A 2WULA 3KJYA 3IHGA 2V2GA 3IOSA 1J08A 1G0TA 3VWVA 4RI6A 3PH9A 5GAPD 1B8XA 1PL2A 1PFOA 3VPTA 2VAFA 1PSQA 2CQ9A 2MZCA 1U3AA 2CT6A 3APOA 5INYA 4RQRA 1ZGNA 2VO4A 2BTOT 2CZ2A 4HDEA 4PTSA 1AAZA 3U5RE 1TK8B 1TTZA 4KNDA 3TB2A 3QD9A 5IO0A 4K6XA 2X99A 2I3YA 1SK0A 2QA1A 1J9BA 3P7XA 3KGKA 3IHQA 4QL9A 1FO5A 3K8NA 5ECHB 4LL1B 1TK0B 2K9FA 3UL3A 4QQ7A 2YWOA 3EC3A 4WF5A 2H0HA 1O6JA 3GL5A 2H0IA 4V2NA 2E2MA 2H74A 3ZMKA 4XRDA 5LCZA 1T1VA 5ID2B 2C8UA 5A4UA 1PX7A 3TUEA 1A2LA 4MF6A 1TU7A 5IOXA 2E2GA 2VD1A 3G7YA 2K18A 4PNGA 1YKAA 1FHEA 2YWIA 4IJ3A 4BVXA 3WYWA 3QCPA 5DJMA 4HU9A 3ZTLA 1K0AA 2H71A 3IDVA 1XZOA 1PX6A 2PUKC 3M8NA 1BQ7A 4ZXGA 1BAYA 3D0ZA 4ML1A 4OFTA 5ECIB 2R0CA 4PGTA 2X8HA 1I5GA 1ERWA 2AV4A 2CZ3A 3A5WA 3IE3A 4K5RA 3I43A 2FA4A 3BCKA 4POBA 5G31A 3C71A 1EV9A 2NTOA 1G6YA 3ZL5A 3APQA 3KD0A 4MF7A 5D96A 1X5EA 2HSMA 5DCGA 5GSSA 2MMNA 3E9JB 4K1FA 4Q5QA 4ILFA 1N2AA 4XHMA 5D9XA 1CQGA 1SL1B 4BIKA 4DSRA 4OFNA 1M7TA 3ZLPA 2OJLA 3NOFA 4HSCX 4I5QA 5L71A 3GKMA 4ZBBA 2G0FA 2QSIA 1WP0A 1RW1A 1VF2A 3QR6A 1SJIA 5JWOB 4DSSA 2YNXA 1RK4A 2GQLA 2LNTA 4KE3A 3QFAC 4EC0A 4AF2A 5D8IA 2DJ0A 3RPPA 1FB6A 5JWQB 1USBA 4IJIA 2N5FA 2B7KA 3GV1A 2GQKA 4XCSA 2XBQA 3W6GA 1K0MA 3WD6A 1FAAA 1EWXA 5DBQA 5EVOA 4YAVA 4AJ8A 1ACVA 4PX1A 3PINA 5J9CA 2L4QA 1S3DA 4HOJA 1TRSA 4POMA 1M3IA 3IAM2 6GSXA 1KBNA 1XWBA 1TI3A 4HU7A 2HI7A 1F37A 3MAKA 1U87A 1A8LA 1WWJA 16GSA 1FB0A 2O89A 1SYXA 1K3LA 1YEXA 1ON4A 4TKYA 2EIOA 1DSBA 3DGQA 19GSA 1HQOA 1A0FA 3GMFA 3M3MA 4YH2A 2EC4A 2CX4A 2YV7A 3MWHA 5CRWA 2CV4A 1X9WB 5H5RA 5KN2A 3HXSA 2XC2A 2GT6A 2IMDA 2HZFA 3HA9A 5D73A 4G10A 2C0FA 5G30A 4DEJA 1S3AA 2D2ZA 4K7OA 3ERGA 2NBSA 3LYPA 1OC9B 2R2JA 1BEDA 5CAXA 1YEPA 1O81A 3ZYWA 2PN8A 3KP9A 10GSA 4OO4A 2GSRA 3IV4A 4WR4A 3TRXA 1SJZA 2V6OA 2YP6A 3DWVA 4HJMA 4NHWA 1Z5YE 3VI7A 1T8EB 5IM9A 4N10A 4OFMA 5IMVA 5GAND 2P5QA 1EP7A 4JBBA 4XRAA 3FKFA 1YF0A 2ON7A 3GHAA 4FO5A 3DD3A 2YWMA 1GP1A 3FR3A 2LRNA 2VLTA 4HS1A 4POLA 2PVQA 2HNLA 5JWRB 3TKSA 3F9UA 3KTBA 4X4JA 4LA1A 3WGEA 2L59A 5B6MA 1A23A 2HRKA 4ZL7A 2A2RA 4HQZA 4OCEA 2VUPA 4FH8A 4I2UA 2AHEA 2V6KA 4JEDA 2OKAA 4GQFA 3F0IA 5LNKe 3GKKA 1ERVA 3UOMA 4G0LA 1GSEA 1JFUA 4O7HA 3CQFA 3KH9A 1JZWA 1OKDA 4ICYA 3HKRA 1WE0A 1K0CA 1MDIA 4ZB8A 4IGJA 1YZXA 2O85A 3S9FA 3UMAA 2C3NA 1GH2A 4L8EA 3Q6OA 5ENUA 4L0UA 6GSYA 3FRCA
chains in the Genus database with same CATH topology
1K0OA 2DIYA 5DAKB 4LL4B 2YZHA 3F6DA 5AIVA 3RBTA 3L4NA 1A2MA 2CAIA 2L57A 2R4VA 4G2EA 1B4PA 5EPFA 2HRAA 1PMTA 1SD8A 1PGTA 1A2JA 2NVLA 4MABA 1XW6A 1HNAA 4IN0A 2FA8A 4GF0A 5G5FA 5BMUA 3CSHA 3OR5A 3A2WA 1O73A 4JU5A 2VLUA 1ZZYA 3LG6A 4IHUA 2L5LA 1O8WA 3CBUA 3H4KA 2A2PA 1K0DA 2AAWA 1ERUA 2OADA 4ZBDA 3U6VA 3TJKA 1ZYEA 1ERTA 3QAGA 2B3SA 2H70A 1NW2A 5B8BA 5COHA 1PA3A 4IVFA 5C00A 3ZVJA 5ECOB 2L4CA 3J7Yk 1V57A 3JCML 3Q74A 1Z6MA 3CTGA 2IMFA 3KZQA 5JCGA 4TXVA 5ECNB 3VLNA 3EMXA 3D6IA 3N9JA 5F06A 4L5OA 4TR4A 3EYTA 2ZNMA 4GSTA 3FZ5A 2GTUA 4Z2RA 4ML6A 2V1MA 4K9ZA 4EVMA 1XWAA 2ZCTA 5KN0A 1YY7A 1EV4A 3VURA 4PNFA 3TDGA 1JZDA 3IC4A 4OMVA 5J3RA 3DEXA 2LUSA 4PQIA 2H1AA 3APSA 4BL7A 4DSQA 4D73B 3IA1A 2H66A 3N5OA 5BRTA 4MP4A 2TRXA 6GSVA 2AYTA 1R7HA 2JZSA 4TRXA 4HQSA 2QGVA 1U6TA 2H72A 1FW1A 3QPMA 4V1Ap 5B8AA 3ZFLA 3UARA 2IPAA 2VL2C 5HR1A 5J9BA 5DALA 3Q19A 3L9VA 2ALBA 3ME7A 1GSFA 3LQ7A 4CY8A 2AJQB 2A2SA 2KP1A 2B1LA 2IMIA 3ZIVA 2ON5A 4TXOA 1G7EA 5DVBA 2F8AA 1NHOA 4GRFA 1OYJA 3HVVA 3WGXA 2FWGA 1SKSB 2H73A 2CA8A 1PN0A 4ZB6A 2DKHA 5E4WA 2PERA 4NWYA 2HFDA 1WJKA 2LRTA 4XS6A 5KOWA 2H1BA 1K0BA 3GTUA 1JZRA 4DVCA 2LS5A 4CW9A 5IMCA 3GUSA 5GSTA 3FR9A 4ULXA 3HHVA 4N30A 1XCCA 3RPNA 1QXHA 2VCQA 5IPHA 2WRTA 1EGOA 2FHEA 3TKSE 4PURA 1TRVA 1EOHA 2OBIA 1QMVA 2C1YA 4HZ4A 3O3TA 1PN9A 1T4YA 1OE7A 1XFLA 2K8SA 3FZ4A 1GSQA 3V1WA 3TJJA 4JE1A 1Z7RA 2OE0A 4Z2UA 5FWGA 2O8VB 4NXIA 4RQXA 1I9DA 3IBHA 18GSA 2L6CA 3HJMA 1F9MA 4TVEA 4JR4A 4TR3A 1TW9A 1MEKA 1V9WA 4TW5A 1J0FA 1UVZA 1M2BA 3VWWA 2B1KA 3M1GA 4FYBA 3IR4A 3FZAA 2GS3A 3VWXA 1WIKA 5DJLA 2H0GA 5ECSA 1SYRA 2FGXA 3UEMA 1MDKA 4EDYA 4TOPA 3VPQA 2OE3A 3A2VA 3FYGA 2KHPA 2FWFA 4XS4B 4HI7A 2WS2A 3RAZA 2VM2A 2LRCA 2VCZA 3DVWA 2I9HA 2F9SA 3KTLA 4DSSB 2AUVA 5IMZA 1R5PA 3TCOA 3M9KA 2C3QA 2RIIA 3FHKA 3QAVA 1WOUA 4MH3A 1GSUA 5ID2A 1NSWA 1V2AA 3D21A 4MZWA 2MMOA 2YV9A 3EWLA 5A5KA 1O85A 2DJ2A 4TR1B 1VF4A 1M2DA 5FHIA 1GTUA 2QC7A 2WCIA 4KDXA 3HYPA 20GSA 4ZB9A 1ILOA 3F4TA 3HZ4A 2PMTA 2FCHA 3GYKA 2GLRA 5CYYA 1PQNA 2MBSA 1GNEA 3ZREA 2JADA 4BWSA 1SL0B 1EP8A 1SK2A 2V41A 1X5CA 1BG5A 1VGLA 3E0UA 4F9ZA 2WJUA 4JZQA 1AC1A 2P0GA 4KB3A 2FY6A 4ACSA 4J57E 3UVTA 1R26A 2R6KA 4BPYA 4I97A 2GDRA 4MDCA 5CRHA 3TGZA 1X9SB 3F6FA 4EXJA 12GSA 3VK9A 5LD0A 3NZNA 2H19A 2X8CA 4G0IA 1GLQA 5AGYA 2VCVA 22GSA 3LFLA 4G0KA 1AQWA 2GGTA 1AQXA 2E0QA 4KDYA 5HFKA 5KN3A 2KUCA 3LJRA 5AIXA 5IIZA 1KEBA 2K8VA 2HYXA 13GSA 3NIVA 3CRUA 1VF3A 4L0WA 2H6YA 3HVXA 9GSSA 3ERWA 1OC3A 6GSWA 1XW9A 2I4AA 4BVYA 4OWYA 4ID0A 5IOWA 1K0NA 2F8FA 3EPTA 4AJ6A 3QOUA 5D9WA 2I1UA 4EUYA 1T00A 1KTEA 2DJKA 2Z9SA 2IFQA 1E2YA 4O5RA 2IMEA 4BWQA 3TJGA 3G9BA 3EU3A 1O7UA 1SL2B 3FY7A 2A4VA 3LW9A 5CRGA 2J23A 3FW2A 3FZ9A 2LSTA 2L6DA 1GTAA 1AIUA 2JU5A 1W89A 2LJAA 4P3YB 4KGIA 2C4JA 3G7IA 2B6MA 3AY8A 2X64A 3SBCA 1VF1A 1ZL9A 1SD9A 4KW6A 4O5QA 1F6MC 3IXRA 4LMVA 5DDLA 2H6ZA 2H76A 5G5EA 3GN3A 5B7CA 1HD2A 1OAZA 4H86A 3TRQA 3HCZA 5C04A 4F0CA 1YKCA 4NAXA 2LTKA 1TXXA 2R0PA 3MIXA 1JLWA 3GX8A 3EE2A 4HEA2 6GSSA 5KEJA 1ZYNA 1OVNA 4FIWA 3R2QA 3LXZA 4I8BA 1XWKA 3HD5A 2F3MA 2HZEA 4AGSA 4F82A 2JSZA 2G2QA 3D22A 3LORA 3CSJA 2H01A 4YKFA 3GURA 2RUFA 2AB6A 1BYEA 3GKNA 3TKPA 3ZZXA 4MK3A 1F3AA 2C3TA 3EMPA 3PPUA 2VL2A 2PU9C 2GVPA 2MMZA 1DUGA 4K0GA 2YPMA 4XTSA 2LNSA 2K6VA 3H1NA 1GUHA 1FVKA 1TK5B 1S3CA 2KP2A 4X1UA 1XWGA 2YJHA 2TIRA 4Q5RA 3P8WA 4EIPA 5JCWA 3HJOA 5F05A 2XBIA 3GL3A 3R3EA 1HYUA 2N5BA 1IYIA 2H75A 3L78A 1ST9A 2BJXA 3UIWA 2L5OA 6GSTA 4GQCA 5DQYA 5EL8A 3TKQA 2GSQA 2R5GA 3C7MA 2YZUA 3HVSA 4LLRA 4USSA 4MMMA 5HFIA 4PUAA 3WGDA 3KMOA 7GSSA 1Z7PA 3W8SA 1X5DA 3QMXA 1OC8A 1XVQA 2GT5A 3BOAA 4G9HA 1T4ZA 5HR0A 1C72A 4MA9A 3P2AA 2FWHA 3LWAA 4ZL8A 1JLVA 3A2XA 4MPFA 3GH6A 8GSSA 4EIQA 5IMFA 1GSSA 4PUFC 3F4RA 5DAKA 4IBPA 1XVWA 2YN1A 1XPVA 4X0XA 1LBKA 3HY2A 2HLSA 5IO2A 1QGVA 1URMA 3PR8A 3ERFA 4CHSA 1Y25A 2RM6A 3EVIA 1AW9A 1OKTA 1M9AA 4MNNA 3IK7A 4XIHA 2OA7A 1TJDA 5KOXA 3DYRA 4TN8A 5ELAA 5A4VA 2QKEA 1XBSA 2H6XA 4NPBA 2VL3A 5JCUA 4KSOA 3TJBA 4GSSA 4K0NA 1F3BA 5HQPA 2FNOA 1RQMA 1XWCA 2VCWA 3F8UA 1WPIA 4GSNA 2GQMA 3ZFBA 5A4WA 2QA2A 4MH2A 4EL1A 1MD3A 4ECIA 5HFGA 2A4HA 3EURA 3FK8A 1M99A 4EKZA 3I69A 3ZITA 3GNJA 3IPZA 4JR6A 2IMKA 4TXOB 1U3IA 4GLTA 3F3QA 1B48A 2XPDA 4KSMA 3L0HA 2DKIA 4KAEA 1Z6NA 3ZIJA 3PGTA 1GULA 1Z3EA 1EEMA 4ECJA 1FG4A 2DJ3A 3GA4A 2LQOA 5D93A 3GX0A 3KXOA 1SK1A 3GH9A 3C73A 5J41A 3GTUB 4N11A 2IN3A 3H79A 4KCAA 4K8MA 2YANA 1YDKA 3EU4A 3ZRDA 1GWCA 2WZ9A 1E6BA 1DBYA 1GLPA 2LV3A 1DE1A 1LU4A 3C1RA 2VCXA 3GSTA 4K5SA 1THOA 1AXDA 1FOHA 5F07A 3ZVJD 2PWJA 1PKWA 4WF4A 3HZ8A 4ZILA 3UVHA 2DC5A 4KDUA 2RM5A 1SENA 4V2LA 3TKRA 4YKGA 4KH7A 3VI5A 2X8GA 2VOCA 1N8JA 5GZZB 3G7JA 2MBTA 2OACA 1THXA 4K2XA 3UJ1A 1Q4JA 4F03A 4O32A 1U88A 4IQ1A 5IMDA 1A0RP 