2QKEA

Wild type crystal structure of full length circadian clock protein kaib from thermosynechococcus elongatus bp-1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
98
structure length
98
Chain Sequence
MAPLRKTYVLKLYVAGNTPNSVRALKTLNNILEKEFKGVYALKVIDVLKNPQLAEEDKILATPTLAKVLPPPVRRIIGDLSNREKVLIGLDLLYEEIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Circadian clock protein
molecule keywords Circadian clock protein kaiB
publication title Structural model of the circadian clock KaiB-KaiC complex and mechanism for modulation of KaiC phosphorylation.
pubmed doi rcsb
total genus 21
structure length 98
sequence length 98
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07689 KaiB KaiB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2qkeA00
2K6VA 3I43A 3TRQA 3D22A 2IN3A 1TK0B 1T00A 3DXBA 3HD5A 3HA9A 4LLRA 1PQNA 2MZCA 4DSSB 5KN0A 3VI7A 3QCPA 5EY6A 1PMTA 2IWTA 3PH9A 4F0BA 4HZ2A 1TJDA 5D9TA 1T1VA 3IPZA 4JE1A 2DIYA 4JBBA 2VLVA 1PRXA 2G2QA 2P0GA 5L71A 4V1Ag 1KEBA 3VWXA 1GSYA 4WF5A 2XBIA 2VLTA 1A2LA 1X0RA 4K8MA 2WJUA 2DJ0A 3RBTA 2PERA 1TRSA 2H1GA 2CV4A 2CZ2A 3N5OA 3DKSA 5DJLA 1I5GA 3GUSA 4MJCA 2IMDA 2FWEA 3APQA 4KCAA 2E0QA 3C7MA 1G6WA 4MCUA 4XRAA 3A5WA 4TOPA 2V1MA 2WB9A 4LL1B 2P5QA 3A2WA 3HXSA 5HQPA 2OA7A 3G7IA 3NIVA 1Z5YE 2A2RA 3PGTA 2V2GA 3CRUA 1YF1A 2HI7A 3ZVJD 1JHBA 2WULA 1BAYA 4QQ7A 2GQMA 3UBLA 3LJRA 1A24A 5JCWA 3TDGA 3ZREA 1XWBA 2OE3A 4TN8A 3ZVJA 2WFCA 1R5PA 1F3BA 1Y6EA 2GZZA 1K0DA 1XW6A 3VLNA 3KJYA 3EYTA 1WWJA 4Q5FA 1PL2A 1XIYA 2CAIA 3BD2A 1MD4A 1XWGA 5G1KA 1K0BA 4MA9A 1DE2A 1FVKA 1V57A 4IGJA 5G30A 2FHEA 1JLWA 4N30A 2IL3A 4HEA2 4K9ZA 2YV7A 2RIIA 3WGEA 2NTOA 5D9VA 4CW9A 2AB6A 1T7PB 1IYHA 1SL1B 1A0RP 3KIJA 1T8EB 2F9SA 1XW9A 3L9SA 3LGCA 4EUYA 1T4YA 5G31A 3EMPA 1GULA 4L5OA 4NHZA 5IMVA 2H6XA 5EL8A 3IXRA 1WJKA 4X43A 1PKZA 3APOA 4NWYA 4XS4B 5A4VA 2K18A 1HNAA 4YQUA 2GQKA 2LEGA 5KN3A 3Q18A 2QGVA 2GT5A 5HFKA 4MDCA 4L0WA 3VWWA 1SD9A 4WETA 3TGZA 2HYXA 3GV1A 4PUFC 4PXOA 4EXJA 5G1LA 4Q5QA 2YPMA 3LXZA 1T4ZA 3EWLA 1BYEA 3WT2A 4HS1A 3LYKA 4MJEA 1M0UA 1ML6A 5D9XA 1YY7A 1JZWA 2RLIA 1AQXA 3M1GA 5ECKB 4BVYA 1YZXA 5GZZB 4BWSA 2HSYA 5HR2A 3CRTA 5KEJA 1YKCA 3FZ9A 4BL7A 2H30A 2MYGA 1Q98A 5EPFA 3FEUA 4KE3A 4ECBA 3IA1A 5IIZA 5GSTA 2HE3A 6GSVA 5CRWA 5J3RA 4KDYA 4OFMA 3RPNA 2EIOA 3R2QA 1TI3A 2HXKA 2CX3A 1SJZA 3QFBC 4ZBBA 1FB0A 1ZZYA 1SYXA 4MZBA 1XWKA 4KCEA 4TXVA 4ULXA 4ILFA 3MWHA 2H74A 2B1LA 4IW9A 4OO5A 3C73A 3F6DA 2O85A 2LNSA 1ZYQB 4IJIA 4PUAA 1TOFA 4AJ7A 5ECLB 2F8AA 5ECOB 5GAPD 5ABRA 3ZFLA 2C1YA 3L4NA 4HI7A 4CHSA 5ELAA 2F8FA 1GSEA 5CAXA 3DMLA 2R37A 2YANA 13GSA 1XFLA 2V32A 2CVBA 4ML1A 3GHAA 1NM3A 2H1AA 2IMKA 4OD7A 3LFLA 2VM2A 4KB3A 2MMZA 4GLTA 4MZCA 5C04A 3HJOA 5KN1A 5F05A 2OJLA 3IK7A 1AXDA 2BTOT 2VCWA 2CT6A 2C4JA 1A2MA 1SL2B 1HYUA 4XS6A 3ZYWA 2C0FA 3VWVA 4EL1A 4ID0A 4QL9A 2L4QA 1GSSA 3U5RE 1W4VA 2WCIA 4BA7A 3DD3A 2E7PA 3DGQA 5IM9A 1GH2A 2X8GA 2FUG2 3ME7A 4OWYA 3LQ7A 2XPEA 4DEJA 5IPGA 2K9FA 1J9BA 4TR0A 3HYPA 2KUCA 2JZRA 4OCFA 3KH7A 4IHUA 3F4SA 5HFGA 4K7OA 3FR3A 3HDCA 1Y25A 3DEXA 2HFDA 1UN2A 4KNDA 3DYRA 4MPGA 5JWRB 1M9AA 2L5LA 3TRXA 2B5XA 4YH2A 1SD8A 1PL1A 1X5DA 1J08A 5IO0A 2G0FA 3IC4A 3CSIA 3UOMA 5D8IA 4KW6A 1ERTA 5B6NA 1E6BA 3FR6A 3TKQA 4TXOB 2WZ9A 4IVFA 1XOBA 2VCZA 4O5RA 1XVQA 3QOUA 3LWAA 1K3OA 3EU4A 1GUMA 2LRCA 5J4UA 2HZEB 1V98A 3K8NA 4WXTA 1TK8B 5H5QA 5LCZA 3KMOA 3HCZA 2I4AA 3CTFA 1RQMA 1AUCA 4GWRA 3GKXA 2YP6A 2ZCTA 1THXA 2CA8A 4LA1A 4ZL7A 1SK2A 1ZGNA 2VLUA 3I9V2 1OE8A 1B8XA 2TIRA 4P3YB 2DBCA 1SK1A 1E2YA 3KZQA 2YWMA 3TUEA 3V1WA 2N5AA 1QUWA 2ON5A 3QD9A 1B4QA 3FY7A 4ZL9A 3GMFA 4E8HA 4IQAA 1EP8A 2O7KA 3BBYA 2C3NA 4L5LA 4BVXA 3VPTA 4HOJA 3CSJA 4EDZA 1GLPA 1TKDB 1VF4A 3MSZA 1ZL9A 2N5FA 4F0CA 1SKRB 2AAWA 2H0HA 3CXGA 3HHVA 1K0CA 5HR0A 1UA5A 4O92A 1R7HA 6GSTA 4OFTA 3U6VA 3HJPA 3TCOA 4ECIA 5HR1A 6GSUA 2CAQA 2PVOC 2H75A 2H6YA 3W8JA 4EDYA 1AW9A 1ZCPA 2CX4A 5F06A 3P2AA 1X9SB 3Q74A 2O89A 1M7TA 5CO3A 1M2AA 2ZUPA 3D6IA 5J9CA 4IELA 5JWOB 4BWQA 2YWOA 1FVJA 1FW1A 2JL4A 4WBRD 4F9ZA 4I5QA 1LJRA 3UVHA 4I2TA 1DBYA 1RK4A 1H75A 1TP9A 4KDXA 1B48A 1OYJA 1B4PA 5GAND 1XCCA 4G10A 3QAGA 3PINA 4PQ1A 1S3DA 2I3YA 4MMMA 3GFKA 4NV5A 4XS4A 3CYNA 4KSOA 4V1Ap 3TKSA 3APSA 1PA3A 2H1DA 8GSSA 4KDUA 2GZYA 4IQ1A 1U87A 3WYWA 4HJMA 3TOUA 3IAM2 4AJ6A 1M2DA 3UVTA 3WGXA 3TRPA 1GSUA 5CREA 3IK9A 3W8SA 3KMNA 3ZZXA 2FGXA 3TJBA 2ES7A 4OCEA 2H19A 5DCGA 1A23A 3GKMA 1AAZA 1JFUA 4BPYA 1U3AA 5DQYA 1G0TA 1LBKA 3ISOA 3FW2A 4K0GA 1PD21 1R5AA 3ERGA 4YAVA 3IR4A 1KBNA 2L5OA 4POKA 1R26A 1SENA 3O3TA 3P90A 2DC5A 1OVNA 4MJBA 5DJMA 2HRNA 3ZIVA 2LV3A 3RAZA 2WRTA 2I1UA 4HUAA 4QL7A 4X1UA 1YF0A 2V41A 3E9JB 4J56E 3HZ4A 3VFIA 3Q6OA 1A0FA 2L57A 4FH8A 3BCIA 1GLQA 4G9HA 5DALB 4AF2A 3GX8A 4I2UA 2E2GA 1GUHA 3TKPA 1ILOA 1YEPA 2DJ3A 3A2XA 2RUEA 5F0GA 2FWHA 4K7NA 3A2VA 2B7JA 3ZFBA 4MZWA 4KX4A 5AGYA 4TR1B 3N9JA 3MDKA 1EV4A 2B1KA 3JCML 3W6GA 3WGDA 3IV4A 3J7Yk 3D21A 3P7XA 4TR3A 4GSTA 5IMFA 1O7UA 2X99A 2JSYA 5F07A 1MD3A 16GSA 5ECNB 5JWQB 1M9BA 3TKRA 2LQOA 1AQWA 4IKHA 2JZTA 3MAKA 5AISA 3IHQA 12GSA 4RQRA 2VL2A 3EC3A 1ABAA 4HU7A 5ECIB 3DVXA 3EVIA 3D4TA 1G7EA 1GSFA 1OC9B 1GNWA 4Q5RA 2HLSA 1NSWA 1XXUA 1XWCA 1VF2A 3F9UA 3TKSC 4DSRA 3LEFA 3L9VA 3J7Yb 3L9UA 5IQYA 2YZHA 3KP8A 1USBA 1J0FA 1BQ7A 2OE0A 1S3AA 2B7KA 1B9YC 3H4KA 3CTGA 2FNOA 4LMVA 3I6AA 1F9MA 4FYCA 20GSA 3BOAA 2KP1A 3RPPA 2GSSA 6GSSA 1OKTA 1YJ6A 3VPQA 1U6TA 2AJQB 3ERWA 1K0NA 1WIKA 3ME8A 3KTBA 1FB6A 3KD0A 3UIWA 2Z9SA 3ZLPA 3VI5A 5DAKA 1NW2A 4RQXA 5ECHB 4PGTA 4POMA 5FWGA 1DSBA 3LORA 2P5RA 4F2IA 4KAEA 3HZ8A 5J5NA 3UJ1A 2DLXA 2BJXA 3HVVA 3GTUB 1PKWA 1GUKA 3IRAA 1O73A 2ZNMA 2OBIA 4TR4A 3QDNA 1EWXA 2OBKA 3GH6A 4F03A 5ID2A 4XS1A 4GSNA 3GNJA 2TRXA 1ERUA 1K0MA 3C1SA 4WR4A 3TKSE 4K6XA 4HQZA 1IYIA 2GSQA 1KNGA 6GSWA 4G2EA 2FCHA 2HZEA 2PUKC 4ZL8A 1R4WA 1V58A 3M3MA 1MDIA 1Z7RA 1ERVA 2C0GA 3DIEA 3VURA 1XPVA 4MPFA 2IMIA 5A4WA 3D4MA 4MP4A 2MMNA 2HZFA 3P8WA 2DSAA 3BJ5A 2H1BA 3SWLA 4JR4A 4YQMA 2LJAA 2C80A 2XPDA 2J23A 3S9FA 1QXHA 5DBQA 3VWUA 2YWNA 1Z6MA 2YJHA 2ON7A 4ZB8A 1V9WA 4WEYA 5LD0A 1W89A 5IO2A 2XHFA 3NZNA 1OC3A 3LSZA 1G6YA 4PQIA 2RUFA 1XOAA 2VCXA 2H76A 2YN1A 2IJYA 2YCDA 2P31A 3TB2A 1EGRA 2WS2A 1SKSB 4MJAA 1K0AA 2FLSA 3ED3A 3IBHA 1TU7A 5H5SA 3WT1A 3KCMA 5A4UA 2AV4A 3F4TA 1BX9A 4JEDA 5CRHA 2PN8A 3M9KA 1Z3EA 1FG4A 4TRXA 2MBTA 1V40A 1S3CA 3GKKA 2IMFA 3H79A 4NV2A 1OKDA 2PVQA 1VF3A 3UBKA 1TDIA 2E2MA 4DSSA 4MH2A 1TXXA 1ACVA 5AIXA 3O6TA 3GSSA 1N8JA 2RM6A 4DVCA 3HVSA 1GTUA 3DVWA 4FYUA 3FZ4A 14GSA 4ZIJA 3GH9A 2NDOA 4ACSA 4RUVA 4MF7A 4KH7A 1U3IA 3CBUA 2VL3A 4AJ8A 3L0HA 4E8EA 4WBJA 1WE0A 1DUGA 1EEJA 1WOUA 1AQVA 4OMVA 4NXIA 5H5RA 3UEMA 5IMDA 5HFIA 2EIRA 1EP7A 5COHA 3M9JA 2H73A 2GLRA 4IJ3A 2O8VB 2LQQA 2PGTA 1YQ1A 3EE2A 1GSDA 4JU5A 5G2ZA 2MMOA 1ZOFA 4L8EA 4EF0A 3H1NA 1AIUA 3NOFA 1OE7A 4I8BA 2H0GA 4X0XA 1URMA 2JU5A 11GSA 1QK8A 5CYYA 2I81A 3DWVA 4FIWA 3IDVA 3UL3A 1JLVA 3D5JA 2PMTA 2A4VA 5B6MA 4O7HA 1EOHA 2L6CA 2RM5A 4ZB6A 1FHEA 3GKNA 2FA8A 2IFQB 3L78A 2K8VA 3FKFA 3CSHA 1EGOA 3C1RA 3RDWA 2L4CA 2FWFA 4ZBAA 4FO5A 2C3QA 3KP9A 2FD3A 1RW1A 3ZMLA 4L0UA 2VCVA 2CVKA 3GA4A 4AGSA 6GSXA 5D93A 1TRUA 1F3AA 3PR8A 3QR6A 5B7CA 1O85A 4IP6A 4ZBDA 3ZRDA 1M2BA 1WP0A 4IS0A 3MNGA 3H93A 3Q19A 5ECSA 2X8HA 1GWCA 3ZIJA 2GTUA 2OE1A 1PN9A 4J2FA 4ZILA 1WMJA 2CZ3A 4TR1A 1MDKA 2M80A 5J9BA 2VM1A 4JR6A 3RHBA 2L59A 5CP1A 3TJJA 1SU9A 2A2SA 2CQ9A 3FK8A 1OC8A 2YJ7A 1SL0B 2GQLA 4RI7A 5GSSA 4HQSA 4HZ4A 4V2LA 1GTAA 2XC2A 4MLYA 4G19A 2HSHA 2R3XA 4OFNA 4IBPA 2H0IA 2VD0A 5ECMB 3F4RA 4KA0A 3TJFA 4ECCA 1WPIA 1FOVA 1U88A 1O6JA 1Q4JA 1PX6A 3GIXA 4POLA 1F2EA 5IOXA 1OC9A 5FT3A 2NVLA 1O8XA 2LUSA 1CQHA 3E3EA 1TI1A 1A8YA 1DE1A 2GS3A 2JADA 1GP1A 4ZB9A 2F51A 3VK9A 2D2ZA 4IP1A 2L6DA 4GF0A 4WF4A 1F6MC 3KTLA 1XVWA 2M72A 1B9XC 2YOIA 5AIVA 18GSA 3HVXA 1XW5A 1C72A 4K2DA 2B6MA 4KGIA 3E0UA 1ST9A 3GURA 2BMXA 5FHIA 1SJIA 3WD6A 2C0DA 1CQGA 2C8UA 2GT6A 4XTSA 1GTIA 4H86A 4EC0A 1Z6NA 1LU4A 2K8SA 5IMZA 3GTUA 3ZMKA 4N10A 3KXOA 1K3LA 4GSSA 1PSQA 4MH3A 5JCGA 3UARA 2DMLA 4D73B 4GTUA 2DIZA 2R2JA 1F37A 4XRDA 2H70A 2IMEA 4XIHA 1QQ2A 4NHWA 2R6KA 2GGTA 4OO4A 1BEDA 3IE3A 3GL5A 3ZL5A 1GSQA 2C3TA 1ON4A 3ZITA 1N2AA 4MF6A 3HY2A 3F3RA 3KGKA 4FYBA 3LG6A 1GNEA 2VCQA 4TKYA 1TK5B 1ZMAA 1K0OA 3G7JA 4IN0A 2VL9A 2QSIA 2XBQA 1HNCA 3QPMA 4JRRA 2HRFA 2YWIA 1NHYA 1JZOA 17GSA 4PQHA 3C71A 1UC7A 3G9BA 1H4OA 4V2MA 4GCIA 2PPTA 1XZOA 1QGVA 2I9HA 3UAPA 1VRSD 3FZ5A 2DJKA 2IIYA 3A3TA 3F63A 22GSA 3LYPA 4K1FA 2OKAA 3GSTA 3AY8A 5CRGA 1XWAA 5B8AA 1G7OA 2B5YA 5ECQB 5D73A 3EURA 5A5KA 7GSSA 5IMAA 1KTEA 1NHOA 2JACA 2LNTA 4GRFA 5F8BA 3HJMA 3ERFA 4RI6A 1O81A 4ML6A 2LKUA 2PU9C 5ECRB 4PNFA 5C00A 5G5FA 2X64A 2AYTA 2LJRA 4ECJA 3KM6A 2MBSA 1TU8A 4EE0A 1V2AA 4DSQA 4KSMA 2F3MA 3ZTLA 4Q5NA 2B5EA 2KLXA 5DVBA 2B3SA 4TW5A 5LNKe 2LS5A 2H01A 3FRCA 3KH9A 2LSTA 3QFAC 3OR5A 1YDKA 3LXTA 1X9WB 4NAXA 2LRNA 3EINA 2GSTA 3TJKA 2AHEA 4TXOA 1X9MB 3FYGA 1ZYEA 3UMAA 2FY6A 2LTKA 1BG5A 2KHPA 1MDJA 4CDOA 1MEKA 4KUNA 4XCSA 1FAAA 2LJKA 3IAS2 4K0NA 2J9HA 4GQCA 2JZSA 3GX0A 10GSA 2QC7A 1O8WA 1SK0A 3RHCA 3GRXA 1QMVA 4HDEA 3EU3A 5E59A 2REMA 2DJJA 4LMWA 5D9WA 1I9DA 2V6KA 3HKRA 1PGTA 6GSYA 2OADA 4YAPA 3F6FA 4LL4B 2H6ZA 1JZDA 1Z7PA 3SBCA 5EVOA 2PBJA 2WDUA 4J57E 1HNBA 2ALBA 3G7YA 4MK3A 1SYRA 2M46A 3QAVA 2VL2C 2H71A 4N11A 5DDLA 5DQSA 2NPBA 4POBA 1QFNA 3F8UA 4WR5A 4I6XA 4MF5A 4HU9A 2MMAA 2IFQA 1TRWA 5HR3A 4MABA 4NMUA 4PX1A 1YKAA 4YQVA 1TTZA 4ISDA 5D96A 2GZPA 1VF1A 2AUVA 5B8BA 1BJXA 1UVZA 5JCUA 3F0IA 5ECPB 2VAFA 2VOCA 3O76A 4HJ2A 2X8CA 2N5BA 1K3YA 2WGRA 4XHMA 1HD2A 2NBSA 5DAKB 1EZKA 1VGLA 1HQOA 2VD1A 3FR9A 1JZRA 1MTCA 2YNXA 4I97A 2EIQA 1AC1A 1SJ6A 2H72A 5CRDA 3C8EA 2QKEA 3GYKA 2YV9A 2DJ1A 2JSZA 4NPBA 3QMXA 1A8LA 4N0VA 5ID2B 2PWJA 1ERWA 3F3QA 2GSRA 3D0ZA 3CMIA 1X5CA 4EVMA 2EC4A 4F82A 2DJ2A 3QAWA 2VUPA 1M99A 5ENUA 1EV9A 4JZQA 3GN3A 5CNWA 1WRYA 2VCTA 1OAZA 2CVDA 3BCKA 3M8NA 5KN2A 1SKWB 5ELGA 2R5GA 9GSSA 2VIMA 5IOWA 4K7IA 3M0FA 2KOKA 2H66A 4TVEA 2FA4A 3TOTA 1TRVA 3TJGA 1GTBA 2R4VA 2OACA 1YEXA 2FWGA 19GSA 2LRTA 2IPAA 4ZXGA 3IOSA 1THOA 1X5EA 1PX7A 2KP2A 3H8QA 5IPHA 1EEMA 4EKZA 2O87A 4N0ZA 5DCHA 5E4WA 2TRCP 2C0EA 1XBSA 2GDRA 4WKWA 5G5EA 3KEBA 5DALA 4V2NA 2HNLA 2GVPA 4D73A 1T3BA 3EMXA 2DMMA 5IMCA 1EOGA 4EO3A 4PNGA 4PURA 3GL3A 2H8LA 4GXZA 5AN1A 4O32A 3FHKA 1GL8A 2YZUA 1TW9A 5INYA 1A2JA 2VO4A 3DRNA 5J41A 4Z7XA 1Z9HA 1GRXA 3US3A 4GQFA 2HT9A 2V6OA 1FO5A 3FZAA 3I69A
