4K2DA

Crystal structure of burkholderia pseudomallei dsba
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
191
structure length
191
Chain Sequence
SPSAPVAGKDFEVMKSPQPVSAPAGKVEVIEFFWYGCPHCYEFEPTIEAWVKKQGDKIAFKRVPVAFRDDFVPHSKLFYALAALGVSEKVTPAVFNAIHKEKNYLLTPQAQADFLATQGVDKKKFLDAYNSFSVQGQVKQSAELLKNYNIDGVPTIVVQGKYKTGPAYTNSLEGTAQVLDFLVKQVQDKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thiol:disulfide interchange protein
publication title Disarming Burkholderia pseudomallei: Structural and Functional Characterization of a Disulfide Oxidoreductase (DsbA) Required for Virulence In Vivo.
pubmed doi rcsb
source organism Burkholderia pseudomallei
total genus 60
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2013-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4k2dA00
4NMUA 2B5EA 3A2XA 3KMNA 5ECIB 1IYHA 5J9BA 4J57E 2VLVA 5JWOB 5IMVA 1GSFA 3WT1A 1TI3A 2GZYA 2H6XA 3FR3A 2H71A 1Z6NA 2L6CA 3A2VA 3GKMA 1O85A 2VM1A 5F05A 2PGTA 4G10A 4WBRD 5HQPA 1KTEA 4EVMA 4HQZA 1WPIA 3GX8A 1O7UA 4BWSA 2C1YA 2I4AA 2RLIA 4ZILA 1EOGA 2M46A 4HI7A 1T4YA 4TOPA 4GSTA 2YANA 5J4UA 3LGCA 2BMXA 5B8AA 2C0GA 2GQMA 2V2GA 3TCOA 4ZL9A 2B5YA 1ZGNA 3GL3A 1TRSA 4XHMA 2O89A 4LLRA 4MPFA 4Q5RA 3LXTA 4PX1A 5G2ZA 3HYPA 3EMXA 5ECMB 3L9VA 1V98A 2DJ3A 1ZYEA 3LYPA 5LD0A 5HR3A 5D9VA 4TXOB 1U6TA 4DSRA 3CYNA 1K3YA 4POLA 2GGTA 3KMOA 5JCWA 1NM3A 4RQRA 2N5FA 2HNLA 1K3OA 2TIRA 4OCFA 2DJ1A 1R26A 3KZQA 4N10A 1TW9A 4WR4A 2MMOA 1WRYA 4MA9A 2K8VA 2JZTA 2QGVA 5ECNB 1M2DA 5CP1A 1T1VA 1GH2A 3M8NA 3A2WA 3APQA 3TKSC 4KDXA 2OE1A 3ZREA 3RPNA 3US3A 1ERTA 3GURA 3D22A 3GH6A 3IR4A 4JEDA 3IE3A 2GSTA 3S9FA 4IQAA 1R5PA 1AIUA 2TRXA 2YNXA 6GSWA 5IMDA 5ID2A 1QK8A 1FAAA 4IQ1A 2WB9A 3E0UA 4MF6A 1XBSA 4PURA 3BJ5A 1W89A 3F63A 2IMKA 2GQKA 2PBJA 1AC1A 5DAKA 3APSA 4GQFA 3TJGA 3KH9A 3CMIA 2BTOT 2CZ3A 3VWUA 3C73A 1GSDA 1XWAA 1WP0A 3TKSE 3PINA 3H79A 2GVPA 2JU5A 3EINA 2EIOA 1S3CA 3KEBA 1A2LA 3FY7A 4IS0A 5H5RA 1J0FA 3LG6A 1J08A 2OE3A 2WS2A 2X8CA 1Z9HA 1XOAA 4ZB9A 1PGTA 6GSYA 3DMLA 4G9HA 3V1WA 3FW2A 3TKRA 1GUKA 3D21A 1SK1A 2H70A 2I81A 5ECQB 3ZLPA 2FWGA 2V6OA 3DWVA 3TKPA 1A2JA 2EIQA 4PQ1A 3LSZA 3M3MA 3F0IA 3L9UA 2H1AA 1X9SB 2LV3A 5ECKB 5CO3A 3DYRA 4D73A 1AQWA 3EURA 2CX4A 3CSHA 4ZL7A 3HDCA 3UVTA 4OFNA 3FEUA 1O6JA 2ZUPA 3GV1A 3BCIA 5DBQA 1K3LA 4K7OA 2L5LA 5E59A 1ZCPA 1PA3A 5KN0A 1B4QA 3VURA 2H1DA 1GRXA 5KEJA 4HEA2 3GA4A 3QD9A 1SJIA 4IVFA 19GSA 2H6YA 2PPTA 5AGYA 4JE1A 1OC8A 3VI7A 3ZVJA 1GTUA 3GUSA 2DIZA 1TK0B 2F3MA 3KCMA 1OC3A 4EDZA 5CNWA 1A2MA 5G5FA 4MJEA 2RM5A 1K0NA 2LJAA 2LRNA 1XIYA 3QFBC 2WGRA 1AQXA 1AQVA 2FHEA 2GSRA 4POBA 2VL3A 3KXOA 2GT5A 4F0BA 3IAS2 4GSSA 3W8SA 5IQYA 1SD8A 1MD3A 3IV4A 3CSIA 3PR8A 3TDGA 1BYEA 4HJMA 1E6BA 4MJAA 3VPTA 3K8NA 3E3EA 2CVKA 2H0HA 3Q19A 3VWVA 10GSA 3RHCA 1I5GA 1V40A 2KHPA 3HJMA 4JR6A 1K0DA 4PXOA 2CVBA 2R3XA 4E8EA 1XVWA 3HVSA 1M9AA 2C3QA 2V6KA 2X8HA 1YEXA 3QCPA 5AIVA 2YP6A 3CTFA 2B3SA 4QQ7A 1YQ1A 4YAVA 1NSWA 2A2RA 4E8HA 4F0CA 3FR6A 1BQ7A 1J9BA 4X0XA 3ZL5A 1QMVA 5EVOA 1SKSB 4TR0A 5CRWA 5JWRB 1DBYA 2JACA 1X5CA 3I6AA 1HNBA 1EZKA 1BX9A 3N9JA 4YQVA 3FRCA 4KGIA 1BEDA 2HE3A 3W8JA 2MMAA 3LQ7A 17GSA 3HZ4A 5HFKA 1ZOFA 3AY8A 3PH9A 5J5NA 5AISA 1MEKA 2L57A 3NIVA 1QQ2A 2NPBA 4K7IA 3RPPA 3M0FA 1BJXA 1F3AA 4ZBBA 4KSOA 2YZUA 1X9WB 1WMJA 4MH2A 4MF5A 1TKDB 3UJ1A 3DEXA 1K0OA 5INYA 4AF2A 3IK7A 1TRUA 2CAQA 1EEJA 3TRPA 4RI6A 1PRXA 4ISDA 2ZNMA 3RAZA 1ML6A 2BJXA 3VLNA 1PX6A 1XWGA 3F4SA 2DC5A 3CSJA 4MK3A 3I43A 1G7OA 4FYCA 3KJYA 2PUKC 1N8JA 3HXSA 3EC3A 4GXZA 5D96A 5B8BA 2LTKA 1TRWA 5E4WA 3LXZA 2E2MA 1Y6EA 4WBJA 2B7KA 4PGTA 5HR2A 3DVWA 2JZSA 2N5AA 4HU7A 1EGOA 2HXKA 4MABA 4ZBAA 4WETA 5IOXA 2LS5A 2CT6A 1SK2A 1HD2A 4HDEA 5JWQB 1HNCA 2ON5A 5G30A 2IL3A 2A2SA 3SWLA 3QAWA 3LEFA 4HOJA 2C0FA 3BD2A 4XS6A 5C04A 5AIXA 1B9YC 1JZRA 3Q6OA 3G7IA 5A4WA 2FUG2 4ILFA 1THXA 3C71A 2HYXA 2IIYA 1A0RP 4BVXA 14GSA 2NBSA 3TJKA 3UEMA 3IC4A 2C3NA 1SJ6A 1USBA 4WEYA 1EV9A 3KM6A 3HHVA 2IN3A 1GTBA 3NOFA 4O7HA 1HQOA 1Q4JA 5IM9A 5G1KA 1SL2B 4ULXA 4OO4A 6GSXA 2REMA 1Z7PA 3O3TA 4P3YB 5IMFA 3QFAC 1X9MB 3GYKA 2CQ9A 1H75A 1HNAA 3EVIA 4IJ3A 2F8FA 5ECLB 2RIIA 2DSAA 4MLYA 3KH7A 5IO2A 1GSEA 3G9BA 1NHYA 1U3IA 4DSSB 4PQHA 4AJ6A 1DUGA 2K9FA 4J2FA 4V2LA 2H6ZA 1F37A 1GNEA 5KN2A 2MBSA 1MTCA 3C7MA 2H1BA 3EU4A 4XRDA 4ZB6A 2AJQB 1PMTA 1O81A 2C0DA 2VL9A 3FK8A 2L5OA 2HZEB 1N2AA 2QC7A 4LMVA 4G2EA 2R6KA 3NZNA 3P8WA 5IPHA 5IOWA 1MDKA 4JBBA 1GLQA 4L5LA 5IPGA 2B5XA 5A4UA 1VF2A 2R37A 1Q98A 4RI7A 5DCHA 4EKZA 4MPGA 2P0GA 2B7JA 2E7PA 1EV4A 3IHQA 4HJ2A 3RHBA 3GRXA 4K0NA 3GMFA 4IKHA 4XS4A 3EE2A 3TKSA 4BPYA 3UVHA 4TR4A 5JCUA 4L0UA 2GLRA 4NHWA 5EL8A 3U6VA 4KH7A 4OO5A 4MJBA 1OVNA 2HT9A 4TW5A 3FYGA 6GSTA 4N30A 3TB2A 3QMXA 2B1KA 2WFCA 4DVCA 2H0IA 4PUFC 2EIRA 2JSYA 3GSTA 1GTAA 3ZITA 1Z5YE 2EC4A 3TRXA 4V2MA 3MDKA 1AXDA 3EMPA 5DJMA 1B48A 3ED3A 1PL2A 2YWOA 1TI1A 4TR1B 2DMMA 2H73A 2LEGA 4MZWA 5B6MA 3R2QA 3QOUA 5DQYA 3CRUA 4GSNA 4POMA 4XCSA 1C72A 4WXTA 1WE0A 3UIWA 2XPEA 3GTUB 2O7KA 2FD3A 4KB3A 1QXHA 2R4VA 4ZB8A 3E9JB 3CBUA 4K9ZA 1F2EA 1K0AA 2LQOA 1B9XC 2LRCA 3Q74A 3UMAA 4JZQA 2FWFA 3FZ9A 4GF0A 3TJJA 4K1FA 1V58A 4Q5NA 1TK8B 3DRNA 2AAWA 3D4MA 2PVOC 5ECOB 2DIYA 3FZAA 2NVLA 4CDOA 2KP1A 1GUHA 3FHKA 4DEJA 1XZOA 2GT6A 2QKEA 3DIEA 4ML6A 4NXIA 4L8EA 3DGQA 3GKNA 2V41A 1FOVA 1SD9A 3KP9A 4Q5FA 1URMA 2C4JA 2H19A 3ZTLA 4ML1A 1YDKA 3F3RA 1KNGA 6GSUA 1WWJA 3BOAA 4I8BA 3WGEA 7GSSA 1X0RA 1Y25A 2LNTA 3F3QA 3HY2A 4ID0A 4F03A 5GZZB 4I6XA 2DBCA 2FCHA 5C00A 3IDVA 1T8EB 3ZMLA 5CRGA 2DLXA 1THOA 2WZ9A 1FVJA 4I97A 3RDWA 4MH3A 1A0FA 3C8EA 3GX0A 1KEBA 3H8QA 2RM6A 4KCEA 1TXXA 3DVXA 3HJOA 3HKRA 4K0GA 3KTLA 4PNGA 3GN3A 2H01A 4NWYA 9GSSA 1FB6A 3P90A 3M9KA 2L4QA 1UC7A 5ECRB 1JZOA 5B7CA 4GCIA 2WDUA 3ZMKA 4F9ZA 1V9WA 3ME8A 3IPZA 4BA7A 5ECHB 1JFUA 1ACVA 1OE8A 1TTZA 2X64A 3D5JA 2G0FA 4FIWA 4KUNA 5IO0A 4OD7A 3EWLA 1PQNA 4MCUA 2OKAA 2OBIA 4YQUA 2PMTA 1SL1B 1M0UA 5GAND 1GTIA 1R7HA 2LJKA 1S3DA 2YWIA 1MD4A 1EWXA 1M99A 1A24A 5DCGA 3GFKA 5D73A 3UL3A 1FHEA 4TXOA 2YWMA 4G19A 2D2ZA 1ERVA 2KUCA 5IMAA 4HS1A 5HR1A 2G2QA 2OACA 3C1RA 1ERUA 1PN9A 4PUAA 3N5OA 5DDLA 1G7EA 4MZBA 2OJLA 1ZYQB 2FA8A 1AW9A 2IPAA 1FW1A 2L4CA 2VL2A 3TGZA 4BVYA 4K6XA 4KW6A 1PL1A 1MDJA 1T3BA 2OE0A 3VK9A 5HR0A 3L9SA 1TU8A 2X8GA 3ERFA 2H0GA 3ZVJD 2LSTA 5F06A 1XVQA 5DAKB 1NHOA 2CAIA 4KAEA 4K2DA 4N0VA 2I3YA 2VCZA 1GUMA 5DQSA 2GSSA 4FYBA 1YJ6A 3LORA 3MNGA 3L4NA 3MAKA 1SU9A 1TP9A 2R2JA 4I2UA 22GSA 2L59A 2PWJA 4POKA 4EUYA 5H5QA 1Z3EA 2IFQB 1T7PB 1SENA 1LBKA 2OA7A 2XPDA 1O8WA 6GSSA 5H5SA 1HYUA 2CV4A 3GIXA 3G7JA 1XW9A 2ES7A 2OBKA 1GNWA 1ZZYA 2CZ2A 2P5QA 3TJBA 2FGXA 2OADA 1JZDA 4CW9A 1VF4A 2L6DA 2B1LA 1VF3A 1XWCA 5FHIA 3UAPA 1GWCA 2P31A 4I5QA 4TR1A 2O87A 2XHFA 2H74A 4TR3A 3F4TA 2GS3A 1YF0A 4X43A 6GSVA 2AHEA 4ACSA 4D73B 11GSA 3HCZA 1Z7RA 4ECIA 2E0QA 5A4VA 4ZXGA 1GSSA 4I2TA 2IJYA 2QSIA 1SK0A 2V32A 3I9V2 1K0BA 4ECCA 1EP7A 4EE0A 3GKKA 5D9WA 1O73A 4JRRA 2LQQA 2C80A 1ON4A 5IMZA 3VI5A 4GWRA 4FYUA 3H1NA 2O8VB 5DALB 3JCML 1XXUA 5F07A 1XFLA 2GQLA 3D6IA 5ECSA 5LCZA 2N5BA 1XCCA 1UA5A 2PVQA 4K8MA 4LL4B 5ABRA 3BBYA 4L5OA 5GSTA 2J23A 2VD0A 5JCGA 3ZRDA 2PU9C 2VIMA 1GSQA 2HLSA 2MZCA 4TN8A 4IGJA 4EL1A 3LYKA 1EGRA 3P7XA 2VCXA 3EU3A 3DKSA 4RUVA 1I9DA 1TRVA 2IMIA 2I9HA 4AGSA 4XIHA 1T00A 3UBLA 1B8XA 2MMZA 4EO3A 1OC9B 2DJ0A 4RQXA 3J7Yb 1FG4A 2KP2A 1GSUA 4IP1A 1SL0B 2YCDA 4MMMA 4XTSA 1E2YA 3D4TA 2AV4A 2YOIA 4LMWA 1YZXA 5IMCA 2P5RA 4ZIJA 4NPBA 1JZWA 1AUCA 3H4KA 2FY6A 2VUPA 5ECPB 3IK9A 2K8SA 2HRNA 3KP8A 5G1LA 1O8XA 2C0EA 1ZMAA 4FO5A 4XRAA 3M9JA 4WR5A 1QGVA 5IIZA 1XOBA 2KLXA 4IW9A 1DE1A 2F8AA 4F2IA 2XBIA 2JL4A 4EC0A 3BCKA 1M2BA 4O5RA 4IHUA 4HZ4A 5ELGA 2FLSA 4KA0A 4HUAA 2VCQA 1VF1A 4IJIA 4BL7A 2LJRA 4OFMA 3UARA 3EYTA 2RUFA 4KNDA 2H1GA 2HZFA 4N0ZA 1XW5A 3F6FA 4GQCA 1AAZA 2J9HA 1ZL9A 3OR5A 4XS1A 3IRAA 1A8LA 1SKRB 3SBCA 1BAYA 1WIKA 4QL9A 5CAXA 3GL5A 2FA4A 2H75A 1U88A 3CRTA 5J9CA 1QFNA 4GLTA 3TRQA 1XWKA 4ECJA 1G6WA 3ZZXA 1LU4A 1T4ZA 1GSYA 2CA8A 2AB6A 3GNJA 4N11A 3LFLA 1V57A 2VCVA 1R4WA 2VM2A 1TJDA 3PGTA 4KX4A 5F0GA 4NHZA 3O76A 2VCTA 5DVBA 3VWWA 1Z6MA 3APOA 4LL1B 1OYJA 3WGXA 1F3BA 2YJHA 4O32A 1R5AA 1RK4A 1LJRA 2CX3A 4V1Ap 5G31A 2LKUA 2YWNA 1W4VA 3KIJA 1OAZA 3IXRA 1K0CA 1MDIA 1SJZA 2MBTA 1EP8A 2YJ7A 2GDRA 3QR6A 5D8IA 3WGDA 5KN3A 2VOCA 2YV9A 5F8BA 1WJKA 4JU5A 4OMVA 1RQMA 2GZZA 4WKWA 2FNOA 2IFQA 4DSQA 5CYYA 3VWXA 4OCEA 1VGLA 2C8UA 3D0ZA 2IWTA 4PNFA 1YY7A 1PKWA 3HD5A 2AUVA 1UVZA 3CXGA 1DSBA 4NV5A 2LNSA 3I69A 3G7YA 4F82A 3DXBA 2HSHA 4QL7A 4TXVA 1H4OA 4ECBA 3IAM2 2AYTA 4OFTA 3TOUA 5G5EA 3LWAA 20GSA 1JHBA 3TKQA 1YEPA 2GTUA 2VAFA 4ZBDA 3UBKA 1G0TA 3GHAA 12GSA 1EOHA 3M1GA 5D9TA 3P2AA 2VLUA 5AN1A 1UN2A 3GSSA 3L0HA 5KN1A 3ISOA 3ZFBA 1FB0A 4GTUA 2DMLA 3GH9A 2KOKA 3FZ5A 3Q18A 2LRTA 3ME7A 2NTOA 1A8YA 1G6YA 2IMFA 4HZ2A 3L78A 1IYIA 1SYRA 1GL8A 3ERGA 4K7NA 4NV2A 4AJ8A 5DALA 4Z7XA 3FR9A 2H66A 1TK5B 5ELAA 1ABAA 4TRXA 5COHA 2F9SA 3TOTA 2MYGA 4YH2A 1JLVA 3KGKA 5CRHA 1TOFA 2GZPA 1X5EA 1WOUA 2WJUA 5L71A 4Q5QA 4KCAA 2DJ2A 2K18A 4MF7A 1M2AA 3A3TA 2ALBA 1FO5A 3QDNA 1RW1A 3MWHA 13GSA 5J41A 3CTGA 1QUWA 1PKZA 1S3AA 2HFDA 1U3AA 2H72A 5GSSA 3F4RA 4V2NA 4WF5A 2YV7A 2H30A 1OC9A 5EPFA 1EEMA 1SYXA 2CVDA 4YAPA 1OKDA 3MSZA 4DSSA 5B6NA 4IBPA 5HFGA 5D93A 3DD3A 3WYWA 3HVVA 1ILOA 3KTBA 2M72A 3WD6A 1OE7A 2YN1A 4WF4A 5GAPD 4XS4B 2M80A 1ERWA 1K0MA 4H86A 2XBQA 3ZFLA 4IN0A 2HZEA 4GRFA 1YKCA 2TRCP 3QPMA 5CREA 5J3RA 2JZRA 2HRFA 3GKXA 4MZCA 1VRSD 1FVKA 2B6MA 5ENUA 2WULA 2ZCTA 1CQGA 2DJKA 2H8LA 4J56E 5ID2B 5FT3A 1XW6A 2PERA 2V1MA 3KD0A 4KE3A 2K6VA 5LNKe 1DE2A 1TU7A 2A4VA 4IP6A 1GP1A 4L0WA 2GSQA 1SKWB 5A5KA 3U5RE 4MJCA 1F9MA 1V2AA 2E2GA 1CQHA 5EY6A 4YQMA 1M7TA 2VL2C 2FWEA 2YZHA 2VD1A 3HZ8A 3RBTA 2LUSA 4TVEA 1YF1A 1JLWA 2WCIA 3IA1A 3ZYWA 3ZIVA 2RUEA 4MP4A 2HI7A 1TDIA 3O6TA 3FKFA 3VPQA 3VFIA 2X99A 1M9BA 4AJ7A 3HA9A 16GSA 3LJRA 4HQSA 1KBNA 1YKAA 3WT2A 1BG5A 1PSQA 1U87A 1PX7A 3QAVA 5FWGA 2H76A 1A23A 2IMEA 1NW2A 1GLPA 4V1Ag 4TKYA 2NDOA 4X1UA 4EXJA 8GSSA 2VCWA 2IMDA 4ZL8A 1XPVA 3TUEA 2VO4A 4BWQA 5D9XA 3W6GA 2JADA 2O85A 1OKTA 4NAXA 1GULA 2HSYA 4HU9A 18GSA 2DJJA 2F51A 5DJLA 3HVXA 4EDYA 3F9UA 3F8UA 2JSZA 4PQIA 3ZIJA 3IBHA 5HFIA 3UOMA 3TJFA 4O92A 4OWYA 3IOSA 4KSMA 3GTUA 3J7Yk 2PN8A 2FWHA 2ON7A 4JR4A 2YPMA 2MMNA 4EF0A 2WRTA 4KDUA 4MDCA 4KDYA 5CRDA 2XC2A 3QAGA 4FH8A 2Z9SA 3FZ4A 3H93A 1B4PA 1F6MC 3ERWA 4IELA 2VLTA 2I1UA 3C1SA 1PD21 2C3TA 1XWBA 1ST9A 1X5DA 3HJPA 2R5GA 4LA1A 3F6DA 3A5WA 4CHSA