3W8JA 1PKZA 4BVXB 4PXOA 5IMAA 1TU8A 3FEUA 1SKRB 3DMLA 2REMA 3F3RA 5DCHA 3KMNA 1UN2A 4GTUA 3F63A 3E3EA 4TR0A 1GRXA 5ECLB 4WBRD 4ECBA 3VWUA 1HNCA 4GWRA 2KLXA 5H5SA 3QAWA 4MLYA 1MTCA 2NDOA 2FUG2 4OO5A 4OD7A 4KX4A 3KP8A 2LJRA 2OE1A 1X0RA 2DLXA 2IWTA 2LEGA 4HUAA 3WT2A 3MSZA 1PD21 3O6TA 2HRFA 4PQHA 1JHBA 1QQ2A 1K3YA 1M2AA 5D9TA 2VLVA 5J4UA 1SU9A 5ABRA 4NMUA 3D4TA 3DVXA 3TJFA 3C1SA 2B7JA 2CVDA 3I9V2 2DSAA 3IC8A 2PGTA 3CSIA 1M0UA 2HE3A 1B4QA 2IL3A 2VCTA 1KNGA 4WETA 2IIYA 3CRTA 1EEJA 4EF0A 3QFBC 2X4AA 14GSA 3C8EA 3F4SA 4IKHA 4NV2A 1GUMA 3ISOA 3TOTA 2TRCP 5G1KA 4MZCA 1M9BA 2V32A 4MF5A 3GSSA 4XS4A 2FWEA 4IS0A 3KM6A 1DE2A 4K7NA 2HT9A 3A3TA 2I81A 2FLSA 3DKSA 3A5IA 2J9HA 1V98A 2XPEA 3IK9A 4YQVA 4NV5A 5IQYA 2JACA 2HXKA 2JSYA 4PQ1A 2UZ8A 3UBKA 1A24A 1X9MB 1GSYA 2IJYA 4BVYB 2B5EA 4TR1A 3VFIA 2C0DA 11GSA 2WDUA 3QDNA 4OCFA 3ZMLA 2R3XA 2IFQB 1GUKA 4RUVA 3LXTA 4IQAA 4V1Ag 5ECPB 2DJ1A 2GZYA 1TP9A 2WGRA 1Q98A 3D4MA 2DIZA 3HJPA 1GL8A 4MPGA 4Q5NA 2R37A 1VRSD 1BX9A 4ZBAA 3I6AA 1QUWA 1H4OA 1T7PB 2DMLA 2M72A 3TOUA 5F0GA 3GIXA 1XXUA 1G7OA 4EDZA 3KH7A 1YQ1A 5AISA 2PBJA 3MYDA 4KA0A 5CP1A 1GSDA 3MDKA 1A8YA 2FD3A 1R5AA 3BD2A 2VD0A 4WBJA 3J7Yb 2P31A 2B5XA 2PVOC 2C0GA 5EY6A 2LQQA 2X49A 2JL4A 2C0EA 1QFNA 2YCDA 4IELA 1ZCPA 2HZEB 5DQSA 5ECQB 5F8BA 4CY6A 4GXZA 4L5LA 2GZPA 3CYNA 4QL7A 1ZYPA 3LGCA 1K3OA 3H93A 4ZIJA 4Q5FA 4FYUA 3ED3A 4NHZA 2BMXA 2DJJA 1F2EA 4I6XA 2YWNA 3EINA 3RDWA 5ECKB 2KOKA 2H1DA 1YF1A 1R4WA 4Z7XA 4MZBA 5IPGA 2H30A 1XOBA 1ZYQB 2RUEA 2PPTA 3UAPA 4FQUA 2MYGA 4E8HA 1NM3A 2C80A 1EGRA 5HR3A 3MNGA 3LYKA 1B9YC 2YJ7A 3BJ5A 4N0VA 4AJ7A 1O8XA 2E7PA 4J2FA 3DRNA 1OC9A 3L9SA 3US3A 2VIMA 1WMJA 1ABAA 4HZ2A 1T3BA 1TI1A 4GCIA 1W4VA 1YJ6A 2ES7A 4G19A 2GZZA 2LJKA 1TKDB 1ML6A 3GKXA 2O7KA 5J5NA 2XHFA 3BBYA 5AN1A 5CREA 2HSYA 3KEBA 4I2TA 1H75A 1Z9HA 5E59A 1PL1A 2VL9A 4KUNA 4CDOA 2CAQA 4Z2TA 3M9JA 2GSTA 2JZRA 1UC7A 4O92A 1NHYA 1V58A 4YQUA 4IW9A 3GFKA 3CMIA 5CO3A 4A5PA 4X43A 2YOIA 4IP6A 1AUCA 4HJ2A 4E8EA 1B9XC 5CNWA 1SJ6A 1GTIA 4IP1A 2OBKA 4V2MA 2H8LA 2LKUA 2F51A 1HNBA 4RI7A 3FMWA 4MJCA 5CRDA 2CX3A 4F0BA 4MJAA 3DXBA 2EIRA 1ZOFA 17GSA 2H1GA 2RLIA 2CVBA 4KCEA 1SKWB 1MD4A 4MCUA 3M0FA 1EOGA 3GRXA 2DMMA 1ZMAA 2JZTA 5G1LA 5ELGA 2DBCA 2P5RA 1LJRA 4K7IA 3UBLA 2WFCA 2B5YA 3KCMA 2HSHA 1OE8A 2WB9A 2HRNA 4BL7B 1GNWA 4O5UA 5FT3A 4KF9A 1TRUA 3WT1A 1EZKA 1JZOA 5KN1A 2M46A 1V40A 2MMAA 1TOFA 3LEFA 1FOVA 4WEYA 1GTBA 4BA7A 3FR6A 2ZUPA 4ZL9A 4LMWA 2CVKA 1XW5A 1UA5A 1XIYA 2N5AA 4XS1A 1TRWA 1XOAA 3L9UA 4MJBA 4YQMA 5DALB 3P90A 1CQHA 4POKA 6GSUA 2VM1A 4N0ZA 3LSZA 5D9VA 2O87A 1BJXA 3IRAA 2EIQA 4J56E 2R0GA 4YAPA 5ECMB 5B6NA 3DIEA 1G6WA 1Y6EA 1IYHA 5HR2A 4JRRA 4MJEA 5G2ZA 4K2DA 4FYCA 3CTFA 4ECCA 3TKSC 3RHBA 2NPBA 1WRYA 3H8QA 4WR5A 3RHCA 3BCIA 4WKWA 1TDIA 3ME8A 2M80A 3CXGA 3IAS2 1PRXA 3KIJA 5ECRB 3TRPA 2GSSA 3O76A 1AQVA 3SWLA 5H5QA 4EE0A 4ISDA 3HDCA 4WXTA 4EO3A 3Q18A 4D73A 3D5JA 1FVJA 1MDJA 4F2IA 1QK8A 2WULA 3KJYA 3IHGA 2V2GA 3IOSA 1J08A 1G0TA 3VWVA 4RI6A 3PH9A 5GAPD 1B8XA 1PL2A 3VPTA 2VAFA 1PSQA 2CQ9A 2MZCA 1U3AA 2CT6A 3APOA 5INYA 4RQRA 1ZGNA 2VO4A 2BTOT 2CZ2A 4HDEA 4PTSA 1AAZA 3U5RE 1TK8B 1TTZA 4KNDA 3TB2A 3QD9A 5IO0A 4K6XA 2X99A 2I3YA 1SK0A 2QA1A 1J9BA 3P7XA 3KGKA 3IHQA 4QL9A 1FO5A 3K8NA 5ECHB 4LL1B 1TK0B 2K9FA 3UL3A 4QQ7A 2YWOA 3EC3A 4WF5A 2H0HA 1O6JA 3GL5A 2H0IA 4V2NA 2E2MA 2H74A 3ZMKA 4XRDA 5LCZA 1T1VA 5ID2B 2C8UA 5A4UA 1PX7A 3TUEA 1A2LA 4MF6A 1TU7A 5IOXA 2E2GA 2VD1A 3G7YA 2K18A 4PNGA 1YKAA 1FHEA 2YWIA 4IJ3A 4BVXA 3WYWA 3QCPA 5DJMA 4HU9A 3ZTLA 1K0AA 2H71A 3IDVA 1XZOA 1PX6A 2PUKC 3M8NA 1BQ7A 4ZXGA 1BAYA 3D0ZA 4ML1A 4OFTA 5ECIB 2R0CA 4PGTA 2X8HA 1I5GA 1ERWA 2AV4A 2CZ3A 3A5WA 3IE3A 4K5RA 3I43A 2FA4A 3BCKA 4POBA 5G31A 3C71A 1EV9A 2NTOA 1G6YA 3ZL5A 3APQA 3KD0A 4MF7A 5D96A 1X5EA 2HSMA 5DCGA 5GSSA 2MMNA 3E9JB 4K1FA 4Q5QA 4ILFA 1N2AA 4XHMA 5D9XA 1CQGA 1SL1B 4DSRA 4OFNA 1M7TA 3ZLPA 2OJLA 3NOFA 4I5QA 5L71A 3GKMA 4ZBBA 2G0FA 2QSIA 1WP0A 1RW1A 1VF2A 3QR6A 1SJIA 5JWOB 4DSSA 2YNXA 1RK4A 2GQLA 2LNTA 4KE3A 3QFAC 4EC0A 4AF2A 5D8IA 2DJ0A 3RPPA 1FB6A 5JWQB 1USBA 4IJIA 2N5FA 2B7KA 3GV1A 2GQKA 4XCSA 2XBQA 3W6GA 1K0MA 3WD6A 1FAAA 1EWXA 5DBQA 5EVOA 4YAVA 4AJ8A 1ACVA 4PX1A 3PINA 5J9CA 2L4QA 1S3DA 4HOJA 1TRSA 4POMA 3IAM2 6GSXA 1KBNA 1XWBA 1TI3A 4HU7A 2HI7A 1F37A 3MAKA 1U87A 1A8LA 1WWJA 16GSA 1FB0A 2O89A 1SYXA 1K3LA 1YEXA 1ON4A 4TKYA 2EIOA 1DSBA 3DGQA 19GSA 1HQOA 1A0FA 3GMFA 3M3MA 4YH2A 2EC4A 2CX4A 2YV7A 3MWHA 5CRWA 2CV4A 1X9WB 5H5RA 5KN2A 3HXSA 2XC2A 2GT6A 2IMDA 2HZFA 3HA9A 5D73A 4G10A 2C0FA 5G30A 4DEJA 1S3AA 2D2ZA 4K7OA 3ERGA 2NBSA 3LYPA 1OC9B 2R2JA 1BEDA 5CAXA 1YEPA 1O81A 3ZYWA 2PN8A 3KP9A 10GSA 4OO4A 2GSRA 3IV4A 4WR4A 3TRXA 1SJZA 2V6OA 2YP6A 3DWVA 4HJMA 4NHWA 1Z5YE 3VI7A 1T8EB 5IM9A 4N10A 4OFMA 5IMVA 5GAND 2P5QA 1EP7A 4JBBA 4XRAA 3FKFA 1YF0A 2ON7A 3GHAA 4FO5A 3DD3A 2YWMA 1GP1A 3FR3A 2LRNA 2VLTA 4HS1A 4POLA 2PVQA 2HNLA 5JWRB 3TKSA 3F9UA 3KTBA 4X4JA 4LA1A 3WGEA 2L59A 5B6MA 1A23A 2HRKA 4ZL7A 2A2RA 4HQZA 4OCEA 2VUPA 4FH8A 4I2UA 2AHEA 2V6KA 4JEDA 2OKAA 4GQFA 3F0IA 5LNKe 3GKKA 1ERVA 3UOMA 4G0LA 1GSEA 1JFUA 4O7HA 3KH9A 1JZWA 1OKDA 4ICYA 3HKRA 1WE0A 1K0CA 1MDIA 4ZB8A 4IGJA 1YZXA 2O85A 3S9FA 3UMAA 2C3NA 1GH2A 4L8EA 3Q6OA 5ENUA 4L0UA 6GSYA 3FRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K0O A;  2DIY A;  5DAK B;  4LL4 B;  2YZH A;  3F6D A;  5AIV A;  3RBT A;  3L4N A;  1A2M A;  2CAI A;  2L57 A;  2R4V A;  4G2E A;  1B4P A;  5EPF A;  1PMT A;  1SD8 A;  1PGT A;  1A2J A;  2NVL A;  4MAB A;  1XW6 A;  1HNA A;  4IN0 A;  2FA8 A;  4GF0 A;  5G5F A;  3CSH A;  3OR5 A;  3A2W A;  1O73 A;  4JU5 A;  2VLU A;  1ZZY A;  3LG6 A;  4IHU A;  2L5L A;  1O8W A;  3CBU A;  3H4K A;  1K0D A;  2AAW A;  1ERU A;  2OAD A;  4ZBD A;  3U6V A;  3TJK A;  1ZYE A;  1ERT A;  3QAG A;  2B3S A;  2H70 A;  1NW2 A;  5B8B A;  5COH A;  1PA3 A;  4IVF A;  5C00 A;  3ZVJ A;  5ECO B;  2L4C A;  3J7Y k;  1V57 A;  3JCM L;  3Q74 A;  1Z6M A;  3CTG A;  2IMF A;  3KZQ A;  5JCG A;  4TXV A;  5ECN B;  3VLN A;  3EMX A;  3D6I A;  3N9J A;  5F06 A;  4L5O A;  4TR4 A;  3EYT A;  2ZNM A;  4GST A;  3FZ5 A;  2GTU A;  4ML6 A;  2V1M A;  4K9Z A;  4EVM A;  1XWA A;  2ZCT A;  5KN0 A;  1YY7 A;  1EV4 A;  3VUR A;  4PNF A;  3TDG A;  1JZD A;  3IC4 A;  4OMV A;  5J3R A;  3DEX A;  2LUS A;  4PQI A;  2H1A A;  3APS A;  4BL7 A;  4DSQ A;  4D73 B;  3IA1 A;  2H66 A;  3N5O A;  4MP4 A;  2TRX A;  6GSV A;  2AYT A;  1R7H A;  2JZS A;  4TRX A;  4HQS A;  2QGV A;  1U6T A;  2H72 A;  1FW1 A;  3QPM A;  4V1A p;  5B8A A;  3ZFL A;  3UAR A;  2IPA A;  2VL2 C;  5HR1 A;  5J9B A;  5DAL A;  3Q19 A;  3L9V A;  2ALB A;  3ME7 A;  1GSF A;  3LQ7 A;  2AJQ B;  2A2S A;  2KP1 A;  2B1L A;  2IMI A;  3ZIV A;  2ON5 A;  4TXO A;  1G7E A;  5DVB A;  2F8A A;  1NHO A;  4GRF A;  1OYJ A;  3HVV A;  3WGX A;  2FWG A;  1SKS B;  2H73 A;  2CA8 A;  4ZB6 A;  5E4W A;  2PER A;  4NWY A;  2HFD A;  1WJK A;  2LRT A;  4XS6 A;  2H1B A;  1K0B A;  3GTU A;  1JZR A;  4DVC A;  2LS5 A;  4CW9 A;  5IMC A;  3GUS A;  5GST A;  3FR9 A;  4ULX A;  3HHV A;  4N30 A;  1XCC A;  3RPN A;  1QXH A;  2VCQ A;  5IPH A;  2WRT A;  1EGO A;  2FHE A;  3TKS E;  4PUR A;  1TRV