chains in the Genus database with same CATH superfamily
2K6VA 3I43A 3TRQA 3D22A 2IN3A 1TK0B 1T00A 3DXBA 3HD5A 3HA9A 4LLRA 1PQNA 2MZCA 4DSSB 5KN0A 3VI7A 3QCPA 5EY6A 1PMTA 2IWTA 4Z2TA 3PH9A 4F0BA 4HZ2A 1TJDA 5D9TA 1T1VA 3IPZA 4JE1A 2DIYA 4JBBA 2VLVA 4A5PA 1PRXA 2G2QA 2P0GA 5L71A 4V1Ag 1KEBA 3VWXA 1GSYA 4WF5A 2XBIA 2VLTA 1A2LA 1X0RA 4K8MA 2WJUA 2DJ0A 3RBTA 2PERA 1TRSA 2H1GA 4USSA 2CV4A 2CZ2A 3N5OA 2A2PA 3DKSA 5DJLA 1I5GA 3GUSA 4MJCA 2IMDA 2FWEA 3APQA 4KCAA 2E0QA 3C7MA 1G6WA 4MCUA 4XRAA 3A5WA 4TOPA 2V1MA 2WB9A 4LL1B 2P5QA 3A2WA 3HXSA 5HQPA 2OA7A 3G7IA 3NIVA 1Z5YE 2A2RA 3PGTA 2V2GA 3CRUA 1YF1A 2HI7A 3ZVJD 1JHBA 2WULA 1BAYA 4EIPA 4QQ7A 2GQMA 3UBLA 3LJRA 1A24A 5JCWA 3TDGA 3ZREA 1XWBA 2OE3A 4TN8A 3ZVJA 2WFCA 1R5PA 1F3BA 1Y6EA 2GZZA 1K0DA 1XW6A 3VLNA 3KJYA 3EYTA 1WWJA 4Q5FA 1PL2A 1XIYA 2CAIA 3BD2A 1MD4A 1XWGA 5G1KA 1K0BA 4MA9A 1DE2A 1FVKA 1V57A 4IGJA 3R3EA 5G30A 4K5SA 2FHEA 1JLWA 4N30A 2IL3A 4HEA2 4K9ZA 2YV7A 2RIIA 3WGEA 2NTOA 5D9VA 4CW9A 2AB6A 1T7PB 1IYHA 1SL1B 1A0RP 3KIJA 1T8EB 2F9SA 1XW9A 3L9SA 3LGCA 4EUYA 1T4YA 5G31A 3EMPA 1GULA 4L5OA 4NHZA 5IMVA 2H6XA 5EL8A 3IXRA 1WJKA 4X43A 1PKZA 3APOA 4NWYA 4XS4B 5A4VA 2K18A 1HNAA 4YQUA 2GQKA 2LEGA 5KN3A 3Q18A 2QGVA 2GT5A 5HFKA 4MDCA 4L0WA 3VWWA 1SD9A 4WETA 3TGZA 2HYXA 3GV1A 4PUFC 4PXOA 4EXJA 5G1LA 4Q5QA 2YPMA 3LXZA 1T4ZA 3EWLA 1BYEA 3WT2A 4HS1A 3LYKA 4MJEA 1M0UA 1ML6A 5D9XA 1YY7A 1JZWA 2RLIA 1AQXA 3M1GA 5ECKB 4BVYA 1YZXA 5GZZB 4BWSA 2HSYA 5HR2A 3CRTA 1PN0A 5KEJA 1YKCA 3FZ9A 4BL7A 2H30A 2MYGA 1Q98A 5EPFA 3FEUA 4KE3A 2DKIA 4ECBA 3IA1A 5IIZA 5GSTA 2HE3A 6GSVA 5CRWA 5J3RA 4KDYA 4OFMA 3RPNA 2EIOA 3R2QA 1TI3A 2HXKA 2CX3A 1SJZA 2HRAA 3QFBC 4ZBBA 1FB0A 1ZZYA 1SYXA 4MZBA 1XWKA 4KCEA 4TXVA 4ULXA 4ILFA 3MWHA 2H74A 2B1LA 4IW9A 4OO5A 3C73A 3F6DA 2O85A 2LNSA 1ZYQB 4IJIA 4PUAA 1TOFA 4AJ7A 5ECLB 2F8AA 5ECOB 5GAPD 5ABRA 3ZFLA 2C1YA 3L4NA 4HI7A 4CHSA 5ELAA 2F8FA 1GSEA 5CAXA 3DMLA 2R37A 2YANA 13GSA 1XFLA 2V32A 2CVBA 4ML1A 3GHAA 1NM3A 2H1AA 2IMKA 4OD7A 2QA2A 3LFLA 2VM2A 4KB3A 2MMZA 4GLTA 4MZCA 5C04A 3HJOA 5KN1A 5F05A 2OJLA 3IK7A 1AXDA 2BTOT 2VCWA 2CT6A 2C4JA 1A2MA 1SL2B 1HYUA 4XS6A 3ZYWA 2C0FA 3VWVA 4EL1A 4ID0A 4QL9A 2L4QA 1GSSA 3U5RE 1W4VA 2WCIA 4BA7A 3DD3A 2E7PA 3DGQA 5IM9A 1GH2A 2X8GA 2FUG2 4ICYA 3ME7A 4OWYA 3LQ7A 2XPEA 4DEJA 5IPGA 2K9FA 1J9BA 4TR0A 3HYPA 2KUCA 2JZRA 4OCFA 3KH7A 4IHUA 3F4SA 5HFGA 4K7OA 3FR3A 3HDCA 1Y25A 3DEXA 2HFDA 1UN2A 4KNDA 3DYRA 4MPGA 5JWRB 1M9AA 2L5LA 3FMWA 3TRXA 2B5XA 4YH2A 1SD8A 1PL1A 1X5DA 1J08A 4EIQA 5IO0A 1XG8A 2G0FA 3IC4A 3CSIA 3UOMA 5D8IA 4KW6A 1ERTA 5B6NA 1E6BA 3FR6A 3TKQA 4TXOB 2WZ9A 4IVFA 1XOBA 2UZ8A 2VCZA 4O5RA 1XVQA 3QOUA 3LWAA 1K3OA 3EU4A 1GUMA 2LRCA 5J4UA 2HZEB 1ZYNA 1V98A 3K8NA 4WXTA 1TK8B 4X4JA 5H5QA 5LCZA 3KMOA 3HCZA 2I4AA 3CTFA 1RQMA 1AUCA 4GWRA 3GKXA 2YP6A 2ZCTA 4G0IA 1THXA 2CA8A 4LA1A 4ZL7A 1SK2A 1ZGNA 2VLUA 3I9V2 1OE8A 1B8XA 2TIRA 4P3YB 2DBCA 1SK1A 1E2YA 3KZQA 2YWMA 3TUEA 3V1WA 2N5AA 1QUWA 2ON5A 3QD9A 1B4QA 3FY7A 4ZL9A 3GMFA 4E8HA 4IQAA 1EP8A 2O7KA 3BBYA 2C3NA 4L5LA 4BVXA 3VPTA 4HOJA 3CSJA 4EDZA 1GLPA 1TKDB 1VF4A 3MSZA 1ZL9A 2N5FA 4F0CA 1SKRB 2AAWA 2H0HA 3CXGA 3HHVA 1K0CA 5HR0A 1UA5A 4O92A 1R7HA 6GSTA 4OFTA 3U6VA 3HJPA 3TCOA 4ECIA 5HR1A 6GSUA 2CAQA 2PVOC 2H75A 2H6YA 3W8JA 4EDYA 1AW9A 1ZCPA 2CX4A 5F06A 3P2AA 1X9SB 3Q74A 2O89A 1M7TA 5CO3A 1M2AA 2ZUPA 3D6IA 5J9CA 4IELA 5JWOB 4BWQA 2YWOA 1FVJA 1FW1A 2JL4A 4WBRD 4F9ZA 4I5QA 1LJRA 3UVHA 4I2TA 1DBYA 1RK4A 1H75A 1TP9A 4KDXA 1B48A 1OYJA 1B4PA 5GAND 1XCCA 4G10A 3QAGA 3PINA 4PQ1A 1S3DA 2I3YA 4MMMA 3GFKA 4NV5A 4XS4A 3CYNA 4KSOA 4V1Ap 3TKSA 3APSA 1PA3A 2H1DA 8GSSA 4KDUA 2GZYA 4IQ1A 1U87A 3WYWA 4HJMA 3TOUA 3IAM2 4AJ6A 1M2DA 3UVTA 3WGXA 3TRPA 1GSUA 5CREA 3IK9A 3W8SA 3LW9A 3KMNA 3ZZXA 2FGXA 3TJBA 2ES7A 4OCEA 2H19A 5DCGA 1A23A 3GKMA 1AAZA 1JFUA 4BPYA 1U3AA 5DQYA 1G0TA 3EPTA 1LBKA 3ISOA 3FW2A 4K0GA 1PD21 1R5AA 3ERGA 4YAVA 3IR4A 1M3JA 2R0CA 1KBNA 2L5OA 4POKA 1R26A 1SENA 3O3TA 3P90A 2DC5A 1OVNA 4MJBA 5DJMA 2HRNA 3ZIVA 2LV3A 3RAZA 2WRTA 2I1UA 4HUAA 4QL7A 4X1UA 1YF0A 2V41A 3E9JB 4J56E 3HZ4A 3VFIA 3Q6OA 1A0FA 2HSMA 2L57A 4FH8A 3BCIA 4Z2UA 1GLQA 4G9HA 5DALB 4AF2A 3GX8A 4I2UA 2E2GA 1GUHA 3TKPA 1ILOA 1YEPA 2DJ3A 3A2XA 2RUEA 5F0GA 2FWHA 4K7NA 3A2VA 2B7JA 3ZFBA 4MZWA 4KX4A 5AGYA 4TR1B 3N9JA 3MDKA 1EV4A 2B1KA 3JCML 3W6GA 3WGDA 3IV4A 3J7Yk 3D21A 3P7XA 4TR3A 4GSTA 5IMFA 1O7UA 2X99A 2JSYA 5F07A 1MD3A 16GSA 5ECNB 5JWQB 1M9BA 3TKRA 2LQOA 1AQWA 4IKHA 2JZTA 3MAKA 5AISA 3IHQA 12GSA 4RQRA 2VL2A 3EC3A 1ABAA 4HU7A 5ECIB 3DVXA 3EVIA 3D4TA 1G7EA 1GSFA 4FQUA 1OC9B 1GNWA 4Q5RA 2HLSA 1NSWA 1XXUA 1XWCA 1VF2A 3F9UA 3TKSC 4DSRA 3LEFA 3L9VA 3J7Yb 3L9UA 5IQYA 2YZHA 3KP8A 1USBA 1J0FA 1BQ7A 2OE0A 1S3AA 2B7KA 1B9YC 3H4KA 3CTGA 2FNOA 4LMVA 3I6AA 1F9MA 4FYCA 20GSA 3BOAA 2KP1A 3RPPA 2GSSA 6GSSA 1OKTA 1YJ6A 3VPQA 1U6TA 2AJQB 3ERWA 1K0NA 1WIKA 3IHGA 3ME8A 3KTBA 1FB6A 3KD0A 3UIWA 2Z9SA 3ZLPA 3VI5A 5DAKA 1NW2A 4RQXA 5ECHB 4PGTA 4POMA 5FWGA 4YKGA 1DSBA 3LORA 2P5RA 4F2IA 4KAEA 3HZ8A 5J5NA 3UJ1A 2DLXA 3CQFA 2BJXA 3HVVA 3GTUB 1PKWA 1GUKA 3IRAA 1O73A 2ZNMA 2OBIA 4TR4A 3QDNA 1EWXA 2OBKA 3GH6A 4F03A 5ID2A 4XS1A 4GSNA 3GNJA 2TRXA 1ERUA 1K0MA 3C1SA 4WR4A 3TKSE 4K6XA 4HQZA 1IYIA 2GSQA 1KNGA 6GSWA 4G2EA 2FCHA 3IC8A 2HZEA 2PUKC 4ZL8A 1R4WA 1V58A 3M3MA 1MDIA 1Z7RA 1ERVA 2C0GA 3DIEA 3VURA 1XPVA 4MPFA 2IMIA 5A4WA 3D4MA 4MP4A 2MMNA 2HZFA 3P8WA 2DSAA 3BJ5A 2H1BA 3SWLA 4JR4A 4YQMA 2LJAA 2C80A 2XPDA 2J23A 3S9FA 1QXHA 5DBQA 1S3RA 3VWUA 2YWNA 1Z6MA 2YJHA 2ON7A 4ZB8A 1V9WA 4WEYA 5LD0A 1W89A 3MYDA 5IO2A 2XHFA 3A5IA 3NZNA 1OC3A 3LSZA 1G6YA 4PQIA 2RUFA 1XOAA 2VCXA 4O5QA 2H76A 2YN1A 2IJYA 2QA1A 2YCDA 2P31A 3TB2A 1EGRA 2WS2A 1SKSB 4MJAA 1K0AA 2FLSA 3ED3A 3IBHA 1TU7A 5H5SA 3WT1A 4BVYB 3KCMA 5A4UA 2AV4A 3F4TA 1BX9A 4JEDA 5CRHA 4Z2RA 2PN8A 3M9KA 1Z3EA 1FG4A 4TRXA 2MBTA 1V40A 1S3CA 3GKKA 2IMFA 3H79A 4NV2A 1OKDA 2PVQA 1VF3A 3UBKA 1TDIA 2E2MA 4DSSA 4MH2A 1TXXA 1ACVA 5AIXA 3O6TA 3GSSA 1N8JA 2RM6A 4DVCA 3HVSA 1GTUA 3DVWA 4FYUA 3FZ4A 14GSA 4ZIJA 3GH9A 2NDOA 4ACSA 4RUVA 4MF7A 4KH7A 1U3IA 3CBUA 2VL3A 4AJ8A 3L0HA 4E8EA 4WBJA 1WE0A 1DUGA 1EEJA 1WOUA 1AQVA 4OMVA 4NXIA 5H5RA 3UEMA 5IMDA 5HFIA 2EIRA 1EP7A 5COHA 3M9JA 2H73A 2GLRA 4IJ3A 2O8VB 4CY8A 2LQQA 2PGTA 1YQ1A 3EE2A 1GSDA 4JU5A 5G2ZA 2MMOA 4YKFA 1ZOFA 4L8EA 4EF0A 3H1NA 1AIUA 3NOFA 1OE7A 4I8BA 2H0GA 4X0XA 1URMA 2JU5A 11GSA 1QK8A 5CYYA 2HRKA 2I81A 3DWVA 4FIWA 3IDVA 3UL3A 1JLVA 3D5JA 2PMTA 2A4VA 5B6MA 4O7HA 1EOHA 2L6CA 2X4AA 2RM5A 4ZB6A 1FHEA 3GKNA 2FA8A 2IFQB 3L78A 2K8VA 3FKFA 3CSHA 1EGOA 3C1RA 3RDWA 2L4CA 2FWFA 4ZBAA 4FO5A 2C3QA 3KP9A 2FD3A 1RW1A 3ZMLA 4L0UA 2VCVA 2CVKA 3GA4A 4AGSA 6GSXA 5D93A 1TRUA 1F3AA 3PR8A 3QR6A 5B7CA 1O85A 4IP6A 4ZBDA 3ZRDA 1M2BA 1WP0A 4IS0A 3MNGA 3H93A 3Q19A 2X8HA 4K2XA 1GWCA 5ECSA 3ZIJA 2GTUA 2OE1A 1PN9A 4J2FA 4ZILA 1WMJA 2CZ3A 4TR1A 1MDKA 2M80A 5J9BA 2VM1A 4JR6A 4KF9A 3RHBA 2L59A 5CP1A 3TJJA 1SU9A 2A2SA 2CQ9A 3FK8A 1OC8A 2YJ7A 1SL0B 2GQLA 4RI7A 5GSSA 4HQSA 4HZ4A 4V2LA 1GTAA 2XC2A 4MLYA 4G19A 1M3IA 2X49A 2HSHA 2R3XA 4OFNA 4IBPA 2H0IA 2VD0A 5ECMB 3F4RA 4KA0A 3TJFA 4ECCA 1WPIA 1FOVA 1U88A 1O6JA 1Q4JA 1PX6A 3GIXA 4POLA 1F2EA 5IOXA 1OC9A 5FT3A 2NVLA 1O8XA 2LUSA 1CQHA 1PFOA 4BIKA 3E3EA 1TI1A 1A8YA 1DE1A 2GS3A 2JADA 1GP1A 4ZB9A 2F51A 3VK9A 2D2ZA 4IP1A 2L6DA 5KOWA 4GF0A 4WF4A 1F6MC 3KTLA 1XVWA 2M72A 1B9XC 2YOIA 5AIVA 18GSA 3HVXA 1XW5A 1C72A 4K2DA 2B6MA 4KGIA 3E0UA 1ST9A 3MIXA 3GURA 2BMXA 5FHIA 1SJIA 3WD6A 2C0DA 1CQGA 2C8UA 2GT6A 4BVXB 4XTSA 1GTIA 4H86A 4EC0A 1Z6NA 1LU4A 2K8SA 5IMZA 3GTUA 3ZMKA 4N10A 1FOHA 3KXOA 1K3LA 4GSSA 1PSQA 4MH3A 5JCGA 3UARA 2DMLA 4D73B 4GTUA 2DIZA 2R2JA 1F37A 4XRDA 2H70A 2IMEA 4XIHA 1QQ2A 4NHWA 2R6KA 2GGTA 4OO4A 1BEDA 3IE3A 3GL5A 3ZL5A 1GSQA 2C3TA 1ON4A 3ZITA 1N2AA 4MF6A 3HY2A 3F3RA 3KGKA 4FYBA 3LG6A 1GNEA 2VCQA 4TKYA 1TK5B 1ZMAA 1K0OA 3G7JA 4IN0A 2VL9A 2QSIA 4PTSA 2XBQA 1HNCA 3QPMA 4JRRA 2HRFA 2YWIA 1NHYA 1JZOA 17GSA 4PQHA 3C71A 1UC7A 3G9BA 1H4OA 4V2MA 4GCIA 2PPTA 1XZOA 1QGVA 2R0PA 2I9HA 3UAPA 1VRSD 3FZ5A 2DJKA 2IIYA 5BRTA 3A3TA 3F63A 22GSA 3LYPA 4K1FA 2OKAA 3GSTA 3AY8A 5CRGA 1XWAA 5B8AA 1G7OA 2B5YA 5ECQB 5D73A 3EURA 5A5KA 7GSSA 5IMAA 1KTEA 1NHOA 2JACA 2LNTA 4GRFA 5F8BA 3HJMA 3ERFA 4RI6A 1O81A 4ML6A 2LKUA 2PU9C 5ECRB 4PNFA 5C00A 5G5FA 2X64A 2AYTA 2LJRA 4ECJA 3KM6A 4HSCX 2MBSA 2R0GA 1TU8A 4EE0A 1V2AA 4DSQA 4KSMA 2F3MA 3ZTLA 4Q5NA 2B5EA 2KLXA 5DVBA 2B3SA 4TW5A 5KOXA 