4K2DA

Crystal structure of burkholderia pseudomallei dsba
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
191
structure length
191
Chain Sequence
SPSAPVAGKDFEVMKSPQPVSAPAGKVEVIEFFWYGCPHCYEFEPTIEAWVKKQGDKIAFKRVPVAFRDDFVPHSKLFYALAALGVSEKVTPAVFNAIHKEKNYLLTPQAQADFLATQGVDKKKFLDAYNSFSVQGQVKQSAELLKNYNIDGVPTIVVQGKYKTGPAYTNSLEGTAQVLDFLVKQVQDKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein
publication title Disarming Burkholderia pseudomallei: Structural and Functional Characterization of a Disulfide Oxidoreductase (DsbA) Required for Virulence In Vivo.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Oxidoreductase
total genus 60
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2013-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4k2dA00
3CBUA 5IMZA 3UIWA 1GWCA 1K0DA 2DJKA 5AIXA 2DBCA 2F3MA 2CQ9A 3GKKA 3M8NA 4LLRA 3GYKA 2BTOT 1QUWA 2HSYA 3A2XA 3HJPA 2YP6A 3GH9A 3C71A 5D73A 4E8HA 3O3TA 3ERFA 1NW2A 3FEUA 4K8MA 1NHYA 3HHVA 4G10A 5HR2A 2H0HA 5C04A 4MDCA 4MPGA 1HNAA 1ZZYA 4BVXA 4KNDA 2FHEA 2LUSA 1B9XC 3A3TA 3V1WA 5ECMB 4KX4A 5ECKB 5CRDA 1TI3A 4ECJA 5DAKB 2GQKA 4PQHA 2ZCTA 4OMVA 2IN3A 4ML1A 2RLIA 1I5GA 3KH9A 1V40A 4IW9A 1SKRB 2JL4A 3WGDA 5JWOB 3FZ9A 1XZOA 4N11A 2LRTA 1OC3A 1T1VA 3KP8A 2H1DA 1THXA 3UMAA 1SKSB 2C3TA 4MLYA 2EIQA 3UARA 5KN0A 4MJCA 6GSUA 1UC7A 4JR6A 4PUFC 1JFUA 2DJ3A 2J23A 5LNKe 1R4WA 4PGTA 1XOAA 5IO2A 2XPEA 2OA7A 3KMNA 3NOFA 3M9KA 3CTGA 3L9UA 5DCHA 5KN2A 2GQLA 5ELAA 3EE2A 5IIZA 5FT3A 2OE0A 4P3YB 1EZKA 2YJ7A 1URMA 2JSZA 1ILOA 3D4MA 4YQUA 1GUHA 4K7OA 2RUEA 1MD3A 1M2AA 1B9YC 2FA8A 3EINA 4MABA 5J41A 1V2AA 1QQ2A 4LA1A 2H0IA 3DRNA 2YWIA 1G7EA 3SBCA 2NVLA 4FYCA 5DBQA 1BAYA 5G5FA 4D73A 4XRDA 3IBHA 3D22A 3TOUA 3IAM2 4YH2A 2O85A 6GSYA 1GRXA 1MD4A 5G2ZA 6GSVA 3NZNA 2PPTA 1TU8A 4DVCA 2MBTA 1A2JA 4FH8A 4KAEA 5D9XA 6GSXA 3APQA 1GUMA 3S9FA 2MMZA 4PX1A 4I5QA 3EMPA 2HFDA 3ERWA 3DWVA 4K1FA 3TCOA 3WGEA 1AAZA 2VM2A 4PQIA 3SWLA 4G9HA 1SKWB 5ECPB 1AQVA 1Z6MA 4DSRA 2TIRA 3I6AA 2WRTA 4DEJA 3LYPA 3G7YA 2JZTA 3GSTA 4D73B 1XWAA 2G2QA 1TKDB 3IOSA 3GIXA 1SENA 4NV2A 1WIKA 1EWXA 3I69A 2AHEA 2B6MA 3WT1A 3QAWA 3ZL5A 1Q98A 1HYUA 5INYA 1J08A 4IELA 4XHMA 1M9BA 2H75A 1PL2A 2C8UA 3GL3A 3GUSA 2L4CA 3TJKA 4GWRA 1ZMAA 3LWAA 2A4VA 4IKHA 1TOFA 4IN0A 3VWVA 5EL8A 3UVTA 4NHZA 3ZREA 4CHSA 1H4OA 1PSQA 4V2LA 1SD8A 2X8HA 3HVXA 3P90A 1Z6NA 3LXTA 1DE2A 2HI7A 1TU7A 2REMA 2VOCA 4K9ZA 1GTAA 4NV5A 4TW5A 1GUKA 3D5JA 1J0FA 4YAVA 2AAWA 2CX3A 1THOA 1CQHA 5IPGA 1WRYA 1PX6A 5IMVA 2E0QA 3LYKA 4XS1A 2HRFA 3GX0A 7GSSA 1GH2A 3FK8A 4YAPA 2DC5A 1V57A 1YF1A 3H79A 5E59A 4EDZA 18GSA 2LSTA 1Z3EA 3EYTA 1XWGA 2IMKA 3UEMA 1QXHA 4ZL8A 3RHBA 3CTFA 3QFAC 2R6KA 3O76A 1FVJA 4BVYA 2M72A 2Z9SA 5A4UA 4EUYA 1V98A 1PN9A 3TRXA 2QKEA 4J56E 1B4QA 1A0RP 2LRNA 13GSA 2LJRA 4HU9A 3G7JA 5HR3A 2PN8A 5CO3A 4IVFA 1F3BA 1DSBA 2O87A 3ZMLA 1YKCA 4XCSA 5GSTA 2OACA 2E2GA 5DJLA 1PQNA 1M9AA 4HU7A 1VGLA 1F2EA 4IQ1A 1WPIA 5B8BA 5CRHA 4PNFA 5A4WA 3LSZA 2PMTA 3QFBC 5ECNB 2HT9A 4WEYA 1GSUA 2WFCA 5H5RA 3NIVA 1A2LA 2ZNMA 2WS2A 4ECBA 4MZBA 2HXKA 3LG6A 1XXUA 1K3LA 2B1KA 2LV3A 2OBKA 2FWGA 5D9TA 2YZHA 2R2JA 3HCZA 1UA5A 1B48A 3TKSA 2K8VA 1V9WA 3VPTA 3VI7A 2B5YA 1VF4A 2DSAA 5LCZA 3FZ4A 3UOMA 1RQMA 1BYEA 3RAZA 2DJ1A 1X5CA 4BA7A 3TKRA 5COHA 1HNCA 3TKQA 3PGTA 3WD6A 3F63A 3HVSA 1DE1A 4HZ4A 2H30A 3Q6OA 3C8EA 1YEPA 5B6NA 2LEGA 3DVWA 5ECSA 3C73A 3ME7A 1TRSA 4Q5QA 1KBNA 3TKPA 4V1Ap 3Q18A 2IIYA 1TDIA 3LORA 4HZ2A 3IK7A 3QR6A 3IDVA 2OJLA 2B1LA 2IMFA 5DJMA 2FWEA 3MDKA 3TDGA 5CRGA 2CVKA 3WT2A 5C00A 2VAFA 2HYXA 2LNSA 2RUFA 1GTIA 4IP1A 4LMWA 2CZ2A 2LQOA 1JZWA 4F2IA 2E2MA 5JCGA 1A23A 4KDYA 1H75A 3VWXA 1N2AA 2WDUA 3P7XA 1TW9A 1JLWA 1GSYA 4OFTA 2IL3A 1X0RA 1V58A 4X43A 2MYGA 2IJYA 2GLRA 4OFMA 3EU4A 2LJAA 1X5EA 2LQQA 2VCQA 2H70A 3BD2A 3H4KA 1NM3A 2NBSA 4EL1A 1SYXA 1GSFA 3VWUA 1PKZA 1O8XA 2K6VA 2R5GA 2EC4A 4XRAA 3TB2A 2IWTA 4LMVA 4K7NA 4RI7A 2FCHA 4H86A 2ON5A 2YNXA 2CAQA 2I9HA 3LFLA 4F0BA 4BWSA 1U87A 2C3QA 4AF2A 2CZ3A 4I2TA 1FAAA 2I1UA 3AY8A 4FYUA 3FW2A 2PGTA 3FZAA 1USBA 2CA8A 2DIYA 1O81A 3GA4A 2OE3A 4V2NA 1SD9A 3IRAA 4G2EA 2MZCA 2VCWA 2C1YA 4I97A 1G0TA 2PBJA 2O8VB 4HI7A 4PURA 3ZRDA 2RM6A 2VCZA 3F4SA 2E7PA 4EXJA 1S3CA 4ZB6A 3FR9A 4QL7A 3GTUA 1F3AA 1DUGA 4JZQA 1A8LA 4TR0A 2BJXA 3W6GA 4ILFA 1AXDA 3HZ4A 1T7PB 4HOJA 5IPHA 5CREA 2VD1A 3TKSC 4N10A 4ZL9A 3KXOA 4GXZA 4KDXA 3DVXA 5KN3A 2VL9A 5G30A 2O7KA 4MZWA 2V32A 5ENUA 2GT6A 1O7UA 2JSYA 1T4YA 4ZILA 2B5XA 2WB9A 3BCKA 5F8BA 22GSA 1U88A 1GTUA 3KH7A 5LD0A 2FY6A 3IPZA 2ALBA 5F06A 4TVEA 4IHUA 2GT5A 1RW1A 1FB0A 4O92A 4ZBBA 2C80A 3TGZA 1Z9HA 3HVVA 3UL3A 2NTOA 2YWNA 1XCCA 4CDOA 2FA4A 4L0UA 4KA0A 2H0GA 5F05A 3GTUB 3Q19A 5F0GA 3A2WA 1YY7A 4EDYA 1M99A 1J9BA 2C4JA 2HE3A 3C1RA 1OAZA 4O32A 2GGTA 4K0NA 3EWLA 3WGXA 4HQSA 1T00A 2WCIA 1SU9A 1AIUA 2AV4A 5KEJA 1KEBA 4Q5RA 1T8EB 1OE8A 10GSA 1X5DA 5EY6A 2KLXA 3IR4A 3IAS2 2L5OA 2LKUA 3UVHA 2CVBA 2LTKA 2FD3A 1SYRA 1YQ1A 1Z7PA 1OKTA 2H1AA 1GLQA 1K3YA 4Q5FA 2VCXA 4KW6A 1BQ7A 2N5BA 2GS3A 5D93A 4ZB9A 3TOTA 5G1KA 1PX7A 4EC0A 2L59A 5H5QA 1XBSA 4ZXGA 1F9MA 4MJBA 5L71A 5GAPD 1WOUA 5HR0A 3W8JA 4WR4A 2OADA 3FKFA 3P2AA 2HLSA 1QK8A 2FLSA 1M0UA 3D21A 5G31A 2V2GA 2VLTA 1BJXA 2KHPA 1UN2A 1A8YA 4J57E 1EV4A 4TXOA 2GSQA 1O85A 1QMVA 5ABRA 3DMLA 3KM6A 2B7JA 6GSSA 4MP4A 1S3DA 1XW6A 1FVKA 2L6DA 4I6XA 3DKSA 1JZOA 1FOVA 3G7IA 2JADA 1X9MB 4IGJA 3VFIA 1MTCA 2LRCA 1MEKA 1EEJA 1YZXA 2X8CA 1XIYA 5F07A 1KTEA 1IYHA 1Z7RA 1HQOA 1ZYQB 2GDRA 5DQSA 5D9WA 2XC2A 1WMJA 1ERVA 5HFKA 5HQPA 5FHIA 1ZGNA 4TR4A 5HR1A 2V6OA 3I9V2 4HUAA 3KGKA 3PINA 5J9BA 3FHKA 3M3MA 2YCDA 1JLVA 4RQRA 4MF5A 3GN3A 4E8EA 4OD7A 5J9CA 4TXOB 1ERTA 3ZLPA 5JCWA 2O89A 3EMXA 4MJAA 2YANA 4K0GA 4HJ2A 4DSSA 2XBQA 3HXSA 1XW9A 2H6XA 1EV9A 3QMXA 1JHBA 4K2DA 3HJMA 1FB6A 1PA3A 1AUCA 4O7HA 1ZYEA 5DDLA 2YV7A 4AJ7A 5AN1A 2H1BA 1QFNA 4QQ7A 1R26A 2K18A 3FYGA 2MMAA 4I2UA 3TJJA 2GSTA 4POBA 19GSA 4IP6A 4KCAA 1S3AA 3E9JB 2ZUPA 1EOHA 4POKA 4FO5A 3ZVJA 5IMFA 3TKSE 3LGCA 4RI6A 4WF5A 3ZFBA 1AW9A 4OWYA 1N8JA 2H71A 2FUG2 4WBJA 3VURA 1TI1A 4PUAA 5ECOB 2L57A 2VL2A 1K0MA 2CX4A 1GSSA 2L6CA 5E4WA 4BL7A 2CVDA 2H1GA 1PMTA 1E2YA 11GSA 2XBIA 2A2SA 4DSSB 2H72A 2H6YA 4ML6A 1SK2A 2MMOA 4CW9A 2X8GA 5KN1A 3RBTA 4MH2A 20GSA 1G7OA 5IMAA 3GX8A 3CYNA 3ZIVA 1CQGA 3H1NA 2BMXA 1BX9A 4HDEA 1PRXA 4MCUA 2WULA 2PVOC 1XVQA 3IC4A 3F3RA 2M80A 1ZOFA 2XHFA 3KJYA 2R4VA 2PU9C 3KCMA 4ZBDA 3J7Yb 3GSSA 3L0HA 3TJFA 4XTSA 1GULA 3QD9A 4BPYA 4ACSA 2QSIA 1WE0A 1M7TA 2EIRA 2P5RA 4N30A 5G1LA 2VD0A 2MBSA 4N0ZA 2DLXA 3FR3A 3CSJA 3GKXA 3J7Yk 4KUNA 2H01A 3DD3A 3L78A 1OC9A 4ZL7A 5A4VA 2I81A 1YDKA 5J4UA 1X9SB 2YWOA 2C0GA 2YV9A 3RHCA 3DIEA 2OKAA 4IJ3A 2PVQA 3BCIA 2HRNA 2YN1A 2DJJA 1SL1B 1B8XA 2B5EA 1TK5B 5A5KA 3GKNA 4PXOA 5B8AA 1ON4A 3K8NA 2PERA 3JCML 3E3EA 3TUEA 2GZYA 5DVBA 1O73A 3CSIA 4EKZA 2CT6A 3F9UA 5EPFA 5J3RA 4AJ6A 2WZ9A 3BJ5A 3DGQA 4F0CA 2F8AA 8GSSA 1OYJA 2LNTA 4IBPA 4V1Ag 5DALA 3GL5A 1GLPA 3TRQA 1OC9B 2F51A 4PNGA 2MMNA 1SJZA 1EP8A 1R5PA 2C3NA 2GTUA 3MAKA 5CAXA 1DBYA 2V1MA 3PH9A 5FWGA 3W8SA 1TP9A 4TXVA 5D96A 1U3IA 5ECQB 3FRCA 4ZBAA 1NHOA 4MF6A 4F9ZA 2AB6A 3IA1A 3KMOA 4KE3A 4BWQA 1TXXA 5IOWA 4ISDA 1MDIA 2HZFA 2H76A 2DJ0A 2K9FA 2VL2C 4XIHA 3HA9A 3UAPA 4MMMA 3U5RE 2H74A 4GF0A 4MF7A 4NWYA 1ZL9A 3CSHA 1VF3A 2H19A 1Y25A 2IMIA 4TKYA 2VO4A 4IQAA 17GSA 5HFGA 3GNJA 5AISA 1SJ6A 6GSTA 5DALB 4NPBA 4KCEA 3M9JA 5JWQB 1B4PA 1XWBA 5IQYA 3N9JA 2FWFA 4MPFA 1VF2A 3DYRA 4LL1B 3ISOA 2H66A 2WJUA 4ULXA 2TRCP 3MWHA 4GTUA 3L4NA 3CRUA 4F82A 2PWJA 1O8WA 1VF1A 5DCGA 4HQZA 1KNGA 3HDCA 4KB3A 2VM1A 1FO5A 4RUVA 5JCUA 2GSSA 2IMEA 3D4TA 2CV4A 1ERUA 3LQ7A 5CYYA 3H8QA 4XS4A 1TRUA 3F3QA 4X0XA 5IMDA 4JBBA 2DMLA 2C0DA 5DQYA 4MH3A 4GLTA 5H5SA 1A24A 4J2FA 3VLNA 2L5LA 1F37A 2EIOA 2HNLA 3EU3A 3ERGA 4EE0A 3R2QA 2GQMA 4K6XA 2YZUA 3CXGA 3DEXA 5J5NA 4EVMA 2DMMA 3FY7A 1A2MA 1YJ6A 4KH7A 3QDNA 5GSSA 3P8WA 4HS1A 1I9DA 2GZPA 1U6TA 2J9HA 2F8FA 3UBLA 1XWCA 3QPMA 5B7CA 2HZEA 1XFLA 3UJ1A 3ZYWA 5GZZB 2RIIA 2KP2A 3GKMA 5CNWA 1YF0A 5ID2A 2IMDA 4L5OA 3GFKA 3DXBA 5ECRB 4X1UA 2NDOA 1ERWA 2JACA 1FW1A 4XS4B 5IM9A 4OFNA 1EOGA 4ZB8A 1R5AA 2X99A 1A0FA 1SJIA 3HKRA 3D6IA 1K0BA 4I8BA 1M2BA 4MK3A 4GSNA 1TK0B 12GSA 3TJBA 4JE1A 3PR8A 1ST9A 3GURA 5D9VA 3KTBA 4WF4A 2TRXA 4MJEA 3F8UA 3C1SA 3GH6A 3VI5A 2B3SA 3KZQA 3ZFLA 1TK8B 2KUCA 3M1GA 2HZEB 1YKAA 2H8LA 3QOUA 1PL1A 1NSWA 3D0ZA 4L0WA 1GL8A 1T4ZA 1K0AA 1K0NA 1WWJA 3RPPA 2C0EA 1WJKA 5IO0A 1E6BA 4TN8A 3US3A 5ID2B 3TJGA 1TRVA 1FG4A 2KOKA 4V2MA 1ABAA 2OE1A 1Z5YE 3F6FA 3MNGA 1FHEA 1SL2B 2YPMA 1ML6A 3I43A 3F0IA 5CRWA 2PUKC 2N5AA 3L9VA 2R37A 2VUPA 1K0CA 3G9BA 3KIJA 2V6KA 1PD21 2FWHA 4KGIA 4HEA2 6GSWA 3WYWA 2IFQA 5ECHB 3BOAA 1Q4JA 1JZDA 5ELGA 3CMIA 2YOIA 3APSA 3U6VA 2VCVA 3VK9A 4ECCA 2HSHA 4POMA 4KSOA 2I3YA 4ECIA 3RPNA 4JR4A 2KP1A 1W4VA 3ED3A 1GNEA 2A2RA 4GQFA 2QC7A 1XWKA 1SL0B 4WBRD 3QAGA 4N0VA 5ECIB 1HNBA 3ZZXA 3LXZA 3KD0A 1TRWA 1F6MC 3KP9A 1GSDA 4FIWA 4L8EA 1PGTA 4TRXA 5ECLB 4RQXA 2H73A 1GSQA 1XOBA 4KDUA 3L9SA 4AGSA 2R3XA 3A2VA 4GQCA 1BEDA 1GP1A 3HY2A 2RM5A 1T3BA 2I4AA 4YQVA 4IJIA 2IFQB 3F4RA 3N5OA 1RK4A 3IXRA 16GSA 2CAIA 2F9SA 4NAXA 5HFIA 14GSA 4TR1A 2AYTA 3GHAA 2N5FA 2JZSA 2ES7A 3EC3A 4IS0A 3MSZA 1G6WA 4WKWA 1HD2A 1X9WB 5EVOA 3EVIA 4F03A 1GSEA 4KSMA 1AC1A 4GRFA 1OVNA 4G19A 1JZRA 3LEFA 1TTZA 2VLVA 1K0OA 3IHQA 2OBIA 1TJDA 1XPVA 2L4QA 4JRRA 4O5RA 4PQ1A 4HJMA 4MZCA 3ZITA 2B7KA 4OCFA 4ID0A 4DSQA 2LJKA 4TR3A 1IYIA 1SK1A 3IE3A 4GSTA 4JU5A 2GSRA 3GMFA 1MDKA 4GSSA 2GVPA 5G5EA 2P5QA 3ZIJA 3H93A 3A5WA 4GCIA 1ZCPA 2D2ZA 1U3AA 1ACVA 2VIMA 1C72A 1XVWA 1WP0A 2IPAA 2M46A 3APOA 5B6MA 1M2DA 3KEBA 1K3OA 4AJ8A 3OR5A 3CRTA 4QL9A 4OO4A 5JWRB 3HZ8A 4WR5A 4WXTA 4Q5NA 1BG5A 3FR6A 4LL4B 1W89A 4TR1B 3GV1A 2VLUA 3VWWA 2AUVA 4EF0A 2YJHA 2G0FA 1AQWA 5AIVA 3IV4A 4WETA 2FGXA 1XW5A 3ZVJD 2JZRA 2LS5A 2C0FA 3FZ5A 3QAVA 3TRPA 5IMCA 4OO5A 1VRSD 4ZIJA 4MA9A 1OC8A 3ZTLA 3UBKA 2DIZA 2H6ZA 3EURA 4K7IA 4NXIA 2AJQB 3O6TA 2VL3A 1Y6EA 3F4TA 3ZMKA 4TOPA 3QCPA 3Q74A 5AGYA 3IK9A 2XPDA 1EGRA 3LJRA 3BBYA 3C7MA 1AQXA 4EO3A 4XS6A 2GZZA 1PKWA 3M0FA 1EGOA 3GRXA 4Z7XA 4YQMA 3VPQA 9GSSA 1EP7A 2X64A 1OE7A 2P0GA 1UVZA 1MDJA 1O6JA 4L5LA 5CP1A 1YEXA 3HYPA 1QGVA 3E0UA 1EEMA 3ME8A 2ON7A 5D8IA 4FYBA 5IOXA 5GAND 1LJRA 2NPBA 1G6YA 1OKDA 2VCTA 4NHWA 3HJOA 2JU5A 2YWMA 2K8SA 3KTLA 2DJ2A 2P31A 3RDWA 2FNOA 1LU4A 3HD5A 1LBKA 1GTBA 3F6DA 4JEDA 4NMUA 1SK0A 2QGVA 5DAKA 4POLA 1GNWA 1R7HA 2V41A 2WGRA 4OCEA