A;  1EOH A;  2OBI A;  1QMV A;  2C1Y A;  4HZ4 A;  3O3T A;  1PN9 A;  1T4Y A;  1OE7 A;  1XFL A;  2K8S A;  3FZ4 A;  1GSQ A;  3V1W A;  3TJJ A;  4JE1 A;  1Z7R A;  2OE0 A;  5FWG A;  2O8V B;  4NXI A;  4RQX A;  1I9D A;  3IBH A;  18GS A;  2L6C A;  3HJM A;  1F9M A;  4TVE A;  4JR4 A;  4TR3 A;  1TW9 A;  1MEK A;  1V9W A;  4TW5 A;  1J0F A;  1UVZ A;  1M2B A;  3VWW A;  2B1K A;  3M1G A;  4FYB A;  3IR4 A;  3FZA A;  2GS3 A;  3VWX A;  1WIK A;  5DJL A;  2H0G A;  5ECS A;  1SYR A;  2FGX A;  3UEM A;  1MDK A;  4EDY A;  4TOP A;  3VPQ A;  2OE3 A;  3A2V A;  3FYG A;  2KHP A;  2FWF A;  4XS4 B;  4HI7 A;  2WS2 A;  3RAZ A;  2VM2 A;  2LRC A;  2VCZ A;  3DVW A;  2I9H A;  2F9S A;  3KTL A;  4DSS B;  2AUV A;  5IMZ A;  1R5P A;  3TCO A;  3M9K A;  2C3Q A;  2RII A;  3FHK A;  3QAV A;  1WOU A;  4MH3 A;  1GSU A;  5ID2 A;  1NSW A;  1V2A A;  3D21 A;  4MZW A;  2MMO A;  2YV9 A;  3EWL A;  5A5K A;  1O85 A;  2DJ2 A;  4TR1 B;  1VF4 A;  1M2D A;  5FHI A;  1GTU A;  2QC7 A;  2WCI A;  4KDX A;  3HYP A;  20GS A;  4ZB9 A;  1ILO A;  3F4T A;  3HZ4 A;  2PMT A;  2FCH A;  3GYK A;  2GLR A;  5CYY A;  1PQN A;  2MBS A;  1GNE A;  3ZRE A;  2JAD A;  4BWS A;  1SL0 B;  1EP8 A;  1SK2 A;  2V41 A;  1X5C A;  1BG5 A;  1VGL A;  3E0U A;  4F9Z A;  2WJU A;  4JZQ A;  1AC1 A;  2P0G A;  4KB3 A;  2FY6 A;  4ACS A;  4J57 E;  3UVT A;  1R26 A;  2R6K A;  4BPY A;  4I97 A;  2GDR A;  4MDC A;  5CRH A;  3TGZ A;  1X9S B;  3F6F A;  4EXJ A;  12GS A;  3VK9 A;  5LD0 A;  3NZN A;  2H19 A;  2X8C A;  1GLQ A;  5AGY A;  2VCV A;  22GS A;  3LFL A;  1AQW A;  2GGT A;  1AQX A;  2E0Q A;  4KDY A;  5HFK A;  5KN3 A;  2KUC A;  3LJR A;  5AIX A;  5IIZ A;  1KEB A;  2K8V A;  2HYX A;  13GS A;  3NIV A;  3CRU A;  1VF3 A;  4L0W A;  2H6Y A;  3HVX A;  9GSS A;  3ERW A;  1OC3 A;  6GSW A;  1XW9 A;  2I4A A;  4BVY A;  4OWY A;  4ID0 A;  5IOW A;  1K0N A;  2F8F A;  4AJ6 A;  3QOU A;  5D9W A;  2I1U A;  4EUY A;  1T00 A;  1KTE A;  2DJK A;  2Z9S A;  2IFQ A;  1E2Y A;  4O5R A;  2IME A;  4BWQ A;  3TJG A;  3G9B A;  3EU3 A;  1O7U A;  1SL2 B;  3FY7 A;  2A4V A;  5CRG A;  2J23 A;  3FW2 A;  3FZ9 A;  2LST A;  2L6D A;  1GTA A;  1AIU A;  2JU5 A;  1W89 A;  2LJA A;  4P3Y B;  4KGI A;  2C4J A;  3G7I A;  2B6M A;  3AY8 A;  2X64 A;  3SBC A;  1VF1 A;  1ZL9 A;  1SD9 A;  4KW6 A;  1F6M C;  3IXR A;  4LMV A;  5DDL A;  2H6Z A;  2H76 A;  5G5E A;  3GN3 A;  5B7C A;  1HD2 A;  1OAZ A;  4H86 A;  3TRQ A;  3HCZ A;  5C04 A;  4F0C A;  1YKC A;  4NAX A;  2LTK A;  1TXX A;  1JLW A;  3GX8 A;  3EE2 A;  4HEA 2;  6GSS A;  5KEJ A;  1OVN A;  4FIW A;  3R2Q A;  3LXZ A;  4I8B A;  1XWK A;  3HD5 A;  2F3M A;  2HZE A;  4AGS A;  4F82 A;  2JSZ A;  2G2Q A;  3D22 A;  3LOR A;  3CSJ A;  2H01 A;  3GUR A;  2RUF A;  2AB6 A;  1BYE A;  3GKN A;  3TKP A;  3ZZX A;  4MK3 A;  1F3A A;  2C3T A;  3EMP A;  2VL2 A;  2PU9 C;  2GVP A;  2MMZ A;  1DUG A;  4K0G A;  2YPM A;  4XTS A;  2LNS A;  2K6V A;  3H1N A;  1GUH A;  1FVK A;  1TK5 B;  1S3C A;  2KP2 A;  4X1U A;  1XWG A;  2YJH A;  2TIR A;  4Q5R A;  3P8W A;  5JCW A;  3HJO A;  5F05 A;  2XBI A;  3GL3 A;  1HYU A;  2N5B A;  1IYI A;  2H75 A;  3L78 A;  1ST9 A;  2BJX A;  3UIW A;  2L5O A;  6GST A;  4GQC A;  5DQY A;  5EL8 A;  3TKQ A;  2GSQ A;  2R5G A;  3C7M A;  2YZU A;  3HVS A;  4LLR A;  4MMM A;  5HFI A;  4PUA A;  3WGD A;  3KMO A;  7GSS A;  1Z7P A;  3W8S A;  1X5D A;  3QMX A;  1OC8 A;  1XVQ A;  2GT5 A;  3BOA A;  4G9H A;  1T4Z A;  5HR0 A;  1C72 A;  4MA9 A;  3P2A A;  2FWH A;  3LWA A;  4ZL8 A;  1JLV A;  3A2X A;  4MPF A;  3GH6 A;  8GSS A;  5IMF A;  1GSS A;  4PUF C;  3F4R A;  5DAK A;  4IBP A;  1XVW A;  2YN1 A;  1XPV A;  4X0X A;  1LBK A;  3HY2 A;  2HLS A;  5IO2 A;  1QGV A;  1URM A;  3PR8 A;  3ERF A;  4CHS A;  1Y25 A;  2RM6 A;  3EVI A;  1AW9 A;  1OKT A;  1M9A A;  3IK7 A;  4XIH A;  2OA7 A;  1TJD A;  3DYR A;  4TN8 A;  5ELA A;  5A4V A;  2QKE A;  1XBS A;  2H6X A;  4NPB A;  2VL3 A;  5JCU A;  4KSO A;  3TJB A;  4GSS A;  4K0N A;  1F3B A;  5HQP A;  2FNO A;  1RQM A;  1XWC A;  2VCW A;  3F8U A;  1WPI A;  4GSN A;  2GQM A;  3ZFB A;  5A4W A;  4MH2 A;  4EL1 A;  1MD3 A;  4ECI A;  5HFG A;  3EUR A;  3FK8 A;  1M99 A;  4EKZ A;  3I69 A;  3ZIT A;  3GNJ A;  3IPZ A;  4JR6 A;  2IMK A;  4TXO B;  1U3I A;  4GLT A;  3F3Q A;  1B48 A;  2XPD A;  4KSM A;  3L0H A;  4KAE A;  1Z6N A;  3ZIJ A;  3PGT A;  1GUL A;  1Z3E A;  1EEM A;  4ECJ A;  1FG4 A;  2DJ3 A;  3GA4 A;  2LQO A;  5D93 A;  3GX0 A;  3KXO A;  1SK1 A;  3GH9 A;  3C73 A;  5J41 A;  3GTU B;  4N11 A;  2IN3 A;  3H79 A;  4KCA A;  4K8M A;  2YAN A;  1YDK A;  3EU4 A;  3ZRD A;  1GWC A;  2WZ9 A;  1E6B A;  1DBY A;  1GLP A;  2LV3 A;  1DE1 A;  1LU4 A;  3C1R A;  2VCX A;  3GST A;  1THO A;  1AXD A;  5F07 A;  3ZVJ D;  2PWJ A;  1PKW A;  4WF4 A;  3HZ8 A;  4ZIL A;  3UVH A;  2DC5 A;  4KDU A;  2RM5 A;  1SEN A;  4V2L A;  3TKR A;  4KH7 A;  3VI5 A;  2X8G A;  2VOC A;  1N8J A;  5GZZ B;  3G7J A;  2MBT A;  2OAC A;  1THX A;  3UJ1 A;  1Q4J A;  4F03 A;  4O32 A;  1U88 A;  4IQ1 A;  5IMD A;  1A0R P;  3W8J A;  1PKZ A;  4PXO A;  5IMA A;  1TU8 A;  3FEU A;  1SKR B;  3DML A;  2REM A;  3F3R A;  5DCH A;  3KMN A;  1UN2 A;  4GTU A;  3F63 A;  3E3E A;  4TR0 A;  1GRX A;  5ECL B;  4WBR D;  4ECB A;  3VWU A;  1HNC A;  4GWR A;  2KLX A;  5H5S A;  3QAW A;  4MLY A;  1MTC A;  2NDO A;  2FUG 2;  4OO5 A;  4OD7 A;  4KX4 A;  3KP8 A;  2LJR A;  2OE1 A;  1X0R A;  2DLX A;  2IWT A;  2LEG A;  4HUA A;  3WT2 A;  3MSZ A;  1PD2 1;  3O6T A;  2HRF A;  4PQH A;  1JHB A;  1QQ2 A;  1K3Y A;  1M2A A;  5D9T A;  2VLV A;  5J4U A;  1SU9 A;  5ABR A;  4NMU A;  3D4T A;  3DVX A;  3TJF A;  3C1S A;  2B7J A;  2CVD A;  3I9V 2;  2DSA A;  2PGT A;  3CSI A;  1M0U A;  2HE3 A;  1B4Q A;  2IL3 A;  2VCT A;  1KNG A;  4WET A;  2IIY A;  3CRT A;  1EEJ A;  4EF0 A;  3QFB C;  14GS A;  3C8E A;  3F4S A;  4IKH A;  4NV2 A;  1GUM A;  3ISO A;  3TOT A;  2TRC P;  5G1K A;  4MZC A;  1M9B A;  2V32 A;  4MF5 A;  3GSS A;  4XS4 A;  2FWE A;  4IS0 A;  3KM6 A;  1DE2 A;  4K7N A;  2HT9 A;  3A3T A;  2I81 A;  2FLS A;  3DKS A;  2J9H A;  1V98 A;  2XPE A;  3IK9 A;  4YQV A;  4NV5 A;  5IQY A;  2JAC A;  2HXK A;  2JSY A;  4PQ1 A;  3UBK A;  1A24 A;  1X9M B;  1GSY A;  2IJY A;  2B5E A;  4TR1 A;  3VFI A;  2C0D A;  11GS A;  2WDU A;  3QDN A;  4OCF A;  3ZML A;  2R3X A;  2IFQ B;  1GUK A;  4RUV A;  3LXT A;  4IQA A;  4V1A g;  5ECP B;  2DJ1 A;  2GZY A;  1TP9 A;  2WGR A;  1Q98 A;  3D4M A;  2DIZ A;  3HJP A;  1GL8 A;  4MPG A;  4Q5N A;  2R37 A;  1VRS D;  1BX9 A;  4ZBA A;  3I6A A;  1QUW A;  1H4O A;  1T7P B;  2DML A;  2M72 A;  3TOU A;  5F0G A;  3GIX A;  1XXU A;  1G7O A;  4EDZ A;  3KH7 A;  1YQ1 A;  5AIS A;  2PBJ A;  4KA0 A;  5CP1 A;  1GSD A;  3MDK A;  1A8Y A;  2FD3 A;  1R5A A;  3BD2 A;  2VD0 A;  4WBJ A;  3J7Y b;  2P31 A;  2B5X A;  2PVO C;  2C0G A;  5EY6 A;  2LQQ A;  2JL4 A;  2C0E A;  1QFN A;  2YCD A;  4IEL A;  1ZCP A;  2HZE B;  5DQS A;  5ECQ B;  5F8B A;  4GXZ A;  4L5L A;  2GZP A;  3CYN A;  4QL7 A;  3LGC A;  1K3O A;  3H93 A;  4ZIJ A;  4Q5F A;  4FYU A;  3ED3 A;  4NHZ A;  2BMX A;  2DJJ A;  1F2E A;  4I6X A;  2YWN A;  3EIN A;  3RDW A;  5ECK B;  2KOK A;  2H1D A;  1YF1 A;  1R4W A;  4Z7X A;  4MZB A;  5IPG A;  2H30 A;  