4N0ZA

Crystal structure of cisplatin bound to a plasmodium falciparum glutaredoxin 1 (pfgrx1)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
107
structure length
107
Chain Sequence
SEAVKKWVNKIIEENIIAVFAKTECPYCIKAISILKGYNLNSHMHVENIEKNPDMANIQAYLKELTGKSSVPRIFINKDVVGGCDDLVKENDEGKLKERLQKLGLVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glutaredoxin
publication title Interaction of Cisplatin with plasmodium falciparum Glutaredoxin 1
rcsb
source organism Plasmodium falciparum
total genus 37
structure length 107
sequence length 107
ec nomenclature ec 1.20.4.1: Arsenate reductase (glutaredoxin).
pdb deposition date 2013-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4n0zA00
3KP8A 1GSEA 1U87A 5CRGA 1ABAA 1PGTA 1BG5A 1GRXA 3ZYWA 1QUWA 1KTEA 4XS4B 1AQVA 3VFIA 3IK7A 1T7PB 1FW1A 1N2AA 5H5SA 1SK2A 2RM6A 3RDWA 1O81A 1ZZYA 4QL9A 2EIRA 1J0FA 3UVTA 4GQCA 4PX1A 3DXBA 5AIXA 2GSSA 4ZXGA 1C72A 3S9FA 4ECIA 4MDCA 2AAWA 5CP1A 2NBSA 2VOCA 1K0CA 1SL2B 1MTCA 1VF3A 5JCUA 4HJ2A 2RUFA 3J7Yb 5B8BA 2MMAA 4WR4A 5DALA 2DIYA 4K0NA 2ZUPA 4OD7A 2B1KA 3ZIVA 3IR4A 2VD1A 3LXZA 2QSIA 4NXIA 1ZCPA 4O32A 4MJCA 5DQYA 3FEUA 2X8HA 2PVOC 4I8BA 2JZSA 3I9V2 4I5QA 1XWAA 2KOKA 3FKFA 2Z9SA 4KUNA 5CRHA 2MZCA 1M0UA 2KHPA 2L59A 2OBIA 3M1GA 1SL0B 4F9ZA 3FK8A 1WPIA 1B4QA 2BMXA 4AJ8A 4X0XA 2FA4A 3KMNA 1V9WA 2P0GA 2X99A 5KN0A 1TRUA 1E2YA 4EF0A 1OC9A 3FZAA 3HZ8A 2IMIA 5IQYA 1XW6A 2OBKA 4N10A 1X0RA 3CSJA 5D93A 1TK5B 1GTUA 5G5EA 3VWWA 3D22A 2HZFA 2BJXA 3RPPA 1MDIA 3F9UA 6GSXA 4TXOA 4XTSA 5CNWA 3QD9A 4GF0A 1NSWA 3ZZXA 4DSSA 3GH9A 2ALBA 4ML6A 2VIMA 3RHBA 1NW2A 2HRFA 1MD3A 3UL3A 3UARA 1B9XC 2A4VA 2GZZA 2IMFA 5IMZA 2NVLA 2C80A 3IHQA 5ID2A 1ERWA 2LRCA 2DBCA 4ZBAA 1HYUA 2CVKA 4V1Ag 4F03A 1JHBA 3HVXA 2F9SA 2CX4A 3MSZA 3DWVA 3RBTA 4PQ1A 2DSAA 4MPFA 4IQ1A 3H4KA 3W8SA 5EL8A 3BD2A 3VPQA 5IMVA 2WRTA 4JR4A 1PQNA 5CAXA 1R4WA 4PXOA 2JSZA 1SYRA 3HY2A 1ERTA 1XWCA 4MABA 2E0QA 2R4VA 1GSQA 2N5AA 1K3LA 1A24A 5CREA 2RIIA 4EE0A 3CSHA 3IPZA 1GP1A 3O76A 2C4JA 1QXHA 2DLXA 4YQMA 5GZZB 4K6XA 4TN8A 1QFNA 14GSA 5HFKA 4HU9A 4XIHA 1XW9A 3EYTA 2M46A 6GSSA 3J7Yk 3RAZA 2C0GA 1XWGA 2XPDA 2EC4A 2ON7A 3GKMA 4ZB8A 3TGZA 5H5QA 6GSWA 1O7UA 4NWYA 7GSSA 2B5XA 2F3MA 2B6MA 2PU9C 1TU8A 2K18A 1ON4A 2VLVA 5DQSA 2V41A 2VCTA 5G1KA 1OVNA 2VCQA 1X9MB 2P5RA 3C71A 5HR2A 5J9BA 4DVCA 4N30A 4JE1A 1TKDB 4MZBA 2X64A 5INYA 2LJRA 3CRUA 5H5RA 4Q5RA 5ECKB 4MF7A 4DSRA 5DJMA 3IK9A 4TKYA 4BWQA 4FH8A 2AB6A 3GTUB 4GXZA 5J4UA 19GSA 4YH2A 1R26A 1TI1A 2V2GA 1GTIA 3UAPA 5F8BA 2FWHA 3WD6A 5ECHB 2OKAA 2L4QA 1OC3A 1S3AA 3FHKA 4POMA 4BWSA 1HNCA 4ZILA 5D9WA 1AQXA 3QPMA 5KN1A 1W4VA 2RM5A 4POLA 2CVDA 3I69A 1PKZA 3CRTA 4CW9A 1AAZA 5ECOB 3KZQA 4KA0A 3H79A 5F06A 3LWAA 4ISDA 1A2MA 2N5FA 2WULA 5DCGA 2VL2C 4K1FA 1KNGA 4CDOA 3HD5A 3AY8A 5DCHA 2GZYA 3UVHA 3IRAA 2HI7A 1SYXA 3TJFA 2L4CA 4ULXA 3ME8A 5EVOA 2OE3A 1GSDA 4OCFA 3DMLA 4JZQA 5COHA 1BYEA 2YV9A 3V1WA 5CRDA 4D73B 4HOJA 2G0FA 4LL4B 2VCVA 1ZYQB 1M7TA 4ECJA 2J9HA 5A5KA 3TRXA 4PUFC 5G30A 3WGEA 3CTFA 1EP8A 1IYHA 2AV4A 2LV3A 1YEPA 5HR3A 2GZPA 5IPGA 1ZOFA 2H0HA 2TIRA 1Q98A 5IM9A 5EPFA 1M99A 5F0GA 4EDYA 3HDCA 2RUEA 3NZNA 3FY7A 4TR3A 3DGQA 4EL1A 4O7HA 4XRDA 5ELAA 3US3A 20GSA 3BBYA 2YCDA 3DYRA 3TKSA 1A23A 1FB6A 3F4TA 4JEDA 2GT6A 4I2UA 1JZOA 3HVSA 2K9FA 2DJ2A 2H70A 1OAZA 4ZL9A 3GIXA 1HD2A 3I43A 3E0UA 1B9YC 4HI7A 5LCZA 2XC2A 1JZWA 1V58A 2YWOA 3BCIA 3P90A 2FNOA 4RUVA 2YWMA 2M72A 2K8VA 5D9VA 2CAQA 3Q19A 4EXJA 2HNLA 3APSA 4JR6A 1UVZA 1W89A 1K0BA 4IP6A 2LQOA 5GAND 1AUCA 1SKRB 3TOUA 1X5DA 4J57E 3F6FA 3TCOA 1OE8A 3EMPA 5HQPA 2IFQB 1VRSD 1O85A 4FYCA 1DUGA 4MP4A 1YKCA 4ZBBA 1WWJA 5J9CA 5IMAA 1LJRA 5A4UA 1GSFA 2GVPA 2HE3A 2YNXA 2LNTA 2YOIA 4XRAA 1BX9A 2J23A 4EO3A 1K3YA 2O89A 3GYKA 2H30A 5FWGA 4JBBA 3CXGA 2L6DA 4I6XA 4HS1A 1R5AA 6GSYA 3CBUA 5F07A 1O6JA 2YZHA 1AQWA 3VI7A 4L5OA 1WIKA 1QMVA 1PX7A 3ZRDA 3KCMA 1PX6A 4MJEA 1T1VA 3MWHA 2H6ZA 2YPMA 1OC8A 2NTOA 5B6MA 2H8LA 1WRYA 4WBJA 1DE1A 2LNSA 1TU7A 4FYUA 3DD3A 2F8AA 2IPAA 4WBRD 4RQRA 5ENUA 3RHCA 4P3YB 1G7OA 1I9DA 1Z3EA 2GSRA 4MH3A 1F37A 3ZITA 5JWOB 4TXVA 2DMMA 3FRCA 1GSYA 1NM3A 4OFMA 5D96A 1V40A 1JLVA 5F05A 1G0TA 4KH7A 3D6IA 1JLWA 2DJJA 1EV9A 4K7OA 2H1DA 2LQQA 1YF0A 4I97A 3ERFA 2R6KA 4IW9A 1X9SB 1M2AA 3LG6A 5AIVA 2H0GA 3D4TA 1QK8A 3M8NA 3KD0A 3QFAC 3VURA 4BPYA 1PL1A 4MPGA 2H01A 4ZB9A 5ECRB 2F51A 2IFQA 4N0VA 2LSTA 2GT5A 1SK1A 4IGJA 1J9BA 3KXOA 1Q4JA 1A8LA 3W8JA 4KW6A 2PGTA 2YZUA 1IYIA 5ECNB 3VK9A 4HQSA 3W6GA 1PL2A 2H6YA 4Q5FA 13GSA 2C3QA 2H19A 3UOMA 1EEJA 2BTOT 5J3RA 4GRFA 3DKSA 4NMUA 1F3AA 4NHZA 4LA1A 3TUEA 1XFLA 2XHFA 5C04A 2O85A 3ME7A 1G6WA 2H76A 2KUCA 1NHYA 1SJZA 5E4WA 1F6MC 3OR5A 3ED3A 2V6OA 5G5FA 4E8HA 3TB2A 5G2ZA 2HFDA 3GKKA 4XS6A 3TKSE 3R2QA 2L5LA 4TR1B 1BAYA 4KB3A 2EIOA 5HR0A 4XS4A 18GSA 3E3EA 1ML6A 2ZCTA 5D73A 1FHEA 17GSA 1GUHA 5KEJA 2VAFA 3HJOA 4I2TA 1U6TA 3D5JA 4FIWA 5DAKB 4G10A 1WOUA 4GQFA 2JL4A 4OCEA 5GAPD 1VGLA 4KCAA 1Z5YE 4K7IA 3HHVA 5IPHA 4NV5A 1HQOA 2H73A 1XPVA 1K0AA 2DMLA 3C8EA 3EVIA 3G7YA 3RPNA 1M2BA 1TRWA 2H1GA 4NAXA 1K3OA 5HFGA 3GKNA 3ZFLA 2E2GA 5ABRA 4K9ZA 1EV4A 1Z6MA 1LU4A 2R3XA 2NPBA 3LYKA 1TXXA 4KSOA 2DJ0A 1EWXA 1UA5A 1FB0A 3C73A 3EINA 2LJKA 3WGXA 1BQ7A 3DIEA 1E6BA 3JCML 1ST9A 3HZ4A 2IMDA 1EOHA 4YAPA 5ECPB 1XVWA 2MMOA 2TRCP 3IAS2 4YQVA 2VCWA 3TOTA 1T4ZA 4MZCA 2LUSA 2MBSA 1K0OA 1WE0A 3EU3A 3FZ9A 1VF2A 3FZ5A 3IBHA 3K8NA 5ECMB 2HT9A 3L9SA 2VLUA 5LNKe 1KBNA 2VUPA 1XOAA 1B4PA 4IKHA 2ES7A 1TI3A 11GSA 5ECSA 3F63A 1S3DA 3Q6OA 2XBQA 2DJKA 1G7EA 2H75A 3ZREA 4XHMA 1M9BA 3GSTA 3GN3A 4KDYA 5CO3A 1RK4A 3EC3A 3FR6A 4OFTA 1F3BA 3KTBA 1TK8B 1NHOA 1V2AA 3BCKA 3F3RA 3VLNA 1XWBA 3F4SA 3C1RA 3PR8A 3N5OA 3TJGA 1M9AA 5IOXA 2L6CA 1PMTA 4V2LA 3A2VA 4MF6A 1XIYA 1OKDA 2CT6A 2PMTA 4KCEA 4LMWA 1GLQA 3HXSA 3KH9A 5LD0A 3ZMLA 1Y25A 2G2QA 5J5NA 6GSUA 3CMIA 1MDKA 4G19A 1TRSA 4TOPA 4X1UA 2JZRA 2B3SA 3WYWA 3GMFA 1RQMA 4PGTA 3HKRA 2V6KA 4MJBA 4EVMA 1O73A 2X8GA 4MCUA 2R2JA 2WDUA 2FUG2 2H1BA 3D4MA 4O92A 2HZEB 2C0DA 1BEDA 1A8YA 22GSA 4FYBA 2B7KA 2R5GA 5AN1A 3GSSA 3IDVA 3HA9A 4KAEA 2I81A 2HYXA 4GTUA 3IOSA 2IMKA 5ECIB 2VL3A 2GQMA 3ZIJA 1QQ2A 2OE0A 2FA8A 2H6XA 2WCIA 3H93A 4QL7A 2KP2A 2I4AA 4OO4A 3VI5A 2OADA 1EGRA 4OO5A 1SL1B 3KGKA 4F2IA 5ELGA 1WMJA 3A3TA 1USBA 1X5CA 3GFKA 1ACVA 2H66A 4YAVA 3KJYA 6GSVA 3APOA 3TKPA 5GSTA 2I1UA 3APQA 1EEMA 1B8XA 3GNJA 5HR1A 1UC7A 3GUSA 2LJAA 1ILOA 4XCSA 4MLYA 2IL3A 3TRPA 3GA4A 1XXUA 5KN3A 9GSSA 3M9JA 1QGVA 1VF1A 5JWQB 4XS1A 3GTUA 1FVKA 2JU5A 4IQAA 1XVQA 5ECLB 4PURA 2HRNA 2CAIA 3GV1A 4F0CA 3ERWA 3UMAA 2PVQA 2VCXA 4ZL7A 5FHIA 1YJ6A 3FR3A 2MMZA 5G31A 1FVJA 2OACA 2PBJA 2LRTA 4LLRA 1UN2A 1MD4A 4HEA2 1Z7PA 3VWVA 4F82A 5EY6A 5E59A 2WJUA 2WZ9A 4V2MA 1XCCA 4HQZA 12GSA 5DALB 1XOBA 2KP1A 5IO2A 3FZ4A 1TJDA 2C0FA 2CV4A 2K6VA 3LQ7A 4E8EA 1CQGA 2CZ3A 1LBKA 2AUVA 4IS0A 2FCHA 1SKWB 1OE7A 4GWRA 3D21A 4HZ2A 4D73A 1AIUA 3IV4A 3NOFA 4YQUA 3P2AA 4IP1A 1JZDA 4IN0A 5A4VA 5ECQB 3TJKA 5D8IA 3KMOA 1GWCA 3LXTA 3VWUA 1DBYA 1ERVA 4QQ7A 2VL9A 1OC9B 5FT3A 1XZOA 4IJ3A 4ECCA 5JCWA 2FHEA 2TRXA 3EU4A 3BOAA 4HDEA 3D0ZA 2L57A 5AGYA 1YY7A 2GLRA 2VCZA 3G9BA 2WS2A 2DJ1A 1YQ1A 3GURA 1M2DA 1JZRA 4JU5A 4TXOB 1GNEA 2B7JA 1GL8A 4NV2A 2A2SA 3QAGA 1TDIA 1SJIA 4DSSB 3ZFBA 2VM2A 3LJRA 4OWYA 4WF5A 2PERA 5B8AA 2GS3A 1MEKA 2MMNA 4MMMA 4KE3A 4IJIA 1SENA 4WETA 2YANA 1K0DA 3QAVA 2O8VB 2FGXA 2B5EA 8GSSA 1T8EB 2MBTA 5ID2B 4ZL8A 5IOWA 1I5GA 1Z9HA 3DVWA 4L0UA 4WXTA 1F2EA 2JZTA 2YWNA 3QFBC 3LYPA 1URMA 3DRNA 2LS5A 3LEFA 1A0FA 3GHAA 2JSYA 3CTGA 1EGOA 2H1AA 3GRXA 4KGIA 3TRQA 1EOGA 4N11A 2C3TA 2CA8A 2XBIA 2HLSA 5CRWA 3EURA 1T00A 2LRNA 4Q5QA 3O6TA 2WGRA 2R37A 4HU7A 2OJLA 1GULA 4RQXA 3IAM2 4O5RA 3ZLPA 1YKAA 4IELA 1XW5A 2YJHA 2GSTA 3HJPA 2C1YA 1S3CA 2VM1A 2ZNMA 3C1SA 2QGVA 4MH2A 2PUKC 1X9WB 1PSQA 3LGCA 1Y6EA 1H4OA 1R5PA 2IIYA 3TKRA 2VLTA 2OA7A 2X8CA 5B6NA 1YF1A 5GSSA 1R7HA 3IE3A 2KLXA 2V32A 2P31A 1G6YA 3TKQA 3WGDA 1FAAA 2FD3A 3ZL5A 4L0WA 1TK0B 1OKTA 2GQKA 2V1MA 2N5BA 1BJXA 2M80A 3Q74A 3A2XA 1A0RP 1V98A 3IA1A 3M9KA 5JCGA 4MF5A 3L4NA 2QC7A 3GL5A 2A2RA 4KSMA 1K0NA 3HVVA 4EDZA 3F0IA 2FWFA 4RI7A 2H0IA 1DE2A 5IMFA 3UBLA 4Q5NA 3VPTA 2YV7A 4ID0A 4TRXA 10GSA 3MNGA 4DSQA 3CSIA 4J2FA 3KM6A 16GSA 3DEXA 3F8UA 1AXDA 2XPEA 1X5EA 2PPTA 4ZIJA 4GCIA 1V57A 3ZMKA 4PNGA 3M3MA 3CYNA 4MK3A 4KDXA 3TJJA 1YDKA 3A5WA 4JRRA 4TW5A 3QAWA 1FG4A 3HYPA 1U88A 1PKWA 2IN3A 1WJKA 3ERGA 3U5RE 3UBKA 4AJ6A 4H86A 1FOVA 4WEYA 2E7PA 1YZXA 2H72A 3G7IA 1SKSB 1O8XA 4KDUA 2ON5A 2CX3A 2PN8A 4NHWA 4POKA 2HXKA 4BL7A 5DVBA 4IBPA 4V2NA 2K8SA 1ZGNA 4GLTA 1SJ6A 3A2WA 4PQIA 3QMXA 1TW9A 1SK0A 3M0FA 1GSUA 4WR5A 2B1LA 2P5QA 4GSTA 2AHEA 2B5YA 4MJAA 4PQHA 2JACA 4HUAA 2I9HA 3TDGA 4GSNA 4NPBA 3KIJA 4ZB6A 3MAKA 1H75A 1K0MA 3ZVJD 5B7CA 4BA7A 4ECBA 1YEXA 3N9JA 4TR1A 2GQLA 3E9JB 3MDKA 3O3TA 1JFUA 1Z7RA 2VD0A 2YWIA 6GSTA 2O7KA 1A2LA 2GGTA 2FWGA 2C8UA 1TOFA 3EWLA 1TP9A 3EE2A 1DSBA 1THOA 3NIVA 3U6VA 5DAKA 2DC5A 1MDJA 3L78A 4L5LA 4FO5A 4RI6A 4TR4A 4ML1A 3P8WA 1TRVA 2FY6A 2JADA 2FLSA 3F3QA 3QR6A 4X43A 3F4RA 5D9XA 3VWXA 3BJ5A 2NDOA 2YP6A 3TKSC 3KH7A 3PGTA 1T3BA 3P7XA 2F8FA 4AGSA 4WF4A 5DDLA 1GUMA 1GSSA 5DBQA 2IJYA 4EUYA 3KP9A 4PUAA 2L5OA 4L8EA 5IIZA 5AISA 1PA3A 3F6DA 4TR0A 1SU9A 4J56E 4LMVA 3HJMA 3FR9A 4GSSA 5J41A 2H71A 4BVXA 1F9MA 1N8JA 3ZVJA 1EP7A 2DIZA 3G7JA 5IMDA 4HJMA 2YJ7A 4EC0A 3L0HA 1XBSA 2GTUA 3IXRA 2LKUA 1SD8A 4BVYA 1GLPA 3C7MA 2VO4A 3FYGA 5C00A 1GTBA 1THXA 2LTKA 2CZ2A 1WP0A 1J08A 4POBA 1HNBA 3LSZA 2OE1A 5A4WA 3DVXA 4OFNA 4LL1B 4DEJA 4K7NA 4K2DA 3Q18A 5G1LA 2H74A 1SD9A 5L71A 2FWEA 1ZMAA 3I6AA 2HSYA 5HFIA 5KN2A 2O87A 3L9UA 1PN9A 2CQ9A 3SBCA 2I3YA 3ZTLA 1PD21 1AW9A 3SWLA 2YN1A 2QKEA 4AJ7A 1XWKA 2AYTA 1KEBA 1EZKA 2CVBA 4F0BA 3UJ1A 3ISOA 4ILFA 2VL2A 4MA9A 2C0EA 4KNDA 2LEGA 3GX0A 1Z6NA 1HNAA 1GNWA 3LFLA 4Z7XA 1U3AA 2WB9A 4ACSA 5IMCA 3UIWA 4IHUA 1VF4A 4G9HA 4PNFA 4K0GA 3H8QA 4MZWA 4TVEA 5DJLA 3QOUA 1FO5A 1ZL9A 3KTLA 5JWRB 2IMEA 3L9VA 3WT2A 1PRXA 2HSHA 2GDRA 2HZEA 3PH9A 3TJBA 2IWTA 2PWJA 5IO0A 2D2ZA 2AJQB 3GX8A 4G2EA 2RLIA 1GTAA 2C3NA 2DJ3A 4HZ4A 3PINA 3IC4A 2E2MA 3QCPA 1U3IA 1O8WA 1ZYEA 3H1NA 4N0ZA 1GH2A 4ZBDA 4WKWA 3GL3A 3FW2A 3HCZA 3GH6A 1OYJA 5CYYA 2EIQA 3GKXA 1B48A 4K8MA 1RW1A 1ERUA 2MYGA 4EKZA 4CHSA 2REMA 4V1Ap 4OMVA 1A2JA 2WFCA 1GUKA 3UEMA 4KX4A 5D9TA 3KEBA 3WT1A 1AC1A 1TTZA 3LORA 3EMXA 3QDNA 1T4YA 2GSQA 4IVFA 1CQHA 4AF2A
