3ZIVA

Crystal structure of ancestral thioredoxin relative to last archaea- eukaryotes common ancestor (aeca) from the precambrian period
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
105
Chain Sequence
SVIEINDENFDEVIKKSDKVVVVDFWAEWCGPCRMIAPIIEELAEEYAGKVVFGKVNVDENPEIAAKYGIMSIPTLLFFKNGKVVDQLVGARPKEALKERIKKYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords AECA THIOREDOXIN
publication title Conservation of Protein Structure Over Four Billion Years
pubmed doi rcsb
source organism Synthetic construct
total genus 25
structure length 105
sequence length 105
chains with identical sequence B, C
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2013-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3zivA00
2OBIA 2FD3A 2FWHA 4TKYA 1FOVA 4K6XA 4KGIA 4ZL9A 4JEDA 5G1KA 4H86A 1XIYA 4WXTA 1R5AA 1ERTA 3M0FA 1K0BA 1KTEA 4PURA 4HUAA 2C3NA 2OKAA 5IM9A 5B7CA 5GAPD 2O89A 2KLXA 4F9ZA 3EU3A 4KAEA 4CW9A 1M2AA 3TJJA 2LRTA 10GSA 5H5SA 5FT3A 5ID2A 3EWLA 2VL2A 4IGJA 1ZMAA 2HT9A 2H74A 4PXOA 4WF5A 3GL3A 3DWVA 5KN0A 1EP7A 2V41A 1WJKA 4NHWA 3FKFA 2GTUA 2K8SA 1WE0A 4MJBA 2GGTA 4LL1B 5DJMA 1T8EB 5D8IA 1PL2A 4HS1A 2VL9A 2VCXA 2LQOA 3A5WA 5ENUA 2IL3A 2OA7A 2YJ7A 1GTAA 4BWSA 9GSSA 1QFNA 2GZPA 3E9JB 1NM3A 4L0WA 5IO0A 3ERWA 3KP9A 1LU4A 2MMZA 4KSMA 4IJ3A 4IVFA 2XHFA 4MCUA 5COHA 2PMTA 4I2TA 3KH9A 4E8EA 4WR4A 6GSWA 1J0FA 1NSWA 2LJAA 3LYKA 2CV4A 5DQSA 2ON7A 4P3YB 17GSA 1QGVA 1YKCA 1OYJA 1W4VA 2CAIA 4V1Ag 1MEKA 1O81A 5F07A 1G7OA 1JZOA 3APOA 4KNDA 2MZCA 2TRCP 2VD0A 2CAQA 5J4UA 5J9BA 1B4QA 4YQMA 1YEPA 5EL8A 2QGVA 3CRUA 3ERFA 1RW1A 2AAWA 4XHMA 1V98A 4XRDA 1XW9A 1X9SB 4OFTA 1EOHA 4AGSA 5J3RA 2HLSA 4BVYA 2ALBA 1TI3A 3C73A 3N5OA 4EVMA 5F06A 1BYEA 2V1MA 2ZUPA 3QDNA 5B8AA 5IOXA 3IHQA 1OC3A 2B3SA 1TTZA 4YH2A 1ZCPA 2JZSA 2MBSA 4J56E 3TJGA 3P2AA 3EYTA 1F3BA 3UJ1A 3C71A 1TRSA 1O85A 3E3EA 4TR3A 1PSQA 3F4TA 2GSQA 2BMXA 2GQLA 2JSYA 4JR4A 1K3OA 1SD8A 4GWRA 1TU7A 1XVWA 4N0ZA 3VWUA 3FZ9A 2DLXA 20GSA 4FYUA 4KCEA 1GSSA 1HNAA 3A2XA 1W89A 2CT6A 5GAND 4ZL7A 5KN2A 2GT5A 3U5RE 2FHEA 4EDZA 1WWJA 2X64A 4IJIA 1OC9A 2B1LA 2M80A 1O6JA 4ZB6A 3HZ4A 1TK0B 1PGTA 3EINA 2PBJA 4XS6A 2YZHA 3HJPA 3TUEA 2N5BA 1ACVA 3QFAC 4MZWA 4I2UA 2B7KA 4KB3A 3IAS2 4I5QA 4K8MA 2WULA 4LMWA 1O8WA 4FIWA 5HR2A 2FCHA 3FW2A 1EEJA 1TOFA 4Q5QA 1J9BA 13GSA 1N8JA 3IA1A 4GQFA 3M3MA 2G2QA 3DVWA 3VI5A 3FRCA 1JHBA 3ZITA 3F3RA 1VF4A 1WPIA 5AGYA 1U87A 1T4YA 4PGTA 1K0CA 1X9WB 4TR1B 3IOSA 3GKXA 4EKZA 3E0UA 2VLVA 3CRTA 2B1KA 4Q5NA 3VWVA 2D2ZA 1VRSD 5HQPA 2OJLA 2PGTA 2XPEA 2DMLA 4MK3A 2PERA 5CP1A 4HEA2 2AYTA 3QOUA 2PVQA 2K18A 2YWNA 1JZWA 1Z7PA 4I6XA 5DCGA 1CQHA 2I9HA 3BCKA 1TU8A 4XS1A 5GZZB 3SWLA 3GX8A 2VCZA 2B5EA 3IC4A 5H5QA 2L59A 2N5AA 3D22A 3KD0A 3F6FA 2L6DA 2YN1A 4OCFA 3LYPA 5G2ZA 1N2AA 1FVKA 2MYGA 2HXKA 3F0IA 2IWTA 3UIWA 4ECJA 3HA9A 4MJEA 2OE0A 4ECBA 5FHIA 3ZIJA 3HXSA 3TJFA 4JE1A 4ULXA 2IFQA 5LNKe 2CZ2A 5CRWA 2HI7A 2C3QA 1HD2A 3IK7A 3FR3A 4G9HA 3L9SA 3TJKA 2HZEB 3IK9A 1XWBA 4KSOA 4JR6A 3IRAA 4AJ6A 2AUVA 3RBTA 4ZILA 2BTOT 2B5XA 4OD7A 3UL3A 4TRXA 4F82A 2VCWA 2X8HA 1AQXA 4IQAA 1T1VA 4JU5A 4AF2A 5KEJA 1WRYA 1BG5A 4HU9A 2JZRA 4NHZA 4WETA 3FK8A 3RAZA 5ECMB 3LEFA 4LMVA 5A4VA 2M72A 5JCUA 1XCCA 1V57A 2RIIA 3M8NA 1SL2B 5KN1A 3R2QA 4HDEA 1K0DA 1VF1A 5DJLA 2OE1A 3O3TA 3DIEA 2GSRA 3QMXA 4MJCA 1PMTA 5D9VA 2DJJA 2WJUA 2GZYA 3TRXA 1GNWA 4BVXA 4KCAA 2H6ZA 5IMAA 1UC7A 5D93A 2ZNMA 1V58A 1TKDB 6GSVA 4MH2A 5G31A 1BQ7A 1M2DA 3G7JA 4XS4B 3EC3A 1A8LA 3PINA 3DGQA 2P5QA 4MF5A 3KTBA 4DEJA 2H66A 5D9WA 5DAKA 2E2GA 4YAVA 2VIMA 3ZVJD 1PRXA 3WT2A 1OAZA 5ECPB 4MZCA 4GCIA 4N30A 2K6VA 1GSEA 1GUHA 4PUAA 2V6KA 5HR3A 1RK4A 1BEDA 4RQXA 3KP8A 3HD5A 1R5PA 2O85A 2YWOA 3TOTA 1KEBA 3S9FA 4HJMA 4PQ1A 5JCGA 1ZZYA 1J08A 3GX0A 3HVVA 4EE0A 1JLWA 4GSNA 4ZB9A 3UEMA 2IMDA 3DEXA 3QAGA 2FY6A 4HQZA 1U3AA 4BWQA 3LQ7A 3D0ZA 1MDJA 3GA4A 3GL5A 2KP2A 3O76A 3A3TA 2EIQA 2DJKA 1E2YA 1SYXA 4PUFC 1TK8B 2H6YA 2VM1A 5DALB 3M9KA 3TGZA 2C1YA 2CVBA 4HZ2A 1F9MA 1HNCA 1SU9A 1FB0A 1SJZA 3HVXA 5ECSA 2YWIA 4TW5A 3C1RA 2H73A 1A24A 5CRGA 4TR4A 4HU7A 4MDCA 5ECLB 1VGLA 2JU5A 1EOGA 2VCTA 3G7YA 3WT1A 2LNSA 2HYXA 1SD9A 2GVPA 1T3BA 4ISDA 3DYRA 4K7OA 2Z9SA 2EC4A 3FEUA 2A2SA 2JADA 1H75A 4DSSA 2XPDA 5HFKA 1KNGA 3H8QA 4IKHA 1M9AA 2CVDA 4MLYA 3RHCA 4OFMA 4K0NA 5C00A 1Q98A 2FUG2 2VCQA 3H79A 1MD4A 2JZTA 1QMVA 2G0FA 4MPGA 5ELAA 2KP1A 1DBYA 3EMPA 2YZUA 3GSTA 4HZ4A 5JCWA 1USBA 1M99A 1F2EA 1AXDA 1X0RA 2RUEA 3HCZA 4I97A 5D9TA 4V2LA 19GSA 3CSJA 1M7TA 1RQMA 2CQ9A 1TXXA 3MNGA 5D73A 4LA1A 6GSYA 3CXGA 1PX6A 1XPVA 4RI6A 1TW9A 5CRHA 2C80A 2DC5A 5DBQA 1OKTA 2DJ0A 5A4UA 1QUWA 1SL1B 1A8YA 4CDOA 2DBCA 2V2GA 4TR1A 3BCIA 4GLTA 2MMAA 2LNTA 2JACA 4CHSA 3IV4A 1G0TA 4MZBA 2V6OA 2FA4A 3HZ8A 3APQA 5H5RA 2HRFA 2HFDA 5CAXA 5IQYA 2C3TA 2FNOA 2JSZA 2FWEA 3DMLA 4OCEA 3F6DA 4BL7A 1XBSA 4WEYA 4KDXA 2OBKA 3IE3A 3WGEA 2A4VA 5B6NA 1EGRA 3LXZA 3SBCA 5ECKB 3GYKA 2YCDA 1IYHA 1XFLA 1GL8A 3TKPA 3D6IA 3ZLPA 2HZFA 3QR6A 3VPTA 3UBLA 5B8BA 3WGXA 5FWGA 2HE3A 4L5LA 1Q4JA 2P31A 4IW9A 3ZVJA 4DVCA 1BX9A 4EDYA 2LV3A 4MABA 5DDLA 3GKKA 2M46A 4F2IA 2HNLA 3ZREA 3CBUA 5AN1A 1GTIA 5LD0A 1K0OA 1YF0A 3TKRA 2HZEA 4JBBA 2L4CA 3Q6OA 3I43A 1DE1A 2O87A 4WBJA 3QAWA 2KUCA 2PVOC 1X5EA 3ME7A 1Y25A 4ML6A 3ZMLA 5ID2B 3TKSC 3D5JA 3M1GA 2DSAA 2H1GA 3FYGA 5DVBA 5JWQB 1ZYQB 1V9WA 2YNXA 1OE7A 1XZOA 5LCZA 2PN8A 1ERUA 5CNWA 4ECCA 1EV9A 1LBKA 2H72A 1XOBA 4OFNA 4IBPA 1B9XC 4K2DA 1ST9A 4I8BA 1GUMA 4K1FA 4ILFA 1S3DA 1TRWA 4KA0A 4KDYA 1YF1A 2LJRA 2O8VB 3G7IA 5A5KA 1E6BA 3LG6A 1GLPA 12GSA 2J23A 3P90A 1UN2A 4QQ7A 1MDIA 2FGXA 1MTCA 1V40A 2VLUA 5G30A 2GT6A 3AY8A 2VL3A 1OVNA 1V2AA 2IIYA 4DSQA 2AJQB 3HJOA 1XW5A 3EMXA 1R26A 3L9VA 4Z7XA 3BBYA 4D73A 3QPMA 1X5CA 1Z5YE 2H1DA 3WD6A 1GRXA 4X43A 3HDCA 1JZDA 5IMVA 3GFKA 1A2MA 1B48A 3RDWA 3GIXA 4RUVA 1YDKA 4MA9A 2F8AA 1JLVA 1ZOFA 3GTUA 1EZKA 2E2MA 1BAYA 2BJXA 5EPFA 1R4WA 3V1WA 5A4WA 3VWXA 2L5OA 3ZYWA 4MF7A 3KCMA 1AIUA 2GZZA 1FG4A 2VCVA 4Q5RA 1GSQA 1PKZA 4EC0A 4IQ1A 4FYCA 1NW2A 3NOFA 3NZNA 1QQ2A 1GSYA 2QKEA 4N11A 3GN3A 1SENA 2GLRA 3IR4A 3KMNA 2WRTA 2R3XA 2H0IA 5HFGA 3J7Yk 3H93A 3D4MA 1SJIA 2LRCA 2VD1A 4POLA 1DE2A 3M9JA 2P0GA 5F0GA 2WDUA 2X99A 1O7UA 4V2NA 3L78A 2DJ3A 4POKA 3EURA 2JL4A 3I6AA 4IP6A 2KOKA 2A2RA 3IBHA 2NVLA 8GSSA 3GURA 5G5EA 2MMNA 22GSA 2PWJA 1T4ZA 4BPYA 2O7KA 2C8UA 1GWCA 5E4WA 3NIVA 1Z7RA 2VO4A 4K7NA 3HHVA 3F3QA 1THOA 1A0RP 4K0GA 1DSBA 1OC9B 1U6TA 4YQVA 3ZFLA 1A2LA 1XW6A 2DJ1A 3OR5A 2LQQA 2XBIA 1C72A 1SKRB 1K0MA 1GNEA 3MAKA 2E7PA 2IMKA 2DJ2A 5J9CA 1TP9A 2GQMA 1GTUA 4KH7A 4GQCA 2DIZA 1PX7A 5CRDA 2J9HA 2VM2A 3KZQA 3ZMKA 5G5FA 1QK8A 3CYNA 5ECNB 2L6CA 1ML6A 3L9UA 3C8EA 3GHAA 1FW1A 3ZZXA 3CSHA 2TIRA 4NV5A 1YEXA 4O7HA 4TOPA 2H70A 1NHOA 2WCIA 4L8EA 2WB9A 1UA5A 2NDOA 2VL2C 1ZL9A 2H30A 1Z6MA 2IJYA 4ECIA 3F8UA 2F8FA 4MJAA 1NHYA 2R4VA 5AIVA 4ZIJA 4FH8A 5CO3A 1PN9A 3VFIA 4NMUA 4TN8A 3A2WA 5IMDA 4HQSA 3RHBA 2RM6A 4KE3A 5IMZA 3WGDA 5JWRB 2YWMA 5B6MA 2YPMA 1SKWB 2CA8A 2OACA 4ZBBA 4E8HA 3LJRA 4RI7A 1F6MC 3CTFA 5IMFA 1U3IA 1OKDA 4IELA 1SKSB 4F0BA 1CQGA 2MBTA 3TKQA 3CTGA 3A2VA 2R5GA 1AAZA 1R7HA 2QC7A 2FLSA 2GSTA 2K9FA 1F3AA 2DIYA 2ZCTA 1GSFA 1ON4A 1GSDA 3KM6A 3ZIVA 5IO2A 1PD21 1O73A 1Z9HA 2FWFA 3KJYA 4NXIA 4ZXGA 4PNFA 5HR0A 1FHEA 1XXUA 4WR5A 3EVIA 4BA7A 4PQHA 3HVSA 4AJ8A 1GTBA 3KH7A 5ABRA 5IPGA 2YOIA 18GSA 2IFQB 4F03A 2IPAA 1F37A 3UARA 5ELGA 4POBA 4YAPA 5ECIB 3QAVA 1XWKA 1PA3A 3UOMA 3DKSA 1PL1A 4TXVA 2LEGA 3LFLA 1MDKA 2OE3A 3HY2A 1ZYEA 1ERWA 2AHEA 2VLTA 5EY6A 2YJHA 3MSZA 1SK2A 4KDUA 5IIZA 5CREA 1I9DA 3W8JA 3Q18A 4DSRA 2LKUA 1XWAA 4OMVA 3K8NA 1EV4A 2H76A 1M2BA 3QFBC 16GSA 4ZBDA 3FY7A 4TXOB 2RUFA 2E0QA 2EIRA 3DD3A 4N0VA 1SL0B 1VF3A 2C4JA 4KX4A 5IOWA 2I1UA 4XTSA 1URMA 2PU9C 4ZL8A 3TOUA 3IXRA 3VK9A 3BD2A 3P7XA 4MH3A 4XCSA 2GQKA 2AB6A 4F0CA 1XWGA 3KMOA 5IMCA 3LGCA 3GUSA 2R37A 3KTLA 1A2JA 5IPHA 3GH6A 3UBKA 3TDGA 1WIKA 3PH9A 3US3A 4RQRA 4LL4B 3ERGA 1OC8A 2H8LA 3F9UA 4MMMA 1AQVA 4L5OA 3IDVA 3FZ4A 5DAKB 3JCML 5DCHA 3P8WA 1AC1A 1B9YC 1DUGA 1EP8A 2L57A 4Q5FA 4GF0A 4ZB8A 2XC2A 3J7Yb 1I5GA 2LTKA 7GSSA 4GXZA 3VWWA 3IPZA 3FR6A 1UVZA 2H19A 2HRNA 3GKNA 3UMAA 3GMFA 4GRFA 2NPBA 2CVKA 1G6YA 1M9BA 2LUSA 1WP0A 3ME8A 2N5FA 4IP1A 4OO4A 1PQNA 2HSYA 2HSHA 1U88A 5INYA 2PPTA 2XBQA 1H4OA 2H0GA 1T7PB 1XOAA 2K8VA 3TRPA 3VLNA 3KEBA 2I81A 3FZ5A 2NBSA 3LSZA 4NWYA 3DRNA 4J57E 3LXTA 2B5YA 4WBRD 4XRAA 2GDRA 2H0HA 2PUKC 1K0AA 1HQOA 4EO3A 2H71A 3D21A 2F9SA 4J2FA 2L4QA 2YANA 4GTUA 4IS0A 3GNJA 1FVJA 4V2MA 3F4SA 4TVEA 2WFCA 1S3AA 5HFIA 5HR1A 4PX1A 2H1AA 3DXBA 3RPPA 1SK0A 3GV1A 1GH2A 1YZXA 4DSSB 5F8BA 6GSUA 2R6KA 4ACSA 1GLQA 4ML1A 5G1LA 1YQ1A 1X5DA 2H1BA 3HYPA 4LLRA 2H01A 3I9V2 2NTOA 2H75A 1G6WA 3Q19A 3W6GA 3APSA 1XVQA 2RM5A 1OE8A 5AIXA 4PNGA 3KGKA 3CSIA 1AW9A 3GH9A 3EE2A 4X1UA 5AISA 5EVOA 4XS4A 2WZ9A 1TDIA 2WGRA 2YP6A 4MPFA 4EF0A 4G19A 4PQIA 1SJ6A 3PGTA 5F05A 3F4RA 3N9JA 2CX3A 1XWCA 2F3MA 4GSTA 2LS5A 2I3YA 2IMIA 1FAAA 1WMJA 1ILOA 4HOJA 3BJ5A 2IMEA 1S3CA 3FHKA 5KN3A 1Y6EA 3ISOA 4ID0A 3F63A 3Q74A 3TJBA 3HJMA 3UVHA 4HJ2A 1ABAA 3TKSA 3TRQA 3ZFBA 1G7EA 4KUNA 3DVXA 2X8GA 1YJ6A 3L4NA 2AV4A 1A23A 2KHPA 2OADA 4K9ZA 3WYWA 1IYIA 5GSSA 4JRRA 2R2JA 6GSXA 3G9BA 1X9MB 5JWOB 2DMMA 3HKRA 3KIJA 3MWHA 3ED3A 4X0XA 1YKAA 4EXJA 4L0UA 3KXOA 6GSSA 3GKMA 5CYYA 2X8CA 5DALA 3PR8A 4NAXA 4IHUA 4G10A 3ZTLA 3D4TA 3GRXA 1TI1A 3C1SA 3EU4A 1TRVA 2C0EA 4V1Ap 1VF2A 1WOUA 4O32A 2GS3A 1MD3A 2WS2A 2IN3A 2V32A 3QD9A 4K7IA 1Z3EA 1ERVA 4TR0A 1SYRA 3TCOA 4ZBAA 2LJKA 4O5RA 1O8XA 5C04A 1LJRA 14GSA 4QL9A 4POMA 2VOCA 1HNBA 1JZRA 1EWXA 1TJDA 3TKSE 4WF4A 5ECHB 5L71A 1GP1A 3RPNA 4NPBA 3I69A 4MF6A 5GSTA 1KBNA 4AJ7A 3VI7A 1AQWA 1FO5A 2QSIA 3ZL5A 1PKWA 3MDKA 3C7MA 1GUKA 4KW6A 4HI7A 1JFUA 3UVTA 4NV2A 2B7JA 3O6TA 4TXOA 2CZ3A 5J41A 5DQYA 4WKWA 1HYUA 1TRUA 3VPQA 5ECOB 3H1NA 4N10A 5ECQB 4O92A 1TK5B 3FZAA 1K3LA 1AUCA 2H6XA 1K0NA 2YV7A 1ZGNA 4QL7A 2TRXA 1EGOA 3VURA 1GULA 2CX4A 2GSSA 1QXHA 3U6VA 3IAM2 2EIOA 2VUPA 2F51A 6GSTA 2MMOA 2B6MA 4EL1A 4FO5A 2LRNA 4GSSA 5J5NA 1GSUA 11GSA 3LORA 2ES7A 2C0DA 4MP4A 2RLIA 4D73B 4G2EA 3LWAA 1K3YA 4OWYA 4FYBA 4IN0A 1B4PA 1Z6NA 3GSSA 3CMIA 2ON5A 3H4KA 1YY7A 4OO5A 3TB2A 3W8SA 3GTUB 3L0HA 3UAPA 2VAFA 4JZQA 3FR9A 5D9XA 5ECRB 2I4AA 2FA8A 1B8XA 1A0FA 1THXA 1M0UA 2IMFA 2C0FA 2L5LA 1EEMA 1BJXA 3ZRDA 1FB6A 4XIHA 2C0GA 2LSTA 3BOAA 1T00A 2FWGA 4EUYA 2P5RA 2YV9A 5D96A 4YQUA 1SK1A 2REMA 5E59A 3QCPA
