3ZIVA

Crystal structure of ancestral thioredoxin relative to last archaea- eukaryotes common ancestor (aeca) from the precambrian period
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
105
Chain Sequence
SVIEINDENFDEVIKKSDKVVVVDFWAEWCGPCRMIAPIIEELAEEYAGKVVFGKVNVDENPEIAAKYGIMSIPTLLFFKNGKVVDQLVGARPKEALKERIKKYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AECA THIOREDOXIN
publication title Conservation of Protein Structure Over Four Billion Years
pubmed doi rcsb
source organism Synthetic construct
molecule tags Oxidoreductase
total genus 25
structure length 105
sequence length 105
chains with identical sequence B, C
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2013-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3zivA00
3M3MA 4MJAA 1N2AA 2C80A 4PGTA 1HYUA 4EKZA 1EEJA 1TRSA 2RLIA 1WOUA 4TR4A 4N11A 2RUFA 2VM2A 5ECRB 3HA9A 3ZVJA 3L4NA 2DMMA 3C73A 3J7Yk 2YZUA 2OBIA 3KGKA 1XZOA 2MMOA 2JADA 3APSA 1OAZA 3FY7A 5DCGA 3TRPA 4OO4A 5AN1A 5EVOA 2PGTA 4EUYA 3EMXA 3GX8A 3GRXA 2IFQA 2H73A 1N8JA 1ZOFA 1SD8A 1R5AA 12GSA 1NW2A 5GAPD 4EXJA 1PKZA 1TI1A 3GKKA 1PRXA 2DLXA 3FZ9A 2P5RA 2C0GA 1U3IA 3EURA 1EOGA 1H4OA 2K8VA 6GSTA 4JRRA 10GSA 2VCZA 2KHPA 3MDKA 4NHZA 2R37A 4J56E 3D6IA 5DBQA 5B7CA 4FH8A 4NXIA 2J9HA 5G1LA 5DDLA 3WYWA 1X5CA 2PWJA 1A23A 4WR4A 1VF3A 4TRXA 4MP4A 2WB9A 2HE3A 1OKDA 4IJ3A 2C3TA 3CSJA 3G7JA 1KEBA 1Z9HA 3F3QA 1X0RA 2MMNA 3VLNA 3I43A 1USBA 2Z9SA 3FW2A 3F8UA 1PL2A 5IM9A 2LKUA 2OJLA 3VWVA 2FWHA 2YPMA 2DSAA 5IIZA 1F37A 2DJJA 2G0FA 2QC7A 2WS2A 1ACVA 2FUG2 2BJXA 1Q98A 3U6VA 5DALB 5KN2A 4I5QA 5CREA 2JU5A 4NV2A 4XIHA 3HCZA 3U5RE 3QAVA 3IXRA 3TKQA 1J08A 14GSA 2YV9A 2TRXA 2WJUA 1URMA 3H1NA 3GSSA 4ZL8A 1OE7A 1T7PB 1V98A 5ECPB 1O85A 3UBKA 1PD21 2X64A 3CYNA 1G6YA 5DCHA 4V1Ap 4Q5FA 3HY2A 4IP1A 3CBUA 4KW6A 1PGTA 3D0ZA 3KP9A 1IYHA 4P3YB 4D73A 3UAPA 5HR3A 3LG6A 3ZMKA 1K0NA 2N5FA 1VF2A 1SYRA 1OVNA 