5LNKe 2LS5A 2H01A 3FRCA 3KH9A 2LSTA 3QFAC 3OR5A 1YDKA 3LXTA 1X9WB 4NAXA 2LRNA 3EINA 2GSTA 3TJKA 2AHEA 4TXOA 1X9MB 3FYGA 1ZYEA 3UMAA 2FY6A 2LTKA 1BG5A 2KHPA 1MDJA 4CDOA 1MEKA 4KUNA 4XCSA 1FAAA 2LJKA 3IAS2 4K0NA 2J9HA 4GQCA 2JZSA 3GX0A 10GSA 2QC7A 1O8WA 1SK0A 3RHCA 3GRXA 1QMVA 4HDEA 4K5RA 3EU3A 5E59A 2REMA 2DJJA 4LMWA 5D9WA 1I9DA 2V6KA 3HKRA 1PGTA 4MNNA 6GSYA 2OADA 4YAPA 3F6FA 4LL4B 2H6ZA 1JZDA 1Z7PA 3SBCA 5EVOA 2PBJA 2WDUA 4J57E 1HNBA 2ALBA 3G7YA 4MK3A 1SYRA 2M46A 3QAVA 2VL2C 2H71A 4G0LA 4N11A 5DDLA 4G0KA 5DQSA 2NPBA 4POBA 2DKHA 1QFNA 3F8UA 4WR5A 4I6XA 4MF5A 4HU9A 2MMAA 2IFQA 1TRWA 5HR3A 4MABA 4NMUA 4PX1A 1YKAA 4YQVA 1TTZA 4ISDA 5D96A 2GZPA 1VF1A 2AUVA 5B8BA 1BJXA 1UVZA 5JCUA 3F0IA 3PPUA 5ECPB 2VAFA 2VOCA 3O76A 4HJ2A 2X8CA 4BL7B 2N5BA 1K3YA 2WGRA 4XHMA 1HD2A 1ZYPA 2NBSA 5DAKB 1EZKA 1VGLA 1HQOA 2VD1A 3FR9A 1JZRA 1MTCA 2YNXA 4I97A 2EIQA 1AC1A 1SJ6A 2H72A 5CRDA 3C8EA 2QKEA 4CY6A 3GYKA 2YV9A 2DJ1A 2JSZA 4NPBA 3QMXA 1A8LA 4N0VA 5ID2B 2PWJA 1ERWA 3F3QA 2GSRA 3D0ZA 3CMIA 1X5CA 4EVMA 2EC4A 2A4HA 4O5UA 4F82A 2DJ2A 3QAWA 2VUPA 1M99A 5ENUA 1EV9A 4JZQA 3GN3A 5CNWA 1WRYA 2VCTA 1OAZA 2CVDA 3BCKA 3M8NA 5KN2A 1SKWB 5ELGA 2R5GA 9GSSA 2VIMA 5IOWA 4K7IA 3M0FA 2KOKA 2H66A 4TVEA 2FA4A 3TOTA 1TRVA 3TJGA 1GTBA 2R4VA 2OACA 1YEXA 2FWGA 19GSA 2LRTA 2IPAA 4ZXGA 3IOSA 3HVNA 1THOA 1X5EA 1PX7A 2KP2A 3H8QA 5IPHA 1EEMA 4EKZA 2O87A 4N0ZA 5DCHA 5E4WA 2TRCP 2C0EA 1XBSA 2GDRA 4WKWA 5G5EA 3KEBA 5DALA 4V2NA 2HNLA 2GVPA 4D73A 1T3BA 3EMXA 5BMUA 2DMMA 5IMCA 1EOGA 4EO3A 4PNGA 4PURA 3GL3A 2H8LA 4GXZA 5AN1A 4O32A 3FHKA 1GL8A 2YZUA 1TW9A 5INYA 1A2JA 2VO4A 3DRNA 5J41A 4Z7XA 1Z9HA 1GRXA 3US3A 4GQFA 2HT9A 2V6OA 1FO5A 3FZAA 3I69A
chains in the Genus database with same CATH topology
2K6VA 3I43A 3TRQA 3D22A 2IN3A 1TK0B 1T00A 3DXBA 3HD5A 3HA9A 4LLRA 1PQNA 2MZCA 4DSSB 5KN0A 3VI7A 3QCPA 5EY6A 1PMTA 2IWTA 4Z2TA 3PH9A 4F0BA 4HZ2A 1TJDA 5D9TA 1T1VA 3IPZA 4JE1A 2DIYA 4JBBA 2VLVA 4A5PA 1PRXA 2G2QA 2P0GA 5L71A 4V1Ag 1KEBA 3VWXA 1GSYA 4WF5A 2XBIA 2VLTA 1A2LA 1X0RA 4K8MA 2WJUA 2DJ0A 3RBTA 2PERA 1TRSA 2H1GA 4USSA 2CV4A 2CZ2A 3N5OA 2A2PA 3DKSA 5DJLA 1I5GA 3GUSA 4MJCA 2IMDA 2FWEA 3APQA 4KCAA 2E0QA 3C7MA 1G6WA 4MCUA 4XRAA 3A5WA 4TOPA 2V1MA 2WB9A 4LL1B 2P5QA 3A2WA 3HXSA 5HQPA 2OA7A 3G7IA 3NIVA 1Z5YE 2A2RA 3PGTA 2V2GA 3CRUA 1YF1A 2HI7A 3ZVJD 1JHBA 2WULA 1BAYA 4EIPA 4QQ7A 2GQMA 3UBLA 3LJRA 1A24A 5JCWA 3TDGA 3ZREA 1XWBA 2OE3A 4TN8A 3ZVJA 2WFCA 1R5PA 1F3BA 1Y6EA 2GZZA 1K0DA 1XW6A 3VLNA 3KJYA 3EYTA 1WWJA 4Q5FA 1PL2A 1XIYA 2CAIA 3BD2A 1MD4A 1XWGA 5G1KA 1K0BA 4MA9A 1DE2A 1FVKA 1V57A 4IGJA 3R3EA 5G30A 4K5SA 2FHEA 1JLWA 4N30A 2IL3A 4HEA2 4K9ZA 2YV7A 2RIIA 3WGEA 2NTOA 5D9VA 4CW9A 2AB6A 1T7PB 1IYHA 1SL1B 1A0RP 3KIJA 1T8EB 2F9SA 1XW9A 3L9SA 3LGCA 4EUYA 1T4YA 5G31A 3EMPA 1GULA 4L5OA 4NHZA 5IMVA 2H6XA 5EL8A 3IXRA 1WJKA 4X43A 1PKZA 3APOA 4NWYA 4XS4B 5A4VA 2K18A 1HNAA 4YQUA 2GQKA 2LEGA 5KN3A 3Q18A 2QGVA 2GT5A 5HFKA 4MDCA 4L0WA 3VWWA 1SD9A 4WETA 3TGZA 2HYXA 3GV1A 4PUFC 4PXOA 4EXJA 5G1LA 4Q5QA 2YPMA 3LXZA 1T4ZA 3EWLA 1BYEA 3WT2A 4HS1A 3LYKA 4MJEA 1M0UA 1ML6A 5D9XA 1YY7A 1JZWA 2RLIA 1AQXA 3M1GA 5ECKB 4BVYA 1YZXA 5GZZB 4BWSA 2HSYA 5HR2A 3CRTA 1PN0A 5KEJA 1YKCA 3FZ9A 4BL7A 2H30A 2MYGA 1Q98A 5EPFA 3FEUA 4KE3A 2DKIA 4ECBA 3IA1A 5IIZA 5GSTA 2HE3A 6GSVA 5CRWA 5J3RA 4KDYA 4OFMA 3RPNA 2EIOA 3R2QA 1TI3A 2HXKA 2CX3A 1SJZA 2HRAA 3QFBC 4ZBBA 1FB0A 1ZZYA 1SYXA 4MZBA 1XWKA 4KCEA 4TXVA 4ULXA 4ILFA 3MWHA 2H74A 2B1LA 4IW9A 4OO5A 3C73A 3F6DA 2O85A 2LNSA 1ZYQB 4IJIA 4PUAA 1TOFA 4AJ7A 5ECLB 2F8AA 5ECOB 5GAPD 5ABRA 3ZFLA 2C1YA 3L4NA 4HI7A 4CHSA 5ELAA 2F8FA 1GSEA 5CAXA 3DMLA 2R37A 2YANA 13GSA 1XFLA 2V32A 2CVBA 4ML1A 3GHAA 1NM3A 2H1AA 2IMKA 4OD7A 2QA2A 3LFLA 2VM2A 4KB3A 2MMZA 4GLTA 4MZCA 5C04A 3HJOA 5KN1A 5F05A 2OJLA 3IK7A 1AXDA 2BTOT 2VCWA 2CT6A 2C4JA 1A2MA 1SL2B 1HYUA 4XS6A 3ZYWA 2C0FA 3VWVA 4EL1A 4ID0A 4QL9A 2L4QA 1GSSA 3U5RE 1W4VA 2WCIA 4BA7A 3DD3A 2E7PA 3DGQA 5IM9A 1GH2A 2X8GA 2FUG2 4ICYA 3ME7A 4OWYA 3LQ7A 2XPEA 4DEJA 5IPGA 2K9FA 1J9BA 4TR0A 3HYPA 2KUCA 2JZRA 4OCFA 3KH7A 4IHUA 3F4SA 5HFGA 4K7OA 3FR3A 3HDCA 1Y25A 3DEXA 2HFDA 1UN2A 4KNDA 3DYRA 4MPGA 5JWRB 1M9AA 2L5LA 3FMWA 3TRXA 2B5XA 4YH2A 1SD8A 1PL1A 1X5DA 1J08A 4EIQA 5IO0A 2G0FA 3IC4A 3CSIA 3UOMA 5D8IA 4KW6A 1ERTA 5B6NA 1E6BA 3FR6A 3TKQA 4TXOB 2WZ9A 4IVFA 1XOBA 2UZ8A 2VCZA 4O5RA 1XVQA 3QOUA 3LWAA 1K3OA 3EU4A 1GUMA 2LRCA 5J4UA 2HZEB 1ZYNA 1V98A 3K8NA 4WXTA 1TK8B 4X4JA 5H5QA 5LCZA 3KMOA 3HCZA 2I4AA 3CTFA 1RQMA 1AUCA 4GWRA 3GKXA 2YP6A 2ZCTA 4G0IA 1THXA 2CA8A 4LA1A 4ZL7A 1SK2A 1ZGNA 2VLUA 3I9V2 1OE8A 1B8XA 2TIRA 4P3YB 2DBCA 1SK1A 1E2YA 3KZQA 2YWMA 3TUEA 3V1WA 2N5AA 1QUWA 2ON5A 3QD9A 1B4QA 3FY7A 4ZL9A 3GMFA 4E8HA 4IQAA 1EP8A 2O7KA 3BBYA 2C3NA 4L5LA 4BVXA 3VPTA 4HOJA 3CSJA 4EDZA 1GLPA 1TKDB 1VF4A 3MSZA 1ZL9A 2N5FA 4F0CA 1SKRB 2AAWA 2H0HA 3CXGA 3HHVA 1K0CA 5HR0A 1UA5A 4O92A 1R7HA 6GSTA 4OFTA 3U6VA 3HJPA 3TCOA 4ECIA 5HR1A 6GSUA 2CAQA 2PVOC 2H75A 2H6YA 3W8JA 4EDYA 1AW9A 1ZCPA 2CX4A 5F06A 3P2AA 1X9SB 3Q74A 2O89A 1M7TA 5CO3A 1M2AA 2ZUPA 3D6IA 5J9CA 4IELA 5JWOB 4BWQA 2YWOA 1FVJA 1FW1A 2JL4A 4WBRD 4F9ZA 4I5QA 1LJRA 3UVHA 4I2TA 1DBYA 1RK4A 1H75A 1TP9A 4KDXA 1B48A 1OYJA 1B4PA 5GAND 1XCCA 4G10A 3QAGA 3PINA 4PQ1A 1S3DA 2I3YA 4MMMA 3GFKA 4NV5A 4XS4A 3CYNA 4KSOA 4V1Ap 3TKSA 3APSA 1PA3A 2H1DA 8GSSA 4KDUA 2GZYA 4IQ1A 1U87A 3WYWA 4HJMA 3TOUA 3IAM2 4AJ6A 1M2DA 3UVTA 3WGXA 3TRPA 1GSUA 5CREA 3IK9A 3W8SA 3LW9A 3KMNA 3ZZXA 2FGXA 3TJBA 2ES7A 4OCEA 2H19A 5DCGA 1A23A 3GKMA 1AAZA 1JFUA 4BPYA 1U3AA 5DQYA 1G0TA 3EPTA 1LBKA 3ISOA 3FW2A 4K0GA 1PD21 1R5AA 3ERGA 4YAVA 3IR4A 2R0CA 1KBNA 2L5OA 4POKA 1R26A 1SENA 3O3TA 3P90A 2DC5A 1OVNA 4MJBA 5DJMA 2HRNA 3ZIVA 2LV3A 3RAZA 2WRTA 2I1UA 4HUAA 4QL7A 4X1UA 1YF0A 2V41A 3E9JB 4J56E 3HZ4A 3VFIA 3Q6OA 1A0FA 2HSMA 2L57A 4FH8A 3BCIA 4Z2UA 1GLQA 4G9HA 5DALB 4AF2A 3GX8A 4I2UA 2E2GA 1GUHA 3TKPA 1ILOA 1YEPA 2DJ3A 3A2XA 2RUEA 5F0GA 2FWHA 4K7NA 3A2VA 2B7JA 3ZFBA 4MZWA 4KX4A 5AGYA 4TR1B 3N9JA 3MDKA 1EV4A 2B1KA 3JCML 3W6GA 3WGDA 3IV4A 3J7Yk 3D21A 3P7XA 4TR3A 4GSTA 5IMFA 1O7UA 2X99A 2JSYA 5F07A 1MD3A 16GSA 5ECNB 5JWQB 1M9BA 3TKRA 2LQOA 1AQWA 4IKHA 2JZTA 3MAKA 5AISA 3IHQA 12GSA 4RQRA 2VL2A 3EC3A 1ABAA 4HU7A 5ECIB 3DVXA 3EVIA 3D4TA 1G7EA 1GSFA 4FQUA 1OC9B 1GNWA 4Q5RA 2HLSA 1NSWA 1XXUA 1XWCA 1VF2A 3F9UA 3TKSC 4DSRA 3LEFA 3L9VA 3J7Yb 3L9UA 5IQYA 2YZHA 3KP8A 1USBA 1J0FA 1BQ7A 2OE0A 1S3AA 2B7KA 1B9YC 3H4KA 3CTGA 2FNOA 4LMVA 3I6AA 1F9MA 4FYCA 20GSA 3BOAA 2KP1A 3RPPA 2GSSA 6GSSA 1OKTA 1YJ6A 3VPQA 1U6TA 2AJQB 3ERWA 1K0NA 1WIKA 3IHGA 3ME8A 3KTBA 1FB6A 3KD0A 3UIWA 2Z9SA 3ZLPA 3VI5A 5DAKA 1NW2A 4RQXA 5ECHB 4PGTA 4POMA 5FWGA 4YKGA 1DSBA 3LORA 2P5RA 4F2IA 4KAEA 3HZ8A 5J5NA 3UJ1A 2DLXA 2BJXA 3HVVA 3GTUB 1PKWA 1GUKA 3IRAA 1O73A 2ZNMA 2OBIA 4TR4A 3QDNA 1EWXA 2OBKA 3GH6A 4F03A 5ID2A 4XS1A 4GSNA 3GNJA 2TRXA 1ERUA 1K0MA 3C1SA 4WR4A 3TKSE 4K6XA 4HQZA 1IYIA 2GSQA 1KNGA 6GSWA 4G2EA 2FCHA 3IC8A 2HZEA 2PUKC 4ZL8A 1R4WA 1V58A 3M3MA 1MDIA 1Z7RA 1ERVA 2C0GA 3DIEA 3VURA 1XPVA 4MPFA 2IMIA 5A4WA 3D4MA 4MP4A 2MMNA 2HZFA 3P8WA 2DSAA 3BJ5A 2H1BA 3SWLA 4JR4A 4YQMA 2LJAA 2C80A 2XPDA 2J23A 3S9FA 1QXHA 5DBQA 3VWUA 2YWNA 1Z6MA 2YJHA 2ON7A 4ZB8A 1V9WA 4WEYA 5LD0A 1W89A 3MYDA 5IO2A 2XHFA 3A5IA 3NZNA 1OC3A 3LSZA 1G6YA 4PQIA 2RUFA 1XOAA 2VCXA 4O5QA 2H76A 2YN1A 2IJYA 2QA1A 2YCDA 2P31A 3TB2A 1EGRA 2WS2A 1SKSB 4MJAA 1K0AA 2FLSA 3ED3A 3IBHA 1TU7A 5H5SA 3WT1A 4BVYB 3KCMA 5A4UA 2AV4A 3F4TA 1BX9A 4JEDA 5CRHA 4Z2RA 2PN8A 3M9KA 1Z3EA 1FG4A 4TRXA 2MBTA 1V40A 1S3CA 3GKKA 2IMFA 3H79A 4NV2A 1OKDA 2PVQA 1VF3A 3UBKA 1TDIA 2E2MA 4DSSA 4MH2A 1TXXA 1ACVA 5AIXA 3O6TA 3GSSA 1N8JA 2RM6A 4DVCA 3HVSA 1GTUA 3DVWA 4FYUA 3FZ4A 14GSA 4ZIJA 3GH9A 2NDOA 4ACSA 4RUVA 4MF7A 4KH7A 1U3IA 3CBUA 2VL3A 4AJ8A 3L0HA 4E8EA 4WBJA 1WE0A 1DUGA 1EEJA 1WOUA 1AQVA 4OMVA 4NXIA 5H5RA 3UEMA 5IMDA 5HFIA 2EIRA 1EP7A 5COHA 3M9JA 2H73A 2GLRA 4IJ3A 2O8VB 4CY8A 2LQQA 2PGTA 1YQ1A 3EE2A 1GSDA 4JU5A 5G2ZA 2MMOA 4YKFA 1ZOFA 4L8EA 4EF0A 3H1NA 1AIUA 3NOFA 1OE7A 4I8BA 2H0GA 4X0XA 1URMA 2JU5A 11GSA 1QK8A 5CYYA 2HRKA 2I81A 3DWVA 4FIWA 3IDVA 3UL3A 1JLVA 3D5JA 2PMTA 2A4VA 5B6MA 4O7HA 1EOHA 2L6CA 2X4AA 2RM5A 4ZB6A 1FHEA 3GKNA 2FA8A 2IFQB 3L78A 2K8VA 3FKFA 3CSHA 1EGOA 3C1RA 3RDWA 2L4CA 2FWFA 4ZBAA 4FO5A 2C3QA 3KP9A 2FD3A 1RW1A 3ZMLA 4L0UA 2VCVA 2CVKA 3GA4A 4AGSA 6GSXA 5D93A 1TRUA 1F3AA 3PR8A 3QR6A 5B7CA 1O85A 4IP6A 4ZBDA 3ZRDA 1M2BA 1WP0A 4IS0A 3MNGA 3H93A 3Q19A 2X8HA 4K2XA 1GWCA 5ECSA 3ZIJA 2GTUA 2OE1A 1PN9A 4J2FA 4ZILA 1WMJA 2CZ3A 4TR1A 1MDKA 2M80A 5J9BA 2VM1A 4JR6A 4KF9A 3RHBA 2L59A 5CP1A 3TJJA 1SU9A 2A2SA 2CQ9A 3FK8A 1OC8A 2YJ7A 1SL0B 2GQLA 4RI7A 5GSSA 4HQSA 4HZ4A 4V2LA 1GTAA 2XC2A 4MLYA 4G19A 2X49A 2HSHA 2R3XA 4OFNA 4IBPA 2H0IA 2VD0A 5ECMB 3F4RA 4KA0A 3TJFA 4ECCA 1WPIA 1FOVA 1U88A 1O6JA 1Q4JA 1PX6A 3GIXA 4POLA 1F2EA 5IOXA 1OC9A 5FT3A 2NVLA 1O8XA 2LUSA 1CQHA 3E3EA 1TI1A 1A8YA 1DE1A 2GS3A 2JADA 1GP1A 4ZB9A 2F51A 3VK9A 2D2ZA 4IP1A 2L6DA 5KOWA 4GF0A 4WF4A 1F6MC 3KTLA 1XVWA 2M72A 1B9XC 2YOIA 5AIVA 18GSA 3HVXA 1XW5A 1C72A 4K2DA 2B6MA 4KGIA 3E0UA 1ST9A 3MIXA 3GURA 2BMXA 5FHIA 1SJIA 3WD6A 2C0DA 1CQGA 2C8UA 2GT6A 4BVXB 4XTSA 1GTIA 4H86A 4EC0A 1Z6NA 1LU4A 2K8SA 5IMZA 3GTUA 3ZMKA 4N10A 1FOHA 3KXOA 1K3LA 4GSSA 1PSQA 4MH3A 5JCGA 3UARA 2DMLA 4D73B 4GTUA 2DIZA 2R2JA 1F37A 4XRDA 2H70A 2IMEA 4XIHA 1QQ2A 4NHWA 2R6KA 2GGTA 4OO4A 1BEDA 3IE3A 3GL5A 3ZL5A 1GSQA 2C3TA 1ON4A 3ZITA 1N2AA 