chains in the Genus database with same CATH superfamily
3CBUA 5IMZA 3UIWA 1GWCA 1K0DA 2DJKA 5AIXA 2DBCA 2F3MA 2CQ9A 2DKIA 3GKKA 3M8NA 4LLRA 3GYKA 2BTOT 1QUWA 2HSYA 3A2XA 3HJPA 2YP6A 3GH9A 3C71A 5D73A 4E8HA 3O3TA 3ERFA 1NW2A 3FEUA 4K8MA 1NHYA 3HHVA 4G10A 5HR2A 2H0HA 5C04A 4MDCA 4MPGA 1HNAA 1ZZYA 4BVXA 4KNDA 2FHEA 2LUSA 1B9XC 3A3TA 3V1WA 5ECMB 4KX4A 5ECKB 5CRDA 1TI3A 4ECJA 5DAKB 2GQKA 4PQHA 2ZCTA 4OMVA 2IN3A 4ML1A 2RLIA 1I5GA 3KH9A 1V40A 4IW9A 1SKRB 2JL4A 3WGDA 5JWOB 3FZ9A 1XZOA 4EIPA 4N11A 2LRTA 1OC3A 1T1VA 3KP8A 2H1DA 1THXA 3UMAA 1SKSB 2C3TA 4MLYA 2EIQA 3UARA 5KN0A 4MJCA 6GSUA 1UC7A 4JR6A 4PUFC 1JFUA 2DJ3A 2J23A 5LNKe 1R4WA 4PGTA 1XOAA 3MYDA 5IO2A 4BVXB 2XPEA 2OA7A 3KMNA 3NOFA 3M9KA 3CTGA 3L9UA 5DCHA 5KN2A 1ZYPA 2GQLA 5ELAA 3EE2A 5IIZA 5FT3A 2OE0A 4P3YB 1EZKA 2YJ7A 1URMA 2JSZA 1ILOA 3D4MA 4YQUA 1GUHA 4K7OA 2RUEA 1MD3A 1M2AA 1B9YC 2FA8A 3EINA 4MABA 5J41A 1V2AA 1QQ2A 4Z2RA 4LA1A 2H0IA 3DRNA 2YWIA 1G7EA 2A4HA 1ZYNA 3SBCA 2NVLA 4FYCA 5DBQA 1BAYA 5G5FA 2HRAA 4D73A 4XRDA 3IBHA 3D22A 3TOUA 3IAM2 4YH2A 2O85A 6GSYA 1GRXA 1MD4A 5G2ZA 6GSVA 3NZNA 2PPTA 1TU8A 4DVCA 2MBTA 1A2JA 4FH8A 5BRTA 1FOHA 4KAEA 5D9XA 6GSXA 3APQA 1GUMA 3S9FA 2MMZA 4MNNA 4PX1A 4I5QA 3EMPA 2HFDA 3ERWA 3DWVA 4K1FA 3TCOA 3WGEA 1AAZA 2VM2A 4PQIA 3SWLA 4G9HA 1SKWB 5ECPB 1AQVA 1Z6MA 4DSRA 2TIRA 3I6AA 2WRTA 4PTSA 4DEJA 2R0GA 3LYPA 3G7YA 2JZTA 3GSTA 4D73B 1XWAA 2G2QA 1TKDB 3IOSA 3GIXA 1SENA 4NV2A 1WIKA 1EWXA 3I69A 2AHEA 2B6MA 3WT1A 3QAWA 3ZL5A 1Q98A 1HYUA 5INYA 1J08A 4IELA 4XHMA 1M9BA 2H75A 1PL2A 2C8UA 3GL3A 3GUSA 2L4CA 3TJKA 4GWRA 1ZMAA 3LWAA 2A4VA 4IKHA 1TOFA 4IN0A 3VWVA 5EL8A 3UVTA 4NHZA 4CY6A 3ZREA 4CHSA 1H4OA 1PSQA 4V2LA 1SD8A 2X8HA 3HVXA 3P90A 1Z6NA 3LXTA 1DE2A 2HI7A 1TU7A 2REMA 2VOCA 4K9ZA 1GTAA 4NV5A 4TW5A 1GUKA 3D5JA 1J0FA 4YAVA 2AAWA 2CX3A 1THOA 1CQHA 5IPGA 1WRYA 1PX6A 5IMVA 2E0QA 3LYKA 4XS1A 2HRFA 3GX0A 7GSSA 1GH2A 3FK8A 4YAPA 2DC5A 1V57A 1YF1A 3H79A 5E59A 4EDZA 18GSA 2LSTA 1Z3EA 3EYTA 1XWGA 3PPUA 2IMKA 3UEMA 1QXHA 4K5RA 4ZL8A 3RHBA 3CTFA 3QFAC 2R6KA 3O76A 1FVJA 4BVYA 5KOXA 2M72A 2Z9SA 5A4UA 4EUYA 1V98A 1PN9A 3TRXA 2QKEA 4J56E 1B4QA 1A0RP 2LRNA 13GSA 2LJRA 4HU9A 3G7JA 5HR3A 2PN8A 5CO3A 4IVFA 4YKGA 1F3BA 1DSBA 1XG8A 2O87A 3ZMLA 1YKCA 4XCSA 5GSTA 2OACA 2E2GA 5DJLA 1PQNA 1M9AA 4HU7A 1VGLA 1F2EA 4IQ1A 1WPIA 5B8BA 5CRHA 4PNFA 5A4WA 3LSZA 2PMTA 3QFBC 5ECNB 2HT9A 4WEYA 3A5IA 4G0KA 3R3EA 1GSUA 2WFCA 5H5RA 1M3IA 3NIVA 1A2LA 2ZNMA 2WS2A 4ECBA 4MZBA 2HXKA 3LG6A 1XXUA 1K3LA 2B1KA 2LV3A 2OBKA 2FWGA 5D9TA 2YZHA 2R2JA 3HCZA 1UA5A 1B48A 3TKSA 2K8VA 1V9WA 3VPTA 4BVYB 3VI7A 2B5YA 1VF4A 2DSAA 5LCZA 3FZ4A 3UOMA 1RQMA 1BYEA 3RAZA 2DJ1A 1X5CA 4BA7A 3TKRA 5COHA 1HNCA 3TKQA 3PGTA 3WD6A 3F63A 3HVSA 1DE1A 4HZ4A 2H30A 3Q6OA 3C8EA 1YEPA 5B6NA 2LEGA 3DVWA 5ECSA 3C73A 3ME7A 1TRSA 4Q5QA 1KBNA 3TKPA 4V1Ap 3Q18A 2IIYA 1TDIA 3LORA 4HZ2A 3IK7A 3QR6A 3IDVA 2OJLA 2B1LA 2IMFA 5DJMA 2FWEA 3MDKA 3TDGA 5CRGA 2CVKA 3WT2A 5C00A 2VAFA 4BIKA 2HYXA 2LNSA 2RUFA 1GTIA 5KOWA 4IP1A 4LMWA 2CZ2A 2LQOA 1JZWA 4F2IA 2E2MA 4X4JA 5JCGA 1A23A 4KDYA 1H75A 3VWXA 1N2AA 2WDUA 3P7XA 1TW9A 1JLWA 1GSYA 4OFTA 2IL3A 1X0RA 1V58A 4X43A 2MYGA 2IJYA 2GLRA 5BMUA 4OFMA 3EU4A 2LJAA 1X5EA 2LQQA 2VCQA 2H70A 3BD2A 3H4KA 1NM3A 2NBSA 4EL1A 1SYXA 1GSFA 2HSMA 3VWUA 1PKZA 1O8XA 2K6VA 2R5GA 2EC4A 4XRAA 3TB2A 2IWTA 4LMVA 4K7NA 4RI7A 2FCHA 4H86A 2ON5A 2YNXA 2CAQA 2I9HA 3LFLA 4F0BA 4BWSA 1U87A 2C3QA 4AF2A 2CZ3A 4I2TA 1FAAA 2I1UA 3AY8A 4FYUA 3FW2A 2PGTA 3FZAA 1USBA 2CA8A 2DIYA 4O5QA 1O81A 3GA4A 2OE3A 4V2NA 1SD9A 3IRAA 4G2EA 2MZCA 2VCWA 2C1YA 4I97A 1G0TA 2PBJA 2O8VB 4HI7A 4PURA 3ZRDA 2RM6A 2VCZA 3F4SA 2E7PA 4EXJA 1S3CA 4ZB6A 3FR9A 4QL7A 3GTUA 1F3AA 1DUGA 4JZQA 1A8LA 4TR0A 2BJXA 3W6GA 4ILFA 1AXDA 3HZ4A 1T7PB 4HOJA 5IPHA 4CY8A 5CREA 2VD1A 3TKSC 4N10A 4ZL9A 4FQUA 3KXOA 4GXZA 4KDXA 3DVXA 5KN3A 2VL9A 5G30A 2O7KA 4MZWA 2V32A 5ENUA 2GT6A 1O7UA 2JSYA 1T4YA 4ZILA 2B5XA 2WB9A 3BCKA 5F8BA 22GSA 1U88A 4KF9A 1GTUA 3KH7A 5LD0A 2FY6A 3IPZA 2ALBA 5F06A 4TVEA 4IHUA 2GT5A 1RW1A 1FB0A 4O92A 4ZBBA 2C80A 3TGZA 1Z9HA 3HVVA 3UL3A 2NTOA 2YWNA 1XCCA 4CDOA 2FA4A 4L0UA 4KA0A 2H0GA 5F05A 3GTUB 3Q19A 5F0GA 3A2WA 1YY7A 4EDYA 1M99A 1J9BA 2C4JA 2HE3A 3C1RA 1OAZA 4O32A 2GGTA 4K0NA 3EWLA 3WGXA 4HQSA 1T00A 2WCIA 1SU9A 1AIUA 2AV4A 5KEJA 1KEBA 4Q5RA 1T8EB 1OE8A 10GSA 1X5DA 5EY6A 2KLXA 3IR4A 3IAS2 2L5OA 2LKUA 3UVHA 2CVBA 2LTKA 2FD3A 1SYRA 1YQ1A 3FMWA 1Z7PA 1OKTA 2H1AA 1GLQA 1K3YA 4Q5FA 2VCXA 4KW6A 1BQ7A 2N5BA 2GS3A 5D93A 4ZB9A 3TOTA 5G1KA 1PX7A 4EC0A 2L59A 3LW9A 5H5QA 1XBSA 4ZXGA 1F9MA 4MJBA 5L71A 5GAPD 1WOUA 5HR0A 3W8JA 4WR4A 2OADA 3FKFA 3P2AA 2HLSA 1QK8A 2FLSA 1M0UA 3D21A 5G31A 2V2GA 2VLTA 1BJXA 2KHPA 1UN2A 1A8YA 4J57E 1EV4A 4TXOA 2GSQA 1O85A 1QMVA 4A5PA 5ABRA 3DMLA 3KM6A 2B7JA 6GSSA 4MP4A 1S3DA 1XW6A 2A2PA 1FVKA 2L6DA 4I6XA 3DKSA 1JZOA 1FOVA 3G7IA 2JADA 1X9MB 4IGJA 3VFIA 1MTCA 2LRCA 1MEKA 3CQFA 1M3JA 1EEJA 1YZXA 2X8CA 1XIYA 5F07A 1KTEA 1IYHA 1Z7RA 1HQOA 1ZYQB 2GDRA 2XC2A 5D9WA 5DQSA 1WMJA 1ERVA 5HFKA 5HQPA 5FHIA 1ZGNA 4TR4A 5HR1A 2V6OA 3I9V2 4G0IA 4HUAA 3KGKA 3PINA 5J9BA 3FHKA 3M3MA 2YCDA 1JLVA 4RQRA 4MF5A 3GN3A 4E8EA 4OD7A 5J9CA 4TXOB 1ERTA 3ZLPA 5JCWA 2O89A 3EMXA 4MJAA 2YANA 4K0GA 4HJ2A 4DSSA 2XBQA 3HXSA 1XW9A 2H6XA 1EV9A 3QMXA 1JHBA 4K2DA 3HJMA 2R0CA 1FB6A 1PA3A 1AUCA 4O7HA 1ZYEA 5DDLA 2YV7A 4AJ7A 5AN1A 2H1BA 1QFNA 4QQ7A 1R26A 2K18A 3FYGA 2MMAA 4I2UA 3TJJA 2GSTA 4POBA 19GSA 4IP6A 4KCAA 1S3AA 3E9JB 2ZUPA 1EOHA 4POKA 4FO5A 3ZVJA 5IMFA 3TKSE 3LGCA 4RI6A 4WF5A 3ZFBA 1AW9A 4OWYA 1N8JA 2H71A 2FUG2 4WBJA 3VURA 1TI1A 4PUAA 5ECOB 2L57A 2VL2A 1K0MA 2CX4A 1GSSA 2L6CA 5E4WA 4BL7A 2CVDA 2H1GA 1PMTA 1E2YA 4YKFA 11GSA 2XBIA 2A2SA 4DSSB 2H72A 2H6YA 4ML6A 1SK2A 2MMOA 4CW9A 2X8GA 5KN1A 3RBTA 4MH2A 20GSA 1G7OA 5IMAA 3GX8A 3CYNA 3ZIVA 1CQGA 3H1NA 2BMXA 1BX9A 4HDEA 1PRXA 4MCUA 2WULA 2PVOC 1XVQA 3IC4A 3F3RA 2M80A 1ZOFA 2XHFA 4G0LA 3KJYA 2R4VA 2PU9C 3KCMA 4ZBDA 3J7Yb 3GSSA 2HRKA 3IHGA 3L0HA 3TJFA 4XTSA 1GULA 3QD9A 4BPYA 4ACSA 2QSIA 1WE0A 1M7TA 2EIRA 2P5RA 4N30A 4BL7B 5G1LA 2VD0A 2MBSA 4N0ZA 2DLXA 3FR3A 3CSJA 3GKXA 3J7Yk 4KUNA 2H01A 3DD3A 3L78A 1OC9A 4ZL7A 5A4VA 2I81A 1YDKA 5J4UA 1X9SB 2YWOA 2C0GA 2YV9A 3RHCA 3DIEA 2OKAA 4IJ3A 2PVQA 3BCIA 2HRNA 2YN1A 2DJJA 1SL1B 1B8XA 2B5EA 1TK5B 5A5KA 3GKNA 4PXOA 2R0PA 5B8AA 1ON4A 3K8NA 2PERA 3JCML 3E3EA 3TUEA 2GZYA 5DVBA 1O73A 3CSIA 4EKZA 2CT6A 3F9UA 5EPFA 5J3RA 4AJ6A 2WZ9A 3BJ5A 3DGQA 4F0CA 2F8AA 4O5UA 8GSSA 1OYJA 2LNTA 4IBPA 4V1Ag 5DALA 3GL5A 1GLPA 3TRQA 1OC9B 2F51A 4PNGA 2MMNA 1SJZA 1EP8A 1R5PA 2C3NA 2GTUA 3MAKA 5CAXA 1DBYA 2V1MA 3PH9A 5FWGA 3W8SA 1TP9A 4TXVA 5D96A 1U3IA 5ECQB 3FRCA 4ZBAA 1NHOA 4MF6A 4F9ZA 2AB6A 3IA1A 3KMOA 4KE3A 4BWQA 1TXXA 5IOWA 4ISDA 1MDIA 2HZFA 2H76A 2DJ0A 2K9FA 2VL2C 4XIHA 3HA9A 3UAPA 4MMMA 3U5RE 2H74A 4GF0A 2X49A 4MF7A 4NWYA 1ZL9A 3CSHA 1VF3A 2H19A 1Y25A 2IMIA 4TKYA 2VO4A 4IQAA 17GSA 5HFGA 3GNJA 5AISA 1SJ6A 6GSTA 5DALB 4NPBA 4KCEA 3M9JA 5JWQB 1B4PA 1XWBA 5IQYA 3N9JA 2FWFA 4MPFA 1VF2A 3DYRA 4LL1B 3ISOA 2H66A 2WJUA 4ULXA 2TRCP 3MWHA 4GTUA 3L4NA 3CRUA 4F82A 2PWJA 1O8WA 1VF1A 5DCGA 4HQZA 1KNGA 3HDCA 4KB3A 2VM1A 1FO5A 4RUVA 5JCUA 2GSSA 2IMEA 3D4TA 2CV4A 1ERUA 3LQ7A 5CYYA 3H8QA 4XS4A 1TRUA 3F3QA 4X0XA 3HVNA 5IMDA 4JBBA 2DMLA 2C0DA 5DQYA 4HSCX 4MH3A 4GLTA 5H5SA 1A24A 4J2FA 3VLNA 2L5LA 1F37A 2EIOA 4Z2TA 2HNLA 3EU3A 3ERGA 4EE0A 3R2QA 4Z2UA 2GQMA 4K6XA 4K5SA 2YZUA 3CXGA 3DEXA 5J5NA 4EVMA 2DMMA 3FY7A 1A2MA 1YJ6A 4KH7A 3QDNA 5GSSA 3P8WA 4HS1A 1I9DA 2GZPA 1U6TA 2J9HA 2F8FA 3UBLA 1XWCA 3QPMA 5B7CA 2HZEA 1XFLA 3UJ1A 3ZYWA 5GZZB 2QA1A 2RIIA 1PFOA 2KP2A 3GKMA 5CNWA 1YF0A 5ID2A 2IMDA 4L5OA 3GFKA 3DXBA 5ECRB 4X1UA 2NDOA 1ERWA 2JACA 1FW1A 4XS4B 5IM9A 4OFNA 1EOGA 4ZB8A 1R5AA 2X99A 1A0FA 1SJIA 3HKRA 3D6IA 1K0BA 4I8BA 1M2BA 4MK3A 4EIQA 4GSNA 1TK0B 12GSA 3TJBA 4JE1A 3PR8A 1ST9A 3GURA 5D9VA 3KTBA 4WF4A 2TRXA 4MJEA 3F8UA 3C1SA 3GH6A 3VI5A 4K2XA 2B3SA 3KZQA 3ZFLA 1TK8B 2KUCA 3M1GA 2HZEB 1YKAA 2H8LA 3QOUA 1PL1A 1NSWA 3D0ZA 4L0WA 1GL8A 3EPTA 1T4ZA 1K0AA 1K0NA 1WWJA 3RPPA 2C0EA 1WJKA 5IO0A 1PN0A 1E6BA 4TN8A 3US3A 5ID2B 3TJGA 1TRVA 4USSA 1FG4A 2KOKA 4V2MA 1ABAA 2OE1A 1Z5YE 3F6FA 3MNGA 1FHEA 1SL2B 2YPMA 1ML6A 3I43A 3F0IA 5CRWA 2PUKC 2N5AA 3L9VA 2R37A 2VUPA 1K0CA 3G9BA 3KIJA 2V6KA 1PD21 2FWHA 4KGIA 4HEA2 6GSWA 3WYWA 2IFQA 5ECHB 3BOAA 1Q4JA 1JZDA 5ELGA 3CMIA 2YOIA 3APSA 3U6VA 2VCVA 3VK9A 4ECCA 2HSHA 4POMA 4KSOA 