chains in the Genus database with same CATH superfamily
4NMUA 2B5EA 3A2XA 3KMNA 5ECIB 1IYHA 5J9BA 4J57E 2VLVA 5JWOB 5IMVA 1GSFA 3WT1A 1TI3A 2GZYA 2H6XA 3FR3A 2H71A 1Z6NA 2L6CA 3A2VA 3GKMA 1O85A 2VM1A 5F05A 3MIXA 2PGTA 4G10A 4WBRD 5HQPA 1KTEA 4EVMA 4HQZA 1WPIA 3GX8A 1O7UA 4BWSA 4G0IA 2C1YA 2I4AA 2RLIA 4ZILA 1EOGA 2M46A 4HI7A 1T4YA 4TOPA 4GSTA 2YANA 5J4UA 3LGCA 2BMXA 5B8AA 2C0GA 2GQMA 2V2GA 3TCOA 4ZL9A 2B5YA 1ZGNA 3GL3A 1TRSA 4XHMA 2O89A 4LLRA 4MPFA 4Q5RA 3LXTA 4PX1A 5G2ZA 3HYPA 3EMXA 5ECMB 3L9VA 1V98A 2DJ3A 1ZYEA 3LYPA 5LD0A 5HR3A 5D9VA 4TXOB 1U6TA 4DSRA 3CYNA 1K3YA 4POLA 2GGTA 3KMOA 5JCWA 1NM3A 4RQRA 2N5FA 2HNLA 1K3OA 2TIRA 4OCFA 3A5IA 2DJ1A 1R26A 3KZQA 4N10A 1TW9A 4WR4A 2MMOA 1WRYA 4MA9A 4A5PA 2K8VA 2JZTA 2QGVA 1M3JA 1FOHA 5ECNB 1M2DA 5CP1A 1T1VA 1GH2A 3M8NA 3A2WA 4O5QA 3APQA 3TKSC 4KDXA 2OE1A 3ZREA 3RPNA 3US3A 1ERTA 3GURA 3D22A 3GH6A 3IR4A 4JEDA 3IE3A 2GSTA 3S9FA 4IQAA 1R5PA 1AIUA 2TRXA 2YNXA 6GSWA 5IMDA 5ID2A 1QK8A 1FAAA 4IQ1A 2WB9A 3E0UA 4MF6A 1XBSA 4PURA 3BJ5A 1W89A 3F63A 2IMKA 2GQKA 2PBJA 1AC1A 5DAKA 3APSA 4GQFA 3TJGA 3KH9A 3CMIA 2BTOT 2CZ3A 3VWUA 3C73A 1GSDA 1XWAA 1WP0A 3TKSE 3PINA 3H79A 2GVPA 2JU5A 3EINA 2EIOA 1S3CA 3KEBA 1A2LA 3FY7A 4IS0A 5H5RA 1J0FA 3LG6A 1J08A 2OE3A 2WS2A 2X8CA 1Z9HA 1XOAA 4ZB9A 1PGTA 6GSYA 3DMLA 4G9HA 3V1WA 3FW2A 3TKRA 1GUKA 3D21A 1SK1A 2H70A 2I81A 5ECQB 3ZLPA 2FWGA 2V6OA 3DWVA 3TKPA 1A2JA 2EIQA 4PQ1A 3LSZA 3M3MA 3F0IA 3L9UA 4BVXB 2H1AA 1X9SB 2LV3A 5ECKB 5CO3A 3DYRA 4D73A 1AQWA 3EURA 2CX4A 3CSHA 4ZL7A 5KOXA 3HDCA 3UVTA 4OFNA 3FEUA 1O6JA 2ZUPA 3GV1A 3BCIA 5DBQA 1K3LA 4K7OA 2L5LA 5E59A 3CQFA 1ZCPA 1PA3A 5KN0A 1S3RA 1B4QA 3VURA 2H1DA 1GRXA 5KEJA 4HEA2 3GA4A 3QD9A 1SJIA 4IVFA 19GSA 2H6YA 2PPTA 5AGYA 4JE1A 1OC8A 3VI7A 3ZVJA 1GTUA 3GUSA 2DIZA 1TK0B 2F3MA 3KCMA 4K5SA 1OC3A 4EDZA 5CNWA 1A2MA 5G5FA 4MJEA 2RM5A 1K0NA 2LJAA 2LRNA 4USSA 1XIYA 3QFBC 2WGRA 1AQXA 1AQVA 2FHEA 2GSRA 4POBA 2VL3A 3KXOA 2GT5A 4F0BA 3IAS2 4GSSA 3W8SA 5IQYA 1SD8A 1MD3A 3IV4A 3CSIA 3LW9A 3PR8A 1BYEA 3TDGA 4HJMA 1E6BA 4MJAA 3VPTA 3K8NA 3E3EA 2CVKA 2H0HA 3Q19A 3VWVA 10GSA 3RHCA 1I5GA 1V40A 2KHPA 3HJMA 4JR6A 4BL7B 1K0DA 4PXOA 2CVBA 2R3XA 4E8EA 1XVWA 3HVSA 1M9AA 2C3QA 2V6KA 2X8HA 1YEXA 3QCPA 5AIVA 2YP6A 3CTFA 2B3SA 4QQ7A 1YQ1A 4YAVA 1NSWA 2A2RA 4E8HA 4F0CA 3FR6A 1BQ7A 1J9BA 4X0XA 3ZL5A 1QMVA 5EVOA 1SKSB 4TR0A 5CRWA 5JWRB 1DBYA 2JACA 1X5CA 3I6AA 4MNNA 3FMWA 1HNBA 1EZKA 1BX9A 3N9JA 4YQVA 3FRCA 4KGIA 1BEDA 2HE3A 3W8JA 2MMAA 3LQ7A 17GSA 3HZ4A 5HFKA 1ZOFA 3AY8A 3PH9A 5J5NA 5AISA 1MEKA 2L57A 3NIVA 1QQ2A 2NPBA 4K7IA 3RPPA 3M0FA 1BJXA 1F3AA 4ZBBA 4KSOA 2YZUA 1X9WB 1WMJA 4MH2A 4MF5A 2HSMA 1TKDB 3UJ1A 3DEXA 1K0OA 5INYA 4AF2A 3IK7A 1TRUA 2CAQA 1EEJA 3TRPA 4RI6A 1PRXA 4ISDA 2ZNMA 3RAZA 1ML6A 2BJXA 3VLNA 1PX6A 1XWGA 3F4SA 4CY8A 2DC5A 3CSJA 4MK3A 3I43A 1G7OA 4FYCA 3KJYA 2PUKC 1N8JA 3HXSA 3EC3A 4GXZA 5D96A 5B8BA 2LTKA 1TRWA 5E4WA 3LXZA 2E2MA 1Y6EA 4WBJA 2B7KA 4PGTA 5HR2A 3DVWA 2X4AA 4EIPA 2JZSA 2N5AA 4HU7A 1EGOA 2HXKA 4MABA 4ZBAA 4WETA 5IOXA 2LS5A 2CT6A 1SK2A 1HD2A 4HDEA 5JWQB 1HNCA 2ON5A 5G30A 2IL3A 2A2SA 3SWLA 3QAWA 3LEFA 4HOJA 2C0FA 3BD2A 4XS6A 3EPTA 5C04A 5AIXA 1B9YC 1JZRA 3Q6OA 3G7IA 5A4WA 2FUG2 4ILFA 1THXA 3C71A 2HYXA 2IIYA 1A0RP 4BVXA 14GSA 2NBSA 3TJKA 3UEMA 3IC4A 2C3NA 1SJ6A 1USBA 4WEYA 1EV9A 3KM6A 3HHVA 2IN3A 2X49A 1GTBA 3NOFA 4O7HA 1HQOA 1Q4JA 5IM9A 5G1KA 1SL2B 1ZYNA 4ULXA 4OO4A 6GSXA 2REMA 1Z7PA 3O3TA 4P3YB 5IMFA 3QFAC 1X9MB 3GYKA 2CQ9A 1H75A 1HNAA 3EVIA 4IJ3A 2F8FA 5ECLB 2RIIA 2DSAA 4MLYA 3KH7A 5IO2A 1GSEA 3G9BA 1NHYA 1U3IA 4DSSB 4PQHA 4AJ6A 1DUGA 2K9FA 4J2FA 4V2LA 2H6ZA 1F37A 1GNEA 5KN2A 2MBSA 4KF9A 1MTCA 3C7MA 2H1BA 3EU4A 4XRDA 4ZB6A 2AJQB 1PMTA 1O81A 2C0DA 2VL9A 3FK8A 2L5OA 2HZEB 2DKIA 3PPUA 1N2AA 2QC7A 4LMVA 4G2EA 4G0LA 2R6KA 3NZNA 3P8WA 5IPHA 5IOWA 1MDKA 4JBBA 1GLQA 4L5LA 5IPGA 2B5XA 5A4UA 1VF2A 2R37A 1Q98A 4BVYB 4RI7A 5DCHA 4EKZA 4MPGA 2P0GA 2B7JA 2E7PA 1EV4A 3IHQA 4HJ2A 3RHBA 3GRXA 4K0NA 3GMFA 4IKHA 4XS4A 3EE2A 3TKSA 4BPYA 3UVHA 4TR4A 5JCUA 4L0UA 2GLRA 4NHWA 4ICYA 5EL8A 3U6VA 4KH7A 4OO5A 4MJBA 1OVNA 2HT9A 4TW5A 3FYGA 6GSTA 4N30A 3TB2A 3QMXA 2B1KA 2WFCA 4DVCA 2H0IA 4PUFC 2EIRA 2R0GA 2JSYA 3GSTA 1GTAA 3ZITA 1Z5YE 2EC4A 3TRXA 5BRTA 4V2MA 3MDKA 1AXDA 3EMPA 5DJMA 1B48A 3ED3A 1PL2A 2YWOA 1TI1A 4TR1B 2DMMA 2H73A 2LEGA 4MZWA 5B6MA 3R2QA 3QOUA 5DQYA 4G0KA 3CRUA 5KOWA 4GSNA 4POMA 4XCSA 1C72A 4WXTA 1WE0A 3UIWA 2XPEA 3GTUB 2O7KA 2FD3A 4KB3A 1QXHA 2R4VA 3IHGA 4ZB8A 3E9JB 3CBUA 4K9ZA 1F2EA 1K0AA 2LQOA 1B9XC 2LRCA 3Q74A 3UMAA 4JZQA 2FWFA 3FZ9A 4GF0A 3TJJA 4K1FA 1V58A 4Q5NA 1TK8B 3DRNA 2AAWA 3D4MA 2PVOC 5ECOB 2DIYA 3FZAA 2NVLA 4CDOA 2KP1A 1GUHA 3FHKA 4DEJA 3R3EA 1XZOA 2GT6A 2QKEA 3DIEA 4ML6A 4NXIA 4L8EA 3DGQA 3GKNA 2V41A 1FOVA 1SD9A 3KP9A 4Q5FA 1URMA 2C4JA 2H19A 3ZTLA 4ML1A 1YDKA 3F3RA 1KNGA 6GSUA 1WWJA 3BOAA 4I8BA 2R0PA 3WGEA 7GSSA 1X0RA 1Y25A 2LNTA 3F3QA 3HY2A 4ID0A 5BMUA 4F03A 5GZZB 4I6XA 2DBCA 2FCHA 5C00A 3IDVA 4BIKA 1T8EB 3ZMLA 5CRGA 2DLXA 1THOA 2WZ9A 1FVJA 4I97A 3RDWA 4MH3A 1A0FA 3C8EA 3GX0A 1KEBA 3H8QA 2RM6A 4KCEA 1TXXA 3DVXA 3HJOA 3HKRA 4K0GA 3KTLA 4PNGA 3GN3A 2H01A 4NWYA 9GSSA 1FB6A 3P90A 3M9KA 2L4QA 1UC7A 5ECRB 1JZOA 5B7CA 4GCIA 2WDUA 3ZMKA 4F9ZA 1V9WA 3ME8A 3IPZA 2QA2A 4BA7A 5ECHB 1JFUA 1ACVA 1OE8A 1TTZA 2X64A 3D5JA 2G0FA 4FIWA 4KUNA 5IO0A 4OD7A 3EWLA 1PQNA 4MCUA 2OKAA 2OBIA 4YQUA 2PMTA 1SL1B 1M0UA 5GAND 1GTIA 1R7HA 2LJKA 1S3DA 2YWIA 1MD4A 1EWXA 1M99A 1A24A 5DCGA 3GFKA 5D73A 3UL3A 1FHEA 4TXOA 2YWMA 4G19A 2D2ZA 1ERVA 2KUCA 5IMAA 4HS1A 5HR1A 2G2QA 2OACA 3C1RA 1ERUA 1PN9A 4PUAA 3N5OA 5DDLA 1G7EA 4MZBA 2OJLA 1ZYQB 2FA8A 1AW9A 2IPAA 1FW1A 2L4CA 2VL2A 3TGZA 4BVYA 4K6XA 4KW6A 1PL1A 1MDJA 1T3BA 2OE0A 3VK9A 5HR0A 3L9SA 1TU8A 2X8GA 3ERFA 2H0GA 3ZVJD 2LSTA 5F06A 1XVQA 5DAKB 1NHOA 4K5RA 2CAIA 4KAEA 4K2DA 4N0VA 2I3YA 2VCZA 1GUMA 5DQSA 2GSSA 4FYBA 1YJ6A 3LORA 3MNGA 3L4NA 3MAKA 2DKHA 1SU9A 1TP9A 2R2JA 4I2UA 22GSA 2L59A 2PWJA 1XG8A 4POKA 4EUYA 5H5QA 2R0CA 1Z3EA 2IFQB 1T7PB 1SENA 1LBKA 2OA7A 2XPDA 1O8WA 6GSSA 5H5SA 1HYUA 2CV4A 3GIXA 3G7JA 1XW9A 2ES7A 2OBKA 1GNWA 1ZZYA 2CZ2A 2P5QA 3TJBA 2FGXA 2OADA 1JZDA 4CW9A 1VF4A 2L6DA 2B1LA 1VF3A 1XWCA 5FHIA 3UAPA 1GWCA 2P31A 4I5QA 4TR1A 2O87A 2XHFA 2H74A 4TR3A 3F4TA 2GS3A 1YF0A 4X43A 6GSVA 2AHEA 4ACSA 4D73B 11GSA 3HCZA 1Z7RA 4ECIA 2E0QA 5A4VA 4ZXGA 1GSSA 4I2TA 2IJYA 2QSIA 1SK0A 2V32A 3I9V2 1K0BA 4ECCA 1EP7A 4EE0A 3GKKA 5D9WA 1O73A 4JRRA 2LQQA 2C80A 1ON4A 5IMZA 3VI5A 4GWRA 4FYUA 3H1NA 2O8VB 5DALB 3JCML 1XXUA 5F07A 1XFLA 2GQLA 3D6IA 5ECSA 4Z2TA 5LCZA 2N5BA 1XCCA 1UA5A 2PVQA 4K8MA 4LL4B 5ABRA 3BBYA 4L5OA 5GSTA 2J23A 2VD0A 5JCGA 3ZRDA 2PU9C 2VIMA 1GSQA 2HLSA 2HRKA 2MZCA 4TN8A 4IGJA 4EL1A 3LYKA 1EGRA 3P7XA 2VCXA 3EU3A 3DKSA 4RUVA 1I9DA 1TRVA 2IMIA 2I9HA 4AGSA 4XIHA 1T00A 3UBLA 1B8XA 2MMZA 1M3IA 4EO3A 1OC9B 2DJ0A 4RQXA 3J7Yb 1FG4A 2KP2A 1GSUA 4IP1A 1SL0B 2YCDA 4MMMA 4XTSA 1E2YA 3D4TA 2AV4A 2YOIA 4LMWA 1YZXA 5IMCA 2P5RA 4ZIJA 4NPBA 1JZWA 1AUCA 1PFOA 3H4KA 2FY6A 1ZYPA 2VUPA 5ECPB 3IK9A 2K8SA 2HRNA 3KP8A 5G1LA 4EIQA 1O8XA 2C0EA 1ZMAA 4FO5A 4XRAA 3M9JA 4WR5A 1QGVA 5IIZA 1XOBA 2KLXA 4IW9A 1DE1A 2F8AA 4F2IA 2XBIA 2JL4A 4EC0A 3BCKA 1M2BA 4O5RA 4IHUA 4HZ4A 5ELGA 2FLSA 4KA0A 4PTSA 4HUAA 2VCQA 1VF1A 2A2PA 3MYDA 4IJIA 4BL7A 2LJRA 4OFMA 3UARA 3EYTA 2RUFA 4KNDA 2H1GA 2HZFA 4N0ZA 4YKGA 1XW5A 3F6FA 4GQCA 1AAZA 2A4HA 2J9HA 1ZL9A 3OR5A 4XS1A 3IRAA 1A8LA 1SKRB 3SBCA 1BAYA 1WIKA 4QL9A 5CAXA 3GL5A 2FA4A 4X4JA 2H75A 1U88A 3CRTA 5J9CA 1QFNA 4GLTA 3TRQA 1XWKA 4ECJA 1G6WA 3ZZXA 1LU4A 1T4ZA 1GSYA 2CA8A 2AB6A 3GNJA 4N11A 3LFLA 1V57A 2VCVA 1R4WA 2VM2A 1TJDA 3PGTA 4KX4A 5F0GA 4NHZA 1PN0A 3O76A 2VCTA 5DVBA 3VWWA 1Z6MA 3APOA 4LL1B 1OYJA 3WGXA 1F3BA 2YJHA 4FQUA 1R5AA 1RK4A 1LJRA 2CX3A 4O32A 4V1Ap 5G31A 2LKUA 2YWNA 1W4VA 3KIJA 1OAZA 3IXRA 1K0CA 1MDIA 1SJZA 2MBTA 1EP8A 2YJ7A 2GDRA 3QR6A 5D8IA 3WGDA 5KN3A 2VOCA 2YV9A 5F8BA 1WJKA 4JU5A 4OMVA 1RQMA 2GZZA 4WKWA 2FNOA 2IFQA 4DSQA 5CYYA 3VWXA 4OCEA 1VGLA 2C8UA 3D0ZA 2IWTA 4PNFA 1YY7A 1PKWA 3HD5A 2AUVA 1UVZA 3CXGA 1DSBA 4NV5A 2LNSA 3I69A 3G7YA 4F82A 3DXBA 2HSHA 4QL7A 4TXVA 1H4OA 4ECBA 3IAM2 2AYTA 4OFTA 3TOUA 5G5EA 3LWAA 20GSA 1JHBA 3TKQA 1YEPA 2GTUA 2VAFA 4ZBDA 3UBKA 1G0TA 3GHAA 12GSA 1EOHA 3M1GA 5D9TA 3P2AA 2VLUA 5AN1A 1UN2A 3GSSA 3L0HA 5KN1A 3ISOA 3ZFBA 1FB0A 4GTUA 2DMLA 3GH9A 2KOKA 3FZ5A 3Q18A 2LRTA 3ME7A 2NTOA 1A8YA 1G6YA 2IMFA 4HZ2A 