chains in the Genus database with same CATH superfamily
2OBIA 2FD3A 2FWHA 4TKYA 1FOVA 4K6XA 4KGIA 4ZL9A 4JEDA 5G1KA 4H86A 1XIYA 4WXTA 1R5AA 1ERTA 3M0FA 1K0BA 1KTEA 1PFOA 4PURA 4HUAA 2C3NA 2OKAA 5IM9A 5B7CA 5GAPD 2O89A 2KLXA 4F9ZA 3EU3A 4KAEA 4CW9A 1M2AA 3TJJA 2LRTA 10GSA 5H5SA 5FT3A 5ID2A 3EWLA 2VL2A 4IGJA 1ZMAA 2HT9A 2H74A 4PXOA 4WF5A 4BIKA 3GL3A 3DWVA 5KN0A 1EP7A 2V41A 1WJKA 4NHWA 3FKFA 2GTUA 2K8SA 1WE0A 2X49A 4MJBA 2GGTA 4LL1B 5DJMA 1T8EB 5D8IA 1PL2A 4HS1A 2VL9A 2VCXA 2LQOA 3A5WA 1ZYPA 5ENUA 2IL3A 2OA7A 2YJ7A 1GTAA 4BWSA 9GSSA 1QFNA 2GZPA 3E9JB 1NM3A 4L0WA 5IO0A 3ERWA 4K2XA 3KP9A 1LU4A 2MMZA 4KSMA 4IJ3A 4IVFA 2XHFA 4MCUA 5COHA 2PMTA 4X4JA 4I2TA 3KH9A 4E8EA 4WR4A 6GSWA 1J0FA 1NSWA 2LJAA 3LYKA 2CV4A 5DQSA 2ON7A 4P3YB 17GSA 1QGVA 1YKCA 1OYJA 1W4VA 2CAIA 4V1Ag 1MEKA 1O81A 5F07A 1G7OA 1JZOA 3APOA 4KNDA 2MZCA 2TRCP 2VD0A 2CAQA 5J4UA 5J9BA 1B4QA 4YQMA 1YEPA 5EL8A 2QGVA 3CRUA 3ERFA 2HRAA 1RW1A 2AAWA 4XHMA 1V98A 4XRDA 1XW9A 1X9SB 4OFTA 1EOHA 2A2PA 4AGSA 5J3RA 2HLSA 4BVYA 2ALBA 1TI3A 3C73A 3N5OA 4HSCX 4EVMA 5F06A 1BYEA 2V1MA 2ZUPA 3QDNA 5B8AA 5IOXA 3IHQA 1OC3A 2B3SA 1TTZA 4YH2A 1ZCPA 2JZSA 2MBSA 4J56E 3TJGA 3P2AA 4YKGA 3EYTA 1F3BA 3UJ1A 3C71A 1TRSA 1O85A 3E3EA 4TR3A 1PSQA 3F4TA 2GSQA 2QA2A 2BMXA 2GQLA 2JSYA 4JR4A 1K3OA 1SD8A 4GWRA 1TU7A 1XVWA 4N0ZA 3VWUA 3FZ9A 2DLXA 20GSA 4FYUA 4KCEA 1GSSA 1HNAA 3A2XA 1W89A 2CT6A 3CQFA 5GAND 4ZL7A 5KN2A 2GT5A 3U5RE 2FHEA 4EDZA 1WWJA 2X64A 4IJIA 1OC9A 2B1LA 2M80A 1O6JA 4ZB6A 3HZ4A 1TK0B 1PGTA 3EINA 2A4HA 2PBJA 2YZHA 4XS6A 3HJPA 3TUEA 2N5BA 1ACVA 3QFAC 4MZWA 4I2UA 2B7KA 4KB3A 3IAS2 4I5QA 4K8MA 2WULA 4LMWA 1O8WA 4FIWA 5HR2A 2FCHA 3FW2A 1EEJA 1TOFA 4Q5QA 1J9BA 13GSA 1N8JA 3IA1A 4GQFA 3M3MA 2G2QA 3DVWA 3VI5A 3FRCA 1JHBA 2X4AA 3ZITA 3F3RA 1VF4A 1WPIA 5AGYA 1U87A 1T4YA 4PGTA 1K0CA 1X9WB 4TR1B 3IOSA 3GKXA 4EKZA 3E0UA 2VLVA 3CRTA 2B1KA 4Q5NA 3VWVA 2D2ZA 1VRSD 5HQPA 2OJLA 2PGTA 2XPEA 2DMLA 4MK3A 2PERA 5CP1A 4HEA2 2AYTA 4BL7B 3QOUA 2PVQA 2K18A 2YWNA 1JZWA 1Z7PA 4I6XA 5DCGA 1CQHA 2I9HA 3BCKA 1TU8A 4XS1A 5GZZB 3SWLA 3GX8A 2VCZA 2B5EA 3IC4A 5H5QA 2L59A 2N5AA 3D22A 3KD0A 3F6FA 2L6DA 2YN1A 4OCFA 3LYPA 5G2ZA 1N2AA 1FVKA 2MYGA 2HXKA 3F0IA 2IWTA 3UIWA 4ECJA 3HA9A 4MJEA 2OE0A 4ECBA 5FHIA 3ZIJA 3HXSA 3TJFA 4JE1A 4ULXA 2IFQA 5LNKe 2CZ2A 5CRWA 2HI7A 2C3QA 1HD2A 3IK7A 3FR3A 4G9HA 3L9SA 3TJKA 2HZEB 3IK9A 1XWBA 4KSOA 4JR6A 3IRAA 4AJ6A 2AUVA 3RBTA 4ZILA 2BTOT 2B5XA 4OD7A 3UL3A 4TRXA 4F82A 2VCWA 2X8HA 1AQXA 4IQAA 1T1VA 4YKFA 4JU5A 4AF2A 5KEJA 1WRYA 1BG5A 4A5PA 4HU9A 2JZRA 4NHZA 4WETA 3FK8A 3RAZA 5ECMB 3LEFA 4LMVA 3A5IA 5A4VA 2M72A 5JCUA 1XCCA 1V57A 2RIIA 3M8NA 1SL2B 5KN1A 3R2QA 4HDEA 1K0DA 1VF1A 5DJLA 2OE1A 3O3TA 3DIEA 2GSRA 3QMXA 4MJCA 1PMTA 2DJJA 5D9VA 2WJUA 2GZYA 3TRXA 1GNWA 4BVXA 4KCAA 2H6ZA 5IMAA 1UC7A 5D93A 2ZNMA 1V58A 1TKDB 6GSVA 4MH2A 5G31A 1BQ7A 1M2DA 3G7JA 4XS4B 3EC3A 1A8LA 3PINA 3DGQA 2P5QA 4MF5A 3KTBA 2DKIA 4DEJA 2H66A 5D9WA 5DAKA 4EIQA 2E2GA 4YAVA 2VIMA 3ZVJD 1PRXA 3WT2A 1OAZA 5ECPB 4MZCA 4GCIA 4N30A 2K6VA 1GSEA 1GUHA 4PUAA 2V6KA 5HR3A 1RK4A 1BEDA 4RQXA 3KP8A 3HD5A 1R5PA 2O85A 2YWOA 3TOTA 1KEBA 3S9FA 4HJMA 4PQ1A 5JCGA 1ZZYA 1J08A 3GX0A 3HVVA 4EE0A 1JLWA 4GSNA 4ZB9A 3UEMA 2IMDA 1M3JA 3DEXA 3QAGA 2FY6A 4HQZA 1U3AA 4BWQA 3LQ7A 3D0ZA 4O5UA 1MDJA 3GA4A 3GL5A 2KP2A 3O76A 3A3TA 2EIQA 2DJKA 1E2YA 1SYXA 4PUFC 1TK8B 2H6YA 2VM1A 5DALB 3M9KA 3TGZA 2C1YA 2CVBA 4HZ2A 1F9MA 4O5QA 1HNCA 1SU9A 1FB0A 1SJZA 3HVXA 5ECSA 1XG8A 2YWIA 4TW5A 3C1RA 2H73A 1A24A 5CRGA 4TR4A 4HU7A 4MDCA 5ECLB 1VGLA 2JU5A 1EOGA 2VCTA 3G7YA 3WT1A 2LNSA 2HYXA 1SD9A 2GVPA 1T3BA 4ISDA 3DYRA 4K7OA 2Z9SA 2EC4A 3FEUA 2A2SA 2JADA 1H75A 4DSSA 2XPDA 5HFKA 1KNGA 3H8QA 4IKHA 1M9AA 2CVDA 4MLYA 3RHCA 4OFMA 4K0NA 5C00A 1Q98A 2FUG2 2VCQA 3H79A 1MD4A 2JZTA 1QMVA 2G0FA 4MPGA 5ELAA 2KP1A 1DBYA 3EMPA 2YZUA 3GSTA 4HZ4A 5JCWA 1USBA 1M99A 1F2EA 1AXDA 1X0RA 2RUEA 3HCZA 4I97A 5D9TA 4V2LA 19GSA 3CSJA 1M7TA 1RQMA 2CQ9A 1TXXA 3MNGA 5D73A 4LA1A 6GSYA 3CXGA 1PX6A 1XPVA 4RI6A 1TW9A 5CRHA 2C80A 2DC5A 5DBQA 1OKTA 2DJ0A 5A4UA 1QUWA 1SL1B 1A8YA 4CDOA 2DBCA 2V2GA 4TR1A 3BCIA 4GLTA 2MMAA 2LNTA 2JACA 4CHSA 3IV4A 1G0TA 4MZBA 2V6OA 2FA4A 3HZ8A 3APQA 5H5RA 2HRFA 2HFDA 5CAXA 5IQYA 2C3TA 2FNOA 2JSZA 2FWEA 3DMLA 4OCEA 3F6DA 4BL7A 1XBSA 4WEYA 4KDXA 4CY6A 2OBKA 3IE3A 3WGEA 2A4VA 5B6NA 1EGRA 3LXZA 3SBCA 5ECKB 3GYKA 2YCDA 1IYHA 1XFLA 1GL8A 3R3EA 3TKPA 3D6IA 3ZLPA 2HZFA 3QR6A 3VPTA 3UBLA 5B8BA 3WGXA 5FWGA 2HE3A 4L5LA 1Q4JA 2P31A 4IW9A 3ZVJA 4DVCA 1BX9A 4EDYA 2LV3A 4MABA 3IHGA 5DDLA 3GKKA 2M46A 2DKHA 4F2IA 2HNLA 3ZREA 3CBUA 5AN1A 1GTIA 5LD0A 1K0OA 1YF0A 3TKRA 5BMUA 2HZEA 4JBBA 2L4CA 3Q6OA 3I43A 1DE1A 2O87A 4WBJA 3QAWA 2KUCA 2PVOC 1X5EA 3ME7A 1Y25A 4ML6A 2UZ8A 3ZMLA 5ID2B 3TKSC 3D5JA 3M1GA 2DSAA 4EIPA 2H1GA 3FYGA 5DVBA 5JWQB 1ZYQB 1V9WA 2YNXA 1OE7A 1XZOA 5LCZA 2PN8A 1ERUA 5CNWA 4ECCA 1EV9A 1LBKA 2H72A 1XOBA 4OFNA 4IBPA 1B9XC 4K2DA 1ST9A 4I8BA 1GUMA 4K1FA 4ILFA 1S3DA 1TRWA 4KA0A 4KDYA 2R0CA 1YF1A 2LJRA 4USSA 2O8VB 3G7IA 5A5KA 1E6BA 3LG6A 1GLPA 12GSA 2J23A 3P90A 1UN2A 4QQ7A 1MDIA 2FGXA 1S3RA 1MTCA 1V40A 2VLUA 5G30A 2GT6A 3AY8A 2VL3A 1OVNA 1V2AA 2IIYA 4DSQA 2AJQB 3HJOA 1XW5A 3EMXA 1R26A 3L9VA 4Z7XA 3BBYA 4D73A 3QPMA 1X5CA 1Z5YE 2H1DA 3WD6A 1GRXA 4X43A 3HDCA 1JZDA 5IMVA 3GFKA 1A2MA 1B48A 3RDWA 3GIXA 4RUVA 1YDKA 4MA9A 2F8AA 1JLVA 1ZOFA 3GTUA 1EZKA 2E2MA 1BAYA 2BJXA 5EPFA 1R4WA 5BRTA 3V1WA 5A4WA 3VWXA 2L5OA 3ZYWA 4MF7A 3KCMA 1AIUA 2GZZA 1FG4A 2VCVA 4Q5RA 1GSQA 1PKZA 4EC0A 4IQ1A 4FYCA 1NW2A 3NOFA 3NZNA 1QQ2A 1GSYA 2QKEA 5KOWA 4G0LA 4N11A 3GN3A 1SENA 2GLRA 3IR4A 3KMNA 2WRTA 3PPUA 2R3XA 2H0IA 5HFGA 3J7Yk 3H93A 3D4MA 4CY8A 1SJIA 2LRCA 2VD1A 4POLA 1DE2A 3M9JA 2P0GA 5F0GA 2WDUA 2X99A 1O7UA 2QA1A 4V2NA 4ICYA 3L78A 2DJ3A 4POKA 3EURA 2JL4A 3I6AA 4IP6A 2KOKA 2A2RA 3IBHA 2NVLA 8GSSA 3GURA 5G5EA 2MMNA 22GSA 2PWJA 1T4ZA 4BPYA 2O7KA 2C8UA 1GWCA 5E4WA 3NIVA 1Z7RA 2VO4A 4K7NA 3HHVA 3F3QA 3MYDA 1THOA 1A0RP 4K0GA 1DSBA 2R0PA 1OC9B 1U6TA 4YQVA 3ZFLA 1A2LA 1XW6A 2DJ1A 3OR5A 2LQQA 2XBIA 1C72A 1SKRB 1K0MA 1GNEA 3MAKA 2E7PA 2IMKA 2DJ2A 5J9CA 1TP9A 2GQMA 1GTUA 4KH7A 4GQCA 2DIZA 1PX7A 5CRDA 2J9HA 3EPTA 2VM2A 3KZQA 3ZMKA 5G5FA 1QK8A 3CYNA 4K5RA 5ECNB 2L6CA 1ML6A 3L9UA 3C8EA 3GHAA 1FW1A 3ZZXA 3CSHA 4Z2UA 2TIRA 4NV5A 1YEXA 4O7HA 4TOPA 2H70A 1NHOA 2WCIA 4L8EA 2WB9A 1UA5A 1ZYNA 1M3IA 2NDOA 2VL2C 1ZL9A 3IC8A 2H30A 1Z6MA 2IJYA 4ECIA 3F8UA 2F8FA 4MJAA 1NHYA 2R4VA 5AIVA 4ZIJA 4FH8A 5CO3A 1PN9A 3VFIA 4NMUA 4TN8A 3A2WA 5IMDA 4HQSA 3RHBA 2RM6A 4KE3A 5IMZA 3WGDA 4G0IA 5JWRB 2YWMA 5B6MA 2YPMA 1SKWB 2CA8A 2OACA 4ZBBA 4E8HA 3LJRA 4RI7A 3FMWA 1F6MC 3CTFA 5IMFA 1U3IA 1OKDA 4IELA 1SKSB 3MIXA 4F0BA 1CQGA 2MBTA 1FOHA 3TKQA 3CTGA 3A2VA 2R5GA 1AAZA 1R7HA 2QC7A 2FLSA 2GSTA 2K9FA 1F3AA 2DIYA 2ZCTA 1GSFA 1ON4A 1GSDA 3KM6A 3ZIVA 5IO2A 1PD21 1O73A 1Z9HA 2FWFA 3KJYA 4NXIA 4ZXGA 4PNFA 5HR0A 1FHEA 1XXUA 3HVNA 4WR5A 3EVIA 4BA7A 4PQHA 3HVSA 4AJ8A 1GTBA 3KH7A 5ABRA 5IPGA 2YOIA 18GSA 2IFQB 4F03A 2IPAA 1F37A 3UARA 5ELGA 4POBA 4YAPA 5ECIB 4FQUA 3QAVA 1XWKA 1PA3A 3UOMA 3DKSA 1PL1A 4TXVA 2LEGA 3LFLA 1MDKA 2HRKA 2OE3A 3HY2A 1ZYEA 1ERWA 2AHEA 2VLTA 5EY6A 2YJHA 3MSZA 1SK2A 4KDUA 5IIZA 5CREA 1I9DA 3W8JA 3Q18A 4DSRA 2LKUA 1XWAA 4OMVA 3K8NA 1EV4A 2H76A 1M2BA 3QFBC 16GSA 4ZBDA 3FY7A 4TXOB 2RUFA 2E0QA 2EIRA 3DD3A 4N0VA 1SL0B 1VF3A 2C4JA 4KX4A 5IOWA 2I1UA 4XTSA 1URMA 2PU9C 4ZL8A 3TOUA 3IXRA 3VK9A 3BD2A 3P7XA 4MH3A 4BVXB 4XCSA 2GQKA 2AB6A 4F0CA 1XWGA 3KMOA 5IMCA 3LGCA 3GUSA 2R37A 4G0KA 3KTLA 1A2JA 5IPHA 3GH6A 3UBKA 3TDGA 1WIKA 3PH9A 3US3A 4RQRA 4LL4B 3ERGA 1OC8A 2H8LA 3F9UA 4MMMA 1AQVA 4L5OA 3IDVA 3FZ4A 5DAKB 3JCML 3P8WA 5DCHA 1AC1A 1B9YC 1DUGA 1EP8A 2L57A 4Q5FA 4GF0A 4ZB8A 2XC2A 3J7Yb 1I5GA 2LTKA 7GSSA 4GXZA 3VWWA 3IPZA 3FR6A 1UVZA 2H19A 2HRNA 3GKNA 3UMAA 3GMFA 4GRFA 2NPBA 2CVKA 1G6YA 1M9BA 2LUSA 1WP0A 3ME8A 2N5FA 4IP1A 4OO4A 1PQNA 2HSYA 2HSHA 1U88A 5INYA 2PPTA 2XBQA 1H4OA 2H0GA 1T7PB 1XOAA 2K8VA 3TRPA 3VLNA 3KEBA 2I81A 3FZ5A 2NBSA 3LSZA 4NWYA 3DRNA 4J57E 3LXTA 2B5YA 4WBRD 4XRAA 2GDRA 2H0HA 2PUKC 1K0AA 1HQOA 4EO3A 2H71A 3D21A 2F9SA 4J2FA 2L4QA 2YANA 4GTUA 4IS0A 3GNJA 1FVJA 4V2MA 3F4SA 4TVEA 2WFCA 1S3AA 5HFIA 5HR1A 4PX1A 2H1AA 3DXBA 3RPPA 1SK0A 3GV1A 1GH2A 1YZXA 4DSSB 5F8BA 6GSUA 2R6KA 4ACSA 1GLQA 4ML1A 5G1LA 1YQ1A 1X5DA 2H1BA 3HYPA 4LLRA 2H01A 3I9V2 2NTOA 2H75A 1G6WA 3Q19A 3W6GA 3APSA 1XVQA 2RM5A 1OE8A 5AIXA 4PNGA 3KGKA 3CSIA 1AW9A 3GH9A 3EE2A 4X1UA 