2XBIA 2IPAA 1GTIA 3M0FA 3E3EA 4LL4B 3C71A 2A2RA 4N0ZA 3L9SA 4KCAA 4MABA 1NHOA 4HDEA 4MLYA 3BJ5A 3ZMLA 1PSQA 3LFLA 2LRTA 1SKRB 3P90A 5LNKe 5CYYA 2FGXA 1G7EA 4QL7A 1F2EA 1LBKA 3QAWA 2B1LA 2WZ9A 4FO5A 4X0XA 1PMTA 3PR8A 2OE1A 2VL9A 4OCEA 1MD4A 2HI7A 3GKMA 3D4TA 4MMMA 4YAPA 3KIJA 3ZIJA 3PH9A 2EIQA 1EWXA 5CRWA 3IK9A 1GUHA 5J9BA 4ZBAA 2RIIA 3F3RA 4WF5A 2WCIA 1T3BA 1V58A 2ZNMA 2HRNA 5ELAA 1Z3EA 5LD0A 1EV9A 3KH7A 4N0VA 3HKRA 4EE0A 4WKWA 3EC3A 1A2LA 3NZNA 3GTUA 3US3A 4EDYA 3QMXA 1GUMA 2H0HA 3HXSA 3F4SA 1FHEA 3DVXA 4JE1A 5B6MA 2CZ2A 2IIYA 2K9FA 3HVXA 1YF1A 2PVQA 3E0UA 1GNWA 1ZL9A 3KP8A 4IVFA 2AYTA 3GH9A 3HJOA 4Q5QA 3ISOA 5GSSA 4IHUA 5COHA 1BG5A 4ZB6A 1SJZA 2LTKA 3HZ8A 2CA8A 4AJ8A 4L8EA 3GH6A 3ZL5A 4BA7A 1PN9A 2C3NA 2MBTA 3FK8A 1DE2A 3HDCA 1VF1A 2F51A 1ABAA 5CO3A 1XFLA 1AAZA 4K7IA 2QKEA 5JWRB 1RK4A 2AV4A 2HRFA 2L5OA 2YANA 1SL1B 1O81A 2PN8A 3TB2A 2MMAA 1VGLA 2V41A 4GXZA 3CSHA 3TKSE 3DKSA 4GQFA 3ME7A 4I8BA 1GL8A 4MH2A 1TK0B 1XOAA 2F9SA 4BVXA 4K9ZA 1YKCA 5KEJA 2N5AA 1XWAA 2R5GA 1THXA 5D9VA 1FVJA 1JHBA 3VWWA 3BCIA 2FD3A 1YZXA 3M8NA 1FOVA 1THOA 3WT1A 4NMUA 2AJQB 5JWOB 2LS5A 1CQGA 2DMLA 1QGVA 4WR5A 1QFNA 5D9WA 4X43A 4Q5RA 4PQ1A 4MH3A 4K8MA 3K8NA 2VL2A 4IGJA 2LQQA 5DAKA 1JZRA 4RQXA 4QL9A 4ML1A 2L6DA 3LQ7A 5DJLA 3DMLA 3P8WA 2GT6A 1SJIA 3R2QA 3RHBA 5IMZA 4CDOA 3FR3A 1EEMA 3N9JA 4LMWA 4KUNA 4MJEA 2H0GA 1DBYA 1NM3A 1F3BA 4G9HA 5L71A 2GDRA 4OFNA 1GLPA 1BJXA 2IWTA 3VWUA 3C7MA 20GSA 3RDWA 5E4WA 2CQ9A 2R6KA 2VCXA 1XWBA 1MEKA 1TJDA 4GQCA 3IBHA 1YKAA 4XHMA 5F0GA 4IW9A 4H86A 3DIEA 4ZL9A 5G2ZA 5J4UA 4PX1A 1GTUA 4KSMA 1MTCA 4MJCA 3OR5A 3ED3A 1ZZYA 4X1UA 2C1YA 3UEMA 2CT6A 3DD3A 2HSYA 2GZPA 5ECLB 2L6CA 1XBSA 5ECQB 4GSNA 2JL4A 4GF0A 4YQMA 3O3TA 1TRUA 5HR1A 2HXKA 2K18A 1W89A 5DQSA 1ZYEA 1DSBA 1JLVA 2E0QA 5CRGA 2ON5A 4DEJA 2PUKC 1F3AA 1T00A 1GH2A 1SK2A 4WEYA 3ERGA 2H01A 4EVMA 3C8EA 2AUVA 2B5YA 3RPPA 1QK8A 1OKTA 2CVDA 4JBBA 3MAKA 2IMKA 