3L78A 1IYIA 1SYRA 1GL8A 3ERGA 4K7NA 4NV2A 4AJ8A 5DALA 4Z7XA 3FR9A 2H66A 1TK5B 5ELAA 1ABAA 4K2XA 4TRXA 5COHA 2F9SA 3TOTA 2MYGA 4YH2A 1JLVA 3KGKA 5CRHA 1TOFA 2GZPA 1X5EA 2HRAA 1WOUA 2WJUA 5L71A 4Q5QA 4Z2UA 4KCAA 2DJ2A 2K18A 4MF7A 1M2AA 3A3TA 2ALBA 1FO5A 3QDNA 1RW1A 3MWHA 13GSA 5J41A 3CTGA 1QUWA 1PKZA 1S3AA 2HFDA 1U3AA 2H72A 5GSSA 3F4RA 4V2NA 4WF5A 2YV7A 2H30A 1OC9A 5EPFA 4HSCX 1EEMA 1SYXA 2CVDA 4YAPA 1OKDA 3MSZA 4DSSA 5B6NA 4IBPA 5HFGA 5D93A 3DD3A 3WYWA 3HVVA 1ILOA 3KTBA 2M72A 3WD6A 1OE7A 2YN1A 4WF4A 5GAPD 4XS4B 2M80A 1ERWA 1K0MA 4H86A 2XBQA 3ZFLA 4IN0A 2HZEA 4GRFA 1YKCA 2TRCP 3QPMA 5CREA 5J3RA 2JZRA 2HRFA 3GKXA 4MZCA 1VRSD 1FVKA 2B6MA 5ENUA 2WULA 2ZCTA 1CQGA 2DJKA 2H8LA 4J56E 5ID2B 5FT3A 1XW6A 2PERA 2V1MA 3KD0A 4KE3A 2K6VA 5LNKe 1DE2A 1TU7A 2A4VA 4Z2RA 4IP6A 1GP1A 4L0WA 3HVNA 2GSQA 1SKWB 4YKFA 5A5KA 3U5RE 4MJCA 1F9MA 1V2AA 2E2GA 1CQHA 5EY6A 4YQMA 1M7TA 2VL2C 2FWEA 2YZHA 2VD1A 3HZ8A 3RBTA 2LUSA 4TVEA 1YF1A 1JLWA 2WCIA 3IA1A 3ZYWA 3ZIVA 2RUEA 4MP4A 2HI7A 1TDIA 3O6TA 3FKFA 3VPQA 3VFIA 2X99A 1M9BA 4AJ7A 3HA9A 16GSA 3LJRA 4HQSA 1KBNA 1YKAA 3WT2A 1BG5A 1PSQA 1U87A 1PX7A 3QAVA 5FWGA 2H76A 1A23A 2IMEA 1NW2A 1GLPA 4V1Ag 4TKYA 2NDOA 4X1UA 4EXJA 8GSSA 2VCWA 2IMDA 4ZL8A 1XPVA 3IC8A 3TUEA 2VO4A 2UZ8A 4BWQA 5D9XA 3W6GA 2JADA 2O85A 1OKTA 4NAXA 1GULA 2HSYA 4HU9A 18GSA 2DJJA 2F51A 5DJLA 3HVXA 4EDYA 3F9UA 3F8UA 4CY6A 2JSZA 4PQIA 3ZIJA 3IBHA 5HFIA 3UOMA 3TJFA 4O92A 4OWYA 3IOSA 4KSMA 3GTUA 3J7Yk 2PN8A 2FWHA 2ON7A 4JR4A 2QA1A 2MMNA 2YPMA 4O5UA 4EF0A 2WRTA 4KDUA 4MDCA 4KDYA 5CRDA 2XC2A 3QAGA 4FH8A 2Z9SA 3FZ4A 3H93A 1B4PA 1F6MC 3ERWA 4IELA 2VLTA 2I1UA 3C1SA 1PD21 2C3TA 1XWBA 1ST9A 1X5DA 3HJPA 2R5GA 4LA1A 3F6DA 3A5WA 4CHSA
chains in the Genus database with same CATH topology
4NMUA 2B5EA 3A2XA 3KMNA 5ECIB 1IYHA 5J9BA 4J57E 2VLVA 5JWOB 5IMVA 1GSFA 3WT1A 1TI3A 2GZYA 2H6XA 3FR3A 2H71A 1Z6NA 2L6CA 3A2VA 3GKMA 1O85A 2VM1A 5F05A 3MIXA 2PGTA 4G10A 4WBRD 5HQPA 1KTEA 4EVMA 4HQZA 1WPIA 3GX8A 1O7UA 4BWSA 4G0IA 2C1YA 2I4AA 2RLIA 4ZILA 1EOGA 2M46A 4HI7A 1T4YA 4TOPA 4GSTA 2YANA 5J4UA 3LGCA 2BMXA 5B8AA 2C0GA 2GQMA 2V2GA 3TCOA 4ZL9A 2B5YA 1ZGNA 3GL3A 1TRSA 4XHMA 2O89A 4LLRA 4MPFA 4Q5RA 3LXTA 4PX1A 5G2ZA 3HYPA 3EMXA 5ECMB 3L9VA 1V98A 2DJ3A 1ZYEA 3LYPA 5LD0A 5HR3A 5D9VA 4TXOB 1U6TA 4DSRA 3CYNA 1K3YA 4POLA 2GGTA 3KMOA 5JCWA 1NM3A 4RQRA 2N5FA 2HNLA 1K3OA 2TIRA 4OCFA 3A5IA 2DJ1A 1R26A 3KZQA 4N10A 1TW9A 4WR4A 2MMOA 1WRYA 4MA9A 4A5PA 2K8VA 2JZTA 2QGVA 1FOHA 5ECNB 1M2DA 5CP1A 1T1VA 1GH2A 3M8NA 3A2WA 4O5QA 3APQA 3TKSC 4KDXA 2OE1A 3ZREA 3RPNA 3US3A 1ERTA 3GURA 3D22A 3GH6A 3IR4A 4JEDA 3IE3A 2GSTA 3S9FA 4IQAA 1R5PA 1AIUA 2TRXA 2YNXA 6GSWA 5IMDA 5ID2A 1QK8A 1FAAA 4IQ1A 2WB9A 3E0UA 4MF6A 1XBSA 4PURA 3BJ5A 1W89A 3F63A 2IMKA 2GQKA 2PBJA 1AC1A 5DAKA 3APSA 4GQFA 3TJGA 3KH9A 3CMIA 2BTOT 2CZ3A 3VWUA 3C73A 1GSDA 1XWAA 1WP0A 3TKSE 3PINA 3H79A 2GVPA 2JU5A 3EINA 2EIOA 1S3CA 3KEBA 1A2LA 3FY7A 4IS0A 5H5RA 1J0FA 3LG6A 1J08A 2OE3A 2WS2A 2X8CA 1Z9HA 1XOAA 4ZB9A 1PGTA 6GSYA 3DMLA 4G9HA 3V1WA 3FW2A 3TKRA 1GUKA 3D21A 1SK1A 2H70A 2I81A 5ECQB 3ZLPA 2FWGA 2V6OA 3DWVA 3TKPA 1A2JA 2EIQA 4PQ1A 3LSZA 3M3MA 3F0IA 3L9UA 4BVXB 2H1AA 1X9SB 2LV3A 5ECKB 5CO3A 3DYRA 4D73A 1AQWA 3EURA 2CX4A 3CSHA 4ZL7A 5KOXA 3HDCA 3UVTA 4OFNA 3FEUA 1O6JA 2ZUPA 3GV1A 3BCIA 5DBQA 1K3LA 4K7OA 2L5LA 5E59A 1ZCPA 1PA3A 5KN0A 1B4QA 3VURA 2H1DA 1GRXA 5KEJA 4HEA2 3GA4A 3QD9A 1SJIA 4IVFA 19GSA 2H6YA 2PPTA 5AGYA 4JE1A 1OC8A 3VI7A 3ZVJA 1GTUA 3GUSA 2DIZA 1TK0B 2F3MA 3KCMA 4K5SA 1OC3A 4EDZA 5CNWA 1A2MA 5G5FA 4MJEA 2RM5A 1K0NA 2LJAA 2LRNA 4USSA 1XIYA 3QFBC 2WGRA 1AQXA 1AQVA 2FHEA 2GSRA 4POBA 2VL3A 3KXOA 2GT5A 4F0BA 3IAS2 4GSSA 3W8SA 5IQYA 1SD8A 1MD3A 3IV4A 3CSIA 3LW9A 3PR8A 1BYEA 3TDGA 4HJMA 1E6BA 4MJAA 3VPTA 3K8NA 3E3EA 2CVKA 2H0HA 3Q19A 3VWVA 10GSA 3RHCA 1I5GA 1V40A 2KHPA 3HJMA 4JR6A 4BL7B 1K0DA 4PXOA 2CVBA 2R3XA 4E8EA 1XVWA 3HVSA 1M9AA 2C3QA 2V6KA 2X8HA 1YEXA 3QCPA 5AIVA 2YP6A 3CTFA 2B3SA 4QQ7A 1YQ1A 4YAVA 1NSWA 2A2RA 4E8HA 4F0CA 3FR6A 1BQ7A 1J9BA 4X0XA 3ZL5A 1QMVA 5EVOA 1SKSB 4TR0A 5CRWA 5JWRB 1DBYA 2JACA 1X5CA 3I6AA 4MNNA 3FMWA 1HNBA 1EZKA 1BX9A 3N9JA 4YQVA 3FRCA 4KGIA 1BEDA 2HE3A 3W8JA 2MMAA 3LQ7A 17GSA 3HZ4A 5HFKA 1ZOFA 3AY8A 3PH9A 5J5NA 5AISA 1MEKA 2L57A 3NIVA 1QQ2A 2NPBA 4K7IA 3RPPA 3M0FA 1BJXA 1F3AA 4ZBBA 4KSOA 2YZUA 1X9WB 1WMJA 4MH2A 4MF5A 2HSMA 1TKDB 3UJ1A 3DEXA 1K0OA 5INYA 4AF2A 3IK7A 1TRUA 2CAQA 1EEJA 3TRPA 4RI6A 1PRXA 4ISDA 2ZNMA 3RAZA 1ML6A 2BJXA 3VLNA 1PX6A 1XWGA 3F4SA 4CY8A 2DC5A 3CSJA 4MK3A 3I43A 1G7OA 4FYCA 3KJYA 2PUKC 1N8JA 3HXSA 3EC3A 4GXZA 5D96A 5B8BA 2LTKA 1TRWA 5E4WA 3LXZA 2E2MA 1Y6EA 4WBJA 2B7KA 4PGTA 5HR2A 3DVWA 2X4AA 4EIPA 2JZSA 2N5AA 4HU7A 1EGOA 2HXKA 4MABA 4ZBAA 4WETA 5IOXA 2LS5A 2CT6A 1SK2A 1HD2A 4HDEA 5JWQB 1HNCA 2ON5A 5G30A 2IL3A 2A2SA 3SWLA 3QAWA 3LEFA 4HOJA 2C0FA 3BD2A 4XS6A 3EPTA 5C04A 5AIXA 1B9YC 1JZRA 3Q6OA 3G7IA 5A4WA 2FUG2 4ILFA 1THXA 3C71A 2HYXA 2IIYA 1A0RP 4BVXA 14GSA 2NBSA 3TJKA 3UEMA 3IC4A 2C3NA 1SJ6A 1USBA 4WEYA 1EV9A 3KM6A 3HHVA 2IN3A 2X49A 1GTBA 3NOFA 4O7HA 1HQOA 1Q4JA 5IM9A 5G1KA 1SL2B 1ZYNA 4ULXA 4OO4A 6GSXA 2REMA 1Z7PA 3O3TA 4P3YB 5IMFA 3QFAC 1X9MB 3GYKA 2CQ9A 1H75A 1HNAA 3EVIA 4IJ3A 2F8FA 5ECLB 2RIIA 2DSAA 4MLYA 3KH7A 5IO2A 1GSEA 3G9BA 1NHYA 1U3IA 4DSSB 4PQHA 4AJ6A 1DUGA 2K9FA 4J2FA 4V2LA 2H6ZA 1F37A 1GNEA 5KN2A 2MBSA 4KF9A 1MTCA 3C7MA 2H1BA 3EU4A 4XRDA 4ZB6A 2AJQB 1PMTA 1O81A 2C0DA 2VL9A 3FK8A 2L5OA 2HZEB 2DKIA 3PPUA 1N2AA 2QC7A 4LMVA 4G2EA 4G0LA 2R6KA 3NZNA 3P8WA 5IPHA 5IOWA 1MDKA 4JBBA 1GLQA 4L5LA 5IPGA 2B5XA 5A4UA 1VF2A 2R37A 1Q98A 4BVYB 4RI7A 5DCHA 4EKZA 4MPGA 2P0GA 2B7JA 2E7PA 1EV4A 3IHQA 4HJ2A 3RHBA 3GRXA 4K0NA 3GMFA 4IKHA 4XS4A 3EE2A 3TKSA 4BPYA 3UVHA 4TR4A 5JCUA 4L0UA 2GLRA 4NHWA 4ICYA 5EL8A 3U6VA 4KH7A 4OO5A 4MJBA 1OVNA 2HT9A 4TW5A 3FYGA 6GSTA 4N30A 3TB2A 3QMXA 2B1KA 2WFCA 4DVCA 2H0IA 4PUFC 2EIRA 2R0GA 2JSYA 3GSTA 1GTAA 3ZITA 1Z5YE 2EC4A 3TRXA 5BRTA 4V2MA 3MDKA 1AXDA 3EMPA 5DJMA 1B48A 3ED3A 1PL2A 2YWOA 1TI1A 4TR1B 2DMMA 2H73A 2LEGA 4MZWA 5B6MA 3R2QA 3QOUA 5DQYA 4G0KA 3CRUA 5KOWA 4GSNA 4POMA 4XCSA 1C72A 4WXTA 1WE0A 3UIWA 2XPEA 3GTUB 2O7KA 2FD3A 4KB3A 1QXHA 2R4VA 3IHGA 4ZB8A 3E9JB 3CBUA 4K9ZA 1F2EA 1K0AA 2LQOA 1B9XC 2LRCA 3Q74A 3UMAA 4JZQA 2FWFA 3FZ9A 4GF0A 3TJJA 4K1FA 1V58A 4Q5NA 1TK8B 3DRNA 2AAWA 3D4MA 2PVOC 5ECOB 2DIYA 3FZAA 2NVLA 4CDOA 2KP1A 1GUHA 3FHKA 4DEJA 3R3EA 1XZOA 2GT6A 2QKEA 3DIEA 4ML6A 4NXIA 4L8EA 3DGQA 3GKNA 2V41A 1FOVA 1SD9A 3KP9A 4Q5FA 1URMA 2C4JA 2H19A 3ZTLA 4ML1A 1YDKA 3F3RA 1KNGA 6GSUA 1WWJA 3BOAA 4I8BA 2R0PA 3WGEA 7GSSA 1X0RA 1Y25A 2LNTA 3F3QA 3HY2A 4ID0A 5BMUA 4F03A 5GZZB 4I6XA 2DBCA 2FCHA 5C00A 3IDVA 1T8EB 3ZMLA 5CRGA 2DLXA 1THOA 2WZ9A 1FVJA 4I97A 3RDWA 4MH3A 1A0FA 3C8EA 3GX0A 1KEBA 3H8QA 2RM6A 4KCEA 1TXXA 3DVXA 3HJOA 3HKRA 4K0GA 3KTLA 4PNGA 3GN3A 2H01A 4NWYA 9GSSA 1FB6A 3P90A 3M9KA 2L4QA 1UC7A 5ECRB 1JZOA 5B7CA 4GCIA 2WDUA 3ZMKA 4F9ZA 1V9WA 3ME8A 3IPZA 2QA2A 4BA7A 5ECHB 1JFUA 1ACVA 1OE8A 1TTZA 2X64A 3D5JA 2G0FA 4FIWA 4KUNA 5IO0A 4OD7A 3EWLA 1PQNA 4MCUA 2OKAA 2OBIA 4YQUA 2PMTA 1SL1B 1M0UA 5GAND 1GTIA 1R7HA 2LJKA 1S3DA 2YWIA 1MD4A 1EWXA 1M99A 1A24A 5DCGA 3GFKA 5D73A 3UL3A 1FHEA 4TXOA 2YWMA 4G19A 2D2ZA 1ERVA 2KUCA 5IMAA 4HS1A 5HR1A 2G2QA 2OACA 3C1RA 1ERUA 1PN9A 4PUAA 3N5OA 5DDLA 1G7EA 4MZBA 2OJLA 1ZYQB 2FA8A 1AW9A 2IPAA 1FW1A 2L4CA 2VL2A 3TGZA 4BVYA 4K6XA 4KW6A 1PL1A 1MDJA 1T3BA 2OE0A 3VK9A 5HR0A 3L9SA 1TU8A 2X8GA 3ERFA 2H0GA 3ZVJD 2LSTA 5F06A 1XVQA 5DAKB 1NHOA 4K5RA 2CAIA 4KAEA 4K2DA 4N0VA 2I3YA 2VCZA 1GUMA 5DQSA 2GSSA 4FYBA 1YJ6A 3LORA 3MNGA 3L4NA 3MAKA 2DKHA 1SU9A 1TP9A 2R2JA 4I2UA 22GSA 2L59A 2PWJA 4POKA 4EUYA 5H5QA 2R0CA 1Z3EA 2IFQB 1T7PB 1SENA 1LBKA 2OA7A 2XPDA 1O8WA 6GSSA 5H5SA 1HYUA 2CV4A 3GIXA 3G7JA 1XW9A 2ES7A 2OBKA 1GNWA 1ZZYA 2CZ2A 2P5QA 3TJBA 2FGXA 2OADA 1JZDA 4CW9A 1VF4A 2L6DA 2B1LA 1VF3A 1XWCA 5FHIA 3UAPA 1GWCA 2P31A 4I5QA 4TR1A 2O87A 2XHFA 2H74A 4TR3A 3F4TA 2GS3A 1YF0A 4X43A 6GSVA 2AHEA 4ACSA 4D73B 11GSA 3HCZA 1Z7RA 4ECIA 2E0QA 5A4VA 4ZXGA 1GSSA 4I2TA 2IJYA 2QSIA 1SK0A 2V32A 3I9V2 1K0BA 4ECCA 1EP7A 4EE0A 3GKKA 5D9WA 1O73A 4JRRA 2LQQA 2C80A 1ON4A 5IMZA 3VI5A 4GWRA 4FYUA 3H1NA 2O8VB 5DALB 3JCML 1XXUA 5F07A 1XFLA 2GQLA 3D6IA 5ECSA 4Z2TA 5LCZA 2N5BA 1XCCA 1UA5A 2PVQA 4K8MA 4LL4B 5ABRA 3BBYA 4L5OA 5GSTA 2J23A 2VD0A 5JCGA 3ZRDA 2PU9C 2VIMA 1GSQA 2HLSA 2HRKA 2MZCA 4TN8A 4IGJA 4EL1A 3LYKA 1EGRA 3P7XA 2VCXA 3EU3A 3DKSA 4RUVA 1I9DA 1TRVA 2IMIA 2I9HA 4AGSA 4XIHA 1T00A 3UBLA 1B8XA 2MMZA 4EO3A 1OC9B 2DJ0A 4RQXA 3J7Yb 1FG4A 2KP2A 1GSUA 4IP1A 1SL0B 2YCDA 4MMMA 4XTSA 1E2YA 3D4TA 2AV4A 2YOIA 4LMWA 1YZXA 5IMCA 2P5RA 4ZIJA 4NPBA 1JZWA 1AUCA 3H4KA 2FY6A 1ZYPA 2VUPA 5ECPB 3IK9A 2K8SA 2HRNA 3KP8A 5G1LA 4EIQA 1O8XA 2C0EA 1ZMAA 4FO5A 4XRAA 3M9JA 4WR5A 1QGVA 5IIZA 1XOBA 2KLXA 4IW9A 1DE1A 2F8AA 4F2IA 2XBIA 2JL4A 4EC0A 3BCKA 1M2BA 4O5RA 4IHUA 4HZ4A 5ELGA 2FLSA 4KA0A 4PTSA 4HUAA 2VCQA 1VF1A 2A2PA 3MYDA 4IJIA 4BL7A 2LJRA 4OFMA 3UARA 3EYTA 2RUFA 4KNDA 2H1GA 2HZFA 4N0ZA 4YKGA 1XW5A 3F6FA 4GQCA 1AAZA 2A4HA 2J9HA 1ZL9A 3OR5A 4XS1A 3IRAA 1A8LA 1SKRB 3SBCA 1BAYA 1WIKA 4QL9A 5CAXA 3GL5A 2FA4A 4X4JA 2H75A 1U88A 3CRTA 5J9CA 1QFNA 4GLTA 3TRQA 1XWKA 4ECJA 1G6WA 3ZZXA 1LU4A 1T4ZA 1GSYA 2CA8A 2AB6A 3GNJA 4N11A 3LFLA 1V57A 2VCVA 1R4WA 2VM2A 1TJDA 3PGTA 4KX4A 5F0GA 4NHZA 1PN0A 3O76A 2VCTA 5DVBA 3VWWA 1Z6MA 3APOA 4LL1B 1OYJA 3WGXA 1F3BA 2YJHA 4FQUA 1R5AA 1RK4A 