5AISA 5EVOA 4XS4A 2WZ9A 1TDIA 2WGRA 2YP6A 4MPFA 4EF0A 4G19A 4PQIA 1SJ6A 3PGTA 5F05A 3F4RA 3N9JA 2CX3A 1XWCA 2F3MA 4GSTA 2LS5A 2I3YA 2IMIA 1FAAA 1WMJA 1ILOA 4HOJA 3BJ5A 2IMEA 1S3CA 3FHKA 4MNNA 5KN3A 1Y6EA 3ISOA 4ID0A 3F63A 3Q74A 3TJBA 3HJMA 4Z2RA 3UVHA 4HJ2A 1ABAA 3TKSA 3TRQA 3ZFBA 1G7EA 4KUNA 3DVXA 2X8GA 1YJ6A 3L4NA 2R0GA 2AV4A 1A23A 2KHPA 2OADA 4K9ZA 3WYWA 1IYIA 5GSSA 4JRRA 2R2JA 6GSXA 3G9BA 1X9MB 5JWOB 2DMMA 3HKRA 4BVYB 3KIJA 3MWHA 3ED3A 4X0XA 1YKAA 4EXJA 4L0UA 3KXOA 6GSSA 3GKMA 5CYYA 2X8CA 5DALA 2HSMA 3PR8A 4NAXA 4IHUA 1PN0A 4G10A 3ZTLA 3D4TA 3GRXA 1TI1A 3C1SA 3EU4A 1TRVA 2C0EA 4V1Ap 1VF2A 1WOUA 4O32A 2GS3A 1MD3A 2WS2A 2IN3A 2V32A 3QD9A 4K7IA 1Z3EA 1ERVA 4TR0A 1SYRA 3TCOA 4ZBAA 2LJKA 4O5RA 1O8XA 5C04A 1LJRA 14GSA 4QL9A 4POMA 2VOCA 4Z2TA 1HNBA 1JZRA 1EWXA 1TJDA 3TKSE 4WF4A 5ECHB 4KF9A 5L71A 1GP1A 4PTSA 3RPNA 4NPBA 3I69A 4MF6A 5GSTA 1KBNA 4AJ7A 3VI7A 1AQWA 1FO5A 2QSIA 3ZL5A 1PKWA 3MDKA 3C7MA 1GUKA 4KW6A 4HI7A 1JFUA 3UVTA 4NV2A 2B7JA 3O6TA 4TXOA 2CZ3A 5J41A 5DQYA 4WKWA 1HYUA 1TRUA 3VPQA 5ECOB 3H1NA 4N10A 5ECQB 4O92A 1TK5B 3FZAA 1K3LA 1AUCA 2H6XA 1K0NA 2YV7A 1ZGNA 4QL7A 2TRXA 1EGOA 3VURA 1GULA 2CX4A 2GSSA 1QXHA 3U6VA 3IAM2 2EIOA 2VUPA 2F51A 6GSTA 4K5SA 2MMOA 5KOXA 2B6MA 4EL1A 4FO5A 2LRNA 4GSSA 5J5NA 1GSUA 11GSA 3LORA 2ES7A 2C0DA 4MP4A 2RLIA 4D73B 4G2EA 3LWAA 1K3YA 4OWYA 4FYBA 4IN0A 1B4PA 1Z6NA 3GSSA 3CMIA 2ON5A 3H4KA 1YY7A 4OO5A 3LW9A 3TB2A 3W8SA 3GTUB 3L0HA 3UAPA 2VAFA 4JZQA 3FR9A 5D9XA 5ECRB 2I4AA 2FA8A 1B8XA 1A0FA 1THXA 1M0UA 2IMFA 2C0FA 2L5LA 1EEMA 1BJXA 3ZRDA 1FB6A 4XIHA 2C0GA 2LSTA 3BOAA 1T00A 2FWGA 4EUYA 2P5RA 2YV9A 5D96A 4YQUA 1SK1A 2REMA 5E59A 3QCPA
chains in the Genus database with same CATH topology
2OBIA 2FD3A 2FWHA 4TKYA 1FOVA 4K6XA 4KGIA 4ZL9A 4JEDA 5G1KA 4H86A 1XIYA 4WXTA 1R5AA 1ERTA 3M0FA 1K0BA 1KTEA 4PURA 4HUAA 2C3NA 2OKAA 5IM9A 5B7CA 5GAPD 2O89A 2KLXA 4F9ZA 3EU3A 4KAEA 4CW9A 1M2AA 3TJJA 2LRTA 10GSA 5H5SA 5FT3A 5ID2A 3EWLA 2VL2A 4IGJA 1ZMAA 2HT9A 2H74A 4PXOA 4WF5A 3GL3A 3DWVA 5KN0A 1EP7A 2V41A 1WJKA 4NHWA 3FKFA 2GTUA 2K8SA 1WE0A 2X49A 4MJBA 2GGTA 4LL1B 5DJMA 1T8EB 5D8IA 1PL2A 4HS1A 2VL9A 2VCXA 2LQOA 3A5WA 1ZYPA 5ENUA 2IL3A 2OA7A 2YJ7A 1GTAA 4BWSA 9GSSA 1QFNA 2GZPA 3E9JB 1NM3A 4L0WA 5IO0A 3ERWA 4K2XA 3KP9A 1LU4A 2MMZA 4KSMA 4IJ3A 4IVFA 2XHFA 4MCUA 5COHA 2PMTA 4X4JA 4I2TA 3KH9A 4E8EA 4WR4A 6GSWA 1J0FA 1NSWA 2LJAA 3LYKA 2CV4A 5DQSA 2ON7A 4P3YB 17GSA 1QGVA 1YKCA 1OYJA 1W4VA 2CAIA 4V1Ag 1MEKA 1O81A 5F07A 1G7OA 1JZOA 3APOA 4KNDA 2MZCA 2TRCP 2VD0A 2CAQA 5J4UA 5J9BA 1B4QA 4YQMA 1YEPA 5EL8A 2QGVA 3CRUA 3ERFA 2HRAA 1RW1A 2AAWA 4XHMA 1V98A 4XRDA 1XW9A 1X9SB 4OFTA 1EOHA 2A2PA 4AGSA 5J3RA 2HLSA 4BVYA 2ALBA 1TI3A 3C73A 3N5OA 4EVMA 5F06A 1BYEA 2V1MA 2ZUPA 3QDNA 5B8AA 5IOXA 3IHQA 1OC3A 2B3SA 1TTZA 4YH2A 1ZCPA 2JZSA 2MBSA 4J56E 3TJGA 3P2AA 4YKGA 3EYTA 1F3BA 3UJ1A 3C71A 1TRSA 1O85A 3E3EA 4TR3A 1PSQA 3F4TA 2GSQA 2QA2A 2BMXA 2GQLA 2JSYA 4JR4A 1K3OA 1SD8A 4GWRA 1TU7A 1XVWA 4N0ZA 3VWUA 3FZ9A 2DLXA 20GSA 4FYUA 4KCEA 1GSSA 1HNAA 3A2XA 1W89A 2CT6A 5GAND 4ZL7A 5KN2A 2GT5A 3U5RE 2FHEA 4EDZA 1WWJA 2X64A 4IJIA 1OC9A 2B1LA 2M80A 1O6JA 4ZB6A 3HZ4A 1TK0B 1PGTA 3EINA 2A4HA 2PBJA 2YZHA 4XS6A 3HJPA 3TUEA 2N5BA 1ACVA 3QFAC 4MZWA 4I2UA 2B7KA 4KB3A 3IAS2 4I5QA 4K8MA 2WULA 4LMWA 1O8WA 4FIWA 5HR2A 2FCHA 3FW2A 1EEJA 1TOFA 4Q5QA 1J9BA 13GSA 1N8JA 3IA1A 4GQFA 3M3MA 2G2QA 3DVWA 3VI5A 3FRCA 1JHBA 2X4AA 3ZITA 3F3RA 1VF4A 1WPIA 5AGYA 1U87A 1T4YA 4PGTA 1K0CA 1X9WB 4TR1B 3IOSA 3GKXA 4EKZA 3E0UA 2VLVA 3CRTA 2B1KA 4Q5NA 3VWVA 2D2ZA 1VRSD 5HQPA 2OJLA 2PGTA 2XPEA 2DMLA 4MK3A 2PERA 5CP1A 4HEA2 2AYTA 4BL7B 3QOUA 2PVQA 2K18A 2YWNA 1JZWA 1Z7PA 4I6XA 5DCGA 1CQHA 2I9HA 3BCKA 1TU8A 4XS1A 5GZZB 3SWLA 3GX8A 2VCZA 2B5EA 3IC4A 5H5QA 2L59A 2N5AA 3D22A 3KD0A 3F6FA 2L6DA 2YN1A 4OCFA 3LYPA 5G2ZA 1N2AA 1FVKA 2MYGA 2HXKA 3F0IA 2IWTA 3UIWA 4ECJA 3HA9A 4MJEA 2OE0A 4ECBA 5FHIA 3ZIJA 3HXSA 3TJFA 4JE1A 4ULXA 2IFQA 5LNKe 2CZ2A 5CRWA 2HI7A 2C3QA 1HD2A 3IK7A 3FR3A 4G9HA 3L9SA 3TJKA 2HZEB 3IK9A 1XWBA 4KSOA 4JR6A 3IRAA 4AJ6A 2AUVA 3RBTA 4ZILA 2BTOT 2B5XA 4OD7A 3UL3A 4TRXA 4F82A 2VCWA 2X8HA 1AQXA 4IQAA 1T1VA 4YKFA 4JU5A 4AF2A 5KEJA 1WRYA 1BG5A 4A5PA 4HU9A 2JZRA 4NHZA 4WETA 3FK8A 3RAZA 5ECMB 3LEFA 4LMVA 3A5IA 5A4VA 2M72A 5JCUA 1XCCA 1V57A 2RIIA 3M8NA 1SL2B 5KN1A 3R2QA 4HDEA 1K0DA 1VF1A 5DJLA 2OE1A 3O3TA 3DIEA 2GSRA 3QMXA 4MJCA 1PMTA 2DJJA 5D9VA 2WJUA 2GZYA 3TRXA 1GNWA 4BVXA 4KCAA 2H6ZA 5IMAA 1UC7A 5D93A 2ZNMA 1V58A 1TKDB 6GSVA 4MH2A 5G31A 1BQ7A 1M2DA 3G7JA 4XS4B 3EC3A 1A8LA 3PINA 3DGQA 2P5QA 4MF5A 3KTBA 2DKIA 4DEJA 2H66A 5D9WA 5DAKA 4EIQA 2E2GA 4YAVA 2VIMA 3ZVJD 1PRXA 3WT2A 1OAZA 5ECPB 4MZCA 4GCIA 4N30A 2K6VA 1GSEA 1GUHA 4PUAA 2V6KA 5HR3A 1RK4A 1BEDA 4RQXA 3KP8A 3HD5A 1R5PA 2O85A 2YWOA 3TOTA 1KEBA 3S9FA 4HJMA 4PQ1A 5JCGA 1ZZYA 1J08A 3GX0A 3HVVA 4EE0A 1JLWA 4GSNA 4ZB9A 3UEMA 2IMDA 3DEXA 3QAGA 2FY6A 4HQZA 1U3AA 4BWQA 3LQ7A 3D0ZA 4O5UA 1MDJA 3GA4A 3GL5A 2KP2A 3O76A 3A3TA 2EIQA 2DJKA 1E2YA 1SYXA 4PUFC 1TK8B 2H6YA 2VM1A 5DALB 3M9KA 3TGZA 2C1YA 2CVBA 4HZ2A 1F9MA 4O5QA 1HNCA 1SU9A 1FB0A 1SJZA 3HVXA 5ECSA 2YWIA 4TW5A 3C1RA 2H73A 1A24A 5CRGA 4TR4A 4HU7A 4MDCA 5ECLB 1VGLA 2JU5A 1EOGA 2VCTA 3G7YA 3WT1A 2LNSA 2HYXA 1SD9A 2GVPA 1T3BA 4ISDA 3DYRA 4K7OA 2Z9SA 2EC4A 3FEUA 2A2SA 2JADA 1H75A 4DSSA 2XPDA 5HFKA 1KNGA 3H8QA 4IKHA 1M9AA 2CVDA 4MLYA 3RHCA 4OFMA 4K0NA 5C00A 1Q98A 2FUG2 2VCQA 3H79A 1MD4A 2JZTA 1QMVA 2G0FA 4MPGA 5ELAA 2KP1A 1DBYA 3EMPA 2YZUA 3GSTA 4HZ4A 5JCWA 1USBA 1M99A 1F2EA 1AXDA 1X0RA 2RUEA 3HCZA 4I97A 5D9TA 4V2LA 19GSA 3CSJA 1M7TA 1RQMA 2CQ9A 1TXXA 3MNGA 5D73A 4LA1A 6GSYA 3CXGA 1PX6A 1XPVA 4RI6A 1TW9A 5CRHA 2C80A 2DC5A 5DBQA 1OKTA 2DJ0A 5A4UA 1QUWA 1SL1B 1A8YA 4CDOA 2DBCA 2V2GA 4TR1A 3BCIA 4GLTA 2MMAA 2LNTA 2JACA 4CHSA 3IV4A 1G0TA 4MZBA 2V6OA 2FA4A 3HZ8A 3APQA 5H5RA 2HRFA 2HFDA 5CAXA 5IQYA 2C3TA 2FNOA 2JSZA 2FWEA 3DMLA 4OCEA 3F6DA 4BL7A 1XBSA 4WEYA 4KDXA 4CY6A 2OBKA 3IE3A 3WGEA 2A4VA 5B6NA 1EGRA 3LXZA 3SBCA 5ECKB 3GYKA 2YCDA 1IYHA 1XFLA 1GL8A 3R3EA 3TKPA 3D6IA 3ZLPA 2HZFA 3QR6A 3VPTA 3UBLA 5B8BA 3WGXA 5FWGA 2HE3A 4L5LA 1Q4JA 2P31A 4IW9A 3ZVJA 4DVCA 1BX9A 4EDYA 2LV3A 4MABA 3IHGA 5DDLA 3GKKA 2M46A 2DKHA 4F2IA 2HNLA 3ZREA 3CBUA 5AN1A 1GTIA 5LD0A 1K0OA 1YF0A 3TKRA 5BMUA 2HZEA 4JBBA 2L4CA 3Q6OA 3I43A 1DE1A 2O87A 4WBJA 3QAWA 2KUCA 2PVOC 1X5EA 3ME7A 1Y25A 4ML6A 2UZ8A 3ZMLA 5ID2B 3TKSC 3D5JA 3M1GA 2DSAA 4EIPA 2H1GA 3FYGA 5DVBA 5JWQB 1ZYQB 1V9WA 2YNXA 1OE7A 1XZOA 5LCZA 2PN8A 1ERUA 5CNWA 4ECCA 1EV9A 1LBKA 2H72A 1XOBA 4OFNA 4IBPA 1B9XC 4K2DA 1ST9A 4I8BA 1GUMA 4K1FA 4ILFA 1S3DA 1TRWA 4KA0A 4KDYA 2R0CA 1YF1A 2LJRA 4USSA 2O8VB 3G7IA 5A5KA 1E6BA 3LG6A 1GLPA 12GSA 2J23A 3P90A 1UN2A 4QQ7A 1MDIA 2FGXA 1MTCA 1V40A 2VLUA 5G30A 2GT6A 3AY8A 2VL3A 1OVNA 1V2AA 2IIYA 4DSQA 2AJQB 3HJOA 1XW5A 3EMXA 1R26A 3L9VA 4Z7XA 3BBYA 4D73A 3QPMA 1X5CA 1Z5YE 2H1DA 3WD6A 1GRXA 4X43A 3HDCA 1JZDA 5IMVA 3GFKA 1A2MA 1B48A 3RDWA 3GIXA 4RUVA 1YDKA 4MA9A 2F8AA 1JLVA 1ZOFA 3GTUA 1EZKA 2E2MA 1BAYA 2BJXA 5EPFA 1R4WA 5BRTA 3V1WA 5A4WA 3VWXA 2L5OA 3ZYWA 4MF7A 3KCMA 1AIUA 2GZZA 1FG4A 2VCVA 4Q5RA 1GSQA 1PKZA 4EC0A 4IQ1A 4FYCA 1NW2A 3NOFA 3NZNA 1QQ2A 1GSYA 2QKEA 5KOWA 4G0LA 4N11A 3GN3A 1SENA 2GLRA 3IR4A 3KMNA 2WRTA 3PPUA 2R3XA 2H0IA 5HFGA 3J7Yk 3H93A 3D4MA 4CY8A 1SJIA 2LRCA 2VD1A 4POLA 1DE2A 3M9JA 2P0GA 5F0GA 2WDUA 2X99A 1O7UA 2QA1A 4V2NA 4ICYA 3L78A 2DJ3A 4POKA 3EURA 2JL4A 3I6AA 4IP6A 2KOKA 2A2RA 3IBHA 2NVLA 8GSSA 3GURA 5G5EA 2MMNA 22GSA 2PWJA 1T4ZA 4BPYA 2O7KA 2C8UA 1GWCA 5E4WA 3NIVA 1Z7RA 2VO4A 4K7NA 3HHVA 3F3QA 3MYDA 1THOA 1A0RP 4K0GA 1DSBA 2R0PA 1OC9B 1U6TA 4YQVA 3ZFLA 1A2LA 1XW6A 2DJ1A 3OR5A 2LQQA 2XBIA 1C72A 1SKRB 1K0MA 1GNEA 3MAKA 2E7PA 2IMKA 2DJ2A 5J9CA 1TP9A 2GQMA 1GTUA 4KH7A 4GQCA 2DIZA 1PX7A 5CRDA 2J9HA 3EPTA 2VM2A 3KZQA 3ZMKA 5G5FA 1QK8A 3CYNA 4K5RA 5ECNB 2L6CA 1ML6A 3L9UA 3C8EA 3GHAA 1FW1A 3ZZXA 3CSHA 4Z2UA 2TIRA 4NV5A 1YEXA 4O7HA 4TOPA 2H70A 1NHOA 2WCIA 4L8EA 2WB9A 1UA5A 1ZYNA 2NDOA 2VL2C 1ZL9A 3IC8A 2H30A 1Z6MA 2IJYA 4ECIA 3F8UA 2F8FA 4MJAA 1NHYA 2R4VA 5AIVA 4ZIJA 4FH8A 5CO3A 1PN9A 3VFIA 4NMUA 4TN8A 3A2WA 5IMDA 4HQSA 3RHBA 2RM6A 4KE3A 5IMZA 3WGDA 4G0IA 5JWRB 2YWMA 5B6MA 2YPMA 1SKWB 2CA8A 2OACA 4ZBBA 4E8HA 3LJRA 4RI7A 3FMWA 1F6MC 3CTFA 5IMFA 1U3IA 1OKDA 4IELA 1SKSB 3MIXA 4F0BA 1CQGA 2MBTA 1FOHA 3TKQA 3CTGA 3A2VA 2R5GA 1AAZA 1R7HA 2QC7A 2FLSA 2GSTA 2K9FA 1F3AA 2DIYA 2ZCTA 1GSFA 1ON4A 1GSDA 3KM6A 3ZIVA 5IO2A 1PD21 1O73A 1Z9HA 2FWFA 3KJYA 4NXIA 4ZXGA 4PNFA 5HR0A 1FHEA 1XXUA 4WR5A 3EVIA 4BA7A 4PQHA 3HVSA 4AJ8A 1GTBA 3KH7A 5ABRA 5IPGA 2YOIA 18GSA 2IFQB 4F03A 2IPAA 1F37A 3UARA 5ELGA 4POBA 4YAPA 5ECIB 4FQUA 3QAVA 1XWKA 1PA3A 3UOMA 3DKSA 1PL1A 4TXVA 2LEGA 3LFLA 1MDKA 2HRKA 2OE3A 3HY2A 1ZYEA 1ERWA 2AHEA 2VLTA 5EY6A 2YJHA 3MSZA 1SK2A 4KDUA 5IIZA 5CREA 1I9DA 3W8JA 3Q18A 4DSRA 2LKUA 1XWAA 4OMVA 3K8NA 1EV4A 2H76A 1M2BA 3QFBC 16GSA 4ZBDA 3FY7A 4TXOB 2RUFA 2E0QA 2EIRA 3DD3A 4N0VA 1SL0B 1VF3A 2C4JA 4KX4A 5IOWA 2I1UA 4XTSA 1URMA 2PU9C 4ZL8A 3TOUA 3IXRA 3VK9A 3BD2A 3P7XA 4MH3A 4BVXB 4XCSA 2GQKA 2AB6A 4F0CA 1XWGA 3KMOA 5IMCA 3LGCA 3GUSA 2R37A 4G0KA 3KTLA 1A2JA 5IPHA 3GH6A 3UBKA 3TDGA 1WIKA 3PH9A 3US3A 4RQRA 4LL4B 3ERGA 1OC8A 2H8LA 3F9UA 4MMMA 1AQVA 4L5OA 3IDVA 3FZ4A 5DAKB 3JCML 3P8WA 5DCHA 1AC1A 1B9YC 1DUGA 1EP8A 2L57A 4Q5FA 4GF0A 4ZB8A 2XC2A 3J7Yb 1I5GA 2LTKA 7GSSA 4GXZA 3VWWA 3IPZA 3FR6A 1UVZA 2H19A 2HRNA 3GKNA 3UMAA 