4MF6A 3HY2A 3F3RA 3KGKA 4FYBA 3LG6A 1GNEA 2VCQA 4TKYA 1TK5B 1ZMAA 1K0OA 3G7JA 4IN0A 2VL9A 2QSIA 4PTSA 2XBQA 1HNCA 3QPMA 4JRRA 2HRFA 2YWIA 1NHYA 1JZOA 17GSA 4PQHA 3C71A 1UC7A 3G9BA 1H4OA 4V2MA 4GCIA 2PPTA 1XZOA 1QGVA 2R0PA 2I9HA 3UAPA 1VRSD 3FZ5A 2DJKA 2IIYA 5BRTA 3A3TA 3F63A 22GSA 3LYPA 4K1FA 2OKAA 3GSTA 3AY8A 5CRGA 1XWAA 5B8AA 1G7OA 2B5YA 5ECQB 5D73A 3EURA 5A5KA 7GSSA 5IMAA 1KTEA 1NHOA 2JACA 2LNTA 4GRFA 5F8BA 3HJMA 3ERFA 4RI6A 1O81A 4ML6A 2LKUA 2PU9C 5ECRB 4PNFA 5C00A 5G5FA 2X64A 2AYTA 2LJRA 4ECJA 3KM6A 2MBSA 2R0GA 1TU8A 4EE0A 1V2AA 4DSQA 4KSMA 2F3MA 3ZTLA 4Q5NA 2B5EA 2KLXA 5DVBA 2B3SA 4TW5A 5KOXA 5LNKe 2LS5A 2H01A 3FRCA 3KH9A 2LSTA 3QFAC 3OR5A 1YDKA 3LXTA 1X9WB 4NAXA 2LRNA 3EINA 2GSTA 3TJKA 2AHEA 4TXOA 1X9MB 3FYGA 1ZYEA 3UMAA 2FY6A 2LTKA 1BG5A 2KHPA 1MDJA 4CDOA 1MEKA 4KUNA 4XCSA 1FAAA 2LJKA 3IAS2 4K0NA 2J9HA 4GQCA 2JZSA 3GX0A 10GSA 2QC7A 1O8WA 1SK0A 3RHCA 3GRXA 1QMVA 4HDEA 4K5RA 3EU3A 5E59A 2REMA 2DJJA 4LMWA 5D9WA 1I9DA 2V6KA 3HKRA 1PGTA 4MNNA 6GSYA 2OADA 4YAPA 3F6FA 4LL4B 2H6ZA 1JZDA 1Z7PA 3SBCA 5EVOA 2PBJA 2WDUA 4J57E 1HNBA 2ALBA 3G7YA 4MK3A 1SYRA 2M46A 3QAVA 2VL2C 2H71A 4G0LA 4N11A 5DDLA 4G0KA 5DQSA 2NPBA 4POBA 2DKHA 1QFNA 3F8UA 4WR5A 4I6XA 4MF5A 4HU9A 2MMAA 2IFQA 1TRWA 5HR3A 4MABA 4NMUA 4PX1A 1YKAA 4YQVA 1TTZA 4ISDA 5D96A 2GZPA 1VF1A 2AUVA 5B8BA 1BJXA 1UVZA 5JCUA 3F0IA 3PPUA 5ECPB 2VAFA 2VOCA 3O76A 4HJ2A 2X8CA 4BL7B 2N5BA 1K3YA 2WGRA 4XHMA 1HD2A 1ZYPA 2NBSA 5DAKB 1EZKA 1VGLA 1HQOA 2VD1A 3FR9A 1JZRA 1MTCA 2YNXA 4I97A 2EIQA 1AC1A 1SJ6A 2H72A 5CRDA 3C8EA 2QKEA 4CY6A 3GYKA 2YV9A 2DJ1A 2JSZA 4NPBA 3QMXA 1A8LA 4N0VA 5ID2B 2PWJA 1ERWA 3F3QA 2GSRA 3D0ZA 3CMIA 1X5CA 4EVMA 2EC4A 2A4HA 4O5UA 4F82A 2DJ2A 3QAWA 2VUPA 1M99A 5ENUA 1EV9A 4JZQA 3GN3A 5CNWA 1WRYA 2VCTA 1OAZA 2CVDA 3BCKA 3M8NA 5KN2A 1SKWB 5ELGA 2R5GA 9GSSA 2VIMA 5IOWA 4K7IA 3M0FA 2KOKA 2H66A 4TVEA 2FA4A 3TOTA 1TRVA 3TJGA 1GTBA 2R4VA 2OACA 1YEXA 2FWGA 19GSA 2LRTA 2IPAA 4ZXGA 3IOSA 1THOA 1X5EA 1PX7A 2KP2A 3H8QA 5IPHA 1EEMA 4EKZA 2O87A 4N0ZA 5DCHA 5E4WA 2TRCP 2C0EA 1XBSA 2GDRA 4WKWA 5G5EA 3KEBA 5DALA 4V2NA 2HNLA 2GVPA 4D73A 1T3BA 3EMXA 5BMUA 2DMMA 5IMCA 1EOGA 4EO3A 4PNGA 4PURA 3GL3A 2H8LA 4GXZA 5AN1A 4O32A 3FHKA 1GL8A 2YZUA 1TW9A 5INYA 1A2JA 2VO4A 3DRNA 5J41A 4Z7XA 1Z9HA 1GRXA 3US3A 4GQFA 2HT9A 2V6OA 1FO5A 3FZAA 3I69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K6V A;  3I43 A;  3TRQ A;  3D22 A;  2IN3 A;  1TK0 B;  1T00 A;  3DXB A;  3HD5 A;  3HA9 A;  4LLR A;  1PQN A;  2MZC A;  4DSS B;  5KN0 A;  3VI7 A;  3QCP A;  5EY6 A;  1PMT A;  2IWT A;  3PH9 A;  4F0B A;  4HZ2 A;  1TJD A;  5D9T A;  1T1V A;  3IPZ A;  4JE1 A;  2DIY A;  4JBB A;  2VLV A;  1PRX A;  2G2Q A;  2P0G A;  5L71 A;  4V1A g;  1KEB A;  3VWX A;  1GSY A;  4WF5 A;  2XBI A;  2VLT A;  1A2L A;  1X0R A;  4K8M A;  2WJU A;  2DJ0 A;  3RBT A;  2PER A;  1TRS A;  2H1G A;  2CV4 A;  2CZ2 A;  3N5O A;  3DKS A;  5DJL A;  1I5G A;  3GUS A;  4MJC A;  2IMD A;  2FWE A;  3APQ A;  4KCA A;  2E0Q A;  3C7M A;  1G6W A;  4MCU A;  4XRA A;  3A5W A;  4TOP A;  2V1M A;  2WB9 A;  4LL1 B;  2P5Q A;  3A2W A;  3HXS A;  5HQP A;  2OA7 A;  3G7I A;  3NIV A;  1Z5Y E;  2A2R A;  3PGT A;  2V2G A;  3CRU A;  1YF1 A;  2HI7 A;  3ZVJ D;  1JHB A;  2WUL A;  1BAY A;  4QQ7 A;  2GQM A;  3UBL A;  3LJR A;  1A24 A;  5JCW A;  3TDG A;  3ZRE A;  1XWB A;  2OE3 A;  4TN8 A;  3ZVJ A;  2WFC A;  1R5P A;  1F3B A;  1Y6E A;  2GZZ A;  1K0D A;  1XW6 A;  3VLN A;  3KJY A;  3EYT A;  1WWJ A;  4Q5F A;  1PL2 A;  1XIY A;  2CAI A;  3BD2 A;  1MD4 A;  1XWG A;  5G1K A;  1K0B A;  4MA9 A;  1DE2 A;  1FVK A;  1V57 A;  4IGJ A;  5G30 A;  2FHE A;  1JLW A;  4N30 A;  2IL3 A;  4HEA 2;  4K9Z A;  2YV7 A;  2RII A;  3WGE A;  2NTO A;  5D9V A;  4CW9 A;  2AB6 A;  1T7P B;  1IYH A;  1SL1 B;  1A0R P;  3KIJ A;  1T8E B;  2F9S A;  1XW9 A;  3L9S A;  3LGC A;  4EUY A;  1T4Y A;  5G31 A;  3EMP A;  1GUL A;  4L5O A;  4NHZ A;  5IMV A;  2H6X A;  5EL8 A;  3IXR A;  1WJK A;  4X43 A;  1PKZ A;  3APO A;  4NWY A;  4XS4 B;  5A4V A;  2K18 A;  1HNA A;  4YQU A;  2GQK A;  2LEG A;  5KN3 A;  3Q18 A;  2QGV A;  2GT5 A;  5HFK A;  4MDC A;  4L0W A;  3VWW A;  1SD9 A;  4WET A;  3TGZ A;  2HYX A;  3GV1 A;  4PUF C;  4PXO A;  4EXJ A;  5G1L A;  4Q5Q A;  2YPM A;  3LXZ A;  1T4Z A;  3EWL A;  1BYE A;  3WT2 A;  4HS1 A;  3LYK A;  4MJE A;  1M0U A;  1ML6 A;  5D9X A;  1YY7 A;  1JZW A;  2RLI A;  1AQX A;  3M1G A;  5ECK B;  4BVY A;  1YZX A;  5GZZ B;  4BWS A;  2HSY A;  5HR2 A;  3CRT A;  5KEJ A;  1YKC A;  3FZ9 A;  4BL7 A;  2H30 A;  2MYG A;  1Q98 A;  5EPF A;  3FEU A;  4KE3 A;  4ECB A;  3IA1 A;  5IIZ A;  5GST A;  2HE3 A;  6GSV A;  5CRW A;  5J3R A;  4KDY A;  4OFM A;  3RPN A;  2EIO A;  3R2Q A;  1TI3 A;  2HXK A;  2CX3 A;  1SJZ A;  3QFB C;  4ZBB A;  1FB0 A;  1ZZY A;  1SYX A;  4MZB A;  1XWK A;  4KCE A;  4TXV A;  4ULX A;  4ILF A;  3MWH A;  2H74 A;  2B1L A;  4IW9 A;  4OO5 A;  3C73 A;  3F6D A;  2O85 A;  2LNS A;  1ZYQ B;  4IJI A;  4PUA A;  1TOF A;  4AJ7 A;  5ECL B;  2F8A A;  5ECO B;  5GAP D;  5ABR A;  3ZFL A;  2C1Y A;  3L4N A;  4HI7 A;  4CHS A;  5ELA A;  2F8F A;  1GSE A;  5CAX A;  3DML A;  2R37 A;  2YAN A;  13GS A;  1XFL A;  2V32 A;  2CVB A;  4ML1 A;  3GHA A;  1NM3 A;  2H1A A;  2IMK A;  4OD7 A;  3LFL A;  2VM2 A;  4KB3 A;  2MMZ A;  4GLT A;  4MZC A;  5C04 A;  3HJO A;  5KN1 A;  5F05 A;  2OJL A;  3IK7 A;  1AXD A;  2BTO T;  2VCW A;  2CT6 A;  2C4J A;  1A2M A;  1SL2 B;  1HYU A;  4XS6 A;  3ZYW A;  2C0F A;  3VWV A;  4EL1 A;  4ID0 A;  4QL9 A;  2L4Q A;  1GSS A;  3U5R E;  1W4V A;  2WCI A;  4BA7 A;  3DD3 A;  2E7P A;  3DGQ A;  5IM9 A;  1GH2 A;  2X8G A;  2FUG 2;  3ME7 A;  4OWY A;  3LQ7 A;  2XPE A;  4DEJ A;  5IPG A;  2K9F A;  1J9B A;  4TR0 A;  3HYP A;  2KUC A;  2JZR A;  4OCF A;  3KH7 A;  4IHU A;  3F4S A;  5HFG A;  4K7O A;  3FR3 A;  3HDC A;  1Y25 A;  3DEX A;  2HFD A;  1UN2 A;  4KND A;  3DYR A;  4MPG A;  5JWR B;  1M9A A;  2L5L A;  3TRX A;  2B5X A;  4YH2 A;  1SD8 A;  1PL1 A;  1X5D A;  1J08 A;  5IO0 A;  2G0F A;  3IC4 A;  3CSI A;  3UOM A;  5D8I A;  4KW6 A;  1ERT A;  5B6N A;  1E6B A;  3FR6 A;  3TKQ A;  4TXO B;  2WZ9 A;  4IVF A;  1XOB A;  2VCZ A;  4O5R A;  1XVQ A;  3QOU A;  3LWA A;  1K3O A;  3EU4 A;  1GUM A;  2LRC A;  5J4U A;  2HZE B;  1V98 A;  3K8N A;  4WXT A;  1TK8 B;  5H5Q A;  5LCZ A;  3KMO A;  3HCZ A;  2I4A A;  3CTF A;  1RQM A;  1AUC A;  4GWR A;  3GKX A;  2YP6 A;  2ZCT A;  1THX A;  2CA8 A;  4LA1 A;  4ZL7 A;  1SK2 A;  1ZGN A;  2VLU A;  3I9V 2;  1OE8 A;  1B8X A;  2TIR A;  4P3Y B;  2DBC A;  1SK1 A;  1E2Y A;  3KZQ A;  2YWM A;  3TUE A;  3V1W A;  2N5A A;  1QUW A;  2ON5 A;  3QD9 A;  1B4Q A;  3FY7 A;  4ZL9 A;  3GMF A;  4E8H A;  4IQA A;  1EP8 A;  2O7K A;  3BBY A;  2C3N A;  4L5L A;  4BVX A;  3VPT A;  4HOJ A;  3CSJ A;  4EDZ A;  1GLP A;  1TKD B;  1VF4 A;  3MSZ A;  1ZL9 A;  2N5F A;  4F0C A;  1SKR B;  2AAW A;  2H0H A;  3CXG A;  3HHV A;  1K0C A;  5HR0 A;  1UA5 A;  4O92 A;  1R7H A;  6GST A;  4OFT A;  3U6V A;  3HJP A;  3TCO A;  4ECI A;  5HR1 A;  6GSU A;  2CAQ A;  2PVO C;  2H75 A;  2H6Y A;  3W8J A;  4EDY A;  1AW9 A;  1ZCP A;  2CX4 A;  5F06 A;  3P2A A;  1X9S B;  3Q74 A;  2O89 A;  1M7T A;  5CO3 A;  1M2A A;  2ZUP A;  3D6I A;  5J9C A;  4IEL A;  5JWO B;  4BWQ A;  2YWO A;  1FVJ A;  1FW1 A;  2JL4 A;  4WBR D;  4F9Z A;  4I5Q A;  1LJR A;  3UVH A;  4I2T A;  1DBY A;  1RK4 A;  1H75 A;  1TP9 A;  4KDX A;  1B48 A;  1OYJ A;  1B4P A;  5GAN D;  1XCC A;  4G10 A;  3QAG A;  3PIN A;  4PQ1 A;  1S3D A;  2I3Y A;  4MMM A;  3GFK A;  4NV5 A;  4XS4 A;  3CYN A;  4KSO A;  4V1A p;  3TKS A;  3APS A;  1PA3 A;  2H1D A;  8GSS A;  4KDU A;  2GZY A;  4IQ1 A;  1U87 A;  3WYW A;  4HJM A;  3TOU A;  3IAM 2;  4AJ6 A;  1M2D A;  3UVT A;  3WGX A;  3TRP A;  1GSU A;  5CRE A;  3IK9 A;  3W8S A;  3KMN A;  3ZZX A;  2FGX A;  3TJB A;  2ES7 A;  4OCE A;  2H19 A;  5DCG A;  1A23 A;  3GKM A;  1AAZ A;  1JFU A;  4BPY A;  1U3A A;  5DQY A;  1G0T A;  1LBK A;  3ISO A;  3FW2 A;  4K0G A;  1PD2 1;  1R5A A;  3ERG A;  4YAV A;  3IR4 A;  1KBN A;  2L5O A;  4POK A;  1R26 A;  1SEN A;  3O3T A;  3P90 A;  2DC5 A;  1OVN A;  4MJB A;  5DJM A;  2HRN A;  3ZIV A;  2LV3 A;  3RAZ A;  2WRT A;  2I1U A;  4HUA A;  4QL7 A;  4X1U A;  1YF0 A;  2V41 A;  3E9J B;  4J56 E;  3HZ4 A;  3VFI A;  3Q6O A;  1A0F A;  2L57 A;  4FH8 A;  3BCI A;  1GLQ A;  4G9H A;  5DAL B;  4AF2 A;  3GX8 A;  4I2U A;  2E2G A;  1GUH A;  3TKP A;  1ILO A;  1YEP A;  2DJ3 A;  3A2X A;  2RUE A;  5F0G A;  2FWH A;  4K7N A;  3A2V A;  2B7J A;  3ZFB A;  4MZW A;  4KX4 A;  5AGY A;  4TR1 B;  3N9J A;  3MDK A;  1EV4 A;  2B1K A;  3JCM L;  3W6G A;  3WGD A;  3IV4 A;  3J7Y k;  3D21 A;  3P7X A;  4TR3 A;  4GST A;  5IMF A;  1O7U A;  2X99 A;  2JSY A;  5F07 A;  1MD3 A;  16GS A;  5ECN B;  5JWQ B;  1M9B A;  3TKR A;  2LQO A;  1AQW A;  4IKH A;  2JZT A;  3MAK A;  5AIS A;  3IHQ A;  12GS A;  4RQR A;  2VL2 A;  3EC3 A;  1ABA A;  4HU7 A;  5ECI B;  3DVX A;  3EVI A;  3D4T A;  1G7E A;  1GSF A;  1OC9 B;  1GNW A;  4Q5R A;  2HLS A;  1NSW A;  1XXU A;  1XWC A;  1VF2 A;  3F9U A;  3TKS C;  4DSR A;  3LEF A;  3L9V A;  3J7Y b;  3L9U A;  5IQY A;  2YZH A;  3KP8 A;  1USB A;  1J0F A;  1BQ7 A;  2OE0 A;  1S3A A;  2B7K A;  1B9Y C;  3H4K A;  3CTG A;  2FNO A;  4LMV A;  3I6A A;  1F9M A;  4FYC A;  20GS A;  3BOA A;  2KP1 A;  3RPP A;  2GSS A;  6GSS A;  1OKT A;  1YJ6 A;  3VPQ A;  1U6T A;  2AJQ B;  3ERW A;  1K0N A;  1WIK A;  3ME8 A;  3KTB A;  1FB6 A;  3KD0 A;  3UIW A;  2Z9S