2I3YA 4ECIA 3RPNA 4JR4A 2KP1A 1W4VA 3ED3A 1GNEA 2A2RA 4GQFA 2QC7A 1XWKA 1SL0B 4WBRD 3QAGA 4N0VA 5ECIB 1HNBA 3ZZXA 3LXZA 3KD0A 1TRWA 1F6MC 3KP9A 1GSDA 4FIWA 4L8EA 1PGTA 4TRXA 5ECLB 4RQXA 2H73A 1GSQA 1XOBA 4KDUA 3L9SA 2UZ8A 4AGSA 2R3XA 3A2VA 4GQCA 1BEDA 1GP1A 3HY2A 2RM5A 1T3BA 2I4AA 4YQVA 4IJIA 2IFQB 3F4RA 3N5OA 1RK4A 3IXRA 16GSA 2CAIA 2F9SA 4NAXA 5HFIA 14GSA 4TR1A 2AYTA 3GHAA 2N5FA 2JZSA 2ES7A 3EC3A 4IS0A 3MSZA 1G6WA 4WKWA 1HD2A 1X9WB 5EVOA 3EVIA 4F03A 1GSEA 4KSMA 1AC1A 4GRFA 1OVNA 4G19A 1JZRA 3IC8A 2X4AA 3LEFA 2DKHA 1TTZA 2VLVA 1K0OA 3IHQA 2OBIA 1TJDA 1XPVA 2L4QA 4JRRA 4O5RA 4PQ1A 4HJMA 4MZCA 3ZITA 2B7KA 4OCFA 4ID0A 4DSQA 2LJKA 4TR3A 1IYIA 1SK1A 3IE3A 4GSTA 4JU5A 2GSRA 3GMFA 1MDKA 4GSSA 2GVPA 5G5EA 2P5QA 3ZIJA 3H93A 3A5WA 4GCIA 1ZCPA 2D2ZA 1U3AA 1ACVA 2VIMA 1C72A 1XVWA 1WP0A 2IPAA 2M46A 3APOA 5B6MA 1M2DA 3KEBA 1K3OA 4AJ8A 3OR5A 3CRTA 4QL9A 4OO4A 5JWRB 3HZ8A 4WR5A 4WXTA 4Q5NA 1BG5A 3FR6A 4LL4B 1W89A 4TR1B 3GV1A 2VLUA 3VWWA 2AUVA 4EF0A 2QA2A 2YJHA 2G0FA 1AQWA 5AIVA 3IV4A 4WETA 2FGXA 4ICYA 1XW5A 3ZVJD 2JZRA 2LS5A 2C0FA 3FZ5A 3QAVA 3TRPA 5IMCA 4OO5A 1VRSD 4ZIJA 4MA9A 1OC8A 3ZTLA 3UBKA 2DIZA 2H6ZA 3EURA 4K7IA 4NXIA 2AJQB 3O6TA 1S3RA 2VL3A 1Y6EA 3F4TA 3ZMKA 4TOPA 3QCPA 3Q74A 5AGYA 3IK9A 2XPDA 1EGRA 3LJRA 3BBYA 3C7MA 1AQXA 4EO3A 4XS6A 2GZZA 1PKWA 3M0FA 1EGOA 3GRXA 4Z7XA 4YQMA 3VPQA 9GSSA 1EP7A 2X64A 1OE7A 2P0GA 1UVZA 1MDJA 1O6JA 4L5LA 3MIXA 5CP1A 1YEXA 3HYPA 1QGVA 3E0UA 1EEMA 3ME8A 2ON7A 5D8IA 4FYBA 5IOXA 5GAND 1LJRA 2NPBA 1G6YA 1OKDA 2VCTA 4NHWA 3HJOA 2JU5A 2YWMA 2K8SA 3KTLA 2DJ2A 2P31A 3RDWA 2FNOA 1LU4A 3HD5A 1LBKA 1GTBA 3F6DA 4JEDA 4NMUA 1SK0A 2QGVA 5DAKA 4POLA 1GNWA 1R7HA 2V41A 2WGRA 4OCEA
chains in the Genus database with same CATH topology
3CBUA 5IMZA 3UIWA 1GWCA 1K0DA 2DJKA 5AIXA 2DBCA 2F3MA 2CQ9A 2DKIA 3GKKA 3M8NA 4LLRA 3GYKA 2BTOT 1QUWA 2HSYA 3A2XA 3HJPA 2YP6A 3GH9A 3C71A 5D73A 4E8HA 3O3TA 3ERFA 1NW2A 3FEUA 4K8MA 1NHYA 3HHVA 4G10A 5HR2A 2H0HA 5C04A 4MDCA 4MPGA 1HNAA 1ZZYA 4BVXA 4KNDA 2FHEA 2LUSA 1B9XC 3A3TA 3V1WA 5ECMB 4KX4A 5ECKB 5CRDA 1TI3A 4ECJA 5DAKB 2GQKA 4PQHA 2ZCTA 4OMVA 2IN3A 4ML1A 2RLIA 1I5GA 3KH9A 1V40A 4IW9A 1SKRB 2JL4A 3WGDA 5JWOB 3FZ9A 1XZOA 4EIPA 4N11A 2LRTA 1OC3A 1T1VA 3KP8A 2H1DA 1THXA 3UMAA 1SKSB 2C3TA 4MLYA 2EIQA 3UARA 5KN0A 4MJCA 6GSUA 1UC7A 4JR6A 4PUFC 1JFUA 2DJ3A 2J23A 5LNKe 1R4WA 4PGTA 1XOAA 3MYDA 5IO2A 4BVXB 2XPEA 2OA7A 3KMNA 3NOFA 3M9KA 3CTGA 3L9UA 5DCHA 5KN2A 1ZYPA 2GQLA 5ELAA 3EE2A 5IIZA 5FT3A 2OE0A 4P3YB 1EZKA 2YJ7A 1URMA 2JSZA 1ILOA 3D4MA 4YQUA 1GUHA 4K7OA 2RUEA 1MD3A 1M2AA 1B9YC 2FA8A 3EINA 4MABA 5J41A 1V2AA 1QQ2A 4Z2RA 4LA1A 2H0IA 3DRNA 2YWIA 1G7EA 2A4HA 1ZYNA 3SBCA 2NVLA 4FYCA 5DBQA 1BAYA 5G5FA 2HRAA 4D73A 4XRDA 3IBHA 3D22A 3TOUA 3IAM2 4YH2A 2O85A 6GSYA 1GRXA 1MD4A 5G2ZA 6GSVA 3NZNA 2PPTA 1TU8A 4DVCA 2MBTA 1A2JA 4FH8A 5BRTA 1FOHA 4KAEA 5D9XA 6GSXA 3APQA 1GUMA 3S9FA 2MMZA 4MNNA 4PX1A 4I5QA 3EMPA 2HFDA 3ERWA 3DWVA 4K1FA 3TCOA 3WGEA 1AAZA 2VM2A 4PQIA 3SWLA 4G9HA 1SKWB 5ECPB 1AQVA 1Z6MA 4DSRA 2TIRA 3I6AA 2WRTA 4PTSA 4DEJA 2R0GA 3LYPA 3G7YA 2JZTA 3GSTA 4D73B 1XWAA 2G2QA 1TKDB 3IOSA 3GIXA 1SENA 4NV2A 1WIKA 1EWXA 3I69A 2AHEA 2B6MA 3WT1A 3QAWA 3ZL5A 1Q98A 1HYUA 5INYA 1J08A 4IELA 4XHMA 1M9BA 2H75A 1PL2A 2C8UA 3GL3A 3GUSA 2L4CA 3TJKA 4GWRA 1ZMAA 3LWAA 2A4VA 4IKHA 1TOFA 4IN0A 3VWVA 5EL8A 3UVTA 4NHZA 4CY6A 3ZREA 4CHSA 1H4OA 1PSQA 4V2LA 1SD8A 2X8HA 3HVXA 3P90A 1Z6NA 3LXTA 1DE2A 2HI7A 1TU7A 2REMA 2VOCA 4K9ZA 1GTAA 4NV5A 4TW5A 1GUKA 3D5JA 1J0FA 4YAVA 2AAWA 2CX3A 1THOA 1CQHA 5IPGA 1WRYA 1PX6A 5IMVA 2E0QA 3LYKA 4XS1A 2HRFA 3GX0A 7GSSA 1GH2A 3FK8A 4YAPA 2DC5A 1V57A 1YF1A 3H79A 5E59A 4EDZA 18GSA 2LSTA 1Z3EA 3EYTA 1XWGA 3PPUA 2IMKA 3UEMA 1QXHA 4K5RA 4ZL8A 3RHBA 3CTFA 3QFAC 2R6KA 3O76A 1FVJA 4BVYA 5KOXA 2M72A 2Z9SA 5A4UA 4EUYA 1V98A 1PN9A 3TRXA 2QKEA 4J56E 1B4QA 1A0RP 2LRNA 13GSA 2LJRA 4HU9A 3G7JA 5HR3A 2PN8A 5CO3A 4IVFA 4YKGA 1F3BA 1DSBA 2O87A 3ZMLA 1YKCA 4XCSA 5GSTA 2OACA 2E2GA 5DJLA 1PQNA 1M9AA 4HU7A 1VGLA 1F2EA 4IQ1A 1WPIA 5B8BA 5CRHA 4PNFA 5A4WA 3LSZA 2PMTA 3QFBC 5ECNB 2HT9A 4WEYA 3A5IA 4G0KA 3R3EA 1GSUA 2WFCA 5H5RA 3NIVA 1A2LA 2ZNMA 2WS2A 4ECBA 4MZBA 2HXKA 3LG6A 1XXUA 1K3LA 2B1KA 2LV3A 2OBKA 2FWGA 5D9TA 2YZHA 2R2JA 3HCZA 1UA5A 1B48A 3TKSA 2K8VA 1V9WA 3VPTA 4BVYB 3VI7A 2B5YA 1VF4A 2DSAA 5LCZA 3FZ4A 3UOMA 1RQMA 1BYEA 3RAZA 2DJ1A 1X5CA 4BA7A 3TKRA 5COHA 1HNCA 3TKQA 3PGTA 3WD6A 3F63A 3HVSA 1DE1A 4HZ4A 2H30A 3Q6OA 3C8EA 1YEPA 5B6NA 2LEGA 3DVWA 5ECSA 3C73A 3ME7A 1TRSA 4Q5QA 1KBNA 3TKPA 4V1Ap 3Q18A 2IIYA 1TDIA 3LORA 4HZ2A 3IK7A 3QR6A 3IDVA 2OJLA 2B1LA 2IMFA 5DJMA 2FWEA 3MDKA 3TDGA 5CRGA 2CVKA 3WT2A 5C00A 2VAFA 2HYXA 2LNSA 2RUFA 1GTIA 5KOWA 4IP1A 4LMWA 2CZ2A 2LQOA 1JZWA 4F2IA 2E2MA 4X4JA 5JCGA 1A23A 4KDYA 1H75A 3VWXA 1N2AA 2WDUA 3P7XA 1TW9A 1JLWA 1GSYA 4OFTA 2IL3A 1X0RA 1V58A 4X43A 2MYGA 2IJYA 2GLRA 5BMUA 4OFMA 3EU4A 2LJAA 1X5EA 2LQQA 2VCQA 2H70A 3BD2A 3H4KA 1NM3A 2NBSA 4EL1A 1SYXA 1GSFA 2HSMA 3VWUA 1PKZA 1O8XA 2K6VA 2R5GA 2EC4A 4XRAA 3TB2A 2IWTA 4LMVA 4K7NA 4RI7A 2FCHA 4H86A 2ON5A 2YNXA 2CAQA 2I9HA 3LFLA 4F0BA 4BWSA 1U87A 2C3QA 4AF2A 2CZ3A 4I2TA 1FAAA 2I1UA 3AY8A 4FYUA 3FW2A 2PGTA 3FZAA 1USBA 2CA8A 2DIYA 4O5QA 1O81A 3GA4A 2OE3A 4V2NA 1SD9A 3IRAA 4G2EA 2MZCA 2VCWA 2C1YA 4I97A 1G0TA 2PBJA 2O8VB 4HI7A 4PURA 3ZRDA 2RM6A 2VCZA 3F4SA 2E7PA 4EXJA 1S3CA 4ZB6A 3FR9A 4QL7A 3GTUA 1F3AA 1DUGA 4JZQA 1A8LA 4TR0A 2BJXA 3W6GA 4ILFA 1AXDA 3HZ4A 1T7PB 4HOJA 5IPHA 4CY8A 5CREA 2VD1A 3TKSC 4N10A 4ZL9A 4FQUA 3KXOA 4GXZA 4KDXA 3DVXA 5KN3A 2VL9A 5G30A 2O7KA 4MZWA 2V32A 5ENUA 2GT6A 1O7UA 2JSYA 1T4YA 4ZILA 2B5XA 2WB9A 3BCKA 5F8BA 22GSA 1U88A 4KF9A 1GTUA 3KH7A 5LD0A 2FY6A 3IPZA 2ALBA 5F06A 4TVEA 4IHUA 2GT5A 1RW1A 1FB0A 4O92A 4ZBBA 2C80A 3TGZA 1Z9HA 3HVVA 3UL3A 2NTOA 2YWNA 1XCCA 4CDOA 2FA4A 4L0UA 4KA0A 2H0GA 5F05A 3GTUB 3Q19A 5F0GA 3A2WA 1YY7A 4EDYA 1M99A 1J9BA 2C4JA 2HE3A 3C1RA 1OAZA 4O32A 2GGTA 4K0NA 3EWLA 3WGXA 4HQSA 1T00A 2WCIA 1SU9A 1AIUA 2AV4A 5KEJA 1KEBA 4Q5RA 1T8EB 1OE8A 10GSA 1X5DA 5EY6A 2KLXA 3IR4A 3IAS2 2L5OA 2LKUA 3UVHA 2CVBA 2LTKA 2FD3A 1SYRA 1YQ1A 3FMWA 1Z7PA 1OKTA 2H1AA 1GLQA 1K3YA 4Q5FA 2VCXA 4KW6A 1BQ7A 2N5BA 2GS3A 5D93A 4ZB9A 3TOTA 5G1KA 1PX7A 4EC0A 2L59A 3LW9A 5H5QA 1XBSA 4ZXGA 1F9MA 4MJBA 5L71A 5GAPD 1WOUA 5HR0A 3W8JA 4WR4A 2OADA 3FKFA 3P2AA 2HLSA 1QK8A 2FLSA 1M0UA 3D21A 5G31A 2V2GA 2VLTA 1BJXA 2KHPA 1UN2A 1A8YA 4J57E 1EV4A 4TXOA 2GSQA 1O85A 1QMVA 4A5PA 5ABRA 3DMLA 3KM6A 2B7JA 6GSSA 4MP4A 1S3DA 1XW6A 2A2PA 1FVKA 2L6DA 4I6XA 3DKSA 1JZOA 1FOVA 3G7IA 2JADA 1X9MB 4IGJA 3VFIA 1MTCA 2LRCA 1MEKA 1EEJA 1YZXA 2X8CA 1XIYA 5F07A 1KTEA 1IYHA 1Z7RA 1HQOA 1ZYQB 2GDRA 2XC2A 5D9WA 5DQSA 1WMJA 1ERVA 5HFKA 5HQPA 5FHIA 1ZGNA 4TR4A 5HR1A 2V6OA 3I9V2 4G0IA 4HUAA 3KGKA 3PINA 5J9BA 3FHKA 3M3MA 2YCDA 1JLVA 4RQRA 4MF5A 3GN3A 4E8EA 4OD7A 5J9CA 4TXOB 1ERTA 3ZLPA 5JCWA 2O89A 3EMXA 4MJAA 2YANA 4K0GA 4HJ2A 4DSSA 2XBQA 3HXSA 1XW9A 2H6XA 1EV9A 3QMXA 1JHBA 4K2DA 3HJMA 2R0CA 1FB6A 1PA3A 1AUCA 4O7HA 1ZYEA 5DDLA 2YV7A 4AJ7A 5AN1A 2H1BA 1QFNA 4QQ7A 1R26A 2K18A 3FYGA 2MMAA 4I2UA 3TJJA 2GSTA 4POBA 19GSA 4IP6A 4KCAA 1S3AA 3E9JB 2ZUPA 1EOHA 4POKA 4FO5A 3ZVJA 5IMFA 3TKSE 3LGCA 4RI6A 4WF5A 3ZFBA 1AW9A 4OWYA 1N8JA 2H71A 2FUG2 4WBJA 3VURA 1TI1A 4PUAA 5ECOB 2L57A 2VL2A 1K0MA 2CX4A 1GSSA 2L6CA 5E4WA 4BL7A 2CVDA 2H1GA 1PMTA 1E2YA 4YKFA 11GSA 2XBIA 2A2SA 4DSSB 2H72A 2H6YA 4ML6A 1SK2A 2MMOA 4CW9A 2X8GA 5KN1A 3RBTA 4MH2A 20GSA 1G7OA 5IMAA 3GX8A 3CYNA 3ZIVA 1CQGA 3H1NA 2BMXA 1BX9A 4HDEA 1PRXA 4MCUA 2WULA 2PVOC 1XVQA 3IC4A 3F3RA 2M80A 1ZOFA 2XHFA 4G0LA 3KJYA 2R4VA 2PU9C 3KCMA 4ZBDA 3J7Yb 3GSSA 2HRKA 3IHGA 3L0HA 3TJFA 4XTSA 1GULA 3QD9A 4BPYA 4ACSA 2QSIA 1WE0A 1M7TA 2EIRA 2P5RA 4N30A 4BL7B 5G1LA 2VD0A 2MBSA 4N0ZA 2DLXA 3FR3A 3CSJA 3GKXA 3J7Yk 4KUNA 2H01A 3DD3A 3L78A 1OC9A 4ZL7A 5A4VA 2I81A 1YDKA 5J4UA 1X9SB 2YWOA 2C0GA 2YV9A 3RHCA 3DIEA 2OKAA 4IJ3A 2PVQA 3BCIA 2HRNA 2YN1A 2DJJA 1SL1B 1B8XA 2B5EA 1TK5B 5A5KA 3GKNA 4PXOA 2R0PA 5B8AA 1ON4A 3K8NA 2PERA 3JCML 3E3EA 3TUEA 2GZYA 5DVBA 1O73A 3CSIA 4EKZA 2CT6A 3F9UA 5EPFA 5J3RA 4AJ6A 2WZ9A 3BJ5A 3DGQA 4F0CA 2F8AA 4O5UA 8GSSA 1OYJA 2LNTA 4IBPA 4V1Ag 5DALA 3GL5A 1GLPA 3TRQA 1OC9B 2F51A 4PNGA 2MMNA 1SJZA 1EP8A 1R5PA 2C3NA 2GTUA 3MAKA 5CAXA 1DBYA 2V1MA 3PH9A 5FWGA 3W8SA 1TP9A 4TXVA 5D96A 1U3IA 5ECQB 3FRCA 4ZBAA 1NHOA 4MF6A 4F9ZA 2AB6A 3IA1A 3KMOA 4KE3A 4BWQA 1TXXA 5IOWA 4ISDA 1MDIA 2HZFA 2H76A 2DJ0A 2K9FA 2VL2C 4XIHA 3HA9A 3UAPA 4MMMA 3U5RE 2H74A 4GF0A 2X49A 4MF7A 4NWYA 1ZL9A 3CSHA 1VF3A 2H19A 1Y25A 2IMIA 4TKYA 2VO4A 4IQAA 17GSA 5HFGA 3GNJA 5AISA 1SJ6A 6GSTA 5DALB 4NPBA 4KCEA 3M9JA 5JWQB 1B4PA 1XWBA 5IQYA 3N9JA 2FWFA 4MPFA 1VF2A 3DYRA 4LL1B 3ISOA 2H66A 2WJUA 4ULXA 2TRCP 3MWHA 4GTUA 3L4NA 3CRUA 4F82A 2PWJA 1O8WA 1VF1A 5DCGA 4HQZA 1KNGA 3HDCA 4KB3A 2VM1A 1FO5A 4RUVA 5JCUA 2GSSA 2IMEA 3D4TA 2CV4A 1ERUA 3LQ7A 5CYYA 3H8QA 4XS4A 1TRUA 3F3QA 4X0XA 5IMDA 4JBBA 2DMLA 2C0DA 5DQYA 4MH3A 4GLTA 5H5SA 1A24A 4J2FA 3VLNA 2L5LA 1F37A 2EIOA 4Z2TA 2HNLA 3EU3A 3ERGA 4EE0A 3R2QA 4Z2UA 2GQMA 4K6XA 4K5SA 2YZUA 3CXGA 3DEXA 5J5NA 4EVMA 2DMMA 3FY7A 1A2MA 1YJ6A 4KH7A 3QDNA 5GSSA 3P8WA 4HS1A 1I9DA 2GZPA 1U6TA 2J9HA 2F8FA 3UBLA 1XWCA 3QPMA 5B7CA 2HZEA 1XFLA 3UJ1A 3ZYWA 5GZZB 2QA1A 2RIIA 2KP2A 3GKMA 5CNWA 1YF0A 5ID2A 2IMDA 4L5OA 3GFKA 3DXBA 5ECRB 4X1UA 2NDOA 1ERWA 2JACA 1FW1A 4XS4B 5IM9A 4OFNA 1EOGA 4ZB8A 1R5AA 2X99A 1A0FA 1SJIA 3HKRA 3D6IA 