chains in the Genus database with same CATH superfamily
3KP8A 1GSEA 1U87A 5CRGA 1ABAA 1PGTA 1BG5A 1GRXA 4CY8A 3ZYWA 1QUWA 1KTEA 4XS4B 1AQVA 3VFIA 3IK7A 1T7PB 1FW1A 1N2AA 5H5SA 1SK2A 2RM6A 3RDWA 1O81A 1ZZYA 4QL9A 2EIRA 1J0FA 3UVTA 4GQCA 4PX1A 3DXBA 5AIXA 2GSSA 4ZXGA 1C72A 3S9FA 4ECIA 4MDCA 2AAWA 5CP1A 2NBSA 2VOCA 1K0CA 1SL2B 1MTCA 1VF3A 5JCUA 4HJ2A 2RUFA 3J7Yb 5B8BA 2MMAA 4WR4A 5DALA 2DIYA 4K0NA 2ZUPA 4OD7A 2B1KA 3ZIVA 3IR4A 4Z2RA 2VD1A 3LXZA 2QSIA 4NXIA 1ZCPA 4O32A 4MJCA 5DQYA 4FQUA 3FEUA 2X8HA 2PVOC 4I8BA 2JZSA 3I9V2 4I5QA 1XWAA 2KOKA 3FKFA 2Z9SA 4KUNA 5CRHA 2MZCA 1M0UA 2KHPA 2L59A 2OBIA 3M1GA 1SL0B 2R0CA 4F9ZA 3FK8A 4K5SA 1WPIA 1B4QA 2BMXA 4AJ8A 4X0XA 2FA4A 3KMNA 1V9WA 2P0GA 2X99A 5KN0A 1TRUA 1E2YA 4EF0A 1OC9A 3FZAA 3HZ8A 2IMIA 5IQYA 1XW6A 4CY6A 2OBKA 4N10A 1X0RA 3CSJA 5D93A 1TK5B 1GTUA 5G5EA 3VWWA 3D22A 2HZFA 2BJXA 1PN0A 3RPPA 1MDIA 3F9UA 6GSXA 4TXOA 4XTSA 5CNWA 3QD9A 4GF0A 1NSWA 3ZZXA 4DSSA 3GH9A 2ALBA 4ML6A 2VIMA 3RHBA 1NW2A 2HRFA 1MD3A 3UL3A 3UARA 1B9XC 2A4VA 2GZZA 2IMFA 5IMZA 2NVLA 1PFOA 2C80A 3IHQA 1ERWA 5ID2A 2LRCA 2DBCA 4ZBAA 1HYUA 2CVKA 4V1Ag 4F03A 1JHBA 3HVXA 2F9SA 2CX4A 3MSZA 3DWVA 3RBTA 4PQ1A 2DSAA 4MPFA 4IQ1A 3H4KA 3W8SA 5EL8A 1XG8A 3BD2A 3VPQA 5IMVA 2WRTA 4JR4A 4HSCX 1PQNA 5CAXA 1R4WA 4PXOA 3IC8A 2JSZA 1SYRA 3HY2A 1ERTA 1XWCA 4MABA 2E0QA 2R4VA 1GSQA 2N5AA 1K3LA 1A24A 5CREA 2RIIA 4EIQA 4EE0A 3CSHA 3IPZA 1GP1A 3O76A 2C4JA 1QXHA 2DLXA 4YQMA 5GZZB 4K6XA 4TN8A 1QFNA 14GSA 5HFKA 4HU9A 4XIHA 1XW9A 3EYTA 2M46A 6GSSA 3J7Yk 3RAZA 2C0GA 1XWGA 2XPDA 2EC4A 2ON7A 3GKMA 4ZB8A 3TGZA 5H5QA 6GSWA 1O7UA 4NWYA 7GSSA 2B5XA 2F3MA 2B6MA 2PU9C 1TU8A 2K18A 1ON4A 2VLVA 5DQSA 2V41A 2VCTA 5G1KA 1OVNA 2VCQA 1X9MB 2P5RA 3C71A 5HR2A 5J9BA 4DVCA 4N30A 4JE1A 1TKDB 4MZBA 2X64A 5INYA 2LJRA 3CRUA 5H5RA 4Q5RA 5ECKB 4MF7A 4DSRA 5DJMA 3IK9A 4TKYA 4BWQA 4FH8A 2AB6A 3GTUB 4GXZA 5J4UA 19GSA 4YH2A 1R26A 1TI1A 4Z2TA 2V2GA 1GTIA 3UAPA 5F8BA 2FWHA 3WD6A 5ECHB 2OKAA 2L4QA 1OC3A 1S3AA 3FHKA 4POMA 4BWSA 1HNCA 4ZILA 5D9WA 1AQXA 3QPMA 5KN1A 1W4VA 2RM5A 4POLA 2CVDA 3HVNA 3I69A 1PKZA 3CRTA 4CW9A 1AAZA 5ECOB 3KZQA 4KA0A 3H79A 5F06A 3LWAA 4ISDA 1A2MA 2N5FA 2WULA 5DCGA 2VL2C 4K1FA 1KNGA 4CDOA 3HD5A 3AY8A 5DCHA 2GZYA 3UVHA 3IRAA 2HI7A 1SYXA 3TJFA 2L4CA 4ULXA 3ME8A 5EVOA 2OE3A 2UZ8A 1GSDA 4OCFA 3DMLA 4JZQA 5COHA 1BYEA 2YV9A 3LW9A 3V1WA 5CRDA 4D73B 4A5PA 4HOJA 2G0FA 4LL4B 2VCVA 1ZYQB 1M7TA 4ECJA 2J9HA 5A5KA 3TRXA 4PUFC 5G30A 3WGEA 3CTFA 1EP8A 1IYHA 2AV4A 2LV3A 1YEPA 5HR3A 2GZPA 5IPGA 1ZOFA 2H0HA 2TIRA 1Q98A 5IM9A 5EPFA 1M99A 5F0GA 4EDYA 1ZYNA 3HDCA 2RUEA 3NZNA 3FY7A 4TR3A 2R0GA 3DGQA 4EL1A 4O7HA 4ICYA 4XRDA 5ELAA 3US3A 20GSA 3BBYA 2YCDA 3DYRA 3TKSA 1A23A 1FB6A 3F4TA 3MYDA 4JEDA 2GT6A 4I2UA 1JZOA 3HVSA 2K9FA 2DJ2A 2H70A 1OAZA 4ZL9A 3GIXA 1HD2A 3I43A 3E0UA 1B9YC 4HI7A 5LCZA 2XC2A 1JZWA 3CQFA 1V58A 2YWOA 3BCIA 3P90A 2FNOA 4RUVA 4YKGA 2YWMA 2M72A 2K8VA 5D9VA 1ZYPA 2CAQA 3Q19A 4EXJA 2HNLA 3APSA 4JR6A 1UVZA 1W89A 1K0BA 4IP6A 2LQOA 5GAND 1AUCA 1SKRB 3TOUA 1X5DA 4J57E 3F6FA 3TCOA 1OE8A 3EMPA 5HQPA 2IFQB 1VRSD 1O85A 4FYCA 1DUGA 4MP4A 1YKCA 4ZBBA 1WWJA 5J9CA 4G0LA 5IMAA 1LJRA 5A4UA 1GSFA 2GVPA 2HE3A 2YNXA 2LNTA 2YOIA 4XRAA 1BX9A 2J23A 4EO3A 1K3YA 2O89A 2X4AA 3GYKA 2H30A 5FWGA 4JBBA 3CXGA 2L6DA 4I6XA 4HS1A 1R5AA 6GSYA 3CBUA 5F07A 1O6JA 2YZHA 1AQWA 3VI7A 4L5OA 1WIKA 1QMVA 1PX7A 3ZRDA 3KCMA 1PX6A 4MJEA 1T1VA 3MWHA 5BRTA 2H6ZA 2YPMA 1OC8A 2NTOA 5B6MA 2H8LA 1WRYA 4K5RA 4WBJA 1DE1A 2LNSA 1TU7A 4FYUA 3DD3A 2F8AA 2IPAA 4WBRD 3FMWA 4RQRA 5ENUA 3RHCA 4BIKA 4P3YB 1G7OA 1I9DA 4USSA 1Z3EA 2GSRA 4MH3A 1F37A 3ZITA 5JWOB 4TXVA 2DMMA 3FRCA 1GSYA 4O5QA 1NM3A 4OFMA 5D96A 1V40A 1JLVA 5F05A 1G0TA 4KH7A 3D6IA 1JLWA 2DJJA 1EV9A 4K7OA 2H1DA 2LQQA 1YF0A 4I97A 3ERFA 2R6KA 4IW9A 1X9SB 1M2AA 4G0IA 3LG6A 5AIVA 2H0GA 3D4TA 1QK8A 3M8NA 3KD0A 3QFAC 3VURA 4BPYA 1PL1A 4MPGA 2H01A 4ZB9A 5ECRB 2F51A 2IFQA 4N0VA 2LSTA 2GT5A 1SK1A 4IGJA 1J9BA 3KXOA 1Q4JA 1A8LA 3W8JA 4KW6A 2PGTA 2YZUA 1IYIA 5ECNB 3VK9A 4HQSA 3W6GA 1PL2A 4BL7B 2H6YA 4Q5FA 13GSA 2C3QA 2H19A 3UOMA 1EEJA 2BTOT 5J3RA 4GRFA 3DKSA 4NMUA 1F3AA 4NHZA 2R0PA 4LA1A 3TUEA 1XFLA 2XHFA 5C04A 2O85A 3ME7A 1G6WA 2H76A 2KUCA 1NHYA 1SJZA 5E4WA 1F6MC 3OR5A 3ED3A 2V6OA 5G5FA 4E8HA 3TB2A 5G2ZA 2HFDA 3GKKA 4XS6A 3TKSE 3R2QA 2L5LA 4TR1B 1BAYA 4KB3A 2EIOA 5HR0A 4XS4A 18GSA 3E3EA 1ML6A 2ZCTA 5D73A 1FHEA 17GSA 1GUHA 5KEJA 2VAFA 3HJOA 4I2TA 1U6TA 3D5JA 4FIWA 5DAKB 4G10A 1WOUA 4GQFA 2JL4A 3EPTA 4OCEA 5GAPD 1VGLA 4KCAA 1Z5YE 4K7IA 3HHVA 5IPHA 4NV5A 1HQOA 2H73A 1XPVA 1K0AA 2DMLA 3C8EA 3EVIA 3G7YA 3RPNA 1M2BA 1TRWA 2H1GA 4NAXA 1K3OA 5HFGA 3GKNA 3ZFLA 2E2GA 5ABRA 4K9ZA 1EV4A 1Z6MA 1LU4A 2R3XA 2NPBA 3LYKA 1TXXA 4KSOA 2DJ0A 1EWXA 1UA5A 1FB0A 3C73A 3EINA 2LJKA 3WGXA 1BQ7A 3DIEA 1E6BA 3JCML 1ST9A 3HZ4A 2IMDA 1EOHA 4YAPA 4BVXB 5ECPB 1XVWA 2MMOA 2TRCP 3IAS2 4YQVA 2VCWA 3TOTA 1T4ZA 4YKFA 4MZCA 2LUSA 2MBSA 1K0OA 1WE0A 3EU3A 3FZ9A 1VF2A 3FZ5A 3IBHA 3K8NA 4BVYB 5ECMB 2HT9A 3L9SA 2VLUA 5LNKe 1KBNA 2VUPA 1XOAA 1B4PA 4IKHA 1M3JA 2ES7A 1TI3A 11GSA 5ECSA 3F63A 1S3DA 3Q6OA 2XBQA 2DJKA 1G7EA 2H75A 3ZREA 4XHMA 2QA2A 1M9BA 3GSTA 3GN3A 4KDYA 5CO3A 1RK4A 3EC3A 3FR6A 4OFTA 1F3BA 2QA1A 3KTBA 1TK8B 1NHOA 1V2AA 3BCKA 3F3RA 3VLNA 1XWBA 3F4SA 3C1RA 3PR8A 3N5OA 5BMUA 3TJGA 1M9AA 5IOXA 2L6CA 1PMTA 4X4JA 4V2LA 3A2VA 4MF6A 1XIYA 1OKDA 2CT6A 2PMTA 4KCEA 4LMWA 1GLQA 3HXSA 3KH9A 5LD0A 3ZMLA 1Y25A 2G2QA 5J5NA 6GSUA 2HRKA 3CMIA 1MDKA 4G19A 1TRSA 4TOPA 4X1UA 2JZRA 2HRAA 2B3SA 3WYWA 3GMFA 1RQMA 4PGTA 3HKRA 2V6KA 4MJBA 4EVMA 1O73A 2X8GA 4MCUA 2R2JA 2WDUA 2FUG2 2H1BA 3D4MA 4O92A 2HZEB 2C0DA 1BEDA 1A8YA 2A4HA 22GSA 4FYBA 2B7KA 2R5GA 5AN1A 3GSSA 3IDVA 3HA9A 4KAEA 2I81A 2HYXA 4GTUA 3IOSA 2IMKA 5ECIB 2VL3A 2GQMA 3ZIJA 1S3RA 1QQ2A 2OE0A 2FA8A 2H6XA 2WCIA 3H93A 4QL7A 2KP2A 2I4AA 4OO4A 3VI5A 2OADA 1EGRA 4OO5A 1SL1B 3KGKA 4F2IA 5ELGA 1WMJA 3A3TA 1USBA 1X5CA 3GFKA 1ACVA 2H66A 4YAVA 3KJYA 6GSVA 3APOA 3TKPA 5GSTA 2I1UA 3APQA 1EEMA 1B8XA 3GNJA 5HR1A 1UC7A 3GUSA 2LJAA 1ILOA 4XCSA 4MLYA 2IL3A 3TRPA 2A2PA 3GA4A 1XXUA 5KN3A 9GSSA 3M9JA 1QGVA 1VF1A 5JWQB 4XS1A 3GTUA 1FVKA 2JU5A 4IQAA 1XVQA 5ECLB 4PURA 2HRNA 2CAIA 2X49A 3GV1A 4F0CA 3ERWA 3UMAA 2PVQA 2VCXA 4ZL7A 5FHIA 1YJ6A 3FR3A 1M3IA 2MMZA 5G31A 1FVJA 2OACA 2PBJA 2LRTA 4LLRA 1UN2A 1MD4A 4HEA2 4KF9A 1Z7PA 1FOHA 3VWVA 4F82A 5EY6A 5E59A 2WJUA 2WZ9A 4V2MA 1XCCA 4HQZA 12GSA 5DALB 1XOBA 2KP1A 5IO2A 3FZ4A 1TJDA 2C0FA 2CV4A 4G0KA 2K6VA 3PPUA 3LQ7A 4E8EA 1CQGA 2CZ3A 1LBKA 2AUVA 4IS0A 2FCHA 1SKWB 2DKHA 1OE7A 4GWRA 3D21A 4HZ2A 4D73A 1AIUA 3IV4A 3NOFA 4YQUA 3P2AA 4IP1A 1JZDA 4IN0A 5A4VA 5ECQB 3TJKA 5D8IA 3KMOA 1GWCA 3LXTA 3VWUA 1DBYA 1ERVA 4QQ7A 2VL9A 1OC9B 5FT3A 1XZOA 4IJ3A 4ECCA 5JCWA 2FHEA 2TRXA 3EU4A 3BOAA 4HDEA 3D0ZA 2L57A 5AGYA 4PTSA 1YY7A 2GLRA 2VCZA 3G9BA 2WS2A 2DJ1A 1YQ1A 3GURA 1M2DA 1JZRA 4JU5A 4TXOB 1GNEA 2B7JA 1GL8A 4NV2A 2A2SA 3QAGA 1TDIA 1SJIA 4DSSB 3ZFBA 2VM2A 3LJRA 4OWYA 4WF5A 2PERA 5B8AA 2GS3A 1MEKA 2MMNA 4MMMA 4KE3A 4IJIA 1SENA 4WETA 2YANA 1K0DA 3QAVA 2O8VB 2FGXA 2B5EA 8GSSA 1T8EB 2MBTA 5ID2B 4ZL8A 5IOWA 1I5GA 1Z9HA 3DVWA 4L0UA 4WXTA 1F2EA 2JZTA 2YWNA 3QFBC 3LYPA 1URMA 3DRNA 2LS5A 3LEFA 1A0FA 3GHAA 2JSYA 3CTGA 1EGOA 2H1AA 3GRXA 4KGIA 3TRQA 1EOGA 4N11A 2C3TA 2CA8A 2XBIA 2HLSA 5CRWA 3EURA 4MNNA 1T00A 2LRNA 4Q5QA 3O6TA 2WGRA 2R37A 4HU7A 2OJLA 1GULA 4RQXA 3IAM2 4O5RA 3ZLPA 1YKAA 4IELA 1XW5A 2YJHA 2GSTA 3HJPA 2C1YA 1S3CA 2VM1A 2ZNMA 3C1SA 2QGVA 4MH2A 2PUKC 1X9WB 1PSQA 3LGCA 1Y6EA 1H4OA 1R5PA 2IIYA 3TKRA 2VLTA 2OA7A 2X8CA 5B6NA 1YF1A 5GSSA 1R7HA 3IE3A 2KLXA 2V32A 2P31A 1G6YA 3TKQA 3WGDA 1FAAA 2FD3A 3ZL5A 4L0WA 1TK0B 1OKTA 2GQKA 2V1MA 2N5BA 1BJXA 2M80A 3Q74A 5KOXA 3A2XA 1A0RP 1V98A 3IA1A 3IHGA 3M9KA 5JCGA 4MF5A 3L4NA 2QC7A 3GL5A 4Z2UA 2A2RA 4KSMA 1K0NA 3HVVA 4EDZA 3F0IA 2FWFA 4RI7A 2H0IA 1DE2A 5IMFA 3UBLA 4Q5NA 3VPTA 2YV7A 4ID0A 4TRXA 10GSA 3MNGA 4DSQA 3CSIA 4J2FA 3KM6A 16GSA 3DEXA 3F8UA 1AXDA 2XPEA 1X5EA 2PPTA 4ZIJA 4GCIA 1V57A 3ZMKA 4PNGA 3M3MA 3CYNA 4MK3A 4KDXA 3TJJA 1YDKA 3A5WA 4JRRA 4TW5A 3QAWA 1FG4A 3HYPA 1U88A 1PKWA 2IN3A 1WJKA 3ERGA 3U5RE 3UBKA 4AJ6A 4H86A 1FOVA 4WEYA 2E7PA 1YZXA 2H72A 3G7IA 1SKSB 1O8XA 4KDUA 2ON5A 2CX3A 2PN8A 4NHWA 4POKA 2HXKA 4BL7A 5DVBA 4IBPA 4V2NA 2K8SA 1ZGNA 4GLTA 1SJ6A 3A2WA 4PQIA 3QMXA 1TW9A 1SK0A 3M0FA 1GSUA 4WR5A 2B1LA 3R3EA 2P5QA 4GSTA 2AHEA 2B5YA 4MJAA 4PQHA 2JACA 4HUAA 4EIPA 2I9HA 3TDGA 4GSNA 4NPBA 3KIJA 4ZB6A 3MAKA 1H75A 1K0MA 3ZVJD 5B7CA 4BA7A 