3GMFA 4GRFA 2NPBA 2CVKA 1G6YA 1M9BA 2LUSA 1WP0A 3ME8A 2N5FA 4IP1A 4OO4A 1PQNA 2HSYA 2HSHA 1U88A 5INYA 2PPTA 2XBQA 1H4OA 2H0GA 1T7PB 1XOAA 2K8VA 3TRPA 3VLNA 3KEBA 2I81A 3FZ5A 2NBSA 3LSZA 4NWYA 3DRNA 4J57E 3LXTA 2B5YA 4WBRD 4XRAA 2GDRA 2H0HA 2PUKC 1K0AA 1HQOA 4EO3A 2H71A 3D21A 2F9SA 4J2FA 2L4QA 2YANA 4GTUA 4IS0A 3GNJA 1FVJA 4V2MA 3F4SA 4TVEA 2WFCA 1S3AA 5HFIA 5HR1A 4PX1A 2H1AA 3DXBA 3RPPA 1SK0A 3GV1A 1GH2A 1YZXA 4DSSB 5F8BA 6GSUA 2R6KA 4ACSA 1GLQA 4ML1A 5G1LA 1YQ1A 1X5DA 2H1BA 3HYPA 4LLRA 2H01A 3I9V2 2NTOA 2H75A 1G6WA 3Q19A 3W6GA 3APSA 1XVQA 2RM5A 1OE8A 5AIXA 4PNGA 3KGKA 3CSIA 1AW9A 3GH9A 3EE2A 4X1UA 5AISA 5EVOA 4XS4A 2WZ9A 1TDIA 2WGRA 2YP6A 4MPFA 4EF0A 4G19A 4PQIA 1SJ6A 3PGTA 5F05A 3F4RA 3N9JA 2CX3A 1XWCA 2F3MA 4GSTA 2LS5A 2I3YA 2IMIA 1FAAA 1WMJA 1ILOA 4HOJA 3BJ5A 2IMEA 1S3CA 3FHKA 4MNNA 5KN3A 1Y6EA 3ISOA 4ID0A 3F63A 3Q74A 3TJBA 3HJMA 4Z2RA 3UVHA 4HJ2A 1ABAA 3TKSA 3TRQA 3ZFBA 1G7EA 4KUNA 3DVXA 2X8GA 1YJ6A 3L4NA 2R0GA 2AV4A 1A23A 2KHPA 2OADA 4K9ZA 3WYWA 1IYIA 5GSSA 4JRRA 2R2JA 6GSXA 3G9BA 1X9MB 5JWOB 2DMMA 3HKRA 4BVYB 3KIJA 3MWHA 3ED3A 4X0XA 1YKAA 4EXJA 4L0UA 3KXOA 6GSSA 3GKMA 5CYYA 2X8CA 5DALA 2HSMA 3PR8A 4NAXA 4IHUA 1PN0A 4G10A 3ZTLA 3D4TA 3GRXA 1TI1A 3C1SA 3EU4A 1TRVA 2C0EA 4V1Ap 1VF2A 1WOUA 4O32A 2GS3A 1MD3A 2WS2A 2IN3A 2V32A 3QD9A 4K7IA 1Z3EA 1ERVA 4TR0A 1SYRA 3TCOA 4ZBAA 2LJKA 4O5RA 1O8XA 5C04A 1LJRA 14GSA 4QL9A 4POMA 2VOCA 4Z2TA 1HNBA 1JZRA 1EWXA 1TJDA 3TKSE 4WF4A 5ECHB 4KF9A 5L71A 1GP1A 4PTSA 3RPNA 4NPBA 3I69A 4MF6A 5GSTA 1KBNA 4AJ7A 3VI7A 1AQWA 1FO5A 2QSIA 3ZL5A 1PKWA 3MDKA 3C7MA 1GUKA 4KW6A 4HI7A 1JFUA 3UVTA 4NV2A 2B7JA 3O6TA 4TXOA 2CZ3A 5J41A 5DQYA 4WKWA 1HYUA 1TRUA 3VPQA 5ECOB 3H1NA 4N10A 5ECQB 4O92A 1TK5B 3FZAA 1K3LA 1AUCA 2H6XA 1K0NA 2YV7A 1ZGNA 4QL7A 2TRXA 1EGOA 3VURA 1GULA 2CX4A 2GSSA 1QXHA 3U6VA 3IAM2 2EIOA 2VUPA 2F51A 6GSTA 4K5SA 2MMOA 5KOXA 2B6MA 4EL1A 4FO5A 2LRNA 4GSSA 5J5NA 1GSUA 11GSA 3LORA 2ES7A 2C0DA 4MP4A 2RLIA 4D73B 4G2EA 3LWAA 1K3YA 4OWYA 4FYBA 4IN0A 1B4PA 1Z6NA 3GSSA 3CMIA 2ON5A 3H4KA 1YY7A 4OO5A 3LW9A 3TB2A 3W8SA 3GTUB 3L0HA 3UAPA 2VAFA 4JZQA 3FR9A 5D9XA 5ECRB 2I4AA 2FA8A 1B8XA 1A0FA 1THXA 1M0UA 2IMFA 2C0FA 2L5LA 1EEMA 1BJXA 3ZRDA 1FB6A 4XIHA 2C0GA 2LSTA 3BOAA 1T00A 2FWGA 4EUYA 2P5RA 2YV9A 5D96A 4YQUA 1SK1A 2REMA 5E59A 3QCPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OBI A;  2FD3 A;  2FWH A;  4TKY A;  1FOV A;  4K6X A;  4KGI A;  4ZL9 A;  4JED A;  5G1K A;  4H86 A;  1XIY A;  4WXT A;  1R5A A;  1ERT A;  3M0F A;  1K0B A;  1KTE A;  4PUR A;  4HUA A;  2C3N A;  2OKA A;  5IM9 A;  5B7C A;  5GAP D;  2O89 A;  2KLX A;  4F9Z A;  3EU3 A;  4KAE A;  4CW9 A;  1M2A A;  3TJJ A;  2LRT A;  10GS A;  5H5S A;  5FT3 A;  5ID2 A;  3EWL A;  2VL2 A;  4IGJ A;  1ZMA A;  2HT9 A;  2H74 A;  4PXO A;  4WF5 A;  3GL3 A;  3DWV A;  5KN0 A;  1EP7 A;  2V41 A;  1WJK A;  4NHW A;  3FKF A;  2GTU A;  2K8S A;  1WE0 A;  4MJB A;  2GGT A;  4LL1 B;  5DJM A;  1T8E B;  5D8I A;  1PL2 A;  4HS1 A;  2VL9 A;  2VCX A;  2LQO A;  3A5W A;  5ENU A;  2IL3 A;  2OA7 A;  2YJ7 A;  1GTA A;  4BWS A;  9GSS A;  1QFN A;  2GZP A;  3E9J B;  1NM3 A;  4L0W A;  5IO0 A;  3ERW A;  3KP9 A;  1LU4 A;  2MMZ A;  4KSM A;  4IJ3 A;  4IVF A;  2XHF A;  4MCU A;  5COH A;  2PMT A;  4I2T A;  3KH9 A;  4E8E A;  4WR4 A;  6GSW A;  1J0F A;  1NSW A;  2LJA A;  3LYK A;  2CV4 A;  5DQS A;  2ON7 A;  4P3Y B;  17GS A;  1QGV A;  1YKC A;  1OYJ A;  1W4V A;  2CAI A;  4V1A g;  1MEK A;  1O81 A;  5F07 A;  1G7O A;  1JZO A;  3APO A;  4KND A;  2MZC A;  2TRC P;  2VD0 A;  2CAQ A;  5J4U A;  5J9B A;  1B4Q A;  4YQM A;  1YEP A;  5EL8 A;  2QGV A;  3CRU A;  3ERF A;  1RW1 A;  2AAW A;  4XHM A;  1V98 A;  4XRD A;  1XW9 A;  1X9S B;  4OFT A;  1EOH A;  4AGS A;  5J3R A;  2HLS A;  4BVY A;  2ALB A;  1TI3 A;  3C73 A;  3N5O A;  4EVM A;  5F06 A;  1BYE A;  2V1M A;  2ZUP A;  3QDN A;  5B8A A;  5IOX A;  3IHQ A;  1OC3 A;  2B3S A;  1TTZ A;  4YH2 A;  1ZCP A;  2JZS A;  2MBS A;  4J56 E;  3TJG A;  3P2A A;  3EYT A;  1F3B A;  3UJ1 A;  3C71 A;  1TRS A;  1O85 A;  3E3E A;  4TR3 A;  1PSQ A;  3F4T A;  2GSQ A;  2BMX A;  2GQL A;  2JSY A;  4JR4 A;  1K3O A;  1SD8 A;  4GWR A;  1TU7 A;  1XVW A;  4N0Z A;  3VWU A;  3FZ9 A;  2DLX A;  20GS A;  4FYU A;  4KCE A;  1GSS A;  1HNA A;  3A2X A;  1W89 A;  2CT6 A;  5GAN D;  4ZL7 A;  5KN2 A;  2GT5 A;  3U5R E;  2FHE A;  4EDZ A;  1WWJ A;  2X64 A;  4IJI A;  1OC9 A;  2B1L A;  2M80 A;  1O6J A;  4ZB6 A;  3HZ4 A;  1TK0 B;  1PGT A;  3EIN A;  2PBJ A;  4XS6 A;  2YZH A;  3HJP A;  3TUE A;  2N5B A;  1ACV A;  3QFA C;  4MZW A;  4I2U A;  2B7K A;  4KB3 A;  3IAS 2;  4I5Q A;  4K8M A;  2WUL A;  4LMW A;  1O8W A;  4FIW A;  5HR2 A;  2FCH A;  3FW2 A;  1EEJ A;  1TOF A;  4Q5Q A;  1J9B A;  13GS A;  1N8J A;  3IA1 A;  4GQF A;  3M3M A;  2G2Q A;  3DVW A;  3VI5 A;  3FRC A;  1JHB A;  3ZIT A;  3F3R A;  1VF4 A;  1WPI A;  5AGY A;  1U87 A;  1T4Y A;  4PGT A;  1K0C A;  1X9W B;  4TR1 B;  3IOS A;  3GKX A;  4EKZ A;  3E0U A;  2VLV A;  3CRT A;  2B1K A;  4Q5N A;  3VWV A;  2D2Z A;  1VRS D;  5HQP A;  2OJL A;  2PGT A;  2XPE A;  2DML A;  4MK3 A;  2PER A;  5CP1 A;  4HEA 2;  2AYT A;  3QOU A;  2PVQ A;  2K18 A;  2YWN A;  1JZW A;  1Z7P A;  4I6X A;  5DCG A;  1CQH A;  2I9H A;  3BCK A;  1TU8 A;  4XS1 A;  5GZZ B;  3SWL A;  3GX8 A;  2VCZ A;  2B5E A;  3IC4 A;  5H5Q A;  2L59 A;  2N5A A;  3D22 A;  3KD0 A;  3F6F A;  2L6D A;  2YN1 A;  4OCF A;  3LYP A;  5G2Z A;  1N2A A;  1FVK A;  2MYG A;  2HXK A;  3F0I A;  2IWT A;  3UIW A;  4ECJ A;  3HA9 A;  4MJE A;  2OE0 A;  4ECB A;  5FHI A;  3ZIJ A;  3HXS A;  3TJF A;  4JE1 A;  4ULX A;  2IFQ A;  5LNK e;  2CZ2 A;  5CRW A;  2HI7 A;  2C3Q A;  1HD2 A;  3IK7 A;  3FR3 A;  4G9H A;  3L9S A;  3TJK A;  2HZE B;  3IK9 A;  1XWB A;  4KSO A;  4JR6 A;  3IRA A;  4AJ6 A;  2AUV A;  3RBT A;  4ZIL A;  2BTO T;  2B5X A;  4OD7 A;  3UL3 A;  4TRX A;  4F82 A;  2VCW A;  2X8H A;  1AQX A;  4IQA A;  1T1V A;  4JU5 A;  4AF2 A;  5KEJ A;  1WRY A;  1BG5 A;  4HU9 A;  2JZR A;  4NHZ A;  4WET A;  3FK8 A;  3RAZ A;  5ECM B;  3LEF A;  4LMV A;  5A4V A;  2M72 A;  5JCU A;  1XCC A;  1V57 A;  2RII A;  3M8N A;  1SL2 B;  5KN1 A;  3R2Q A;  4HDE A;  1K0D A;  1VF1 A;  5DJL A;  2OE1 A;  3O3T A;  3DIE A;  2GSR A;  3QMX A;  4MJC A;  1PMT A;  5D9V A;  2DJJ A;  2WJU A;  2GZY A;  3TRX A;  1GNW A;  4BVX A;  4KCA A;  2H6Z A;  5IMA A;  1UC7 A;  5D93 A;  2ZNM A;  1V58 A;  1TKD B;  6GSV A;  4MH2 A;  5G31 A;  1BQ7 A;  1M2D A;  3G7J A;  4XS4 B;  3EC3 A;  1A8L A;  3PIN A;  3DGQ A;  2P5Q A;  4MF5 A;  3KTB A;  4DEJ A;  2H66 A;  5D9W A;  5DAK A;  2E2G A;  4YAV A;  2VIM A;  3ZVJ D;  1PRX A;  3WT2 A;  1OAZ A;  5ECP B;  4MZC A;  4GCI A;  4N30 A;  2K6V A;  1GSE A;  1GUH A;  4PUA A;  2V6K A;  5HR3 A;  1RK4 A;  1BED A;  4RQX A;  3KP8 A;  3HD5 A;  1R5P A;  2O85 A;  2YWO A;  3TOT A;  1KEB A;  3S9F A;  4HJM A;  4PQ1 A;  5JCG A;  1ZZY A;  1J08 A;  3GX0 A;  3HVV A;  4EE0 A;  1JLW A;  4GSN A;  4ZB9 A;  3UEM A;  2IMD A;  3DEX A;  3QAG A;  2FY6 A;  4HQZ A;  1U3A A;  4BWQ A;  3LQ7 A;  3D0Z A;  1MDJ A;  3GA4 A;  3GL5 A;  2KP2 A;  3O76 A;  3A3T A;  2EIQ A;  2DJK A;  1E2Y A;  1SYX A;  4PUF C;  1TK8 B;  2H6Y A;  2VM1 A;  5DAL B;  3M9K A;  3TGZ A;  2C1Y A;  2CVB A;  4HZ2 A;  1F9M A;  1HNC A;  1SU9 A;  1FB0 A;  1SJZ A;  3HVX A;  5ECS A;  2YWI A;  4TW5 A;  3C1R A;  2H73 A;  1A24 A;  5CRG A;  4TR4 A;  4HU7 A;  4MDC A;  5ECL B;  1VGL A;  2JU5 A;  1EOG A;  2VCT A;  3G7Y A;  3WT1 A;  2LNS A;  2HYX A;  1SD9 A;  2GVP A;  1T3B A;  4ISD A;  3DYR A;  4K7O A;  2Z9S A;  2EC4 A;  3FEU A;  2A2S A;  2JAD A;  1H75 A;  4DSS A;  2XPD A;  5HFK A;  1KNG A;  3H8Q A;  4IKH A;  1M9A A;  2CVD A;  4MLY A;  3RHC A;  4OFM A;  4K0N A;  5C00 A;  1Q98 A;  2FUG 2;  2VCQ A;  3H79 A;  1MD4 A;  2JZT A;  1QMV A;  2G0F A;  4MPG A;  5ELA A;  2KP1 A;  1DBY A;  3EMP A;  2YZU A;  3GST A;  4HZ4 A;  5JCW A;  1USB A;  1M99 A;  1F2E A;  1AXD A;  1X0R A;  2RUE A;  3HCZ A;  4I97 A;  5D9T A;  4V2L A;  19GS A;  3CSJ A;  1M7T A;  1RQM A;  2CQ9 A;  1TXX A;  3MNG A;  5D73 A;  4LA1 A;  6GSY A;  3CXG A;  1PX6 A;  1XPV A;  4RI6 A;  1TW9 A;  5CRH A;  2C80 A;  2DC5 A;  5DBQ A;  1OKT A;  2DJ0 A;  5A4U A;  1QUW A;  1SL1 B;  1A8Y A;  4CDO A;  2DBC A;  2V2G A;  4TR1 A;  3BCI A;  4GLT A;  2MMA A;  2LNT A;  2JAC A;  4CHS A;  3IV4 A;  1G0T A;  4MZB A;  2V6O A;  2FA4 A;  3HZ8 A;  3APQ A;  5H5R A;  2HRF A;  2HFD A;  5CAX A;  5IQY A;  2C3T A;  2FNO A;  2JSZ A;  2FWE A;  3DML A;  4OCE A;  3F6D A;  4BL7 A;  1XBS A;  4WEY A;  4KDX A;  2OBK A;  3IE3 A;  3WGE A;  2A4V A;  5B6N A;  1EGR A;  3LXZ A;  3SBC A;  5ECK B;  3GYK A;  2YCD A;  1IYH A;  1XFL A;  1GL8 A;  3TKP A;  3D6I A;  3ZLP A;  2HZF A;  3QR6 A;  3VPT A;  3UBL A;  5B8B A;  3WGX A;  5FWG A;  2HE3 A;  4L5L A;  1Q4J A;  2P31 A;  4IW9 A;  3ZVJ A;  4DVC A;  1BX9 A;  4EDY A;  2LV3 A;  4MAB A;  5DDL A;  3GKK A;  2M46 A;  4F2I A;  2HNL A;  3ZRE A;  3CBU A;  5AN1 A;  1GTI A;  5LD0 A;  1K0O A;  1YF0 A;  3TKR A;  2HZE A;  4JBB A;  2L4C A;  3Q6O A;  3I43 A;  1DE1 A;  2O87 A;  4WBJ A;  3QAW A;  2KUC A;  2PVO C;  1X5E A;  3ME7 A;  1Y25 A;  4ML6 A;  3ZML A;  5ID2 B;  3TKS C;  3D5J A;  3M1G A;  2DSA A;  2H1G A;  3FYG A;  5DVB A;  5JWQ B;  1ZYQ B;  1V9W A;  2YNX A;  1OE7 A;  1XZO A;  5LCZ A;  2PN8 A;  1ERU A;  5CNW A;  4ECC A;  1EV9 A;  1LBK A;  2H72 A;  1XOB A;  4OFN A;  4IBP A;  1B9X C;  4K2D A;  1ST9 A;  4I8B A;  1GUM A;  4K1F A;  4ILF A;  1S3D A;  1TRW A;  4KA0 A;  4KDY A;  1YF1 A;  2LJR A;  2O8V B;  3G7I A;  5A5K A;  1E6B A;  3LG6 A;  1GLP A;  12GS A;  2J23 A;  3P90 A;  1UN2 A;  4QQ7 A;  1MDI A;  2FGX A;  1MTC A;  1V40 A;  2VLU A;  5G30 A;  2GT6 A;  3AY8 A;  2VL3 A;  1OVN A;  1V2A A;  2IIY A;  4DSQ A;  2AJQ B;  3HJO A;  1XW5 A;  3EMX A;  1R26 A;  3L9V A;  4Z7X A;  3BBY A;  4D73 A;  3QPM A;  1X5C A;  1Z5Y E;  2H1D A;  3WD6 A;  1GRX A;  4X43 A;  3HDC A;  1JZD A;  5IMV A;  3GFK A;  1A2M A;  1B48 A;  3RDW A;  3GIX A;  4RUV A;  1YDK A;  4MA9 A;  2F8A A;  1JLV A;  1ZOF A;  3GTU A;  1EZK A;  2E2M A;  1BAY A;  2BJX A;  5EPF A;  1R4W A;  3V1W A;  5A4W A;  3VWX A;  2L5O A;  3ZYW A;  4MF7 A;  3KCM A;  1AIU A;  2GZZ A;  1FG4 A;  2VCV A;  4Q5R A;  1GSQ A;  1PKZ A;  4EC0 A;  4IQ1 A;  4FYC A;  1NW2 A;  3NOF A;  3NZN A;  1QQ2 A;  1GSY A;  2QKE A;  4N11 A;  3GN3 A;  1SEN A;  2GLR A;  3IR4 A;  3KMN A;  2WRT A;  2R3X A;  2H0I A;  5HFG A;  3J7Y k;  3H93 A;  3D4M A;  1SJI A;  2LRC A;  2VD1 A;  4POL A;  1DE2 A;  3M9J A;  2P0G A;  5F0G A;  2WDU A;  2X99 A;  1O7U A;  4V2N A;  3L78 A;  2DJ3 A;  4POK A;  3EUR A;  2JL4 A;  3I6A A;  4IP6 A;  2KOK A;  2A2R A;  3IBH A;  2NVL A;  8GSS A;  3GUR A;  5G5E A;  2MMN A;  22GS A;  2PWJ A;  1T4Z A;  4BPY A;  2O7K A;  2C8U A;  1GWC A;  5E4W A;  3NIV A;  1Z7R A;  2VO4 A;  4K7N A;  3HHV A;  3F3Q A;  1THO A;  1A0R P;  4K0G A;  1DSB A;  1OC9 B;  1U6T A;  4YQV A;  3ZFL A;  1A2L A;  1XW6 A;  2DJ1 A;  3OR5 A;  2LQQ A;  2XBI A;  1C72 A;  1SKR B;  1K0M A;  1GNE A;  3MAK A;  2E7P A;  2IMK A;  2DJ2 A;  5J9C A;  1TP9 A;  2GQM A;  1GTU A;  4KH7 A;  4GQC A;  2DIZ A;  1PX7 A;  5CRD A;  2J9H A;  2VM2 A;  3KZQ A;  3ZMK A;  5G5F A;  1QK8 A;  3CYN A;  5ECN B;  2L6C A;  1ML6 A;  3L9U A;  3C8E A;  3GHA A;  1FW1 A;  3ZZX A;  3CSH A;  2TIR A;  4NV5 A;  1YEX A;  4O7H A;  4TOP A;  2H70 A;  1NHO A;  2WCI A;  4L8E A;  2WB9 A;  1UA5 A;  2NDO A;  2VL2 C;  1ZL9 A;  2H30 A;  1Z6M A;  2IJY A;  4ECI A;  3F8U A;  2F8F A;  4MJA A;  1NHY A;  2R4V A;  5AIV A;  4ZIJ A;  4FH8 A;  5CO3 A;  1PN9 A;  3VFI A;  4NMU A;  4TN8 A;  3A2W A;  5IMD A;  4HQS A;  3RHB A;  2RM6 A;  4KE3 A;  5IMZ A;  3WGD A;  5JWR B;  2YWM A;  5B6M A;  2YPM A;  1SKW B;  2CA8 A;  2OAC A;  4ZBB A;  4E8H A;  3LJR A;  4RI7 A;  1F6M C;  3CTF A;  5IMF A;  1U3I A;  1OKD A;  4IEL A;  1SKS B;  4F0B A;  1CQG A;  2MBT A;  3TKQ A;  3CTG A;  3A2V A;  2R5G A;  1AAZ A;  1R7H A;  2QC7 A;  2FLS A;  2GST A;  2K9F A;  1F3A A;  2DIY A;  2ZCT A;  1GSF A;  1ON4 A;  1GSD A;  3KM6 A;  3ZIV A;  5IO2 A;  1PD2 1;  1O73 A;  1Z9H A;  2FWF A;  3KJY A;  4NXI A;  4ZXG A;  4PNF A;  5HR0 A;  1FHE A;  1XXU A;  4WR5 A;  3EVI A;  4BA7 A;  4PQH A;  3HVS A;  4AJ8 A;  1GTB A;  3KH7 A;  5ABR A;  5IPG A;  2YOI A;  18GS A;  2IFQ B;  4F03 A;  2IPA A;  1F37 A;  3UAR A;  5ELG A;  4POB A;  4YAP A;  5ECI B;  3QAV A;  1XWK A;  1PA3 A;  3UOM A;  3DKS A;  1PL1 A;  4TXV A;  2LEG A;  3LFL A;  1MDK A;  2OE3 A;  3HY2 A;  1ZYE A;  1ERW A;  2AHE A;  2VLT A;  5EY6 A;  2YJH A;  3MSZ A;  1SK2 A;  4KDU A;  5IIZ A;  5CRE A;  1I9D A;  3W8J A;  3Q18 A;  4DSR A;  2LKU A;  1XWA A;  4OMV A;  3K8N A;  1EV4 A;  2H76 A;  1M2B A;  3QFB C;  16GS A;  4ZBD A;  3FY7 A;  4TXO B;  2RUF A;  2E0Q A;  2EIR A;  3DD3 A;  4N0V A;  1SL0 B;  1VF3 A;  2C4J A;  4KX4 A;  5IOW A;  2I1U A;  4XTS A;  1URM A;  2PU9 C;  4ZL8 A;  3TOU A;  3IXR A;  3VK9 A;  3BD2 A;  3P7X A;  4MH3 A;  4XCS A;  2GQK A;  2AB6 A;  4F0C A;  1XWG A;  3KMO A;  5IMC A;  3LGC A;  3GUS A;  2R37 A;  3KTL A;  1A2J A;  5IPH A;  3GH6 A;  3UBK A;  3TDG A;  1WIK A;  3PH9 A;  3US3 A;  4RQR A;  4LL4 B;  3ERG A;  1OC8 A;  2H8L A;  3F9U A;  4MMM A;  1AQV A;  4L5O A;  3IDV A;  3FZ4 A;  5DAK B;  3JCM L;  5DCH A;  3P8W A;  1AC1 A;  1B9Y C;  1DUG A;  1EP8 A;  2L57 A;  4Q5F A;  4GF0 A;  4ZB8 A;  2XC2 A;  3J7Y b;  1I5G A;  2LTK A;  7GSS A;  4GXZ A;  3VWW A;  3IPZ A;  3FR6 A;  1UVZ A;  2H19 A;  2HRN A;  3GKN A;  3UMA A;  3GMF A;  4GRF A;  2NPB A;  2CVK A;  1G6Y A;  1M9B A;  2LUS A;  1WP0 A;  3ME8 A;  2N5F A;  4IP1 A;  4OO4 A;  1PQN A;  2HSY A;  2HSH A;  1U88 A;  5INY A;  2PPT A;  2XBQ A;  1H4O A;  2H0G A;  1T7P B;  1XOA A;  2K8V A;  3TRP A;  3VLN A;  3KEB A;  2I81 A;  3FZ5 A;  2NBS A;  3LSZ A;  4NWY A;  3DRN A;  4J57 E;  3LXT A;  2B5Y A;  4WBR D;  4XRA A;  2GDR A;  2H0H A;  2PUK C;  1K0A A;  1HQO A;  4EO3 A;  2H71 A;  3D21 A;  2F9S A;  4J2F A;  2L4Q A;  2YAN A;  4GTU A;  4IS0 A;  3GNJ A;  1FVJ A;  4V2M A;  3F4S A;  4TVE A;  2WFC A;  1S3A A;  5HFI A;  5HR1 A;  4PX1 A;  2H1A A;  3DXB A;  3RPP A;  1SK0 A;  3GV1 A;  1GH2 A;  1YZX A;  4DSS B;  5F8B A;  6GSU A;  2R6K A;  4ACS A;  1GLQ A;  4ML1 A;  5G1L A;  1YQ1 A;  1X5D A;  2H1B A;  3HYP A;  4LLR A;  2H01 A;  3I9V 2;  2NTO A;  2H75 A;  1G6W A;  3Q19 A;  3W6G A;  3APS A;  1XVQ A;  2RM5 A;  1OE8 A;  5AIX A;  4PNG A;  3KGK A;  3CSI A;  1AW9 A;  3GH9 A;  3EE2 A;  4X1U A;  5AIS A;  5EVO A;  4XS4 A;  2WZ9 A;  1TDI A;  2WGR A;  2YP6 A;  4MPF A;  4EF0 A;  4G19 A;  4PQI A;  1SJ6 A;  3PGT A;  5F05 A;  3F4R A;  3N9J A;  2CX3 A;  1XWC A;  2F3M A;  4GST A;  2LS5 A;  2I3Y A;  2IMI A;  1FAA A;  1WMJ A;  1ILO A;  4HOJ A;  3BJ5 A;  2IME A;  1S3C A;  3FHK A;  5KN3 A;  1Y6E A;  3ISO A;  4ID0 A;  3F63 A;  3Q74 A;  3TJB A;  3HJM A;  3UVH A;  4HJ2 A;  1ABA A;  3TKS A;  3TRQ A;  3ZFB A;  1G7E A;  4KUN A;  3DVX A;  2X8G A;  1YJ6 A;  3L4N A;  2AV4 A;  1A23 A;  2KHP A;  2OAD A;  4K9Z A;  3WYW A;  1IYI A;  5GSS A;  4JRR A;  2R2J A;  6GSX A;  3G9B A;  1X9M B;  5JWO B;  2DMM A;  3HKR A;  3KIJ A;  3MWH A;  3ED3 A;  4X0X A;  1YKA A;  4EXJ A;  4L0U A;  3KXO A;  6GSS A;  3GKM A;  5CYY A;  2X8C A;  5DAL A;  3PR8 A;  4NAX A;  4IHU A;  4G10 A;  3ZTL A;  3D4T A;  3GRX A;  1TI1 A;  3C1S A;  3EU4 A;  1TRV A;  2C0E A;  4V1A p;  1VF2 A;  1WOU A;  4O32 A;  2GS3 A;  1MD3 A;  2WS2 A;  2IN3 A;  2V32 A;  3QD9 A;  4K7I A;  1Z3E A;  1ERV A;  4TR0 A;  1SYR A;  3TCO A;  4ZBA A;  2LJK A;  4O5R A;  1O8X A;  5C04 A;  1LJR A;  14GS A;  4QL9 A;  4POM A;  2VOC A;  1HNB A;  1JZR A;  1EWX A;  1TJD A;  3TKS E;  4WF4 A;  5ECH B;  5L71 A;  1GP1 A;  3RPN A;  4NPB A;  3I69 A;  4MF6 A;  5GST A;  1KBN A;  4AJ7 A;  3VI7 A;  1AQW A;  1FO5 A;  2QSI A;  3ZL5 A;  1PKW A;  3MDK A;  3C7M A;  1GUK A;  4KW6 A;  4HI7 A;  1JFU A;  3UVT A;  4NV2 A;  2B7J A;  3O6T A;  4TXO A;  2CZ3 A;  5J41 A;  5DQY A;  4WKW A;  1HYU A;  1TRU A;  3VPQ A;  5ECO B;  3H1N A;  4N10 A;  5ECQ B;  4O92 A;  1TK5 B;  3FZA A;  1K3L A;  1AUC A;  2H6X A;  1K0N A;  2YV7 A;  1ZGN A;  4QL7 A;  2TRX A;  1EGO A;  3VUR A;  1GUL A;  2CX4 A;  2GSS A;  1QXH A;  3U6V A;  3IAM 2;  2EIO A;  2VUP A;  2F51 A;  6GST A;  2MMO A;  2B6M A;  4EL1 A;  4FO5 A;  2LRN A;  4GSS A;  5J5N A;  1GSU A;  11GS A;  3LOR A;  2ES7 A;  2C0D A;  4MP4 A;  2RLI A;  4D73 B;  4G2E A;  3LWA A;  1K3Y A;  4OWY A;  4FYB A;  4IN0 A;  1B4P A;  1Z6N A;  3GSS A;  3CMI A;  2ON5 A;  3H4K A;  1YY7 A;  4OO5 A;  3TB2 A;  3W8S A;  3GTU B;  3L0H A;  3UAP A;  2VAF A;  4JZQ A;  3FR9 A;  5D9X A;  5ECR B;  2I4A A;  2FA8 A;  1B8X A;  1A0F A;  1THX A;  1M0U A;  2IMF A;  2C0F A;  2L5L A;  1EEM A;  1BJX A;  3ZRD A;  1FB6 A;  4XIH A;  2C0G A;  2LST A;  3BOA A;  1T00 A;  2FWG A;  4EUY A;  2P5R A;  2YV9 A;  5D96 A;  4YQU A;  1SK1 A;  2REM A;  5E59 A;  3QCP A; 
#chains in the Genus database with same CATH topology
 2OBI A;  2FD3 A;  2FWH A;  4TKY A;  1FOV A;  4K6X A;  4KGI A;  4ZL9 A;  4JED A;  5G1K A;  4H86 A;  1XIY A;  4WXT A;  1R5A A;  1ERT A;  3M0F A;  1K0B A;  1KTE A;  1PFO A;  4PUR A;  4HUA A;  2C3N A;  2OKA A;  5IM9 A;  5B7C A;  5GAP D;  2O89 A;  2KLX A;  4F9Z A;  3EU3 A;  4KAE A;  4CW9 A;  1M2A A;  3TJJ A;  2LRT A;  10GS A;  5H5S A;  5FT3 A;  5ID2 A;  3EWL A;  2VL2 A;  4IGJ A;  1ZMA A;  2HT9 A;  2H74 A;  4PXO A;  4WF5 A;  4BIK A;  3GL3 A;  3DWV A;  5KN0 A;  1EP7 A;  2V41 A;  1WJK A;  4NHW A;  3FKF A;  2GTU A;  2K8S A;  1WE0 A;  2X49 A;  4MJB A;  2GGT A;  4LL1 B;  5DJM A;  1T8E B;  5D8I A;  1PL2 A;  4HS1 A;  2VL9 A;  2VCX A;  2LQO A;  3A5W A;  1ZYP A;  5ENU A;  2IL3 A;  2OA7 A;  2YJ7 A;  1GTA A;  4BWS A;  9GSS A;  1QFN A;  2GZP A;  3E9J B;  1NM3 A;  4L0W A;  5IO0 A;  3ERW A;  4K2X A;  3KP9 A;  1LU4 A;  2MMZ A;  4KSM A;  4IJ3 A;  4IVF A;  2XHF A;  4MCU A;  5COH A;  2PMT A;  4X4J A;  4I2T A;  3KH9 A;  4E8E A;  4WR4 A;  6GSW A;  1J0F A;  1NSW A;  2LJA A;  3LYK A;  2CV4 A;  5DQS A;  2ON7 A;  4P3Y B;  17GS A;  1QGV A;  1YKC A;  1OYJ A;  1W4V A;  2CAI A;  4V1A g;  1MEK A;  1O81 A;  5F07 A;  1G7O A;  1JZO A;  3APO A;  4KND A;  2MZC A;  2TRC P;  2VD0 A;  2CAQ A;  5J4U A;  5J9B A;  1B4Q A;  4YQM A;  1YEP A;  5EL8 A;  2QGV A;  3CRU A;  3ERF A;  2HRA A;  1RW1 A;  2AAW A;  4XHM A;  1V98 A;  4XRD A;  1XW9 A;  1X9S B;  4OFT A;  1EOH A;  2A2P A;  4AGS A;  5J3R A;  2HLS A;  4BVY A;  2ALB A;  1TI3 A;  3C73 A;  3N5O A;  4HSC X;  4EVM A;  5F06 A;  1BYE A;  2V1M A;  2ZUP A;  3QDN A;  5B8A A;  5IOX A;  3IHQ A;  1OC3 A;  2B3S A;  1TTZ A;  4YH2 A;  1ZCP A;  2JZS A;  2MBS A;  4J56 E;  3TJG A;  3P2A A;  4YKG A;  3EYT A;  1F3B A;  3UJ1 A;  3C71 A;  1TRS A;  1O85 A;  3E3E A;  4TR3 A;  1PSQ A;  3F4T A;  2GSQ A;  2QA2 A;  2BMX A;  2GQL A;  2JSY A;  4JR4 A;  1K3O A;  1SD8 A;  4GWR A;  1TU7 A;  1XVW A;  4N0Z A;  3VWU A;  3FZ9 A;  2DLX A;  20GS A;  4FYU