1K0BA 4I8BA 1M2BA 4MK3A 4EIQA 4GSNA 1TK0B 12GSA 3TJBA 4JE1A 3PR8A 1ST9A 3GURA 5D9VA 3KTBA 4WF4A 2TRXA 4MJEA 3F8UA 3C1SA 3GH6A 3VI5A 4K2XA 2B3SA 3KZQA 3ZFLA 1TK8B 2KUCA 3M1GA 2HZEB 1YKAA 2H8LA 3QOUA 1PL1A 1NSWA 3D0ZA 4L0WA 1GL8A 3EPTA 1T4ZA 1K0AA 1K0NA 1WWJA 3RPPA 2C0EA 1WJKA 5IO0A 1PN0A 1E6BA 4TN8A 3US3A 5ID2B 3TJGA 1TRVA 4USSA 1FG4A 2KOKA 4V2MA 1ABAA 2OE1A 1Z5YE 3F6FA 3MNGA 1FHEA 1SL2B 2YPMA 1ML6A 3I43A 3F0IA 5CRWA 2PUKC 2N5AA 3L9VA 2R37A 2VUPA 1K0CA 3G9BA 3KIJA 2V6KA 1PD21 2FWHA 4KGIA 4HEA2 6GSWA 3WYWA 2IFQA 5ECHB 3BOAA 1Q4JA 1JZDA 5ELGA 3CMIA 2YOIA 3APSA 3U6VA 2VCVA 3VK9A 4ECCA 2HSHA 4POMA 4KSOA 2I3YA 4ECIA 3RPNA 4JR4A 2KP1A 1W4VA 3ED3A 1GNEA 2A2RA 4GQFA 2QC7A 1XWKA 1SL0B 4WBRD 3QAGA 4N0VA 5ECIB 1HNBA 3ZZXA 3LXZA 3KD0A 1TRWA 1F6MC 3KP9A 1GSDA 4FIWA 4L8EA 1PGTA 4TRXA 5ECLB 4RQXA 2H73A 1GSQA 1XOBA 4KDUA 3L9SA 2UZ8A 4AGSA 2R3XA 3A2VA 4GQCA 1BEDA 1GP1A 3HY2A 2RM5A 1T3BA 2I4AA 4YQVA 4IJIA 2IFQB 3F4RA 3N5OA 1RK4A 3IXRA 16GSA 2CAIA 2F9SA 4NAXA 5HFIA 14GSA 4TR1A 2AYTA 3GHAA 2N5FA 2JZSA 2ES7A 3EC3A 4IS0A 3MSZA 1G6WA 4WKWA 1HD2A 1X9WB 5EVOA 3EVIA 4F03A 1GSEA 4KSMA 1AC1A 4GRFA 1OVNA 4G19A 1JZRA 3IC8A 2X4AA 3LEFA 2DKHA 1TTZA 2VLVA 1K0OA 3IHQA 2OBIA 1TJDA 1XPVA 2L4QA 4JRRA 4O5RA 4PQ1A 4HJMA 4MZCA 3ZITA 2B7KA 4OCFA 4ID0A 4DSQA 2LJKA 4TR3A 1IYIA 1SK1A 3IE3A 4GSTA 4JU5A 2GSRA 3GMFA 1MDKA 4GSSA 2GVPA 5G5EA 2P5QA 3ZIJA 3H93A 3A5WA 4GCIA 1ZCPA 2D2ZA 1U3AA 1ACVA 2VIMA 1C72A 1XVWA 1WP0A 2IPAA 2M46A 3APOA 5B6MA 1M2DA 3KEBA 1K3OA 4AJ8A 3OR5A 3CRTA 4QL9A 4OO4A 5JWRB 3HZ8A 4WR5A 4WXTA 4Q5NA 1BG5A 3FR6A 4LL4B 1W89A 4TR1B 3GV1A 2VLUA 3VWWA 2AUVA 4EF0A 2QA2A 2YJHA 2G0FA 1AQWA 5AIVA 3IV4A 4WETA 2FGXA 4ICYA 1XW5A 3ZVJD 2JZRA 2LS5A 2C0FA 3FZ5A 3QAVA 3TRPA 5IMCA 4OO5A 1VRSD 4ZIJA 4MA9A 1OC8A 3ZTLA 3UBKA 2DIZA 2H6ZA 3EURA 4K7IA 4NXIA 2AJQB 3O6TA 2VL3A 1Y6EA 3F4TA 3ZMKA 4TOPA 3QCPA 3Q74A 5AGYA 3IK9A 2XPDA 1EGRA 3LJRA 3BBYA 3C7MA 1AQXA 4EO3A 4XS6A 2GZZA 1PKWA 3M0FA 1EGOA 3GRXA 4Z7XA 4YQMA 3VPQA 9GSSA 1EP7A 2X64A 1OE7A 2P0GA 1UVZA 1MDJA 1O6JA 4L5LA 3MIXA 5CP1A 1YEXA 3HYPA 1QGVA 3E0UA 1EEMA 3ME8A 2ON7A 5D8IA 4FYBA 5IOXA 5GAND 1LJRA 2NPBA 1G6YA 1OKDA 2VCTA 4NHWA 3HJOA 2JU5A 2YWMA 2K8SA 3KTLA 2DJ2A 2P31A 3RDWA 2FNOA 1LU4A 3HD5A 1LBKA 1GTBA 3F6DA 4JEDA 4NMUA 1SK0A 2QGVA 5DAKA 4POLA 1GNWA 1R7HA 2V41A 2WGRA 4OCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CBU A;  5IMZ A;  3UIW A;  1GWC A;  1K0D A;  2DJK A;  5AIX A;  2DBC A;  2F3M A;  2CQ9 A;  3GKK A;  3M8N A;  4LLR A;  3GYK A;  2BTO T;  1QUW A;  2HSY A;  3A2X A;  3HJP A;  2YP6 A;  3GH9 A;  3C71 A;  5D73 A;  4E8H A;  3O3T A;  3ERF A;  1NW2 A;  3FEU A;  4K8M A;  1NHY A;  3HHV A;  4G10 A;  5HR2 A;  2H0H A;  5C04 A;  4MDC A;  4MPG A;  1HNA A;  1ZZY A;  4BVX A;  4KND A;  2FHE A;  2LUS A;  1B9X C;  3A3T A;  3V1W A;  5ECM B;  4KX4 A;  5ECK B;  5CRD A;  1TI3 A;  4ECJ A;  5DAK B;  2GQK A;  4PQH A;  2ZCT A;  4OMV A;  2IN3 A;  4ML1 A;  2RLI A;  1I5G A;  3KH9 A;  1V40 A;  4IW9 A;  1SKR B;  2JL4 A;  3WGD A;  5JWO B;  3FZ9 A;  1XZO A;  4N11 A;  2LRT A;  1OC3 A;  1T1V A;  3KP8 A;  2H1D A;  1THX A;  3UMA A;  1SKS B;  2C3T A;  4MLY A;  2EIQ A;  3UAR A;  5KN0 A;  4MJC A;  6GSU A;  1UC7 A;  4JR6 A;  4PUF C;  1JFU A;  2DJ3 A;  2J23 A;  5LNK e;  1R4W A;  4PGT A;  1XOA A;  5IO2 A;  2XPE A;  2OA7 A;  3KMN A;  3NOF A;  3M9K A;  3CTG A;  3L9U A;  5DCH A;  5KN2 A;  2GQL A;  5ELA A;  3EE2 A;  5IIZ A;  5FT3 A;  2OE0 A;  4P3Y B;  1EZK A;  2YJ7 A;  1URM A;  2JSZ A;  1ILO A;  3D4M A;  4YQU A;  1GUH A;  4K7O A;  2RUE A;  1MD3 A;  1M2A A;  1B9Y C;  2FA8 A;  3EIN A;  4MAB A;  5J41 A;  1V2A A;  1QQ2 A;  4LA1 A;  2H0I A;  3DRN A;  2YWI A;  1G7E A;  3SBC A;  2NVL A;  4FYC A;  5DBQ A;  1BAY A;  5G5F A;  4D73 A;  4XRD A;  3IBH A;  3D22 A;  3TOU A;  3IAM 2;  4YH2 A;  2O85 A;  6GSY A;  1GRX A;  1MD4 A;  5G2Z A;  6GSV A;  3NZN A;  2PPT A;  1TU8 A;  4DVC A;  2MBT A;  1A2J A;  4FH8 A;  4KAE A;  5D9X A;  6GSX A;  3APQ A;  1GUM A;  3S9F A;  2MMZ A;  4PX1 A;  4I5Q A;  3EMP A;  2HFD A;  3ERW A;  3DWV A;  4K1F A;  3TCO A;  3WGE A;  1AAZ A;  2VM2 A;  4PQI A;  3SWL A;  4G9H A;  1SKW B;  5ECP B;  1AQV A;  1Z6M A;  4DSR A;  2TIR A;  3I6A A;  2WRT A;  4DEJ A;  3LYP A;  3G7Y A;  2JZT A;  3GST A;  4D73 B;  1XWA A;  2G2Q A;  1TKD B;  3IOS A;  3GIX A;  1SEN A;  4NV2 A;  1WIK A;  1EWX A;  3I69 A;  2AHE A;  2B6M A;  3WT1 A;  3QAW A;  3ZL5 A;  1Q98 A;  1HYU A;  5INY A;  1J08 A;  4IEL A;  4XHM A;  1M9B A;  2H75 A;  1PL2 A;  2C8U A;  3GL3 A;  3GUS A;  2L4C A;  3TJK A;  4GWR A;  1ZMA A;  3LWA A;  2A4V A;  4IKH A;  1TOF A;  4IN0 A;  3VWV A;  5EL8 A;  3UVT A;  4NHZ A;  3ZRE A;  4CHS A;  1H4O A;  1PSQ A;  4V2L A;  1SD8 A;  2X8H A;  3HVX A;  3P90 A;  1Z6N A;  3LXT A;  1DE2 A;  2HI7 A;  1TU7 A;  2REM A;  2VOC A;  4K9Z A;  1GTA A;  4NV5 A;  4TW5 A;  1GUK A;  3D5J A;  1J0F A;  4YAV A;  2AAW A;  2CX3 A;  1THO A;  1CQH A;  5IPG A;  1WRY A;  1PX6 A;  5IMV A;  2E0Q A;  3LYK A;  4XS1 A;  2HRF A;  3GX0 A;  7GSS A;  1GH2 A;  3FK8 A;  4YAP A;  2DC5 A;  1V57 A;  1YF1 A;  3H79 A;  5E59 A;  4EDZ A;  18GS A;  2LST A;  1Z3E A;  3EYT A;  1XWG A;  2IMK A;  3UEM A;  1QXH A;  4ZL8 A;  3RHB A;  3CTF A;  3QFA C;  2R6K A;  3O76 A;  1FVJ A;  4BVY A;  2M72 A;  2Z9S A;  5A4U A;  4EUY A;  1V98 A;  1PN9 A;  3TRX A;  2QKE A;  4J56 E;  1B4Q A;  1A0R P;  2LRN A;  13GS A;  2LJR A;  4HU9 A;  3G7J A;  5HR3 A;  2PN8 A;  5CO3 A;  4IVF A;  1F3B A;  1DSB A;  2O87 A;  3ZML A;  1YKC A;  4XCS A;  5GST A;  2OAC A;  2E2G A;  5DJL A;  1PQN A;  1M9A A;  4HU7 A;  1VGL A;  1F2E A;  4IQ1 A;  1WPI A;  5B8B A;  5CRH A;  4PNF A;  5A4W A;  3LSZ A;  2PMT A;  3QFB C;  5ECN B;  2HT9 A;  4WEY A;  1GSU A;  2WFC A;  5H5R A;  3NIV A;  1A2L A;  2ZNM A;  2WS2 A;  4ECB A;  4MZB A;  2HXK A;  3LG6 A;  1XXU A;  1K3L A;  2B1K A;  2LV3 A;  2OBK A;  2FWG A;  5D9T A;  2YZH A;  2R2J A;  3HCZ A;  1UA5 A;  1B48 A;  3TKS A;  2K8V A;  1V9W A;  3VPT A;  3VI7 A;  2B5Y A;  1VF4 A;  2DSA A;  5LCZ A;  3FZ4 A;  3UOM A;  1RQM A;  1BYE A;  3RAZ A;  2DJ1 A;  1X5C A;  4BA7 A;  3TKR A;  5COH A;  1HNC A;  3TKQ A;  3PGT A;  3WD6 A;  3F63 A;  3HVS A;  1DE1 A;  4HZ4 A;  2H30 A;  3Q6O A;  3C8E A;  1YEP A;  5B6N A;  2LEG A;  3DVW A;  5ECS A;  3C73 A;  3ME7 A;  1TRS A;  4Q5Q A;  1KBN A;  3TKP A;  4V1A p;  3Q18 A;  2IIY A;  1TDI A;  3LOR A;  4HZ2 A;  3IK7 A;  3QR6 A;  3IDV A;  2OJL A;  2B1L A;  2IMF A;  5DJM A;  2FWE A;  3MDK A;  3TDG A;  5CRG A;  2CVK A;  3WT2 A;  5C00 A;  2VAF A;  2HYX A;  2LNS A;  2RUF A;  1GTI A;  4IP1 A;  4LMW A;  2CZ2 A;  2LQO A;  1JZW A;  4F2I A;  2E2M A;  5JCG A;  1A23 A;  4KDY A;  1H75 A;  3VWX A;  1N2A A;  2WDU A;  3P7X A;  1TW9 A;  1JLW A;  1GSY A;  4OFT A;  2IL3 A;  1X0R A;  1V58 A;  4X43 A;  2MYG A;  2IJY A;  2GLR A;  4OFM A;  3EU4 A;  2LJA A;  1X5E A;  2LQQ A;  2VCQ A;  2H70 A;  3BD2 A;  3H4K A;  1NM3 A;  2NBS A;  4EL1 A;  1SYX A;  1GSF A;  3VWU A;  1PKZ A;  1O8X A;  2K6V A;  2R5G A;  2EC4 A;  4XRA A;  3TB2 A;  2IWT A;  4LMV A;  4K7N A;  4RI7 A;  2FCH A;  4H86 A;  2ON5 A;  2YNX A;  2CAQ A;  2I9H A;  3LFL A;  4F0B A;  4BWS A;  1U87 A;  2C3Q A;  4AF2 A;  2CZ3 A;  4I2T A;  1FAA A;  2I1U A;  3AY8 A;  4FYU A;  3FW2 A;  2PGT A;  3FZA A;  1USB A;  2CA8 A;  2DIY A;  1O81 A;  3GA4 A;  2OE3 A;  4V2N A;  1SD9 A;  3IRA A;  4G2E A;  2MZC A;  2VCW A;  2C1Y A;  4I97 A;  1G0T A;  2PBJ A;  2O8V B;  4HI7 A;  4PUR A;  3ZRD A;  2RM6 A;  2VCZ A;  3F4S A;  2E7P A;  4EXJ A;  1S3C A;  4ZB6 A;  3FR9 A;  4QL7 A;  3GTU A;  1F3A A;  1DUG A;  4JZQ A;  1A8L A;  4TR0 A;  2BJX A;  3W6G A;  4ILF A;  1AXD A;  3HZ4 A;  1T7P B;  4HOJ A;  5IPH A;  5CRE A;  2VD1 A;  3TKS C;  4N10 A;  4ZL9 A;  3KXO A;  4GXZ A;  4KDX A;  3DVX A;  5KN3 A;  2VL9 A;  5G30 A;  2O7K A;  4MZW A;  2V32 A;  5ENU A;  2GT6 A;  1O7U A;  2JSY A;  1T4Y A;  4ZIL A;  2B5X A;  2WB9 A;  3BCK A;  5F8B A;  22GS A;  1U88 A;  1GTU A;  3KH7 A;  5LD0 A;  2FY6 A;  3IPZ A;  2ALB A;  5F06 A;  4TVE A;  4IHU A;  2GT5 A;  1RW1 A;  1FB0 A;  4O92 A;  4ZBB A;  2C80 A;  3TGZ A;  1Z9H A;  3HVV A;  3UL3 A;  2NTO A;  2YWN A;  1XCC A;  4CDO A;  2FA4 A;  4L0U A;  4KA0 A;  2H0G A;  5F05 A;  3GTU B;  3Q19 A;  5F0G A;  3A2W A;  1YY7 A;  4EDY A;  1M99 A;  1J9B A;  2C4J A;  2HE3 A;  3C1R A;  1OAZ A;  4O32 A;  2GGT A;  4K0N A;  3EWL A;  3WGX A;  4HQS A;  1T00 A;  2WCI A;  1SU9 A;  1AIU A;  2AV4 A;  5KEJ A;  1KEB A;  4Q5R A;  1T8E B;  1OE8 A;  10GS A;  1X5D A;  5EY6 A;  2KLX A;  3IR4 A;  3IAS 2;  2L5O A;  2LKU A;  3UVH A;  2CVB A;  2LTK A;  2FD3 A;  1SYR A;  1YQ1 A;  1Z7P A;  1OKT A;  2H1A A;  1GLQ A;  1K3Y A;  4Q5F A;  2VCX A;  4KW6 A;  1BQ7 A;  2N5B A;  2GS3 A;  5D93 A;  4ZB9 A;  3TOT A;  5G1K A;  1PX7 A;  4EC0 A;  2L59 A;  5H5Q A;  1XBS A;  4ZXG A;  1F9M A;  4MJB A;  5L71 A;  5GAP D;  1WOU A;  5HR0 A;  3W8J A;  4WR4 A;  2OAD A;  3FKF A;  3P2A A;  2HLS A;  1QK8 A;  2FLS A;  1M0U A;  3D21 A;  5G31 A;  2V2G A;  2VLT A;  1BJX A;  2KHP A;  1UN2 A;  1A8Y A;  4J57 E;  1EV4 A;  4TXO A;  2GSQ A;  1O85 A;  1QMV A;  5ABR A;  3DML A;  3KM6 A;  2B7J A;  6GSS A;  4MP4 A;  1S3D A;  1XW6 A;  1FVK A;  2L6D A;  4I6X A;  3DKS A;  1JZO A;  1FOV A;  3G7I A;  2JAD A;  1X9M B;  4IGJ A;  3VFI A;  1MTC A;  2LRC A;  1MEK A;  1EEJ A;  1YZX A;  2X8C A;  1XIY A;  5F07 A;  1KTE A;  1IYH A;  1Z7R A;  1HQO A;  1ZYQ B;  2GDR A;  5DQS