4ECBA 1YEXA 3N9JA 4TR1A 2GQLA 3E9JB 3MDKA 3O3TA 1JFUA 1Z7RA 2VD0A 2YWIA 6GSTA 2O7KA 1A2LA 2GGTA 2FWGA 2C8UA 1TOFA 3EWLA 1TP9A 3EE2A 1DSBA 1THOA 3NIVA 3U6VA 5DAKA 2DC5A 1MDJA 3L78A 4L5LA 4FO5A 4RI6A 4TR4A 4ML1A 3P8WA 1TRVA 2FY6A 2JADA 2FLSA 3F3QA 5KOWA 3QR6A 4X43A 3F4RA 5D9XA 3VWXA 3BJ5A 2NDOA 2YP6A 3TKSC 3KH7A 3PGTA 1T3BA 3P7XA 2F8FA 4AGSA 4WF4A 5DDLA 1GUMA 1GSSA 5DBQA 2IJYA 4EUYA 3KP9A 4PUAA 2L5OA 2HSMA 4L8EA 5IIZA 5AISA 1PA3A 3F6DA 4TR0A 1SU9A 4J56E 4LMVA 3HJMA 3FR9A 4GSSA 5J41A 2H71A 4BVXA 1F9MA 1N8JA 3ZVJA 1EP7A 2DIZA 3G7JA 5IMDA 4HJMA 2YJ7A 4EC0A 3L0HA 1XBSA 2GTUA 3IXRA 2LKUA 1SD8A 4BVYA 1GLPA 3C7MA 2VO4A 3FYGA 5C00A 1GTBA 1THXA 2LTKA 2CZ2A 1WP0A 1J08A 4POBA 1HNBA 3LSZA 2OE1A 5A4WA 3DVXA 4OFNA 4LL1B 4DEJA 4K7NA 4K2DA 3Q18A 5G1LA 2H74A 1SD9A 5L71A 3MIXA 2FWEA 1ZMAA 3I6AA 2HSYA 5HFIA 5KN2A 2O87A 3L9UA 4K2XA 1PN9A 2CQ9A 3SBCA 2I3YA 3ZTLA 1PD21 1AW9A 3SWLA 2YN1A 2QKEA 4AJ7A 1XWKA 2AYTA 1KEBA 1EZKA 2CVBA 4F0BA 3UJ1A 3ISOA 4ILFA 2VL2A 4MA9A 2C0EA 4KNDA 2LEGA 3GX0A 1Z6NA 1HNAA 1GNWA 3LFLA 4Z7XA 1U3AA 2WB9A 4ACSA 5IMCA 3UIWA 4IHUA 1VF4A 4G9HA 4PNFA 4K0GA 3H8QA 4MZWA 4TVEA 5DJLA 3QOUA 1FO5A 1ZL9A 3KTLA 5JWRB 2IMEA 3L9VA 3WT2A 1PRXA 2HSHA 2GDRA 2HZEA 3A5IA 3PH9A 3TJBA 2IWTA 2PWJA 5IO0A 2D2ZA 2AJQB 3GX8A 4O5UA 4G2EA 2RLIA 1GTAA 2C3NA 2DJ3A 4HZ4A 3PINA 3IC4A 2E2MA 3QCPA 1U3IA 1O8WA 1ZYEA 3H1NA 4N0ZA 1GH2A 4ZBDA 4WKWA 3GL3A 3FW2A 3HCZA 3GH6A 1OYJA 5CYYA 2EIQA 3GKXA 1B48A 4K8MA 1RW1A 1ERUA 2MYGA 4EKZA 4CHSA 2REMA 4V1Ap 4OMVA 1A2JA 2WFCA 1GUKA 3UEMA 4KX4A 5D9TA 3KEBA 3WT1A 1AC1A 1TTZA 3LORA 3EMXA 3QDNA 1T4YA 2DKIA 2GSQA 4IVFA 1CQHA 4AF2A
chains in the Genus database with same CATH topology
3KP8A 1GSEA 1U87A 5CRGA 1ABAA 1PGTA 1BG5A 1GRXA 4CY8A 3ZYWA 1QUWA 1KTEA 4XS4B 1AQVA 3VFIA 3IK7A 1T7PB 1FW1A 1N2AA 5H5SA 1SK2A 2RM6A 3RDWA 1O81A 1ZZYA 4QL9A 2EIRA 1J0FA 3UVTA 4GQCA 4PX1A 3DXBA 5AIXA 2GSSA 4ZXGA 1C72A 3S9FA 4ECIA 4MDCA 2AAWA 5CP1A 2NBSA 2VOCA 1K0CA 1SL2B 1MTCA 1VF3A 5JCUA 4HJ2A 2RUFA 3J7Yb 5B8BA 2MMAA 4WR4A 5DALA 2DIYA 4K0NA 2ZUPA 4OD7A 2B1KA 3ZIVA 3IR4A 4Z2RA 2VD1A 3LXZA 2QSIA 4NXIA 1ZCPA 4O32A 4MJCA 5DQYA 4FQUA 3FEUA 2X8HA 2PVOC 4I8BA 2JZSA 3I9V2 4I5QA 1XWAA 2KOKA 3FKFA 2Z9SA 4KUNA 5CRHA 2MZCA 1M0UA 2KHPA 2L59A 2OBIA 3M1GA 1SL0B 2R0CA 4F9ZA 3FK8A 4K5SA 1WPIA 1B4QA 2BMXA 4AJ8A 4X0XA 2FA4A 3KMNA 1V9WA 2P0GA 2X99A 5KN0A 1TRUA 1E2YA 4EF0A 1OC9A 3FZAA 3HZ8A 2IMIA 5IQYA 1XW6A 4CY6A 2OBKA 4N10A 1X0RA 3CSJA 5D93A 1TK5B 1GTUA 5G5EA 3VWWA 3D22A 2HZFA 2BJXA 1PN0A 3RPPA 1MDIA 3F9UA 6GSXA 4TXOA 4XTSA 5CNWA 3QD9A 4GF0A 1NSWA 3ZZXA 4DSSA 3GH9A 2ALBA 4ML6A 2VIMA 3RHBA 1NW2A 2HRFA 1MD3A 3UL3A 3UARA 1B9XC 2A4VA 2GZZA 2IMFA 5IMZA 2NVLA 2C80A 3IHQA 5ID2A 1ERWA 2LRCA 2DBCA 4ZBAA 1HYUA 2CVKA 4V1Ag 4F03A 1JHBA 3HVXA 2F9SA 2CX4A 3MSZA 3DWVA 3RBTA 4PQ1A 2DSAA 4MPFA 4IQ1A 3H4KA 3W8SA 5EL8A 3BD2A 3VPQA 5IMVA 2WRTA 4JR4A 1PQNA 5CAXA 1R4WA 4PXOA 3IC8A 2JSZA 1SYRA 3HY2A 1ERTA 1XWCA 4MABA 2E0QA 2R4VA 1GSQA 2N5AA 1K3LA 1A24A 5CREA 2RIIA 4EIQA 4EE0A 3CSHA 3IPZA 1GP1A 3O76A 2C4JA 1QXHA 2DLXA 4YQMA 5GZZB 4K6XA 4TN8A 1QFNA 14GSA 5HFKA 4HU9A 4XIHA 1XW9A 3EYTA 2M46A 6GSSA 3J7Yk 3RAZA 2C0GA 1XWGA 2XPDA 2EC4A 2ON7A 3GKMA 4ZB8A 3TGZA 5H5QA 6GSWA 1O7UA 4NWYA 7GSSA 2B5XA 2F3MA 2B6MA 2PU9C 1TU8A 2K18A 1ON4A 2VLVA 5DQSA 2V41A 2VCTA 5G1KA 1OVNA 2VCQA 1X9MB 2P5RA 3C71A 5HR2A 5J9BA 4DVCA 4N30A 4JE1A 1TKDB 4MZBA 2X64A 5INYA 2LJRA 3CRUA 5H5RA 4Q5RA 5ECKB 4MF7A 4DSRA 5DJMA 3IK9A 4TKYA 4BWQA 4FH8A 2AB6A 3GTUB 4GXZA 5J4UA 19GSA 4YH2A 1R26A 1TI1A 4Z2TA 2V2GA 1GTIA 3UAPA 5F8BA 2FWHA 3WD6A 5ECHB 2OKAA 2L4QA 1OC3A 1S3AA 3FHKA 4POMA 4BWSA 1HNCA 4ZILA 5D9WA 1AQXA 3QPMA 5KN1A 1W4VA 2RM5A 4POLA 2CVDA 3I69A 1PKZA 3CRTA 4CW9A 1AAZA 5ECOB 3KZQA 4KA0A 3H79A 5F06A 3LWAA 4ISDA 1A2MA 2N5FA 2WULA 5DCGA 2VL2C 4K1FA 1KNGA 4CDOA 3HD5A 3AY8A 5DCHA 2GZYA 3UVHA 3IRAA 2HI7A 1SYXA 3TJFA 2L4CA 4ULXA 3ME8A 5EVOA 2OE3A 2UZ8A 1GSDA 4OCFA 3DMLA 4JZQA 5COHA 1BYEA 2YV9A 3LW9A 3V1WA 5CRDA 4D73B 4A5PA 4HOJA 2G0FA 4LL4B 2VCVA 1ZYQB 1M7TA 4ECJA 2J9HA 5A5KA 3TRXA 4PUFC 5G30A 3WGEA 3CTFA 1EP8A 1IYHA 2AV4A 2LV3A 1YEPA 5HR3A 2GZPA 5IPGA 1ZOFA 2H0HA 2TIRA 1Q98A 5IM9A 5EPFA 1M99A 5F0GA 4EDYA 1ZYNA 3HDCA 2RUEA 3NZNA 3FY7A 4TR3A 2R0GA 3DGQA 4EL1A 4O7HA 4ICYA 4XRDA 5ELAA 3US3A 20GSA 3BBYA 2YCDA 3DYRA 3TKSA 1A23A 1FB6A 3F4TA 3MYDA 4JEDA 2GT6A 4I2UA 1JZOA 3HVSA 2K9FA 2DJ2A 2H70A 1OAZA 4ZL9A 3GIXA 1HD2A 3I43A 3E0UA 1B9YC 4HI7A 5LCZA 2XC2A 1JZWA 1V58A 2YWOA 3BCIA 3P90A 2FNOA 4RUVA 4YKGA 2YWMA 2M72A 2K8VA 5D9VA 1ZYPA 2CAQA 3Q19A 4EXJA 2HNLA 3APSA 4JR6A 1UVZA 1W89A 1K0BA 4IP6A 2LQOA 5GAND 1AUCA 1SKRB 3TOUA 1X5DA 4J57E 3F6FA 3TCOA 1OE8A 3EMPA 5HQPA 2IFQB 1VRSD 1O85A 4FYCA 1DUGA 4MP4A 1YKCA 4ZBBA 1WWJA 5J9CA 4G0LA 5IMAA 1LJRA 5A4UA 1GSFA 2GVPA 2HE3A 2YNXA 2LNTA 2YOIA 4XRAA 1BX9A 2J23A 4EO3A 1K3YA 2O89A 2X4AA 3GYKA 2H30A 5FWGA 4JBBA 3CXGA 2L6DA 4I6XA 4HS1A 1R5AA 6GSYA 3CBUA 5F07A 1O6JA 2YZHA 1AQWA 3VI7A 4L5OA 1WIKA 1QMVA 1PX7A 3ZRDA 3KCMA 1PX6A 4MJEA 1T1VA 3MWHA 5BRTA 2H6ZA 2YPMA 1OC8A 2NTOA 5B6MA 2H8LA 1WRYA 4K5RA 4WBJA 1DE1A 2LNSA 1TU7A 4FYUA 3DD3A 2F8AA 2IPAA 4WBRD 3FMWA 4RQRA 5ENUA 3RHCA 4P3YB 1G7OA 1I9DA 4USSA 1Z3EA 2GSRA 4MH3A 1F37A 3ZITA 5JWOB 4TXVA 2DMMA 3FRCA 1GSYA 4O5QA 1NM3A 4OFMA 5D96A 1V40A 1JLVA 5F05A 1G0TA 4KH7A 3D6IA 1JLWA 2DJJA 1EV9A 4K7OA 2H1DA 2LQQA 1YF0A 4I97A 3ERFA 2R6KA 4IW9A 1X9SB 1M2AA 4G0IA 3LG6A 5AIVA 2H0GA 3D4TA 1QK8A 3M8NA 3KD0A 3QFAC 3VURA 4BPYA 1PL1A 4MPGA 2H01A 4ZB9A 5ECRB 2F51A 2IFQA 4N0VA 2LSTA 2GT5A 1SK1A 4IGJA 1J9BA 3KXOA 1Q4JA 1A8LA 3W8JA 4KW6A 2PGTA 2YZUA 1IYIA 5ECNB 3VK9A 4HQSA 3W6GA 1PL2A 4BL7B 2H6YA 4Q5FA 13GSA 2C3QA 2H19A 3UOMA 1EEJA 2BTOT 5J3RA 4GRFA 3DKSA 4NMUA 1F3AA 4NHZA 2R0PA 4LA1A 3TUEA 1XFLA 2XHFA 5C04A 2O85A 3ME7A 1G6WA 2H76A 2KUCA 1NHYA 1SJZA 5E4WA 1F6MC 3OR5A 3ED3A 2V6OA 5G5FA 4E8HA 3TB2A 5G2ZA 2HFDA 3GKKA 4XS6A 3TKSE 3R2QA 2L5LA 4TR1B 1BAYA 4KB3A 2EIOA 5HR0A 4XS4A 18GSA 3E3EA 1ML6A 2ZCTA 5D73A 1FHEA 17GSA 1GUHA 5KEJA 2VAFA 3HJOA 4I2TA 1U6TA 3D5JA 4FIWA 5DAKB 4G10A 1WOUA 4GQFA 2JL4A 3EPTA 4OCEA 5GAPD 1VGLA 4KCAA 1Z5YE 4K7IA 3HHVA 5IPHA 4NV5A 1HQOA 2H73A 1XPVA 1K0AA 2DMLA 3C8EA 3EVIA 3G7YA 3RPNA 1M2BA 1TRWA 2H1GA 4NAXA 1K3OA 5HFGA 3GKNA 3ZFLA 2E2GA 5ABRA 4K9ZA 1EV4A 1Z6MA 1LU4A 2R3XA 2NPBA 3LYKA 1TXXA 4KSOA 2DJ0A 1EWXA 1UA5A 1FB0A 3C73A 3EINA 2LJKA 3WGXA 1BQ7A 3DIEA 1E6BA 3JCML 1ST9A 3HZ4A 2IMDA 1EOHA 4YAPA 4BVXB 5ECPB 1XVWA 2MMOA 2TRCP 3IAS2 4YQVA 2VCWA 3TOTA 1T4ZA 4YKFA 4MZCA 2LUSA 2MBSA 1K0OA 1WE0A 3EU3A 3FZ9A 1VF2A 3FZ5A 3IBHA 3K8NA 4BVYB 5ECMB 2HT9A 3L9SA 2VLUA 5LNKe 1KBNA 2VUPA 1XOAA 1B4PA 4IKHA 2ES7A 1TI3A 11GSA 5ECSA 3F63A 1S3DA 3Q6OA 2XBQA 2DJKA 1G7EA 2H75A 3ZREA 4XHMA 2QA2A 1M9BA 3GSTA 3GN3A 4KDYA 5CO3A 1RK4A 3EC3A 3FR6A 4OFTA 1F3BA 2QA1A 3KTBA 1TK8B 1NHOA 1V2AA 3BCKA 3F3RA 3VLNA 1XWBA 3F4SA 3C1RA 3PR8A 3N5OA 5BMUA 3TJGA 1M9AA 5IOXA 2L6CA 1PMTA 4X4JA 4V2LA 3A2VA 4MF6A 1XIYA 1OKDA 2CT6A 2PMTA 4KCEA 4LMWA 1GLQA 3HXSA 3KH9A 5LD0A 3ZMLA 1Y25A 2G2QA 5J5NA 6GSUA 2HRKA 3CMIA 1MDKA 4G19A 1TRSA 4TOPA 4X1UA 2JZRA 2HRAA 2B3SA 3WYWA 3GMFA 1RQMA 4PGTA 3HKRA 2V6KA 4MJBA 4EVMA 1O73A 2X8GA 4MCUA 2R2JA 2WDUA 2FUG2 2H1BA 3D4MA 4O92A 2HZEB 2C0DA 1BEDA 1A8YA 2A4HA 22GSA 4FYBA 2B7KA 2R5GA 5AN1A 3GSSA 3IDVA 3HA9A 4KAEA 2I81A 2HYXA 4GTUA 3IOSA 2IMKA 5ECIB 2VL3A 2GQMA 3ZIJA 1QQ2A 2OE0A 2FA8A 2H6XA 2WCIA 3H93A 4QL7A 2KP2A 2I4AA 4OO4A 3VI5A 2OADA 1EGRA 4OO5A 1SL1B 3KGKA 4F2IA 5ELGA 1WMJA 3A3TA 1USBA 1X5CA 3GFKA 1ACVA 2H66A 4YAVA 3KJYA 6GSVA 3APOA 3TKPA 5GSTA 2I1UA 3APQA 1EEMA 1B8XA 3GNJA 5HR1A 1UC7A 3GUSA 2LJAA 1ILOA 4XCSA 4MLYA 2IL3A 3TRPA 2A2PA 3GA4A 1XXUA 5KN3A 9GSSA 3M9JA 1QGVA 1VF1A 5JWQB 4XS1A 3GTUA 1FVKA 2JU5A 4IQAA 1XVQA 5ECLB 4PURA 2HRNA 2CAIA 2X49A 3GV1A 4F0CA 3ERWA 3UMAA 2PVQA 2VCXA 4ZL7A 5FHIA 1YJ6A 3FR3A 2MMZA 5G31A 1FVJA 2OACA 2PBJA 2LRTA 4LLRA 1UN2A 1MD4A 4HEA2 4KF9A 1Z7PA 1FOHA 3VWVA 4F82A 5EY6A 5E59A 2WJUA 2WZ9A 4V2MA 1XCCA 4HQZA 12GSA 5DALB 1XOBA 2KP1A 5IO2A 3FZ4A 1TJDA 2C0FA 2CV4A 4G0KA 2K6VA 3PPUA 3LQ7A 4E8EA 1CQGA 2CZ3A 1LBKA 2AUVA 4IS0A 2FCHA 1SKWB 2DKHA 1OE7A 4GWRA 3D21A 4HZ2A 4D73A 1AIUA 3IV4A 3NOFA 4YQUA 3P2AA 4IP1A 1JZDA 4IN0A 5A4VA 5ECQB 3TJKA 5D8IA 3KMOA 1GWCA 3LXTA 3VWUA 1DBYA 1ERVA 4QQ7A 2VL9A 1OC9B 5FT3A 1XZOA 4IJ3A 4ECCA 5JCWA 2FHEA 2TRXA 3EU4A 3BOAA 4HDEA 3D0ZA 2L57A 5AGYA 4PTSA 1YY7A 2GLRA 2VCZA 3G9BA 2WS2A 2DJ1A 1YQ1A 3GURA 1M2DA 1JZRA 4JU5A 4TXOB 1GNEA 2B7JA 1GL8A 4NV2A 2A2SA 3QAGA 1TDIA 1SJIA 4DSSB 3ZFBA 2VM2A 3LJRA 4OWYA 4WF5A 2PERA 5B8AA 2GS3A 1MEKA 2MMNA 4MMMA 4KE3A 4IJIA 1SENA 4WETA 2YANA 1K0DA 3QAVA 2O8VB 2FGXA 2B5EA 8GSSA 1T8EB 2MBTA 5ID2B 4ZL8A 5IOWA 1I5GA 1Z9HA 3DVWA 4L0UA 4WXTA 1F2EA 2JZTA 2YWNA 3QFBC 3LYPA 1URMA 3DRNA 2LS5A 3LEFA 1A0FA 3GHAA 2JSYA 3CTGA 1EGOA 2H1AA 3GRXA 4KGIA 3TRQA 1EOGA 4N11A 2C3TA 2CA8A 2XBIA 2HLSA 5CRWA 3EURA 4MNNA 1T00A 2LRNA 4Q5QA 3O6TA 2WGRA 2R37A 4HU7A 2OJLA 1GULA 4RQXA 3IAM2 4O5RA 3ZLPA 1YKAA 4IELA 1XW5A 2YJHA 2GSTA 3HJPA 2C1YA 1S3CA 2VM1A 2ZNMA 3C1SA 2QGVA 4MH2A 2PUKC 1X9WB 1PSQA 3LGCA 1Y6EA 1H4OA 1R5PA 2IIYA 3TKRA 2VLTA 2OA7A 2X8CA 5B6NA 1YF1A 5GSSA 1R7HA 3IE3A 2KLXA 2V32A 2P31A 1G6YA 3TKQA 3WGDA 1FAAA 2FD3A 3ZL5A 4L0WA 1TK0B 1OKTA 2GQKA 2V1MA 2N5BA 1BJXA 2M80A 3Q74A 5KOXA 3A2XA 1A0RP 1V98A 3IA1A 3IHGA 3M9KA 5JCGA 4MF5A 3L4NA 2QC7A 3GL5A 4Z2UA 2A2RA 4KSMA 1K0NA 3HVVA 4EDZA 3F0IA 2FWFA 