A;  4KCE A;  1GSS A;  1HNA A;  3A2X A;  1W89 A;  2CT6 A;  3CQF A;  5GAN D;  4ZL7 A;  5KN2 A;  2GT5 A;  3U5R E;  2FHE A;  4EDZ A;  1WWJ A;  2X64 A;  4IJI A;  1OC9 A;  2B1L A;  2M80 A;  1O6J A;  4ZB6 A;  3HZ4 A;  1TK0 B;  1PGT A;  3EIN A;  2A4H A;  2PBJ A;  2YZH A;  4XS6 A;  3HJP A;  3TUE A;  2N5B A;  1ACV A;  3QFA C;  4MZW A;  4I2U A;  2B7K A;  4KB3 A;  3IAS 2;  4I5Q A;  4K8M A;  2WUL A;  4LMW A;  1O8W A;  4FIW A;  5HR2 A;  2FCH A;  3FW2 A;  1EEJ A;  1TOF A;  4Q5Q A;  1J9B A;  13GS A;  1N8J A;  3IA1 A;  4GQF A;  3M3M A;  2G2Q A;  3DVW A;  3VI5 A;  3FRC A;  1JHB A;  2X4A A;  3ZIT A;  3F3R A;  1VF4 A;  1WPI A;  5AGY A;  1U87 A;  1T4Y A;  4PGT A;  1K0C A;  1X9W B;  4TR1 B;  3IOS A;  3GKX A;  4EKZ A;  3E0U A;  2VLV A;  3CRT A;  2B1K A;  4Q5N A;  3VWV A;  2D2Z A;  1VRS D;  5HQP A;  2OJL A;  2PGT A;  2XPE A;  2DML A;  4MK3 A;  2PER A;  5CP1 A;  4HEA 2;  2AYT A;  4BL7 B;  3QOU A;  2PVQ A;  2K18 A;  2YWN A;  1JZW A;  1Z7P A;  4I6X A;  5DCG A;  1CQH A;  2I9H A;  3BCK A;  1TU8 A;  4XS1 A;  5GZZ B;  3SWL A;  3GX8 A;  2VCZ A;  2B5E A;  3IC4 A;  5H5Q A;  2L59 A;  2N5A A;  3D22 A;  3KD0 A;  3F6F A;  2L6D A;  2YN1 A;  4OCF A;  3LYP A;  5G2Z A;  1N2A A;  1FVK A;  2MYG A;  2HXK A;  3F0I A;  2IWT A;  3UIW A;  4ECJ A;  3HA9 A;  4MJE A;  2OE0 A;  4ECB A;  5FHI A;  3ZIJ A;  3HXS A;  3TJF A;  4JE1 A;  4ULX A;  2IFQ A;  5LNK e;  2CZ2 A;  5CRW A;  2HI7 A;  2C3Q A;  1HD2 A;  3IK7 A;  3FR3 A;  4G9H A;  3L9S A;  3TJK A;  2HZE B;  3IK9 A;  1XWB A;  4KSO A;  4JR6 A;  3IRA A;  4AJ6 A;  2AUV A;  3RBT A;  4ZIL A;  2BTO T;  2B5X A;  4OD7 A;  3UL3 A;  4TRX A;  4F82 A;  2VCW A;  2X8H A;  1AQX A;  4IQA A;  1T1V A;  4YKF A;  4JU5 A;  4AF2 A;  5KEJ A;  1WRY A;  1BG5 A;  4A5P A;  4HU9 A;  2JZR A;  4NHZ A;  4WET A;  3FK8 A;  3RAZ A;  5ECM B;  3LEF A;  4LMV A;  3A5I A;  5A4V A;  2M72 A;  5JCU A;  1XCC A;  1V57 A;  2RII A;  3M8N A;  1SL2 B;  5KN1 A;  3R2Q A;  4HDE A;  1K0D A;  1VF1 A;  5DJL A;  2OE1 A;  3O3T A;  3DIE A;  2GSR A;  3QMX A;  4MJC A;  1PMT A;  2DJJ A;  5D9V A;  2WJU A;  2GZY A;  3TRX A;  1GNW A;  4BVX A;  4KCA A;  2H6Z A;  5IMA A;  1UC7 A;  5D93 A;  2ZNM A;  1V58 A;  1TKD B;  6GSV A;  4MH2 A;  5G31 A;  1BQ7 A;  1M2D A;  3G7J A;  4XS4 B;  3EC3 A;  1A8L A;  3PIN A;  3DGQ A;  2P5Q A;  4MF5 A;  3KTB A;  2DKI A;  4DEJ A;  2H66 A;  5D9W A;  5DAK A;  4EIQ A;  2E2G A;  4YAV A;  2VIM A;  3ZVJ D;  1PRX A;  3WT2 A;  1OAZ A;  5ECP B;  4MZC A;  4GCI A;  4N30 A;  2K6V A;  1GSE A;  1GUH A;  4PUA A;  2V6K A;  5HR3 A;  1RK4 A;  1BED A;  4RQX A;  3KP8 A;  3HD5 A;  1R5P A;  2O85 A;  2YWO A;  3TOT A;  1KEB A;  3S9F A;  4HJM A;  4PQ1 A;  5JCG A;  1ZZY A;  1J08 A;  3GX0 A;  3HVV A;  4EE0 A;  1JLW A;  4GSN A;  4ZB9 A;  3UEM A;  2IMD A;  1M3J A;  3DEX A;  3QAG A;  2FY6 A;  4HQZ A;  1U3A A;  4BWQ A;  3LQ7 A;  3D0Z A;  4O5U A;  1MDJ A;  3GA4 A;  3GL5 A;  2KP2 A;  3O76 A;  3A3T A;  2EIQ A;  2DJK A;  1E2Y A;  1SYX A;  4PUF C;  1TK8 B;  2H6Y A;  2VM1 A;  5DAL B;  3M9K A;  3TGZ A;  2C1Y A;  2CVB A;  4HZ2 A;  1F9M A;  4O5Q A;  1HNC A;  1SU9 A;  1FB0 A;  1SJZ A;  3HVX A;  5ECS A;  1XG8 A;  2YWI A;  4TW5 A;  3C1R A;  2H73 A;  1A24 A;  5CRG A;  4TR4 A;  4HU7 A;  4MDC A;  5ECL B;  1VGL A;  2JU5 A;  1EOG A;  2VCT A;  3G7Y A;  3WT1 A;  2LNS A;  2HYX A;  1SD9 A;  2GVP A;  1T3B A;  4ISD A;  3DYR A;  4K7O A;  2Z9S A;  2EC4 A;  3FEU A;  2A2S A;  2JAD A;  1H75 A;  4DSS A;  2XPD A;  5HFK A;  1KNG A;  3H8Q A;  4IKH A;  1M9A A;  2CVD A;  4MLY A;  3RHC A;  4OFM A;  4K0N A;  5C00 A;  1Q98 A;  2FUG 2;  2VCQ A;  3H79 A;  1MD4 A;  2JZT A;  1QMV A;  2G0F A;  4MPG A;  5ELA A;  2KP1 A;  1DBY A;  3EMP A;  2YZU A;  3GST A;  4HZ4 A;  5JCW A;  1USB A;  1M99 A;  1F2E A;  1AXD A;  1X0R A;  2RUE A;  3HCZ A;  4I97 A;  5D9T A;  4V2L A;  19GS A;  3CSJ A;  1M7T A;  1RQM A;  2CQ9 A;  1TXX A;  3MNG A;  5D73 A;  4LA1 A;  6GSY A;  3CXG A;  1PX6 A;  1XPV A;  4RI6 A;  1TW9 A;  5CRH A;  2C80 A;  2DC5 A;  5DBQ A;  1OKT A;  2DJ0 A;  5A4U A;  1QUW A;  1SL1 B;  1A8Y A;  4CDO A;  2DBC A;  2V2G A;  4TR1 A;  3BCI A;  4GLT A;  2MMA A;  2LNT A;  2JAC A;  4CHS A;  3IV4 A;  1G0T A;  4MZB A;  2V6O A;  2FA4 A;  3HZ8 A;  3APQ A;  5H5R A;  2HRF A;  2HFD A;  5CAX A;  5IQY A;  2C3T A;  2FNO A;  2JSZ A;  2FWE A;  3DML A;  4OCE A;  3F6D A;  4BL7 A;  1XBS A;  4WEY A;  4KDX A;  4CY6 A;  2OBK A;  3IE3 A;  3WGE A;  2A4V A;  5B6N A;  1EGR A;  3LXZ A;  3SBC A;  5ECK B;  3GYK A;  2YCD A;  1IYH A;  1XFL A;  1GL8 A;  3R3E A;  3TKP A;  3D6I A;  3ZLP A;  2HZF A;  3QR6 A;  3VPT A;  3UBL A;  5B8B A;  3WGX A;  5FWG A;  2HE3 A;  4L5L A;  1Q4J A;  2P31 A;  4IW9 A;  3ZVJ A;  4DVC A;  1BX9 A;  4EDY A;  2LV3 A;  4MAB A;  3IHG A;  5DDL A;  3GKK A;  2M46 A;  2DKH A;  4F2I A;  2HNL A;  3ZRE A;  3CBU A;  5AN1 A;  1GTI A;  5LD0 A;  1K0O A;  1YF0 A;  3TKR A;  5BMU A;  2HZE A;  4JBB A;  2L4C A;  3Q6O A;  3I43 A;  1DE1 A;  2O87 A;  4WBJ A;  3QAW A;  2KUC A;  2PVO C;  1X5E A;  3ME7 A;  1Y25 A;  4ML6 A;  2UZ8 A;  3ZML A;  5ID2 B;  3TKS C;  3D5J A;  3M1G A;  2DSA A;  4EIP A;  2H1G A;  3FYG A;  5DVB A;  5JWQ B;  1ZYQ B;  1V9W A;  2YNX A;  1OE7 A;  1XZO A;  5LCZ A;  2PN8 A;  1ERU A;  5CNW A;  4ECC A;  1EV9 A;  1LBK A;  2H72 A;  1XOB A;  4OFN A;  4IBP A;  1B9X C;  4K2D A;  1ST9 A;  4I8B A;  1GUM A;  4K1F A;  4ILF A;  1S3D A;  1TRW A;  4KA0 A;  4KDY A;  2R0C A;  1YF1 A;  2LJR A;  4USS A;  2O8V B;  3G7I A;  5A5K A;  1E6B A;  3LG6 A;  1GLP A;  12GS A;  2J23 A;  3P90 A;  1UN2 A;  4QQ7 A;  1MDI A;  2FGX A;  1S3R A;  1MTC A;  1V40 A;  2VLU A;  5G30 A;  2GT6 A;  3AY8 A;  2VL3 A;  1OVN A;  1V2A A;  2IIY A;  4DSQ A;  2AJQ B;  3HJO A;  1XW5 A;  3EMX A;  1R26 A;  3L9V A;  4Z7X A;  3BBY A;  4D73 A;  3QPM A;  1X5C A;  1Z5Y E;  2H1D A;  3WD6 A;  1GRX A;  4X43 A;  3HDC A;  1JZD A;  5IMV A;  3GFK A;  1A2M A;  1B48 A;  3RDW A;  3GIX A;  4RUV A;  1YDK A;  4MA9 A;  2F8A A;  1JLV A;  1ZOF A;  3GTU A;  1EZK A;  2E2M A;  1BAY A;  2BJX A;  5EPF A;  1R4W A;  5BRT A;  3V1W A;  5A4W A;  3VWX A;  2L5O A;  3ZYW A;  4MF7 A;  3KCM A;  1AIU A;  2GZZ A;  1FG4 A;  2VCV A;  4Q5R A;  1GSQ A;  1PKZ A;  4EC0 A;  4IQ1 A;  4FYC A;  1NW2 A;  3NOF A;  3NZN A;  1QQ2 A;  1GSY A;  2QKE A;  5KOW A;  4G0L A;  4N11 A;  3GN3 A;  1SEN A;  2GLR A;  3IR4 A;  3KMN A;  2WRT A;  3PPU A;  2R3X A;  2H0I A;  5HFG A;  3J7Y k;  3H93 A;  3D4M A;  4CY8 A;  1SJI A;  2LRC A;  2VD1 A;  4POL A;  1DE2 A;  3M9J A;  2P0G A;  5F0G A;  2WDU A;  2X99 A;  1O7U A;  2QA1 A;  4V2N A;  4ICY A;  3L78 A;  2DJ3 A;  4POK A;  3EUR A;  2JL4 A;  3I6A A;  4IP6 A;  2KOK A;  2A2R A;  3IBH A;  2NVL A;  8GSS A;  3GUR A;  5G5E A;  2MMN A;  22GS A;  2PWJ A;  1T4Z A;  4BPY A;  2O7K A;  2C8U A;  1GWC A;  5E4W A;  3NIV A;  1Z7R A;  2VO4 A;  4K7N A;  3HHV A;  3F3Q A;  3MYD A;  1THO A;  1A0R P;  4K0G A;  1DSB A;  2R0P A;  1OC9 B;  1U6T A;  4YQV A;  3ZFL A;  1A2L A;  1XW6 A;  2DJ1 A;  3OR5 A;  2LQQ A;  2XBI A;  1C72 A;  1SKR B;  1K0M A;  1GNE A;  3MAK A;  2E7P A;  2IMK A;  2DJ2 A;  5J9C A;  1TP9 A;  2GQM A;  1GTU A;  4KH7 A;  4GQC A;  2DIZ A;  1PX7 A;  5CRD A;  2J9H A;  3EPT A;  2VM2 A;  3KZQ A;  3ZMK A;  5G5F A;  1QK8 A;  3CYN A;  4K5R A;  5ECN B;  2L6C A;  1ML6 A;  3L9U A;  3C8E A;  3GHA A;  1FW1 A;  3ZZX A;  3CSH A;  4Z2U A;  2TIR A;  4NV5 A;  1YEX A;  4O7H A;  4TOP A;  2H70 A;  1NHO A;  2WCI A;  4L8E A;  2WB9 A;  1UA5 A;  1ZYN A;  1M3I A;  2NDO A;  2VL2 C;  1ZL9 A;  3IC8 A;  2H30 A;  1Z6M A;  2IJY A;  4ECI A;  3F8U A;  2F8F A;  4MJA A;  1NHY A;  2R4V A;  5AIV A;  4ZIJ A;  4FH8 A;  5CO3 A;  1PN9 A;  3VFI A;  4NMU A;  4TN8 A;  3A2W A;  5IMD A;  4HQS A;  3RHB A;  2RM6 A;  4KE3 A;  5IMZ A;  3WGD A;  4G0I A;  5JWR B;  2YWM A;  5B6M A;  2YPM A;  1SKW B;  2CA8 A;  2OAC A;  4ZBB A;  4E8H A;  3LJR A;  4RI7 A;  3FMW A;  1F6M C;  3CTF A;  5IMF A;  1U3I A;  1OKD A;  4IEL A;  1SKS B;  3MIX A;  4F0B A;  1CQG A;  2MBT A;  1FOH A;  3TKQ A;  3CTG A;  3A2V A;  2R5G A;  1AAZ A;  1R7H A;  2QC7 A;  2FLS A;  2GST A;  2K9F A;  1F3A A;  2DIY A;  2ZCT A;  1GSF A;  1ON4 A;  1GSD A;  3KM6 A;  3ZIV A;  5IO2 A;  1PD2 1;  1O73 A;  1Z9H A;  2FWF A;  3KJY A;  4NXI A;  4ZXG A;  4PNF A;  5HR0 A;  1FHE A;  1XXU A;  3HVN A;  4WR5 A;  3EVI A;  4BA7 A;  4PQH A;  3HVS A;  4AJ8 A;  1GTB A;  3KH7 A;  5ABR A;  5IPG A;  2YOI A;  18GS A;  2IFQ B;  4F03 A;  2IPA A;  1F37 A;  3UAR A;  5ELG A;  4POB A;  4YAP A;  5ECI B;  4FQU A;  3QAV A;  1XWK A;  1PA3 A;  3UOM A;  3DKS A;  1PL1 A;  4TXV A;  2LEG A;  3LFL A;  1MDK A;  2HRK A;  2OE3 A;  3HY2 A;  1ZYE A;  1ERW A;  2AHE A;  2VLT A;  5EY6 A;  2YJH A;  3MSZ A;  1SK2 A;  4KDU A;  5IIZ A;  5CRE A;  1I9D A;  3W8J A;  3Q18 A;  4DSR A;  2LKU A;  1XWA A;  4OMV A;  3K8N A;  1EV4 A;  2H76 A;  1M2B A;  3QFB C;  16GS A;  4ZBD A;  3FY7 A;  4TXO B;  2RUF A;  2E0Q A;  2EIR A;  3DD3 A;  4N0V A;  1SL0 B;  1VF3 A;  2C4J A;  4KX4 A;  5IOW A;  2I1U A;  4XTS A;  1URM A;  2PU9 C;  4ZL8 A;  3TOU A;  3IXR A;  3VK9 A;  3BD2 A;  3P7X A;  4MH3 A;  4BVX B;  4XCS A;  2GQK A;  2AB6 A;  4F0C A;  1XWG A;  3KMO A;  5IMC A;  3LGC A;  3GUS A;  2R37 A;  4G0K A;  3KTL A;  1A2J A;  5IPH A;  3GH6 A;  3UBK A;  3TDG A;  1WIK A;  3PH9 A;  3US3 A;  4RQR A;  4LL4 B;  3ERG A;  1OC8 A;  2H8L A;  3F9U A;  4MMM A;  1AQV A;  4L5O A;  3IDV A;  3FZ4 A;  5DAK B;  3JCM L;  3P8W A;  