1LJRA 2CX3A 4O32A 4V1Ap 5G31A 2LKUA 2YWNA 1W4VA 3KIJA 1OAZA 3IXRA 1K0CA 1MDIA 1SJZA 2MBTA 1EP8A 2YJ7A 2GDRA 3QR6A 5D8IA 3WGDA 5KN3A 2VOCA 2YV9A 5F8BA 1WJKA 4JU5A 4OMVA 1RQMA 2GZZA 4WKWA 2FNOA 2IFQA 4DSQA 5CYYA 3VWXA 4OCEA 1VGLA 2C8UA 3D0ZA 2IWTA 4PNFA 1YY7A 1PKWA 3HD5A 2AUVA 1UVZA 3CXGA 1DSBA 4NV5A 2LNSA 3I69A 3G7YA 4F82A 3DXBA 2HSHA 4QL7A 4TXVA 1H4OA 4ECBA 3IAM2 2AYTA 4OFTA 3TOUA 5G5EA 3LWAA 20GSA 1JHBA 3TKQA 1YEPA 2GTUA 2VAFA 4ZBDA 3UBKA 1G0TA 3GHAA 12GSA 1EOHA 3M1GA 5D9TA 3P2AA 2VLUA 5AN1A 1UN2A 3GSSA 3L0HA 5KN1A 3ISOA 3ZFBA 1FB0A 4GTUA 2DMLA 3GH9A 2KOKA 3FZ5A 3Q18A 2LRTA 3ME7A 2NTOA 1A8YA 1G6YA 2IMFA 4HZ2A 3L78A 1IYIA 1SYRA 1GL8A 3ERGA 4K7NA 4NV2A 4AJ8A 5DALA 4Z7XA 3FR9A 2H66A 1TK5B 5ELAA 1ABAA 4K2XA 4TRXA 5COHA 2F9SA 3TOTA 2MYGA 4YH2A 1JLVA 3KGKA 5CRHA 1TOFA 2GZPA 1X5EA 2HRAA 1WOUA 2WJUA 5L71A 4Q5QA 4Z2UA 4KCAA 2DJ2A 2K18A 4MF7A 1M2AA 3A3TA 2ALBA 1FO5A 3QDNA 1RW1A 3MWHA 13GSA 5J41A 3CTGA 1QUWA 1PKZA 1S3AA 2HFDA 1U3AA 2H72A 5GSSA 3F4RA 4V2NA 4WF5A 2YV7A 2H30A 1OC9A 5EPFA 1EEMA 1SYXA 2CVDA 4YAPA 1OKDA 3MSZA 4DSSA 5B6NA 4IBPA 5HFGA 5D93A 3DD3A 3WYWA 3HVVA 1ILOA 3KTBA 2M72A 3WD6A 1OE7A 2YN1A 4WF4A 5GAPD 4XS4B 2M80A 1ERWA 1K0MA 4H86A 2XBQA 3ZFLA 4IN0A 2HZEA 4GRFA 1YKCA 2TRCP 3QPMA 5CREA 5J3RA 2JZRA 2HRFA 3GKXA 4MZCA 1VRSD 1FVKA 2B6MA 5ENUA 2WULA 2ZCTA 1CQGA 2DJKA 2H8LA 4J56E 5ID2B 5FT3A 1XW6A 2PERA 2V1MA 3KD0A 4KE3A 2K6VA 5LNKe 1DE2A 1TU7A 2A4VA 4Z2RA 4IP6A 1GP1A 4L0WA 2GSQA 1SKWB 4YKFA 5A5KA 3U5RE 4MJCA 1F9MA 1V2AA 2E2GA 1CQHA 5EY6A 4YQMA 1M7TA 2VL2C 2FWEA 2YZHA 2VD1A 3HZ8A 3RBTA 2LUSA 4TVEA 1YF1A 1JLWA 2WCIA 3IA1A 3ZYWA 3ZIVA 2RUEA 4MP4A 2HI7A 1TDIA 3O6TA 3FKFA 3VPQA 3VFIA 2X99A 1M9BA 4AJ7A 3HA9A 16GSA 3LJRA 4HQSA 1KBNA 1YKAA 3WT2A 1BG5A 1PSQA 1U87A 1PX7A 3QAVA 5FWGA 2H76A 1A23A 2IMEA 1NW2A 1GLPA 4V1Ag 4TKYA 2NDOA 4X1UA 4EXJA 8GSSA 2VCWA 2IMDA 4ZL8A 1XPVA 3IC8A 3TUEA 2VO4A 2UZ8A 4BWQA 5D9XA 3W6GA 2JADA 2O85A 1OKTA 4NAXA 1GULA 2HSYA 4HU9A 18GSA 2DJJA 2F51A 5DJLA 3HVXA 4EDYA 3F9UA 3F8UA 4CY6A 2JSZA 4PQIA 3ZIJA 3IBHA 5HFIA 3UOMA 3TJFA 4O92A 4OWYA 3IOSA 4KSMA 3GTUA 3J7Yk 2PN8A 2FWHA 2ON7A 4JR4A 2QA1A 2MMNA 2YPMA 4O5UA 4EF0A 2WRTA 4KDUA 4MDCA 4KDYA 5CRDA 2XC2A 3QAGA 4FH8A 2Z9SA 3FZ4A 3H93A 1B4PA 1F6MC 3ERWA 4IELA 2VLTA 2I1UA 3C1SA 1PD21 2C3TA 1XWBA 1ST9A 1X5DA 3HJPA 2R5GA 4LA1A 3F6DA 3A5WA 4CHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NMU A;  2B5E A;  3A2X A;  3KMN A;  5ECI B;  1IYH A;  5J9B A;  4J57 E;  2VLV A;  5JWO B;  5IMV A;  1GSF A;  3WT1 A;  1TI3 A;  2GZY A;  2H6X A;  3FR3 A;  2H71 A;  1Z6N A;  2L6C A;  3A2V A;  3GKM A;  1O85 A;  2VM1 A;  5F05 A;  2PGT A;  4G10 A;  4WBR D;  5HQP A;  1KTE A;  4EVM A;  4HQZ A;  1WPI A;  3GX8 A;  1O7U A;  4BWS A;  2C1Y A;  2I4A A;  2RLI A;  4ZIL A;  1EOG A;  2M46 A;  4HI7 A;  1T4Y A;  4TOP A;  4GST A;  2YAN A;  5J4U A;  3LGC A;  2BMX A;  5B8A A;  2C0G A;  2GQM A;  2V2G A;  3TCO A;  4ZL9 A;  2B5Y A;  1ZGN A;  3GL3 A;  1TRS A;  4XHM A;  2O89 A;  4LLR A;  4MPF A;  4Q5R A;  3LXT A;  4PX1 A;  5G2Z A;  3HYP A;  3EMX A;  5ECM B;  3L9V A;  1V98 A;  2DJ3 A;  1ZYE A;  3LYP A;  5LD0 A;  5HR3 A;  5D9V A;  4TXO B;  1U6T A;  4DSR A;  3CYN A;  1K3Y A;  4POL A;  2GGT A;  3KMO A;  5JCW A;  1NM3 A;  4RQR A;  2N5F A;  2HNL A;  1K3O A;  2TIR A;  4OCF A;  2DJ1 A;  1R26 A;  3KZQ A;  4N10 A;  1TW9 A;  4WR4 A;  2MMO A;  1WRY A;  4MA9 A;  2K8V A;  2JZT A;  2QGV A;  5ECN B;  1M2D A;  5CP1 A;  1T1V A;  1GH2 A;  3M8N A;  3A2W A;  3APQ A;  3TKS C;  4KDX A;  2OE1 A;  3ZRE A;  3RPN A;  3US3 A;  1ERT A;  3GUR A;  3D22 A;  3GH6 A;  3IR4 A;  4JED A;  3IE3 A;  2GST A;  3S9F A;  4IQA A;  1R5P A;  1AIU A;  2TRX A;  2YNX A;  6GSW A;  5IMD A;  5ID2 A;  1QK8 A;  1FAA A;  4IQ1 A;  2WB9 A;  3E0U A;  4MF6 A;  1XBS A;  4PUR A;  3BJ5 A;  1W89 A;  3F63 A;  2IMK A;  2GQK A;  2PBJ A;  1AC1 A;  5DAK A;  3APS A;  4GQF A;  3TJG A;  3KH9 A;  3CMI A;  2BTO T;  2CZ3 A;  3VWU A;  3C73 A;  1GSD A;  1XWA A;  1WP0 A;  3TKS E;  3PIN A;  3H79 A;  2GVP A;  2JU5 A;  3EIN A;  2EIO A;  1S3C A;  3KEB A;  1A2L A;  3FY7 A;  4IS0 A;  5H5R A;  1J0F A;  3LG6 A;  1J08 A;  2OE3 A;  2WS2 A;  2X8C A;  1Z9H A;  1XOA A;  4ZB9 A;  1PGT A;  6GSY A;  3DML A;  4G9H A;  3V1W A;  3FW2 A;  3TKR A;  1GUK A;  3D21 A;  1SK1 A;  2H70 A;  2I81 A;  5ECQ B;  3ZLP A;  2FWG A;  2V6O A;  3DWV A;  3TKP A;  1A2J A;  2EIQ A;  4PQ1 A;  3LSZ A;  3M3M A;  3F0I A;  3L9U A;  2H1A A;  1X9S B;  2LV3 A;  5ECK B;  5CO3 A;  3DYR A;  4D73 A;  1AQW A;  3EUR A;  2CX4 A;  3CSH A;  4ZL7 A;  3HDC A;  3UVT A;  4OFN A;  3FEU A;  1O6J A;  2ZUP A;  3GV1 A;  3BCI A;  5DBQ A;  1K3L A;  4K7O A;  2L5L A;  5E59 A;  1ZCP A;  1PA3 A;  5KN0 A;  1B4Q A;  3VUR A;  2H1D A;  1GRX A;  5KEJ A;  4HEA 2;  3GA4 A;  3QD9 A;  1SJI A;  4IVF A;  19GS A;  2H6Y A;  2PPT A;  5AGY A;  4JE1 A;  1OC8 A;  3VI7 A;  3ZVJ A;  1GTU A;  3GUS A;  2DIZ A;  1TK0 B;  2F3M A;  3KCM A;  1OC3 A;  4EDZ A;  5CNW A;  1A2M A;  5G5F A;  4MJE A;  2RM5 A;  1K0N A;  2LJA A;  2LRN A;  1XIY A;  3QFB C;  2WGR A;  1AQX A;  1AQV A;  2FHE A;  2GSR A;  4POB A;  2VL3 A;  3KXO A;  2GT5 A;  4F0B A;  3IAS 2;  4GSS A;  3W8S A;  5IQY A;  1SD8 A;  1MD3 A;  3IV4 A;  3CSI A;  3PR8 A;  3TDG A;  1BYE A;  4HJM A;  1E6B A;  4MJA A;  3VPT A;  3K8N A;  3E3E A;  2CVK A;  2H0H A;  3Q19 A;  3VWV A;  10GS A;  3RHC A;  1I5G A;  1V40 A;  2KHP A;  3HJM A;  4JR6 A;  1K0D A;  4PXO A;  2CVB A;  2R3X A;  4E8E A;  1XVW A;  3HVS A;  1M9A A;  2C3Q A;  2V6K A;  2X8H A;  1YEX A;  3QCP A;  5AIV A;  2YP6 A;  3CTF A;  2B3S A;  4QQ7 A;  1YQ1 A;  4YAV A;  1NSW A;  2A2R A;  4E8H A;  4F0C A;  3FR6 A;  1BQ7 A;  1J9B A;  4X0X A;  3ZL5 A;  1QMV A;  5EVO A;  1SKS B;  4TR0 A;  5CRW A;  5JWR B;  1DBY A;  2JAC A;  1X5C A;  3I6A A;  1HNB A;  1EZK A;  1BX9 A;  3N9J A;  4YQV A;  3FRC A;  4KGI A;  1BED A;  2HE3 A;  3W8J A;  2MMA A;  3LQ7 A;  17GS A;  3HZ4 A;  5HFK A;  1ZOF A;  3AY8 A;  3PH9 A;  5J5N A;  5AIS A;  1MEK A;  2L57 A;  3NIV A;  1QQ2 A;  2NPB A;  4K7I A;  3RPP A;  3M0F A;  1BJX A;  1F3A A;  4ZBB A;  4KSO A;  2YZU A;  1X9W B;  1WMJ A;  4MH2 A;  4MF5 A;  1TKD B;  3UJ1 A;  3DEX A;  1K0O A;  5INY A;  4AF2 A;  3IK7 A;  1TRU A;  2CAQ A;  1EEJ A;  3TRP A;  4RI6 A;  1PRX A;  4ISD A;  2ZNM A;  3RAZ A;  1ML6 A;  2BJX A;  3VLN A;  1PX6 A;  1XWG A;  3F4S A;  2DC5 A;  3CSJ A;  4MK3 A;  3I43 A;  1G7O A;  4FYC A;  3KJY A;  2PUK C;  1N8J A;  3HXS A;  3EC3 A;  4GXZ A;  5D96 A;  5B8B A;  2LTK A;  1TRW A;  5E4W A;  3LXZ A;  2E2M A;  1Y6E A;  4WBJ A;  2B7K A;  4PGT A;  5HR2 A;  3DVW A;  2JZS A;  2N5A A;  4HU7 A;  1EGO A;  2HXK A;  4MAB A;  4ZBA A;  4WET A;  5IOX A;  2LS5 A;  2CT6 A;  1SK2 A;  1HD2 A;  4HDE A;  5JWQ B;  1HNC A;  2ON5 A;  5G30 A;  2IL3 A;  2A2S A;  3SWL A;  3QAW A;  3LEF A;  4HOJ A;  2C0F A;  3BD2 A;  4XS6 A;  5C04 A;  5AIX A;  1B9Y C;  1JZR A;  3Q6O A;  3G7I A;  5A4W A;  2FUG 2;  4ILF A;  1THX A;  3C71 A;  2HYX A;  2IIY A;  1A0R P;  4BVX A;  14GS A;  2NBS A;  3TJK A;  3UEM A;  3IC4 A;  2C3N A;  1SJ6 A;  1USB A;  4WEY A;  1EV9 A;  3KM6 A;  3HHV A;  2IN3 A;  1GTB A;  3NOF A;  4O7H A;  1HQO A;  1Q4J A;  5IM9 A;  5G1K A;  1SL2 B;  4ULX A;  4OO4 A;  6GSX A;  2REM A;  1Z7P A;  3O3T A;  4P3Y B;  5IMF A;  3QFA C;  1X9M B;  3GYK A;  2CQ9 A;  1H75 A;  1HNA A;  3EVI A;  4IJ3 A;  2F8F A;  5ECL B;  2RII A;  2DSA A;  4MLY A;  3KH7 A;  5IO2 A;  1GSE A;  3G9B A;  1NHY A;  1U3I A;  4DSS B;  4PQH A;  4AJ6 A;  1DUG A;  2K9F A;  4J2F A;  4V2L A;  2H6Z A;  1F37 A;  1GNE A;  5KN2 A;  2MBS A;  1MTC A;  3C7M A;  2H1B A;  3EU4 A;  4XRD A;  4ZB6 A;  2AJQ B;  1PMT A;  1O81 A;  2C0D A;  2VL9 A;  3FK8 A;  2L5O A;  2HZE B;  1N2A A;  2QC7 A;  4LMV A;  4G2E A;  2R6K A;  3NZN A;  3P8W A;  5IPH A;  5IOW A;  1MDK A;  4JBB A;  1GLQ A;  4L5L A;  5IPG A;  2B5X A;  5A4U A;  1VF2 A;  2R37 A;  1Q98 A;  4RI7 A;  5DCH A;  4EKZ A;  4MPG A;  2P0G A;  2B7J A;  2E7P A;  1EV4 A;  3IHQ A;  4HJ2 A;  3RHB A;  3GRX A;  4K0N A;  3GMF A;  4IKH A;  4XS4 A;  3EE2 A;  3TKS A;  4BPY A;  3UVH A;  4TR4 A;  5JCU A;  4L0U A;  2GLR A;  4NHW A;  5EL8 A;  3U6V A;  4KH7 A;  4OO5 A;  4MJB A;  1OVN A;  2HT9 A;  4TW5 A;  3FYG A;  6GST A;  4N30 A;  3TB2 A;  3QMX A;  2B1K A;  2WFC A;  4DVC A;  2H0I A;  4PUF C;  2EIR A;  2JSY A;  3GST A;  1GTA A;  3ZIT A;  1Z5Y E;  2EC4 A;  3TRX A;  4V2M A;  3MDK A;  1AXD A;  3EMP A;  5DJM A;  1B48 A;  3ED3 A;  1PL2 A;  2YWO A;  1TI1 A;  4TR1 B;  2DMM A;  2H73 A;  2LEG A;  4MZW A;  5B6M A;  3R2Q A;  3QOU A;  5DQY A;  3CRU A;  4GSN A;  4POM A;  4XCS A;  1C72 A;  4WXT A;  1WE0 A;  3UIW A;  2XPE A;  3GTU B;  2O7K A;  2FD3 A;  4KB3 A;  1QXH A;  2R4V A;  4ZB8 A;  3E9J B;  3CBU A;  4K9Z A;  1F2E A;  1K0A A;  2LQO A;  1B9X C;  2LRC A;  3Q74 A;  3UMA A;  4JZQ A;  2FWF A;  3FZ9 A;  4GF0 A;  3TJJ A;  4K1F A;  1V58 A;  4Q5N A;  1TK8 B;  3DRN A;  2AAW A;  3D4M A;  2PVO C;  5ECO B;  2DIY A;  3FZA A;  2NVL A;  4CDO A;  2KP1 A;  1GUH A;  3FHK A;  4DEJ A;  1XZO A;  2GT6 A;  2QKE A;  3DIE A;  4ML6 A;  4NXI A;  4L8E A;  3DGQ A;  3GKN A;  2V41 A;  1FOV A;  1SD9 A;  3KP9 A;  4Q5F A;  1URM A;  2C4J A;  2H19 A;  3ZTL A;  4ML1 A;  1YDK A;  3F3R A;  1KNG A;  6GSU A;  1WWJ A;  3BOA A;  4I8B A;  3WGE A;  7GSS A;  1X0R A;  1Y25 A;  2LNT A;  3F3Q A;  3HY2 A;  4ID0 A;  4F03 A;  5GZZ B;  4I6X A;  2DBC A;  2FCH A;  5C00 A;  3IDV A;  