A;  3ZLP A;  3VI5 A;  5DAK A;  1NW2 A;  4RQX A;  5ECH B;  4PGT A;  4POM A;  5FWG A;  1DSB A;  3LOR A;  2P5R A;  4F2I A;  4KAE A;  3HZ8 A;  5J5N A;  3UJ1 A;  2DLX A;  2BJX A;  3HVV A;  3GTU B;  1PKW A;  1GUK A;  3IRA A;  1O73 A;  2ZNM A;  2OBI A;  4TR4 A;  3QDN A;  1EWX A;  2OBK A;  3GH6 A;  4F03 A;  5ID2 A;  4XS1 A;  4GSN A;  3GNJ A;  2TRX A;  1ERU A;  1K0M A;  3C1S A;  4WR4 A;  3TKS E;  4K6X A;  4HQZ A;  1IYI A;  2GSQ A;  1KNG A;  6GSW A;  4G2E A;  2FCH A;  2HZE A;  2PUK C;  4ZL8 A;  1R4W A;  1V58 A;  3M3M A;  1MDI A;  1Z7R A;  1ERV A;  2C0G A;  3DIE A;  3VUR A;  1XPV A;  4MPF A;  2IMI A;  5A4W A;  3D4M A;  4MP4 A;  2MMN A;  2HZF A;  3P8W A;  2DSA A;  3BJ5 A;  2H1B A;  3SWL A;  4JR4 A;  4YQM A;  2LJA A;  2C80 A;  2XPD A;  2J23 A;  3S9F A;  1QXH A;  5DBQ A;  3VWU A;  2YWN A;  1Z6M A;  2YJH A;  2ON7 A;  4ZB8 A;  1V9W A;  4WEY A;  5LD0 A;  1W89 A;  5IO2 A;  2XHF A;  3NZN A;  1OC3 A;  3LSZ A;  1G6Y A;  4PQI A;  2RUF A;  1XOA A;  2VCX A;  2H76 A;  2YN1 A;  2IJY A;  2YCD A;  2P31 A;  3TB2 A;  1EGR A;  2WS2 A;  1SKS B;  4MJA A;  1K0A A;  2FLS A;  3ED3 A;  3IBH A;  1TU7 A;  5H5S A;  3WT1 A;  3KCM A;  5A4U A;  2AV4 A;  3F4T A;  1BX9 A;  4JED A;  5CRH A;  2PN8 A;  3M9K A;  1Z3E A;  1FG4 A;  4TRX A;  2MBT A;  1V40 A;  1S3C A;  3GKK A;  2IMF A;  3H79 A;  4NV2 A;  1OKD A;  2PVQ A;  1VF3 A;  3UBK A;  1TDI A;  2E2M A;  4DSS A;  4MH2 A;  1TXX A;  1ACV A;  5AIX A;  3O6T A;  3GSS A;  1N8J A;  2RM6 A;  4DVC A;  3HVS A;  1GTU A;  3DVW A;  4FYU A;  3FZ4 A;  14GS A;  4ZIJ A;  3GH9 A;  2NDO A;  4ACS A;  4RUV A;  4MF7 A;  4KH7 A;  1U3I A;  3CBU A;  2VL3 A;  4AJ8 A;  3L0H A;  4E8E A;  4WBJ A;  1WE0 A;  1DUG A;  1EEJ A;  1WOU A;  1AQV A;  4OMV A;  4NXI A;  5H5R A;  3UEM A;  5IMD A;  5HFI A;  2EIR A;  1EP7 A;  5COH A;  3M9J A;  2H73 A;  2GLR A;  4IJ3 A;  2O8V B;  2LQQ A;  2PGT A;  1YQ1 A;  3EE2 A;  1GSD A;  4JU5 A;  5G2Z A;  2MMO A;  1ZOF A;  4L8E A;  4EF0 A;  3H1N A;  1AIU A;  3NOF A;  1OE7 A;  4I8B A;  2H0G A;  4X0X A;  1URM A;  2JU5 A;  11GS A;  1QK8 A;  5CYY A;  2I81 A;  3DWV A;  4FIW A;  3IDV A;  3UL3 A;  1JLV A;  3D5J A;  2PMT A;  2A4V A;  5B6M A;  4O7H A;  1EOH A;  2L6C A;  2RM5 A;  4ZB6 A;  1FHE A;  3GKN A;  2FA8 A;  2IFQ B;  3L78 A;  2K8V A;  3FKF A;  3CSH A;  1EGO A;  3C1R A;  3RDW A;  2L4C A;  2FWF A;  4ZBA A;  4FO5 A;  2C3Q A;  3KP9 A;  2FD3 A;  1RW1 A;  3ZML A;  4L0U A;  2VCV A;  2CVK A;  3GA4 A;  4AGS A;  6GSX A;  5D93 A;  1TRU A;  1F3A A;  3PR8 A;  3QR6 A;  5B7C A;  1O85 A;  4IP6 A;  4ZBD A;  3ZRD A;  1M2B A;  1WP0 A;  4IS0 A;  3MNG A;  3H93 A;  3Q19 A;  5ECS A;  2X8H A;  1GWC A;  3ZIJ A;  2GTU A;  2OE1 A;  1PN9 A;  4J2F A;  4ZIL A;  1WMJ A;  2CZ3 A;  4TR1 A;  1MDK A;  2M80 A;  5J9B A;  2VM1 A;  4JR6 A;  3RHB A;  2L59 A;  5CP1 A;  3TJJ A;  1SU9 A;  2A2S A;  2CQ9 A;  3FK8 A;  1OC8 A;  2YJ7 A;  1SL0 B;  2GQL A;  4RI7 A;  5GSS A;  4HQS A;  4HZ4 A;  4V2L A;  1GTA A;  2XC2 A;  4MLY A;  4G19 A;  2HSH A;  2R3X A;  4OFN A;  4IBP A;  2H0I A;  2VD0 A;  5ECM B;  3F4R A;  4KA0 A;  3TJF A;  4ECC A;  1WPI A;  1FOV A;  1U88 A;  1O6J A;  1Q4J A;  1PX6 A;  3GIX A;  4POL A;  1F2E A;  5IOX A;  1OC9 A;  5FT3 A;  2NVL A;  1O8X A;  2LUS A;  1CQH A;  3E3E A;  1TI1 A;  1A8Y A;  1DE1 A;  2GS3 A;  2JAD A;  1GP1 A;  4ZB9 A;  2F51 A;  3VK9 A;  2D2Z A;  4IP1 A;  2L6D A;  4GF0 A;  4WF4 A;  1F6M C;  3KTL A;  1XVW A;  2M72 A;  1B9X C;  2YOI A;  5AIV A;  18GS A;  3HVX A;  1XW5 A;  1C72 A;  4K2D A;  2B6M A;  4KGI A;  3E0U A;  1ST9 A;  3GUR A;  2BMX A;  5FHI A;  1SJI A;  3WD6 A;  2C0D A;  1CQG A;  2C8U A;  2GT6 A;  4XTS A;  1GTI A;  4H86 A;  4EC0 A;  1Z6N A;  1LU4 A;  2K8S A;  5IMZ A;  3GTU A;  3ZMK A;  4N10 A;  3KXO A;  1K3L A;  4GSS A;  1PSQ A;  4MH3 A;  5JCG A;  3UAR A;  2DML A;  4D73 B;  4GTU A;  2DIZ A;  2R2J A;  1F37 A;  4XRD A;  2H70 A;  2IME A;  4XIH A;  1QQ2 A;  4NHW A;  2R6K A;  2GGT A;  4OO4 A;  1BED A;  3IE3 A;  3GL5 A;  3ZL5 A;  1GSQ A;  2C3T A;  1ON4 A;  3ZIT A;  1N2A A;  4MF6 A;  3HY2 A;  3F3R A;  3KGK A;  4FYB A;  3LG6 A;  1GNE A;  2VCQ A;  4TKY A;  1TK5 B;  1ZMA A;  1K0O A;  3G7J A;  4IN0 A;  2VL9 A;  2QSI A;  2XBQ A;  1HNC A;  3QPM A;  4JRR A;  2HRF A;  2YWI A;  1NHY A;  1JZO A;  17GS A;  4PQH A;  3C71 A;  1UC7 A;  3G9B A;  1H4O A;  4V2M A;  4GCI A;  2PPT A;  1XZO A;  1QGV A;  2I9H A;  3UAP A;  1VRS D;  3FZ5 A;  2DJK A;  2IIY A;  3A3T A;  3F63 A;  22GS A;  3LYP A;  4K1F A;  2OKA A;  3GST A;  3AY8 A;  5CRG A;  1XWA A;  5B8A A;  1G7O A;  2B5Y A;  5ECQ B;  5D73 A;  3EUR A;  5A5K A;  7GSS A;  5IMA A;  1KTE A;  1NHO A;  2JAC A;  2LNT A;  4GRF A;  5F8B A;  3HJM A;  3ERF A;  4RI6 A;  1O81 A;  4ML6 A;  2LKU A;  2PU9 C;  5ECR B;  4PNF A;  5C00 A;  5G5F A;  2X64 A;  2AYT A;  2LJR A;  4ECJ A;  3KM6 A;  2MBS A;  1TU8 A;  4EE0 A;  1V2A A;  4DSQ A;  4KSM A;  2F3M A;  3ZTL A;  4Q5N A;  2B5E A;  2KLX A;  5DVB A;  2B3S A;  4TW5 A;  5LNK e;  2LS5 A;  2H01 A;  3FRC A;  3KH9 A;  2LST A;  3QFA C;  3OR5 A;  1YDK A;  3LXT A;  1X9W B;  4NAX A;  2LRN A;  3EIN A;  2GST A;  3TJK A;  2AHE A;  4TXO A;  1X9M B;  3FYG A;  1ZYE A;  3UMA A;  2FY6 A;  2LTK A;  1BG5 A;  2KHP A;  1MDJ A;  4CDO A;  1MEK A;  4KUN A;  4XCS A;  1FAA A;  2LJK A;  3IAS 2;  4K0N A;  2J9H A;  4GQC A;  2JZS A;  3GX0 A;  10GS A;  2QC7 A;  1O8W A;  1SK0 A;  3RHC A;  3GRX A;  1QMV A;  4HDE A;  3EU3 A;  5E59 A;  2REM A;  2DJJ A;  4LMW A;  5D9W A;  1I9D A;  2V6K A;  3HKR A;  1PGT A;  6GSY A;  2OAD A;  4YAP A;  3F6F A;  4LL4 B;  2H6Z A;  1JZD A;  1Z7P A;  3SBC A;  5EVO A;  2PBJ A;  2WDU A;  4J57 E;  1HNB A;  2ALB A;  3G7Y A;  4MK3 A;  1SYR A;  2M46 A;  3QAV A;  2VL2 C;  2H71 A;  4N11 A;  5DDL A;  5DQS A;  2NPB A;  4POB A;  1QFN A;  3F8U A;  4WR5 A;  4I6X A;  4MF5 A;  4HU9 A;  2MMA A;  2IFQ A;  1TRW A;  5HR3 A;  4MAB A;  4NMU A;  4PX1 A;  1YKA A;  4YQV A;  1TTZ A;  4ISD A;  5D96 A;  2GZP A;  1VF1 A;  2AUV A;  5B8B A;  1BJX A;  1UVZ A;  5JCU A;  3F0I A;  5ECP B;  2VAF A;  2VOC A;  3O76 A;  4HJ2 A;  2X8C A;  2N5B A;  1K3Y A;  2WGR A;  4XHM A;  1HD2 A;  2NBS A;  5DAK B;  1EZK A;  1VGL A;  1HQO A;  2VD1 A;  3FR9 A;  1JZR A;  1MTC A;  2YNX A;  4I97 A;  2EIQ A;  1AC1 A;  1SJ6 A;  2H72 A;  5CRD A;  3C8E A;  2QKE A;  3GYK A;  2YV9 A;  2DJ1 A;  2JSZ A;  4NPB A;  3QMX A;  1A8L A;  4N0V A;  5ID2 B;  2PWJ A;  1ERW A;  3F3Q A;  2GSR A;  3D0Z A;  3CMI A;  1X5C A;  4EVM A;  2EC4 A;  4F82 A;  2DJ2 A;  3QAW A;  2VUP A;  1M99 A;  5ENU A;  1EV9 A;  4JZQ A;  3GN3 A;  5CNW A;  1WRY A;  2VCT A;  1OAZ A;  2CVD A;  3BCK A;  3M8N A;  5KN2 A;  1SKW B;  5ELG A;  2R5G A;  9GSS A;  2VIM A;  5IOW A;  4K7I A;  3M0F A;  2KOK A;  2H66 A;  4TVE A;  2FA4 A;  3TOT A;  1TRV A;  3TJG A;  1GTB A;  2R4V A;  2OAC A;  1YEX A;  2FWG A;  19GS A;  2LRT A;  2IPA A;  4ZXG A;  3IOS A;  1THO A;  1X5E A;  1PX7 A;  2KP2 A;  3H8Q A;  5IPH A;  1EEM A;  4EKZ A;  2O87 A;  4N0Z A;  5DCH A;  5E4W A;  2TRC P;  2C0E A;  1XBS A;  2GDR A;  4WKW A;  5G5E A;  3KEB A;  5DAL A;  4V2N A;  2HNL A;  2GVP A;  4D73 A;  1T3B A;  3EMX A;  2DMM A;  5IMC A;  1EOG A;  4EO3 A;  4PNG A;  4PUR A;  3GL3 A;  2H8L A;  4GXZ A;  5AN1 A;  4O32 A;  3FHK A;  1GL8 A;  2YZU A;  1TW9 A;  5INY A;  1A2J A;  2VO4 A;  3DRN A;  5J41 A;  4Z7X A;  1Z9H A;  1GRX A;  3US3 A;  4GQF A;  2HT9 A;  2V6O A;  1FO5 A;  3FZA A;  3I69 A; 
#chains in the Genus database with same CATH topology
 2K6V A;  3I43 A;  3TRQ A;  3D22 A;  2IN3 A;  1TK0 B;  1T00 A;  3DXB A;  3HD5 A;  3HA9 A;  4LLR A;  1PQN A;  2MZC A;  4DSS B;  5KN0 A;  3VI7 A;  3QCP A;  5EY6 A;  1PMT A;  2IWT A;  4Z2T A;  3PH9 A;  4F0B A;  4HZ2 A;  1TJD A;  5D9T A;  1T1V A;  3IPZ A;  4JE1 A;  2DIY A;  4JBB A;  2VLV A;  4A5P A;  1PRX A;  2G2Q A;  2P0G A;  5L71 A;  4V1A g;  1KEB A;  3VWX A;  1GSY A;  4WF5 A;  2XBI A;  2VLT A;  1A2L A;  1X0R A;  4K8M A;  2WJU A;  2DJ0 A;  3RBT A;  2PER A;  1TRS A;  2H1G A;  4USS A;  2CV4 A;  2CZ2 A;  3N5O A;  2A2P A;  3DKS A;  5DJL A;  1I5G A;  3GUS A;  4MJC A;  2IMD A;  2FWE A;  3APQ A;  4KCA A;  2E0Q A;  3C7M A;  1G6W A;  4MCU A;  4XRA A;  3A5W A;  4TOP A;  2V1M A;  2WB9 A;  4LL1 B;  2P5Q A;  3A2W A;  3HXS A;  5HQP A;  2OA7 A;  3G7I A;  3NIV A;  1Z5Y E;  2A2R A;  3PGT A;  2V2G A;  3CRU A;  1YF1 A;  2HI7 A;  3ZVJ D;  1JHB A;  2WUL A;  1BAY A;  4EIP A;  4QQ7 A;  2GQM A;  3UBL A;  3LJR A;  1A24 A;  5JCW A;  3TDG A;  3ZRE A;  1XWB A;  2OE3 A;  4TN8 A;  3ZVJ A;  2WFC A;  1R5P A;  1F3B A;  1Y6E A;  2GZZ A;  1K0D A;  1XW6 A;  3VLN A;  3KJY A;  3EYT A;  1WWJ A;  4Q5F A;  1PL2 A;  1XIY A;  2CAI A;  3BD2 A;  1MD4 A;  1XWG A;  5G1K A;  1K0B A;  4MA9 A;  1DE2 A;  1FVK A;  1V57 A;  4IGJ A;  3R3E A;  5G30 A;  4K5S A;  2FHE A;  1JLW A;  4N30 A;  2IL3 A;  4HEA 2;  4K9Z A;  2YV7 A;  2RII A;  3WGE A;  2NTO A;  5D9V A;  4CW9 A;  2AB6 A;  1T7P B;  1IYH A;  1SL1 B;  1A0R P;  3KIJ A;  1T8E B;  2F9S A;  1XW9 A;  3L9S A;  3LGC A;  4EUY A;  1T4Y A;  5G31 A;  3EMP A;  1GUL A;  4L5O A;  4NHZ A;  5IMV A;  2H6X A;  5EL8 A;  3IXR A;  1WJK A;  4X43 A;  1PKZ A;  3APO A;  4NWY A;  4XS4 B;  5A4V A;  2K18 A;  1HNA A;  4YQU A;  2GQK A;  2LEG A;  5KN3 A;  3Q18 A;  2QGV A;  2GT5 A;  5HFK A;  4MDC A;  4L0W A;  3VWW A;  1SD9 A;  4WET A;  3TGZ A;  2HYX A;  3GV1 A;  4PUF C;  4PXO A;  4EXJ A;  5G1L A;  4Q5Q A;  2YPM A;  3LXZ A;  1T4Z A;  3EWL A;  1BYE