4IS0A 4MPGA 5E59A 5GAND 4PQHA 3TJFA 3GA4A 2V2GA 3NIVA 4WBRD 1TU8A 2BMXA 1V2AA 1GTBA 1R5PA 3TRXA 1CQHA 1MDKA 5F07A 2DIZA 3GL5A 1GTAA 5FT3A 2H76A 1M2AA 4KAEA 7GSSA 2YZHA 1XOBA 3TKSC 3APOA 1JZDA 3LYKA 2F8FA 2H74A 4EO3A 2AHEA 1K0CA 4O32A 3SBCA 1DE1A 2DJ2A 3EVIA 5GSTA 1J0FA 2CZ3A 1FB6A 2C3QA 3DRNA 4E8EA 3V1WA 1I9DA 1EZKA 4Q5NA 3TDGA 5ECHB 1B4PA 5ECMB 2B5XA 2VLTA 4F0BA 1O8XA 3UVTA 5DALA 3C1RA 1SK0A 4GLTA 3I9V2 5IO0A 1E6BA 1EV4A 1X9WB 3LXZA 4O7HA 2O85A 4I2UA 1TRWA 1XVWA 5EPFA 4XCSA 6GSVA 5IO2A 3KD0A 2H6YA 2KLXA 1SL2B 4G19A 1M9AA 3EMPA 4TN8A 3J7Yb 2TRCP 2B1KA 3GL3A 1LU4A 4GSTA 3BD2A 1A8YA 2IMDA 2YJHA 5ID2B 5IQYA 4MK3A 3F4RA 3D5JA 2H72A 4HZ4A 2B5EA 1M2DA 2FCHA 3QDNA 3EINA 3DWVA 2GTUA 5IMCA 3KZQA 3LXTA 4BWSA 2VM1A 1SD9A 2VCTA 4XTSA 2GZYA 3DGQA 5AIXA 1A2MA 19GSA 1GRXA 4GCIA 4OFMA 4ECBA 2FA8A 3FZAA 4TKYA 1ZMAA 4TR1B 3ZREA 1SKWB 2GT5A 5LCZA 1O73A 3KMOA 1ZYQB 2HZEB 4F2IA 3QD9A 4XS4B 1KNGA 4IQ1A 1WPIA 2NDOA 2JSYA 3GYKA 2NBSA 5C04A 1AUCA 3FEUA 5ENUA 3ZZXA 1M99A 5JCWA 3L0HA 4WETA 3LSZA 18GSA 1EP7A 2VLVA 1AW9A 1SJ6A 2BTOT 2CVBA 2GZZA 2HFDA 2FWGA 3BCKA 4ZB8A 3W6GA 2O8VB 3ZITA 4YQVA 1FG4A 4KDUA 3GMFA 3ZLPA 6GSWA 2RUEA 1SK1A 3DVWA 3IC4A 1BYEA 3GKNA 3CSIA 1AQVA 2IMIA 2A2SA 2FWEA 3KCMA 4RI6A 2YP6A 1PA3A 4KSOA 5B8BA 3E9JB 4DSSB 1YY7A 5D93A 1TTZA 2LJKA 4TXVA 1T4YA 4WBJA 4HQZA 2IMEA 4K1FA 4I97A 1B9XC 2B7JA 2EIOA 1XPVA 4HI7A 4HQSA 1MDIA 1ZGNA 4MCUA 5HFKA 2DJ0A 1KBNA 2WDUA 3UVHA 1Z6NA 1U6TA 6GSXA 1QUWA 3KTLA 5IMDA 3GURA 3G9BA 4V1Ag 2ZUPA 3ZTLA 3TJJA 3UOMA 3EE2A 4IJIA 2XPDA 2IN3A 3FHKA 1VRSD 2O7KA 4XRDA 2JACA 4POBA 3FZ5A 1O6JA 2KP2A 2L5LA 3N5OA 1UA5A 3TRQA 3VPTA 2CAQA 1WE0A 3LEFA 5IMFA 2H66A 3MWHA 2YWNA 2X8GA 1JLWA 3BOAA 3H79A 4LL1B 5EL8A 2PERA 1YDKA 4GRFA 1TK8B 3VI7A 1S3DA 2LJRA 4ML6A 4PUFC 1FAAA 4TXOB 3L78A 2GQMA 4KB3A 2C4JA 4MZWA 1TK5B 1ST9A 1A24A 3UBLA 1A0RP 2GQLA 1GWCA 2VUPA 2X8CA 2C0DA 2D2ZA 3KEBA 2FY6A 4XS6A 4KNDA 4TOPA 