1T8E B;  3ZML A;  5CRG A;  2DLX A;  1THO A;  2WZ9 A;  1FVJ A;  4I97 A;  3RDW A;  4MH3 A;  1A0F A;  3C8E A;  3GX0 A;  1KEB A;  3H8Q A;  2RM6 A;  4KCE A;  1TXX A;  3DVX A;  3HJO A;  3HKR A;  4K0G A;  3KTL A;  4PNG A;  3GN3 A;  2H01 A;  4NWY A;  9GSS A;  1FB6 A;  3P90 A;  3M9K A;  2L4Q A;  1UC7 A;  5ECR B;  1JZO A;  5B7C A;  4GCI A;  2WDU A;  3ZMK A;  4F9Z A;  1V9W A;  3ME8 A;  3IPZ A;  4BA7 A;  5ECH B;  1JFU A;  1ACV A;  1OE8 A;  1TTZ A;  2X64 A;  3D5J A;  2G0F A;  4FIW A;  4KUN A;  5IO0 A;  4OD7 A;  3EWL A;  1PQN A;  4MCU A;  2OKA A;  2OBI A;  4YQU A;  2PMT A;  1SL1 B;  1M0U A;  5GAN D;  1GTI A;  1R7H A;  2LJK A;  1S3D A;  2YWI A;  1MD4 A;  1EWX A;  1M99 A;  1A24 A;  5DCG A;  3GFK A;  5D73 A;  3UL3 A;  1FHE A;  4TXO A;  2YWM A;  4G19 A;  2D2Z A;  1ERV A;  2KUC A;  5IMA A;  4HS1 A;  5HR1 A;  2G2Q A;  2OAC A;  3C1R A;  1ERU A;  1PN9 A;  4PUA A;  3N5O A;  5DDL A;  1G7E A;  4MZB A;  2OJL A;  1ZYQ B;  2FA8 A;  1AW9 A;  2IPA A;  1FW1 A;  2L4C A;  2VL2 A;  3TGZ A;  4BVY A;  4K6X A;  4KW6 A;  1PL1 A;  1MDJ A;  1T3B A;  2OE0 A;  3VK9 A;  5HR0 A;  3L9S A;  1TU8 A;  2X8G A;  3ERF A;  2H0G A;  3ZVJ D;  2LST A;  5F06 A;  1XVQ A;  5DAK B;  1NHO A;  2CAI A;  4KAE A;  4K2D A;  4N0V A;  2I3Y A;  2VCZ A;  1GUM A;  5DQS A;  2GSS A;  4FYB A;  1YJ6 A;  3LOR A;  3MNG A;  3L4N A;  3MAK A;  1SU9 A;  1TP9 A;  2R2J A;  4I2U A;  22GS A;  2L59 A;  2PWJ A;  4POK A;  4EUY A;  5H5Q A;  1Z3E A;  2IFQ B;  1T7P B;  1SEN A;  1LBK A;  2OA7 A;  2XPD A;  1O8W A;  6GSS A;  5H5S A;  1HYU A;  2CV4 A;  3GIX A;  3G7J A;  1XW9 A;  2ES7 A;  2OBK A;  1GNW A;  1ZZY A;  2CZ2 A;  2P5Q A;  3TJB A;  2FGX A;  2OAD A;  1JZD A;  4CW9 A;  1VF4 A;  2L6D A;  2B1L A;  1VF3 A;  1XWC A;  5FHI A;  3UAP A;  1GWC A;  2P31 A;  4I5Q A;  4TR1 A;  2O87 A;  2XHF A;  2H74 A;  4TR3 A;  3F4T A;  2GS3 A;  1YF0 A;  4X43 A;  6GSV A;  2AHE A;  4ACS A;  4D73 B;  11GS A;  3HCZ A;  1Z7R A;  4ECI A;  2E0Q A;  5A4V A;  4ZXG A;  1GSS A;  4I2T A;  2IJY A;  2QSI A;  1SK0 A;  2V32 A;  3I9V 2;  1K0B A;  4ECC A;  1EP7 A;  4EE0 A;  3GKK A;  5D9W A;  1O73 A;  4JRR A;  2LQQ A;  2C80 A;  1ON4 A;  5IMZ A;  3VI5 A;  4GWR A;  4FYU A;  3H1N A;  2O8V B;  5DAL B;  3JCM L;  1XXU A;  5F07 A;  1XFL A;  2GQL A;  3D6I A;  5ECS A;  5LCZ A;  2N5B A;  1XCC A;  1UA5 A;  2PVQ A;  4K8M A;  4LL4 B;  5ABR A;  3BBY A;  4L5O A;  5GST A;  2J23 A;  2VD0 A;  5JCG A;  3ZRD A;  2PU9 C;  2VIM A;  1GSQ A;  2HLS A;  2MZC A;  4TN8 A;  4IGJ A;  4EL1 A;  3LYK A;  1EGR A;  3P7X A;  2VCX A;  3EU3 A;  3DKS A;  4RUV A;  1I9D A;  1TRV A;  2IMI A;  2I9H A;  4AGS A;  4XIH A;  1T00 A;  3UBL A;  1B8X A;  2MMZ A;  4EO3 A;  1OC9 B;  2DJ0 A;  4RQX A;  3J7Y b;  1FG4 A;  2KP2 A;  1GSU A;  4IP1 A;  1SL0 B;  2YCD A;  4MMM A;  4XTS A;  1E2Y A;  3D4T A;  2AV4 A;  2YOI A;  4LMW A;  1YZX A;  5IMC A;  2P5R A;  4ZIJ A;  4NPB A;  1JZW A;  1AUC A;  3H4K A;  2FY6 A;  2VUP A;  5ECP B;  3IK9 A;  2K8S A;  2HRN A;  3KP8 A;  5G1L A;  1O8X A;  2C0E A;  1ZMA A;  4FO5 A;  4XRA A;  3M9J A;  4WR5 A;  1QGV A;  5IIZ A;  1XOB A;  2KLX A;  4IW9 A;  1DE1 A;  2F8A A;  4F2I A;  2XBI A;  2JL4 A;  4EC0 A;  3BCK A;  1M2B A;  4O5R A;  4IHU A;  4HZ4 A;  5ELG A;  2FLS A;  4KA0 A;  4HUA A;  2VCQ A;  1VF1 A;  4IJI A;  4BL7 A;  2LJR A;  4OFM A;  3UAR A;  3EYT A;  2RUF A;  4KND A;  2H1G A;  2HZF A;  4N0Z A;  1XW5 A;  3F6F A;  4GQC A;  1AAZ A;  2J9H A;  1ZL9 A;  3OR5 A;  4XS1 A;  3IRA A;  1A8L A;  1SKR B;  3SBC A;  1BAY A;  1WIK A;  4QL9 A;  5CAX A;  3GL5 A;  2FA4 A;  2H75 A;  1U88 A;  3CRT A;  5J9C A;  1QFN A;  4GLT A;  3TRQ A;  1XWK A;  4ECJ A;  1G6W A;  3ZZX A;  1LU4 A;  1T4Z A;  1GSY A;  2CA8 A;  2AB6 A;  3GNJ A;  4N11 A;  3LFL A;  1V57 A;  2VCV A;  1R4W A;  2VM2 A;  1TJD A;  3PGT A;  4KX4 A;  5F0G A;  4NHZ A;  3O76 A;  2VCT A;  5DVB A;  3VWW A;  1Z6M A;  3APO A;  4LL1 B;  1OYJ A;  3WGX A;  1F3B A;  2YJH A;  4O32 A;  1R5A A;  1RK4 A;  1LJR A;  2CX3 A;  4V1A p;  5G31 A;  2LKU A;  2YWN A;  1W4V A;  3KIJ A;  1OAZ A;  3IXR A;  1K0C A;  1MDI A;  1SJZ A;  2MBT A;  1EP8 A;  2YJ7 A;  2GDR A;  3QR6 A;  5D8I A;  3WGD A;  5KN3 A;  2VOC A;  2YV9 A;  5F8B A;  1WJK A;  4JU5 A;  4OMV A;  1RQM A;  2GZZ A;  4WKW A;  2FNO A;  2IFQ A;  4DSQ A;  5CYY A;  3VWX A;  4OCE A;  1VGL A;  2C8U A;  3D0Z A;  2IWT A;  4PNF A;  1YY7 A;  1PKW A;  3HD5 A;  2AUV A;  1UVZ A;  3CXG A;  1DSB A;  4NV5 A;  2LNS A;  3I69 A;  3G7Y A;  4F82 A;  3DXB A;  2HSH A;  4QL7 A;  4TXV A;  1H4O A;  4ECB A;  3IAM 2;  2AYT A;  4OFT A;  3TOU A;  5G5E A;  3LWA A;  20GS A;  1JHB A;  3TKQ A;  1YEP A;  2GTU A;  2VAF A;  4ZBD A;  3UBK A;  1G0T A;  3GHA A;  12GS A;  1EOH A;  3M1G A;  5D9T A;  3P2A A;  2VLU A;  5AN1 A;  1UN2 A;  3GSS A;  3L0H A;  5KN1 A;  3ISO A;  3ZFB A;  1FB0 A;  4GTU A;  2DML A;  3GH9 A;  2KOK A;  3FZ5 A;  3Q18 A;  2LRT A;  3ME7 A;  2NTO A;  1A8Y A;  1G6Y A;  2IMF A;  4HZ2 A;  3L78 A;  1IYI A;  1SYR A;  1GL8 A;  3ERG A;  4K7N A;  4NV2 A;  4AJ8 A;  5DAL A;  4Z7X A;  3FR9 A;  2H66 A;  1TK5 B;  5ELA A;  1ABA A;  4TRX A;  5COH A;  2F9S A;  3TOT A;  2MYG A;  4YH2 A;  1JLV A;  3KGK A;  5CRH A;  1TOF A;  2GZP A;  1X5E A;  1WOU A;  2WJU A;  5L71 A;  4Q5Q A;  4KCA A;  2DJ2 A;  2K18 A;  4MF7 A;  1M2A A;  3A3T A;  2ALB A;  1FO5 A;  3QDN A;  1RW1 A;  3MWH A;  13GS A;  5J41 A;  3CTG A;  1QUW A;  1PKZ A;  1S3A A;  2HFD A;  1U3A A;  2H72 A;  5GSS A;  3F4R A;  4V2N A;  4WF5 A;  2YV7 A;  2H30 A;  1OC9 A;  5EPF A;  1EEM A;  1SYX A;  2CVD A;  4YAP A;  1OKD A;  3MSZ A;  4DSS A;  5B6N A;  4IBP A;  5HFG A;  5D93 A;  3DD3 A;  3WYW A;  3HVV A;  1ILO A;  3KTB A;  2M72 A;  3WD6 A;  1OE7 A;  2YN1 A;  4WF4 A;  5GAP D;  4XS4 B;  2M80 A;  1ERW A;  1K0M A;  4H86 A;  2XBQ A;  3ZFL A;  4IN0 A;  2HZE A;  4GRF A;  1YKC A;  2TRC P;  3QPM A;  5CRE A;  5J3R A;  2JZR A;  2HRF A;  3GKX A;  4MZC A;  1VRS D;  1FVK A;  2B6M A;  5ENU A;  2WUL A;  2ZCT A;  1CQG A;  2DJK A;  2H8L A;  4J56 E;  5ID2 B;  5FT3 A;  1XW6 A;  2PER A;  2V1M A;  3KD0 A;  4KE3 A;  2K6V A;  5LNK e;  1DE2 A;  1TU7 A;  2A4V A;  4IP6 A;  1GP1 A;  4L0W A;  2GSQ A;  1SKW B;  5A5K A;  3U5R E;  4MJC A;  1F9M A;  1V2A A;  2E2G A;  1CQH A;  5EY6 A;  4YQM A;  1M7T A;  2VL2 C;  2FWE A;  2YZH A;  2VD1 A;  3HZ8 A;  3RBT A;  2LUS A;  4TVE A;  1YF1 A;  1JLW A;  2WCI A;  3IA1 A;  3ZYW A;  3ZIV A;  2RUE A;  4MP4 A;  2HI7 A;  1TDI A;  3O6T A;  3FKF A;  3VPQ A;  3VFI A;  2X99 A;  1M9B A;  4AJ7 A;  3HA9 A;  16GS A;  3LJR A;  4HQS A;  1KBN A;  1YKA A;  3WT2 A;  1BG5 A;  1PSQ A;  1U87 A;  1PX7 A;  3QAV A;  5FWG A;  2H76 A;  1A23 A;  2IME A;  1NW2 A;  1GLP A;  4V1A g;  4TKY A;  2NDO A;  4X1U A;  4EXJ A;  8GSS A;  2VCW A;  2IMD A;  4ZL8 A;  1XPV A;  3TUE A;  2VO4 A;  4BWQ A;  5D9X A;  3W6G A;  2JAD A;  2O85 A;  1OKT A;  4NAX A;  1GUL A;  2HSY A;  4HU9 A;  18GS A;  2DJJ A;  2F51 A;  5DJL A;  3HVX A;  4EDY A;  3F9U A;  3F8U A;  2JSZ A;  4PQI A;  3ZIJ A;  3IBH A;  5HFI A;  3UOM A;  3TJF A;  4O92 A;  4OWY A;  3IOS A;  4KSM A;  3GTU A;  3J7Y k;  2PN8 A;  2FWH A;  2ON7 A;  4JR4 A;  2YPM A;  2MMN A;  4EF0 A;  2WRT A;  4KDU A;  4MDC A;  4KDY A;  5CRD A;  2XC2 A;  3QAG A;  4FH8 A;  2Z9S A;  3FZ4 A;  3H93 A;  1B4P A;  1F6M C;  3ERW A;  4IEL A;  2VLT A;  2I1U A;  3C1S A;  1PD2 1;  2C3T A;  1XWB A;  1ST9 A;  1X5D A;  3HJP A;  2R5G A;  4LA1 A;  3F6D A;  3A5W A;  4CHS A; 
#chains in the Genus database with same CATH topology
 4NMU A;  2B5E A;  3A2X A;  3KMN A;  5ECI B;  1IYH A;  5J9B A;  4J57 E;  2VLV A;  5JWO B;  5IMV A;  1GSF A;  3WT1 A;  1TI3 A;  2GZY A;  2H6X A;  3FR3 A;  2H71 A;  1Z6N A;  2L6C A;  3A2V A;  3GKM A;  1O85 A;  2VM1 A;  5F05 A;  3MIX A;  2PGT A;  4G10 A;  4WBR D;  5HQP A;  1KTE A;  4EVM A;  4HQZ A;  1WPI A;  3GX8 A;  1O7U A;  4BWS A;  4G0I A;  2C1Y A;  2I4A A;  2RLI A;  4ZIL A;  1EOG A;  2M46 A;  4HI7 A;  1T4Y A;  4TOP A;  4GST A;  2YAN A;  5J4U A;  3LGC A;  2BMX A;  5B8A A;  2C0G A;  2GQM A;  2V2G A;  3TCO A;  4ZL9 A;  2B5Y A;  1ZGN A;  3GL3 A;  1TRS A;  4XHM A;  2O89 A;  4LLR A;  4MPF A;  4Q5R A;  3LXT A;  4PX1 A;  5G2Z A;  3HYP A;  3EMX A;  5ECM B;  3L9V A;  1V98 A;  2DJ3 A;  1ZYE A;  3LYP A;  5LD0 A;  5HR3 A;  5D9V A;  4TXO B;  1U6T A;  4DSR A;  3CYN A;  1K3Y A;  4POL A;  2GGT A;  3KMO A;  5JCW A;  1NM3 A;  4RQR A;  2N5F A;  2HNL A;  1K3O A;  2TIR A;  4OCF A;  3A5I A;  2DJ1 A;  1R26 A;  3KZQ A;  4N10 A;  1TW9 A;  4WR4 A;  2MMO A;  1WRY A;  4MA9 A;  4A5P A;  2K8V A;  2JZT A;  2QGV A;  1M3J A;  1FOH A;  5ECN B;  1M2D A;  5CP1 A;  1T1V A;  1GH2 A;  3M8N A;  3A2W A;  4O5Q A;  3APQ A;  3TKS C;  4KDX A;  2OE1 A;  3ZRE A;  3RPN A;  3US3 A;  1ERT A;  3GUR A;  3D22 A;  3GH6 A;  3IR4 A;  4JED A;  3IE3 A;  2GST A;  3S9F A;  4IQA A;  1R5P A;  1AIU A;  2TRX A;  2YNX A;  6GSW A;  5IMD A;  5ID2 A;  1QK8 A;  1FAA A;  4IQ1 A;  2WB9 A;  3E0U A;  4MF6 A;  1XBS A;  4PUR A;  3BJ5 A;  1W89 A;  3F63 A;  2IMK A;  2GQK A;  2PBJ A;  1AC1 A;  5DAK A;  3APS A;  4GQF A;  3TJG A;  3KH9 A;  3CMI A;  2BTO T;  2CZ3 A;  3VWU A;  3C73 A;  1GSD A;  1XWA A;  1WP0 A;  3TKS E;  3PIN A;  3H79 A;  2GVP A;  2JU5 A;  3EIN A;  2EIO A;  1S3C A;  3KEB A;  1A2L A;  3FY7 A;  4IS0 A;  5H5R A;  1J0F A;  3LG6 A;  1J08 A;  2OE3 A;  2WS2 A;  2X8C A;  1Z9H A;  1XOA A;  4ZB9 A;  1PGT A;  6GSY A;  3DML A;  4G9H A;  3V1W A;  3FW2 A;  3TKR A;  1GUK A;  