A;  3WT2 A;  4HS1 A;  3LYK A;  4MJE A;  1M0U A;  1ML6 A;  5D9X A;  1YY7 A;  1JZW A;  2RLI A;  1AQX A;  3M1G A;  5ECK B;  4BVY A;  1YZX A;  5GZZ B;  4BWS A;  2HSY A;  5HR2 A;  3CRT A;  1PN0 A;  5KEJ A;  1YKC A;  3FZ9 A;  4BL7 A;  2H30 A;  2MYG A;  1Q98 A;  5EPF A;  3FEU A;  4KE3 A;  2DKI A;  4ECB A;  3IA1 A;  5IIZ A;  5GST A;  2HE3 A;  6GSV A;  5CRW A;  5J3R A;  4KDY A;  4OFM A;  3RPN A;  2EIO A;  3R2Q A;  1TI3 A;  2HXK A;  2CX3 A;  1SJZ A;  2HRA A;  3QFB C;  4ZBB A;  1FB0 A;  1ZZY A;  1SYX A;  4MZB A;  1XWK A;  4KCE A;  4TXV A;  4ULX A;  4ILF A;  3MWH A;  2H74 A;  2B1L A;  4IW9 A;  4OO5 A;  3C73 A;  3F6D A;  2O85 A;  2LNS A;  1ZYQ B;  4IJI A;  4PUA A;  1TOF A;  4AJ7 A;  5ECL B;  2F8A A;  5ECO B;  5GAP D;  5ABR A;  3ZFL A;  2C1Y A;  3L4N A;  4HI7 A;  4CHS A;  5ELA A;  2F8F A;  1GSE A;  5CAX A;  3DML A;  2R37 A;  2YAN A;  13GS A;  1XFL A;  2V32 A;  2CVB A;  4ML1 A;  3GHA A;  1NM3 A;  2H1A A;  2IMK A;  4OD7 A;  2QA2 A;  3LFL A;  2VM2 A;  4KB3 A;  2MMZ A;  4GLT A;  4MZC A;  5C04 A;  3HJO A;  5KN1 A;  5F05 A;  2OJL A;  3IK7 A;  1AXD A;  2BTO T;  2VCW A;  2CT6 A;  2C4J A;  1A2M A;  1SL2 B;  1HYU A;  4XS6 A;  3ZYW A;  2C0F A;  3VWV A;  4EL1 A;  4ID0 A;  4QL9 A;  2L4Q A;  1GSS A;  3U5R E;  1W4V A;  2WCI A;  4BA7 A;  3DD3 A;  2E7P A;  3DGQ A;  5IM9 A;  1GH2 A;  2X8G A;  2FUG 2;  4ICY A;  3ME7 A;  4OWY A;  3LQ7 A;  2XPE A;  4DEJ A;  5IPG A;  2K9F A;  1J9B A;  4TR0 A;  3HYP A;  2KUC A;  2JZR A;  4OCF A;  3KH7 A;  4IHU A;  3F4S A;  5HFG A;  4K7O A;  3FR3 A;  3HDC A;  1Y25 A;  3DEX A;  2HFD A;  1UN2 A;  4KND A;  3DYR A;  4MPG A;  5JWR B;  1M9A A;  2L5L A;  3FMW A;  3TRX A;  2B5X A;  4YH2 A;  1SD8 A;  1PL1 A;  1X5D A;  1J08 A;  4EIQ A;  5IO0 A;  1XG8 A;  2G0F A;  3IC4 A;  3CSI A;  3UOM A;  5D8I A;  4KW6 A;  1ERT A;  5B6N A;  1E6B A;  3FR6 A;  3TKQ A;  4TXO B;  2WZ9 A;  4IVF A;  1XOB A;  2UZ8 A;  2VCZ A;  4O5R A;  1XVQ A;  3QOU A;  3LWA A;  1K3O A;  3EU4 A;  1GUM A;  2LRC A;  5J4U A;  2HZE B;  1ZYN A;  1V98 A;  3K8N A;  4WXT A;  1TK8 B;  4X4J A;  5H5Q A;  5LCZ A;  3KMO A;  3HCZ A;  2I4A A;  3CTF A;  1RQM A;  1AUC A;  4GWR A;  3GKX A;  2YP6 A;  2ZCT A;  4G0I A;  1THX A;  2CA8 A;  4LA1 A;  4ZL7 A;  1SK2 A;  1ZGN A;  2VLU A;  3I9V 2;  1OE8 A;  1B8X A;  2TIR A;  4P3Y B;  2DBC A;  1SK1 A;  1E2Y A;  3KZQ A;  2YWM A;  3TUE A;  3V1W A;  2N5A A;  1QUW A;  2ON5 A;  3QD9 A;  1B4Q A;  3FY7 A;  4ZL9 A;  3GMF A;  4E8H A;  4IQA A;  1EP8 A;  2O7K A;  3BBY A;  2C3N A;  4L5L A;  4BVX A;  3VPT A;  4HOJ A;  3CSJ A;  4EDZ A;  1GLP A;  1TKD B;  1VF4 A;  3MSZ A;  1ZL9 A;  2N5F A;  4F0C A;  1SKR B;  2AAW A;  2H0H A;  3CXG A;  3HHV A;  1K0C A;  5HR0 A;  1UA5 A;  4O92 A;  1R7H A;  6GST A;  4OFT A;  3U6V A;  3HJP A;  3TCO A;  4ECI A;  5HR1 A;  6GSU A;  2CAQ A;  2PVO C;  2H75 A;  2H6Y A;  3W8J A;  4EDY A;  1AW9 A;  1ZCP A;  2CX4 A;  5F06 A;  3P2A A;  1X9S B;  3Q74 A;  2O89 A;  1M7T A;  5CO3 A;  1M2A A;  2ZUP A;  3D6I A;  5J9C A;  4IEL A;  5JWO B;  4BWQ A;  2YWO A;  1FVJ A;  1FW1 A;  2JL4 A;  4WBR D;  4F9Z A;  4I5Q A;  1LJR A;  3UVH A;  4I2T A;  1DBY A;  1RK4 A;  1H75 A;  1TP9 A;  4KDX A;  1B48 A;  1OYJ A;  1B4P A;  5GAN D;  1XCC A;  4G10 A;  3QAG A;  3PIN A;  4PQ1 A;  1S3D A;  2I3Y A;  4MMM A;  3GFK A;  4NV5 A;  4XS4 A;  3CYN A;  4KSO A;  4V1A p;  3TKS A;  3APS A;  1PA3 A;  2H1D A;  8GSS A;  4KDU A;  2GZY A;  4IQ1 A;  1U87 A;  3WYW A;  4HJM A;  3TOU A;  3IAM 2;  4AJ6 A;  1M2D A;  3UVT A;  3WGX A;  3TRP A;  1GSU A;  5CRE A;  3IK9 A;  3W8S A;  3LW9 A;  3KMN A;  3ZZX A;  2FGX A;  3TJB A;  2ES7 A;  4OCE A;  2H19 A;  5DCG A;  1A23 A;  3GKM A;  1AAZ A;  1JFU A;  4BPY A;  1U3A A;  5DQY A;  1G0T A;  3EPT A;  1LBK A;  3ISO A;  3FW2 A;  4K0G A;  1PD2 1;  1R5A A;  3ERG A;  4YAV A;  3IR4 A;  1M3J A;  2R0C A;  1KBN A;  2L5O A;  4POK A;  1R26 A;  1SEN A;  3O3T A;  3P90 A;  2DC5 A;  1OVN A;  4MJB A;  5DJM A;  2HRN A;  3ZIV A;  2LV3 A;  3RAZ A;  2WRT A;  2I1U A;  4HUA A;  4QL7 A;  4X1U A;  1YF0 A;  2V41 A;  3E9J B;  4J56 E;  3HZ4 A;  3VFI A;  3Q6O A;  1A0F A;  2HSM A;  2L57 A;  4FH8 A;  3BCI A;  4Z2U A;  1GLQ A;  4G9H A;  5DAL B;  4AF2 A;  3GX8 A;  4I2U A;  2E2G A;  1GUH A;  3TKP A;  1ILO A;  1YEP A;  2DJ3 A;  3A2X A;  2RUE A;  5F0G A;  2FWH A;  4K7N A;  3A2V A;  2B7J A;  3ZFB A;  4MZW A;  4KX4 A;  5AGY A;  4TR1 B;  3N9J A;  3MDK A;  1EV4 A;  2B1K A;  3JCM L;  3W6G A;  3WGD A;  3IV4 A;  3J7Y k;  3D21 A;  3P7X A;  4TR3 A;  4GST A;  5IMF A;  1O7U A;  2X99 A;  2JSY A;  5F07 A;  1MD3 A;  16GS A;  5ECN B;  5JWQ B;  1M9B A;  3TKR A;  2LQO A;  1AQW A;  4IKH A;  2JZT A;  3MAK A;  5AIS A;  3IHQ A;  12GS A;  4RQR A;  2VL2 A;  3EC3 A;  1ABA A;  4HU7 A;  5ECI B;  3DVX A;  3EVI A;  3D4T A;  1G7E A;  1GSF A;  4FQU A;  1OC9 B;  1GNW A;  4Q5R A;  2HLS A;  1NSW A;  1XXU A;  1XWC A;  1VF2 A;  3F9U A;  3TKS C;  4DSR A;  3LEF A;  3L9V A;  3J7Y b;  3L9U A;  5IQY A;  2YZH A;  3KP8 A;  1USB A;  1J0F A;  1BQ7 A;  2OE0 A;  1S3A A;  2B7K A;  1B9Y C;  3H4K A;  3CTG A;  2FNO A;  4LMV A;  3I6A A;  1F9M A;  4FYC A;  20GS A;  3BOA A;  2KP1 A;  3RPP A;  2GSS A;  6GSS A;  1OKT A;  1YJ6 A;  3VPQ A;  1U6T A;  2AJQ B;  3ERW A;  1K0N A;  1WIK A;  3IHG A;  3ME8 A;  3KTB A;  1FB6 A;  3KD0 A;  3UIW A;  2Z9S A;  3ZLP A;  3VI5 A;  5DAK A;  1NW2 A;  4RQX A;  5ECH B;  4PGT A;  4POM A;  5FWG A;  4YKG A;  1DSB A;  3LOR A;  2P5R A;  4F2I A;  4KAE A;  3HZ8 A;  5J5N A;  3UJ1 A;  2DLX A;  3CQF A;  2BJX A;  3HVV A;  3GTU B;  1PKW A;  1GUK A;  3IRA A;  1O73 A;  2ZNM A;  2OBI A;  4TR4 A;  3QDN A;  1EWX A;  2OBK A;  3GH6 A;  4F03 A;  5ID2 A;  4XS1 A;  4GSN A;  3GNJ A;  2TRX A;  1ERU A;  1K0M A;  3C1S A;  4WR4 A;  3TKS E;  4K6X A;  4HQZ A;  1IYI A;  2GSQ A;  1KNG A;  6GSW A;  4G2E A;  2FCH A;  3IC8 A;  2HZE A;  2PUK C;  4ZL8 A;  1R4W A;  1V58 A;  3M3M A;  1MDI A;  1Z7R A;  1ERV A;  2C0G A;  3DIE A;  3VUR A;  1XPV A;  4MPF A;  2IMI A;  5A4W A;  3D4M A;  4MP4 A;  2MMN A;  2HZF A;  3P8W A;  2DSA A;  3BJ5 A;  2H1B A;  3SWL A;  4JR4 A;  4YQM A;  2LJA A;  2C80 A;  2XPD A;  2J23 A;  3S9F A;  1QXH A;  5DBQ A;  1S3R A;  3VWU A;  2YWN A;  1Z6M A;  2YJH A;  2ON7 A;  4ZB8 A;  1V9W A;  4WEY A;  5LD0 A;  1W89 A;  3MYD A;  5IO2 A;  2XHF A;  3A5I A;  3NZN A;  1OC3 A;  3LSZ A;  1G6Y A;  4PQI A;  2RUF A;  1XOA A;  2VCX A;  4O5Q A;  2H76 A;  2YN1 A;  2IJY A;  2QA1 A;  2YCD A;  2P31 A;  3TB2 A;  1EGR A;  2WS2 A;  1SKS B;  4MJA A;  1K0A A;  2FLS A;  3ED3 A;  3IBH A;  1TU7 A;  5H5S A;  3WT1 A;  4BVY B;  3KCM A;  5A4U A;  2AV4 A;  3F4T A;  1BX9 A;  4JED A;  5CRH A;  4Z2R A;  2PN8 A;  3M9K A;  1Z3E A;  1FG4 A;  4TRX A;  2MBT A;  1V40 A;  1S3C A;  3GKK A;  2IMF A;  3H79 A;  4NV2 A;  1OKD A;  2PVQ A;  1VF3 A;  3UBK A;  1TDI A;  2E2M A;  4DSS A;  4MH2 A;  1TXX A;  1ACV A;  5AIX A;  3O6T A;  3GSS A;  1N8J A;  2RM6 A;  4DVC A;  3HVS A;  1GTU A;  3DVW A;  4FYU A;  3FZ4 A;  14GS A;  4ZIJ A;  3GH9 A;  2NDO A;  4ACS A;  4RUV A;  4MF7 A;  4KH7 A;  1U3I A;  3CBU A;  2VL3 A;  4AJ8 A;  3L0H A;  4E8E A;  4WBJ A;  1WE0 A;  1DUG A;  1EEJ A;  1WOU A;  1AQV A;  4OMV A;  4NXI A;  5H5R A;  3UEM A;  5IMD A;  5HFI A;  2EIR A;  1EP7 A;  5COH A;  3M9J A;  2H73 A;  2GLR A;  4IJ3 A;  2O8V B;  4CY8 A;  2LQQ A;  2PGT A;  1YQ1 A;  3EE2 A;  1GSD A;  4JU5 A;  5G2Z A;  2MMO A;  4YKF A;  1ZOF A;  4L8E A;  4EF0 A;  3H1N A;  1AIU A;  3NOF A;  1OE7 A;  4I8B A;  2H0G A;  4X0X A;  1URM A;  2JU5 A;  11GS A;  1QK8 A;  5CYY A;  2HRK A;  2I81 A;  3DWV A;  4FIW A;  3IDV A;  3UL3 A;  1JLV A;  3D5J A;  2PMT A;  2A4V A;  5B6M A;  4O7H A;  1EOH A;  2L6C A;  2X4A A;  2RM5 A;  4ZB6 A;  1FHE A;  3GKN A;  2FA8 A;  2IFQ B;  3L78 A;  2K8V A;  3FKF A;  3CSH A;  1EGO A;  3C1R A;  3RDW A;  2L4C A;  2FWF A;  4ZBA A;  4FO5 A;  2C3Q A;  3KP9 A;  2FD3 A;  1RW1 A;  3ZML A;  4L0U A;  2VCV A;  2CVK A;  3GA4 A;  4AGS A;  6GSX A;  5D93 A;  1TRU A;  1F3A A;  3PR8 A;  3QR6 A;  5B7C A;  1O85 A;  4IP6 A;  4ZBD A;  3ZRD A;  1M2B A;  1WP0 A;  4IS0 A;  3MNG A;  3H93 A;  3Q19 A;  2X8H A;  4K2X A;  1GWC A;  5ECS A;  3ZIJ A;  2GTU A;  2OE1 A;  1PN9 A;  4J2F A;  4ZIL A;  1WMJ A;  2CZ3 A;  4TR1 A;  1MDK A;  2M80 A;  5J9B A;  2VM1 A;  4JR6 A;  4KF9 A;  3RHB A;  2L59 A;  5CP1 A;  3TJJ A;  1SU9 A;  2A2S A;  2CQ9 A;  3FK8 A;  1OC8 A;  2YJ7 A;  1SL0 B;  2GQL A;  4RI7 A;  5GSS A;  4HQS A;  4HZ4 A;  4V2L A;  1GTA A;  2XC2 A;  4MLY A;  4G19 A;  1M3I A;  2X49 A;  2HSH A;  2R3X A;  4OFN A;  4IBP A;  2H0I A;  2VD0 A;  5ECM B;  3F4R A;  4KA0 A;  3TJF A;  4ECC A;  1WPI A;  1FOV A;  1U88 A;  1O6J A;  1Q4J A;  1PX6 A;  3GIX A;  4POL A;  1F2E A;  5IOX A;  1OC9 A;  5FT3 A;  2NVL A;  1O8X A;  2LUS A;  1CQH A;  1PFO A;  4BIK A;  3E3E A;  1TI1 A;  1A8Y A;  1DE1 A;  2GS3 A;  2JAD A;  1GP1 A;  4ZB9 A;  2F51 A;  3VK9 A;  2D2Z A;  4IP1 A;  2L6D A;  5KOW A;  4GF0 A;  4WF4 A;  1F6M C;  3KTL A;  1XVW A;  2M72 A;  1B9X C;  2YOI A;  5AIV A;  18GS A;  3HVX A;  1XW5 A;  1C72 A;  4K2D A;  2B6M A;  4KGI A;  3E0U A;  1ST9 A;  3MIX A;  3GUR A;  2BMX A;  5FHI A;  1SJI A;  3WD6 A;  2C0D A;  1CQG A;  2C8U A;  2GT6 A;  4BVX B;  4XTS A;  1GTI A;  4H86 A;  4EC0 A;  1Z6N A;  1LU4 A;  2K8S A;  5IMZ A;  3GTU A;  3ZMK A;  4N10 A;  1FOH A;  3KXO A;  1K3L A;  4GSS A;  1PSQ A;  4MH3 A;  5JCG A;  3UAR A;  2DML A;  4D73 B;  4GTU A;  2DIZ A;  2R2J A;  