1XOB A;  1ZYQ B;  2RUE A;  2PPT A;  3UAP A;  2MYG A;  4E8H A;  1NM3 A;  2C80 A;  1EGR A;  5HR3 A;  3MNG A;  3LYK A;  1B9Y C;  2YJ7 A;  3BJ5 A;  4N0V A;  4AJ7 A;  1O8X A;  2E7P A;  4J2F A;  3DRN A;  1OC9 A;  3L9S A;  3US3 A;  2VIM A;  1WMJ A;  1ABA A;  4HZ2 A;  1T3B A;  1TI1 A;  4GCI A;  1W4V A;  1YJ6 A;  2ES7 A;  4G19 A;  2GZZ A;  2LJK A;  1TKD B;  1ML6 A;  3GKX A;  2O7K A;  5J5N A;  2XHF A;  3BBY A;  5AN1 A;  5CRE A;  2HSY A;  3KEB A;  4I2T A;  1H75 A;  1Z9H A;  5E59 A;  1PL1 A;  2VL9 A;  4KUN A;  4CDO A;  2CAQ A;  3M9J A;  2GST A;  2JZR A;  1UC7 A;  4O92 A;  1NHY A;  1V58 A;  4YQU A;  4IW9 A;  3GFK A;  3CMI A;  5CO3 A;  4X43 A;  2YOI A;  4IP6 A;  1AUC A;  4HJ2 A;  4E8E A;  1B9X C;  5CNW A;  1SJ6 A;  1GTI A;  4IP1 A;  2OBK A;  4V2M A;  2H8L A;  2LKU A;  2F51 A;  1HNB A;  4RI7 A;  4MJC A;  5CRD A;  2CX3 A;  4F0B A;  4MJA A;  3DXB A;  2EIR A;  1ZOF A;  17GS A;  2H1G A;  2RLI A;  2CVB A;  4KCE A;  1SKW B;  1MD4 A;  4MCU A;  3M0F A;  1EOG A;  3GRX A;  2DMM A;  1ZMA A;  2JZT A;  5G1L A;  5ELG A;  2DBC A;  2P5R A;  1LJR A;  4K7I A;  3UBL A;  2WFC A;  2B5Y A;  3KCM A;  2HSH A;  1OE8 A;  2WB9 A;  2HRN A;  1GNW A;  5FT3 A;  1TRU A;  3WT1 A;  1EZK A;  1JZO A;  5KN1 A;  2M46 A;  1V40 A;  2MMA A;  1TOF A;  3LEF A;  1FOV A;  4WEY A;  1GTB A;  4BA7 A;  3FR6 A;  2ZUP A;  4ZL9 A;  4LMW A;  2CVK A;  1XW5 A;  1UA5 A;  1XIY A;  2N5A A;  4XS1 A;  1TRW A;  1XOA A;  3L9U A;  4MJB A;  4YQM A;  5DAL B;  3P90 A;  1CQH A;  4POK A;  6GSU A;  2VM1 A;  4N0Z A;  3LSZ A;  5D9V A;  2O87 A;  1BJX A;  3IRA A;  2EIQ A;  4J56 E;  4YAP A;  5ECM B;  5B6N A;  3DIE A;  1G6W A;  1Y6E A;  1IYH A;  5HR2 A;  4JRR A;  4MJE A;  5G2Z A;  4K2D A;  4FYC A;  3CTF A;  4ECC A;  3TKS C;  3RHB A;  2NPB A;  1WRY A;  3H8Q A;  4WR5 A;  3RHC A;  3BCI A;  4WKW A;  1TDI A;  3ME8 A;  2M80 A;  3CXG A;  3IAS 2;  1PRX A;  3KIJ A;  5ECR B;  3TRP A;  2GSS A;  3O76 A;  1AQV A;  3SWL A;  5H5Q A;  4EE0 A;  4ISD A;  3HDC A;  4WXT A;  4EO3 A;  3Q18 A;  4D73 A;  3D5J A;  1FVJ A;  1MDJ A;  4F2I A;  1QK8 A;  2WUL A;  3KJY A;  2V2G A;  3IOS A;  1J08 A;  1G0T A;  3VWV A;  4RI6 A;  3PH9 A;  5GAP D;  1B8X A;  1PL2 A;  3VPT A;  2VAF A;  1PSQ A;  2CQ9 A;  2MZC A;  1U3A A;  2CT6 A;  3APO A;  5INY A;  4RQR A;  1ZGN A;  2VO4 A;  2BTO T;  2CZ2 A;  4HDE A;  1AAZ A;  3U5R E;  1TK8 B;  1TTZ A;  4KND A;  3TB2 A;  3QD9 A;  5IO0 A;  4K6X A;  2X99 A;  2I3Y A;  1SK0 A;  1J9B A;  3P7X A;  3KGK A;  3IHQ A;  4QL9 A;  1FO5 A;  3K8N A;  5ECH B;  4LL1 B;  1TK0 B;  2K9F A;  3UL3 A;  4QQ7 A;  2YWO A;  3EC3 A;  4WF5 A;  2H0H A;  1O6J A;  3GL5 A;  2H0I A;  4V2N A;  2E2M A;  2H74 A;  3ZMK A;  4XRD A;  5LCZ A;  1T1V A;  5ID2 B;  2C8U A;  5A4U A;  1PX7 A;  3TUE A;  1A2L A;  4MF6 A;  1TU7 A;  5IOX A;  2E2G A;  2VD1 A;  3G7Y A;  2K18 A;  4PNG A;  1YKA A;  1FHE A;  2YWI A;  4IJ3 A;  4BVX A;  3WYW A;  3QCP A;  5DJM A;  4HU9 A;  3ZTL A;  1K0A A;  2H71 A;  3IDV A;  1XZO A;  1PX6 A;  2PUK C;  3M8N A;  1BQ7 A;  4ZXG A;  1BAY A;  3D0Z A;  4ML1 A;  4OFT A;  5ECI B;  4PGT A;  2X8H A;  1I5G A;  1ERW A;  2AV4 A;  2CZ3 A;  3A5W A;  3IE3 A;  3I43 A;  2FA4 A;  3BCK A;  4POB A;  5G31 A;  3C71 A;  1EV9 A;  2NTO A;  1G6Y A;  3ZL5 A;  3APQ A;  3KD0 A;  4MF7 A;  5D96 A;  1X5E A;  5DCG A;  5GSS A;  2MMN A;  3E9J B;  4K1F A;  4Q5Q A;  4ILF A;  1N2A A;  4XHM A;  5D9X A;  1CQG A;  1SL1 B;  4DSR A;  4OFN A;  1M7T A;  3ZLP A;  2OJL A;  3NOF A;  4I5Q A;  5L71 A;  3GKM A;  4ZBB A;  2G0F A;  2QSI A;  1WP0 A;  1RW1 A;  1VF2 A;  3QR6 A;  1SJI A;  5JWO B;  4DSS A;  2YNX A;  1RK4 A;  2GQL A;  2LNT A;  4KE3 A;  3QFA C;  4EC0 A;  4AF2 A;  5D8I A;  2DJ0 A;  3RPP A;  1FB6 A;  5JWQ B;  1USB A;  4IJI A;  2N5F A;  2B7K A;  3GV1 A;  2GQK A;  4XCS A;  2XBQ A;  3W6G A;  1K0M A;  3WD6 A;  1FAA A;  1EWX A;  5DBQ A;  5EVO A;  4YAV A;  4AJ8 A;  1ACV A;  4PX1 A;  3PIN A;  5J9C A;  2L4Q A;  1S3D A;  4HOJ A;  1TRS A;  4POM A;  3IAM 2;  6GSX A;  1KBN A;  1XWB A;  1TI3 A;  4HU7 A;  2HI7 A;  1F37 A;  3MAK A;  1U87 A;  1A8L A;  1WWJ A;  16GS A;  1FB0 A;  2O89 A;  1SYX A;  1K3L A;  1YEX A;  1ON4 A;  4TKY A;  2EIO A;  1DSB A;  3DGQ A;  19GS A;  1HQO A;  1A0F A;  3GMF A;  3M3M A;  4YH2 A;  2EC4 A;  2CX4 A;  2YV7 A;  3MWH A;  5CRW A;  2CV4 A;  1X9W B;  5H5R A;  5KN2 A;  3HXS A;  2XC2 A;  2GT6 A;  2IMD A;  2HZF A;  3HA9 A;  5D73 A;  4G10 A;  2C0F A;  5G30 A;  4DEJ A;  1S3A A;  2D2Z A;  4K7O A;  3ERG A;  2NBS A;  3LYP A;  1OC9 B;  2R2J A;  1BED A;  5CAX A;  1YEP A;  1O81 A;  3ZYW A;  2PN8 A;  3KP9 A;  10GS A;  4OO4 A;  2GSR A;  3IV4 A;  4WR4 A;  3TRX A;  1SJZ A;  2V6O A;  2YP6 A;  3DWV A;  4HJM A;  4NHW A;  1Z5Y E;  3VI7 A;  1T8E B;  5IM9 A;  4N10 A;  4OFM A;  5IMV A;  5GAN D;  2P5Q A;  1EP7 A;  4JBB A;  4XRA A;  3FKF A;  1YF0 A;  2ON7 A;  3GHA A;  4FO5 A;  3DD3 A;  2YWM A;  1GP1 A;  3FR3 A;  2LRN A;  2VLT A;  4HS1 A;  4POL A;  2PVQ A;  2HNL A;  5JWR B;  3TKS A;  3F9U A;  3KTB A;  4LA1 A;  3WGE A;  2L59 A;  5B6M A;  1A23 A;  4ZL7 A;  2A2R A;  4HQZ A;  4OCE A;  2VUP A;  4FH8 A;  4I2U A;  2AHE A;  2V6K A;  4JED A;  2OKA A;  4GQF A;  3F0I A;  5LNK e;  3GKK A;  1ERV A;  3UOM A;  1GSE A;  1JFU A;  4O7H A;  3KH9 A;  1JZW A;  1OKD A;  3HKR A;  1WE0 A;  1K0C A;  1MDI A;  4ZB8 A;  4IGJ A;  1YZX A;  2O85 A;  3S9F A;  3UMA A;  2C3N A;  1GH2 A;  4L8E A;  3Q6O A;  5ENU A;  4L0U A;  6GSY A;  3FRC A; 
#chains in the Genus database with same CATH topology
 1K0O A;  2DIY A;  5DAK B;  4LL4 B;  2YZH A;  3F6D A;  5AIV A;  3RBT A;  3L4N A;  1A2M A;  2CAI A;  2L57 A;  2R4V A;  4G2E A;  1B4P A;  5EPF A;  2HRA A;  1PMT A;  1SD8 A;  1PGT A;  1A2J A;  2NVL A;  4MAB A;  1XW6 A;  1HNA A;  4IN0 A;  2FA8 A;  4GF0 A;  5G5F A;  5BMU A;  3CSH A;  3OR5 A;  3A2W A;  1O73 A;  4JU5 A;  2VLU A;  1ZZY A;  3LG6 A;  4IHU A;  2L5L A;  1O8W A;  3CBU A;  3H4K A;  2A2P A;  1K0D A;  2AAW A;  1ERU A;  2OAD A;  4ZBD A;  3U6V A;  3TJK A;  1ZYE A;  1ERT A;  3QAG A;  2B3S A;  2H70 A;  1NW2 A;  5B8B A;  5COH A;  1PA3 A;  4IVF A;  5C00 A;  3ZVJ A;  5ECO B;  2L4C A;  3J7Y k;  1V57 A;  3JCM L;  3Q74 A;  1Z6M A;  3CTG A;  2IMF A;  3KZQ A;  5JCG A;  4TXV A;  5ECN B;  1S3R A;  3VLN A;  3EMX A;  3D6I A;  3N9J A;  5F06 A;  4L5O A;  4TR4 A;  3EYT A;  2ZNM A;  4GST A;  3FZ5 A;  2GTU A;  4Z2R A;  4ML6 A;  2V1M A;  4K9Z A;  4EVM A;  1XWA A;  2ZCT A;  5KN0 A;  1YY7 A;  1EV4 A;  3VUR A;  4PNF A;  3TDG A;  1JZD A;  3IC4 A;  4OMV A;  5J3R A;  3DEX A;  2LUS A;  4PQI A;  2H1A A;  3APS A;  4BL7 A;  4DSQ A;  4D73 B;  3IA1 A;  2H66 A;  3N5O A;  5BRT A;  4MP4 A;  2TRX A;  6GSV A;  2AYT A;  1R7H A;  2JZS A;  4TRX A;  4HQS A;  2QGV A;  1U6T A;  2H72 A;  1FW1 A;  3QPM A;  4V1A p;  5B8A A;  3ZFL A;  3UAR A;  2IPA A;  2VL2 C;  5HR1 A;  5J9B A;  5DAL A;  3Q19 A;  3L9V A;  2ALB A;  3ME7 A;  1GSF A;  3LQ7 A;  4CY8 A;  2AJQ B;  2A2S A;  2KP1 A;  2B1L A;  2IMI A;  3ZIV A;  2ON5 A;  4TXO A;  1G7E A;  5DVB A;  2F8A A;  1NHO A;  4GRF A;  1OYJ A;  3HVV A;  3WGX A;  2FWG A;  1SKS B;  2H73 A;  2CA8 A;  1PN0 A;  4ZB6 A;  2DKH A;  5E4W A;  2PER A;  