4RI7A 2H0IA 1DE2A 5IMFA 3UBLA 4Q5NA 3VPTA 2YV7A 4ID0A 4TRXA 10GSA 3MNGA 4DSQA 3CSIA 4J2FA 3KM6A 16GSA 3DEXA 3F8UA 1AXDA 2XPEA 1X5EA 2PPTA 4ZIJA 4GCIA 1V57A 3ZMKA 4PNGA 3M3MA 3CYNA 4MK3A 4KDXA 3TJJA 1YDKA 3A5WA 4JRRA 4TW5A 3QAWA 1FG4A 3HYPA 1U88A 1PKWA 2IN3A 1WJKA 3ERGA 3U5RE 3UBKA 4AJ6A 4H86A 1FOVA 4WEYA 2E7PA 1YZXA 2H72A 3G7IA 1SKSB 1O8XA 4KDUA 2ON5A 2CX3A 2PN8A 4NHWA 4POKA 2HXKA 4BL7A 5DVBA 4IBPA 4V2NA 2K8SA 1ZGNA 4GLTA 1SJ6A 3A2WA 4PQIA 3QMXA 1TW9A 1SK0A 3M0FA 1GSUA 4WR5A 2B1LA 3R3EA 2P5QA 4GSTA 2AHEA 2B5YA 4MJAA 4PQHA 2JACA 4HUAA 4EIPA 2I9HA 3TDGA 4GSNA 4NPBA 3KIJA 4ZB6A 3MAKA 1H75A 1K0MA 3ZVJD 5B7CA 4BA7A 4ECBA 1YEXA 3N9JA 4TR1A 2GQLA 3E9JB 3MDKA 3O3TA 1JFUA 1Z7RA 2VD0A 2YWIA 6GSTA 2O7KA 1A2LA 2GGTA 2FWGA 2C8UA 1TOFA 3EWLA 1TP9A 3EE2A 1DSBA 1THOA 3NIVA 3U6VA 5DAKA 2DC5A 1MDJA 3L78A 4L5LA 4FO5A 4RI6A 4TR4A 4ML1A 3P8WA 1TRVA 2FY6A 2JADA 2FLSA 3F3QA 5KOWA 3QR6A 4X43A 3F4RA 5D9XA 3VWXA 3BJ5A 2NDOA 2YP6A 3TKSC 3KH7A 3PGTA 1T3BA 3P7XA 2F8FA 4AGSA 4WF4A 5DDLA 1GUMA 1GSSA 5DBQA 2IJYA 4EUYA 3KP9A 4PUAA 2L5OA 2HSMA 4L8EA 5IIZA 5AISA 1PA3A 3F6DA 4TR0A 1SU9A 4J56E 4LMVA 3HJMA 3FR9A 4GSSA 5J41A 2H71A 4BVXA 1F9MA 1N8JA 3ZVJA 1EP7A 2DIZA 3G7JA 5IMDA 4HJMA 2YJ7A 4EC0A 3L0HA 1XBSA 2GTUA 3IXRA 2LKUA 1SD8A 4BVYA 1GLPA 3C7MA 2VO4A 3FYGA 5C00A 1GTBA 1THXA 2LTKA 2CZ2A 1WP0A 1J08A 4POBA 1HNBA 3LSZA 2OE1A 5A4WA 3DVXA 4OFNA 4LL1B 4DEJA 4K7NA 4K2DA 3Q18A 5G1LA 2H74A 1SD9A 5L71A 3MIXA 2FWEA 1ZMAA 3I6AA 2HSYA 5HFIA 5KN2A 2O87A 3L9UA 4K2XA 1PN9A 2CQ9A 3SBCA 2I3YA 3ZTLA 1PD21 1AW9A 3SWLA 2YN1A 2QKEA 4AJ7A 1XWKA 2AYTA 1KEBA 1EZKA 2CVBA 4F0BA 3UJ1A 3ISOA 4ILFA 2VL2A 4MA9A 2C0EA 4KNDA 2LEGA 3GX0A 1Z6NA 1HNAA 1GNWA 3LFLA 4Z7XA 1U3AA 2WB9A 4ACSA 5IMCA 3UIWA 4IHUA 1VF4A 4G9HA 4PNFA 4K0GA 3H8QA 4MZWA 4TVEA 5DJLA 3QOUA 1FO5A 1ZL9A 3KTLA 5JWRB 2IMEA 3L9VA 3WT2A 1PRXA 2HSHA 2GDRA 2HZEA 3A5IA 3PH9A 3TJBA 2IWTA 2PWJA 5IO0A 2D2ZA 2AJQB 3GX8A 4O5UA 4G2EA 2RLIA 1GTAA 2C3NA 2DJ3A 4HZ4A 3PINA 3IC4A 2E2MA 3QCPA 1U3IA 1O8WA 1ZYEA 3H1NA 4N0ZA 1GH2A 4ZBDA 4WKWA 3GL3A 3FW2A 3HCZA 3GH6A 1OYJA 5CYYA 2EIQA 3GKXA 1B48A 4K8MA 1RW1A 1ERUA 2MYGA 4EKZA 4CHSA 2REMA 4V1Ap 4OMVA 1A2JA 2WFCA 1GUKA 3UEMA 4KX4A 5D9TA 3KEBA 3WT1A 1AC1A 1TTZA 3LORA 3EMXA 3QDNA 1T4YA 2DKIA 2GSQA 4IVFA 1CQHA 4AF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KP8 A;  1GSE A;  1U87 A;  5CRG A;  1ABA A;  1PGT A;  1BG5 A;  1GRX A;  3ZYW A;  1QUW A;  1KTE A;  4XS4 B;  1AQV A;  3VFI A;  3IK7 A;  1T7P B;  1FW1 A;  1N2A A;  5H5S A;  1SK2 A;  2RM6 A;  3RDW A;  1O81 A;  1ZZY A;  4QL9 A;  2EIR A;  1J0F A;  3UVT A;  4GQC A;  4PX1 A;  3DXB A;  5AIX A;  2GSS A;  4ZXG A;  1C72 A;  3S9F A;  4ECI A;  4MDC A;  2AAW A;  5CP1 A;  2NBS A;  2VOC A;  1K0C A;  1SL2 B;  1MTC A;  1VF3 A;  5JCU A;  4HJ2 A;  2RUF A;  3J7Y b;  5B8B A;  2MMA A;  4WR4 A;  5DAL A;  2DIY A;  4K0N A;  2ZUP A;  4OD7 A;  2B1K A;  3ZIV A;  3IR4 A;  2VD1 A;  3LXZ A;  2QSI A;  4NXI A;  1ZCP A;  4O32 A;  4MJC A;  5DQY A;  3FEU A;  2X8H A;  2PVO C;  4I8B A;  2JZS A;  3I9V 2;  4I5Q A;  1XWA A;  2KOK A;  3FKF A;  2Z9S A;  4KUN A;  5CRH A;  2MZC A;  1M0U A;  2KHP A;  2L59 A;  2OBI A;  3M1G A;  1SL0 B;  4F9Z A;  3FK8 A;  1WPI A;  1B4Q A;  2BMX A;  4AJ8 A;  4X0X A;  2FA4 A;  3KMN A;  1V9W A;  2P0G A;  2X99 A;  5KN0 A;  1TRU A;  1E2Y A;  4EF0 A;  1OC9 A;  3FZA A;  3HZ8 A;  2IMI A;  5IQY A;  1XW6 A;  2OBK A;  4N10 A;  1X0R A;  3CSJ A;  5D93 A;  1TK5 B;  1GTU A;  5G5E A;  3VWW A;  3D22 A;  2HZF A;  2BJX A;  3RPP A;  1MDI A;  3F9U A;  6GSX A;  4TXO A;  4XTS A;  5CNW A;  3QD9 A;  4GF0 A;  1NSW A;  3ZZX A;  4DSS A;  3GH9 A;  2ALB A;  4ML6 A;  2VIM A;  3RHB A;  1NW2 A;  2HRF A;  1MD3 A;  3UL3 A;  3UAR A;  1B9X C;  2A4V A;  2GZZ A;  2IMF A;  5IMZ A;  2NVL A;  2C80 A;  3IHQ A;  5ID2 A;  1ERW A;  2LRC A;  2DBC A;  4ZBA A;  1HYU A;  2CVK A;  4V1A g;  4F03 A;  1JHB A;  3HVX A;  2F9S A;  2CX4 A;  3MSZ A;  3DWV A;  3RBT A;  4PQ1 A;  2DSA A;  4MPF A;  4IQ1 A;  3H4K A;  3W8S A;  5EL8 A;  3BD2 A;  3VPQ A;  5IMV A;  2WRT A;  4JR4 A;  1PQN A;  5CAX A;  1R4W A;  4PXO A;  2JSZ A;  1SYR A;  3HY2 A;  1ERT A;  1XWC A;  4MAB A;  2E0Q A;  2R4V A;  1GSQ A;  2N5A A;  1K3L A;  1A24 A;  5CRE A;  2RII A;  4EE0 A;  3CSH A;  3IPZ A;  1GP1 A;  3O76 A;  2C4J A;  1QXH A;  2DLX A;  4YQM A;  5GZZ B;  4K6X A;  4TN8 A;  1QFN A;  14GS A;  5HFK A;  4HU9 A;  4XIH A;  1XW9 A;  3EYT A;  2M46 A;  6GSS A;  3J7Y k;  3RAZ A;  2C0G A;  1XWG A;  2XPD A;  2EC4 A;  2ON7 A;  3GKM A;  4ZB8 A;  3TGZ A;  5H5Q A;  6GSW A;  1O7U A;  4NWY A;  7GSS A;  2B5X A;  2F3M A;  2B6M A;  2PU9 C;  1TU8 A;  2K18 A;  1ON4 A;  2VLV A;  5DQS A;  2V41 A;  2VCT A;  5G1K A;  1OVN A;  2VCQ A;  1X9M B;  2P5R A;  3C71 A;  5HR2 A;  5J9B A;  4DVC A;  4N30 A;  4JE1 A;  1TKD B;  4MZB A;  2X64 A;  5INY A;  2LJR A;  3CRU A;  5H5R A;  4Q5R A;  5ECK B;  4MF7 A;  4DSR A;  5DJM A;  3IK9 A;  4TKY A;  4BWQ A;  4FH8 A;  2AB6 A;  3GTU B;  4GXZ A;  5J4U A;  19GS A;  4YH2 A;  1R26 A;  1TI1 A;  2V2G A;  1GTI A;  3UAP A;  5F8B A;  2FWH A;  3WD6 A;  5ECH B;  2OKA A;  2L4Q A;  1OC3 A;  1S3A A;  3FHK A;  4POM A;  4BWS A;  1HNC A;  4ZIL A;  5D9W A;  1AQX A;  3QPM A;  5KN1 A;  1W4V A;  2RM5 A;  4POL A;  2CVD A;  3I69 A;  1PKZ A;  3CRT A;  4CW9 A;  1AAZ A;  5ECO B;  3KZQ A;  4KA0 A;  3H79 A;  5F06 A;  3LWA A;  4ISD A;  1A2M A;  2N5F A;  2WUL A;  5DCG A;  2VL2 C;  4K1F A;  1KNG A;  4CDO A;  3HD5 A;  3AY8 A;  5DCH A;  2GZY A;  3UVH A;  3IRA A;  2HI7 A;  1SYX A;  3TJF A;  2L4C A;  4ULX A;  3ME8 A;  5EVO A;  2OE3 A;  1GSD A;  4OCF A;  3DML A;  4JZQ A;  5COH A;  1BYE A;  2YV9 A;  3V1W A;  5CRD A;  4D73 B;  4HOJ A;  2G0F A;  4LL4 B;  2VCV A;  1ZYQ B;  1M7T A;  4ECJ A;  2J9H A;  5A5K A;  3TRX A;  4PUF C;  5G30 A;  3WGE A;  3CTF A;  1EP8 A;  1IYH A;  2AV4 A;  2LV3 A;  1YEP A;  5HR3 A;  2GZP A;  5IPG A;  1ZOF A;  2H0H A;  2TIR A;  1Q98 A;  5IM9 A;  5EPF A;  1M99 A;  5F0G A;  4EDY A;  3HDC A;  2RUE A;  3NZN A;  3FY7 A;  4TR3 A;  3DGQ A;  4EL1 A;  4O7H A;  4XRD A;  5ELA A;  3US3 A;  20GS A;  3BBY A;  2YCD A;  3DYR A;  3TKS A;  1A23 A;  1FB6 A;  3F4T A;  4JED A;  2GT6 A;  4I2U A;  1JZO A;  3HVS A;  2K9F A;  2DJ2 A;  2H70 A;  1OAZ A;  4ZL9 A;  3GIX A;  1HD2 A;  3I43 A;  3E0U A;  1B9Y C;  4HI7 A;  5LCZ A;  2XC2 A;  1JZW A;  1V58 A;  2YWO A;  3BCI A;  3P90 A;  2FNO A;  4RUV A;  2YWM A;  2M72 A;  2K8V A;  5D9V A;  2CAQ A;  3Q19 A;  4EXJ A;  2HNL A;  3APS A;  4JR6 A;  1UVZ A;  1W89 A;  1K0B A;  4IP6 A;  2LQO A;  5GAN D;  1AUC A;  1SKR B;  3TOU A;  1X5D A;  4J57 E;  3F6F A;  3TCO A;  1OE8 A;  3EMP A;  5HQP A;  2IFQ B;  1VRS D;  1O85 A;  4FYC A;  1DUG A;  4MP4 A;  1YKC A;  4ZBB A;  1WWJ A;  5J9C A;  5IMA A;  1LJR A;  5A4U A;  1GSF A;  2GVP A;  2HE3 A;  2YNX A;  2LNT A;  2YOI A;  4XRA A;  1BX9 A;  2J23 A;  4EO3 A;  1K3Y A;  2O89 A;  3GYK A;  2H30 A;  5FWG A;  4JBB A;  3CXG A;  2L6D A;  4I6X A;  4HS1 A;  1R5A A;  6GSY A;  3CBU A;  5F07 A;  1O6J A;  2YZH A;  1AQW A;  3VI7 A;  4L5O A;  1WIK A;  1QMV A;  1PX7 A;  3ZRD A;  3KCM A;  1PX6 A;  4MJE A;  1T1V A;  3MWH A;  2H6Z A;  2YPM A;  1OC8 A;  2NTO A;  5B6M A;  2H8L A;  1WRY A;  4WBJ A;  1DE1 A;  2LNS A;  1TU7 A;  4FYU A;  3DD3 A;  2F8A A;  2IPA A;  4WBR D;  4RQR A;  5ENU A;  3RHC A;  4P3Y B;  1G7O A;  1I9D A;  1Z3E A;  2GSR A;  4MH3 A;  1F37 A;  3ZIT A;  5JWO B;  4TXV A;  2DMM A;  3FRC A;  1GSY A;  1NM3 A;  4OFM A;  5D96 A;  1V40 A;  1JLV A;  5F05 A;  1G0T A;  4KH7 A;  3D6I A;  1JLW A;  2DJJ A;  1EV9 A;  4K7O A;  2H1D A;  2LQQ A;  1YF0 A;  4I97 A;  3ERF A;  2R6K A;  4IW9 A;  1X9S B;  1M2A A;  3LG6 A;  5AIV A;  2H0G A;  3D4T A;  1QK8 A;  3M8N A;  3KD0 A;  3QFA C;  3VUR A;  4BPY A;  1PL1 A;  4MPG A;  2H01 A;  4ZB9 A;  5ECR B;  2F51 A;  2IFQ A;  4N0V A;  2LST A;  2GT5 A;  1SK1 A;  4IGJ A;  1J9B A;  3KXO A;  1Q4J A;  1A8L A;  3W8J A;  4KW6 A;  2PGT A;  2YZU A;  1IYI A;  5ECN B;  3VK9 A;  4HQS A;  3W6G A;  1PL2 A;  2H6Y A;  4Q5F A;  13GS A;  2C3Q A;  2H19 A;  3UOM A;  1EEJ A;  2BTO T;  5J3R A;  4GRF A;  3DKS A;  4NMU A;  1F3A A;  4NHZ A;  4LA1 A;  3TUE A;  1XFL A;  2XHF A;  5C04 A;  2O85 A;  3ME7 A;  1G6W A;  2H76 A;  2KUC A;  1NHY A;  1SJZ A;  5E4W A;  1F6M C;  3OR5 A;  3ED3 A;  2V6O A;  5G5F A;  4E8H A;  3TB2 A;  5G2Z A;  2HFD A;  3GKK A;  4XS6 A;  3TKS E;  3R2Q A;  2L5L A;  4TR1 B;  1BAY A;  4KB3 A;  2EIO A;  5HR0 A;  4XS4 A;  18GS A;  3E3E A;  1ML6 A;  2ZCT A;  5D73 A;  1FHE A;  17GS A;  1GUH A;  5KEJ A;  2VAF A;  3HJO A;  4I2T A;  1U6T A;  3D5J A;  4FIW A;  5DAK B;  4G10 A;  1WOU A;  4GQF A;  2JL4 A;  4OCE A;  5GAP D;  1VGL A;  4KCA A;  1Z5Y E;  4K7I A;  3HHV A;  5IPH A;  4NV5 A;  1HQO A;  2H73 A;  1XPV A;  1K0A A;  2DML A;  3C8E A;  3EVI A;  3G7Y A;  3RPN A;  1M2B A;  1TRW A;  2H1G A;  4NAX A;  1K3O A;  5HFG A;  3GKN A;  3ZFL A;  2E2G A;  5ABR A;  4K9Z A;  1EV4 A;  1Z6M A;  1LU4 A;  2R3X A;  2NPB A;  3LYK A;  1TXX A;  4KSO A;  2DJ0 A;  1EWX A;  1UA5 A;  1FB0 A;  3C73 A;  3EIN A;  2LJK A;  3WGX A;  1BQ7 A;  3DIE A;  1E6B A;  3JCM L;  1ST9 A;  3HZ4 A;  2IMD A;  1EOH A;  4YAP A;  5ECP B;  1XVW A;  2MMO A;  2TRC P;  3IAS 2;  4YQV A;  2VCW A;  3TOT A;  1T4Z A;  4MZC A;  2LUS A;  2MBS A;  1K0O A;  1WE0 A;  3EU3 A;  3FZ9 A;  1VF2 A;  3FZ5 A;  3IBH A;  3K8N A;  5ECM B;  2HT9 A;  3L9S A;  2VLU A;  5LNK e;  1KBN