5DCH A;  1AC1 A;  1B9Y C;  1DUG A;  1EP8 A;  2L57 A;  4Q5F A;  4GF0 A;  4ZB8 A;  2XC2 A;  3J7Y b;  1I5G A;  2LTK A;  7GSS A;  4GXZ A;  3VWW A;  3IPZ A;  3FR6 A;  1UVZ A;  2H19 A;  2HRN A;  3GKN A;  3UMA A;  3GMF A;  4GRF A;  2NPB A;  2CVK A;  1G6Y A;  1M9B A;  2LUS A;  1WP0 A;  3ME8 A;  2N5F A;  4IP1 A;  4OO4 A;  1PQN A;  2HSY A;  2HSH A;  1U88 A;  5INY A;  2PPT A;  2XBQ A;  1H4O A;  2H0G A;  1T7P B;  1XOA A;  2K8V A;  3TRP A;  3VLN A;  3KEB A;  2I81 A;  3FZ5 A;  2NBS A;  3LSZ A;  4NWY A;  3DRN A;  4J57 E;  3LXT A;  2B5Y A;  4WBR D;  4XRA A;  2GDR A;  2H0H A;  2PUK C;  1K0A A;  1HQO A;  4EO3 A;  2H71 A;  3D21 A;  2F9S A;  4J2F A;  2L4Q A;  2YAN A;  4GTU A;  4IS0 A;  3GNJ A;  1FVJ A;  4V2M A;  3F4S A;  4TVE A;  2WFC A;  1S3A A;  5HFI A;  5HR1 A;  4PX1 A;  2H1A A;  3DXB A;  3RPP A;  1SK0 A;  3GV1 A;  1GH2 A;  1YZX A;  4DSS B;  5F8B A;  6GSU A;  2R6K A;  4ACS A;  1GLQ A;  4ML1 A;  5G1L A;  1YQ1 A;  1X5D A;  2H1B A;  3HYP A;  4LLR A;  2H01 A;  3I9V 2;  2NTO A;  2H75 A;  1G6W A;  3Q19 A;  3W6G A;  3APS A;  1XVQ A;  2RM5 A;  1OE8 A;  5AIX A;  4PNG A;  3KGK A;  3CSI A;  1AW9 A;  3GH9 A;  3EE2 A;  4X1U A;  5AIS A;  5EVO A;  4XS4 A;  2WZ9 A;  1TDI A;  2WGR A;  2YP6 A;  4MPF A;  4EF0 A;  4G19 A;  4PQI A;  1SJ6 A;  3PGT A;  5F05 A;  3F4R A;  3N9J A;  2CX3 A;  1XWC A;  2F3M A;  4GST A;  2LS5 A;  2I3Y A;  2IMI A;  1FAA A;  1WMJ A;  1ILO A;  4HOJ A;  3BJ5 A;  2IME A;  1S3C A;  3FHK A;  4MNN A;  5KN3 A;  1Y6E A;  3ISO A;  4ID0 A;  3F63 A;  3Q74 A;  3TJB A;  3HJM A;  4Z2R A;  3UVH A;  4HJ2 A;  1ABA A;  3TKS A;  3TRQ A;  3ZFB A;  1G7E A;  4KUN A;  3DVX A;  2X8G A;  1YJ6 A;  3L4N A;  2R0G A;  2AV4 A;  1A23 A;  2KHP A;  2OAD A;  4K9Z A;  3WYW A;  1IYI A;  5GSS A;  4JRR A;  2R2J A;  6GSX A;  3G9B A;  1X9M B;  5JWO B;  2DMM A;  3HKR A;  4BVY B;  3KIJ A;  3MWH A;  3ED3 A;  4X0X A;  1YKA A;  4EXJ A;  4L0U A;  3KXO A;  6GSS A;  3GKM A;  5CYY A;  2X8C A;  5DAL A;  2HSM A;  3PR8 A;  4NAX A;  4IHU A;  1PN0 A;  4G10 A;  3ZTL A;  3D4T A;  3GRX A;  1TI1 A;  3C1S A;  3EU4 A;  1TRV A;  2C0E A;  4V1A p;  1VF2 A;  1WOU A;  4O32 A;  2GS3 A;  1MD3 A;  2WS2 A;  2IN3 A;  2V32 A;  3QD9 A;  4K7I A;  1Z3E A;  1ERV A;  4TR0 A;  1SYR A;  3TCO A;  4ZBA A;  2LJK A;  4O5R A;  1O8X A;  5C04 A;  1LJR A;  14GS A;  4QL9 A;  4POM A;  2VOC A;  4Z2T A;  1HNB A;  1JZR A;  1EWX A;  1TJD A;  3TKS E;  4WF4 A;  5ECH B;  4KF9 A;  5L71 A;  1GP1 A;  4PTS A;  3RPN A;  4NPB A;  3I69 A;  4MF6 A;  5GST A;  1KBN A;  4AJ7 A;  3VI7 A;  1AQW A;  1FO5 A;  2QSI A;  3ZL5 A;  1PKW A;  3MDK A;  3C7M A;  1GUK A;  4KW6 A;  4HI7 A;  1JFU A;  3UVT A;  4NV2 A;  2B7J A;  3O6T A;  4TXO A;  2CZ3 A;  5J41 A;  5DQY A;  4WKW A;  1HYU A;  1TRU A;  3VPQ A;  5ECO B;  3H1N A;  4N10 A;  5ECQ B;  4O92 A;  1TK5 B;  3FZA A;  1K3L A;  1AUC A;  2H6X A;  1K0N A;  2YV7 A;  1ZGN A;  4QL7 A;  2TRX A;  1EGO A;  3VUR A;  1GUL A;  2CX4 A;  2GSS A;  1QXH A;  3U6V A;  3IAM 2;  2EIO A;  2VUP A;  2F51 A;  6GST A;  4K5S A;  2MMO A;  5KOX A;  2B6M A;  4EL1 A;  4FO5 A;  2LRN A;  4GSS A;  5J5N A;  1GSU A;  11GS A;  3LOR A;  2ES7 A;  2C0D A;  4MP4 A;  2RLI A;  4D73 B;  4G2E A;  3LWA A;  1K3Y A;  4OWY A;  4FYB A;  4IN0 A;  1B4P A;  1Z6N A;  3GSS A;  3CMI A;  2ON5 A;  3H4K A;  1YY7 A;  4OO5 A;  3LW9 A;  3TB2 A;  3W8S A;  3GTU B;  3L0H A;  3UAP A;  2VAF A;  4JZQ A;  3FR9 A;  5D9X A;  5ECR B;  2I4A A;  2FA8 A;  1B8X A;  1A0F A;  1THX A;  1M0U A;  2IMF A;  2C0F A;  2L5L A;  1EEM A;  1BJX A;  3ZRD A;  1FB6 A;  4XIH A;  2C0G A;  2LST A;  3BOA A;  1T00 A;  2FWG A;  4EUY A;  2P5R A;  2YV9 A;  5D96 A;  4YQU A;  1SK1 A;  2REM A;  5E59 A;  3QCP A; 
#chains in the Genus database with same CATH homology
 2OBI A;  2FD3 A;  2FWH A;  4TKY A;  1FOV A;  4K6X A;  4KGI A;  4ZL9 A;  4JED A;  5G1K A;  4H86 A;  1XIY A;  4WXT A;  1R5A A;  1ERT A;  3M0F A;  1K0B A;  1KTE A;  4PUR A;  4HUA A;  2C3N A;  2OKA A;  5IM9 A;  5B7C A;  5GAP D;  2O89 A;  2KLX A;  4F9Z A;  3EU3 A;  4KAE A;  4CW9 A;  1M2A A;  3TJJ A;  2LRT A;  10GS A;  5H5S A;  5FT3 A;  5ID2 A;  3EWL A;  2VL2 A;  4IGJ A;  1ZMA A;  2HT9 A;  2H74 A;  4PXO A;  4WF5 A;  3GL3 A;  3DWV A;  5KN0 A;  1EP7 A;  2V41 A;  1WJK A;  4NHW A;  3FKF A;  2GTU A;  2K8S A;  1WE0 A;  2X49 A;  4MJB A;  2GGT A;  4LL1 B;  5DJM A;  1T8E B;  5D8I A;  1PL2 A;  4HS1 A;  2VL9 A;  2VCX A;  2LQO A;  3A5W A;  1ZYP A;  5ENU A;  2IL3 A;  2OA7 A;  2YJ7 A;  1GTA A;  4BWS A;  9GSS A;  1QFN A;  2GZP A;  3E9J B;  1NM3 A;  4L0W A;  5IO0 A;  3ERW A;  4K2X A;  3KP9 A;  1LU4 A;  2MMZ A;  4KSM A;  4IJ3 A;  4IVF A;  2XHF A;  4MCU A;  5COH A;  2PMT A;  4X4J A;  4I2T A;  3KH9 A;  4E8E A;  4WR4 A;  6GSW A;  1J0F A;  1NSW A;  2LJA A;  3LYK A;  2CV4 A;  5DQS A;  2ON7 A;  4P3Y B;  17GS A;  1QGV A;  1YKC A;  1OYJ A;  1W4V A;  2CAI A;  4V1A g;  1MEK A;  1O81 A;  5F07 A;  1G7O A;  1JZO A;  3APO A;  4KND A;  2MZC A;  2TRC P;  2VD0 A;  2CAQ A;  5J4U A;  5J9B A;  1B4Q A;  4YQM A;  1YEP A;  5EL8 A;  2QGV A;  3CRU A;  3ERF A;  2HRA A;  1RW1 A;  2AAW A;  4XHM A;  1V98 A;  4XRD A;  1XW9 A;  1X9S B;  4OFT A;  1EOH A;  2A2P A;  4AGS A;  5J3R A;  2HLS A;  4BVY A;  2ALB A;  1TI3 A;  3C73 A;  3N5O A;  4EVM A;  5F06 A;  1BYE A;  2V1M A;  2ZUP A;  3QDN A;  5B8A A;  5IOX A;  3IHQ A;  1OC3 A;  2B3S A;  1TTZ A;  4YH2 A;  1ZCP A;  2JZS A;  2MBS A;  4J56 E;  3TJG A;  3P2A A;  4YKG A;  3EYT A;  1F3B A;  3UJ1 A;  3C71 A;  1TRS A;  1O85 A;  3E3E A;  4TR3 A;  1PSQ A;  3F4T A;  2GSQ A;  2QA2 A;  2BMX A;  2GQL A;  2JSY A;  4JR4 A;  1K3O A;  1SD8 A;  4GWR A;  1TU7 A;  1XVW A;  4N0Z A;  3VWU A;  3FZ9 A;  2DLX A;  20GS A;  4FYU A;  4KCE A;  1GSS A;  1HNA A;  3A2X A;  1W89 A;  2CT6 A;  5GAN D;  4ZL7 A;  5KN2 A;  2GT5 A;  3U5R E;  2FHE A;  4EDZ A;  1WWJ A;  2X64 A;  4IJI A;  1OC9 A;  2B1L A;  2M80 A;  1O6J A;  4ZB6 A;  3HZ4 A;  1TK0 B;  1PGT A;  3EIN A;  2A4H A;  2PBJ A;  2YZH A;  4XS6 A;  3HJP A;  3TUE A;  2N5B A;  1ACV A;  3QFA C;  4MZW A;  4I2U A;  2B7K A;  4KB3 A;  3IAS 2;  4I5Q A;  4K8M A;  2WUL A;  4LMW A;  1O8W A;  4FIW A;  5HR2 A;  2FCH A;  3FW2 A;  1EEJ A;  1TOF A;  4Q5Q A;  1J9B A;  13GS A;  1N8J A;  3IA1 A;  4GQF A;  3M3M A;  2G2Q A;  3DVW A;  3VI5 A;  3FRC A;  1JHB A;  2X4A A;  3ZIT A;  3F3R A;  1VF4 A;  1WPI A;  5AGY A;  1U87 A;  1T4Y A;  4PGT A;  1K0C A;  1X9W B;  4TR1 B;  3IOS A;  3GKX A;  4EKZ A;  3E0U A;  2VLV A;  3CRT A;  2B1K A;  4Q5N A;  3VWV A;  2D2Z A;  1VRS D;  5HQP A;  2OJL A;  2PGT A;  2XPE A;  2DML A;  4MK3 A;  2PER A;  5CP1 A;  4HEA 2;  2AYT A;  4BL7 B;  3QOU A;  2PVQ A;  2K18 A;  2YWN A;  1JZW A;  1Z7P A;  4I6X A;  5DCG A;  1CQH A;  2I9H A;  3BCK A;  1TU8 A;  4XS1 A;  5GZZ B;  3SWL A;  3GX8 A;  2VCZ A;  2B5E A;  3IC4 A;  5H5Q A;  2L59 A;  2N5A A;  3D22 A;  3KD0 A;  3F6F A;  2L6D A;  2YN1 A;  4OCF A;  3LYP A;  5G2Z A;  1N2A A;  1FVK A;  2MYG A;  2HXK A;  3F0I A;  2IWT A;  3UIW A;  4ECJ A;  3HA9 A;  4MJE A;  2OE0 A;  4ECB A;  5FHI A;  3ZIJ A;  3HXS A;  3TJF A;  4JE1 A;  4ULX A;  2IFQ A;  5LNK e;  2CZ2 A;  5CRW A;  2HI7 A;  2C3Q A;  1HD2 A;  3IK7 A;  3FR3 A;  4G9H A;  3L9S A;  3TJK A;  2HZE B;  3IK9 A;  1XWB A;  4KSO A;  4JR6 A;  3IRA A;  4AJ6 A;  2AUV A;  3RBT A;  4ZIL A;  2BTO T;  2B5X A;  4OD7 A;  3UL3 A;  4TRX A;  4F82 A;  2VCW A;  2X8H A;  1AQX A;  4IQA A;  1T1V A;  4YKF A;  4JU5 A;  4AF2 A;  5KEJ A;  1WRY A;  1BG5 A;  4A5P A;  4HU9 A;  2JZR A;  4NHZ A;  4WET A;  3FK8 A;  3RAZ A;  5ECM B;  3LEF A;  4LMV A;  3A5I A;  5A4V A;  2M72 A;  5JCU A;  1XCC A;  1V57 A;  2RII A;  3M8N A;  1SL2 B;  5KN1 A;  3R2Q A;  4HDE A;  1K0D A;  1VF1 A;  5DJL A;  2OE1 A;  3O3T A;  3DIE A;  2GSR A;  3QMX A;  4MJC A;  1PMT A;  2DJJ A;  5D9V A;  2WJU A;  2GZY A;  3TRX A;  1GNW A;  4BVX A;  4KCA A;  2H6Z A;  5IMA A;  1UC7 A;  5D93 A;  2ZNM A;  1V58 A;  1TKD B;  6GSV A;  4MH2 A;  5G31 A;  1BQ7 A;  1M2D A;  3G7J A;  4XS4 B;  3EC3 A;  1A8L A;  3PIN A;  3DGQ A;  2P5Q A;  4MF5 A;  3KTB A;  2DKI A;  4DEJ A;  2H66 A;  5D9W A;  5DAK A;  4EIQ A;  2E2G A;  4YAV A;  2VIM A;  3ZVJ D;  1PRX A;  3WT2 A;  1OAZ A;  5ECP B;  4MZC A;  4GCI A;  4N30 A;  2K6V A;  1GSE A;  1GUH A;  4PUA A;  2V6K A;  5HR3 A;  1RK4 A;  1BED A;  4RQX A;  3KP8 A;  3HD5 A;  1R5P A;  2O85 A;  2YWO A;  3TOT A;  1KEB A;  3S9F A;  4HJM A;  4PQ1 A;  5JCG A;  1ZZY A;  1J08 A;  3GX0 A;  3HVV A;  4EE0 A;  1JLW A;  4GSN A;  4ZB9 A;  3UEM A;  2IMD A;  3DEX A;  3QAG A;  2FY6 A;  4HQZ A;  1U3A A;  4BWQ A;  3LQ7 A;  3D0Z A;  4O5U A;  1MDJ A;  3GA4 A;  3GL5 A;  2KP2 A;  3O76 A;  3A3T A;  2EIQ A;  2DJK A;  1E2Y A;  1SYX A;  4PUF C;  1TK8 B;  2H6Y A;  2VM1 A;  5DAL B;  3M9K A;  3TGZ A;  2C1Y A;  2CVB A;  4HZ2 A;  1F9M A;  4O5Q A;  1HNC A;  1SU9 A;  1FB0 A;  1SJZ A;  3HVX A;  5ECS A;  2YWI A;  4TW5 A;  3C1R A;  2H73 A;  1A24 A;  5CRG A;  4TR4 A;  4HU7 A;  4MDC A;  5ECL B;  1VGL A;  2JU5 A;  1EOG A;  2VCT A;  3G7Y A;  3WT1 A;  2LNS A;  2HYX A;  1SD9 A;  2GVP A;  1T3B A;  4ISD A;  3DYR A;  4K7O A;  2Z9S A;  2EC4 A;  3FEU A;  2A2S A;  2JAD A;  1H75 A;  4DSS A;  2XPD A;  5HFK A;  1KNG A;  3H8Q A;  4IKH A;  1M9A A;  2CVD A;  4MLY A;  3RHC A;  4OFM A;  4K0N A;  5C00 A;  1Q98 A;  2FUG 2;  2VCQ A;  3H79 A;  1MD4 A;  2JZT A;  1QMV A;  2G0F A;  4MPG A;  5ELA A;  2KP1 A;  1DBY A;  3EMP A;  2YZU A;  3GST A;  4HZ4 A;  5JCW