2M46A 2P31A 2O89A 1V57A 2L4CA 2M80A 2B3SA 1AXDA 3W8JA 1V9WA 4HJMA 5H5RA 2C0EA 2QSIA 3NOFA 3CMIA 1U87A 3APQA 5FHIA 1GULA 4KE3A 2GSTA 6GSSA 3HVVA 4ID0A 5ECKB 2LUSA 2R3XA 1F9MA 1X5DA 2XBQA 2LRNA 4OO5A 3GFKA 3HJMA 1BX9A 3CTFA 4NWYA 1OC3A 2F3MA 3WD6A 3QAGA 3P7XA 3JCML 4AF2A 5IPHA 5A5KA 1W4VA 2E2GA 3FYGA 3UL3A 2R4VA 1WWJA 2OE0A 4JR4A 5DJMA 4LMVA 3WGXA 5J41A 4EF0A 2X99A 3GUSA 4O5RA 1RQMA 3CRUA 3TKPA 3HJPA 1UN2A 3P2AA 5IPGA 3A2VA 2HYXA 1PL1A 4POKA 3WT2A 5D8IA 4HZ2A 2VL3A 3IR4A 3VFIA 3QCPA 3DYRA 4MJBA 3G7IA 2L57A 3Q6OA 3ZIVA 4ZIJA 2V6OA 2AAWA 3RAZA 1JFUA 2HZFA 2J23A 4HJ2A 3TUEA 3IAM2 3F4TA 1KTEA 1XW6A 1F6MC 1HQOA 1OC9B 1K0AA 2YWOA 2A4VA 2YNXA 2QGVA 3D4MA 1T8EB 1U88A 2E7PA 4KA0A 4KDYA 1Z7PA 2MYGA 3IK7A 4KX4A 1K0DA 5JCGA 2HSHA 4LLRA 3WGEA 1K3YA 1XW5A 1PX6A 3TCOA 1YF0A 2H30A 3GX0A 1FO5A 1H75A 4OD7A 1TOFA 1ERVA 5CNWA 4HU7A 3FRCA 3IPZA 1K3LA 1OC8A 1SYXA 2OKAA 4F0CA 4CW9A 3KJYA 5D9XA 2LNTA 3VURA 4ILFA 3CXGA 4ZXGA 1AIUA 1XIYA 4TVEA 3D21A 3GV1A 3F63A 4OWYA 2V1MA 3UIWA 4OFTA 3VK9A 4PNFA 3FKFA 5HR2A 1TP9A 1GSQA 4ECJA 4IKHA 3IOSA 1HNCA 4J2FA 4ECIA 1R7HA 3VI5A 1GSYA 3HD5A 4HEA2 2CVKA 3M9KA 1AQWA 1ZCPA 4FYUA 4PQIA 2B6MA 1R26A 2YWMA 4G10A 1TU7A 1ERTA 1UC7A 1GSEA 2HT9A 2PVOC 3H8QA 1K0BA 1Y25A 2GQKA 4IP6A 2ALBA 2VLUA 3I69A 5D96A 2K6VA 1TRVA 2E2MA 3TJBA 2PPTA 4IN0A 5A4WA 1ILOA 2P0GA 4ECCA 5ID2A 1DUGA 3D22A 1XW9A 4YAVA 2X8HA 3L9UA 2P5QA 4MF7A 2VIMA 2XHFA 4L5OA 2VCWA 5FWGA 1ML6A 4QQ7A 4NHWA 2H8LA 4K6XA 4K0GA 5IMAA 2OACA 1YEXA 4JU5A 3TOUA 4FIWA 4F82A 1O8WA 2OE3A 2H75A 5IOXA 1NHYA 1ERUA 4WF4A 4HUAA 2GSRA 2H1GA 1V40A 1EP8A 1R4WA 5G5FA 2IL3A 4TR1A 1GSSA 4DSRA 1BAYA 2F8AA 2C8UA 5INYA 1GSUA 4XRAA 1LJRA 2HZEA 4MZBA 2NTOA 1Z7RA 5JWQB 2VO4A 3GN3A 4FYBA 3F6FA 2LJAA 4XS4A 1X9MB 2DJ1A 4ZBDA 2V6KA 4MPFA 3ZFBA 1B4QA 2VCQA 2NPBA 1M9BA 2H1BA 4F9ZA 1Q4JA 1VF4A 4ACSA 4J57E 4AGSA 3AY8A 3GKXA 3QFBC 5GZZB 1TKDB 3I6AA 2YJ7A 17GSA 3EYTA 2M72A 4BWQA 