A;  2VUP A;  1XOA A;  1B4P A;  4IKH A;  2ES7 A;  1TI3 A;  11GS A;  5ECS A;  3F63 A;  1S3D A;  3Q6O A;  2XBQ A;  2DJK A;  1G7E A;  2H75 A;  3ZRE A;  4XHM A;  1M9B A;  3GST A;  3GN3 A;  4KDY A;  5CO3 A;  1RK4 A;  3EC3 A;  3FR6 A;  4OFT A;  1F3B A;  3KTB A;  1TK8 B;  1NHO A;  1V2A A;  3BCK A;  3F3R A;  3VLN A;  1XWB A;  3F4S A;  3C1R A;  3PR8 A;  3N5O A;  3TJG A;  1M9A A;  5IOX A;  2L6C A;  1PMT A;  4V2L A;  3A2V A;  4MF6 A;  1XIY A;  1OKD A;  2CT6 A;  2PMT A;  4KCE A;  4LMW A;  1GLQ A;  3HXS A;  3KH9 A;  5LD0 A;  3ZML A;  1Y25 A;  2G2Q A;  5J5N A;  6GSU A;  3CMI A;  1MDK A;  4G19 A;  1TRS A;  4TOP A;  4X1U A;  2JZR A;  2B3S A;  3WYW A;  3GMF A;  1RQM A;  4PGT A;  3HKR A;  2V6K A;  4MJB A;  4EVM A;  1O73 A;  2X8G A;  4MCU A;  2R2J A;  2WDU A;  2FUG 2;  2H1B A;  3D4M A;  4O92 A;  2HZE B;  2C0D A;  1BED A;  1A8Y A;  22GS A;  4FYB A;  2B7K A;  2R5G A;  5AN1 A;  3GSS A;  3IDV A;  3HA9 A;  4KAE A;  2I81 A;  2HYX A;  4GTU A;  3IOS A;  2IMK A;  5ECI B;  2VL3 A;  2GQM A;  3ZIJ A;  1QQ2 A;  2OE0 A;  2FA8 A;  2H6X A;  2WCI A;  3H93 A;  4QL7 A;  2KP2 A;  2I4A A;  4OO4 A;  3VI5 A;  2OAD A;  1EGR A;  4OO5 A;  1SL1 B;  3KGK A;  4F2I A;  5ELG A;  1WMJ A;  3A3T A;  1USB A;  1X5C A;  3GFK A;  1ACV A;  2H66 A;  4YAV A;  3KJY A;  6GSV A;  3APO A;  3TKP A;  5GST A;  2I1U A;  3APQ A;  1EEM A;  1B8X A;  3GNJ A;  5HR1 A;  1UC7 A;  3GUS A;  2LJA A;  1ILO A;  4XCS A;  4MLY A;  2IL3 A;  3TRP A;  3GA4 A;  1XXU A;  5KN3 A;  9GSS A;  3M9J A;  1QGV A;  1VF1 A;  5JWQ B;  4XS1 A;  3GTU A;  1FVK A;  2JU5 A;  4IQA A;  1XVQ A;  5ECL B;  4PUR A;  2HRN A;  2CAI A;  3GV1 A;  4F0C A;  3ERW A;  3UMA A;  2PVQ A;  2VCX A;  4ZL7 A;  5FHI A;  1YJ6 A;  3FR3 A;  2MMZ A;  5G31 A;  1FVJ A;  2OAC A;  2PBJ A;  2LRT A;  4LLR A;  1UN2 A;  1MD4 A;  4HEA 2;  1Z7P A;  3VWV A;  4F82 A;  5EY6 A;  5E59 A;  2WJU A;  2WZ9 A;  4V2M A;  1XCC A;  4HQZ A;  12GS A;  5DAL B;  1XOB A;  2KP1 A;  5IO2 A;  3FZ4 A;  1TJD A;  2C0F A;  2CV4 A;  2K6V A;  3LQ7 A;  4E8E A;  1CQG A;  2CZ3 A;  1LBK A;  2AUV A;  4IS0 A;  2FCH A;  1SKW B;  1OE7 A;  4GWR A;  3D21 A;  4HZ2 A;  4D73 A;  1AIU A;  3IV4 A;  3NOF A;  4YQU A;  3P2A A;  4IP1 A;  1JZD A;  4IN0 A;  5A4V A;  5ECQ B;  3TJK A;  5D8I A;  3KMO A;  1GWC A;  3LXT A;  3VWU A;  1DBY A;  1ERV A;  4QQ7 A;  2VL9 A;  1OC9 B;  5FT3 A;  1XZO A;  4IJ3 A;  4ECC A;  5JCW A;  2FHE A;  2TRX A;  3EU4 A;  3BOA A;  4HDE A;  3D0Z A;  2L57 A;  5AGY A;  1YY7 A;  2GLR A;  2VCZ A;  3G9B A;  2WS2 A;  2DJ1 A;  1YQ1 A;  3GUR A;  1M2D A;  1JZR A;  4JU5 A;  4TXO B;  1GNE A;  2B7J A;  1GL8 A;  4NV2 A;  2A2S A;  3QAG A;  1TDI A;  1SJI A;  4DSS B;  3ZFB A;  2VM2 A;  3LJR A;  4OWY A;  4WF5 A;  2PER A;  5B8A A;  2GS3 A;  1MEK A;  2MMN A;  4MMM A;  4KE3 A;  4IJI A;  1SEN A;  4WET A;  2YAN A;  1K0D A;  3QAV A;  2O8V B;  2FGX A;  2B5E A;  8GSS A;  1T8E B;  2MBT A;  5ID2 B;  4ZL8 A;  5IOW A;  1I5G A;  1Z9H A;  3DVW A;  4L0U A;  4WXT A;  1F2E A;  2JZT A;  2YWN A;  3QFB C;  3LYP A;  1URM A;  3DRN A;  2LS5 A;  3LEF A;  1A0F A;  3GHA A;  2JSY A;  3CTG A;  1EGO A;  2H1A A;  3GRX A;  4KGI A;  3TRQ A;  1EOG A;  4N11 A;  2C3T A;  2CA8 A;  2XBI A;  2HLS A;  5CRW A;  3EUR A;  1T00 A;  2LRN A;  4Q5Q A;  3O6T A;  2WGR A;  2R37 A;  4HU7 A;  2OJL A;  1GUL A;  4RQX A;  3IAM 2;  4O5R A;  3ZLP A;  1YKA A;  4IEL A;  1XW5 A;  2YJH A;  2GST A;  3HJP A;  2C1Y A;  1S3C A;  2VM1 A;  2ZNM A;  3C1S A;  2QGV A;  4MH2 A;  2PUK C;  1X9W B;  1PSQ A;  3LGC A;  1Y6E A;  1H4O A;  1R5P A;  2IIY A;  3TKR A;  2VLT A;  2OA7 A;  2X8C A;  5B6N A;  1YF1 A;  5GSS A;  1R7H A;  3IE3 A;  2KLX A;  2V32 A;  2P31 A;  1G6Y A;  3TKQ A;  3WGD A;  1FAA A;  2FD3 A;  3ZL5 A;  4L0W A;  1TK0 B;  1OKT A;  2GQK A;  2V1M A;  2N5B A;  1BJX A;  2M80 A;  3Q74 A;  3A2X A;  1A0R P;  1V98 A;  3IA1 A;  3M9K A;  5JCG A;  4MF5 A;  3L4N A;  2QC7 A;  3GL5 A;  2A2R A;  4KSM A;  1K0N A;  3HVV A;  4EDZ A;  3F0I A;  2FWF A;  4RI7 A;  2H0I A;  1DE2 A;  5IMF A;  3UBL A;  4Q5N A;  3VPT A;  2YV7 A;  4ID0 A;  4TRX A;  10GS A;  3MNG A;  4DSQ A;  3CSI A;  4J2F A;  3KM6 A;  16GS A;  3DEX A;  3F8U A;  1AXD A;  2XPE A;  1X5E A;  2PPT A;  4ZIJ A;  4GCI A;  1V57 A;  3ZMK A;  4PNG A;  3M3M A;  3CYN A;  4MK3 A;  4KDX A;  3TJJ A;  1YDK A;  3A5W A;  4JRR A;  4TW5 A;  3QAW A;  1FG4 A;  3HYP A;  1U88 A;  1PKW A;  2IN3 A;  1WJK A;  3ERG A;  3U5R E;  3UBK A;  4AJ6 A;  4H86 A;  1FOV A;  4WEY A;  2E7P A;  1YZX A;  2H72 A;  3G7I A;  1SKS B;  1O8X A;  4KDU A;  2ON5 A;  2CX3 A;  2PN8 A;  4NHW A;  4POK A;  2HXK A;  4BL7 A;  5DVB A;  4IBP A;  4V2N A;  2K8S A;  1ZGN A;  4GLT A;  1SJ6 A;  3A2W A;  4PQI A;  3QMX A;  1TW9 A;  1SK0 A;  3M0F A;  1GSU A;  4WR5 A;  2B1L A;  2P5Q A;  4GST A;  2AHE A;  2B5Y A;  4MJA A;  4PQH A;  2JAC A;  4HUA A;  2I9H A;  3TDG A;  4GSN A;  4NPB A;  3KIJ A;  4ZB6 A;  3MAK A;  1H75 A;  1K0M A;  3ZVJ D;  5B7C A;  4BA7 A;  4ECB A;  1YEX A;  3N9J A;  4TR1 A;  2GQL A;  3E9J B;  3MDK A;  3O3T A;  1JFU A;  1Z7R A;  2VD0 A;  2YWI A;  6GST A;  2O7K A;  1A2L A;  2GGT A;  2FWG A;  2C8U A;  1TOF A;  3EWL A;  1TP9 A;  3EE2 A;  1DSB A;  1THO A;  3NIV A;  3U6V A;  5DAK A;  2DC5 A;  1MDJ A;  3L78 A;  4L5L A;  4FO5 A;  4RI6 A;  4TR4 A;  4ML1 A;  3P8W A;  1TRV A;  2FY6 A;  2JAD A;  2FLS A;  3F3Q A;  3QR6 A;  4X43 A;  3F4R A;  5D9X A;  3VWX A;  3BJ5 A;  2NDO A;  2YP6 A;  3TKS C;  3KH7 A;  3PGT A;  1T3B A;  3P7X A;  2F8F A;  4AGS A;  4WF4 A;  5DDL A;  1GUM A;  1GSS A;  5DBQ A;  2IJY A;  4EUY A;  3KP9 A;  4PUA A;  2L5O A;  4L8E A;  5IIZ A;  5AIS A;  1PA3 A;  3F6D A;  4TR0 A;  1SU9 A;  4J56 E;  4LMV A;  3HJM A;  3FR9 A;  4GSS A;  5J41 A;  2H71 A;  4BVX A;  1F9M A;  1N8J A;  3ZVJ A;  1EP7 A;  2DIZ A;  3G7J A;  5IMD A;  4HJM A;  2YJ7 A;  4EC0 A;  3L0H A;  1XBS A;  2GTU A;  3IXR A;  2LKU A;  1SD8 A;  4BVY A;  1GLP A;  3C7M A;  2VO4 A;  3FYG A;  5C00 A;  1GTB A;  1THX A;  2LTK A;  2CZ2 A;  1WP0 A;  1J08 A;  4POB A;  1HNB A;  3LSZ A;  2OE1 A;  5A4W A;  3DVX A;  4OFN A;  4LL1 B;  4DEJ A;  4K7N A;  4K2D A;  3Q18 A;  5G1L A;  2H74 A;  1SD9 A;  5L71 A;  2FWE A;  1ZMA A;  3I6A A;  2HSY A;  5HFI A;  5KN2 A;  2O87 A;  3L9U A;  1PN9 A;  2CQ9 A;  3SBC A;  2I3Y A;  3ZTL A;  1PD2 1;  1AW9 A;  3SWL A;  2YN1 A;  2QKE A;  4AJ7 A;  1XWK A;  2AYT A;  1KEB A;  1EZK A;  2CVB A;  4F0B A;  3UJ1 A;  3ISO A;  4ILF A;  2VL2 A;  4MA9 A;  2C0E A;  4KND A;  2LEG A;  3GX0 A;  1Z6N A;  1HNA A;  1GNW A;  3LFL A;  4Z7X A;  1U3A A;  2WB9 A;  4ACS A;  5IMC A;  3UIW A;  4IHU A;  1VF4 A;  4G9H A;  4PNF A;  4K0G A;  3H8Q A;  4MZW A;  4TVE A;  5DJL A;  3QOU A;  1FO5 A;  1ZL9 A;  3KTL A;  5JWR B;  2IME A;  3L9V A;  3WT2 A;  1PRX A;  2HSH A;  2GDR A;  2HZE A;  3PH9 A;  3TJB A;  2IWT A;  2PWJ A;  5IO0 A;  2D2Z A;  2AJQ B;  3GX8 A;  4G2E A;  2RLI A;  1GTA A;  2C3N A;  2DJ3 A;  4HZ4 A;  3PIN A;  3IC4 A;  2E2M A;  3QCP A;  1U3I A;  1O8W A;  1ZYE A;  3H1N A;  4N0Z A;  1GH2 A;  4ZBD A;  4WKW A;  3GL3 A;  3FW2 A;  3HCZ A;  3GH6 A;  1OYJ A;  5CYY A;  2EIQ A;  3GKX A;  1B48 A;  4K8M A;  1RW1 A;  1ERU A;  2MYG A;  4EKZ A;  4CHS A;  2REM A;  4V1A p;  4OMV A;  1A2J A;  2WFC A;  1GUK A;  3UEM A;  4KX4 A;  5D9T A;  3KEB A;  3WT1 A;  1AC1 A;  1TTZ A;  3LOR A;  3EMX A;  3QDN A;  1T4Y A;  2GSQ A;  4IVF A;  1CQH A;  4AF2 A; 
#chains in the Genus database with same CATH topology
 3KP8 A;  1GSE A;  1U87 A;  5CRG A;  1ABA A;  1PGT A;  1BG5 A;  1GRX A;  4CY8 A;  3ZYW A;  1QUW A;  1KTE A;  4XS4 B;  1AQV A;  3VFI A;  3IK7 A;  1T7P B;  1FW1 A;  1N2A A;  5H5S A;  1SK2 A;  2RM6 A;  3RDW A;  1O81 A;  1ZZY A;  4QL9 A;  2EIR A;  1J0F A;  3UVT A;  4GQC A;  4PX1 A;  3DXB A;  5AIX A;  2GSS A;  4ZXG A;  1C72 A;  3S9F A;  4ECI A;  4MDC A;  2AAW A;  5CP1 A;  2NBS A;  2VOC A;  1K0C A;  1SL2 B;  1MTC A;  1VF3 A;  5JCU A;  4HJ2 A;  2RUF A;  3J7Y b;  5B8B A;  2MMA A;  4WR4 A;  5DAL A;  2DIY A;  4K0N A;  2ZUP A;  4OD7 A;  2B1K A;  3ZIV A;  3IR4 A;  4Z2R A;  2VD1 A;  3LXZ A;  2QSI A;  4NXI A;  1ZCP A;  4O32 A;  4MJC A;  5DQY A;  4FQU A;  3FEU A;  2X8H A;  2PVO C;  4I8B A;  2JZS A;  3I9V 2;  4I5Q A;  1XWA A;  2KOK A;  3FKF A;  2Z9S A;  4KUN A;  5CRH A;  2MZC A;  1M0U A;  2KHP A;  2L59 A;  2OBI A;  3M1G A;  1SL0 B;  2R0C A;  4F9Z A;  3FK8 A;  4K5S A;  1WPI A;  1B4Q A;  2BMX A;  4AJ8 A;  4X0X A;  2FA4 A;  3KMN A;  1V9W A;  2P0G A;  2X99 A;  5KN0 A;  1TRU A;  1E2Y A;  4EF0 A;  1OC9 A;  3FZA A;  3HZ8 A;  2IMI A;  5IQY A;  1XW6 A;  4CY6 A;  2OBK A;  4N10 A;  1X0R A;  3CSJ A;  5D93 A;  1TK5 B;  1GTU A;  5G5E A;  3VWW A;  3D22 A;  2HZF A;  2BJX A;  1PN0 A;  3RPP A;  1MDI A;  3F9U A;  6GSX A;  4TXO A;  4XTS A;  5CNW A;  3QD9 A;  4GF0 A;  1NSW A;  3ZZX A;  4DSS A;  3GH9 A;  2ALB A;  4ML6 A;  2VIM A;  3RHB A;  1NW2 A;  2HRF A;  1MD3 A;  3UL3 A;  3UAR A;  1B9X C;  2A4V A;  2GZZ A;  2IMF A;  5IMZ A;  2NVL A;  1PFO A;  2C80 A;  3IHQ A;  1ERW A;  5ID2 A;  2LRC A;  2DBC A;  4ZBA A;  1HYU A;  2CVK A;  4V1A g;  4F03 A;  1JHB A;  3HVX A;  2F9S A;  2CX4 A;  3MSZ A;  3DWV A;  3RBT A;  4PQ1 A;  2DSA A;  4MPF A;  4IQ1 A;  3H4K A;  3W8S A;  5EL8 A;  1XG8 A;  3BD2 A;  3VPQ A;  5IMV A;  2WRT A;  4JR4 A;  4HSC X;  1PQN A;  5CAX A;  1R4W A;  4PXO A;  3IC8 A;  2JSZ A;  1SYR A;  3HY2 A;  1ERT A;  1XWC A;  4MAB A;  2E0Q A;  2R4V A;  1GSQ A;  2N5A A;  1K3L A;  