A;  5D9W A;  2XC2 A;  1WMJ A;  1ERV A;  5HFK A;  5HQP A;  5FHI A;  1ZGN A;  4TR4 A;  5HR1 A;  2V6O A;  3I9V 2;  4HUA A;  3KGK A;  3PIN A;  5J9B A;  3FHK A;  3M3M A;  2YCD A;  1JLV A;  4RQR A;  4MF5 A;  3GN3 A;  4E8E A;  4OD7 A;  5J9C A;  4TXO B;  1ERT A;  3ZLP A;  5JCW A;  2O89 A;  3EMX A;  4MJA A;  2YAN A;  4K0G A;  4HJ2 A;  4DSS A;  2XBQ A;  3HXS A;  1XW9 A;  2H6X A;  1EV9 A;  3QMX A;  1JHB A;  4K2D A;  3HJM A;  1FB6 A;  1PA3 A;  1AUC A;  4O7H A;  1ZYE A;  5DDL A;  2YV7 A;  4AJ7 A;  5AN1 A;  2H1B A;  1QFN A;  4QQ7 A;  1R26 A;  2K18 A;  3FYG A;  2MMA A;  4I2U A;  3TJJ A;  2GST A;  4POB A;  19GS A;  4IP6 A;  4KCA A;  1S3A A;  3E9J B;  2ZUP A;  1EOH A;  4POK A;  4FO5 A;  3ZVJ A;  5IMF A;  3TKS E;  3LGC A;  4RI6 A;  4WF5 A;  3ZFB A;  1AW9 A;  4OWY A;  1N8J A;  2H71 A;  2FUG 2;  4WBJ A;  3VUR A;  1TI1 A;  4PUA A;  5ECO B;  2L57 A;  2VL2 A;  1K0M A;  2CX4 A;  1GSS A;  2L6C A;  5E4W A;  4BL7 A;  2CVD A;  2H1G A;  1PMT A;  1E2Y A;  11GS A;  2XBI A;  2A2S A;  4DSS B;  2H72 A;  2H6Y A;  4ML6 A;  1SK2 A;  2MMO A;  4CW9 A;  2X8G A;  5KN1 A;  3RBT A;  4MH2 A;  20GS A;  1G7O A;  5IMA A;  3GX8 A;  3CYN A;  3ZIV A;  1CQG A;  3H1N A;  2BMX A;  1BX9 A;  4HDE A;  1PRX A;  4MCU A;  2WUL A;  2PVO C;  1XVQ A;  3IC4 A;  3F3R A;  2M80 A;  1ZOF A;  2XHF A;  3KJY A;  2R4V A;  2PU9 C;  3KCM A;  4ZBD A;  3J7Y b;  3GSS A;  3L0H A;  3TJF A;  4XTS A;  1GUL A;  3QD9 A;  4BPY A;  4ACS A;  2QSI A;  1WE0 A;  1M7T A;  2EIR A;  2P5R A;  4N30 A;  5G1L A;  2VD0 A;  2MBS A;  4N0Z A;  2DLX A;  3FR3 A;  3CSJ A;  3GKX A;  3J7Y k;  4KUN A;  2H01 A;  3DD3 A;  3L78 A;  1OC9 A;  4ZL7 A;  5A4V A;  2I81 A;  1YDK A;  5J4U A;  1X9S B;  2YWO A;  2C0G A;  2YV9 A;  3RHC A;  3DIE A;  2OKA A;  4IJ3 A;  2PVQ A;  3BCI A;  2HRN A;  2YN1 A;  2DJJ A;  1SL1 B;  1B8X A;  2B5E A;  1TK5 B;  5A5K A;  3GKN A;  4PXO A;  5B8A A;  1ON4 A;  3K8N A;  2PER A;  3JCM L;  3E3E A;  3TUE A;  2GZY A;  5DVB A;  1O73 A;  3CSI A;  4EKZ A;  2CT6 A;  3F9U A;  5EPF A;  5J3R A;  4AJ6 A;  2WZ9 A;  3BJ5 A;  3DGQ A;  4F0C A;  2F8A A;  8GSS A;  1OYJ A;  2LNT A;  4IBP A;  4V1A g;  5DAL A;  3GL5 A;  1GLP A;  3TRQ A;  1OC9 B;  2F51 A;  4PNG A;  2MMN A;  1SJZ A;  1EP8 A;  1R5P A;  2C3N A;  2GTU A;  3MAK A;  5CAX A;  1DBY A;  2V1M A;  3PH9 A;  5FWG A;  3W8S A;  1TP9 A;  4TXV A;  5D96 A;  1U3I A;  5ECQ B;  3FRC A;  4ZBA A;  1NHO A;  4MF6 A;  4F9Z A;  2AB6 A;  3IA1 A;  3KMO A;  4KE3 A;  4BWQ A;  1TXX A;  5IOW A;  4ISD A;  1MDI A;  2HZF A;  2H76 A;  2DJ0 A;  2K9F A;  2VL2 C;  4XIH A;  3HA9 A;  3UAP A;  4MMM A;  3U5R E;  2H74 A;  4GF0 A;  4MF7 A;  4NWY A;  1ZL9 A;  3CSH A;  1VF3 A;  2H19 A;  1Y25 A;  2IMI A;  4TKY A;  2VO4 A;  4IQA A;  17GS A;  5HFG A;  3GNJ A;  5AIS A;  1SJ6 A;  6GST A;  5DAL B;  4NPB A;  4KCE A;  3M9J A;  5JWQ B;  1B4P A;  1XWB A;  5IQY A;  3N9J A;  2FWF A;  4MPF A;  1VF2 A;  3DYR A;  4LL1 B;  3ISO A;  2H66 A;  2WJU A;  4ULX A;  2TRC P;  3MWH A;  4GTU A;  3L4N A;  3CRU A;  4F82 A;  2PWJ A;  1O8W A;  1VF1 A;  5DCG A;  4HQZ A;  1KNG A;  3HDC A;  4KB3 A;  2VM1 A;  1FO5 A;  4RUV A;  5JCU A;  2GSS A;  2IME A;  3D4T A;  2CV4 A;  1ERU A;  3LQ7 A;  5CYY A;  3H8Q A;  4XS4 A;  1TRU A;  3F3Q A;  4X0X A;  5IMD A;  4JBB A;  2DML A;  2C0D A;  5DQY A;  4MH3 A;  4GLT A;  5H5S A;  1A24 A;  4J2F A;  3VLN A;  2L5L A;  1F37 A;  2EIO A;  2HNL A;  3EU3 A;  3ERG A;  4EE0 A;  3R2Q A;  2GQM A;  4K6X A;  2YZU A;  3CXG A;  3DEX A;  5J5N A;  4EVM A;  2DMM A;  3FY7 A;  1A2M A;  1YJ6 A;  4KH7 A;  3QDN A;  5GSS A;  3P8W A;  4HS1 A;  1I9D A;  2GZP A;  1U6T A;  2J9H A;  2F8F A;  3UBL A;  1XWC A;  3QPM A;  5B7C A;  2HZE A;  1XFL A;  3UJ1 A;  3ZYW A;  5GZZ B;  2RII A;  2KP2 A;  3GKM A;  5CNW A;  1YF0 A;  5ID2 A;  2IMD A;  4L5O A;  3GFK A;  3DXB A;  5ECR B;  4X1U A;  2NDO A;  1ERW A;  2JAC A;  1FW1 A;  4XS4 B;  5IM9 A;  4OFN A;  1EOG A;  4ZB8 A;  1R5A A;  2X99 A;  1A0F A;  1SJI A;  3HKR A;  3D6I A;  1K0B A;  4I8B A;  1M2B A;  4MK3 A;  4GSN A;  1TK0 B;  12GS A;  3TJB A;  4JE1 A;  3PR8 A;  1ST9 A;  3GUR A;  5D9V A;  3KTB A;  4WF4 A;  2TRX A;  4MJE A;  3F8U A;  3C1S A;  3GH6 A;  3VI5 A;  2B3S A;  3KZQ A;  3ZFL A;  1TK8 B;  2KUC A;  3M1G A;  2HZE B;  1YKA A;  2H8L A;  3QOU A;  1PL1 A;  1NSW A;  3D0Z A;  4L0W A;  1GL8 A;  1T4Z A;  1K0A A;  1K0N A;  1WWJ A;  3RPP A;  2C0E A;  1WJK A;  5IO0 A;  1E6B A;  4TN8 A;  3US3 A;  5ID2 B;  3TJG A;  1TRV A;  1FG4 A;  2KOK A;  4V2M A;  1ABA A;  2OE1 A;  1Z5Y E;  3F6F A;  3MNG A;  1FHE A;  1SL2 B;  2YPM A;  1ML6 A;  3I43 A;  3F0I A;  5CRW A;  2PUK C;  2N5A A;  3L9V A;  2R37 A;  2VUP A;  1K0C A;  3G9B A;  3KIJ A;  2V6K A;  1PD2 1;  2FWH A;  4KGI A;  4HEA 2;  6GSW A;  3WYW A;  2IFQ A;  5ECH B;  3BOA A;  1Q4J A;  1JZD A;  5ELG A;  3CMI A;  2YOI A;  3APS A;  3U6V A;  2VCV A;  3VK9 A;  4ECC A;  2HSH A;  4POM A;  4KSO A;  2I3Y A;  4ECI A;  3RPN A;  4JR4 A;  2KP1 A;  1W4V A;  3ED3 A;  1GNE A;  2A2R A;  4GQF A;  2QC7 A;  1XWK A;  1SL0 B;  4WBR D;  3QAG A;  4N0V A;  5ECI B;  1HNB A;  3ZZX A;  3LXZ A;  3KD0 A;  1TRW A;  1F6M C;  3KP9 A;  1GSD A;  4FIW A;  4L8E A;  1PGT A;  4TRX A;  5ECL B;  4RQX A;  2H73 A;  1GSQ A;  1XOB A;  4KDU A;  3L9S A;  4AGS A;  2R3X A;  3A2V A;  4GQC A;  1BED A;  1GP1 A;  3HY2 A;  2RM5 A;  1T3B A;  2I4A A;  4YQV A;  4IJI A;  2IFQ B;  3F4R A;  3N5O A;  1RK4 A;  3IXR A;  16GS A;  2CAI A;  2F9S A;  4NAX A;  5HFI A;  14GS A;  4TR1 A;  2AYT A;  3GHA A;  2N5F A;  2JZS A;  2ES7 A;  3EC3 A;  4IS0 A;  3MSZ A;  1G6W A;  4WKW A;  1HD2 A;  1X9W B;  5EVO A;  3EVI A;  4F03 A;  1GSE A;  4KSM A;  1AC1 A;  4GRF A;  1OVN A;  4G19 A;  1JZR A;  3LEF A;  1TTZ A;  2VLV A;  1K0O A;  3IHQ A;  2OBI A;  1TJD A;  1XPV A;  2L4Q A;  4JRR A;  4O5R A;  4PQ1 A;  4HJM A;  4MZC A;  3ZIT A;  2B7K A;  4OCF A;  4ID0 A;  4DSQ A;  2LJK A;  4TR3 A;  1IYI A;  1SK1 A;  3IE3 A;  4GST A;  4JU5 A;  2GSR A;  3GMF A;  1MDK A;  4GSS A;  2GVP A;  5G5E A;  2P5Q A;  3ZIJ A;  3H93 A;  3A5W A;  4GCI A;  1ZCP A;  2D2Z A;  1U3A A;  1ACV A;  2VIM A;  1C72 A;  1XVW A;  1WP0 A;  2IPA A;  2M46 A;  3APO A;  5B6M A;  1M2D A;  3KEB A;  1K3O A;  4AJ8 A;  3OR5 A;  3CRT A;  4QL9 A;  4OO4 A;  5JWR B;  3HZ8 A;  4WR5 A;  4WXT A;  4Q5N A;  1BG5 A;  3FR6 A;  4LL4 B;  1W89 A;  4TR1 B;  3GV1 A;  2VLU A;  3VWW A;  2AUV A;  4EF0 A;  2YJH A;  2G0F A;  1AQW A;  5AIV A;  3IV4 A;  4WET A;  2FGX A;  1XW5 A;  3ZVJ D;  2JZR A;  2LS5 A;  2C0F A;  3FZ5 A;  3QAV A;  3TRP A;  5IMC A;  4OO5 A;  1VRS D;  4ZIJ A;  4MA9 A;  1OC8 A;  3ZTL A;  3UBK A;  2DIZ A;  2H6Z A;  3EUR A;  4K7I A;  4NXI A;  2AJQ B;  3O6T A;  2VL3 A;  1Y6E A;  3F4T A;  3ZMK A;  4TOP A;  3QCP A;  3Q74 A;  5AGY A;  3IK9 A;  2XPD A;  1EGR A;  3LJR A;  3BBY A;  3C7M A;  1AQX A;  4EO3 A;  4XS6 A;  2GZZ A;  1PKW A;  3M0F A;  1EGO A;  3GRX A;  4Z7X A;  4YQM A;  3VPQ A;  9GSS A;  1EP7 A;  2X64 A;  1OE7 A;  2P0G A;  1UVZ A;  1MDJ A;  1O6J A;  4L5L A;  5CP1 A;  1YEX A;  3HYP A;  1QGV A;  3E0U A;  1EEM A;  3ME8 A;  2ON7 A;  5D8I A;  4FYB A;  5IOX A;  5GAN D;  1LJR A;  2NPB A;  1G6Y A;  1OKD A;  2VCT A;  4NHW A;  3HJO A;  2JU5 A;  2YWM A;  2K8S A;  3KTL A;  2DJ2 A;  2P31 A;  3RDW A;  2FNO A;  1LU4 A;  3HD5 A;  1LBK A;  1GTB A;  3F6D A;  4JED A;  4NMU A;  1SK0 A;  2QGV A;  5DAK A;  4POL A;  1GNW A;  1R7H A;  2V41 A;  2WGR A;  4OCE A; 
#chains in the Genus database with same CATH topology
 3CBU A;  5IMZ A;  3UIW A;  1GWC A;  1K0D A;  2DJK A;  5AIX A;  2DBC A;  2F3M A;  2CQ9 A;  2DKI A;  3GKK A;  3M8N A;  4LLR A;  3GYK A;  2BTO T;  1QUW A;  2HSY A;  3A2X A;  3HJP A;  2YP6 A;  3GH9 A;  3C71 A;  5D73 A;  4E8H A;  3O3T A;  3ERF A;  1NW2 A;  3FEU A;  4K8M A;  1NHY A;  3HHV A;  4G10 A;  5HR2 A;  2H0H A;  5C04 A;  4MDC A;  4MPG A;  1HNA A;  1ZZY A;  4BVX A;  4KND A;  2FHE A;  2LUS A;  1B9X C;  3A3T A;  3V1W A;  5ECM B;  4KX4 A;  5ECK B;  5CRD A;  1TI3 A;  4ECJ A;  5DAK B;  2GQK A;  4PQH A;  2ZCT A;  4OMV A;  2IN3 A;  4ML1 A;  2RLI A;  1I5G A;  3KH9 A;  1V40 A;  4IW9 A;  1SKR B;  2JL4 A;  3WGD A;  5JWO B;  3FZ9 A;  1XZO A;  4EIP A;  4N11 A;  2LRT A;  1OC3 A;  1T1V A;  3KP8 A;  2H1D A;  1THX A;  3UMA A;  1SKS B;  2C3T A;  4MLY A;  2EIQ A;  3UAR A;  5KN0 A;  4MJC A;  6GSU A;  1UC7 A;  4JR6 A;  4PUF C;  1JFU A;  2DJ3 A;  2J23 A;  5LNK e;  1R4W A;  4PGT A;  1XOA A;  3MYD A;  5IO2 A;  4BVX B;  2XPE A;  2OA7 A;  3KMN A;  3NOF A;  3M9K A;  3CTG A;  3L9U A;  5DCH A;  5KN2 A;  1ZYP A;  2GQL A;  5ELA A;  3EE2 A;  5IIZ A;  5FT3 A;  2OE0 A;  4P3Y B;  1EZK A;  2YJ7 A;  1URM A;  2JSZ A;  1ILO A;  3D4M A;  4YQU A;  1GUH A;  4K7O A;  2RUE A;  1MD3 A;  1M2A A;  1B9Y C;  2FA8 A;  3EIN A;  4MAB A;  5J41 A;  1V2A A;  1QQ2 A;  4Z2R A;  4LA1 A;  2H0I A;  3DRN A;  2YWI A;  1G7E A;  2A4H A;  1ZYN A;  3SBC A;  2NVL A;  4FYC A;  5DBQ A;  1BAY A;  5G5F A;  2HRA A;  4D73 A;  4XRD A;  3IBH A;  3D22 A;  3TOU A;  3IAM 2;  4YH2 A;  2O85 A;  6GSY A;  1GRX A;  1MD4 A;  5G2Z A;  6GSV A;  3NZN A;  2PPT A;  1TU8 A;  4DVC A;  2MBT A;  1A2J A;  4FH8 A;  5BRT A;  1FOH A;  4KAE A;  5D9X A;  6GSX A;  3APQ A;  1GUM A;  3S9F A;  2MMZ A;  4MNN A;  4PX1 A;  4I5Q A;  3EMP A;  2HFD A;  3ERW A;  3DWV A;  4K1F A;  3TCO A;  3WGE A;  1AAZ A;  2VM2 A;  4PQI A;  3SWL A;  4G9H A;  1SKW B;  5ECP B;  1AQV A;  1Z6M A;  4DSR A;  2TIR A;  3I6A A;  2WRT A;  