4NWY A;  2HFD A;  1WJK A;  2LRT A;  4XS6 A;  5KOW A;  2H1B A;  1K0B A;  3GTU A;  1JZR A;  4DVC A;  2LS5 A;  4CW9 A;  5IMC A;  3GUS A;  5GST A;  3FR9 A;  4ULX A;  3HHV A;  4N30 A;  1XCC A;  3RPN A;  1QXH A;  2VCQ A;  5IPH A;  2WRT A;  1EGO A;  2FHE A;  3TKS E;  4PUR A;  1TRV A;  1EOH A;  2OBI A;  1QMV A;  2C1Y A;  4HZ4 A;  3O3T A;  1PN9 A;  1T4Y A;  1OE7 A;  1XFL A;  2K8S A;  3FZ4 A;  1GSQ A;  3V1W A;  3TJJ A;  4JE1 A;  1Z7R A;  2OE0 A;  4Z2U A;  5FWG A;  2O8V B;  4NXI A;  3HVN A;  4RQX A;  1I9D A;  3IBH A;  18GS A;  2L6C A;  3HJM A;  1F9M A;  4TVE A;  4JR4 A;  4TR3 A;  1TW9 A;  1MEK A;  1V9W A;  4TW5 A;  1J0F A;  1UVZ A;  1M2B A;  3VWW A;  2B1K A;  3M1G A;  4FYB A;  3IR4 A;  3FZA A;  2GS3 A;  3VWX A;  1WIK A;  5DJL A;  2H0G A;  5ECS A;  1SYR A;  2FGX A;  3UEM A;  1MDK A;  4EDY A;  4TOP A;  3VPQ A;  2OE3 A;  3A2V A;  3FYG A;  2KHP A;  2FWF A;  4XS4 B;  4HI7 A;  2WS2 A;  3RAZ A;  2VM2 A;  2LRC A;  2VCZ A;  3DVW A;  2I9H A;  2F9S A;  3KTL A;  4DSS B;  2AUV A;  5IMZ A;  1R5P A;  3TCO A;  3M9K A;  2C3Q A;  2RII A;  3FHK A;  3QAV A;  1WOU A;  4MH3 A;  1GSU A;  5ID2 A;  1NSW A;  1V2A A;  3D21 A;  4MZW A;  2MMO A;  2YV9 A;  3EWL A;  5A5K A;  1O85 A;  2DJ2 A;  4TR1 B;  1VF4 A;  1M2D A;  5FHI A;  1GTU A;  2QC7 A;  2WCI A;  4KDX A;  3HYP A;  20GS A;  4ZB9 A;  1ILO A;  3F4T A;  3HZ4 A;  2PMT A;  2FCH A;  3GYK A;  2GLR A;  5CYY A;  1PQN A;  2MBS A;  1GNE A;  3ZRE A;  2JAD A;  4BWS A;  1SL0 B;  1EP8 A;  1SK2 A;  2V41 A;  1X5C A;  1BG5 A;  1VGL A;  3E0U A;  4F9Z A;  2WJU A;  4JZQ A;  1AC1 A;  2P0G A;  4KB3 A;  2FY6 A;  4ACS A;  4J57 E;  3UVT A;  1R26 A;  2R6K A;  4BPY A;  4I97 A;  2GDR A;  4MDC A;  5CRH A;  3TGZ A;  1X9S B;  3F6F A;  4EXJ A;  12GS A;  3VK9 A;  5LD0 A;  3NZN A;  2H19 A;  2X8C A;  4G0I A;  1GLQ A;  5AGY A;  2VCV A;  22GS A;  3LFL A;  4G0K A;  1AQW A;  2GGT A;  1AQX A;  2E0Q A;  4KDY A;  5HFK A;  5KN3 A;  2KUC A;  3LJR A;  5AIX A;  5IIZ A;  1KEB A;  2K8V A;  2HYX A;  13GS A;  3NIV A;  3CRU A;  1VF3 A;  4L0W A;  2H6Y A;  3HVX A;  9GSS A;  3ERW A;  1OC3 A;  6GSW A;  1XW9 A;  2I4A A;  4BVY A;  4OWY A;  4ID0 A;  5IOW A;  1K0N A;  2F8F A;  3EPT A;  4AJ6 A;  3QOU A;  5D9W A;  2I1U A;  4EUY A;  1T00 A;  1KTE A;  2DJK A;  2Z9S A;  2IFQ A;  1E2Y A;  4O5R A;  2IME A;  4BWQ A;  3TJG A;  3G9B A;  3EU3 A;  1O7U A;  1SL2 B;  3FY7 A;  2A4V A;  3LW9 A;  5CRG A;  2J23 A;  3FW2 A;  3FZ9 A;  2LST A;  2L6D A;  1GTA A;  1AIU A;  2JU5 A;  1W89 A;  2LJA A;  4P3Y B;  4KGI A;  2C4J A;  3G7I A;  2B6M A;  3AY8 A;  2X64 A;  3SBC A;  1VF1 A;  1ZL9 A;  1SD9 A;  4KW6 A;  4O5Q A;  1F6M C;  3IXR A;  4LMV A;  5DDL A;  2H6Z A;  2H76 A;  5G5E A;  3GN3 A;  5B7C A;  1HD2 A;  1OAZ A;  4H86 A;  3TRQ A;  3HCZ A;  5C04 A;  4F0C A;  1YKC A;  4NAX A;  2LTK A;  1TXX A;  2R0P A;  3MIX A;  1JLW A;  3GX8 A;  3EE2 A;  4HEA 2;  6GSS A;  5KEJ A;  1ZYN A;  1OVN A;  4FIW A;  3R2Q A;  3LXZ A;  4I8B A;  1XWK A;  3HD5 A;  2F3M A;  2HZE A;  4AGS A;  4F82 A;  2JSZ A;  2G2Q A;  3D22 A;  3LOR A;  3CSJ A;  2H01 A;  4YKF A;  3GUR A;  2RUF A;  2AB6 A;  1BYE A;  3GKN A;  3TKP A;  3ZZX A;  4MK3 A;  1F3A A;  2C3T A;  3EMP A;  3PPU A;  2VL2 A;  2PU9 C;  2GVP A;  2MMZ A;  1DUG A;  4K0G A;  2YPM A;  4XTS A;  2LNS A;  2K6V A;  3H1N A;  1GUH A;  1FVK A;  1TK5 B;  1S3C A;  2KP2 A;  4X1U A;  1XWG A;  2YJH A;  2TIR A;  4Q5R A;  3P8W A;  4EIP A;  5JCW A;  3HJO A;  5F05 A;  2XBI A;  3GL3 A;  3R3E A;  1HYU A;  2N5B A;  1IYI A;  2H75 A;  3L78 A;  1ST9 A;  2BJX A;  3UIW A;  2L5O A;  6GST A;  4GQC A;  5DQY A;  5EL8 A;  3TKQ A;  2GSQ A;  2R5G A;  3C7M A;  2YZU A;  3HVS A;  4LLR A;  4USS A;  4MMM A;  5HFI A;  4PUA A;  3WGD A;  3KMO A;  7GSS A;  1Z7P A;  3W8S A;  1X5D A;  3QMX A;  1OC8 A;  1XVQ A;  2GT5 A;  3BOA A;  4G9H A;  1T4Z A;  5HR0 A;  1C72 A;  4MA9 A;  3P2A A;  2FWH A;  3LWA A;  4ZL8 A;  1JLV A;  3A2X A;  4MPF A;  3GH6 A;  8GSS A;  4EIQ A;  5IMF A;  1GSS A;  4PUF C;  3F4R A;  5DAK A;  4IBP A;  1XVW A;  2YN1 A;  1XPV A;  4X0X A;  1LBK A;  3HY2 A;  2HLS A;  5IO2 A;  1QGV A;  1URM A;  3PR8 A;  3ERF A;  4CHS A;  1Y25 A;  2RM6 A;  3EVI A;  1AW9 A;  1OKT A;  1M9A A;  4MNN A;  3IK7 A;  4XIH A;  2OA7 A;  1TJD A;  5KOX A;  3DYR A;  4TN8 A;  5ELA A;  5A4V A;  2QKE A;  1XBS A;  2H6X A;  4NPB A;  2VL3 A;  5JCU A;  4KSO A;  3TJB A;  4GSS A;  4K0N A;  1F3B A;  5HQP A;  2FNO A;  1RQM A;  1XWC A;  2VCW A;  3F8U A;  1WPI A;  4GSN A;  2GQM A;  3ZFB A;  5A4W A;  2QA2 A;  4MH2 A;  4EL1 A;  1MD3 A;  4ECI A;  5HFG A;  2A4H A;  3EUR A;  3FK8 A;  1M99 A;  4EKZ A;  3I69 A;  3ZIT A;  3GNJ A;  3IPZ A;  4JR6 A;  2IMK A;  4TXO B;  1U3I A;  4GLT A;  3F3Q A;  1B48 A;  2XPD A;  4KSM A;  3L0H A;  2DKI A;  4KAE A;  1Z6N A;  3ZIJ A;  3PGT A;  1GUL A;  1Z3E A;  1EEM A;  4ECJ A;  1FG4 A;  2DJ3 A;  3GA4 A;  2LQO A;  5D93 A;  3GX0 A;  3KXO A;  1SK1 A;  3GH9 A;  3C73 A;  5J41 A;  3GTU B;  4N11 A;  2IN3 A;  3H79 A;  4KCA A;  4K8M A;  2YAN A;  1YDK A;  3EU4 A;  3ZRD A;  1GWC A;  2WZ9 A;  1E6B A;  1DBY A;  1GLP A;  2LV3 A;  1DE1 A;  1LU4 A;  3C1R A;  2VCX A;  3GST A;  4K5S A;  1THO A;  1AXD A;  1FOH A;  5F07 A;  3ZVJ D;  2PWJ A;  1PKW A;  4WF4 A;  3HZ8 A;  4ZIL A;  3UVH A;  2DC5 A;  4KDU A;  2RM5 A;  1SEN A;  4V2L A;  3TKR A;  4YKG A;  4KH7 A;  3VI5 A;  2X8G A;  2VOC A;  1N8J A;  5GZZ B;  3G7J A;  2MBT A;  2OAC A;  1THX A;  4K2X A;  3UJ1 A;  1Q4J A;  4F03 A;  4O32 A;  1U88 A;  4IQ1 A;  5IMD A;  1A0R P;  3W8J A;  1PKZ A;  4BVX B;  4PXO A;  5IMA A;  1TU8 A;  3FEU A;  1SKR B;  3DML A;  2REM A;  3F3R A;  5DCH A;  3KMN A;  1UN2 A;  4GTU A;  3F63 A;  3E3E A;  4TR0 A;  1GRX A;  5ECL B;  4WBR D;  4ECB A;  3VWU A;  1HNC A;  4GWR A;  2KLX A;  5H5S A;  3QAW A;  4MLY A;  1MTC A;  2NDO A;  2FUG 2;  4OO5 A;  4OD7 A;  4KX4 A;  3KP8 A;  2LJR A;  2OE1 A;  1X0R A;  2DLX A;  2IWT A;  2LEG A;  4HUA A;  3WT2 A;  3MSZ A;  1XG8 A;  1PD2 1;  3O6T A;  2HRF A;  4PQH A;  1JHB A;  1QQ2 A;  1K3Y A;  1M2A A;  5D9T A;  2VLV A;  5J4U A;  1SU9 A;  5ABR A;  4NMU A;  3D4T A;  3DVX A;  3TJF A;  3C1S A;  2B7J A;  2CVD A;  3I9V 2;  2DSA A;  3IC8 A;  2PGT A;  3CSI A;  1M0U A;  2HE3 A;  1B4Q A;  2IL3 A;  2VCT A;  1KNG A;  4WET A;  2IIY A;  3CRT A;  1EEJ A;  4EF0 A;  3QFB C;  2X4A A;  14GS A;  3C8E A;  3F4S A;  4IKH A;  4NV2 A;  1GUM A;  3ISO A;  3TOT A;  2TRC P;  5G1K A;  4MZC A;  1M9B A;  2V32 A;  4MF5 A;  3GSS A;  4XS4 A;  2FWE A;  4IS0 A;  3KM6 A;  1DE2 A;  4K7N A;  2HT9 A;  3A3T A;  2I81 A;  2FLS A;  3DKS A;  3A5I A;  2J9H A;  1V98 A;  2XPE A;  3IK9 A;  4YQV A;  4NV5 A;  5IQY A;  2JAC A;  2HXK A;  2JSY A;  4PQ1 A;  2UZ8 A;  3UBK A;  1A24 A;  1X9M B;  1GSY A;  2IJY A;  4BVY B;  2B5E A;  4TR1 A;  3VFI A;  2C0D A;  11GS A;  2WDU A;  3QDN A;  4OCF A;  3ZML A;  2R3X A;  2IFQ B;  1GUK A;  4RUV A;  3LXT A;  4IQA A;  4V1A g;  5ECP B;  2DJ1 A;  2GZY A;  1TP9 A;  2WGR A;  1Q98 A;  3D4M A;  2DIZ A;  3HJP A;  1GL8 A;  4MPG A;  4Q5N A;  2R37 A;  1VRS D;  1BX9 A;  4ZBA A;  3I6A A;  1QUW A;  1H4O A;  1T7P B;  2DML A;  2M72 A;  3TOU A;  5F0G A;  3GIX A;  1XXU