1A24 A;  5CRE A;  2RII A;  4EIQ A;  4EE0 A;  3CSH A;  3IPZ A;  1GP1 A;  3O76 A;  2C4J A;  1QXH A;  2DLX A;  4YQM A;  5GZZ B;  4K6X A;  4TN8 A;  1QFN A;  14GS A;  5HFK A;  4HU9 A;  4XIH A;  1XW9 A;  3EYT A;  2M46 A;  6GSS A;  3J7Y k;  3RAZ A;  2C0G A;  1XWG A;  2XPD A;  2EC4 A;  2ON7 A;  3GKM A;  4ZB8 A;  3TGZ A;  5H5Q A;  6GSW A;  1O7U A;  4NWY A;  7GSS A;  2B5X A;  2F3M A;  2B6M A;  2PU9 C;  1TU8 A;  2K18 A;  1ON4 A;  2VLV A;  5DQS A;  2V41 A;  2VCT A;  5G1K A;  1OVN A;  2VCQ A;  1X9M B;  2P5R A;  3C71 A;  5HR2 A;  5J9B A;  4DVC A;  4N30 A;  4JE1 A;  1TKD B;  4MZB A;  2X64 A;  5INY A;  2LJR A;  3CRU A;  5H5R A;  4Q5R A;  5ECK B;  4MF7 A;  4DSR A;  5DJM A;  3IK9 A;  4TKY A;  4BWQ A;  4FH8 A;  2AB6 A;  3GTU B;  4GXZ A;  5J4U A;  19GS A;  4YH2 A;  1R26 A;  1TI1 A;  4Z2T A;  2V2G A;  1GTI A;  3UAP A;  5F8B A;  2FWH A;  3WD6 A;  5ECH B;  2OKA A;  2L4Q A;  1OC3 A;  1S3A A;  3FHK A;  4POM A;  4BWS A;  1HNC A;  4ZIL A;  5D9W A;  1AQX A;  3QPM A;  5KN1 A;  1W4V A;  2RM5 A;  4POL A;  2CVD A;  3HVN A;  3I69 A;  1PKZ A;  3CRT A;  4CW9 A;  1AAZ A;  5ECO B;  3KZQ A;  4KA0 A;  3H79 A;  5F06 A;  3LWA A;  4ISD A;  1A2M A;  2N5F A;  2WUL A;  5DCG A;  2VL2 C;  4K1F A;  1KNG A;  4CDO A;  3HD5 A;  3AY8 A;  5DCH A;  2GZY A;  3UVH A;  3IRA A;  2HI7 A;  1SYX A;  3TJF A;  2L4C A;  4ULX A;  3ME8 A;  5EVO A;  2OE3 A;  2UZ8 A;  1GSD A;  4OCF A;  3DML A;  4JZQ A;  5COH A;  1BYE A;  2YV9 A;  3LW9 A;  3V1W A;  5CRD A;  4D73 B;  4A5P A;  4HOJ A;  2G0F A;  4LL4 B;  2VCV A;  1ZYQ B;  1M7T A;  4ECJ A;  2J9H A;  5A5K A;  3TRX A;  4PUF C;  5G30 A;  3WGE A;  3CTF A;  1EP8 A;  1IYH A;  2AV4 A;  2LV3 A;  1YEP A;  5HR3 A;  2GZP A;  5IPG A;  1ZOF A;  2H0H A;  2TIR A;  1Q98 A;  5IM9 A;  5EPF A;  1M99 A;  5F0G A;  4EDY A;  1ZYN A;  3HDC A;  2RUE A;  3NZN A;  3FY7 A;  4TR3 A;  2R0G A;  3DGQ A;  4EL1 A;  4O7H A;  4ICY A;  4XRD A;  5ELA A;  3US3 A;  20GS A;  3BBY A;  2YCD A;  3DYR A;  3TKS A;  1A23 A;  1FB6 A;  3F4T A;  3MYD A;  4JED A;  2GT6 A;  4I2U A;  1JZO A;  3HVS A;  2K9F A;  2DJ2 A;  2H70 A;  1OAZ A;  4ZL9 A;  3GIX A;  1HD2 A;  3I43 A;  3E0U A;  1B9Y C;  4HI7 A;  5LCZ A;  2XC2 A;  1JZW A;  3CQF A;  1V58 A;  2YWO A;  3BCI A;  3P90 A;  2FNO A;  4RUV A;  4YKG A;  2YWM A;  2M72 A;  2K8V A;  5D9V A;  1ZYP A;  2CAQ A;  3Q19 A;  4EXJ A;  2HNL A;  3APS A;  4JR6 A;  1UVZ A;  1W89 A;  1K0B A;  4IP6 A;  2LQO A;  5GAN D;  1AUC A;  1SKR B;  3TOU A;  1X5D A;  4J57 E;  3F6F A;  3TCO A;  1OE8 A;  3EMP A;  5HQP A;  2IFQ B;  1VRS D;  1O85 A;  4FYC A;  1DUG A;  4MP4 A;  1YKC A;  4ZBB A;  1WWJ A;  5J9C A;  4G0L A;  5IMA A;  1LJR A;  5A4U A;  1GSF A;  2GVP A;  2HE3 A;  2YNX A;  2LNT A;  2YOI A;  4XRA A;  1BX9 A;  2J23 A;  4EO3 A;  1K3Y A;  2O89 A;  2X4A A;  3GYK A;  2H30 A;  5FWG A;  4JBB A;  3CXG A;  2L6D A;  4I6X A;  4HS1 A;  1R5A A;  6GSY A;  3CBU A;  5F07 A;  1O6J A;  2YZH A;  1AQW A;  3VI7 A;  4L5O A;  1WIK A;  1QMV A;  1PX7 A;  3ZRD A;  3KCM A;  1PX6 A;  4MJE A;  1T1V A;  3MWH A;  5BRT A;  2H6Z A;  2YPM A;  1OC8 A;  2NTO A;  5B6M A;  2H8L A;  1WRY A;  4K5R A;  4WBJ A;  1DE1 A;  2LNS A;  1TU7 A;  4FYU A;  3DD3 A;  2F8A A;  2IPA A;  4WBR D;  3FMW A;  4RQR A;  5ENU A;  3RHC A;  4BIK A;  4P3Y B;  1G7O A;  1I9D A;  4USS A;  1Z3E A;  2GSR A;  4MH3 A;  1F37 A;  3ZIT A;  5JWO B;  4TXV A;  2DMM A;  3FRC A;  1GSY A;  4O5Q A;  1NM3 A;  4OFM A;  5D96 A;  1V40 A;  1JLV A;  5F05 A;  1G0T A;  4KH7 A;  3D6I A;  1JLW A;  2DJJ A;  1EV9 A;  4K7O A;  2H1D A;  2LQQ A;  1YF0 A;  4I97 A;  3ERF A;  2R6K A;  4IW9 A;  1X9S B;  1M2A A;  4G0I A;  3LG6 A;  5AIV A;  2H0G A;  3D4T A;  1QK8 A;  3M8N A;  3KD0 A;  3QFA C;  3VUR A;  4BPY A;  1PL1 A;  4MPG A;  2H01 A;  4ZB9 A;  5ECR B;  2F51 A;  2IFQ A;  4N0V A;  2LST A;  2GT5 A;  1SK1 A;  4IGJ A;  1J9B A;  3KXO A;  1Q4J A;  1A8L A;  3W8J A;  4KW6 A;  2PGT A;  2YZU A;  1IYI A;  5ECN B;  3VK9 A;  4HQS A;  3W6G A;  1PL2 A;  4BL7 B;  2H6Y A;  4Q5F A;  13GS A;  2C3Q A;  2H19 A;  3UOM A;  1EEJ A;  2BTO T;  5J3R A;  4GRF A;  3DKS A;  4NMU A;  1F3A A;  4NHZ A;  2R0P A;  4LA1 A;  3TUE A;  1XFL A;  2XHF A;  5C04 A;  2O85 A;  3ME7 A;  1G6W A;  2H76 A;  2KUC A;  1NHY A;  1SJZ A;  5E4W A;  1F6M C;  3OR5 A;  3ED3 A;  2V6O A;  5G5F A;  4E8H A;  3TB2 A;  5G2Z A;  2HFD A;  3GKK A;  4XS6 A;  3TKS E;  3R2Q A;  2L5L A;  4TR1 B;  1BAY A;  4KB3 A;  2EIO A;  5HR0 A;  4XS4 A;  18GS A;  3E3E A;  1ML6 A;  2ZCT A;  5D73 A;  1FHE A;  17GS A;  1GUH A;  5KEJ A;  2VAF A;  3HJO A;  4I2T A;  1U6T A;  3D5J A;  4FIW A;  5DAK B;  4G10 A;  1WOU A;  4GQF A;  2JL4 A;  3EPT A;  4OCE A;  5GAP D;  1VGL A;  4KCA A;  1Z5Y E;  4K7I A;  3HHV A;  5IPH A;  4NV5 A;  1HQO A;  2H73 A;  1XPV A;  1K0A A;  2DML A;  3C8E A;  3EVI A;  3G7Y A;  3RPN A;  1M2B A;  1TRW A;  2H1G A;  4NAX A;  1K3O A;  5HFG A;  3GKN A;  3ZFL A;  2E2G A;  5ABR A;  4K9Z A;  1EV4 A;  1Z6M A;  1LU4 A;  2R3X A;  2NPB A;  3LYK A;  1TXX A;  4KSO A;  2DJ0 A;  1EWX A;  1UA5 A;  1FB0 A;  3C73 A;  3EIN A;  2LJK A;  3WGX A;  1BQ7 A;  3DIE A;  1E6B A;  3JCM L;  1ST9 A;  3HZ4 A;  2IMD A;  1EOH A;  4YAP A;  4BVX B;  5ECP B;  1XVW A;  2MMO A;  2TRC P;  3IAS 2;  4YQV A;  2VCW A;  3TOT A;  1T4Z A;  4YKF A;  4MZC A;  2LUS A;  2MBS A;  1K0O A;  1WE0 A;  3EU3 A;  3FZ9 A;  1VF2 A;  3FZ5 A;  3IBH A;  3K8N A;  4BVY B;  5ECM B;  2HT9 A;  3L9S A;  2VLU A;  5LNK e;  1KBN A;  2VUP A;  1XOA A;  1B4P A;  4IKH A;  1M3J A;  2ES7 A;  1TI3 A;  11GS A;  5ECS A;  3F63 A;  1S3D A;  3Q6O A;  2XBQ A;  2DJK A;  1G7E A;  2H75 A;  3ZRE A;  4XHM A;  2QA2 A;  1M9B A;  3GST A;  3GN3 A;  4KDY A;  5CO3 A;  1RK4 A;  3EC3 A;  3FR6 A;  4OFT A;  1F3B A;  2QA1 A;  3KTB A;  1TK8 B;  1NHO A;  1V2A A;  3BCK A;  3F3R A;  3VLN A;  1XWB A;  3F4S A;  3C1R A;  3PR8 A;  3N5O A;  5BMU A;  3TJG A;  1M9A A;  5IOX A;  2L6C A;  1PMT A;  4X4J A;  4V2L A;  3A2V A;  4MF6 A;  1XIY A;  1OKD A;  2CT6 A;  2PMT A;  4KCE A;  4LMW A;  1GLQ A;  3HXS A;  3KH9 A;  5LD0 A;  3ZML A;  1Y25 A;  2G2Q A;  5J5N A;  6GSU A;  2HRK A;  3CMI A;  1MDK A;  4G19 A;  1TRS A;  4TOP A;  4X1U A;  2JZR A;  2HRA A;  2B3S A;  3WYW A;  3GMF A;  1RQM A;  4PGT A;  3HKR A;  2V6K A;  4MJB A;  4EVM A;  1O73 A;  2X8G A;  4MCU A;  2R2J A;  2WDU A;  2FUG 2;  2H1B A;  3D4M A;  4O92 A;  2HZE B;  2C0D A;  1BED A;  1A8Y A;  2A4H A;  22GS A;  4FYB A;  2B7K A;  2R5G A;  5AN1 A;  3GSS A;  3IDV A;  3HA9 A;  4KAE A;  2I81 A;  2HYX A;  4GTU A;  3IOS A;  2IMK A;  5ECI B;  2VL3 A;  2GQM A;  3ZIJ A;  1S3R A;  1QQ2 A;  2OE0 A;  2FA8 A;  2H6X A;  2WCI A;  3H93 A;  4QL7 A;  2KP2 A;  2I4A A;  4OO4 A;  3VI5 A;  2OAD A;  1EGR A;  4OO5 A;  1SL1 B;  3KGK A;  4F2I A;  5ELG A;  1WMJ A;  3A3T A;  1USB A;  1X5C A;  3GFK A;  1ACV A;  2H66 A;  4YAV A;  3KJY A;  6GSV A;  3APO A;  3TKP A;  5GST A;  2I1U A;  3APQ A;  1EEM A;  1B8X A;  3GNJ A;  5HR1 A;  1UC7 A;  3GUS A;  2LJA A;  1ILO A;  4XCS A;  4MLY A;  2IL3 A;  3TRP A;  2A2P A;  3GA4 A;  1XXU A;  5KN3 A;  9GSS A;  3M9J A;  1QGV A;  1VF1 A;  5JWQ B;  4XS1 A;  3GTU A;  1FVK A;  2JU5 A;  4IQA A;  1XVQ A;  5ECL B;  4PUR A;  2HRN A;  2CAI A;  2X49 A;  3GV1 A;  4F0C A;  3ERW A;  3UMA A;  2PVQ A;  2VCX A;  4ZL7 A;  5FHI A;  1YJ6 A;  3FR3 A;  1M3I A;  2MMZ A;  5G31 A;  1FVJ A;  2OAC A;  2PBJ A;  2LRT A;  4LLR A;  1UN2 A;  1MD4 A;  4HEA 2;  4KF9 A;  1Z7P A;  1FOH A;  3VWV A;  4F82 A;  5EY6 A;  5E59 A;  2WJU A;  2WZ9 A;  4V2M A;  1XCC A;  4HQZ A;  12GS A;  5DAL B;  1XOB A;  2KP1 A;  5IO2 A;  3FZ4 A;  1TJD A;  2C0F A;  2CV4 A;  4G0K A;  2K6V A;  3PPU A;  3LQ7 A;  4E8E A;  1CQG A;  2CZ3 A;  1LBK A;  2AUV A;  4IS0 A;  2FCH A;  1SKW B;  2DKH A;  1OE7 A;  4GWR A;  3D21 A;  4HZ2 A;  4D73 A;  1AIU A;  3IV4 A;  3NOF A;  4YQU A;  3P2A A;  4IP1 A;  1JZD A;  4IN0 A;  5A4V A;  5ECQ B;  3TJK A;  5D8I A;  3KMO A;  1GWC A;  3LXT A;  3VWU A;  1DBY A;  1ERV A;  4QQ7 A;  2VL9 A;  1OC9 B;  5FT3 A;  1XZO A;  4IJ3 A;  4ECC A;  5JCW A;  2FHE A;  2TRX A;  3EU4 A;  3BOA A;  4HDE A;  3D0Z A;  2L57 A;  5AGY A;  4PTS A;  1YY7 A;  2GLR A;  2VCZ A;  3G9B A;  2WS2 A;  2DJ1 A;  1YQ1 A;  3GUR A;  1M2D A;  1JZR A;  4JU5 A;  4TXO B;  1GNE A;  2B7J A;  1GL8 A;  4NV2 A;  2A2S A;  3QAG A;  1TDI A;  1SJI A;  4DSS B;  3ZFB A;  2VM2 A;  3LJR A;  4OWY A;  4WF5 A;  2PER A;  5B8A A;  2GS3 A;  1MEK A;  2MMN A;  4MMM A;  4KE3 A;  4IJI A;  1SEN A;  4WET A;  2YAN A;  1K0D A;  3QAV A;  2O8V B;  2FGX A;  2B5E A;  8GSS A;  1T8E B;  2MBT A;  5ID2 B;  4ZL8 A;  5IOW A;  1I5G A;  1Z9H A;  3DVW A;  4L0U A;  4WXT A;  1F2E A;  2JZT A;  2YWN A;  3QFB C;  3LYP A;  1URM A;  3DRN A;  2LS5 A;  3LEF A;  1A0F A;  3GHA A;  2JSY A;  3CTG A;  1EGO A;  2H1A A;  3GRX A;  4KGI A;  3TRQ A;  1EOG A;  4N11 A;  2C3T A;  2CA8 A;  2XBI A;  2HLS A;  5CRW A;  3EUR A;  4MNN A;  1T00 A;  2LRN A;  4Q5Q A;  3O6T A;  2WGR A;  2R37 A;  4HU7 A;  2OJL A;  1GUL A;  4RQX A;  3IAM 2;  4O5R A;  3ZLP A;  1YKA A;  4IEL A;  1XW5 A;  2YJH A;  2GST A;  3HJP A;  2C1Y A;  1S3C A;  2VM1 A;  2ZNM A;  3C1S A;  2QGV A;  4MH2 A;  2PUK C;  1X9W B;  1PSQ A;  3LGC A;  1Y6E A;  1H4O A;  1R5P A;  2IIY A;  3TKR A;  2VLT A;  2OA7 A;  2X8C A;  5B6N A;  1YF1 A;  5GSS A;  1R7H A;  3IE3 A;  2KLX A;  2V32 A;  2P31 A;  1G6Y A;  3TKQ A;  3WGD A;  1FAA A;  2FD3 A;  3ZL5 A;  4L0W A;  1TK0 B;  1OKT A;  2GQK A;  