3D21 A;  1SK1 A;  2H70 A;  2I81 A;  5ECQ B;  3ZLP A;  2FWG A;  2V6O A;  3DWV A;  3TKP A;  1A2J A;  2EIQ A;  4PQ1 A;  3LSZ A;  3M3M A;  3F0I A;  3L9U A;  4BVX B;  2H1A A;  1X9S B;  2LV3 A;  5ECK B;  5CO3 A;  3DYR A;  4D73 A;  1AQW A;  3EUR A;  2CX4 A;  3CSH A;  4ZL7 A;  5KOX A;  3HDC A;  3UVT A;  4OFN A;  3FEU A;  1O6J A;  2ZUP A;  3GV1 A;  3BCI A;  5DBQ A;  1K3L A;  4K7O A;  2L5L A;  5E59 A;  3CQF A;  1ZCP A;  1PA3 A;  5KN0 A;  1S3R A;  1B4Q A;  3VUR A;  2H1D A;  1GRX A;  5KEJ A;  4HEA 2;  3GA4 A;  3QD9 A;  1SJI A;  4IVF A;  19GS A;  2H6Y A;  2PPT A;  5AGY A;  4JE1 A;  1OC8 A;  3VI7 A;  3ZVJ A;  1GTU A;  3GUS A;  2DIZ A;  1TK0 B;  2F3M A;  3KCM A;  4K5S A;  1OC3 A;  4EDZ A;  5CNW A;  1A2M A;  5G5F A;  4MJE A;  2RM5 A;  1K0N A;  2LJA A;  2LRN A;  4USS A;  1XIY A;  3QFB C;  2WGR A;  1AQX A;  1AQV A;  2FHE A;  2GSR A;  4POB A;  2VL3 A;  3KXO A;  2GT5 A;  4F0B A;  3IAS 2;  4GSS A;  3W8S A;  5IQY A;  1SD8 A;  1MD3 A;  3IV4 A;  3CSI A;  3LW9 A;  3PR8 A;  1BYE A;  3TDG A;  4HJM A;  1E6B A;  4MJA A;  3VPT A;  3K8N A;  3E3E A;  2CVK A;  2H0H A;  3Q19 A;  3VWV A;  10GS A;  3RHC A;  1I5G A;  1V40 A;  2KHP A;  3HJM A;  4JR6 A;  4BL7 B;  1K0D A;  4PXO A;  2CVB A;  2R3X A;  4E8E A;  1XVW A;  3HVS A;  1M9A A;  2C3Q A;  2V6K A;  2X8H A;  1YEX A;  3QCP A;  5AIV A;  2YP6 A;  3CTF A;  2B3S A;  4QQ7 A;  1YQ1 A;  4YAV A;  1NSW A;  2A2R A;  4E8H A;  4F0C A;  3FR6 A;  1BQ7 A;  1J9B A;  4X0X A;  3ZL5 A;  1QMV A;  5EVO A;  1SKS B;  4TR0 A;  5CRW A;  5JWR B;  1DBY A;  2JAC A;  1X5C A;  3I6A A;  4MNN A;  3FMW A;  1HNB A;  1EZK A;  1BX9 A;  3N9J A;  4YQV A;  3FRC A;  4KGI A;  1BED A;  2HE3 A;  3W8J A;  2MMA A;  3LQ7 A;  17GS A;  3HZ4 A;  5HFK A;  1ZOF A;  3AY8 A;  3PH9 A;  5J5N A;  5AIS A;  1MEK A;  2L57 A;  3NIV A;  1QQ2 A;  2NPB A;  4K7I A;  3RPP A;  3M0F A;  1BJX A;  1F3A A;  4ZBB A;  4KSO A;  2YZU A;  1X9W B;  1WMJ A;  4MH2 A;  4MF5 A;  2HSM A;  1TKD B;  3UJ1 A;  3DEX A;  1K0O A;  5INY A;  4AF2 A;  3IK7 A;  1TRU A;  2CAQ A;  1EEJ A;  3TRP A;  4RI6 A;  1PRX A;  4ISD A;  2ZNM A;  3RAZ A;  1ML6 A;  2BJX A;  3VLN A;  1PX6 A;  1XWG A;  3F4S A;  4CY8 A;  2DC5 A;  3CSJ A;  4MK3 A;  3I43 A;  1G7O A;  4FYC A;  3KJY A;  2PUK C;  1N8J A;  3HXS A;  3EC3 A;  4GXZ A;  5D96 A;  5B8B A;  2LTK A;  1TRW A;  5E4W A;  3LXZ A;  2E2M A;  1Y6E A;  4WBJ A;  2B7K A;  4PGT A;  5HR2 A;  3DVW A;  2X4A A;  4EIP A;  2JZS A;  2N5A A;  4HU7 A;  1EGO A;  2HXK A;  4MAB A;  4ZBA A;  4WET A;  5IOX A;  2LS5 A;  2CT6 A;  1SK2 A;  1HD2 A;  4HDE A;  5JWQ B;  1HNC A;  2ON5 A;  5G30 A;  2IL3 A;  2A2S A;  3SWL A;  3QAW A;  3LEF A;  4HOJ A;  2C0F A;  3BD2 A;  4XS6 A;  3EPT A;  5C04 A;  5AIX A;  1B9Y C;  1JZR A;  3Q6O A;  3G7I A;  5A4W A;  2FUG 2;  4ILF A;  1THX A;  3C71 A;  2HYX A;  2IIY A;  1A0R P;  4BVX A;  14GS A;  2NBS A;  3TJK A;  3UEM A;  3IC4 A;  2C3N A;  1SJ6 A;  1USB A;  4WEY A;  1EV9 A;  3KM6 A;  3HHV A;  2IN3 A;  2X49 A;  1GTB A;  3NOF A;  4O7H A;  1HQO A;  1Q4J A;  5IM9 A;  5G1K A;  1SL2 B;  1ZYN A;  4ULX A;  4OO4 A;  6GSX A;  2REM A;  1Z7P A;  3O3T A;  4P3Y B;  5IMF A;  3QFA C;  1X9M B;  3GYK A;  2CQ9 A;  1H75 A;  1HNA A;  3EVI A;  4IJ3 A;  2F8F A;  5ECL B;  2RII A;  2DSA A;  4MLY A;  3KH7 A;  5IO2 A;  1GSE A;  3G9B A;  1NHY A;  1U3I A;  4DSS B;  4PQH A;  4AJ6 A;  1DUG A;  2K9F A;  4J2F A;  4V2L A;  2H6Z A;  1F37 A;  1GNE A;  5KN2 A;  2MBS A;  4KF9 A;  1MTC A;  3C7M A;  2H1B A;  3EU4 A;  4XRD A;  4ZB6 A;  2AJQ B;  1PMT A;  1O81 A;  2C0D A;  2VL9 A;  3FK8 A;  2L5O A;  2HZE B;  2DKI A;  3PPU A;  1N2A A;  2QC7 A;  4LMV A;  4G2E A;  4G0L A;  2R6K A;  3NZN A;  3P8W A;  5IPH A;  5IOW A;  1MDK A;  4JBB A;  1GLQ A;  4L5L A;  5IPG A;  2B5X A;  5A4U A;  1VF2 A;  2R37 A;  1Q98 A;  4BVY B;  4RI7 A;  5DCH A;  4EKZ A;  4MPG A;  2P0G A;  2B7J A;  2E7P A;  1EV4 A;  3IHQ A;  4HJ2 A;  3RHB A;  3GRX A;  4K0N A;  3GMF A;  4IKH A;  4XS4 A;  3EE2 A;  3TKS A;  4BPY A;  3UVH A;  4TR4 A;  5JCU A;  4L0U A;  2GLR A;  4NHW A;  4ICY A;  5EL8 A;  3U6V A;  4KH7 A;  4OO5 A;  4MJB A;  1OVN A;  2HT9 A;  4TW5 A;  3FYG A;  6GST A;  4N30 A;  3TB2 A;  3QMX A;  2B1K A;  2WFC A;  4DVC A;  2H0I A;  4PUF C;  2EIR A;  2R0G A;  2JSY A;  3GST A;  1GTA A;  3ZIT A;  1Z5Y E;  2EC4 A;  3TRX A;  5BRT A;  4V2M A;  3MDK A;  1AXD A;  3EMP A;  5DJM A;  1B48 A;  3ED3 A;  1PL2 A;  2YWO A;  1TI1 A;  4TR1 B;  2DMM A;  2H73 A;  2LEG A;  4MZW A;  5B6M A;  3R2Q A;  3QOU A;  5DQY A;  4G0K A;  3CRU A;  5KOW A;  4GSN A;  4POM A;  4XCS A;  1C72 A;  4WXT A;  1WE0 A;  3UIW A;  2XPE A;  3GTU B;  2O7K A;  2FD3 A;  4KB3 A;  1QXH A;  2R4V A;  3IHG A;  4ZB8 A;  3E9J B;  3CBU A;  4K9Z A;  1F2E A;  1K0A A;  2LQO A;  1B9X C;  2LRC A;  3Q74 A;  3UMA A;  4JZQ A;  2FWF A;  3FZ9 A;  4GF0 A;  3TJJ A;  4K1F A;  1V58 A;  4Q5N A;  1TK8 B;  3DRN A;  2AAW A;  3D4M A;  2PVO C;  5ECO B;  2DIY A;  3FZA A;  2NVL A;  4CDO A;  2KP1 A;  1GUH A;  3FHK A;  4DEJ A;  3R3E A;  1XZO A;  2GT6 A;  2QKE A;  3DIE A;  4ML6 A;  4NXI A;  4L8E A;  3DGQ A;  3GKN A;  2V41 A;  1FOV A;  1SD9 A;  3KP9 A;  4Q5F A;  1URM A;  2C4J A;  2H19 A;  3ZTL A;  4ML1 A;  1YDK A;  3F3R A;  1KNG A;  6GSU A;  1WWJ A;  3BOA A;  4I8B A;  2R0P A;  3WGE A;  7GSS A;  1X0R A;  1Y25 A;  2LNT A;  3F3Q A;  3HY2 A;  4ID0 A;  5BMU A;  4F03 A;  5GZZ B;  4I6X A;  2DBC A;  2FCH A;  5C00 A;  3IDV A;  4BIK A;  1T8E B;  3ZML A;  5CRG A;  2DLX A;  1THO A;  2WZ9 A;  1FVJ A;  4I97 A;  3RDW A;  4MH3 A;  1A0F A;  3C8E A;  3GX0 A;  1KEB A;  3H8Q A;  2RM6 A;  4KCE A;  1TXX A;  3DVX A;  3HJO A;  3HKR A;  4K0G A;  3KTL A;  4PNG A;  3GN3 A;  2H01 A;  4NWY A;  9GSS A;  1FB6 A;  3P90 A;  3M9K A;  2L4Q A;  1UC7 A;  5ECR B;  1JZO A;  5B7C A;  4GCI A;  2WDU A;  3ZMK A;  4F9Z A;  1V9W A;  3ME8 A;  3IPZ A;  2QA2 A;  4BA7 A;  5ECH B;  1JFU A;  1ACV A;  1OE8 A;  1TTZ A;  2X64 A;  3D5J A;  2G0F A;  4FIW A;  4KUN A;  5IO0 A;  4OD7 A;  3EWL A;  1PQN A;  4MCU A;  2OKA A;  2OBI A;  4YQU A;  2PMT A;  1SL1 B;  1M0U A;  5GAN D;  1GTI A;  1R7H A;  2LJK A;  1S3D A;  2YWI A;  1MD4 A;  1EWX A;  1M99 A;  1A24 A;  5DCG A;  3GFK A;  5D73 A;  3UL3 A;  1FHE A;  4TXO A;  2YWM A;  4G19 A;  2D2Z A;  1ERV A;  2KUC A;  5IMA A;  4HS1 A;  5HR1 A;  2G2Q A;  2OAC A;  3C1R A;  1ERU A;  1PN9 A;  4PUA A;  3N5O A;  5DDL A;  1G7E A;  4MZB A;  2OJL A;  1ZYQ B;  2FA8 A;  1AW9 A;  2IPA A;  1FW1 A;  2L4C A;  2VL2 A;  3TGZ A;  4BVY A;  4K6X A;  4KW6 A;  1PL1 A;  1MDJ A;  1T3B A;  2OE0 A;  3VK9 A;  5HR0 A;  3L9S A;  1TU8 A;  2X8G A;  3ERF A;  2H0G A;  3ZVJ D;  2LST A;  5F06 A;  1XVQ A;  5DAK B;  1NHO A;  4K5R A;  2CAI A;  4KAE A;  4K2D A;  4N0V A;  2I3Y A;  2VCZ A;  1GUM A;  5DQS A;  2GSS A;  4FYB A;  1YJ6 A;  3LOR A;  3MNG A;  3L4N A;  3MAK A;  2DKH A;  1SU9 A;  1TP9 A;  2R2J A;  4I2U A;  22GS A;  2L59 A;  2PWJ A;  1XG8 A;  4POK A;  4EUY A;  5H5Q A;  2R0C A;  1Z3E A;  2IFQ B;  1T7P B;  1SEN A;  1LBK A;  2OA7 A;  2XPD A;  1O8W A;  6GSS A;  5H5S A;  1HYU A;  2CV4 A;  3GIX A;  3G7J A;  1XW9 A;  2ES7 A;  2OBK A;  1GNW A;  1ZZY A;  2CZ2 A;  2P5Q A;  3TJB A;  2FGX A;  2OAD A;  1JZD A;  4CW9 A;  1VF4 A;  2L6D A;  2B1L A;  1VF3 A;  1XWC A;  5FHI A;  3UAP A;  1GWC A;  2P31 A;  4I5Q A;  4TR1 A;  2O87 A;  2XHF A;  2H74 A;  4TR3 A;  3F4T A;  2GS3 A;  1YF0 A;  4X43 A;  6GSV A;  2AHE A;  4ACS A;  4D73 B;  11GS A;  3HCZ A;  1Z7R A;  4ECI A;  2E0Q A;  5A4V A;  4ZXG A;  1GSS A;  4I2T A;  2IJY A;  2QSI A;  1SK0 A;  2V32 A;  3I9V 2;  1K0B A;  4ECC A;  1EP7 A;  4EE0 A;  3GKK A;  5D9W A;  1O73 A;  4JRR A;  2LQQ A;  2C80 A;  1ON4 A;  5IMZ A;  3VI5 A;  4GWR A;  4FYU A;  3H1N A;  2O8V B;  5DAL B;  3JCM L;  1XXU A;  5F07 A;  1XFL A;  2GQL A;  3D6I A;  5ECS A;  4Z2T A;  5LCZ A;  2N5B A;  1XCC A;  1UA5 A;  2PVQ A;  4K8M A;  4LL4 B;  5ABR A;  3BBY A;  4L5O A;  5GST A;  2J23 A;  2VD0 A;  5JCG A;  3ZRD A;  2PU9 C;  2VIM A;  1GSQ A;  2HLS A;  2HRK A;  2MZC A;  4TN8 A;  4IGJ A;  4EL1 A;  3LYK A;  1EGR A;  3P7X A;  2VCX A;  3EU3 A;  3DKS A;  4RUV A;  1I9D A;  1TRV A;  2IMI A;  2I9H A;  4AGS A;  4XIH A;  1T00 A;  3UBL A;  1B8X A;  2MMZ A;  1M3I A;  4EO3 A;  1OC9 B;  2DJ0 A;  4RQX A;  3J7Y b;  1FG4 A;  2KP2 A;  1GSU A;  4IP1 A;  1SL0 B;  2YCD A;  4MMM A;  4XTS A;  1E2Y A;  3D4T A;  2AV4 A;  2YOI A;  4LMW A;  1YZX A;  5IMC A;  2P5R A;  4ZIJ A;  4NPB A;  1JZW A;  1AUC A;  1PFO A;  3H4K A;  2FY6 A;  1ZYP A;  2VUP A;  5ECP B;  3IK9 A;  2K8S A;  2HRN A;  3KP8 A;  5G1L A;  4EIQ A;  1O8X A;  2C0E A;  1ZMA A;  4FO5 A;  4XRA A;  3M9J A;  4WR5 A;  1QGV A;  5IIZ A;  1XOB A;  2KLX A;  4IW9 A;  1DE1 A;  2F8A A;  4F2I A;  2XBI A;  2JL4 A;  4EC0 A;  3BCK A;  1M2B A;  4O5R A;  4IHU A;  4HZ4 A;  5ELG A;  2FLS A;  4KA0 A;  4PTS A;  4HUA A;  2VCQ A;  1VF1 A;  2A2P A;  3MYD A;  4IJI A;  4BL7 A;  2LJR A;  4OFM A;  3UAR A;  3EYT A;  2RUF A;  4KND A;  2H1G A;  2HZF A;  4N0Z A;  4YKG A;  1XW5 A;  3F6F A;  4GQC A;  1AAZ A;  2A4H A;  2J9H A;  1ZL9 A;  3OR5 A;  4XS1 A;  3IRA A;  1A8L A;  1SKR B;  3SBC A;  1BAY A;  1WIK A;  4QL9 A;  5CAX A;  3GL5 A;  2FA4 A;  4X4J A;  2H75 A;  1U88 A;  3CRT A;  5J9C A;  1QFN A;  4GLT A;  3TRQ A;  1XWK A;  4ECJ A;  1G6W A;  3ZZX A;  1LU4 A;  1T4Z A;  1GSY A;  2CA8 A;  2AB6 A;  3GNJ A;  4N11 A;  3LFL A;  1V57 A;  2VCV A;  1R4W A;  2VM2 A;  1TJD A;  3PGT A;  4KX4 A;  5F0G A;  4NHZ A;  1PN0 A;  3O76 A;  2VCT A;  5DVB A;  3VWW A;  1Z6M A;  3APO A;  4LL1 B;  1OYJ A;  3WGX A;  1F3B A;  2YJH A;  4FQU A;  1R5A A;  1RK4 A;  1LJR A;  2CX3 A;  4O32 A;  4V1A p;  5G31 A;  2LKU A;  2YWN A;  1W4V A;  3KIJ A;  1OAZ A;  3IXR A;  1K0C A;  1MDI A;  1SJZ A;  2MBT A;  1EP8 A;  2YJ7 A;  2GDR A;  3QR6 A;  5D8I A;  3WGD A;  5KN3 A;  2VOC A;  2YV9 A;  5F8B A;  1WJK A;  4JU5 A;  4OMV A;  1RQM A;  2GZZ A;  4WKW A;  2FNO A;  2IFQ A;  4DSQ A;  5CYY A;  3VWX A;  4OCE A;  1VGL A;  2C8U A;  3D0Z A;  2IWT A;  4PNF A;  1YY7 A;  1PKW A;  3HD5 A;  2AUV A;  1UVZ A;  3CXG A;  1DSB A;  4NV5 A;  2LNS A;  3I69 A;  3G7Y A;  4F82 A;  3DXB A;  2HSH A;  4QL7 A;  4TXV A;  1H4O A;  4ECB A;  3IAM 2;  2AYT A;  4OFT A;  3TOU A;  5G5E A;  3LWA A;  20GS A;  1JHB A;  3TKQ A;  1YEP A;  2GTU A;  2VAF A;  4ZBD A;  3UBK A;  1G0T A;  3GHA A;  12GS A;  1EOH A;  3M1G A;  5D9T A;  3P2A A;  2VLU A;  5AN1 A;  1UN2 A;  3GSS A;  3L0H A;  5KN1 A;  3ISO A;  3ZFB A;  1FB0 A;  4GTU A;  2DML A;  3GH9 A;  2KOK A;  3FZ5 A;  3Q18 A;  2LRT A;  3ME7 A;  2NTO A;  1A8Y A;  1G6Y A;  2IMF A;  4HZ2 A;  3L78 A;  1IYI A;  1SYR A;  1GL8 A;  3ERG A;  4K7N A;  4NV2 A;  4AJ8 A;  5DAL A;  4Z7X A;  3FR9 A;  2H66 A;  1TK5 B;  5ELA A;  1ABA A;  4K2X A;  4TRX A;  5COH A;  2F9S A;  3TOT A;  2MYG A;  4YH2 A;  1JLV A;  3KGK A;  5CRH A;  1TOF A;  2GZP A;  1X5E A;  2HRA A;  1WOU A;  2WJU A;  5L71 A;  4Q5Q A;  4Z2U A;  4KCA A;  2DJ2 A;  2K18 A;  4MF7 A;  1M2A A;  3A3T A;  2ALB A;  1FO5 A;  3QDN A;  1RW1 A;  3MWH A;  13GS A;  5J41 A;  3CTG A;  1QUW A;  1PKZ A;  1S3A A;  2HFD A;  1U3A A;  2H72 A;  5GSS A;  3F4R A;  4V2N A;  4WF5 A;  2YV7 A;  2H30 A;  1OC9 A;  5EPF A;  4HSC X;  1EEM A;  1SYX A;  2CVD A;  4YAP A;  1OKD A;  3MSZ A;  4DSS A;  5B6N A;  4IBP A;  5HFG A;  5D93 A;  3DD3 A;  3WYW A;  3HVV A;  1ILO A;  3KTB A;  2M72 A;  3WD6 A;  1OE7 A;  2YN1 A;  4WF4 A;  5GAP D;  4XS4 B;  2M80 A;  1ERW A;  1K0M A;  4H86 A;  2XBQ A;  3ZFL A;  4IN0 A;  2HZE A;  4GRF A;  1YKC A;  2TRC P;  3QPM A;  5CRE A;  5J3R A;  2JZR A;  2HRF A;  3GKX A;  4MZC A;  1VRS D;  1FVK A;  2B6M A;  5ENU A;  2WUL A;  2ZCT A;  1CQG A;  2DJK A;  2H8L A;  4J56 E;  5ID2 B;  5FT3 A;  1XW6 A;  2PER A;  2V1M A;  3KD0 A;  4KE3 A;  2K6V A;  5LNK e;  1DE2 A;  1TU7 A;  2A4V A;  4Z2R A;  4IP6 A;  1GP1 A;  4L0W A;  3HVN A;  2GSQ A;  1SKW B;  4YKF A;  5A5K A;  3U5R E;  4MJC A;  1F9M A;  1V2A A;  2E2G A;  1CQH A;  5EY6 A;  4YQM A;  1M7T A;  2VL2 C;  2FWE A;  2YZH A;  2VD1 A;  3HZ8 A;  3RBT A;  2LUS A;  4TVE A;  1YF1 A;  1JLW A;  2WCI A;  3IA1 A;  3ZYW A;  3ZIV A;  2RUE A;  4MP4 A;  2HI7 A;  1TDI A;  3O6T A;  3FKF A;  3VPQ A;  3VFI A;  2X99 A;  1M9B A;  4AJ7 A;  3HA9 A;  16GS A;  3LJR A;  4HQS A;  1KBN A;  1YKA A;  3WT2 A;  1BG5 A;  1PSQ A;  1U87 A;  1PX7 A;  3QAV A;  5FWG A;  2H76 A;  1A23 A;  2IME A;  1NW2 A;  1GLP A;  4V1A g;  4TKY A;  2NDO A;  4X1U A;  4EXJ A;  8GSS A;  2VCW A;  2IMD A;  4ZL8 A;  1XPV A;  3IC8 A;  3TUE A;  2VO4 A;  2UZ8 A;  4BWQ A;  5D9X A;  3W6G A;  2JAD A;  2O85 A;  1OKT A;  4NAX A;  1GUL A;  2HSY A;  4HU9 A;  18GS A;  2DJJ A;  2F51 A;  5DJL A;  3HVX A;  4EDY A;  3F9U A;  3F8U A;  4CY6 A;  2JSZ A;  4PQI A;  3ZIJ A;  3IBH A;  5HFI A;  3UOM A;  3TJF A;  4O92 A;  4OWY A;  3IOS A;  4KSM A;  3GTU A;  3J7Y k;  2PN8 A;  2FWH A;  2ON7 A;  4JR4 A;  2QA1 A;  2MMN A;  2YPM A;  4O5U A;  4EF0 A;  2WRT A;  4KDU A;  4MDC A;  4KDY A;  5CRD A;  2XC2 A;  3QAG A;  4FH8 A;  2Z9S A;  3FZ4 A;  3H93 A;  1B4P A;  1F6M C;  3ERW A;  4IEL A;  2VLT A;  2I1U A;  3C1S A;  1PD2 1;  2C3T A;  1XWB A;  1ST9 A;  1X5D A;  3HJP A;  2R5G A;  4LA1 A;  3F6D A;  3A5W A;  4CHS A; 
#chains in the Genus database with same CATH homology
 4NMU A;  2B5E A;  3A2X A;  3KMN A;  5ECI B;  1IYH A;  5J9B A;  4J57 E;  2VLV A;  5JWO B;  5IMV A;  1GSF A;  3WT1 A;  1TI3 A;  2GZY A;  2H6X A;  3FR3 A;  2H71 A;  1Z6N A;  2L6C A;  3A2V A;  3GKM A;  1O85 A;  2VM1 A;  5F05 A;  3MIX A;  2PGT A;  4G10 A;  4WBR D;  5HQP A;  1KTE A;  4EVM A;  4HQZ A;  1WPI A;  3GX8 A;  1O7U A;  4BWS A;  4G0I A;  2C1Y A;  2I4A A;  2RLI A;  4ZIL A;  1EOG A;  2M46 A;  4HI7 A;  1T4Y A;  4TOP A;  4GST A;  2YAN A;  5J4U A;  3LGC A;  2BMX A;  5B8A A;  2C0G A;  2GQM A;  2V2G A;  3TCO A;  4ZL9 A;  2B5Y A;  1ZGN A;  3GL3 A;  1TRS A;  4XHM A;  2O89 A;  4LLR A;  4MPF A;  4Q5R A;  3LXT A;  4PX1 A;  5G2Z A;  3HYP A;  3EMX A;  5ECM B;  3L9V A;  1V98 A;  2DJ3 A;  1ZYE A;  3LYP A;  5LD0 A;  5HR3 A;  5D9V A;  4TXO B;  1U6T A;  4DSR A;  3CYN A;  1K3Y A;  4POL A;  2GGT A;  3KMO A;  5JCW A;  1NM3 A;  4RQR A;  2N5F A;  2HNL A;  1K3O A;  2TIR A;  4OCF A;  3A5I A;  2DJ1 A;  1R26 A;  3KZQ A;  4N10 A;  1TW9 A;  4WR4 A;  2MMO A;  1WRY A;  4MA9 A;  4A5P A;  2K8V A;  2JZT A;  2QGV A;  1FOH A;  5ECN B;  1M2D A;  5CP1 A;  1T1V A;  1GH2 A;  3M8N A;  3A2W A;  4O5Q A;  3APQ A;  3TKS C;  4KDX A;  2OE1 A;  3ZRE A;  3RPN A;  3US3 A;  1ERT A;  3GUR A;  3D22 A;  3GH6 A;  3IR4 A;  4JED A;  3IE3 A;  2GST A;  3S9F A;  4IQA A;  1R5P A;  1AIU A;  2TRX A;  2YNX A;  6GSW A;  5IMD A;  5ID2 A;  1QK8 A;  1FAA A;  4IQ1 A;  2WB9 A;  3E0U A;  4MF6 A;  1XBS A;  4PUR A;  3BJ5 A;  1W89 A;  3F63 A;  2IMK A;  2GQK A;  2PBJ A;  1AC1 A;  5DAK A;  3APS A;  4GQF A;  3TJG A;  3KH9 A;  3CMI A;  2BTO T;  2CZ3 A;  3VWU A;  3C73 A;  1GSD A;  1XWA A;  1WP0 A;  3TKS E;  3PIN A;  3H79 A;  2GVP A;  2JU5 A;  3EIN A;  2EIO A;  1S3C A;  3KEB A;  1A2L A;  3FY7 A;  4IS0 A;  5H5R A;  1J0F A;  3LG6 A;  1J08 A;  2OE3 A;  2WS2 A;  2X8C A;  1Z9H A;  1XOA A;  4ZB9 A;  1PGT A;  6GSY A;  3DML A;  4G9H A;  3V1W A;  3FW2 A;  3TKR A;  1GUK A;  3D21 A;  1SK1 A;  2H70 A;  2I81 A;  5ECQ B;  3ZLP A;  2FWG A;  2V6O A;  3DWV A;  3TKP A;  1A2J A;  2EIQ A;  4PQ1 A;  3LSZ A;  3M3M A;  3F0I A;  3L9U A;  4BVX B;  2H1A A;  1X9S B;  2LV3 A;  5ECK B;  5CO3 A;  3DYR A;  4D73 A;  1AQW A;  3EUR A;  2CX4 A;  3CSH A;  4ZL7 A;  5KOX A;  3HDC A;  3UVT A;  4OFN A;  3FEU A;  1O6J A;  2ZUP A;  3GV1 A;  3BCI A;  5DBQ A;  1K3L A;  4K7O A;  2L5L A;  5E59 A;  1ZCP A;  1PA3 A;  5KN0 A;  1B4Q A;  3VUR A;  2H1D A;  1GRX A;  5KEJ A;  4HEA 2;  3GA4 A;  3QD9 A;  1SJI A;  4IVF A;  19GS A;  2H6Y A;  2PPT A;  5AGY A;  4JE1 A;  1OC8 A;  3VI7 A;  3ZVJ A;  1GTU A;  3GUS A;  2DIZ A;  1TK0 B;  2F3M A;  3KCM A;  4K5S A;  1OC3 A;  4EDZ A;  5CNW A;  1A2M A;  5G5F A;  4MJE A;  2RM5 A;  1K0N A;  2LJA A;  2LRN A;  4USS A;  1XIY A;  3QFB C;  2WGR A;  1AQX A;  1AQV A;  2FHE A;  2GSR A;  4POB A;  2VL3 A;  3KXO A;  2GT5 A;  4F0B A;  3IAS 2;  4GSS A;  3W8S A;  5IQY A;  1SD8 A;  1MD3 A;  3IV4 A;  3CSI A;  3LW9 A;  3PR8 A;  1BYE A;  3TDG A;  4HJM A;  1E6B A;  4MJA A;  3VPT A;  3K8N A;  3E3E A;  2CVK A;  2H0H A;  3Q19 A;  3VWV A;  10GS A;  3RHC A;  1I5G A;  1V40 A;  2KHP A;  3HJM A;  4JR6 A;  4BL7 B;  1K0D A;  4PXO A;  2CVB A;  2R3X A;  4E8E A;  1XVW A;  3HVS A;  1M9A A;  2C3Q A;  2V6K A;  2X8H A;  1YEX A;  3QCP A;  5AIV A;  2YP6 A;  3CTF A;  2B3S A;  4QQ7 A;  1YQ1 A;  4YAV A;  1NSW A;  2A2R A;  4E8H A;  4F0C A;  3FR6 A;  1BQ7 A;  1J9B A;  4X0X A;  3ZL5 A;  1QMV A;  5EVO A;  1SKS B;  4TR0 A;  5CRW A;  5JWR B;  1DBY A;  2JAC A;  1X5C A;  3I6A A;  4MNN A;  3FMW A;  1HNB A;  1EZK A;  1BX9 A;  3N9J A;  4YQV A;  3FRC A;  4KGI A;  1BED A;  2HE3 A;  3W8J A;  2MMA A;  3LQ7 A;  17GS A;  3HZ4 A;  5HFK A;  1ZOF A;  3AY8 A;  3PH9 A;  5J5N A;  5AIS A;  1MEK A;  2L57 A;  3NIV A;  1QQ2 A;  2NPB A;  4K7I A;  3RPP A;  3M0F A;  1BJX A;  1F3A A;  4ZBB A;  4KSO A;  2YZU A;  1X9W B;  1WMJ A;  4MH2 A;  4MF5 A;  2HSM A;  1TKD B;  3UJ1 A;  3DEX A;  1K0O A;  5INY A;  4AF2 A;  3IK7 A;  1TRU A;  2CAQ A;  1EEJ A;  3TRP A;  4RI6 A;  1PRX A;  4ISD A;  2ZNM A;  3RAZ A;  1ML6 A;  2BJX A;  3VLN A;  1PX6 A;  1XWG A;  3F4S A;  4CY8 A;  2DC5 A;  3CSJ A;  4MK3 A;  3I43 A;  1G7O A;  4FYC A;  3KJY A;  2PUK C;  1N8J A;  3HXS A;  3EC3 A;  4GXZ A;  5D96 A;  5B8B A;  2LTK A;  1TRW A;  5E4W A;  3LXZ A;  2E2M A;  1Y6E A;  4WBJ A;  2B7K A;  4PGT A;  5HR2 A;  3DVW A;  2X4A A;  4EIP A;  2JZS A;  2N5A A;  4HU7 A;  1EGO A;  2HXK A;  4MAB A;  4ZBA A;  4WET A;  5IOX A;  2LS5 A;  2CT6 A;  1SK2 A;  1HD2 A;  4HDE A;  5JWQ B;  1HNC A;  2ON5 A;  5G30 A;  2IL3 A;  2A2S A;  3SWL A;  3QAW A;  3LEF A;  4HOJ A;  2C0F A;  3BD2 A;  4XS6 A;  3EPT A;  5C04 A;  5AIX A;  1B9Y C;  1JZR A;  3Q6O A;  3G7I A;  5A4W A;  2FUG 2;  4ILF A;  1THX A;  3C71 A;  2HYX A;  2IIY A;  1A0R P;  4BVX A;  14GS A;  2NBS A;  3TJK A;  3UEM A;  3IC4 A;  2C3N A;  1SJ6 A;  1USB A;  4WEY A;  1EV9 A;  3KM6 A;  3HHV A;  2IN3 A;  2X49 A;  1GTB A;  3NOF A;  4O7H A;  1HQO A;  1Q4J A;  5IM9 A;  5G1K A;  1SL2 B;  1ZYN A;  4ULX A;  4OO4 A;  6GSX A;  2REM A;  1Z7P A;  3O3T A;  4P3Y B;  5IMF A;  3QFA C;  1X9M B;  3GYK A;  2CQ9 A;  1H75 A;  1HNA A;  3EVI A;  4IJ3 A;  2F8F A;  5ECL B;  2RII A;  2DSA A;  4MLY A;  3KH7 A;  5IO2 A;  1GSE A;  3G9B A;  1NHY A;  1U3I A;  4DSS B;  4PQH A;  4AJ6 A;  1DUG A;  2K9F A;  4J2F A;  4V2L A;  2H6Z A;  1F37 A;  1GNE A;  5KN2 A;  2MBS A;  4KF9 A;  1MTC A;  3C7M A;  2H1B A;  3EU4 A;  4XRD A;  4ZB6 A;  2AJQ B;  1PMT A;  1O81 A;  2C0D A;  2VL9 A;  3FK8 A;  2L5O A;  2HZE B;  2DKI A;  3PPU A;  1N2A A;  2QC7 A;  4LMV A;  4G2E A;  4G0L A;  2R6K A;  3NZN A;  3P8W A;  5IPH A;  5IOW A;  1MDK A;  4JBB