A;  1G7O A;  4EDZ A;  3KH7 A;  1YQ1 A;  5AIS A;  2PBJ A;  3MYD A;  4KA0 A;  5CP1 A;  1GSD A;  3MDK A;  1A8Y A;  2FD3 A;  1R5A A;  3BD2 A;  2VD0 A;  4WBJ A;  3J7Y b;  2P31 A;  2B5X A;  2PVO C;  2C0G A;  5EY6 A;  2LQQ A;  2X49 A;  2JL4 A;  2C0E A;  1QFN A;  2YCD A;  4IEL A;  1ZCP A;  2HZE B;  5DQS A;  5ECQ B;  5F8B A;  4CY6 A;  4GXZ A;  4L5L A;  2GZP A;  3CYN A;  4QL7 A;  1ZYP A;  3LGC A;  1K3O A;  3H93 A;  4ZIJ A;  4Q5F A;  4FYU A;  3ED3 A;  4NHZ A;  2BMX A;  2DJJ A;  1F2E A;  4I6X A;  2YWN A;  3EIN A;  3RDW A;  5ECK B;  2KOK A;  2H1D A;  1YF1 A;  1R4W A;  4Z7X A;  4MZB A;  5IPG A;  1M3J A;  2H30 A;  1XOB A;  1ZYQ B;  2RUE A;  2PPT A;  3UAP A;  4FQU A;  2MYG A;  4E8H A;  1NM3 A;  2C80 A;  1EGR A;  5HR3 A;  3MNG A;  3LYK A;  1B9Y C;  2YJ7 A;  3BJ5 A;  4N0V A;  4AJ7 A;  1O8X A;  2E7P A;  4J2F A;  3DRN A;  1OC9 A;  3L9S A;  3US3 A;  2VIM A;  1WMJ A;  1ABA A;  4HZ2 A;  1T3B A;  1TI1 A;  4GCI A;  1W4V A;  1YJ6 A;  2ES7 A;  4G19 A;  2GZZ A;  2LJK A;  1TKD B;  1ML6 A;  3GKX A;  2O7K A;  5J5N A;  2XHF A;  3BBY A;  5AN1 A;  5CRE A;  2HSY A;  3KEB A;  4I2T A;  1H75 A;  1Z9H A;  5E59 A;  1PL1 A;  2VL9 A;  4KUN A;  4CDO A;  2CAQ A;  4Z2T A;  3M9J A;  2GST A;  2JZR A;  1UC7 A;  4O92 A;  1NHY A;  1V58 A;  4YQU A;  4IW9 A;  3GFK A;  3CMI A;  5CO3 A;  4A5P A;  4X43 A;  2YOI A;  4IP6 A;  1AUC A;  4HJ2 A;  4E8E A;  1B9X C;  5CNW A;  1SJ6 A;  1GTI A;  4IP1 A;  2OBK A;  4V2M A;  2H8L A;  2LKU A;  2F51 A;  1HNB A;  4RI7 A;  3FMW A;  4MJC A;  5CRD A;  2CX3 A;  4F0B A;  4MJA A;  3DXB A;  2EIR A;  1ZOF A;  17GS A;  2H1G A;  2RLI A;  2CVB A;  4KCE A;  1SKW B;  1MD4 A;  4MCU A;  3M0F A;  1EOG A;  3GRX A;  2DMM A;  1ZMA A;  2JZT A;  5G1L A;  5ELG A;  2DBC A;  2P5R A;  1LJR A;  4K7I A;  3UBL A;  2WFC A;  2B5Y A;  3KCM A;  2HSH A;  1OE8 A;  2WB9 A;  2HRN A;  4BL7 B;  1GNW A;  4O5U A;  5FT3 A;  4KF9 A;  1TRU A;  3WT1 A;  1EZK A;  1JZO A;  5KN1 A;  2M46 A;  1V40 A;  2MMA A;  1TOF A;  3LEF A;  1FOV A;  4WEY A;  1GTB A;  4BA7 A;  3FR6 A;  2ZUP A;  4ZL9 A;  4LMW A;  2CVK A;  1XW5 A;  1UA5 A;  1XIY A;  2N5A A;  4XS1 A;  1TRW A;  1XOA A;  3L9U A;  4MJB A;  4YQM A;  5DAL B;  3P90 A;  1CQH A;  4POK A;  6GSU A;  2VM1 A;  4N0Z A;  3LSZ A;  5D9V A;  2O87 A;  1BJX A;  3IRA A;  2EIQ A;  4J56 E;  2R0G A;  4YAP A;  5ECM B;  5B6N A;  3DIE A;  1G6W A;  1Y6E A;  1IYH A;  5HR2 A;  4JRR A;  4MJE A;  5G2Z A;  4K2D A;  4FYC A;  3CTF A;  4ECC A;  3TKS C;  3RHB A;  2NPB A;  1WRY A;  3H8Q A;  4WR5 A;  3RHC A;  3BCI A;  4WKW A;  1TDI A;  3ME8 A;  2M80 A;  3CXG A;  3IAS 2;  1PRX A;  3KIJ A;  5ECR B;  3TRP A;  2GSS A;  3O76 A;  1AQV A;  3SWL A;  5H5Q A;  4EE0 A;  4ISD A;  3HDC A;  4WXT A;  4EO3 A;  3Q18 A;  4D73 A;  3D5J A;  1FVJ A;  1MDJ A;  4F2I A;  1QK8 A;  2WUL A;  3KJY A;  3IHG A;  2V2G A;  3IOS A;  1J08 A;  1G0T A;  3VWV A;  4RI6 A;  3PH9 A;  5GAP D;  1B8X A;  1PL2 A;  1PFO A;  3VPT A;  2VAF A;  1PSQ A;  2CQ9 A;  2MZC A;  1U3A A;  2CT6 A;  3APO A;  5INY A;  4RQR A;  1ZGN A;  2VO4 A;  2BTO T;  2CZ2 A;  4HDE A;  4PTS A;  1AAZ A;  3U5R E;  1TK8 B;  1TTZ A;  4KND A;  3TB2 A;  3QD9 A;  5IO0 A;  4K6X A;  2X99 A;  2I3Y A;  1SK0 A;  2QA1 A;  1J9B A;  3P7X A;  3KGK A;  3IHQ A;  4QL9 A;  1FO5 A;  3K8N A;  5ECH B;  4LL1 B;  1TK0 B;  2K9F A;  3UL3 A;  4QQ7 A;  2YWO A;  3EC3 A;  4WF5 A;  2H0H A;  1O6J A;  3GL5 A;  2H0I A;  4V2N A;  2E2M A;  2H74 A;  3ZMK A;  4XRD A;  5LCZ A;  1T1V A;  5ID2 B;  2C8U A;  5A4U A;  1PX7 A;  3TUE A;  1A2L A;  4MF6 A;  1TU7 A;  5IOX A;  2E2G A;  2VD1 A;  3G7Y A;  2K18 A;  4PNG A;  1YKA A;  1FHE A;  2YWI A;  4IJ3 A;  4BVX A;  3WYW A;  3QCP A;  5DJM A;  4HU9 A;  3ZTL A;  1K0A A;  2H71 A;  3IDV A;  1XZO A;  1PX6 A;  2PUK C;  3M8N A;  1BQ7 A;  4ZXG A;  1BAY A;  3D0Z A;  4ML1 A;  4OFT A;  5ECI B;  2R0C A;  4PGT A;  2X8H A;  1I5G A;  1ERW A;  2AV4 A;  2CZ3 A;  3A5W A;  3IE3 A;  4K5R A;  3I43 A;  2FA4 A;  3BCK A;  4POB A;  5G31 A;  3C71 A;  1EV9 A;  2NTO A;  1G6Y A;  3ZL5 A;  3APQ A;  3KD0 A;  4MF7 A;  5D96 A;  1X5E A;  2HSM A;  5DCG A;  5GSS A;  2MMN A;  3E9J B;  4K1F A;  4Q5Q A;  4ILF A;  1N2A A;  4XHM A;  5D9X A;  1CQG A;  1SL1 B;  4BIK A;  4DSR A;  4OFN A;  1M7T A;  3ZLP A;  2OJL A;  3NOF A;  4HSC X;  4I5Q A;  5L71 A;  3GKM A;  4ZBB A;  2G0F A;  2QSI A;  1WP0 A;  1RW1 A;  1VF2 A;  3QR6 A;  1SJI A;  5JWO B;  4DSS A;  2YNX A;  1RK4 A;  2GQL A;  2LNT A;  4KE3 A;  3QFA C;  4EC0 A;  4AF2 A;  5D8I A;  2DJ0 A;  3RPP A;  1FB6 A;  5JWQ B;  1USB A;  4IJI A;  2N5F A;  2B7K A;  3GV1 A;  2GQK A;  4XCS A;  2XBQ A;  3W6G A;  1K0M A;  3WD6 A;  1FAA A;  1EWX A;  5DBQ A;  5EVO A;  4YAV A;  4AJ8 A;  1ACV A;  4PX1 A;  3PIN A;  5J9C A;  2L4Q A;  1S3D A;  4HOJ A;  1TRS A;  4POM A;  1M3I A;  3IAM 2;  6GSX A;  1KBN A;  1XWB A;  1TI3 A;  4HU7 A;  2HI7 A;  1F37 A;  3MAK A;  1U87 A;  1A8L A;  1WWJ A;  16GS A;  1FB0 A;  2O89 A;  1SYX A;  1K3L A;  1YEX A;  1ON4 A;  4TKY A;  2EIO A;  1DSB A;  3DGQ A;  19GS A;  1HQO A;  1A0F A;  3GMF A;  3M3M A;  4YH2 A;  2EC4 A;  2CX4 A;  2YV7 A;  3MWH A;  5CRW A;  2CV4 A;  1X9W B;  5H5R A;  5KN2 A;  3HXS A;  2XC2 A;  2GT6 A;  2IMD A;  2HZF A;  3HA9 A;  5D73 A;  4G10 A;  2C0F A;  5G30 A;  4DEJ A;  1S3A A;  2D2Z A;  4K7O A;  3ERG A;  2NBS A;  3LYP A;  1OC9 B;  2R2J A;  1BED A;  5CAX A;  1YEP A;  1O81 A;  3ZYW A;  2PN8 A;  3KP9 A;  10GS A;  4OO4 A;  2GSR A;  3IV4 A;  4WR4 A;  3TRX A;  1SJZ A;  2V6O A;  2YP6 A;  3DWV A;  4HJM A;  4NHW A;  1Z5Y E;  3VI7 A;  1T8E B;  5IM9 A;  4N10 A;  4OFM A;  5IMV A;  5GAN D;  2P5Q A;  1EP7 A;  4JBB A;  4XRA A;  3FKF A;  1YF0 A;  2ON7 A;  3GHA A;  4FO5 A;  3DD3 A;  2YWM A;  1GP1 A;  3FR3 A;  2LRN A;  2VLT A;  4HS1 A;  4POL A;  2PVQ A;  2HNL A;  5JWR B;  3TKS A;  3F9U A;  3KTB A;  4X4J A;  4LA1 A;  3WGE A;  2L59 A;  5B6M A;  1A23 A;  2HRK A;  4ZL7 A;  2A2R A;  4HQZ A;  4OCE A;  2VUP A;  4FH8 A;  4I2U A;  2AHE A;  2V6K A;  4JED A;  2OKA A;  4GQF A;  3F0I A;  5LNK e;  3GKK A;  1ERV A;  3UOM A;  4G0L A;  1GSE A;  1JFU A;  4O7H A;  3CQF A;  3KH9 A;  1JZW A;  1OKD A;  4ICY A;  3HKR A;  1WE0 A;  1K0C A;  1MDI A;  4ZB8 A;  4IGJ A;  1YZX A;  2O85 A;  3S9F A;  3UMA A;  2C3N A;  1GH2 A;  4L8E A;  3Q6O A;  5ENU A;  4L0U A;  6GSY A;  3FRC A; 
#chains in the Genus database with same CATH homology