A;  1USB A;  1M99 A;  1F2E A;  1AXD A;  1X0R A;  2RUE A;  3HCZ A;  4I97 A;  5D9T A;  4V2L A;  19GS A;  3CSJ A;  1M7T A;  1RQM A;  2CQ9 A;  1TXX A;  3MNG A;  5D73 A;  4LA1 A;  6GSY A;  3CXG A;  1PX6 A;  1XPV A;  4RI6 A;  1TW9 A;  5CRH A;  2C80 A;  2DC5 A;  5DBQ A;  1OKT A;  2DJ0 A;  5A4U A;  1QUW A;  1SL1 B;  1A8Y A;  4CDO A;  2DBC A;  2V2G A;  4TR1 A;  3BCI A;  4GLT A;  2MMA A;  2LNT A;  2JAC A;  4CHS A;  3IV4 A;  1G0T A;  4MZB A;  2V6O A;  2FA4 A;  3HZ8 A;  3APQ A;  5H5R A;  2HRF A;  2HFD A;  5CAX A;  5IQY A;  2C3T A;  2FNO A;  2JSZ A;  2FWE A;  3DML A;  4OCE A;  3F6D A;  4BL7 A;  1XBS A;  4WEY A;  4KDX A;  4CY6 A;  2OBK A;  3IE3 A;  3WGE A;  2A4V A;  5B6N A;  1EGR A;  3LXZ A;  3SBC A;  5ECK B;  3GYK A;  2YCD A;  1IYH A;  1XFL A;  1GL8 A;  3R3E A;  3TKP A;  3D6I A;  3ZLP A;  2HZF A;  3QR6 A;  3VPT A;  3UBL A;  5B8B A;  3WGX A;  5FWG A;  2HE3 A;  4L5L A;  1Q4J A;  2P31 A;  4IW9 A;  3ZVJ A;  4DVC A;  1BX9 A;  4EDY A;  2LV3 A;  4MAB A;  3IHG A;  5DDL A;  3GKK A;  2M46 A;  2DKH A;  4F2I A;  2HNL A;  3ZRE A;  3CBU A;  5AN1 A;  1GTI A;  5LD0 A;  1K0O A;  1YF0 A;  3TKR A;  5BMU A;  2HZE A;  4JBB A;  2L4C A;  3Q6O A;  3I43 A;  1DE1 A;  2O87 A;  4WBJ A;  3QAW A;  2KUC A;  2PVO C;  1X5E A;  3ME7 A;  1Y25 A;  4ML6 A;  2UZ8 A;  3ZML A;  5ID2 B;  3TKS C;  3D5J A;  3M1G A;  2DSA A;  4EIP A;  2H1G A;  3FYG A;  5DVB A;  5JWQ B;  1ZYQ B;  1V9W A;  2YNX A;  1OE7 A;  1XZO A;  5LCZ A;  2PN8 A;  1ERU A;  5CNW A;  4ECC A;  1EV9 A;  1LBK A;  2H72 A;  1XOB A;  4OFN A;  4IBP A;  1B9X C;  4K2D A;  1ST9 A;  4I8B A;  1GUM A;  4K1F A;  4ILF A;  1S3D A;  1TRW A;  4KA0 A;  4KDY A;  2R0C A;  1YF1 A;  2LJR A;  4USS A;  2O8V B;  3G7I A;  5A5K A;  1E6B A;  3LG6 A;  1GLP A;  12GS A;  2J23 A;  3P90 A;  1UN2 A;  4QQ7 A;  1MDI A;  2FGX A;  1MTC A;  1V40 A;  2VLU A;  5G30 A;  2GT6 A;  3AY8 A;  2VL3 A;  1OVN A;  1V2A A;  2IIY A;  4DSQ A;  2AJQ B;  3HJO A;  1XW5 A;  3EMX A;  1R26 A;  3L9V A;  4Z7X A;  3BBY A;  4D73 A;  3QPM A;  1X5C A;  1Z5Y E;  2H1D A;  3WD6 A;  1GRX A;  4X43 A;  3HDC A;  1JZD A;  5IMV A;  3GFK A;  1A2M A;  1B48 A;  3RDW A;  3GIX A;  4RUV A;  1YDK A;  4MA9 A;  2F8A A;  1JLV A;  1ZOF A;  3GTU A;  1EZK A;  2E2M A;  1BAY A;  2BJX A;  5EPF A;  1R4W A;  5BRT A;  3V1W A;  5A4W A;  3VWX A;  2L5O A;  3ZYW A;  4MF7 A;  3KCM A;  1AIU A;  2GZZ A;  1FG4 A;  2VCV A;  4Q5R A;  1GSQ A;  1PKZ A;  4EC0 A;  4IQ1 A;  4FYC A;  1NW2 A;  3NOF A;  3NZN A;  1QQ2 A;  1GSY A;  2QKE A;  5KOW A;  4G0L A;  4N11 A;  3GN3 A;  1SEN A;  2GLR A;  3IR4 A;  3KMN A;  2WRT A;  3PPU A;  2R3X A;  2H0I A;  5HFG A;  3J7Y k;  3H93 A;  3D4M A;  4CY8 A;  1SJI A;  2LRC A;  2VD1 A;  4POL A;  1DE2 A;  3M9J A;  2P0G A;  5F0G A;  2WDU A;  2X99 A;  1O7U A;  2QA1 A;  4V2N A;  4ICY A;  3L78 A;  2DJ3 A;  4POK A;  3EUR A;  2JL4 A;  3I6A A;  4IP6 A;  2KOK A;  2A2R A;  3IBH A;  2NVL A;  8GSS A;  3GUR A;  5G5E A;  2MMN A;  22GS A;  2PWJ A;  1T4Z A;  4BPY A;  2O7K A;  2C8U A;  1GWC A;  5E4W A;  3NIV A;  1Z7R A;  2VO4 A;  4K7N A;  3HHV A;  3F3Q A;  3MYD A;  1THO A;  1A0R P;  4K0G A;  1DSB A;  2R0P A;  1OC9 B;  1U6T A;  4YQV A;  3ZFL A;  1A2L A;  1XW6 A;  2DJ1 A;  3OR5 A;  2LQQ A;  2XBI A;  1C72 A;  1SKR B;  1K0M A;  1GNE A;  3MAK A;  2E7P A;  2IMK A;  2DJ2 A;  5J9C A;  1TP9 A;  2GQM A;  1GTU A;  4KH7 A;  4GQC A;  2DIZ A;  1PX7 A;  5CRD A;  2J9H A;  3EPT A;  2VM2 A;  3KZQ A;  3ZMK A;  5G5F A;  1QK8 A;  3CYN A;  4K5R A;  5ECN B;  2L6C A;  1ML6 A;  3L9U A;  3C8E A;  3GHA A;  1FW1 A;  3ZZX A;  3CSH A;  4Z2U A;  2TIR A;  4NV5 A;  1YEX A;  4O7H A;  4TOP A;  2H70 A;  1NHO A;  2WCI A;  4L8E A;  2WB9 A;  1UA5 A;  1ZYN A;  2NDO A;  2VL2 C;  1ZL9 A;  3IC8 A;  2H30 A;  1Z6M A;  2IJY A;  4ECI A;  3F8U A;  2F8F A;  4MJA A;  1NHY A;  2R4V A;  5AIV A;  4ZIJ A;  4FH8 A;  5CO3 A;  1PN9 A;  3VFI A;  4NMU A;  4TN8 A;  3A2W A;  5IMD A;  4HQS A;  3RHB A;  2RM6 A;  4KE3 A;  5IMZ A;  3WGD A;  4G0I A;  5JWR B;  2YWM A;  5B6M A;  2YPM A;  1SKW B;  2CA8 A;  2OAC A;  4ZBB A;  4E8H A;  3LJR A;  4RI7 A;  3FMW A;  1F6M C;  3CTF A;  5IMF A;  1U3I A;  1OKD A;  4IEL A;  1SKS B;  3MIX A;  4F0B A;  1CQG A;  2MBT A;  1FOH A;  3TKQ A;  3CTG A;  3A2V A;  2R5G A;  1AAZ A;  1R7H A;  2QC7 A;  2FLS A;  2GST A;  2K9F A;  1F3A A;  2DIY A;  2ZCT A;  1GSF A;  1ON4 A;  1GSD A;  3KM6 A;  3ZIV A;  5IO2 A;  1PD2 1;  1O73 A;  1Z9H A;  2FWF A;  3KJY A;  4NXI A;  4ZXG A;  4PNF A;  5HR0 A;  1FHE A;  1XXU A;  4WR5 A;  3EVI A;  4BA7 A;  4PQH A;  3HVS A;  4AJ8 A;  1GTB A;  3KH7 A;  5ABR A;  5IPG A;  2YOI A;  18GS A;  2IFQ B;  4F03 A;  2IPA A;  1F37 A;  3UAR A;  5ELG A;  4POB A;  4YAP A;  5ECI B;  4FQU A;  3QAV A;  1XWK A;  1PA3 A;  3UOM A;  3DKS A;  1PL1 A;  4TXV A;  2LEG A;  3LFL A;  1MDK A;  2HRK A;  2OE3 A;  3HY2 A;  1ZYE A;  1ERW A;  2AHE A;  2VLT A;  5EY6 A;  2YJH A;  3MSZ A;  1SK2 A;  4KDU A;  5IIZ A;  5CRE A;  1I9D A;  3W8J A;  3Q18 A;  4DSR A;  2LKU A;  1XWA A;  4OMV A;  3K8N A;  1EV4 A;  2H76 A;  1M2B A;  3QFB C;  16GS A;  4ZBD A;  3FY7 A;  4TXO B;  2RUF A;  2E0Q A;  2EIR A;  3DD3 A;  4N0V A;  1SL0 B;  1VF3 A;  2C4J A;  4KX4 A;  5IOW A;  2I1U A;  4XTS A;  1URM A;  2PU9 C;  4ZL8 A;  3TOU A;  3IXR A;  3VK9 A;  3BD2 A;  3P7X A;  4MH3 A;  4BVX B;  4XCS A;  2GQK A;  2AB6 A;  4F0C A;  1XWG A;  3KMO A;  5IMC A;  3LGC A;  3GUS A;  2R37 A;  4G0K A;  3KTL A;  1A2J A;  5IPH A;  3GH6 A;  3UBK A;  3TDG A;  1WIK A;  3PH9 A;  3US3 A;  4RQR A;  4LL4 B;  3ERG A;  1OC8 A;  2H8L A;  3F9U A;  4MMM A;  1AQV A;  4L5O A;  3IDV A;  3FZ4 A;  5DAK B;  3JCM L;  3P8W A;  5DCH A;  1AC1 A;  1B9Y C;  1DUG A;  1EP8 A;  2L57 A;  4Q5F A;  4GF0 A;  4ZB8 A;  2XC2 A;  3J7Y b;  1I5G A;  2LTK A;  7GSS A;  4GXZ A;  3VWW A;  3IPZ A;  3FR6 A;  1UVZ A;  2H19 A;  2HRN A;  3GKN A;  3UMA A;  3GMF A;  4GRF A;  2NPB A;  2CVK A;  1G6Y A;  1M9B A;  2LUS A;  1WP0 A;  3ME8 A;  2N5F A;  4IP1 A;  4OO4 A;  1PQN A;  2HSY A;  2HSH A;  1U88 A;  5INY A;  2PPT A;  2XBQ A;  1H4O A;  2H0G A;  1T7P B;  1XOA A;  2K8V A;  3TRP A;  3VLN A;  3KEB A;  2I81 A;  3FZ5 A;  2NBS A;  3LSZ A;  4NWY A;  3DRN A;  4J57 E;  3LXT A;  2B5Y A;  4WBR D;  4XRA A;  2GDR A;  2H0H A;  2PUK C;  1K0A A;  1HQO A;  4EO3 A;  2H71 A;  3D21 A;  2F9S A;  4J2F A;  2L4Q A;  2YAN A;  4GTU A;  4IS0 A;  3GNJ A;  1FVJ A;  4V2M A;  3F4S A;  4TVE A;  2WFC A;  1S3A A;  5HFI A;  5HR1 A;  4PX1 A;  2H1A A;  3DXB A;  3RPP A;  1SK0 A;  3GV1 A;  1GH2 A;  1YZX A;  4DSS B;  5F8B A;  6GSU A;  2R6K A;  4ACS A;  1GLQ A;  4ML1 A;  5G1L A;  1YQ1 A;  1X5D A;  2H1B A;  3HYP A;  4LLR A;  2H01 A;  3I9V 2;  2NTO A;  2H75 A;  1G6W A;  3Q19 A;  3W6G A;  3APS A;  1XVQ A;  2RM5 A;  1OE8 A;  5AIX A;  4PNG A;  3KGK A;  3CSI A;  1AW9 A;  3GH9 A;  3EE2 A;  4X1U A;  5AIS A;  5EVO A;  4XS4 A;  2WZ9 A;  1TDI A;  2WGR A;  2YP6 A;  4MPF A;  4EF0 A;  4G19 A;  4PQI A;  1SJ6 A;  3PGT A;  5F05 A;  3F4R A;  3N9J A;  2CX3 A;  1XWC A;  2F3M A;  4GST A;  2LS5 A;  2I3Y A;  2IMI A;  1FAA A;  1WMJ A;  1ILO A;  4HOJ A;  3BJ5 A;  2IME A;  1S3C A;  3FHK A;  4MNN A;  5KN3 A;  1Y6E A;  3ISO A;  4ID0 A;  3F63 A;  3Q74 A;  3TJB A;  3HJM A;  4Z2R A;  3UVH A;  4HJ2 A;  1ABA A;  3TKS A;  3TRQ A;  3ZFB A;  1G7E A;  4KUN A;  3DVX A;  2X8G A;  1YJ6 A;  3L4N A;  2R0G A;  2AV4 A;  1A23 A;  2KHP A;  2OAD A;  4K9Z A;  3WYW A;  1IYI A;  5GSS A;  4JRR A;  2R2J A;  6GSX A;  3G9B A;  1X9M B;  5JWO B;  2DMM A;  3HKR A;  4BVY B;  3KIJ A;  3MWH A;  3ED3 A;  4X0X A;  1YKA A;  4EXJ A;  4L0U A;  3KXO A;  6GSS A;  3GKM A;  5CYY A;  2X8C A;  5DAL A;  2HSM A;  3PR8 A;  4NAX A;  4IHU A;  1PN0 A;  4G10 A;  3ZTL A;  3D4T A;  3GRX A;  1TI1 A;  3C1S A;  3EU4 A;  1TRV A;  2C0E A;  4V1A p;  1VF2 A;  1WOU A;  4O32 A;  2GS3 A;  1MD3 A;  2WS2 A;  2IN3 A;  2V32 A;  3QD9 A;  4K7I A;  1Z3E A;  1ERV A;  4TR0 A;  1SYR A;  3TCO A;  4ZBA A;  2LJK A;  4O5R A;  1O8X A;  5C04 A;  1LJR A;  14GS A;  4QL9 A;  4POM A;  2VOC A;  4Z2T A;  1HNB A;  1JZR A;  1EWX A;  1TJD A;  3TKS E;  4WF4 A;  5ECH B;  4KF9 A;  5L71 A;  1GP1 A;  4PTS A;  3RPN A;  4NPB A;  3I69 A;  4MF6 A;  5GST A;  1KBN A;  4AJ7 A;  3VI7 A;  1AQW A;  1FO5 A;  2QSI A;  3ZL5 A;  1PKW A;  3MDK A;  3C7M A;  1GUK A;  4KW6 A;  4HI7 A;  1JFU A;  3UVT A;  4NV2 A;  2B7J A;  3O6T A;  4TXO A;  2CZ3 A;  5J41 A;  5DQY A;  4WKW A;  1HYU A;  1TRU A;  3VPQ A;  5ECO B;  3H1N A;  4N10 A;  5ECQ B;  4O92 A;  1TK5 B;  3FZA A;  1K3L A;  1AUC A;  2H6X A;  1K0N A;  2YV7 A;  1ZGN A;  4QL7 A;  2TRX A;  1EGO A;  3VUR A;  1GUL A;  2CX4 A;  2GSS A;  1QXH A;  3U6V A;  3IAM 2;  2EIO A;  2VUP A;  2F51 A;  6GST A;  4K5S A;  2MMO A;  5KOX A;  2B6M A;  4EL1 A;  4FO5 A;  2LRN A;  4GSS A;  5J5N A;  1GSU A;  11GS A;  3LOR A;  2ES7 A;  2C0D A;  4MP4 A;  2RLI A;  4D73 B;  4G2E A;  3LWA A;  1K3Y A;  4OWY A;  4FYB A;  4IN0 A;  1B4P A;  1Z6N A;  3GSS A;  3CMI A;  2ON5 A;  3H4K A;  1YY7 A;  4OO5 A;  3LW9 A;  3TB2 A;  3W8S A;  3GTU B;  3L0H A;  3UAP A;  2VAF A;  4JZQ A;  3FR9 A;  5D9X A;  5ECR B;  2I4A A;  2FA8 A;  1B8X A;  1A0F A;  1THX A;  1M0U A;  2IMF A;  2C0F A;  2L5L A;  1EEM A;  1BJX A;  3ZRD A;  1FB6 A;  4XIH A;  2C0G A;  2LST A;  3BOA A;  1T00 A;  2FWG A;  4EUY A;  2P5R A;  2YV9 A;  5D96 A;  4YQU A;  1SK1 A;  2REM A;  5E59 A;  3QCP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...