A;  1GLQ A;  4L5L A;  5IPG A;  2B5X A;  5A4U A;  1VF2 A;  2R37 A;  1Q98 A;  4BVY B;  4RI7 A;  5DCH A;  4EKZ A;  4MPG A;  2P0G A;  2B7J A;  2E7P A;  1EV4 A;  3IHQ A;  4HJ2 A;  3RHB A;  3GRX A;  4K0N A;  3GMF A;  4IKH A;  4XS4 A;  3EE2 A;  3TKS A;  4BPY A;  3UVH A;  4TR4 A;  5JCU A;  4L0U A;  2GLR A;  4NHW A;  4ICY A;  5EL8 A;  3U6V A;  4KH7 A;  4OO5 A;  4MJB A;  1OVN A;  2HT9 A;  4TW5 A;  3FYG A;  6GST A;  4N30 A;  3TB2 A;  3QMX A;  2B1K A;  2WFC A;  4DVC A;  2H0I A;  4PUF C;  2EIR A;  2R0G A;  2JSY A;  3GST A;  1GTA A;  3ZIT A;  1Z5Y E;  2EC4 A;  3TRX A;  5BRT A;  4V2M A;  3MDK A;  1AXD A;  3EMP A;  5DJM A;  1B48 A;  3ED3 A;  1PL2 A;  2YWO A;  1TI1 A;  4TR1 B;  2DMM A;  2H73 A;  2LEG A;  4MZW A;  5B6M A;  3R2Q A;  3QOU A;  5DQY A;  4G0K A;  3CRU A;  5KOW A;  4GSN A;  4POM A;  4XCS A;  1C72 A;  4WXT A;  1WE0 A;  3UIW A;  2XPE A;  3GTU B;  2O7K A;  2FD3 A;  4KB3 A;  1QXH A;  2R4V A;  3IHG A;  4ZB8 A;  3E9J B;  3CBU A;  4K9Z A;  1F2E A;  1K0A A;  2LQO A;  1B9X C;  2LRC A;  3Q74 A;  3UMA A;  4JZQ A;  2FWF A;  3FZ9 A;  4GF0 A;  3TJJ A;  4K1F A;  1V58 A;  4Q5N A;  1TK8 B;  3DRN A;  2AAW A;  3D4M A;  2PVO C;  5ECO B;  2DIY A;  3FZA A;  2NVL A;  4CDO A;  2KP1 A;  1GUH A;  3FHK A;  4DEJ A;  3R3E A;  1XZO A;  2GT6 A;  2QKE A;  3DIE A;  4ML6 A;  4NXI A;  4L8E A;  3DGQ A;  3GKN A;  2V41 A;  1FOV A;  1SD9 A;  3KP9 A;  4Q5F A;  1URM A;  2C4J A;  2H19 A;  3ZTL A;  4ML1 A;  1YDK A;  3F3R A;  1KNG A;  6GSU A;  1WWJ A;  3BOA A;  4I8B A;  2R0P A;  3WGE A;  7GSS A;  1X0R A;  1Y25 A;  2LNT A;  3F3Q A;  3HY2 A;  4ID0 A;  5BMU A;  4F03 A;  5GZZ B;  4I6X A;  2DBC A;  2FCH A;  5C00 A;  3IDV A;  1T8E B;  3ZML A;  5CRG A;  2DLX A;  1THO A;  2WZ9 A;  1FVJ A;  4I97 A;  3RDW A;  4MH3 A;  1A0F A;  3C8E A;  3GX0 A;  1KEB A;  3H8Q A;  2RM6 A;  4KCE A;  1TXX A;  3DVX A;  3HJO A;  3HKR A;  4K0G A;  3KTL A;  4PNG A;  3GN3 A;  2H01 A;  4NWY A;  9GSS A;  1FB6 A;  3P90 A;  3M9K A;  2L4Q A;  1UC7 A;  5ECR B;  1JZO A;  5B7C A;  4GCI A;  2WDU A;  3ZMK A;  4F9Z A;  1V9W A;  3ME8 A;  3IPZ A;  2QA2 A;  4BA7 A;  5ECH B;  1JFU A;  1ACV A;  1OE8 A;  1TTZ A;  2X64 A;  3D5J A;  2G0F A;  4FIW A;  4KUN A;  5IO0 A;  4OD7 A;  3EWL A;  1PQN A;  4MCU A;  2OKA A;  2OBI A;  4YQU A;  2PMT A;  1SL1 B;  1M0U A;  5GAN D;  1GTI A;  1R7H A;  2LJK A;  1S3D A;  2YWI A;  1MD4 A;  1EWX A;  1M99 A;  1A24 A;  5DCG A;  3GFK A;  5D73 A;  3UL3 A;  1FHE A;  4TXO A;  2YWM A;  4G19 A;  2D2Z A;  1ERV A;  2KUC A;  5IMA A;  4HS1 A;  5HR1 A;  2G2Q A;  2OAC A;  3C1R A;  1ERU A;  1PN9 A;  4PUA A;  3N5O A;  5DDL A;  1G7E A;  4MZB A;  2OJL A;  1ZYQ B;  2FA8 A;  1AW9 A;  2IPA A;  1FW1 A;  2L4C A;  2VL2 A;  3TGZ A;  4BVY A;  4K6X A;  4KW6 A;  1PL1 A;  1MDJ A;  1T3B A;  2OE0 A;  3VK9 A;  5HR0 A;  3L9S A;  1TU8 A;  2X8G A;  3ERF A;  2H0G A;  3ZVJ D;  2LST A;  5F06 A;  1XVQ A;  5DAK B;  1NHO A;  4K5R A;  2CAI A;  4KAE A;  4K2D A;  4N0V A;  2I3Y A;  2VCZ A;  1GUM A;  5DQS A;  2GSS A;  4FYB A;  1YJ6 A;  3LOR A;  3MNG A;  3L4N A;  3MAK A;  2DKH A;  1SU9 A;  1TP9 A;  2R2J A;  4I2U A;  22GS A;  2L59 A;  2PWJ A;  4POK A;  4EUY A;  5H5Q A;  2R0C A;  1Z3E A;  2IFQ B;  1T7P B;  1SEN A;  1LBK A;  2OA7 A;  2XPD A;  1O8W A;  6GSS A;  5H5S A;  1HYU A;  2CV4 A;  3GIX A;  3G7J A;  1XW9 A;  2ES7 A;  2OBK A;  1GNW A;  1ZZY A;  2CZ2 A;  2P5Q A;  3TJB A;  2FGX A;  2OAD A;  1JZD A;  4CW9 A;  1VF4 A;  2L6D A;  2B1L A;  1VF3 A;  1XWC A;  5FHI A;  3UAP A;  1GWC A;  2P31 A;  4I5Q A;  4TR1 A;  2O87 A;  2XHF A;  2H74 A;  4TR3 A;  3F4T A;  2GS3 A;  1YF0 A;  4X43 A;  6GSV A;  2AHE A;  4ACS A;  4D73 B;  11GS A;  3HCZ A;  1Z7R A;  4ECI A;  2E0Q A;  5A4V A;  4ZXG A;  1GSS A;  4I2T A;  2IJY A;  2QSI A;  1SK0 A;  2V32 A;  3I9V 2;  1K0B A;  4ECC A;  1EP7 A;  4EE0 A;  3GKK A;  5D9W A;  1O73 A;  4JRR A;  2LQQ A;  2C80 A;  1ON4 A;  5IMZ A;  3VI5 A;  4GWR A;  4FYU A;  3H1N A;  2O8V B;  5DAL B;  3JCM L;  1XXU A;  5F07 A;  1XFL A;  2GQL A;  3D6I A;  5ECS A;  4Z2T A;  5LCZ A;  2N5B A;  1XCC A;  1UA5 A;  2PVQ A;  4K8M A;  4LL4 B;  5ABR A;  3BBY A;  4L5O A;  5GST A;  2J23 A;  2VD0 A;  5JCG A;  3ZRD A;  2PU9 C;  2VIM A;  1GSQ A;  2HLS A;  2HRK A;  2MZC A;  4TN8 A;  4IGJ A;  4EL1 A;  3LYK A;  1EGR A;  3P7X A;  2VCX A;  3EU3 A;  3DKS A;  4RUV A;  1I9D A;  1TRV A;  2IMI A;  2I9H A;  4AGS A;  4XIH A;  1T00 A;  3UBL A;  1B8X A;  2MMZ A;  4EO3 A;  1OC9 B;  2DJ0 A;  4RQX A;  3J7Y b;  1FG4 A;  2KP2 A;  1GSU A;  4IP1 A;  1SL0 B;  2YCD A;  4MMM A;  4XTS A;  1E2Y A;  3D4T A;  2AV4 A;  2YOI A;  4LMW A;  1YZX A;  5IMC A;  2P5R A;  4ZIJ A;  4NPB A;  1JZW A;  1AUC A;  3H4K A;  2FY6 A;  1ZYP A;  2VUP A;  5ECP B;  3IK9 A;  2K8S A;  2HRN A;  3KP8 A;  5G1L A;  4EIQ A;  1O8X A;  2C0E A;  1ZMA A;  4FO5 A;  4XRA A;  3M9J A;  4WR5 A;  1QGV A;  5IIZ A;  1XOB A;  2KLX A;  4IW9 A;  1DE1 A;  2F8A A;  4F2I A;  2XBI A;  2JL4 A;  4EC0 A;  3BCK A;  1M2B A;  4O5R A;  4IHU A;  4HZ4 A;  5ELG A;  2FLS A;  4KA0 A;  4PTS A;  4HUA A;  2VCQ A;  1VF1 A;  2A2P A;  3MYD A;  4IJI A;  4BL7 A;  2LJR A;  4OFM A;  3UAR A;  3EYT A;  2RUF A;  4KND A;  2H1G A;  2HZF A;  4N0Z A;  4YKG A;  1XW5 A;  3F6F A;  4GQC A;  1AAZ A;  2A4H A;  2J9H A;  1ZL9 A;  3OR5 A;  4XS1 A;  3IRA A;  1A8L A;  1SKR B;  3SBC A;  1BAY A;  1WIK A;  4QL9 A;  5CAX A;  3GL5 A;  2FA4 A;  4X4J A;  2H75 A;  1U88 A;  3CRT A;  5J9C A;  1QFN A;  4GLT A;  3TRQ A;  1XWK A;  4ECJ A;  1G6W A;  3ZZX A;  1LU4 A;  1T4Z A;  1GSY A;  2CA8 A;  2AB6 A;  3GNJ A;  4N11 A;  3LFL A;  1V57 A;  2VCV A;  1R4W A;  2VM2 A;  1TJD A;  3PGT A;  4KX4 A;  5F0G A;  4NHZ A;  1PN0 A;  3O76 A;  2VCT A;  5DVB A;  3VWW A;  1Z6M A;  3APO A;  4LL1 B;  1OYJ A;  3WGX A;  1F3B A;  2YJH A;  4FQU A;  1R5A A;  1RK4 A;  1LJR A;  2CX3 A;  4O32 A;  4V1A p;  5G31 A;  2LKU A;  2YWN A;  1W4V A;  3KIJ A;  1OAZ A;  3IXR A;  1K0C A;  1MDI A;  1SJZ A;  2MBT A;  1EP8 A;  2YJ7 A;  2GDR A;  3QR6 A;  5D8I A;  3WGD A;  5KN3 A;  2VOC A;  2YV9 A;  5F8B A;  1WJK A;  4JU5 A;  4OMV A;  1RQM A;  2GZZ A;  4WKW A;  2FNO A;  2IFQ A;  4DSQ A;  5CYY A;  3VWX A;  4OCE A;  1VGL A;  2C8U A;  3D0Z A;  2IWT A;  4PNF A;  1YY7 A;  1PKW A;  3HD5 A;  2AUV A;  1UVZ A;  3CXG A;  1DSB A;  4NV5 A;  2LNS A;  3I69 A;  3G7Y A;  4F82 A;  3DXB A;  2HSH A;  4QL7 A;  4TXV A;  1H4O A;  4ECB A;  3IAM 2;  2AYT A;  4OFT A;  3TOU A;  5G5E A;  3LWA A;  20GS A;  1JHB A;  3TKQ A;  1YEP A;  2GTU A;  2VAF A;  4ZBD A;  3UBK A;  1G0T A;  3GHA A;  12GS A;  1EOH A;  3M1G A;  5D9T A;  3P2A A;  2VLU A;  5AN1 A;  1UN2 A;  3GSS A;  3L0H A;  5KN1 A;  3ISO A;  3ZFB A;  1FB0 A;  4GTU A;  2DML A;  3GH9 A;  2KOK A;  3FZ5 A;  3Q18 A;  2LRT A;  3ME7 A;  2NTO A;  1A8Y A;  1G6Y A;  2IMF A;  4HZ2 A;  3L78 A;  1IYI A;  1SYR A;  1GL8 A;  3ERG A;  4K7N A;  4NV2 A;  4AJ8 A;  5DAL A;  4Z7X A;  3FR9 A;  2H66 A;  1TK5 B;  5ELA A;  1ABA A;  4K2X A;  4TRX A;  5COH A;  2F9S A;  3TOT A;  2MYG A;  4YH2 A;  1JLV A;  3KGK A;  5CRH A;  1TOF A;  2GZP A;  1X5E A;  2HRA A;  1WOU A;  2WJU A;  5L71 A;  4Q5Q A;  4Z2U A;  4KCA A;  2DJ2 A;  2K18 A;  4MF7 A;  1M2A A;  3A3T A;  2ALB A;  1FO5 A;  3QDN A;  1RW1 A;  3MWH A;  13GS A;  5J41 A;  3CTG A;  1QUW A;  1PKZ A;  1S3A A;  2HFD A;  1U3A A;  2H72 A;  5GSS A;  3F4R A;  4V2N A;  4WF5 A;  2YV7 A;  2H30 A;  1OC9 A;  5EPF A;  1EEM A;  1SYX A;  2CVD A;  4YAP A;  1OKD A;  3MSZ A;  4DSS A;  5B6N A;  4IBP A;  5HFG A;  5D93 A;  3DD3 A;  3WYW A;  3HVV A;  1ILO A;  3KTB A;  2M72 A;  3WD6 A;  1OE7 A;  2YN1 A;  4WF4 A;  5GAP D;  4XS4 B;  2M80 A;  1ERW A;  1K0M A;  4H86 A;  2XBQ A;  3ZFL A;  4IN0 A;  2HZE A;  4GRF A;  1YKC A;  2TRC P;  3QPM A;  5CRE A;  5J3R A;  2JZR A;  2HRF A;  3GKX A;  4MZC A;  1VRS D;  1FVK A;  2B6M A;  5ENU A;  2WUL A;  2ZCT A;  1CQG A;  2DJK A;  2H8L A;  4J56 E;  5ID2 B;  5FT3 A;  1XW6 A;  2PER A;  2V1M A;  3KD0 A;  4KE3 A;  2K6V A;  5LNK e;  1DE2 A;  1TU7 A;  2A4V A;  4Z2R A;  4IP6 A;  1GP1 A;  4L0W A;  2GSQ A;  1SKW B;  4YKF A;  5A5K A;  3U5R E;  4MJC A;  1F9M A;  1V2A A;  2E2G A;  1CQH A;  5EY6 A;  4YQM A;  1M7T A;  2VL2 C;  2FWE A;  2YZH A;  2VD1 A;  3HZ8 A;  3RBT A;  2LUS A;  4TVE A;  1YF1 A;  1JLW A;  2WCI A;  3IA1 A;  3ZYW A;  3ZIV A;  2RUE A;  4MP4 A;  2HI7 A;  1TDI A;  3O6T A;  3FKF A;  3VPQ A;  3VFI A;  2X99 A;  1M9B A;  4AJ7 A;  3HA9 A;  16GS A;  3LJR A;  4HQS A;  1KBN A;  1YKA A;  3WT2 A;  1BG5 A;  1PSQ A;  1U87 A;  1PX7 A;  3QAV A;  5FWG A;  2H76 A;  1A23 A;  2IME A;  1NW2 A;  1GLP A;  4V1A g;  4TKY A;  2NDO A;  4X1U A;  4EXJ A;  8GSS A;  2VCW A;  2IMD A;  4ZL8 A;  1XPV A;  3IC8 A;  3TUE A;  2VO4 A;  2UZ8 A;  4BWQ A;  5D9X A;  3W6G A;  2JAD A;  2O85 A;  1OKT A;  4NAX A;  1GUL A;  2HSY A;  4HU9 A;  18GS A;  2DJJ A;  2F51 A;  5DJL A;  3HVX A;  4EDY A;  3F9U A;  3F8U A;  4CY6 A;  2JSZ A;  4PQI A;  3ZIJ A;  3IBH A;  5HFI A;  3UOM A;  3TJF A;  4O92 A;  4OWY A;  3IOS A;  4KSM A;  3GTU A;  3J7Y k;  2PN8 A;  2FWH A;  2ON7 A;  4JR4 A;  2QA1 A;  2MMN A;  2YPM A;  4O5U A;  4EF0 A;  2WRT A;  4KDU A;  4MDC A;  4KDY A;  5CRD A;  2XC2 A;  3QAG A;  4FH8 A;  2Z9S A;  3FZ4 A;  3H93 A;  1B4P A;  1F6M C;  3ERW A;  4IEL A;  2VLT A;  2I1U A;  3C1S A;  1PD2 1;  2C3T A;  1XWB A;  1ST9 A;  1X5D A;  3HJP A;  2R5G A;  4LA1 A;  3F6D A;  3A5W A;  4CHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...