 1K0O A;  2DIY A;  5DAK B;  4LL4 B;  2YZH A;  3F6D A;  5AIV A;  3RBT A;  3L4N A;  1A2M A;  2CAI A;  2L57 A;  2R4V A;  4G2E A;  1B4P A;  5EPF A;  2HRA A;  1PMT A;  1SD8 A;  1PGT A;  1A2J A;  2NVL A;  4MAB A;  1XW6 A;  1HNA A;  4IN0 A;  2FA8 A;  4GF0 A;  5G5F A;  5BMU A;  3CSH A;  3OR5 A;  3A2W A;  1O73 A;  4JU5 A;  2VLU A;  1ZZY A;  3LG6 A;  4IHU A;  2L5L A;  1O8W A;  3CBU A;  3H4K A;  2A2P A;  1K0D A;  2AAW A;  1ERU A;  2OAD A;  4ZBD A;  3U6V A;  3TJK A;  1ZYE A;  1ERT A;  3QAG A;  2B3S A;  2H70 A;  1NW2 A;  5B8B A;  5COH A;  1PA3 A;  4IVF A;  5C00 A;  3ZVJ A;  5ECO B;  2L4C A;  3J7Y k;  1V57 A;  3JCM L;  3Q74 A;  1Z6M A;  3CTG A;  2IMF A;  3KZQ A;  5JCG A;  4TXV A;  5ECN B;  3VLN A;  3EMX A;  3D6I A;  3N9J A;  5F06 A;  4L5O A;  4TR4 A;  3EYT A;  2ZNM A;  4GST A;  3FZ5 A;  2GTU A;  4Z2R A;  4ML6 A;  2V1M A;  4K9Z A;  4EVM A;  1XWA A;  2ZCT A;  5KN0 A;  1YY7 A;  1EV4 A;  3VUR A;  4PNF A;  3TDG A;  1JZD A;  3IC4 A;  4OMV A;  5J3R A;  3DEX A;  2LUS A;  4PQI A;  2H1A A;  3APS A;  4BL7 A;  4DSQ A;  4D73 B;  3IA1 A;  2H66 A;  3N5O A;  5BRT A;  4MP4 A;  2TRX A;  6GSV A;  2AYT A;  1R7H A;  2JZS A;  4TRX A;  4HQS A;  2QGV A;  1U6T A;  2H72 A;  1FW1 A;  3QPM A;  4V1A p;  5B8A A;  3ZFL A;  3UAR A;  2IPA A;  2VL2 C;  5HR1 A;  5J9B A;  5DAL A;  3Q19 A;  3L9V A;  2ALB A;  3ME7 A;  1GSF A;  3LQ7 A;  4CY8 A;  2AJQ B;  2A2S A;  2KP1 A;  2B1L A;  2IMI A;  3ZIV A;  2ON5 A;  4TXO A;  1G7E A;  5DVB A;  2F8A A;  1NHO A;  4GRF A;  1OYJ A;  3HVV A;  3WGX A;  2FWG A;  1SKS B;  2H73 A;  2CA8 A;  1PN0 A;  4ZB6 A;  2DKH A;  5E4W A;  2PER A;  4NWY A;  2HFD A;  1WJK A;  2LRT A;  4XS6 A;  5KOW A;  2H1B A;  1K0B A;  3GTU A;  1JZR A;  4DVC A;  2LS5 A;  4CW9 A;  5IMC A;  3GUS A;  5GST A;  3FR9 A;  4ULX A;  3HHV A;  4N30 A;  1XCC A;  3RPN A;  1QXH A;  2VCQ A;  5IPH A;  2WRT A;  1EGO A;  2FHE A;  3TKS E;  4PUR A;  1TRV A;  1EOH A;  2OBI A;  1QMV A;  2C1Y A;  4HZ4 A;  3O3T A;  1PN9 A;  1T4Y A;  1OE7 A;  1XFL A;  2K8S A;  3FZ4 A;  1GSQ A;  3V1W A;  3TJJ A;  4JE1 A;  1Z7R A;  2OE0 A;  4Z2U A;  5FWG A;  2O8V B;  4NXI A;  4RQX A;  1I9D A;  3IBH A;  18GS A;  2L6C A;  3HJM A;  1F9M A;  4TVE A;  4JR4 A;  4TR3 A;  1TW9 A;  1MEK A;  1V9W A;  4TW5 A;  1J0F A;  1UVZ A;  1M2B A;  3VWW A;  2B1K A;  3M1G A;  4FYB A;  3IR4 A;  3FZA A;  2GS3 A;  3VWX A;  1WIK A;  5DJL A;  2H0G A;  5ECS A;  1SYR A;  2FGX A;  3UEM A;  1MDK A;  4EDY A;  4TOP A;  3VPQ A;  2OE3 A;  3A2V A;  3FYG A;  2KHP A;  2FWF A;  4XS4 B;  4HI7 A;  2WS2 A;  3RAZ A;  2VM2 A;  2LRC A;  2VCZ A;  3DVW A;  2I9H A;  2F9S A;  3KTL A;  4DSS B;  2AUV A;  5IMZ A;  1R5P A;  3TCO A;  3M9K A;  2C3Q A;  2RII A;  3FHK A;  3QAV A;  1WOU A;  4MH3 A;  1GSU A;  5ID2 A;  1NSW A;  1V2A A;  3D21 A;  4MZW A;  2MMO A;  2YV9 A;  3EWL A;  5A5K A;  1O85 A;  2DJ2 A;  4TR1 B;  1VF4 A;  1M2D A;  5FHI A;  1GTU A;  2QC7 A;  2WCI A;  4KDX A;  3HYP A;  20GS A;  4ZB9 A;  1ILO A;  3F4T A;  3HZ4 A;  2PMT A;  2FCH A;  3GYK A;  2GLR A;  5CYY A;  1PQN A;  2MBS A;  1GNE A;  3ZRE A;  2JAD A;  4BWS A;  1SL0 B;  1EP8 A;  1SK2 A;  2V41 A;  1X5C A;  1BG5 A;  1VGL A;  3E0U A;  4F9Z A;  2WJU A;  4JZQ A;  1AC1 A;  2P0G A;  4KB3 A;  2FY6 A;  4ACS A;  4J57 E;  3UVT A;  1R26 A;  2R6K A;  4BPY A;  4I97 A;  2GDR A;  4MDC A;  5CRH A;  3TGZ A;  1X9S B;  3F6F A;  4EXJ A;  12GS A;  3VK9 A;  5LD0 A;  3NZN A;  2H19 A;  2X8C A;  4G0I A;  1GLQ A;  5AGY A;  2VCV A;  22GS A;  3LFL A;  4G0K A;  1AQW A;  2GGT A;  1AQX A;  2E0Q A;  4KDY A;  5HFK A;  5KN3 A;  2KUC A;  3LJR A;  5AIX A;  5IIZ A;  1KEB A;  2K8V A;  2HYX A;  13GS A;  3NIV A;  3CRU A;  1VF3 A;  4L0W A;  2H6Y A;  3HVX A;  9GSS A;  3ERW A;  1OC3 A;  6GSW A;  1XW9 A;  2I4A A;  4BVY A;  4OWY A;  4ID0 A;  5IOW A;  1K0N A;  2F8F A;  3EPT A;  4AJ6 A;  3QOU A;  5D9W A;  2I1U A;  4EUY A;  1T00 A;  1KTE A;  2DJK A;  2Z9S A;  2IFQ A;  1E2Y A;  4O5R A;  2IME A;  4BWQ A;  3TJG A;  3G9B A;  3EU3 A;  1O7U A;  1SL2 B;  3FY7 A;  2A4V A;  3LW9 A;  5CRG A;  2J23 A;  3FW2 A;  3FZ9 A;  2LST A;  2L6D A;  1GTA A;  1AIU A;  2JU5 A;  1W89 A;  2LJA A;  4P3Y B;  4KGI A;  2C4J A;  3G7I A;  2B6M A;  3AY8 A;  2X64 A;  3SBC A;  1VF1 A;  1ZL9 A;  1SD9 A;  4KW6 A;  4O5Q A;  1F6M C;  3IXR A;  4LMV A;  5DDL A;  2H6Z A;  2H76 A;  5G5E A;  3GN3 A;  5B7C A;  1HD2 A;  1OAZ A;  4H86 A;  3TRQ A;  3HCZ A;  5C04 A;  4F0C A;  1YKC A;  4NAX A;  2LTK A;  1TXX A;  2R0P A;  3MIX A;  1JLW A;  3GX8 A;  3EE2 A;  4HEA 2;  6GSS A;  5KEJ A;  1ZYN A;  1OVN A;  4FIW A;  3R2Q A;  3LXZ A;  4I8B A;  1XWK A;  3HD5 A;  2F3M A;  2HZE A;  4AGS A;  4F82 A;  2JSZ A;  2G2Q A;  3D22 A;  3LOR A;  3CSJ A;  2H01 A;  4YKF A;  3GUR A;  2RUF A;  2AB6 A;  1BYE A;  3GKN A;  3TKP A;  3ZZX A;  4MK3 A;  1F3A A;  2C3T A;  3EMP A;  3PPU A;  2VL2 A;  2PU9 C;  2GVP A;  2MMZ A;  1DUG A;  4K0G A;  2YPM A;  4XTS A;  2LNS A;  2K6V A;  3H1N A;  1GUH A;  1FVK A;  1TK5 B;  1S3C A;  2KP2 A;  4X1U A;  1XWG A;  2YJH A;  2TIR A;  4Q5R A;  3P8W A;  4EIP A;  5JCW A;  3HJO A;  5F05 A;  2XBI A;  3GL3 A;  3R3E A;  1HYU A;  2N5B A;  1IYI A;  2H75 A;  3L78 A;  1ST9 A;  2BJX A;  3UIW A;  2L5O A;  6GST A;  4GQC A;  5DQY A;  5EL8 A;  3TKQ A;  2GSQ A;  2R5G A;  3C7M A;  2YZU A;  3HVS A;  4LLR A;  4USS A;  4MMM A;  5HFI A;  4PUA A;  3WGD A;  3KMO A;  7GSS A;  1Z7P A;  3W8S A;  1X5D A;  3QMX A;  1OC8 A;  1XVQ A;  2GT5 A;  3BOA A;  4G9H A;  1T4Z A;  5HR0 A;  1C72 A;  4MA9 A;  3P2A A;  2FWH A;  3LWA A;  4ZL8 A;  1JLV A;  3A2X A;  4MPF A;  3GH6 A;  8GSS A;  4EIQ A;  5IMF A;  1GSS A;  4PUF C;  3F4R A;  5DAK A;  4IBP A;  1XVW A;  2YN1 A;  1XPV A;  4X0X A;  1LBK A;  3HY2 A;  2HLS A;  5IO2 A;  1QGV A;  1URM A;  3PR8 A;  3ERF A;  4CHS A;  1Y25 A;  2RM6 A;  3EVI A;  1AW9 A;  1OKT A;  1M9A A;  4MNN A;  3IK7 A;  4XIH A;  2OA7 A;  1TJD A;  5KOX A;  3DYR A;  4TN8 A;  5ELA A;  5A4V A;  2QKE A;  1XBS A;  2H6X A;  4NPB A;  2VL3 A;  5JCU A;  4KSO A;  3TJB A;  4GSS A;  4K0N A;  1F3B A;  5HQP A;  2FNO A;  1RQM A;  1XWC A;  2VCW A;  3F8U A;  1WPI A;  4GSN A;  2GQM A;  3ZFB A;  5A4W A;  2QA2 A;  4MH2 A;  4EL1 A;  1MD3 A;  4ECI A;  5HFG A;  2A4H A;  3EUR A;  3FK8 A;  1M99 A;  4EKZ A;  3I69 A;  3ZIT A;  3GNJ A;  3IPZ A;  4JR6 A;  2IMK A;  4TXO B;  1U3I A;  4GLT A;  3F3Q A;  1B48 A;  2XPD A;  4KSM A;  3L0H A;  2DKI A;  4KAE A;  1Z6N A;  3ZIJ A;  3PGT A;  1GUL A;  1Z3E A;  1EEM A;  4ECJ A;  1FG4 A;  2DJ3 A;  3GA4 A;  2LQO A;  5D93 A;  3GX0 A;  3KXO A;  1SK1 A;  3GH9 A;  3C73 A;  5J41 A;  3GTU B;  4N11 A;  2IN3 A;  3H79 A;  4KCA A;  4K8M A;  2YAN A;  1YDK A;  3EU4 A;  3ZRD A;  1GWC A;  2WZ9 A;  1E6B A;  1DBY A;  1GLP A;  2LV3 A;  1DE1 A;  1LU4 A;  3C1R A;  2VCX A;  3GST A;  4K5S A;  1THO A;  1AXD A;  1FOH A;  5F07 A;  3ZVJ D;  2PWJ A;  1PKW A;  4WF4 A;  3HZ8 A;  4ZIL A;  3UVH A;  2DC5 A;  4KDU A;  2RM5 A;  1SEN A;  4V2L A;  3TKR A;  4YKG A;  4KH7 A;  3VI5 A;  2X8G A;  2VOC A;  1N8J A;  5GZZ B;  3G7J A;  2MBT A;  2OAC A;  1THX A;  4K2X A;  3UJ1 A;  1Q4J A;  4F03 A;  4O32 A;  1U88 A;  4IQ1 A;  5IMD A;  1A0R P;  3W8J A;  1PKZ A;  4BVX B;  4PXO A;  5IMA A;  1TU8 A;  3FEU A;  1SKR B;  3DML A;  2REM A;  3F3R A;  5DCH A;  3KMN A;  1UN2 A;  4GTU A;  3F63 A;  3E3E A;  4TR0 A;  1GRX A;  5ECL B;  4WBR D;  4ECB A;  3VWU A;  1HNC A;  4GWR A;  2KLX A;  5H5S A;  3QAW A;  4MLY A;  1MTC A;  2NDO A;  2FUG 2;  4OO5 A;  4OD7 A;  4KX4 A;  3KP8 A;  2LJR A;  2OE1 A;  1X0R A;  2DLX A;  2IWT A;  2LEG A;  4HUA A;  3WT2 A;  3MSZ A;  1PD2 1;  3O6T A;  2HRF A;  4PQH A;  1JHB A;  1QQ2 A;  1K3Y A;  1M2A A;  5D9T A;  2VLV A;  5J4U A;  1SU9 A;  5ABR A;  4NMU A;  3D4T A;  3DVX A;  3TJF A;  3C1S A;  2B7J A;  2CVD A;  3I9V 2;  2DSA A;  3IC8 A;  2PGT A;  3CSI A;  1M0U A;  2HE3 A;  1B4Q A;  2IL3 A;  2VCT A;  1KNG A;  4WET A;  2IIY A;  3CRT A;  1EEJ A;  4EF0 A;  3QFB C;  2X4A A;  14GS A;  3C8E A;  3F4S A;  4IKH A;  4NV2 A;  1GUM A;  3ISO A;  3TOT A;  2TRC P;  5G1K A;  4MZC A;  1M9B A;  2V32 A;  4MF5 A;  3GSS A;  4XS4 A;  2FWE A;  4IS0 A;  3KM6 A;  1DE2 A;  4K7N A;  2HT9 A;  3A3T A;  2I81 A;  2FLS A;  3DKS A;  3A5I A;  2J9H A;  1V98 A;  2XPE A;  3IK9 A;  4YQV A;  4NV5 A;  5IQY A;  2JAC A;  2HXK A;  2JSY A;  4PQ1 A;  2UZ8 A;  3UBK A;  1A24 A;  1X9M B;  1GSY A;  2IJY A;  4BVY B;  2B5E A;  4TR1 A;  3VFI A;  2C0D A;  11GS A;  2WDU A;  3QDN A;  4OCF A;  3ZML A;  2R3X A;  2IFQ B;  1GUK A;  4RUV A;  3LXT A;  4IQA A;  4V1A g;  5ECP B;  2DJ1 A;  2GZY A;  1TP9 A;  2WGR A;  1Q98 A;  3D4M A;  2DIZ A;  3HJP A;  1GL8 A;  4MPG A;  4Q5N A;  2R37 A;  1VRS D;  1BX9 A;  4ZBA A;  3I6A A;  1QUW A;  1H4O A;  1T7P B;  2DML A;  2M72 A;  3TOU A;  5F0G A;  3GIX A;  1XXU A;  1G7O A;  4EDZ A;  3KH7 A;  1YQ1 A;  5AIS A;  2PBJ A;  3MYD A;  4KA0 A;  5CP1 A;  1GSD A;  3MDK A;  1A8Y A;  2FD3 A;  1R5A A;  3BD2 A;  2VD0 A;  4WBJ A;  3J7Y b;  2P31 A;  2B5X A;  2PVO C;  2C0G A;  5EY6 A;  2LQQ A;  2X49 A;  2JL4 A;  2C0E A;  1QFN A;  2YCD A;  4IEL A;  1ZCP A;  2HZE B;  5DQS A;  5ECQ B;  5F8B A;  4CY6 A;  4GXZ A;  4L5L A;  2GZP A;  3CYN A;  4QL7 A;  1ZYP A;  3LGC A;  1K3O A;  3H93 A;  4ZIJ A;  4Q5F A;  4FYU A;  3ED3 A;  4NHZ A;  2BMX A;  2DJJ A;  1F2E A;  4I6X A;  2YWN A;  3EIN A;  3RDW A;  5ECK B;  2KOK A;  2H1D A;  1YF1 A;  1R4W A;  4Z7X A;  4MZB A;  5IPG A;  2H30 A;  1XOB A;  1ZYQ B;  2RUE A;  2PPT A;  3UAP A;  4FQU A;  2MYG A;  4E8H A;  1NM3 A;  2C80 A;  1EGR A;  5HR3 A;  3MNG A;  3LYK A;  1B9Y C;  2YJ7 A;  3BJ5 A;  4N0V A;  4AJ7 A;  1O8X A;  2E7P A;  4J2F A;  3DRN A;  1OC9 A;  3L9S A;  3US3 A;  2VIM A;  1WMJ A;  1ABA A;  4HZ2 A;  1T3B A;  1TI1 A;  4GCI A;  1W4V A;  1YJ6 A;  2ES7 A;  4G19 A;  2GZZ A;  2LJK A;  1TKD B;  1ML6 A;  3GKX A;  2O7K A;  5J5N A;  2XHF A;  3BBY A;  5AN1 A;  5CRE A;  2HSY A;  3KEB A;  4I2T A;  1H75 A;  1Z9H A;  5E59 A;  1PL1 A;  2VL9 A;  4KUN A;  4CDO A;  2CAQ A;  4Z2T A;  3M9J A;  2GST A;  2JZR A;  1UC7 A;  4O92 A;  1NHY A;  1V58 A;  4YQU A;  4IW9 A;  3GFK A;  3CMI A;  5CO3 A;  4A5P A;  4X43 A;  2YOI A;  4IP6 A;  1AUC A;  4HJ2 A;  4E8E A;  1B9X C;  5CNW A;  1SJ6 A;  1GTI A;  4IP1 A;  2OBK A;  4V2M A;  2H8L A;  2LKU A;  2F51 A;  1HNB A;  4RI7 A;  3FMW A;  4MJC A;  5CRD A;  2CX3 A;  4F0B A;  4MJA A;  3DXB A;  2EIR A;  1ZOF A;  17GS A;  2H1G A;  2RLI A;  2CVB A;  4KCE A;  1SKW B;  1MD4 A;  4MCU A;  3M0F A;  1EOG A;  3GRX A;  2DMM A;  1ZMA A;  2JZT A;  5G1L A;  5ELG A;  2DBC A;  2P5R A;  1LJR A;  4K7I A;  3UBL A;  2WFC A;  2B5Y A;  3KCM A;  2HSH A;  1OE8 A;  2WB9 A;  2HRN A;  4BL7 B;  1GNW A;  4O5U A;  5FT3 A;  4KF9 A;  1TRU A;  3WT1 A;  1EZK A;  1JZO A;  5KN1 A;  2M46 A;  1V40 A;  2MMA A;  1TOF A;  3LEF A;  1FOV A;  4WEY A;  1GTB A;  4BA7 A;  3FR6 A;  2ZUP A;  4ZL9 A;  4LMW A;  2CVK A;  1XW5 A;  1UA5 A;  1XIY A;  2N5A A;  4XS1 A;  1TRW A;  1XOA A;  3L9U A;  4MJB A;  4YQM A;  5DAL B;  3P90 A;  1CQH A;  4POK A;  6GSU A;  2VM1 A;  4N0Z A;  3LSZ A;  5D9V A;  2O87 A;  1BJX A;  3IRA A;  2EIQ A;  4J56 E;  2R0G A;  4YAP A;  5ECM B;  5B6N A;  3DIE A;  1G6W A;  1Y6E A;  1IYH A;  5HR2 A;  4JRR A;  4MJE A;  5G2Z A;  4K2D A;  4FYC A;  3CTF A;  4ECC A;  3TKS C;  3RHB A;  2NPB A;  1WRY A;  3H8Q A;  4WR5 A;  3RHC A;  3BCI A;  4WKW A;  1TDI A;  3ME8 A;  2M80 A;  3CXG A;  3IAS 2;  1PRX A;  3KIJ A;  5ECR B;  3TRP A;  2GSS A;  3O76 A;  1AQV A;  3SWL A;  5H5Q A;  4EE0 A;  4ISD A;  3HDC A;  4WXT A;  4EO3 A;  3Q18 A;  4D73 A;  3D5J A;  1FVJ A;  1MDJ A;  4F2I A;  1QK8 A;  2WUL A;  3KJY A;  3IHG A;  2V2G A;  3IOS A;  1J08 A;  1G0T A;  3VWV A;  4RI6 A;  3PH9 A;  5GAP D;  1B8X A;  1PL2 A;  3VPT A;  2VAF A;  1PSQ A;  2CQ9 A;  2MZC A;  1U3A A;  2CT6 A;  3APO A;  5INY A;  4RQR A;  1ZGN A;  2VO4 A;  2BTO T;  2CZ2 A;  4HDE A;  4PTS A;  1AAZ A;  3U5R E;  1TK8 B;  1TTZ A;  4KND A;  3TB2 A;  3QD9 A;  5IO0 A;  4K6X A;  2X99 A;  2I3Y A;  1SK0 A;  2QA1 A;  1J9B A;  3P7X A;  3KGK A;  3IHQ A;  4QL9 A;  1FO5 A;  3K8N A;  5ECH B;  4LL1 B;  1TK0 B;  2K9F A;  3UL3 A;  4QQ7 A;  2YWO A;  3EC3 A;  4WF5 A;  2H0H A;  1O6J A;  3GL5 A;  2H0I A;  4V2N A;  2E2M A;  2H74 A;  3ZMK A;  4XRD A;  5LCZ A;  1T1V A;  5ID2 B;  2C8U A;  5A4U A;  1PX7 A;  3TUE A;  1A2L A;  4MF6 A;  1TU7 A;  5IOX A;  2E2G A;  2VD1 A;  3G7Y A;  2K18 A;  4PNG A;  1YKA A;  1FHE A;  2YWI A;  4IJ3 A;  4BVX A;  3WYW A;  3QCP A;  5DJM A;  4HU9 A;  3ZTL A;  1K0A A;  2H71 A;  3IDV A;  1XZO A;  1PX6 A;  2PUK C;  3M8N A;  1BQ7 A;  4ZXG A;  1BAY A;  3D0Z A;  4ML1 A;  4OFT A;  5ECI B;  2R0C A;  4PGT A;  2X8H A;  1I5G A;  1ERW A;  2AV4 A;  2CZ3 A;  3A5W A;  3IE3 A;  4K5R A;  3I43 A;  2FA4 A;  3BCK A;  4POB A;  5G31 A;  3C71 A;  1EV9 A;  2NTO A;  1G6Y A;  3ZL5 A;  3APQ A;  3KD0 A;  4MF7 A;  5D96 A;  1X5E A;  2HSM A;  5DCG A;  5GSS A;  2MMN A;  3E9J B;  4K1F A;  4Q5Q A;  4ILF A;  1N2A A;  4XHM A;  5D9X A;  1CQG A;  1SL1 B;  4DSR A;  4OFN A;  1M7T A;  3ZLP A;  2OJL A;  3NOF A;  4I5Q A;  5L71 A;  3GKM A;  4ZBB A;  2G0F A;  2QSI A;  1WP0 A;  1RW1 A;  1VF2 A;  3QR6 A;  1SJI A;  5JWO B;  4DSS A;  2YNX A;  1RK4 A;  2GQL A;  2LNT A;  4KE3 A;  3QFA C;  4EC0 A;  4AF2 A;  5D8I A;  2DJ0 A;  3RPP A;  1FB6 A;  5JWQ B;  1USB A;  4IJI A;  2N5F A;  2B7K A;  3GV1 A;  2GQK A;  4XCS A;  2XBQ A;  3W6G A;  1K0M A;  3WD6 A;  1FAA A;  1EWX A;  5DBQ A;  5EVO A;  4YAV A;  4AJ8 A;  1ACV A;  4PX1 A;  3PIN A;  5J9C A;  2L4Q A;  1S3D A;  4HOJ A;  1TRS A;  4POM A;  3IAM 2;  6GSX A;  1KBN A;  1XWB A;  1TI3 A;  4HU7 A;  2HI7 A;  1F37 A;  3MAK A;  1U87 A;  1A8L A;  1WWJ A;  16GS A;  1FB0 A;  2O89 A;  1SYX A;  1K3L A;  1YEX A;  1ON4 A;  4TKY A;  2EIO A;  1DSB A;  3DGQ A;  19GS A;  1HQO A;  1A0F A;  3GMF A;  3M3M A;  4YH2 A;  2EC4 A;  2CX4 A;  2YV7 A;  3MWH A;  5CRW A;  2CV4 A;  1X9W B;  5H5R A;  5KN2 A;  3HXS A;  2XC2 A;  2GT6 A;  2IMD A;  2HZF A;  3HA9 A;  5D73 A;  4G10 A;  2C0F A;  5G30 A;  4DEJ A;  1S3A A;  2D2Z A;  4K7O A;  3ERG A;  2NBS A;  3LYP A;  1OC9 B;  2R2J A;  1BED A;  5CAX A;  1YEP A;  1O81 A;  3ZYW A;  2PN8 A;  3KP9 A;  10GS A;  4OO4 A;  2GSR A;  3IV4 A;  4WR4 A;  3TRX A;  1SJZ A;  2V6O A;  2YP6 A;  3DWV A;  4HJM A;  4NHW A;  1Z5Y E;  3VI7 A;  1T8E B;  5IM9 A;  4N10 A;  4OFM A;  5IMV A;  5GAN D;  2P5Q A;  1EP7 A;  4JBB A;  4XRA A;  3FKF A;  1YF0 A;  2ON7 A;  3GHA A;  4FO5 A;  3DD3 A;  2YWM A;  1GP1 A;  3FR3 A;  2LRN A;  2VLT A;  4HS1 A;  4POL A;  2PVQ A;  2HNL A;  5JWR B;  3TKS A;  3F9U A;  3KTB A;  4X4J A;  4LA1 A;  3WGE A;  2L59 A;  5B6M A;  1A23 A;  2HRK A;  4ZL7 A;  2A2R A;  4HQZ A;  4OCE A;  2VUP A;  4FH8 A;  4I2U A;  2AHE A;  2V6K A;  4JED A;  2OKA A;  4GQF A;  3F0I A;  5LNK e;  3GKK A;  1ERV A;  3UOM A;  4G0L A;  1GSE A;  1JFU A;  4O7H A;  3KH9 A;  1JZW A;  1OKD A;  4ICY A;  3HKR A;  1WE0 A;  1K0C A;  1MDI A;  4ZB8 A;  4IGJ A;  1YZX A;  2O85 A;  3S9F A;  3UMA A;  2C3N A;  1GH2 A;  4L8E A;  3Q6O A;  5ENU A;  4L0U A;  6GSY A;  3FRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...