4PTS A;  4DEJ A;  2R0G A;  3LYP A;  3G7Y A;  2JZT A;  3GST A;  4D73 B;  1XWA A;  2G2Q A;  1TKD B;  3IOS A;  3GIX A;  1SEN A;  4NV2 A;  1WIK A;  1EWX A;  3I69 A;  2AHE A;  2B6M A;  3WT1 A;  3QAW A;  3ZL5 A;  1Q98 A;  1HYU A;  5INY A;  1J08 A;  4IEL A;  4XHM A;  1M9B A;  2H75 A;  1PL2 A;  2C8U A;  3GL3 A;  3GUS A;  2L4C A;  3TJK A;  4GWR A;  1ZMA A;  3LWA A;  2A4V A;  4IKH A;  1TOF A;  4IN0 A;  3VWV A;  5EL8 A;  3UVT A;  4NHZ A;  4CY6 A;  3ZRE A;  4CHS A;  1H4O A;  1PSQ A;  4V2L A;  1SD8 A;  2X8H A;  3HVX A;  3P90 A;  1Z6N A;  3LXT A;  1DE2 A;  2HI7 A;  1TU7 A;  2REM A;  2VOC A;  4K9Z A;  1GTA A;  4NV5 A;  4TW5 A;  1GUK A;  3D5J A;  1J0F A;  4YAV A;  2AAW A;  2CX3 A;  1THO A;  1CQH A;  5IPG A;  1WRY A;  1PX6 A;  5IMV A;  2E0Q A;  3LYK A;  4XS1 A;  2HRF A;  3GX0 A;  7GSS A;  1GH2 A;  3FK8 A;  4YAP A;  2DC5 A;  1V57 A;  1YF1 A;  3H79 A;  5E59 A;  4EDZ A;  18GS A;  2LST A;  1Z3E A;  3EYT A;  1XWG A;  3PPU A;  2IMK A;  3UEM A;  1QXH A;  4K5R A;  4ZL8 A;  3RHB A;  3CTF A;  3QFA C;  2R6K A;  3O76 A;  1FVJ A;  4BVY A;  5KOX A;  2M72 A;  2Z9S A;  5A4U A;  4EUY A;  1V98 A;  1PN9 A;  3TRX A;  2QKE A;  4J56 E;  1B4Q A;  1A0R P;  2LRN A;  13GS A;  2LJR A;  4HU9 A;  3G7J A;  5HR3 A;  2PN8 A;  5CO3 A;  4IVF A;  4YKG A;  1F3B A;  1DSB A;  1XG8 A;  2O87 A;  3ZML A;  1YKC A;  4XCS A;  5GST A;  2OAC A;  2E2G A;  5DJL A;  1PQN A;  1M9A A;  4HU7 A;  1VGL A;  1F2E A;  4IQ1 A;  1WPI A;  5B8B A;  5CRH A;  4PNF A;  5A4W A;  3LSZ A;  2PMT A;  3QFB C;  5ECN B;  2HT9 A;  4WEY A;  3A5I A;  4G0K A;  3R3E A;  1GSU A;  2WFC A;  5H5R A;  1M3I A;  3NIV A;  1A2L A;  2ZNM A;  2WS2 A;  4ECB A;  4MZB A;  2HXK A;  3LG6 A;  1XXU A;  1K3L A;  2B1K A;  2LV3 A;  2OBK A;  2FWG A;  5D9T A;  2YZH A;  2R2J A;  3HCZ A;  1UA5 A;  1B48 A;  3TKS A;  2K8V A;  1V9W A;  3VPT A;  4BVY B;  3VI7 A;  2B5Y A;  1VF4 A;  2DSA A;  5LCZ A;  3FZ4 A;  3UOM A;  1RQM A;  1BYE A;  3RAZ A;  2DJ1 A;  1X5C A;  4BA7 A;  3TKR A;  5COH A;  1HNC A;  3TKQ A;  3PGT A;  3WD6 A;  3F63 A;  3HVS A;  1DE1 A;  4HZ4 A;  2H30 A;  3Q6O A;  3C8E A;  1YEP A;  5B6N A;  2LEG A;  3DVW A;  5ECS A;  3C73 A;  3ME7 A;  1TRS A;  4Q5Q A;  1KBN A;  3TKP A;  4V1A p;  3Q18 A;  2IIY A;  1TDI A;  3LOR A;  4HZ2 A;  3IK7 A;  3QR6 A;  3IDV A;  2OJL A;  2B1L A;  2IMF A;  5DJM A;  2FWE A;  3MDK A;  3TDG A;  5CRG A;  2CVK A;  3WT2 A;  5C00 A;  2VAF A;  4BIK A;  2HYX A;  2LNS A;  2RUF A;  1GTI A;  5KOW A;  4IP1 A;  4LMW A;  2CZ2 A;  2LQO A;  1JZW A;  4F2I A;  2E2M A;  4X4J A;  5JCG A;  1A23 A;  4KDY A;  1H75 A;  3VWX A;  1N2A A;  2WDU A;  3P7X A;  1TW9 A;  1JLW A;  1GSY A;  4OFT A;  2IL3 A;  1X0R A;  1V58 A;  4X43 A;  2MYG A;  2IJY A;  2GLR A;  5BMU A;  4OFM A;  3EU4 A;  2LJA A;  1X5E A;  2LQQ A;  2VCQ A;  2H70 A;  3BD2 A;  3H4K A;  1NM3 A;  2NBS A;  4EL1 A;  1SYX A;  1GSF A;  2HSM A;  3VWU A;  1PKZ A;  1O8X A;  2K6V A;  2R5G A;  2EC4 A;  4XRA A;  3TB2 A;  2IWT A;  4LMV A;  4K7N A;  4RI7 A;  2FCH A;  4H86 A;  2ON5 A;  2YNX A;  2CAQ A;  2I9H A;  3LFL A;  4F0B A;  4BWS A;  1U87 A;  2C3Q A;  4AF2 A;  2CZ3 A;  4I2T A;  1FAA A;  2I1U A;  3AY8 A;  4FYU A;  3FW2 A;  2PGT A;  3FZA A;  1USB A;  2CA8 A;  2DIY A;  4O5Q A;  1O81 A;  3GA4 A;  2OE3 A;  4V2N A;  1SD9 A;  3IRA A;  4G2E A;  2MZC A;  2VCW A;  2C1Y A;  4I97 A;  1G0T A;  2PBJ A;  2O8V B;  4HI7 A;  4PUR A;  3ZRD A;  2RM6 A;  2VCZ A;  3F4S A;  2E7P A;  4EXJ A;  1S3C A;  4ZB6 A;  3FR9 A;  4QL7 A;  3GTU A;  1F3A A;  1DUG A;  4JZQ A;  1A8L A;  4TR0 A;  2BJX A;  3W6G A;  4ILF A;  1AXD A;  3HZ4 A;  1T7P B;  4HOJ A;  5IPH A;  4CY8 A;  5CRE A;  2VD1 A;  3TKS C;  4N10 A;  4ZL9 A;  4FQU A;  3KXO A;  4GXZ A;  4KDX A;  3DVX A;  5KN3 A;  2VL9 A;  5G30 A;  2O7K A;  4MZW A;  2V32 A;  5ENU A;  2GT6 A;  1O7U A;  2JSY A;  1T4Y A;  4ZIL A;  2B5X A;  2WB9 A;  3BCK A;  5F8B A;  22GS A;  1U88 A;  4KF9 A;  1GTU A;  3KH7 A;  5LD0 A;  2FY6 A;  3IPZ A;  2ALB A;  5F06 A;  4TVE A;  4IHU A;  2GT5 A;  1RW1 A;  1FB0 A;  4O92 A;  4ZBB A;  2C80 A;  3TGZ A;  1Z9H A;  3HVV A;  3UL3 A;  2NTO A;  2YWN A;  1XCC A;  4CDO A;  2FA4 A;  4L0U A;  4KA0 A;  2H0G A;  5F05 A;  3GTU B;  3Q19 A;  5F0G A;  3A2W A;  1YY7 A;  4EDY A;  1M99 A;  1J9B A;  2C4J A;  2HE3 A;  3C1R A;  1OAZ A;  4O32 A;  2GGT A;  4K0N A;  3EWL A;  3WGX A;  4HQS A;  1T00 A;  2WCI A;  1SU9 A;  1AIU A;  2AV4 A;  5KEJ A;  1KEB A;  4Q5R A;  1T8E B;  1OE8 A;  10GS A;  1X5D A;  5EY6 A;  2KLX A;  3IR4 A;  3IAS 2;  2L5O A;  2LKU A;  3UVH A;  2CVB A;  2LTK A;  2FD3 A;  1SYR A;  1YQ1 A;  3FMW A;  1Z7P A;  1OKT A;  2H1A A;  1GLQ A;  1K3Y A;  4Q5F A;  2VCX A;  4KW6 A;  1BQ7 A;  2N5B A;  2GS3 A;  5D93 A;  4ZB9 A;  3TOT A;  5G1K A;  1PX7 A;  4EC0 A;  2L59 A;  3LW9 A;  5H5Q A;  1XBS A;  4ZXG A;  1F9M A;  4MJB A;  5L71 A;  5GAP D;  1WOU A;  5HR0 A;  3W8J A;  4WR4 A;  2OAD A;  3FKF A;  3P2A A;  2HLS A;  1QK8 A;  2FLS A;  1M0U A;  3D21 A;  5G31 A;  2V2G A;  2VLT A;  1BJX A;  2KHP A;  1UN2 A;  1A8Y A;  4J57 E;  1EV4 A;  4TXO A;  2GSQ A;  1O85 A;  1QMV A;  4A5P A;  5ABR A;  3DML A;  3KM6 A;  2B7J A;  6GSS A;  4MP4 A;  1S3D A;  1XW6 A;  2A2P A;  1FVK A;  2L6D A;  4I6X A;  3DKS A;  1JZO A;  1FOV A;  3G7I A;  2JAD A;  1X9M B;  4IGJ A;  3VFI A;  1MTC A;  2LRC A;  1MEK A;  3CQF A;  1M3J A;  1EEJ A;  1YZX A;  2X8C A;  1XIY A;  5F07 A;  1KTE A;  1IYH A;  1Z7R A;  1HQO A;  1ZYQ B;  2GDR A;  2XC2 A;  5D9W A;  5DQS A;  1WMJ A;  1ERV A;  5HFK A;  5HQP A;  5FHI A;  1ZGN A;  4TR4 A;  5HR1 A;  2V6O A;  3I9V 2;  4G0I A;  4HUA A;  3KGK A;  3PIN A;  5J9B A;  3FHK A;  3M3M A;  2YCD A;  1JLV A;  4RQR A;  4MF5 A;  3GN3 A;  4E8E A;  4OD7 A;  5J9C A;  4TXO B;  1ERT A;  3ZLP A;  5JCW A;  2O89 A;  3EMX A;  4MJA A;  2YAN A;  4K0G A;  4HJ2 A;  4DSS A;  2XBQ A;  3HXS A;  1XW9 A;  2H6X A;  1EV9 A;  3QMX A;  1JHB A;  4K2D A;  3HJM A;  2R0C A;  1FB6 A;  1PA3 A;  1AUC A;  4O7H A;  1ZYE A;  5DDL A;  2YV7 A;  4AJ7 A;  5AN1 A;  2H1B A;  1QFN A;  4QQ7 A;  1R26 A;  2K18 A;  3FYG A;  2MMA A;  4I2U A;  3TJJ A;  2GST A;  4POB A;  19GS A;  4IP6 A;  4KCA A;  1S3A A;  3E9J B;  2ZUP A;  1EOH A;  4POK A;  4FO5 A;  3ZVJ A;  5IMF A;  3TKS E;  3LGC A;  4RI6 A;  4WF5 A;  3ZFB A;  1AW9 A;  4OWY A;  1N8J A;  2H71 A;  2FUG 2;  4WBJ A;  3VUR A;  1TI1 A;  4PUA A;  5ECO B;  2L57 A;  2VL2 A;  1K0M A;  2CX4 A;  1GSS A;  2L6C A;  5E4W A;  4BL7 A;  2CVD A;  2H1G A;  1PMT A;  1E2Y A;  4YKF A;  11GS A;  2XBI A;  2A2S A;  4DSS B;  2H72 A;  2H6Y A;  4ML6 A;  1SK2 A;  2MMO A;  4CW9 A;  2X8G A;  5KN1 A;  3RBT A;  4MH2 A;  20GS A;  1G7O A;  5IMA A;  3GX8 A;  3CYN A;  3ZIV A;  1CQG A;  3H1N A;  2BMX A;  1BX9 A;  4HDE A;  1PRX A;  4MCU A;  2WUL A;  2PVO C;  1XVQ A;  3IC4 A;  3F3R A;  2M80 A;  1ZOF A;  2XHF A;  4G0L A;  3KJY A;  2R4V A;  2PU9 C;  3KCM A;  4ZBD A;  3J7Y b;  3GSS A;  2HRK A;  3IHG A;  3L0H A;  3TJF A;  4XTS A;  1GUL A;  3QD9 A;  4BPY A;  4ACS A;  2QSI A;  1WE0 A;  1M7T A;  2EIR A;  2P5R A;  4N30 A;  4BL7 B;  5G1L A;  2VD0 A;  2MBS A;  4N0Z A;  2DLX A;  3FR3 A;  3CSJ A;  3GKX A;  3J7Y k;  4KUN A;  2H01 A;  3DD3 A;  3L78 A;  1OC9 A;  4ZL7 A;  5A4V A;  2I81 A;  1YDK A;  5J4U A;  1X9S B;  2YWO A;  2C0G A;  2YV9 A;  3RHC A;  3DIE A;  2OKA A;  4IJ3 A;  2PVQ A;  3BCI A;  2HRN A;  2YN1 A;  2DJJ A;  1SL1 B;  1B8X A;  2B5E A;  1TK5 B;  5A5K A;  3GKN A;  4PXO A;  2R0P A;  5B8A A;  1ON4 A;  3K8N A;  2PER A;  3JCM L;  3E3E A;  3TUE A;  2GZY A;  5DVB A;  1O73 A;  3CSI A;  4EKZ A;  2CT6 A;  3F9U A;  5EPF A;  5J3R A;  4AJ6 A;  2WZ9 A;  3BJ5 A;  3DGQ A;  4F0C A;  2F8A A;  4O5U A;  8GSS A;  1OYJ A;  2LNT A;  4IBP A;  4V1A g;  5DAL A;  3GL5 A;  1GLP A;  3TRQ A;  1OC9 B;  2F51 A;  4PNG A;  2MMN A;  1SJZ A;  1EP8 A;  1R5P A;  2C3N A;  2GTU A;  3MAK A;  5CAX A;  1DBY A;  2V1M A;  3PH9 A;  5FWG A;  3W8S A;  1TP9 A;  4TXV A;  5D96 A;  1U3I A;  5ECQ B;  3FRC A;  4ZBA A;  1NHO A;  4MF6 A;  4F9Z A;  2AB6 A;  3IA1 A;  3KMO A;  4KE3 A;  4BWQ A;  1TXX A;  5IOW A;  4ISD A;  1MDI A;  2HZF A;  2H76 A;  2DJ0 A;  2K9F A;  2VL2 C;  4XIH A;  3HA9 A;  3UAP A;  4MMM A;  3U5R E;  2H74 A;  4GF0 A;  2X49 A;  4MF7 A;  4NWY A;  1ZL9 A;  3CSH A;  1VF3 A;  2H19 A;  1Y25 A;  2IMI A;  4TKY A;  2VO4 A;  4IQA A;  17GS A;  5HFG A;  3GNJ A;  5AIS A;  1SJ6 A;  6GST A;  5DAL B;  4NPB A;  4KCE A;  3M9J A;  5JWQ B;  1B4P A;  1XWB A;  5IQY A;  3N9J A;  2FWF A;  4MPF A;  1VF2 A;  3DYR A;  4LL1 B;  3ISO A;  2H66 A;  2WJU A;  4ULX A;  2TRC P;  3MWH A;  4GTU A;  3L4N A;  3CRU A;  4F82 A;  2PWJ A;  1O8W A;  1VF1 A;  5DCG A;  4HQZ A;  1KNG A;  3HDC A;  4KB3 A;  2VM1 A;  1FO5 A;  4RUV A;  5JCU A;  2GSS A;  2IME A;  3D4T A;  2CV4 A;  1ERU A;  3LQ7 A;  5CYY A;  3H8Q A;  4XS4 A;  1TRU A;  3F3Q A;  4X0X A;  3HVN A;  5IMD A;  4JBB A;  2DML A;  2C0D A;  5DQY A;  4HSC X;  4MH3 A;  4GLT A;  5H5S A;  1A24 A;  4J2F A;  3VLN A;  2L5L A;  1F37 A;  2EIO A;  4Z2T A;  2HNL A;  3EU3 A;  3ERG A;  4EE0 A;  3R2Q A;  4Z2U A;  2GQM A;  4K6X A;  4K5S A;  2YZU A;  3CXG A;  3DEX A;  5J5N A;  4EVM A;  2DMM A;  3FY7 A;  1A2M A;  1YJ6 A;  4KH7 A;  3QDN A;  5GSS A;  3P8W A;  4HS1 A;  1I9D A;  2GZP A;  1U6T A;  2J9H A;  2F8F A;  3UBL A;  1XWC A;  3QPM A;  5B7C A;  2HZE A;  1XFL A;  3UJ1 A;  3ZYW A;  5GZZ B;  2QA1 A;  2RII A;  1PFO A;  2KP2 A;  3GKM A;  5CNW A;  1YF0 A;  5ID2 A;  2IMD A;  4L5O A;  