2V1M A;  2N5B A;  1BJX A;  2M80 A;  3Q74 A;  5KOX A;  3A2X A;  1A0R P;  1V98 A;  3IA1 A;  3IHG A;  3M9K A;  5JCG A;  4MF5 A;  3L4N A;  2QC7 A;  3GL5 A;  4Z2U A;  2A2R A;  4KSM A;  1K0N A;  3HVV A;  4EDZ A;  3F0I A;  2FWF A;  4RI7 A;  2H0I A;  1DE2 A;  5IMF A;  3UBL A;  4Q5N A;  3VPT A;  2YV7 A;  4ID0 A;  4TRX A;  10GS A;  3MNG A;  4DSQ A;  3CSI A;  4J2F A;  3KM6 A;  16GS A;  3DEX A;  3F8U A;  1AXD A;  2XPE A;  1X5E A;  2PPT A;  4ZIJ A;  4GCI A;  1V57 A;  3ZMK A;  4PNG A;  3M3M A;  3CYN A;  4MK3 A;  4KDX A;  3TJJ A;  1YDK A;  3A5W A;  4JRR A;  4TW5 A;  3QAW A;  1FG4 A;  3HYP A;  1U88 A;  1PKW A;  2IN3 A;  1WJK A;  3ERG A;  3U5R E;  3UBK A;  4AJ6 A;  4H86 A;  1FOV A;  4WEY A;  2E7P A;  1YZX A;  2H72 A;  3G7I A;  1SKS B;  1O8X A;  4KDU A;  2ON5 A;  2CX3 A;  2PN8 A;  4NHW A;  4POK A;  2HXK A;  4BL7 A;  5DVB A;  4IBP A;  4V2N A;  2K8S A;  1ZGN A;  4GLT A;  1SJ6 A;  3A2W A;  4PQI A;  3QMX A;  1TW9 A;  1SK0 A;  3M0F A;  1GSU A;  4WR5 A;  2B1L A;  3R3E A;  2P5Q A;  4GST A;  2AHE A;  2B5Y A;  4MJA A;  4PQH A;  2JAC A;  4HUA A;  4EIP A;  2I9H A;  3TDG A;  4GSN A;  4NPB A;  3KIJ A;  4ZB6 A;  3MAK A;  1H75 A;  1K0M A;  3ZVJ D;  5B7C A;  4BA7 A;  4ECB A;  1YEX A;  3N9J A;  4TR1 A;  2GQL A;  3E9J B;  3MDK A;  3O3T A;  1JFU A;  1Z7R A;  2VD0 A;  2YWI A;  6GST A;  2O7K A;  1A2L A;  2GGT A;  2FWG A;  2C8U A;  1TOF A;  3EWL A;  1TP9 A;  3EE2 A;  1DSB A;  1THO A;  3NIV A;  3U6V A;  5DAK A;  2DC5 A;  1MDJ A;  3L78 A;  4L5L A;  4FO5 A;  4RI6 A;  4TR4 A;  4ML1 A;  3P8W A;  1TRV A;  2FY6 A;  2JAD A;  2FLS A;  3F3Q A;  5KOW A;  3QR6 A;  4X43 A;  3F4R A;  5D9X A;  3VWX A;  3BJ5 A;  2NDO A;  2YP6 A;  3TKS C;  3KH7 A;  3PGT A;  1T3B A;  3P7X A;  2F8F A;  4AGS A;  4WF4 A;  5DDL A;  1GUM A;  1GSS A;  5DBQ A;  2IJY A;  4EUY A;  3KP9 A;  4PUA A;  2L5O A;  2HSM A;  4L8E A;  5IIZ A;  5AIS A;  1PA3 A;  3F6D A;  4TR0 A;  1SU9 A;  4J56 E;  4LMV A;  3HJM A;  3FR9 A;  4GSS A;  5J41 A;  2H71 A;  4BVX A;  1F9M A;  1N8J A;  3ZVJ A;  1EP7 A;  2DIZ A;  3G7J A;  5IMD A;  4HJM A;  2YJ7 A;  4EC0 A;  3L0H A;  1XBS A;  2GTU A;  3IXR A;  2LKU A;  1SD8 A;  4BVY A;  1GLP A;  3C7M A;  2VO4 A;  3FYG A;  5C00 A;  1GTB A;  1THX A;  2LTK A;  2CZ2 A;  1WP0 A;  1J08 A;  4POB A;  1HNB A;  3LSZ A;  2OE1 A;  5A4W A;  3DVX A;  4OFN A;  4LL1 B;  4DEJ A;  4K7N A;  4K2D A;  3Q18 A;  5G1L A;  2H74 A;  1SD9 A;  5L71 A;  3MIX A;  2FWE A;  1ZMA A;  3I6A A;  2HSY A;  5HFI A;  5KN2 A;  2O87 A;  3L9U A;  4K2X A;  1PN9 A;  2CQ9 A;  3SBC A;  2I3Y A;  3ZTL A;  1PD2 1;  1AW9 A;  3SWL A;  2YN1 A;  2QKE A;  4AJ7 A;  1XWK A;  2AYT A;  1KEB A;  1EZK A;  2CVB A;  4F0B A;  3UJ1 A;  3ISO A;  4ILF A;  2VL2 A;  4MA9 A;  2C0E A;  4KND A;  2LEG A;  3GX0 A;  1Z6N A;  1HNA A;  1GNW A;  3LFL A;  4Z7X A;  1U3A A;  2WB9 A;  4ACS A;  5IMC A;  3UIW A;  4IHU A;  1VF4 A;  4G9H A;  4PNF A;  4K0G A;  3H8Q A;  4MZW A;  4TVE A;  5DJL A;  3QOU A;  1FO5 A;  1ZL9 A;  3KTL A;  5JWR B;  2IME A;  3L9V A;  3WT2 A;  1PRX A;  2HSH A;  2GDR A;  2HZE A;  3A5I A;  3PH9 A;  3TJB A;  2IWT A;  2PWJ A;  5IO0 A;  2D2Z A;  2AJQ B;  3GX8 A;  4O5U A;  4G2E A;  2RLI A;  1GTA A;  2C3N A;  2DJ3 A;  4HZ4 A;  3PIN A;  3IC4 A;  2E2M A;  3QCP A;  1U3I A;  1O8W A;  1ZYE A;  3H1N A;  4N0Z A;  1GH2 A;  4ZBD A;  4WKW A;  3GL3 A;  3FW2 A;  3HCZ A;  3GH6 A;  1OYJ A;  5CYY A;  2EIQ A;  3GKX A;  1B48 A;  4K8M A;  1RW1 A;  1ERU A;  2MYG A;  4EKZ A;  4CHS A;  2REM A;  4V1A p;  4OMV A;  1A2J A;  2WFC A;  1GUK A;  3UEM A;  4KX4 A;  5D9T A;  3KEB A;  3WT1 A;  1AC1 A;  1TTZ A;  3LOR A;  3EMX A;  3QDN A;  1T4Y A;  2DKI A;  2GSQ A;  4IVF A;  1CQH A;  4AF2 A; 
#chains in the Genus database with same CATH homology
 3KP8 A;  1GSE A;  1U87 A;  5CRG A;  1ABA A;  1PGT A;  1BG5 A;  1GRX A;  4CY8 A;  3ZYW A;  1QUW A;  1KTE A;  4XS4 B;  1AQV A;  3VFI A;  3IK7 A;  1T7P B;  1FW1 A;  1N2A A;  5H5S A;  1SK2 A;  2RM6 A;  3RDW A;  1O81 A;  1ZZY A;  4QL9 A;  2EIR A;  1J0F A;  3UVT A;  4GQC A;  4PX1 A;  3DXB A;  5AIX A;  2GSS A;  4ZXG A;  1C72 A;  3S9F A;  4ECI A;  4MDC A;  2AAW A;  5CP1 A;  2NBS A;  2VOC A;  1K0C A;  1SL2 B;  1MTC A;  1VF3 A;  5JCU A;  4HJ2 A;  2RUF A;  3J7Y b;  5B8B A;  2MMA A;  4WR4 A;  5DAL A;  2DIY A;  4K0N A;  2ZUP A;  4OD7 A;  2B1K A;  3ZIV A;  3IR4 A;  4Z2R A;  2VD1 A;  3LXZ A;  2QSI A;  4NXI A;  1ZCP A;  4O32 A;  4MJC A;  5DQY A;  4FQU A;  3FEU A;  2X8H A;  2PVO C;  4I8B A;  2JZS A;  3I9V 2;  4I5Q A;  1XWA A;  2KOK A;  3FKF A;  2Z9S A;  4KUN A;  5CRH A;  2MZC A;  1M0U A;  2KHP A;  2L59 A;  2OBI A;  3M1G A;  1SL0 B;  2R0C A;  4F9Z A;  3FK8 A;  4K5S A;  1WPI A;  1B4Q A;  2BMX A;  4AJ8 A;  4X0X A;  2FA4 A;  3KMN A;  1V9W A;  2P0G A;  2X99 A;  5KN0 A;  1TRU A;  1E2Y A;  4EF0 A;  1OC9 A;  3FZA A;  3HZ8 A;  2IMI A;  5IQY A;  1XW6 A;  4CY6 A;  2OBK A;  4N10 A;  1X0R A;  3CSJ A;  5D93 A;  1TK5 B;  1GTU A;  5G5E A;  3VWW A;  3D22 A;  2HZF A;  2BJX A;  1PN0 A;  3RPP A;  1MDI A;  3F9U A;  6GSX A;  4TXO A;  4XTS A;  5CNW A;  3QD9 A;  4GF0 A;  1NSW A;  3ZZX A;  4DSS A;  3GH9 A;  2ALB A;  4ML6 A;  2VIM A;  3RHB A;  1NW2 A;  2HRF A;  1MD3 A;  3UL3 A;  3UAR A;  1B9X C;  2A4V A;  2GZZ A;  2IMF A;  5IMZ A;  2NVL A;  2C80 A;  3IHQ A;  5ID2 A;  1ERW A;  2LRC A;  2DBC A;  4ZBA A;  1HYU A;  2CVK A;  4V1A g;  4F03 A;  1JHB A;  3HVX A;  2F9S A;  2CX4 A;  3MSZ A;  3DWV A;  3RBT A;  4PQ1 A;  2DSA A;  4MPF A;  4IQ1 A;  3H4K A;  3W8S A;  5EL8 A;  3BD2 A;  3VPQ A;  5IMV A;  2WRT A;  4JR4 A;  1PQN A;  5CAX A;  1R4W A;  4PXO A;  3IC8 A;  2JSZ A;  1SYR A;  3HY2 A;  1ERT A;  1XWC A;  4MAB A;  2E0Q A;  2R4V A;  1GSQ A;  2N5A A;  1K3L A;  1A24 A;  5CRE A;  2RII A;  4EIQ A;  4EE0 A;  3CSH A;  3IPZ A;  1GP1 A;  3O76 A;  2C4J A;  1QXH A;  2DLX A;  4YQM A;  5GZZ B;  4K6X A;  4TN8 A;  1QFN A;  14GS A;  5HFK A;  4HU9 A;  4XIH A;  1XW9 A;  3EYT A;  2M46 A;  6GSS A;  3J7Y k;  3RAZ A;  2C0G A;  1XWG A;  2XPD A;  2EC4 A;  2ON7 A;  3GKM A;  4ZB8 A;  3TGZ A;  5H5Q A;  6GSW A;  1O7U A;  4NWY A;  7GSS A;  2B5X A;  2F3M A;  2B6M A;  2PU9 C;  1TU8 A;  2K18 A;  1ON4 A;  2VLV A;  5DQS A;  2V41 A;  2VCT A;  5G1K A;  1OVN A;  2VCQ A;  1X9M B;  2P5R A;  3C71 A;  5HR2 A;  5J9B A;  4DVC A;  4N30 A;  4JE1 A;  1TKD B;  4MZB A;  2X64 A;  5INY A;  2LJR A;  3CRU A;  5H5R A;  4Q5R A;  5ECK B;  4MF7 A;  4DSR A;  5DJM A;  3IK9 A;  4TKY A;  4BWQ A;  4FH8 A;  2AB6 A;  3GTU B;  4GXZ A;  5J4U A;  19GS A;  4YH2 A;  1R26 A;  1TI1 A;  4Z2T A;  2V2G A;  1GTI A;  3UAP A;  5F8B A;  2FWH A;  3WD6 A;  5ECH B;  2OKA A;  2L4Q A;  1OC3 A;  1S3A A;  3FHK A;  4POM A;  4BWS A;  1HNC A;  4ZIL A;  5D9W A;  1AQX A;  3QPM A;  5KN1 A;  1W4V A;  2RM5 A;  4POL A;  2CVD A;  3I69 A;  1PKZ A;  3CRT A;  4CW9 A;  1AAZ A;  5ECO B;  3KZQ A;  4KA0 A;  3H79 A;  5F06 A;  3LWA A;  4ISD A;  1A2M A;  2N5F A;  2WUL A;  5DCG A;  2VL2 C;  4K1F A;  1KNG A;  4CDO A;  3HD5 A;  3AY8 A;  5DCH A;  2GZY A;  3UVH A;  3IRA A;  2HI7 A;  1SYX A;  3TJF A;  2L4C A;  4ULX A;  3ME8 A;  5EVO A;  2OE3 A;  2UZ8 A;  1GSD A;  4OCF A;  3DML A;  4JZQ A;  5COH A;  1BYE A;  2YV9 A;  3LW9 A;  3V1W A;  5CRD A;  4D73 B;  4A5P A;  4HOJ A;  2G0F A;  4LL4 B;  2VCV A;  1ZYQ B;  1M7T A;  4ECJ A;  2J9H A;  5A5K A;  3TRX A;  4PUF C;  5G30 A;  3WGE A;  3CTF A;  1EP8 A;  1IYH A;  2AV4 A;  2LV3 A;  1YEP A;  5HR3 A;  2GZP A;  5IPG A;  1ZOF A;  2H0H A;  2TIR A;  1Q98 A;  5IM9 A;  5EPF A;  1M99 A;  5F0G A;  4EDY A;  1ZYN A;  3HDC A;  2RUE A;  3NZN A;  3FY7 A;  4TR3 A;  2R0G A;  3DGQ A;  4EL1 A;  4O7H A;  4ICY A;  4XRD A;  5ELA A;  3US3 A;  20GS A;  3BBY A;  2YCD A;  3DYR A;  3TKS A;  1A23 A;  1FB6 A;  3F4T A;  3MYD A;  4JED A;  2GT6 A;  4I2U A;  1JZO A;  3HVS A;  2K9F A;  2DJ2 A;  2H70 A;  1OAZ A;  4ZL9 A;  3GIX A;  1HD2 A;  3I43 A;  3E0U A;  1B9Y C;  4HI7 A;  5LCZ A;  2XC2 A;  1JZW A;  1V58 A;  2YWO A;  3BCI A;  3P90 A;  2FNO A;  4RUV A;  4YKG A;  2YWM A;  2M72 A;  2K8V A;  5D9V A;  1ZYP A;  2CAQ A;  3Q19 A;  4EXJ A;  2HNL A;  3APS A;  4JR6 A;  1UVZ A;  1W89 A;  1K0B A;  4IP6 A;  2LQO A;  5GAN D;  1AUC A;  1SKR B;  3TOU A;  1X5D A;  4J57 E;  3F6F A;  3TCO A;  1OE8 A;  3EMP A;  5HQP A;  2IFQ B;  1VRS D;  1O85 A;  4FYC A;  1DUG A;  4MP4 A;  1YKC A;  4ZBB A;  1WWJ A;  5J9C A;  4G0L A;  5IMA A;  1LJR A;  5A4U A;  1GSF A;  2GVP A;  2HE3 A;  2YNX A;  2LNT A;  2YOI A;  4XRA A;  1BX9 A;  2J23 A;  4EO3 A;  1K3Y A;  2O89 A;  2X4A A;  3GYK A;  2H30 A;  5FWG A;  4JBB A;  3CXG A;  2L6D A;  4I6X A;  4HS1 A;  1R5A A;  6GSY A;  3CBU A;  5F07 A;  1O6J A;  2YZH A;  1AQW A;  3VI7 A;  4L5O A;  1WIK A;  1QMV A;  1PX7 A;  3ZRD A;  3KCM A;  1PX6 A;  4MJE A;  1T1V A;  3MWH A;  5BRT A;  2H6Z A;  2YPM A;  1OC8 A;  2NTO A;  5B6M A;  2H8L A;  1WRY A;  4K5R A;  4WBJ A;  1DE1 A;  2LNS A;  1TU7 A;  4FYU A;  3DD3 A;  2F8A A;  2IPA A;  4WBR D;  3FMW A;  4RQR A;  5ENU A;  3RHC A;  4P3Y B;  1G7O A;  1I9D A;  4USS A;  1Z3E A;  2GSR A;  4MH3 A;  1F37 A;  3ZIT A;  5JWO B;  4TXV A;  2DMM A;  3FRC A;  1GSY A;  4O5Q A;  1NM3 A;  4OFM A;  5D96 A;  1V40 A;  1JLV A;  5F05 A;  1G0T A;  4KH7 A;  3D6I A;  1JLW A;  2DJJ A;  1EV9 A;  4K7O A;  2H1D A;  2LQQ A;  1YF0 A;  4I97 A;  3ERF A;  2R6K A;  4IW9 A;  1X9S B;  1M2A A;  4G0I A;  3LG6 A;  5AIV A;  2H0G A;  3D4T A;  1QK8 A;  3M8N A;  3KD0 A;  3QFA C;  3VUR