1F37 A;  4XRD A;  2H70 A;  2IME A;  4XIH A;  1QQ2 A;  4NHW A;  2R6K A;  2GGT A;  4OO4 A;  1BED A;  3IE3 A;  3GL5 A;  3ZL5 A;  1GSQ A;  2C3T A;  1ON4 A;  3ZIT A;  1N2A A;  4MF6 A;  3HY2 A;  3F3R A;  3KGK A;  4FYB A;  3LG6 A;  1GNE A;  2VCQ A;  4TKY A;  1TK5 B;  1ZMA A;  1K0O A;  3G7J A;  4IN0 A;  2VL9 A;  2QSI A;  4PTS A;  2XBQ A;  1HNC A;  3QPM A;  4JRR A;  2HRF A;  2YWI A;  1NHY A;  1JZO A;  17GS A;  4PQH A;  3C71 A;  1UC7 A;  3G9B A;  1H4O A;  4V2M A;  4GCI A;  2PPT A;  1XZO A;  1QGV A;  2R0P A;  2I9H A;  3UAP A;  1VRS D;  3FZ5 A;  2DJK A;  2IIY A;  5BRT A;  3A3T A;  3F63 A;  22GS A;  3LYP A;  4K1F A;  2OKA A;  3GST A;  3AY8 A;  5CRG A;  1XWA A;  5B8A A;  1G7O A;  2B5Y A;  5ECQ B;  5D73 A;  3EUR A;  5A5K A;  7GSS A;  5IMA A;  1KTE A;  1NHO A;  2JAC A;  2LNT A;  4GRF A;  5F8B A;  3HJM A;  3ERF A;  4RI6 A;  1O81 A;  4ML6 A;  2LKU A;  2PU9 C;  5ECR B;  4PNF A;  5C00 A;  5G5F A;  2X64 A;  2AYT A;  2LJR A;  4ECJ A;  3KM6 A;  4HSC X;  2MBS A;  2R0G A;  1TU8 A;  4EE0 A;  1V2A A;  4DSQ A;  4KSM A;  2F3M A;  3ZTL A;  4Q5N A;  2B5E A;  2KLX A;  5DVB A;  2B3S A;  4TW5 A;  5KOX A;  5LNK e;  2LS5 A;  2H01 A;  3FRC A;  3KH9 A;  2LST A;  3QFA C;  3OR5 A;  1YDK A;  3LXT A;  1X9W B;  4NAX A;  2LRN A;  3EIN A;  2GST A;  3TJK A;  2AHE A;  4TXO A;  1X9M B;  3FYG A;  1ZYE A;  3UMA A;  2FY6 A;  2LTK A;  1BG5 A;  2KHP A;  1MDJ A;  4CDO A;  1MEK A;  4KUN A;  4XCS A;  1FAA A;  2LJK A;  3IAS 2;  4K0N A;  2J9H A;  4GQC A;  2JZS A;  3GX0 A;  10GS A;  2QC7 A;  1O8W A;  1SK0 A;  3RHC A;  3GRX A;  1QMV A;  4HDE A;  4K5R A;  3EU3 A;  5E59 A;  2REM A;  2DJJ A;  4LMW A;  5D9W A;  1I9D A;  2V6K A;  3HKR A;  1PGT A;  4MNN A;  6GSY A;  2OAD A;  4YAP A;  3F6F A;  4LL4 B;  2H6Z A;  1JZD A;  1Z7P A;  3SBC A;  5EVO A;  2PBJ A;  2WDU A;  4J57 E;  1HNB A;  2ALB A;  3G7Y A;  4MK3 A;  1SYR A;  2M46 A;  3QAV A;  2VL2 C;  2H71 A;  4G0L A;  4N11 A;  5DDL A;  4G0K A;  5DQS A;  2NPB A;  4POB A;  2DKH A;  1QFN A;  3F8U A;  4WR5 A;  4I6X A;  4MF5 A;  4HU9 A;  2MMA A;  2IFQ A;  1TRW A;  5HR3 A;  4MAB A;  4NMU A;  4PX1 A;  1YKA A;  4YQV A;  1TTZ A;  4ISD A;  5D96 A;  2GZP A;  1VF1 A;  2AUV A;  5B8B A;  1BJX A;  1UVZ A;  5JCU A;  3F0I A;  3PPU A;  5ECP B;  2VAF A;  2VOC A;  3O76 A;  4HJ2 A;  2X8C A;  4BL7 B;  2N5B A;  1K3Y A;  2WGR A;  4XHM A;  1HD2 A;  1ZYP A;  2NBS A;  5DAK B;  1EZK A;  1VGL A;  1HQO A;  2VD1 A;  3FR9 A;  1JZR A;  1MTC A;  2YNX A;  4I97 A;  2EIQ A;  1AC1 A;  1SJ6 A;  2H72 A;  5CRD A;  3C8E A;  2QKE A;  4CY6 A;  3GYK A;  2YV9 A;  2DJ1 A;  2JSZ A;  4NPB A;  3QMX A;  1A8L A;  4N0V A;  5ID2 B;  2PWJ A;  1ERW A;  3F3Q A;  2GSR A;  3D0Z A;  3CMI A;  1X5C A;  4EVM A;  2EC4 A;  2A4H A;  4O5U A;  4F82 A;  2DJ2 A;  3QAW A;  2VUP A;  1M99 A;  5ENU A;  1EV9 A;  4JZQ A;  3GN3 A;  5CNW A;  1WRY A;  2VCT A;  1OAZ A;  2CVD A;  3BCK A;  3M8N A;  5KN2 A;  1SKW B;  5ELG A;  2R5G A;  9GSS A;  2VIM A;  5IOW A;  4K7I A;  3M0F A;  2KOK A;  2H66 A;  4TVE A;  2FA4 A;  3TOT A;  1TRV A;  3TJG A;  1GTB A;  2R4V A;  2OAC A;  1YEX A;  2FWG A;  19GS A;  2LRT A;  2IPA A;  4ZXG A;  3IOS A;  3HVN A;  1THO A;  1X5E A;  1PX7 A;  2KP2 A;  3H8Q A;  5IPH A;  1EEM A;  4EKZ A;  2O87 A;  4N0Z A;  5DCH A;  5E4W A;  2TRC P;  2C0E A;  1XBS A;  2GDR A;  4WKW A;  5G5E A;  3KEB A;  5DAL A;  4V2N A;  2HNL A;  2GVP A;  4D73 A;  1T3B A;  3EMX A;  5BMU A;  2DMM A;  5IMC A;  1EOG A;  4EO3 A;  4PNG A;  4PUR A;  3GL3 A;  2H8L A;  4GXZ A;  5AN1 A;  4O32 A;  3FHK A;  1GL8 A;  2YZU A;  1TW9 A;  5INY A;  1A2J A;  2VO4 A;  3DRN A;  5J41 A;  4Z7X A;  1Z9H A;  1GRX A;  3US3 A;  4GQF A;  2HT9 A;  2V6O A;  1FO5 A;  3FZA A;  3I69 A; 
#chains in the Genus database with same CATH homology
 2K6V A;  3I43 A;  3TRQ A;  3D22 A;  2IN3 A;  1TK0 B;  1T00 A;  3DXB A;  3HD5 A;  3HA9 A;  4LLR A;  1PQN A;  2MZC A;  4DSS B;  5KN0 A;  3VI7 A;  3QCP A;  5EY6 A;  1PMT A;  2IWT A;  4Z2T A;  3PH9 A;  4F0B A;  4HZ2 A;  1TJD A;  5D9T A;  1T1V A;  3IPZ A;  4JE1 A;  2DIY A;  4JBB A;  2VLV A;  4A5P A;  1PRX A;  2G2Q A;  2P0G A;  5L71 A;  4V1A g;  1KEB A;  3VWX A;  1GSY A;  4WF5 A;  2XBI A;  2VLT A;  1A2L A;  1X0R A;  4K8M A;  2WJU A;  2DJ0 A;  3RBT A;  2PER A;  1TRS A;  2H1G A;  4USS A;  2CV4 A;  2CZ2 A;  3N5O A;  2A2P A;  3DKS A;  5DJL A;  1I5G A;  3GUS A;  4MJC A;  2IMD A;  2FWE A;  3APQ A;  4KCA A;  2E0Q A;  3C7M A;  1G6W A;  4MCU A;  4XRA A;  3A5W A;  4TOP A;  2V1M A;  2WB9 A;  4LL1 B;  2P5Q A;  3A2W A;  3HXS A;  5HQP A;  2OA7 A;  3G7I A;  3NIV A;  1Z5Y E;  2A2R A;  3PGT A;  2V2G A;  3CRU A;  1YF1 A;  2HI7 A;  3ZVJ D;  1JHB A;  2WUL A;  1BAY A;  4EIP A;  4QQ7 A;  2GQM A;  3UBL A;  3LJR A;  1A24 A;  5JCW A;  3TDG A;  3ZRE A;  1XWB A;  2OE3 A;  4TN8 A;  3ZVJ A;  2WFC A;  1R5P A;  1F3B A;  1Y6E A;  2GZZ A;  1K0D A;  1XW6 A;  3VLN A;  3KJY A;  3EYT A;  1WWJ A;  4Q5F A;  1PL2 A;  1XIY A;  2CAI A;  3BD2 A;  1MD4 A;  1XWG A;  5G1K A;  1K0B A;  4MA9 A;  1DE2 A;  1FVK A;  1V57 A;  4IGJ A;  3R3E A;  5G30 A;  4K5S A;  2FHE A;  1JLW A;  4N30 A;  2IL3 A;  4HEA 2;  4K9Z A;  2YV7 A;  2RII A;  3WGE A;  2NTO A;  5D9V A;  4CW9 A;  2AB6 A;  1T7P B;  1IYH A;  1SL1 B;  1A0R P;  3KIJ A;  1T8E B;  2F9S A;  1XW9 A;  3L9S A;  3LGC A;  4EUY A;  1T4Y A;  5G31 A;  3EMP A;  1GUL A;  4L5O A;  4NHZ A;  5IMV A;  2H6X A;  5EL8 A;  3IXR A;  1WJK A;  4X43 A;  1PKZ A;  3APO A;  4NWY A;  4XS4 B;  5A4V A;  2K18 A;  1HNA A;  4YQU A;  2GQK A;  2LEG A;  5KN3 A;  3Q18 A;  2QGV A;  2GT5 A;  5HFK A;  4MDC A;  4L0W A;  3VWW A;  1SD9 A;  4WET A;  3TGZ A;  2HYX A;  3GV1 A;  4PUF C;  4PXO A;  4EXJ A;  5G1L A;  4Q5Q A;  2YPM A;  3LXZ A;  1T4Z A;  3EWL A;  1BYE A;  3WT2 A;  4HS1 A;  3LYK A;  4MJE A;  1M0U A;  1ML6 A;  5D9X A;  1YY7 A;  1JZW A;  2RLI A;  1AQX A;  3M1G A;  5ECK B;  4BVY A;  1YZX A;  5GZZ B;  4BWS A;  2HSY A;  5HR2 A;  3CRT A;  1PN0 A;  5KEJ A;  1YKC A;  3FZ9 A;  4BL7 A;  2H30 A;  2MYG A;  1Q98 A;  5EPF A;  3FEU A;  4KE3 A;  2DKI A;  4ECB A;  3IA1 A;  5IIZ A;  5GST A;  2HE3 A;  6GSV A;  5CRW A;  5J3R A;  4KDY A;  4OFM A;  3RPN A;  2EIO A;  3R2Q A;  1TI3 A;  2HXK A;  2CX3 A;  1SJZ A;  2HRA A;  3QFB C;  4ZBB A;  1FB0 A;  1ZZY A;  1SYX A;  4MZB A;  1XWK A;  4KCE A;  4TXV A;  4ULX A;  4ILF A;  3MWH A;  2H74 A;  2B1L A;  4IW9 A;  4OO5 A;  3C73 A;  3F6D A;  2O85 A;  2LNS A;  1ZYQ B;  4IJI A;  4PUA A;  1TOF A;  4AJ7 A;  5ECL B;  2F8A A;  5ECO B;  5GAP D;  5ABR A;  3ZFL A;  2C1Y A;  3L4N A;  4HI7 A;  4CHS A;  5ELA A;  2F8F A;  1GSE A;  5CAX A;  3DML A;  2R37 A;  2YAN A;  13GS A;  1XFL A;  2V32 A;  2CVB A;  4ML1 A;  3GHA A;  1NM3 A;  2H1A A;  2IMK A;  4OD7 A;  2QA2 A;  3LFL A;  2VM2 A;  4KB3 A;  2MMZ A;  4GLT A;  4MZC A;  5C04 A;  3HJO A;  5KN1 A;  5F05 A;  2OJL A;  3IK7 A;  1AXD A;  2BTO T;  2VCW A;  2CT6 A;  2C4J A;  1A2M A;  1SL2 B;  1HYU A;  4XS6 A;  3ZYW A;  2C0F A;  3VWV A;  4EL1 A;  4ID0 A;  4QL9 A;  2L4Q A;  1GSS A;  3U5R E;  1W4V A;  2WCI A;  4BA7 A;  3DD3 A;  2E7P A;  3DGQ A;  5IM9 A;  1GH2 A;  2X8G A;  2FUG 2;  4ICY A;  3ME7 A;  4OWY A;  3LQ7 A;  2XPE A;  4DEJ A;  5IPG A;  2K9F A;  1J9B A;  4TR0 A;  3HYP A;  2KUC A;  2JZR A;  4OCF A;  3KH7 A;  4IHU A;  3F4S A;  5HFG A;  4K7O A;  3FR3 A;  3HDC A;  1Y25 A;  3DEX A;  2HFD A;  1UN2 A;  4KND A;  3DYR A;  4MPG A;  5JWR B;  1M9A A;  2L5L A;  3FMW A;  3TRX A;  2B5X A;  4YH2 A;  1SD8 A;  1PL1 A;  1X5D A;  1J08 A;  4EIQ A;  5IO0 A;  2G0F A;  3IC4 A;  3CSI A;  3UOM A;  5D8I A;  4KW6 A;  1ERT A;  5B6N A;  1E6B A;  3FR6 A;  3TKQ A;  4TXO B;  2WZ9 A;  4IVF A;  1XOB A;  2UZ8 A;  2VCZ A;  4O5R A;  1XVQ A;  3QOU A;  3LWA A;  1K3O A;  3EU4 A;  1GUM A;  2LRC A;  5J4U A;  2HZE B;  1ZYN A;  1V98 A;  3K8N A;  4WXT A;  1TK8 B;  4X4J A;  5H5Q A;  5LCZ A;  3KMO A;  3HCZ A;  2I4A A;  3CTF A;  1RQM A;  1AUC A;  4GWR A;  3GKX A;  2YP6 A;  2ZCT A;  4G0I A;  1THX A;  2CA8 A;  4LA1 A;  4ZL7 A;  1SK2 A;  1ZGN A;  2VLU A;  3I9V 2;  1OE8 A;  1B8X A;  2TIR A;  4P3Y B;  2DBC A;  1SK1 A;  1E2Y A;  3KZQ A;  2YWM A;  3TUE A;  3V1W A;  2N5A A;  1QUW A;  2ON5 A;  3QD9 A;  1B4Q A;  3FY7 A;  4ZL9 A;  3GMF A;  4E8H A;  4IQA A;  1EP8 A;  2O7K A;  3BBY A;  2C3N A;  4L5L A;  4BVX A;  3VPT A;  4HOJ A;  3CSJ A;  4EDZ A;  1GLP A;  1TKD B;  1VF4 A;  3MSZ A;  1ZL9 A;  2N5F A;  4F0C A;  1SKR B;  2AAW A;  2H0H A;  3CXG A;  3HHV A;  1K0C A;  5HR0 A;  1UA5 A;  4O92 A;  1R7H A;  6GST A;  4OFT A;  3U6V A;  3HJP A;  3TCO A;  4ECI A;  5HR1 A;  6GSU A;  2CAQ A;  2PVO C;  2H75 A;  2H6Y A;  3W8J A;  4EDY A;  1AW9 A;  1ZCP A;  2CX4 A;  5F06 A;  3P2A A;  1X9S B;  3Q74 A;  2O89 A;  1M7T A;  5CO3 A;  1M2A A;  2ZUP A;  3D6I A;  5J9C A;  4IEL A;  5JWO B;  4BWQ A;  2YWO A;  1FVJ A;  1FW1 A;  2JL4 A;  4WBR D;  4F9Z A;  4I5Q A;  1LJR A;  3UVH A;  4I2T A;  1DBY A;  1RK4 A;  1H75 A;  1TP9 A;  4KDX A;  1B48 A;  1OYJ A;  1B4P A;  5GAN D;  1XCC A;  4G10 A;  3QAG A;  3PIN A;  4PQ1 A;  1S3D A;  2I3Y A;  4MMM A;  3GFK A;  4NV5 A;  4XS4 A;  3CYN A;  4KSO A;  4V1A p;  3TKS A;  3APS A;  1PA3 A;  2H1D A;  8GSS A;  4KDU A;  2GZY A;  4IQ1 A;  1U87 A;  3WYW A;  4HJM A;  3TOU A;  3IAM 2;  4AJ6 A;  1M2D A;  3UVT A;  3WGX A;  3TRP A;  1GSU A;  5CRE A;  3IK9 A;  3W8S A;  3LW9 A;  3KMN A;  3ZZX A;  2FGX A;  3TJB A;  2ES7 A;  4OCE A;  2H19 A;  5DCG A;  1A23 A;  3GKM A;  1AAZ A;  1JFU A;  