3GFK A;  3DXB A;  5ECR B;  4X1U A;  2NDO A;  1ERW A;  2JAC A;  1FW1 A;  4XS4 B;  5IM9 A;  4OFN A;  1EOG A;  4ZB8 A;  1R5A A;  2X99 A;  1A0F A;  1SJI A;  3HKR A;  3D6I A;  1K0B A;  4I8B A;  1M2B A;  4MK3 A;  4EIQ A;  4GSN A;  1TK0 B;  12GS A;  3TJB A;  4JE1 A;  3PR8 A;  1ST9 A;  3GUR A;  5D9V A;  3KTB A;  4WF4 A;  2TRX A;  4MJE A;  3F8U A;  3C1S A;  3GH6 A;  3VI5 A;  4K2X A;  2B3S A;  3KZQ A;  3ZFL A;  1TK8 B;  2KUC A;  3M1G A;  2HZE B;  1YKA A;  2H8L A;  3QOU A;  1PL1 A;  1NSW A;  3D0Z A;  4L0W A;  1GL8 A;  3EPT A;  1T4Z A;  1K0A A;  1K0N A;  1WWJ A;  3RPP A;  2C0E A;  1WJK A;  5IO0 A;  1PN0 A;  1E6B A;  4TN8 A;  3US3 A;  5ID2 B;  3TJG A;  1TRV A;  4USS A;  1FG4 A;  2KOK A;  4V2M A;  1ABA A;  2OE1 A;  1Z5Y E;  3F6F A;  3MNG A;  1FHE A;  1SL2 B;  2YPM A;  1ML6 A;  3I43 A;  3F0I A;  5CRW A;  2PUK C;  2N5A A;  3L9V A;  2R37 A;  2VUP A;  1K0C A;  3G9B A;  3KIJ A;  2V6K A;  1PD2 1;  2FWH A;  4KGI A;  4HEA 2;  6GSW A;  3WYW A;  2IFQ A;  5ECH B;  3BOA A;  1Q4J A;  1JZD A;  5ELG A;  3CMI A;  2YOI A;  3APS A;  3U6V A;  2VCV A;  3VK9 A;  4ECC A;  2HSH A;  4POM A;  4KSO A;  2I3Y A;  4ECI A;  3RPN A;  4JR4 A;  2KP1 A;  1W4V A;  3ED3 A;  1GNE A;  2A2R A;  4GQF A;  2QC7 A;  1XWK A;  1SL0 B;  4WBR D;  3QAG A;  4N0V A;  5ECI B;  1HNB A;  3ZZX A;  3LXZ A;  3KD0 A;  1TRW A;  1F6M C;  3KP9 A;  1GSD A;  4FIW A;  4L8E A;  1PGT A;  4TRX A;  5ECL B;  4RQX A;  2H73 A;  1GSQ A;  1XOB A;  4KDU A;  3L9S A;  2UZ8 A;  4AGS A;  2R3X A;  3A2V A;  4GQC A;  1BED A;  1GP1 A;  3HY2 A;  2RM5 A;  1T3B A;  2I4A A;  4YQV A;  4IJI A;  2IFQ B;  3F4R A;  3N5O A;  1RK4 A;  3IXR A;  16GS A;  2CAI A;  2F9S A;  4NAX A;  5HFI A;  14GS A;  4TR1 A;  2AYT A;  3GHA A;  2N5F A;  2JZS A;  2ES7 A;  3EC3 A;  4IS0 A;  3MSZ A;  1G6W A;  4WKW A;  1HD2 A;  1X9W B;  5EVO A;  3EVI A;  4F03 A;  1GSE A;  4KSM A;  1AC1 A;  4GRF A;  1OVN A;  4G19 A;  1JZR A;  3IC8 A;  2X4A A;  3LEF A;  2DKH A;  1TTZ A;  2VLV A;  1K0O A;  3IHQ A;  2OBI A;  1TJD A;  1XPV A;  2L4Q A;  4JRR A;  4O5R A;  4PQ1 A;  4HJM A;  4MZC A;  3ZIT A;  2B7K A;  4OCF A;  4ID0 A;  4DSQ A;  2LJK A;  4TR3 A;  1IYI A;  1SK1 A;  3IE3 A;  4GST A;  4JU5 A;  2GSR A;  3GMF A;  1MDK A;  4GSS A;  2GVP A;  5G5E A;  2P5Q A;  3ZIJ A;  3H93 A;  3A5W A;  4GCI A;  1ZCP A;  2D2Z A;  1U3A A;  1ACV A;  2VIM A;  1C72 A;  1XVW A;  1WP0 A;  2IPA A;  2M46 A;  3APO A;  5B6M A;  1M2D A;  3KEB A;  1K3O A;  4AJ8 A;  3OR5 A;  3CRT A;  4QL9 A;  4OO4 A;  5JWR B;  3HZ8 A;  4WR5 A;  4WXT A;  4Q5N A;  1BG5 A;  3FR6 A;  4LL4 B;  1W89 A;  4TR1 B;  3GV1 A;  2VLU A;  3VWW A;  2AUV A;  4EF0 A;  2QA2 A;  2YJH A;  2G0F A;  1AQW A;  5AIV A;  3IV4 A;  4WET A;  2FGX A;  4ICY A;  1XW5 A;  3ZVJ D;  2JZR A;  2LS5 A;  2C0F A;  3FZ5 A;  3QAV A;  3TRP A;  5IMC A;  4OO5 A;  1VRS D;  4ZIJ A;  4MA9 A;  1OC8 A;  3ZTL A;  3UBK A;  2DIZ A;  2H6Z A;  3EUR A;  4K7I A;  4NXI A;  2AJQ B;  3O6T A;  1S3R A;  2VL3 A;  1Y6E A;  3F4T A;  3ZMK A;  4TOP A;  3QCP A;  3Q74 A;  5AGY A;  3IK9 A;  2XPD A;  1EGR A;  3LJR A;  3BBY A;  3C7M A;  1AQX A;  4EO3 A;  4XS6 A;  2GZZ A;  1PKW A;  3M0F A;  1EGO A;  3GRX A;  4Z7X A;  4YQM A;  3VPQ A;  9GSS A;  1EP7 A;  2X64 A;  1OE7 A;  2P0G A;  1UVZ A;  1MDJ A;  1O6J A;  4L5L A;  3MIX A;  5CP1 A;  1YEX A;  3HYP A;  1QGV A;  3E0U A;  1EEM A;  3ME8 A;  2ON7 A;  5D8I A;  4FYB A;  5IOX A;  5GAN D;  1LJR A;  2NPB A;  1G6Y A;  1OKD A;  2VCT A;  4NHW A;  3HJO A;  2JU5 A;  2YWM A;  2K8S A;  3KTL A;  2DJ2 A;  2P31 A;  3RDW A;  2FNO A;  1LU4 A;  3HD5 A;  1LBK A;  1GTB A;  3F6D A;  4JED A;  4NMU A;  1SK0 A;  2QGV A;  5DAK A;  4POL A;  1GNW A;  1R7H A;  2V41 A;  2WGR A;  4OCE A; 
#chains in the Genus database with same CATH homology
 3CBU A;  5IMZ A;  3UIW A;  1GWC A;  1K0D A;  2DJK A;  5AIX A;  2DBC A;  2F3M A;  2CQ9 A;  2DKI A;  3GKK A;  3M8N A;  4LLR A;  3GYK A;  2BTO T;  1QUW A;  2HSY A;  3A2X A;  3HJP A;  2YP6 A;  3GH9 A;  3C71 A;  5D73 A;  4E8H A;  3O3T A;  3ERF A;  1NW2 A;  3FEU A;  4K8M A;  1NHY A;  3HHV A;  4G10 A;  5HR2 A;  2H0H A;  5C04 A;  4MDC A;  4MPG A;  1HNA A;  1ZZY A;  4BVX A;  4KND A;  2FHE A;  2LUS A;  1B9X C;  3A3T A;  3V1W A;  5ECM B;  4KX4 A;  5ECK B;  5CRD A;  1TI3 A;  4ECJ A;  5DAK B;  2GQK A;  4PQH A;  2ZCT A;  4OMV A;  2IN3 A;  4ML1 A;  2RLI A;  1I5G A;  3KH9 A;  1V40 A;  4IW9 A;  1SKR B;  2JL4 A;  3WGD A;  5JWO B;  3FZ9 A;  1XZO A;  4EIP A;  4N11 A;  2LRT A;  1OC3 A;  1T1V A;  3KP8 A;  2H1D A;  1THX A;  3UMA A;  1SKS B;  2C3T A;  4MLY A;  2EIQ A;  3UAR A;  5KN0 A;  4MJC A;  6GSU A;  1UC7 A;  4JR6 A;  4PUF C;  1JFU A;  2DJ3 A;  2J23 A;  5LNK e;  1R4W A;  4PGT A;  1XOA A;  3MYD A;  5IO2 A;  4BVX B;  2XPE A;  2OA7 A;  3KMN A;  3NOF A;  3M9K A;  3CTG A;  3L9U A;  5DCH A;  5KN2 A;  1ZYP A;  2GQL A;  5ELA A;  3EE2 A;  5IIZ A;  5FT3 A;  2OE0 A;  4P3Y B;  1EZK A;  2YJ7 A;  1URM A;  2JSZ A;  1ILO A;  3D4M A;  4YQU A;  1GUH A;  4K7O A;  2RUE A;  1MD3 A;  1M2A A;  1B9Y C;  2FA8 A;  3EIN A;  4MAB A;  5J41 A;  1V2A A;  1QQ2 A;  4Z2R A;  4LA1 A;  2H0I A;  3DRN A;  2YWI A;  1G7E A;  2A4H A;  1ZYN A;  3SBC A;  2NVL A;  4FYC A;  5DBQ A;  1BAY A;  5G5F A;  2HRA A;  4D73 A;  4XRD A;  3IBH A;  3D22 A;  3TOU A;  3IAM 2;  4YH2 A;  2O85 A;  6GSY A;  1GRX A;  1MD4 A;  5G2Z A;  6GSV A;  3NZN A;  2PPT A;  1TU8 A;  4DVC A;  2MBT A;  1A2J A;  4FH8 A;  5BRT A;  1FOH A;  4KAE A;  5D9X A;  6GSX A;  3APQ A;  1GUM A;  3S9F A;  2MMZ A;  4MNN A;  4PX1 A;  4I5Q A;  3EMP A;  2HFD A;  3ERW A;  3DWV A;  4K1F A;  3TCO A;  3WGE A;  1AAZ A;  2VM2 A;  4PQI A;  3SWL A;  4G9H A;  1SKW B;  5ECP B;  1AQV A;  1Z6M A;  4DSR A;  2TIR A;  3I6A A;  2WRT A;  4PTS A;  4DEJ A;  2R0G A;  3LYP A;  3G7Y A;  2JZT A;  3GST A;  4D73 B;  1XWA A;  2G2Q A;  1TKD B;  3IOS A;  3GIX A;  1SEN A;  4NV2 A;  1WIK A;  1EWX A;  3I69 A;  2AHE A;  2B6M A;  3WT1 A;  3QAW A;  3ZL5 A;  1Q98 A;  1HYU A;  5INY A;  1J08 A;  4IEL A;  4XHM A;  1M9B A;  2H75 A;  1PL2 A;  2C8U A;  3GL3 A;  3GUS A;  2L4C A;  3TJK A;  4GWR A;  1ZMA A;  3LWA A;  2A4V A;  4IKH A;  1TOF A;  4IN0 A;  3VWV A;  5EL8 A;  3UVT A;  4NHZ A;  4CY6 A;  3ZRE A;  4CHS A;  1H4O A;  1PSQ A;  4V2L A;  1SD8 A;  2X8H A;  3HVX A;  3P90 A;  1Z6N A;  3LXT A;  1DE2 A;  2HI7 A;  1TU7 A;  2REM A;  2VOC A;  4K9Z A;  1GTA A;  4NV5 A;  4TW5 A;  1GUK A;  3D5J A;  1J0F A;  4YAV A;  2AAW A;  2CX3 A;  1THO A;  1CQH A;  5IPG A;  1WRY A;  1PX6 A;  5IMV A;  2E0Q A;  3LYK A;  4XS1 A;  2HRF A;  3GX0 A;  7GSS A;  1GH2 A;  3FK8 A;  4YAP A;  2DC5 A;  1V57 A;  1YF1 A;  3H79 A;  5E59 A;  4EDZ A;  18GS A;  2LST A;  1Z3E A;  3EYT A;  1XWG A;  3PPU A;  2IMK A;  3UEM A;  1QXH A;  4K5R A;  4ZL8 A;  3RHB A;  3CTF A;  3QFA C;  2R6K A;  3O76 A;  1FVJ A;  4BVY A;  5KOX A;  2M72 A;  2Z9S A;  5A4U A;  4EUY A;  1V98 A;  1PN9 A;  3TRX A;  2QKE A;  4J56 E;  1B4Q A;  1A0R P;  2LRN A;  13GS A;  2LJR A;  4HU9 A;  3G7J A;  5HR3 A;  2PN8 A;  5CO3 A;  4IVF A;  4YKG A;  1F3B A;  1DSB A;  2O87 A;  3ZML A;  1YKC A;  4XCS A;  5GST A;  2OAC A;  2E2G A;  5DJL A;  1PQN A;  1M9A A;  4HU7 A;  1VGL A;  1F2E A;  4IQ1 A;  1WPI A;  5B8B A;  5CRH A;  4PNF A;  5A4W A;  3LSZ A;  2PMT A;  3QFB C;  5ECN B;  2HT9 A;  4WEY A;  3A5I A;  4G0K A;  3R3E A;  1GSU A;  2WFC A;  5H5R A;  3NIV A;  1A2L A;  2ZNM A;  2WS2 A;  4ECB A;  4MZB A;  2HXK A;  3LG6 A;  1XXU A;  1K3L A;  2B1K A;  2LV3 A;  2OBK A;  2FWG A;  5D9T A;  2YZH A;  2R2J A;  3HCZ A;  1UA5 A;  1B48 A;  3TKS A;  2K8V A;  1V9W A;  3VPT A;  4BVY B;  3VI7 A;  2B5Y A;  1VF4 A;  2DSA A;  5LCZ A;  3FZ4 A;  3UOM A;  1RQM A;  1BYE A;  3RAZ A;  2DJ1 A;  1X5C A;  4BA7 A;  3TKR A;  5COH A;  1HNC A;  3TKQ A;  3PGT A;  3WD6 A;  3F63 A;  3HVS A;  1DE1 A;  4HZ4 A;  2H30 A;  3Q6O A;  3C8E A;  1YEP A;  5B6N A;  2LEG A;  3DVW A;  5ECS A;  3C73 A;  3ME7 A;  1TRS A;  4Q5Q A;  1KBN A;  3TKP A;  4V1A p;  3Q18 A;  2IIY A;  1TDI A;  3LOR A;  4HZ2 A;  3IK7 A;  3QR6 A;  3IDV A;  2OJL A;  2B1L A;  2IMF A;  5DJM A;  2FWE A;  3MDK A;  3TDG A;  5CRG A;  2CVK A;  3WT2 A;  5C00 A;  2VAF A;  2HYX A;  2LNS A;  2RUF A;  1GTI A;  5KOW A;  4IP1 A;  4LMW A;  2CZ2 A;  2LQO A;  1JZW A;  4F2I A;  2E2M A;  4X4J A;  5JCG A;  1A23 A;  4KDY A;  1H75 A;  3VWX A;  1N2A A;  2WDU A;  3P7X A;  1TW9 A;  1JLW A;  1GSY A;  4OFT A;  2IL3 A;  1X0R A;  1V58 A;  4X43 A;  2MYG A;  2IJY A;  2GLR A;  5BMU A;  4OFM A;  3EU4 A;  2LJA A;  1X5E A;  2LQQ A;  2VCQ A;  2H70 A;  3BD2 A;  3H4K A;  1NM3 A;  2NBS A;  4EL1 A;  1SYX A;  1GSF A;  2HSM A;  3VWU A;  1PKZ A;  1O8X A;  2K6V A;  2R5G A;  2EC4 A;  4XRA A;  3TB2 A;  2IWT A;  4LMV A;  4K7N A;  4RI7 A;  2FCH A;  4H86 A;  2ON5 A;  2YNX A;  2CAQ A;  2I9H A;  3LFL A;  4F0B A;  4BWS A;  1U87 A;  2C3Q A;  4AF2 A;  2CZ3 A;  4I2T A;  1FAA A;  2I1U A;  3AY8 A;  4FYU A;  3FW2 A;  2PGT A;  3FZA A;  1USB A;  2CA8 A;  2DIY A;  4O5Q A;  1O81 A;  3GA4 A;  2OE3 A;  4V2N A;  1SD9 A;  3IRA A;  4G2E A;  2MZC A;  2VCW A;  2C1Y A;  4I97 A;  1G0T A;  2PBJ A;  2O8V B;  4HI7 A;  4PUR A;  3ZRD A;  2RM6 A;  2VCZ A;  3F4S A;  2E7P A;  4EXJ A;  1S3C A;  4ZB6 A;  3FR9 A;  4QL7 A;  3GTU A;  1F3A A;  1DUG A;  4JZQ A;  1A8L A;  4TR0 A;  2BJX A;  3W6G A;  4ILF A;  1AXD A;  3HZ4 A;  1T7P B;  4HOJ A;  5IPH A;  4CY8 A;  5CRE A;  2VD1 A;  3TKS C;  4N10 A;  4ZL9 A;  4FQU A;  3KXO A;  4GXZ A;  4KDX A;  3DVX A;  5KN3 A;  2VL9 A;  5G30 A;  2O7K A;  4MZW A;  2V32 A;  5ENU A;  2GT6 A;  1O7U A;  2JSY A;  1T4Y A;  4ZIL A;  2B5X A;  2WB9 A;  3BCK A;  5F8B A;  22GS A;  1U88 A;  4KF9 A;  1GTU A;  3KH7 A;  5LD0 A;  2FY6 A;  3IPZ A;  2ALB A;  5F06 A;  4TVE A;  4IHU A;  2GT5 A;  1RW1 A;  1FB0 A;  4O92 A;  4ZBB A;  2C80 A;  3TGZ A;  1Z9H A;  3HVV A;  3UL3 A;  2NTO A;  2YWN A;  1XCC A;  4CDO A;  2FA4 A;  4L0U A;  4KA0 A;  2H0G A;  5F05 A;  3GTU B;  3Q19 A;  5F0G A;  3A2W A;  1YY7 A;  4EDY A;  1M99 A;  1J9B A;  2C4J A;  2HE3 A;  3C1R A;  1OAZ A;  4O32 A;  2GGT A;  4K0N A;  3EWL A;  3WGX A;  4HQS A;  1T00 A;  2WCI A;  1SU9 A;  1AIU A;  2AV4 A;  5KEJ A;  1KEB A;  4Q5R A;  1T8E B;  1OE8 A;  10GS A;  1X5D A;  5EY6 A;  2KLX A;  3IR4 A;  3IAS 2;  2L5O A;  2LKU A;  3UVH A;  2CVB A;  2LTK A;  2FD3 A;  1SYR A;  1YQ1 A;  3FMW A;  1Z7P A;  1OKT A;  2H1A A;  1GLQ A;  1K3Y A;  4Q5F A;  2VCX A;  4KW6 A;  1BQ7 A;  2N5B A;  2GS3 A;  5D93 A;  4ZB9 A;  3TOT A;  5G1K A;  1PX7 A;  4EC0 A;  2L59 A;  3LW9 A;  5H5Q A;  1XBS A;  4ZXG A;  1F9M A;  4MJB A;  5L71 A;  5GAP D;  1WOU A;  5HR0 A;  3W8J A;  4WR4 A;  2OAD A;  3FKF A;  3P2A A;  2HLS A;  1QK8 A;  2FLS A;  1M0U A;  3D21 A;  5G31 A;  2V2G A;  2VLT A;  1BJX A;  2KHP A;  1UN2 A;  1A8Y A;  4J57 E;  1EV4 A;  4TXO A;  2GSQ A;  1O85 A;  1QMV A;  4A5P A;  5ABR A;  3DML A;  3KM6 A;  2B7J A;  6GSS A;  4MP4 A;  1S3D A;  1XW6 A;  2A2P A;  1FVK A;  2L6D A;  4I6X A;  3DKS A;  1JZO A;  1FOV A;  3G7I A;  2JAD A;  1X9M B;  4IGJ A;  3VFI A;  1MTC A;  2LRC A;  1MEK A;  1EEJ A;  1YZX A;  2X8C A;  1XIY A;  5F07 A;  1KTE A;  1IYH A;  1Z7R A;  1HQO A;  1ZYQ B;  2GDR A;  2XC2 A;  5D9W A;  5DQS A;  1WMJ A;  1ERV A;  5HFK A;  5HQP A;  5FHI A;  1ZGN A;  4TR4 A;  5HR1 A;  2V6O A;  3I9V 2;  4G0I A;  4HUA A;  3KGK A;  3PIN A;  5J9B A;  3FHK A;  3M3M A;  2YCD A;  1JLV A;  4RQR A;  4MF5 A;  3GN3 A;  4E8E A;  4OD7 A;  5J9C A;  4TXO B;  1ERT A;  3ZLP A;  5JCW A;  2O89 A;  3EMX A;  4MJA A;  2YAN A;  4K0G A;  4HJ2 A;  4DSS A;  2XBQ A;  3HXS A;  1XW9 A;  2H6X A;  1EV9 A;  3QMX A;  1JHB A;  4K2D A;  3HJM A;  2R0C A;  1FB6 A;  1PA3 A;  1AUC A;  4O7H A;  1ZYE A;  5DDL A;  2YV7 A;  4AJ7 A;  5AN1 A;  2H1B A;  1QFN A;  4QQ7 A;  1R26 A;  2K18 A;  3FYG A;  2MMA A;  4I2U A;  3TJJ A;  2GST A;  4POB A;  19GS A;  4IP6 A;  4KCA A;  1S3A A;  3E9J B;  2ZUP A;  1EOH A;  4POK A;  4FO5 A;  3ZVJ A;  5IMF A;  3TKS E;  3LGC A;  4RI6 A;  4WF5 A;  3ZFB A;  1AW9 A;  4OWY A;  1N8J A;  2H71 A;  2FUG 2;  4WBJ A;  3VUR A;  1TI1 A;  4PUA A;  5ECO B;  2L57 A;  2VL2 A;  1K0M A;  2CX4 A;  1GSS A;  2L6C A;  5E4W A;  4BL7 A;  2CVD A;  2H1G A;  1PMT A;  1E2Y A;  4YKF A;  11GS A;  2XBI A;  2A2S A;  4DSS B;  2H72 A;  2H6Y A;  4ML6 A;  1SK2 A;  2MMO A;  4CW9 A;  2X8G A;  5KN1 A;  3RBT A;  4MH2 A;  20GS A;  1G7O A;  5IMA A;  3GX8 A;  3CYN A;  3ZIV A;  1CQG A;  3H1N A;  2BMX A;  1BX9 A;  4HDE A;  1PRX A;  4MCU A;  2WUL A;  2PVO C;  1XVQ A;  3IC4 A;  3F3R A;  2M80 A;  1ZOF A;  2XHF A;  4G0L A;  3KJY A;  2R4V A;  2PU9 C;  3KCM A;  4ZBD A;  3J7Y b;  3GSS A;  2HRK A;  3IHG A;  3L0H A;  3TJF A;  4XTS A;  1GUL A;  3QD9 A;  4BPY A;  4ACS A;  2QSI A;  1WE0 A;  1M7T A;  2EIR A;  2P5R A;  4N30 A;  4BL7 B;  5G1L A;  2VD0 A;  2MBS A;  4N0Z A;  2DLX A;  3FR3 A;  3CSJ A;  3GKX A;  3J7Y k;  4KUN A;  2H01 A;  3DD3 A;  3L78 A;  1OC9 A;  4ZL7 A;  5A4V A;  2I81 A;  1YDK A;  5J4U A;  1X9S B;  2YWO A;  2C0G A;  2YV9 A;  3RHC A;  3DIE A;  2OKA A;  4IJ3 A;  2PVQ A;  3BCI A;  2HRN A;  2YN1 A;  2DJJ A;  1SL1 B;  1B8X A;  2B5E A;  1TK5 B;  5A5K A;  3GKN A;  4PXO A;  2R0P A;  5B8A A;  1ON4 A;  3K8N A;  2PER A;  3JCM L;  3E3E A;  3TUE A;  2GZY A;  5DVB A;  1O73 A;  3CSI A;  4EKZ A;  2CT6 A;  3F9U A;  5EPF A;  5J3R A;  4AJ6 A;  2WZ9 A;  3BJ5 A;  3DGQ A;  4F0C A;  2F8A A;  4O5U A;  8GSS A;  1OYJ A;  2LNT A;  4IBP A;  4V1A g;  5DAL A;  3GL5 A;  1GLP A;  3TRQ A;  1OC9 B;  2F51 A;  4PNG A;  2MMN A;  1SJZ A;  1EP8 A;  1R5P A;  2C3N A;  2GTU A;  3MAK A;  5CAX A;  1DBY A;  2V1M A;  3PH9 A;  5FWG A;  3W8S A;  1TP9 A;  4TXV A;  5D96 A;  1U3I A;  5ECQ B;  3FRC A;  4ZBA A;  1NHO A;  4MF6 A;  4F9Z A;  2AB6 A;  3IA1 A;  3KMO A;  4KE3 A;  4BWQ A;  1TXX A;  5IOW A;  4ISD A;  1MDI A;  2HZF A;  2H76 A;  2DJ0 A;  2K9F A;  2VL2 C;  4XIH A;  3HA9 A;  3UAP A;  4MMM A;  3U5R E;  2H74 A;  4GF0 A;  2X49 A;  4MF7 A;  4NWY A;  1ZL9 A;  3CSH A;  1VF3 A;  2H19 A;  1Y25 A;  2IMI A;  4TKY A;  2VO4 A;  4IQA A;  17GS A;  5HFG A;  3GNJ A;  5AIS A;  1SJ6 A;  6GST A;  5DAL B;  4NPB A;  4KCE A;  3M9J A;  5JWQ B;  1B4P A;  1XWB A;  5IQY A;  3N9J A;  2FWF A;  4MPF A;  1VF2 A;  3DYR A;  4LL1 B;  3ISO A;  2H66 A;  2WJU A;  4ULX A;  2TRC P;  3MWH A;  4GTU A;  3L4N A;  3CRU A;  4F82 A;  2PWJ A;  1O8W A;  1VF1 A;  5DCG A;  4HQZ A;  1KNG A;  3HDC A;  4KB3 A;  2VM1 A;  1FO5 A;  4RUV A;  5JCU A;  2GSS A;  2IME A;  3D4T A;  2CV4 A;  1ERU A;  3LQ7 A;  5CYY A;  3H8Q A;  4XS4 A;  1TRU A;  3F3Q A;  4X0X A;  5IMD A;  4JBB A;  2DML A;  2C0D A;  5DQY A;  4MH3 A;  4GLT A;  5H5S A;  1A24 A;  4J2F A;  3VLN A;  2L5L A;  1F37 A;  2EIO A;  4Z2T A;  2HNL A;  3EU3 A;  3ERG A;  4EE0 A;  3R2Q A;  4Z2U A;  2GQM A;  4K6X A;  4K5S A;  2YZU A;  3CXG A;  3DEX A;  5J5N A;  4EVM A;  2DMM A;  3FY7 A;  1A2M A;  1YJ6 A;  4KH7 A;  3QDN A;  5GSS A;  3P8W A;  4HS1 A;  1I9D A;  2GZP A;  1U6T A;  2J9H A;  2F8F A;  3UBL A;  1XWC A;  3QPM A;  5B7C A;  2HZE A;  1XFL A;  3UJ1 A;  3ZYW A;  5GZZ B;  2QA1 A;  2RII A;  2KP2 A;  3GKM A;  5CNW A;  1YF0 A;  5ID2 A;  2IMD A;  4L5O A;  3GFK A;  3DXB A;  5ECR B;  4X1U A;  2NDO A;  1ERW A;  2JAC A;  1FW1 A;  4XS4 B;  5IM9 A;  4OFN A;  1EOG A;  4ZB8 A;  1R5A A;  2X99 A;  1A0F A;  1SJI A;  3HKR A;  3D6I A;  1K0B A;  4I8B A;  1M2B A;  4MK3 A;  4EIQ A;  4GSN A;  1TK0 B;  12GS A;  3TJB A;  4JE1 A;  3PR8 A;  1ST9 A;  3GUR A;  5D9V A;  3KTB A;  4WF4 A;  2TRX A;  4MJE A;  3F8U A;  3C1S A;  3GH6 A;  3VI5 A;  4K2X A;  2B3S A;  3KZQ A;  3ZFL A;  1TK8 B;  2KUC A;  3M1G A;  2HZE B;  1YKA A;  2H8L A;  3QOU A;  1PL1 A;  1NSW A;  3D0Z A;  4L0W A;  1GL8 A;  3EPT A;  1T4Z A;  1K0A A;  1K0N A;  1WWJ A;  3RPP A;  2C0E A;  1WJK A;  5IO0 A;  1PN0 A;  1E6B A;  4TN8 A;  3US3 A;  5ID2 B;  3TJG A;  1TRV A;  4USS A;  1FG4 A;  2KOK A;  4V2M A;  1ABA A;  2OE1 A;  1Z5Y E;  3F6F A;  3MNG A;  1FHE A;  1SL2 B;  2YPM A;  1ML6 A;  3I43 A;  3F0I A;  5CRW A;  2PUK C;  2N5A A;  3L9V A;  2R37 A;  2VUP A;  1K0C A;  3G9B A;  3KIJ A;  2V6K A;  1PD2 1;  2FWH A;  4KGI A;  4HEA 2;  6GSW A;  3WYW A;  2IFQ A;  5ECH B;  3BOA A;  1Q4J A;  1JZD A;  5ELG A;  3CMI A;  2YOI A;  3APS A;  3U6V A;  2VCV A;  3VK9 A;  4ECC A;  2HSH A;  4POM A;  4KSO A;  2I3Y A;  4ECI A;  3RPN A;  4JR4 A;  2KP1 A;  1W4V A;  3ED3 A;  1GNE A;  2A2R A;  4GQF A;  2QC7 A;  1XWK A;  1SL0 B;  4WBR D;  3QAG A;  4N0V A;  5ECI B;  1HNB A;  3ZZX A;  3LXZ A;  3KD0 A;  1TRW A;  1F6M C;  3KP9 A;  1GSD A;  4FIW A;  4L8E A;  1PGT A;  4TRX A;  5ECL B;  4RQX A;  2H73 A;  1GSQ A;  1XOB A;  4KDU A;  3L9S A;  2UZ8 A;  4AGS A;  2R3X A;  3A2V A;  4GQC A;  1BED A;  1GP1 A;  3HY2 A;  2RM5 A;  1T3B A;  2I4A A;  4YQV A;  4IJI A;  2IFQ B;  3F4R A;  3N5O A;  1RK4 A;  3IXR A;  16GS A;  2CAI A;  2F9S A;  4NAX A;  5HFI A;  14GS A;  4TR1 A;  2AYT A;  3GHA A;  2N5F A;  2JZS A;  2ES7 A;  3EC3 A;  4IS0 A;  3MSZ A;  1G6W A;  4WKW A;  1HD2 A;  1X9W B;  5EVO A;  3EVI A;  4F03 A;  1GSE A;  4KSM A;  1AC1 A;  4GRF A;  1OVN A;  4G19 A;  1JZR A;  3IC8 A;  2X4A A;  3LEF A;  2DKH A;  1TTZ A;  2VLV A;  1K0O A;  3IHQ A;  2OBI A;  1TJD A;  1XPV A;  2L4Q A;  4JRR A;  4O5R A;  4PQ1 A;  4HJM A;  4MZC A;  3ZIT A;  2B7K A;  4OCF A;  4ID0 A;  4DSQ A;  2LJK A;  4TR3 A;  1IYI A;  1SK1 A;  3IE3 A;  4GST A;  4JU5 A;  2GSR A;  3GMF A;  1MDK A;  4GSS A;  2GVP A;  5G5E A;  2P5Q A;  3ZIJ A;  3H93 A;  3A5W A;  4GCI A;  1ZCP A;  2D2Z A;  1U3A A;  1ACV A;  2VIM A;  1C72 A;  1XVW A;  1WP0 A;  2IPA A;  2M46 A;  3APO A;  5B6M A;  1M2D A;  3KEB A;  1K3O A;  4AJ8 A;  3OR5 A;  3CRT A;  4QL9 A;  4OO4 A;  5JWR B;  3HZ8 A;  4WR5 A;  4WXT A;  4Q5N A;  1BG5 A;  3FR6 A;  4LL4 B;  1W89 A;  4TR1 B;  3GV1 A;  2VLU A;  3VWW A;  2AUV A;  4EF0 A;  2QA2 A;  2YJH A;  2G0F A;  1AQW A;  5AIV A;  3IV4 A;  4WET A;  2FGX A;  4ICY A;  1XW5 A;  3ZVJ D;  2JZR A;  2LS5 A;  2C0F A;  3FZ5 A;  3QAV A;  3TRP A;  5IMC A;  4OO5 A;  1VRS D;  4ZIJ A;  4MA9 A;  1OC8 A;  3ZTL A;  3UBK A;  2DIZ A;  2H6Z A;  3EUR A;  4K7I A;  4NXI A;  2AJQ B;  3O6T A;  2VL3 A;  1Y6E A;  3F4T A;  3ZMK A;  4TOP A;  3QCP A;  3Q74 A;  5AGY A;  3IK9 A;  2XPD A;  1EGR A;  3LJR A;  3BBY A;  3C7M A;  1AQX A;  4EO3 A;  4XS6 A;  2GZZ A;  1PKW A;  3M0F A;  1EGO A;  3GRX A;  4Z7X A;  4YQM A;  3VPQ A;  9GSS A;  1EP7 A;  2X64 A;  1OE7 A;  2P0G A;  1UVZ A;  1MDJ A;  1O6J A;  4L5L A;  3MIX A;  5CP1 A;  1YEX A;  3HYP A;  1QGV A;  3E0U A;  1EEM A;  3ME8 A;  2ON7 A;  5D8I A;  4FYB A;  5IOX A;  5GAN D;  1LJR A;  2NPB A;  1G6Y A;  1OKD A;  2VCT A;  4NHW A;  3HJO A;  2JU5 A;  2YWM A;  2K8S A;  3KTL A;  2DJ2 A;  2P31 A;  3RDW A;  2FNO A;  1LU4 A;  3HD5 A;  1LBK A;  1GTB A;  3F6D A;  4JED A;  4NMU A;  1SK0 A;  2QGV A;  5DAK A;  4POL A;  1GNW A;  1R7H A;  2V41 A;  2WGR A;  4OCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...