A;  4BPY A;  1PL1 A;  4MPG A;  2H01 A;  4ZB9 A;  5ECR B;  2F51 A;  2IFQ A;  4N0V A;  2LST A;  2GT5 A;  1SK1 A;  4IGJ A;  1J9B A;  3KXO A;  1Q4J A;  1A8L A;  3W8J A;  4KW6 A;  2PGT A;  2YZU A;  1IYI A;  5ECN B;  3VK9 A;  4HQS A;  3W6G A;  1PL2 A;  4BL7 B;  2H6Y A;  4Q5F A;  13GS A;  2C3Q A;  2H19 A;  3UOM A;  1EEJ A;  2BTO T;  5J3R A;  4GRF A;  3DKS A;  4NMU A;  1F3A A;  4NHZ A;  2R0P A;  4LA1 A;  3TUE A;  1XFL A;  2XHF A;  5C04 A;  2O85 A;  3ME7 A;  1G6W A;  2H76 A;  2KUC A;  1NHY A;  1SJZ A;  5E4W A;  1F6M C;  3OR5 A;  3ED3 A;  2V6O A;  5G5F A;  4E8H A;  3TB2 A;  5G2Z A;  2HFD A;  3GKK A;  4XS6 A;  3TKS E;  3R2Q A;  2L5L A;  4TR1 B;  1BAY A;  4KB3 A;  2EIO A;  5HR0 A;  4XS4 A;  18GS A;  3E3E A;  1ML6 A;  2ZCT A;  5D73 A;  1FHE A;  17GS A;  1GUH A;  5KEJ A;  2VAF A;  3HJO A;  4I2T A;  1U6T A;  3D5J A;  4FIW A;  5DAK B;  4G10 A;  1WOU A;  4GQF A;  2JL4 A;  3EPT A;  4OCE A;  5GAP D;  1VGL A;  4KCA A;  1Z5Y E;  4K7I A;  3HHV A;  5IPH A;  4NV5 A;  1HQO A;  2H73 A;  1XPV A;  1K0A A;  2DML A;  3C8E A;  3EVI A;  3G7Y A;  3RPN A;  1M2B A;  1TRW A;  2H1G A;  4NAX A;  1K3O A;  5HFG A;  3GKN A;  3ZFL A;  2E2G A;  5ABR A;  4K9Z A;  1EV4 A;  1Z6M A;  1LU4 A;  2R3X A;  2NPB A;  3LYK A;  1TXX A;  4KSO A;  2DJ0 A;  1EWX A;  1UA5 A;  1FB0 A;  3C73 A;  3EIN A;  2LJK A;  3WGX A;  1BQ7 A;  3DIE A;  1E6B A;  3JCM L;  1ST9 A;  3HZ4 A;  2IMD A;  1EOH A;  4YAP A;  4BVX B;  5ECP B;  1XVW A;  2MMO A;  2TRC P;  3IAS 2;  4YQV A;  2VCW A;  3TOT A;  1T4Z A;  4YKF A;  4MZC A;  2LUS A;  2MBS A;  1K0O A;  1WE0 A;  3EU3 A;  3FZ9 A;  1VF2 A;  3FZ5 A;  3IBH A;  3K8N A;  4BVY B;  5ECM B;  2HT9 A;  3L9S A;  2VLU A;  5LNK e;  1KBN A;  2VUP A;  1XOA A;  1B4P A;  4IKH A;  2ES7 A;  1TI3 A;  11GS A;  5ECS A;  3F63 A;  1S3D A;  3Q6O A;  2XBQ A;  2DJK A;  1G7E A;  2H75 A;  3ZRE A;  4XHM A;  2QA2 A;  1M9B A;  3GST A;  3GN3 A;  4KDY A;  5CO3 A;  1RK4 A;  3EC3 A;  3FR6 A;  4OFT A;  1F3B A;  2QA1 A;  3KTB A;  1TK8 B;  1NHO A;  1V2A A;  3BCK A;  3F3R A;  3VLN A;  1XWB A;  3F4S A;  3C1R A;  3PR8 A;  3N5O A;  5BMU A;  3TJG A;  1M9A A;  5IOX A;  2L6C A;  1PMT A;  4X4J A;  4V2L A;  3A2V A;  4MF6 A;  1XIY A;  1OKD A;  2CT6 A;  2PMT A;  4KCE A;  4LMW A;  1GLQ A;  3HXS A;  3KH9 A;  5LD0 A;  3ZML A;  1Y25 A;  2G2Q A;  5J5N A;  6GSU A;  2HRK A;  3CMI A;  1MDK A;  4G19 A;  1TRS A;  4TOP A;  4X1U A;  2JZR A;  2HRA A;  2B3S A;  3WYW A;  3GMF A;  1RQM A;  4PGT A;  3HKR A;  2V6K A;  4MJB A;  4EVM A;  1O73 A;  2X8G A;  4MCU A;  2R2J A;  2WDU A;  2FUG 2;  2H1B A;  3D4M A;  4O92 A;  2HZE B;  2C0D A;  1BED A;  1A8Y A;  2A4H A;  22GS A;  4FYB A;  2B7K A;  2R5G A;  5AN1 A;  3GSS A;  3IDV A;  3HA9 A;  4KAE A;  2I81 A;  2HYX A;  4GTU A;  3IOS A;  2IMK A;  5ECI B;  2VL3 A;  2GQM A;  3ZIJ A;  1QQ2 A;  2OE0 A;  2FA8 A;  2H6X A;  2WCI A;  3H93 A;  4QL7 A;  2KP2 A;  2I4A A;  4OO4 A;  3VI5 A;  2OAD A;  1EGR A;  4OO5 A;  1SL1 B;  3KGK A;  4F2I A;  5ELG A;  1WMJ A;  3A3T A;  1USB A;  1X5C A;  3GFK A;  1ACV A;  2H66 A;  4YAV A;  3KJY A;  6GSV A;  3APO A;  3TKP A;  5GST A;  2I1U A;  3APQ A;  1EEM A;  1B8X A;  3GNJ A;  5HR1 A;  1UC7 A;  3GUS A;  2LJA A;  1ILO A;  4XCS A;  4MLY A;  2IL3 A;  3TRP A;  2A2P A;  3GA4 A;  1XXU A;  5KN3 A;  9GSS A;  3M9J A;  1QGV A;  1VF1 A;  5JWQ B;  4XS1 A;  3GTU A;  1FVK A;  2JU5 A;  4IQA A;  1XVQ A;  5ECL B;  4PUR A;  2HRN A;  2CAI A;  2X49 A;  3GV1 A;  4F0C A;  3ERW A;  3UMA A;  2PVQ A;  2VCX A;  4ZL7 A;  5FHI A;  1YJ6 A;  3FR3 A;  2MMZ A;  5G31 A;  1FVJ A;  2OAC A;  2PBJ A;  2LRT A;  4LLR A;  1UN2 A;  1MD4 A;  4HEA 2;  4KF9 A;  1Z7P A;  1FOH A;  3VWV A;  4F82 A;  5EY6 A;  5E59 A;  2WJU A;  2WZ9 A;  4V2M A;  1XCC A;  4HQZ A;  12GS A;  5DAL B;  1XOB A;  2KP1 A;  5IO2 A;  3FZ4 A;  1TJD A;  2C0F A;  2CV4 A;  4G0K A;  2K6V A;  3PPU A;  3LQ7 A;  4E8E A;  1CQG A;  2CZ3 A;  1LBK A;  2AUV A;  4IS0 A;  2FCH A;  1SKW B;  2DKH A;  1OE7 A;  4GWR A;  3D21 A;  4HZ2 A;  4D73 A;  1AIU A;  3IV4 A;  3NOF A;  4YQU A;  3P2A A;  4IP1 A;  1JZD A;  4IN0 A;  5A4V A;  5ECQ B;  3TJK A;  5D8I A;  3KMO A;  1GWC A;  3LXT A;  3VWU A;  1DBY A;  1ERV A;  4QQ7 A;  2VL9 A;  1OC9 B;  5FT3 A;  1XZO A;  4IJ3 A;  4ECC A;  5JCW A;  2FHE A;  2TRX A;  3EU4 A;  3BOA A;  4HDE A;  3D0Z A;  2L57 A;  5AGY A;  4PTS A;  1YY7 A;  2GLR A;  2VCZ A;  3G9B A;  2WS2 A;  2DJ1 A;  1YQ1 A;  3GUR A;  1M2D A;  1JZR A;  4JU5 A;  4TXO B;  1GNE A;  2B7J A;  1GL8 A;  4NV2 A;  2A2S A;  3QAG A;  1TDI A;  1SJI A;  4DSS B;  3ZFB A;  2VM2 A;  3LJR A;  4OWY A;  4WF5 A;  2PER A;  5B8A A;  2GS3 A;  1MEK A;  2MMN A;  4MMM A;  4KE3 A;  4IJI A;  1SEN A;  4WET A;  2YAN A;  1K0D A;  3QAV A;  2O8V B;  2FGX A;  2B5E A;  8GSS A;  1T8E B;  2MBT A;  5ID2 B;  4ZL8 A;  5IOW A;  1I5G A;  1Z9H A;  3DVW A;  4L0U A;  4WXT A;  1F2E A;  2JZT A;  2YWN A;  3QFB C;  3LYP A;  1URM A;  3DRN A;  2LS5 A;  3LEF A;  1A0F A;  3GHA A;  2JSY A;  3CTG A;  1EGO A;  2H1A A;  3GRX A;  4KGI A;  3TRQ A;  1EOG A;  4N11 A;  2C3T A;  2CA8 A;  2XBI A;  2HLS A;  5CRW A;  3EUR A;  4MNN A;  1T00 A;  2LRN A;  4Q5Q A;  3O6T A;  2WGR A;  2R37 A;  4HU7 A;  2OJL A;  1GUL A;  4RQX A;  3IAM 2;  4O5R A;  3ZLP A;  1YKA A;  4IEL A;  1XW5 A;  2YJH A;  2GST A;  3HJP A;  2C1Y A;  1S3C A;  2VM1 A;  2ZNM A;  3C1S A;  2QGV A;  4MH2 A;  2PUK C;  1X9W B;  1PSQ A;  3LGC A;  1Y6E A;  1H4O A;  1R5P A;  2IIY A;  3TKR A;  2VLT A;  2OA7 A;  2X8C A;  5B6N A;  1YF1 A;  5GSS A;  1R7H A;  3IE3 A;  2KLX A;  2V32 A;  2P31 A;  1G6Y A;  3TKQ A;  3WGD A;  1FAA A;  2FD3 A;  3ZL5 A;  4L0W A;  1TK0 B;  1OKT A;  2GQK A;  2V1M A;  2N5B A;  1BJX A;  2M80 A;  3Q74 A;  5KOX A;  3A2X A;  1A0R P;  1V98 A;  3IA1 A;  3IHG A;  3M9K A;  5JCG A;  4MF5 A;  3L4N A;  2QC7 A;  3GL5 A;  4Z2U A;  2A2R A;  4KSM A;  1K0N A;  3HVV A;  4EDZ A;  3F0I A;  2FWF A;  4RI7 A;  2H0I A;  1DE2 A;  5IMF A;  3UBL A;  4Q5N A;  3VPT A;  2YV7 A;  4ID0 A;  4TRX A;  10GS A;  3MNG A;  4DSQ A;  3CSI A;  4J2F A;  3KM6 A;  16GS A;  3DEX A;  3F8U A;  1AXD A;  2XPE A;  1X5E A;  2PPT A;  4ZIJ A;  4GCI A;  1V57 A;  3ZMK A;  4PNG A;  3M3M A;  3CYN A;  4MK3 A;  4KDX A;  3TJJ A;  1YDK A;  3A5W A;  4JRR A;  4TW5 A;  3QAW A;  1FG4 A;  3HYP A;  1U88 A;  1PKW A;  2IN3 A;  1WJK A;  3ERG A;  3U5R E;  3UBK A;  4AJ6 A;  4H86 A;  1FOV A;  4WEY A;  2E7P A;  1YZX A;  2H72 A;  3G7I A;  1SKS B;  1O8X A;  4KDU A;  2ON5 A;  2CX3 A;  2PN8 A;  4NHW A;  4POK A;  2HXK A;  4BL7 A;  5DVB A;  4IBP A;  4V2N A;  2K8S A;  1ZGN A;  4GLT A;  1SJ6 A;  3A2W A;  4PQI A;  3QMX A;  1TW9 A;  1SK0 A;  3M0F A;  1GSU A;  4WR5 A;  2B1L A;  3R3E A;  2P5Q A;  4GST A;  2AHE A;  2B5Y A;  4MJA A;  4PQH A;  2JAC A;  4HUA A;  4EIP A;  2I9H A;  3TDG A;  4GSN A;  4NPB A;  3KIJ A;  4ZB6 A;  3MAK A;  1H75 A;  1K0M A;  3ZVJ D;  5B7C A;  4BA7 A;  4ECB A;  1YEX A;  3N9J A;  4TR1 A;  2GQL A;  3E9J B;  3MDK A;  3O3T A;  1JFU A;  1Z7R A;  2VD0 A;  2YWI A;  6GST A;  2O7K A;  1A2L A;  2GGT A;  2FWG A;  2C8U A;  1TOF A;  3EWL A;  1TP9 A;  3EE2 A;  1DSB A;  1THO A;  3NIV A;  3U6V A;  5DAK A;  2DC5 A;  1MDJ A;  3L78 A;  4L5L A;  4FO5 A;  4RI6 A;  4TR4 A;  4ML1 A;  3P8W A;  1TRV A;  2FY6 A;  2JAD A;  2FLS A;  3F3Q A;  5KOW A;  3QR6 A;  4X43 A;  3F4R A;  5D9X A;  3VWX A;  3BJ5 A;  2NDO A;  2YP6 A;  3TKS C;  3KH7 A;  3PGT A;  1T3B A;  3P7X A;  2F8F A;  4AGS A;  4WF4 A;  5DDL A;  1GUM A;  1GSS A;  5DBQ A;  2IJY A;  4EUY A;  3KP9 A;  4PUA A;  2L5O A;  2HSM A;  4L8E A;  5IIZ A;  5AIS A;  1PA3 A;  3F6D A;  4TR0 A;  1SU9 A;  4J56 E;  4LMV A;  3HJM A;  3FR9 A;  4GSS A;  5J41 A;  2H71 A;  4BVX A;  1F9M A;  1N8J A;  3ZVJ A;  1EP7 A;  2DIZ A;  3G7J A;  5IMD A;  4HJM A;  2YJ7 A;  4EC0 A;  3L0H A;  1XBS A;  2GTU A;  3IXR A;  2LKU A;  1SD8 A;  4BVY A;  1GLP A;  3C7M A;  2VO4 A;  3FYG A;  5C00 A;  1GTB A;  1THX A;  2LTK A;  2CZ2 A;  1WP0 A;  1J08 A;  4POB A;  1HNB A;  3LSZ A;  2OE1 A;  5A4W A;  3DVX A;  4OFN A;  4LL1 B;  4DEJ A;  4K7N A;  4K2D A;  3Q18 A;  5G1L A;  2H74 A;  1SD9 A;  5L71 A;  3MIX A;  2FWE A;  1ZMA A;  3I6A A;  2HSY A;  5HFI A;  5KN2 A;  2O87 A;  3L9U A;  4K2X A;  1PN9 A;  2CQ9 A;  3SBC A;  2I3Y A;  3ZTL A;  1PD2 1;  1AW9 A;  3SWL A;  2YN1 A;  2QKE A;  4AJ7 A;  1XWK A;  2AYT A;  1KEB A;  1EZK A;  2CVB A;  4F0B A;  3UJ1 A;  3ISO A;  4ILF A;  2VL2 A;  4MA9 A;  2C0E A;  4KND A;  2LEG A;  3GX0 A;  1Z6N A;  1HNA A;  1GNW A;  3LFL A;  4Z7X A;  1U3A A;  2WB9 A;  4ACS A;  5IMC A;  3UIW A;  4IHU A;  1VF4 A;  4G9H A;  4PNF A;  4K0G A;  3H8Q A;  4MZW A;  4TVE A;  5DJL A;  3QOU A;  1FO5 A;  1ZL9 A;  3KTL A;  5JWR B;  2IME A;  3L9V A;  3WT2 A;  1PRX A;  2HSH A;  2GDR A;  2HZE A;  3A5I A;  3PH9 A;  3TJB A;  2IWT A;  2PWJ A;  5IO0 A;  2D2Z A;  2AJQ B;  3GX8 A;  4O5U A;  4G2E A;  2RLI A;  1GTA A;  2C3N A;  2DJ3 A;  4HZ4 A;  3PIN A;  3IC4 A;  2E2M A;  3QCP A;  1U3I A;  1O8W A;  1ZYE A;  3H1N A;  4N0Z A;  1GH2 A;  4ZBD A;  4WKW A;  3GL3 A;  3FW2 A;  3HCZ A;  3GH6 A;  1OYJ A;  5CYY A;  2EIQ A;  3GKX A;  1B48 A;  4K8M A;  1RW1 A;  1ERU A;  2MYG A;  4EKZ A;  4CHS A;  2REM A;  4V1A p;  4OMV A;  1A2J A;  2WFC A;  1GUK A;  3UEM A;  4KX4 A;  5D9T A;  3KEB A;  3WT1 A;  1AC1 A;  1TTZ A;  3LOR A;  3EMX A;  3QDN A;  1T4Y A;  2DKI A;  2GSQ A;  4IVF A;  1CQH A;  4AF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...