4BPY A;  1U3A A;  5DQY A;  1G0T A;  3EPT A;  1LBK A;  3ISO A;  3FW2 A;  4K0G A;  1PD2 1;  1R5A A;  3ERG A;  4YAV A;  3IR4 A;  2R0C A;  1KBN A;  2L5O A;  4POK A;  1R26 A;  1SEN A;  3O3T A;  3P90 A;  2DC5 A;  1OVN A;  4MJB A;  5DJM A;  2HRN A;  3ZIV A;  2LV3 A;  3RAZ A;  2WRT A;  2I1U A;  4HUA A;  4QL7 A;  4X1U A;  1YF0 A;  2V41 A;  3E9J B;  4J56 E;  3HZ4 A;  3VFI A;  3Q6O A;  1A0F A;  2HSM A;  2L57 A;  4FH8 A;  3BCI A;  4Z2U A;  1GLQ A;  4G9H A;  5DAL B;  4AF2 A;  3GX8 A;  4I2U A;  2E2G A;  1GUH A;  3TKP A;  1ILO A;  1YEP A;  2DJ3 A;  3A2X A;  2RUE A;  5F0G A;  2FWH A;  4K7N A;  3A2V A;  2B7J A;  3ZFB A;  4MZW A;  4KX4 A;  5AGY A;  4TR1 B;  3N9J A;  3MDK A;  1EV4 A;  2B1K A;  3JCM L;  3W6G A;  3WGD A;  3IV4 A;  3J7Y k;  3D21 A;  3P7X A;  4TR3 A;  4GST A;  5IMF A;  1O7U A;  2X99 A;  2JSY A;  5F07 A;  1MD3 A;  16GS A;  5ECN B;  5JWQ B;  1M9B A;  3TKR A;  2LQO A;  1AQW A;  4IKH A;  2JZT A;  3MAK A;  5AIS A;  3IHQ A;  12GS A;  4RQR A;  2VL2 A;  3EC3 A;  1ABA A;  4HU7 A;  5ECI B;  3DVX A;  3EVI A;  3D4T A;  1G7E A;  1GSF A;  4FQU A;  1OC9 B;  1GNW A;  4Q5R A;  2HLS A;  1NSW A;  1XXU A;  1XWC A;  1VF2 A;  3F9U A;  3TKS C;  4DSR A;  3LEF A;  3L9V A;  3J7Y b;  3L9U A;  5IQY A;  2YZH A;  3KP8 A;  1USB A;  1J0F A;  1BQ7 A;  2OE0 A;  1S3A A;  2B7K A;  1B9Y C;  3H4K A;  3CTG A;  2FNO A;  4LMV A;  3I6A A;  1F9M A;  4FYC A;  20GS A;  3BOA A;  2KP1 A;  3RPP A;  2GSS A;  6GSS A;  1OKT A;  1YJ6 A;  3VPQ A;  1U6T A;  2AJQ B;  3ERW A;  1K0N A;  1WIK A;  3IHG A;  3ME8 A;  3KTB A;  1FB6 A;  3KD0 A;  3UIW A;  2Z9S A;  3ZLP A;  3VI5 A;  5DAK A;  1NW2 A;  4RQX A;  5ECH B;  4PGT A;  4POM A;  5FWG A;  4YKG A;  1DSB A;  3LOR A;  2P5R A;  4F2I A;  4KAE A;  3HZ8 A;  5J5N A;  3UJ1 A;  2DLX A;  2BJX A;  3HVV A;  3GTU B;  1PKW A;  1GUK A;  3IRA A;  1O73 A;  2ZNM A;  2OBI A;  4TR4 A;  3QDN A;  1EWX A;  2OBK A;  3GH6 A;  4F03 A;  5ID2 A;  4XS1 A;  4GSN A;  3GNJ A;  2TRX A;  1ERU A;  1K0M A;  3C1S A;  4WR4 A;  3TKS E;  4K6X A;  4HQZ A;  1IYI A;  2GSQ A;  1KNG A;  6GSW A;  4G2E A;  2FCH A;  3IC8 A;  2HZE A;  2PUK C;  4ZL8 A;  1R4W A;  1V58 A;  3M3M A;  1MDI A;  1Z7R A;  1ERV A;  2C0G A;  3DIE A;  3VUR A;  1XPV A;  4MPF A;  2IMI A;  5A4W A;  3D4M A;  4MP4 A;  2MMN A;  2HZF A;  3P8W A;  2DSA A;  3BJ5 A;  2H1B A;  3SWL A;  4JR4 A;  4YQM A;  2LJA A;  2C80 A;  2XPD A;  2J23 A;  3S9F A;  1QXH A;  5DBQ A;  3VWU A;  2YWN A;  1Z6M A;  2YJH A;  2ON7 A;  4ZB8 A;  1V9W A;  4WEY A;  5LD0 A;  1W89 A;  3MYD A;  5IO2 A;  2XHF A;  3A5I A;  3NZN A;  1OC3 A;  3LSZ A;  1G6Y A;  4PQI A;  2RUF A;  1XOA A;  2VCX A;  4O5Q A;  2H76 A;  2YN1 A;  2IJY A;  2QA1 A;  2YCD A;  2P31 A;  3TB2 A;  1EGR A;  2WS2 A;  1SKS B;  4MJA A;  1K0A A;  2FLS A;  3ED3 A;  3IBH A;  1TU7 A;  5H5S A;  3WT1 A;  4BVY B;  3KCM A;  5A4U A;  2AV4 A;  3F4T A;  1BX9 A;  4JED A;  5CRH A;  4Z2R A;  2PN8 A;  3M9K A;  1Z3E A;  1FG4 A;  4TRX A;  2MBT A;  1V40 A;  1S3C A;  3GKK A;  2IMF A;  3H79 A;  4NV2 A;  1OKD A;  2PVQ A;  1VF3 A;  3UBK A;  1TDI A;  2E2M A;  4DSS A;  4MH2 A;  1TXX A;  1ACV A;  5AIX A;  3O6T A;  3GSS A;  1N8J A;  2RM6 A;  4DVC A;  3HVS A;  1GTU A;  3DVW A;  4FYU A;  3FZ4 A;  14GS A;  4ZIJ A;  3GH9 A;  2NDO A;  4ACS A;  4RUV A;  4MF7 A;  4KH7 A;  1U3I A;  3CBU A;  2VL3 A;  4AJ8 A;  3L0H A;  4E8E A;  4WBJ A;  1WE0 A;  1DUG A;  1EEJ A;  1WOU A;  1AQV A;  4OMV A;  4NXI A;  5H5R A;  3UEM A;  5IMD A;  5HFI A;  2EIR A;  1EP7 A;  5COH A;  3M9J A;  2H73 A;  2GLR A;  4IJ3 A;  2O8V B;  4CY8 A;  2LQQ A;  2PGT A;  1YQ1 A;  3EE2 A;  1GSD A;  4JU5 A;  5G2Z A;  2MMO A;  4YKF A;  1ZOF A;  4L8E A;  4EF0 A;  3H1N A;  1AIU A;  3NOF A;  1OE7 A;  4I8B A;  2H0G A;  4X0X A;  1URM A;  2JU5 A;  11GS A;  1QK8 A;  5CYY A;  2HRK A;  2I81 A;  3DWV A;  4FIW A;  3IDV A;  3UL3 A;  1JLV A;  3D5J A;  2PMT A;  2A4V A;  5B6M A;  4O7H A;  1EOH A;  2L6C A;  2X4A A;  2RM5 A;  4ZB6 A;  1FHE A;  3GKN A;  2FA8 A;  2IFQ B;  3L78 A;  2K8V A;  3FKF A;  3CSH A;  1EGO A;  3C1R A;  3RDW A;  2L4C A;  2FWF A;  4ZBA A;  4FO5 A;  2C3Q A;  3KP9 A;  2FD3 A;  1RW1 A;  3ZML A;  4L0U A;  2VCV A;  2CVK A;  3GA4 A;  4AGS A;  6GSX A;  5D93 A;  1TRU A;  1F3A A;  3PR8 A;  3QR6 A;  5B7C A;  1O85 A;  4IP6 A;  4ZBD A;  3ZRD A;  1M2B A;  1WP0 A;  4IS0 A;  3MNG A;  3H93 A;  3Q19 A;  2X8H A;  4K2X A;  1GWC A;  5ECS A;  3ZIJ A;  2GTU A;  2OE1 A;  1PN9 A;  4J2F A;  4ZIL A;  1WMJ A;  2CZ3 A;  4TR1 A;  1MDK A;  2M80 A;  5J9B A;  2VM1 A;  4JR6 A;  4KF9 A;  3RHB A;  2L59 A;  5CP1 A;  3TJJ A;  1SU9 A;  2A2S A;  2CQ9 A;  3FK8 A;  1OC8 A;  2YJ7 A;  1SL0 B;  2GQL A;  4RI7 A;  5GSS A;  4HQS A;  4HZ4 A;  4V2L A;  1GTA A;  2XC2 A;  4MLY A;  4G19 A;  2X49 A;  2HSH A;  2R3X A;  4OFN A;  4IBP A;  2H0I A;  2VD0 A;  5ECM B;  3F4R A;  4KA0 A;  3TJF A;  4ECC A;  1WPI A;  1FOV A;  1U88 A;  1O6J A;  1Q4J A;  1PX6 A;  3GIX A;  4POL A;  1F2E A;  5IOX A;  1OC9 A;  5FT3 A;  2NVL A;  1O8X A;  2LUS A;  1CQH A;  3E3E A;  1TI1 A;  1A8Y A;  1DE1 A;  2GS3 A;  2JAD A;  1GP1 A;  4ZB9 A;  2F51 A;  3VK9 A;  2D2Z A;  4IP1 A;  2L6D A;  5KOW A;  4GF0 A;  4WF4 A;  1F6M C;  3KTL A;  1XVW A;  2M72 A;  1B9X C;  2YOI A;  5AIV A;  18GS A;  3HVX A;  1XW5 A;  1C72 A;  4K2D A;  2B6M A;  4KGI A;  3E0U A;  1ST9 A;  3MIX A;  3GUR A;  2BMX A;  5FHI A;  1SJI A;  3WD6 A;  2C0D A;  1CQG A;  2C8U A;  2GT6 A;  4BVX B;  4XTS A;  1GTI A;  4H86 A;  4EC0 A;  1Z6N A;  1LU4 A;  2K8S A;  5IMZ A;  3GTU A;  3ZMK A;  4N10 A;  1FOH A;  3KXO A;  1K3L A;  4GSS A;  1PSQ A;  4MH3 A;  5JCG A;  3UAR A;  2DML A;  4D73 B;  4GTU A;  2DIZ A;  2R2J A;  1F37 A;  4XRD A;  2H70 A;  2IME A;  4XIH A;  1QQ2 A;  4NHW A;  2R6K A;  2GGT A;  4OO4 A;  1BED A;  3IE3 A;  3GL5 A;  3ZL5 A;  1GSQ A;  2C3T A;  1ON4 A;  3ZIT A;  1N2A A;  4MF6 A;  3HY2 A;  3F3R A;  3KGK A;  4FYB A;  3LG6 A;  1GNE A;  2VCQ A;  4TKY A;  1TK5 B;  1ZMA A;  1K0O A;  3G7J A;  4IN0 A;  2VL9 A;  2QSI A;  4PTS A;  2XBQ A;  1HNC A;  3QPM A;  4JRR A;  2HRF A;  2YWI A;  1NHY A;  1JZO A;  17GS A;  4PQH A;  3C71 A;  1UC7 A;  3G9B A;  1H4O A;  4V2M A;  4GCI A;  2PPT A;  1XZO A;  1QGV A;  2R0P A;  2I9H A;  3UAP A;  1VRS D;  3FZ5 A;  2DJK A;  2IIY A;  5BRT A;  3A3T A;  3F63 A;  22GS A;  3LYP A;  4K1F A;  2OKA A;  3GST A;  3AY8 A;  5CRG A;  1XWA A;  5B8A A;  1G7O A;  2B5Y A;  5ECQ B;  5D73 A;  3EUR A;  5A5K A;  7GSS A;  5IMA A;  1KTE A;  1NHO A;  2JAC A;  2LNT A;  4GRF A;  5F8B A;  3HJM A;  3ERF A;  4RI6 A;  1O81 A;  4ML6 A;  2LKU A;  2PU9 C;  5ECR B;  4PNF A;  5C00 A;  5G5F A;  2X64 A;  2AYT A;  2LJR A;  4ECJ A;  3KM6 A;  2MBS A;  2R0G A;  1TU8 A;  4EE0 A;  1V2A A;  4DSQ A;  4KSM A;  2F3M A;  3ZTL A;  4Q5N A;  2B5E A;  2KLX A;  5DVB A;  2B3S A;  4TW5 A;  5KOX A;  5LNK e;  2LS5 A;  2H01 A;  3FRC A;  3KH9 A;  2LST A;  3QFA C;  3OR5 A;  1YDK A;  3LXT A;  1X9W B;  4NAX A;  2LRN A;  3EIN A;  2GST A;  3TJK A;  2AHE A;  4TXO A;  1X9M B;  3FYG A;  1ZYE A;  3UMA A;  2FY6 A;  2LTK A;  1BG5 A;  2KHP A;  1MDJ A;  4CDO A;  1MEK A;  4KUN A;  4XCS A;  1FAA A;  2LJK A;  3IAS 2;  4K0N A;  2J9H A;  4GQC A;  2JZS A;  3GX0 A;  10GS A;  2QC7 A;  1O8W A;  1SK0 A;  3RHC A;  3GRX A;  1QMV A;  4HDE A;  4K5R A;  3EU3 A;  5E59 A;  2REM A;  2DJJ A;  4LMW A;  5D9W A;  1I9D A;  2V6K A;  3HKR A;  1PGT A;  4MNN A;  6GSY A;  2OAD A;  4YAP A;  3F6F A;  4LL4 B;  2H6Z A;  1JZD A;  1Z7P A;  3SBC A;  5EVO A;  2PBJ A;  2WDU A;  4J57 E;  1HNB A;  2ALB A;  3G7Y A;  4MK3 A;  1SYR A;  2M46 A;  3QAV A;  2VL2 C;  2H71 A;  4G0L A;  4N11 A;  5DDL A;  4G0K A;  5DQS A;  2NPB A;  4POB A;  2DKH A;  1QFN A;  3F8U A;  4WR5 A;  4I6X A;  4MF5 A;  4HU9 A;  2MMA A;  2IFQ A;  1TRW A;  5HR3 A;  4MAB A;  4NMU A;  4PX1 A;  1YKA A;  4YQV A;  1TTZ A;  4ISD A;  5D96 A;  2GZP A;  1VF1 A;  2AUV A;  5B8B A;  1BJX A;  1UVZ A;  5JCU A;  3F0I A;  3PPU A;  5ECP B;  2VAF A;  2VOC A;  3O76 A;  4HJ2 A;  2X8C A;  4BL7 B;  2N5B A;  1K3Y A;  2WGR A;  4XHM A;  1HD2 A;  1ZYP A;  2NBS A;  5DAK B;  1EZK A;  1VGL A;  1HQO A;  2VD1 A;  3FR9 A;  1JZR A;  1MTC A;  2YNX A;  4I97 A;  2EIQ A;  1AC1 A;  1SJ6 A;  2H72 A;  5CRD A;  3C8E A;  2QKE A;  4CY6 A;  3GYK A;  2YV9 A;  2DJ1 A;  2JSZ A;  4NPB A;  3QMX A;  1A8L A;  4N0V A;  5ID2 B;  2PWJ A;  1ERW A;  3F3Q A;  2GSR A;  3D0Z A;  3CMI A;  1X5C A;  4EVM A;  2EC4 A;  2A4H A;  4O5U A;  4F82 A;  2DJ2 A;  3QAW A;  2VUP A;  1M99 A;  5ENU A;  1EV9 A;  4JZQ A;  3GN3 A;  5CNW A;  1WRY A;  2VCT A;  1OAZ A;  2CVD A;  3BCK A;  3M8N A;  5KN2 A;  1SKW B;  5ELG A;  2R5G A;  9GSS A;  2VIM A;  5IOW A;  4K7I A;  3M0F A;  2KOK A;  2H66 A;  4TVE A;  2FA4 A;  3TOT A;  1TRV A;  3TJG A;  1GTB A;  2R4V A;  2OAC A;  1YEX A;  2FWG A;  19GS A;  2LRT A;  2IPA A;  4ZXG A;  3IOS A;  1THO A;  1X5E A;  1PX7 A;  2KP2 A;  3H8Q A;  5IPH A;  1EEM A;  4EKZ A;  2O87 A;  4N0Z A;  5DCH A;  5E4W A;  2TRC P;  2C0E A;  1XBS A;  2GDR A;  4WKW A;  5G5E A;  3KEB A;  5DAL A;  4V2N A;  2HNL A;  2GVP A;  4D73 A;  1T3B A;  3EMX A;  5BMU A;  2DMM A;  5IMC A;  1EOG A;  4EO3 A;  4PNG A;  4PUR A;  3GL3 A;  2H8L A;  4GXZ A;  5AN1 A;  4O32 A;  3FHK A;  1GL8 A;  2YZU A;  1TW9 A;  5INY A;  1A2J A;  2VO4 A;  3DRN A;  5J41 A;  4Z7X A;  1Z9H A;  1GRX A;  3US3 A;  4GQF A;  2HT9 A;  2V6O A;  1FO5 A;  3FZA A;  3I69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...