2AB6A 3TOTA 3GSTA 1GSDA 3Q18A 1WP0A 5CRHA 2EIRA 4NPBA 1WMJA 4POLA 1G7OA 2I3YA 5A4VA 4JZQA 5KN0A 4DSSA 1ERWA 4E8HA 5F05A 2DIYA 4JEDA 1JZWA 1TW9A 3RHCA 5F8BA 5ECOB 4XS1A 2H19A 3IA1A 4MA9A 2CV4A 5AGYA 2OBKA 3M9JA 4IBPA 2XC2A 1HNAA 1Z5YE 4ULXA 1GLQA 3KMNA 2VD1A 1ON4A 2H6ZA 5HFIA 5IMVA 5G1KA 1C72A 2MZCA 4V2NA 4RI7A 2H71A 5ELGA 4ZL7A 4I6XA 1EOHA 4ZB9A 4WXTA 2CAIA 2FNOA 2VD0A 5H5SA 4PNGA 4NAXA 4MDCA 5ABRA 2WFCA 1O7UA 3KM6A 2GVPA 4K0NA 3IAS2 3FR6A 1YEPA 1B8XA 2YCDA 2K8SA 2KOKA 4EL1A 3IRAA 2L59A 2MMZA 3KH9A 2IFQB 4TXOA 2I9HA 4HS1A 4ISDA 2LNSA 3WGDA 3GHAA 2WGRA 5F06A 5ECNB 6GSUA 3TKRA 1EGOA 3Q19A 3EWLA 5AISA 2HNLA 3HZ4A 3EU4A 4KGIA 1X5EA 5DQYA 4CHSA 1GNEA 4L0WA 1SENA 2MBSA 2VL2C 4FYCA 1WRYA 1WJKA 5JCUA 2L4QA 3TKSA 1HNBA 3RPNA 4KCEA 3ERWA 4OCFA 3G7YA 4N10A 3MNGA 2B7KA 5HR0A 1GUKA 4K7NA 1YQ1A 2FHEA 2JSZA 2JZSA 3UMAA 4G2EA 3TJGA 2YWIA 3VWXA 4HU9A 2DBCA 4ZILA 2DJKA 4PUAA 1RW1A 1BQ7A 3LJRA 4BVYA 3KXOA 1M0UA 3O76A 3GIXA 2TIRA 2LQOA 2ES7A 2PMTA 5EY6A 1S3AA 4RUVA 3TGZA 2WULA 4TW5A 2PBJA 4PURA 1XXUA 5G5EA 4K7OA 4YH2A 3GNJA 4PXOA 3LORA 3UARA 5C00A 3ERFA 1XWKA 3ME8A 1K3OA 4D73B 4N30A 1XCCA 4YQUA 3RBTA 1TDIA 3W8SA 1TXXA 4O92A 1HD2A 3TJKA 4EC0A 1PX7A 3ZYWA 3C1SA 5G30A 2KP1A 4IQAA 11GSA 2H70A 1OC9A 2IMFA 2YN1A 3FR9A 4MZCA 13GSA 4KH7A 1SL0B 1G0TA 2H6XA 5ECIB 5ECSA 1MDJA 3IV4A 2JZRA 2H1AA 2REMA 3ZRDA 4GWRA 2C0FA 5B6NA 2VAFA 3Q74A 4RQRA 1A2JA 2I4AA 1BEDA 1Y6EA 2N5BA 3H4KA 5IOWA 1B48A 2NVLA 2WRTA 2KUCA 2CX3A 2GSSA 2LRCA 5H5QA 2VCVA 1GP1A 2FLSA 1T4ZA 1U3AA 1Z6MA 3H93A 3QFAC 3LYPA 3M1GA 4NV5A 4L5LA 4KDXA 3SWLA 3A2XA 5HQPA 2LSTA 2RM5A 1I5GA 3GTUB 5HFGA 4AJ6A 4DSQA 3IDVA 4L0UA 1SU9A 2EC4A 1G6WA 5CRDA 5CAXA 2RM6A 1QMVA 5CP1A 4AJ7A 3KTBA 1OE8A 2LEGA 1QXHA 2PU9C 5AIVA 4V2LA 2FA4A 2G2QA 3HYPA 4F03A 3QPMA 2DC5A 4POMA 6GSYA 2H0IA 2CX4A 1B9YC 2GSQA 2JZTA 2OA7A 2ZCTA 3IE3A 2OADA 1T1VA 1FB0A 3EU3A 2O87A 2I81A 4JR6A 3HVSA 1UVZA 1QQ2A 3DEXA 2GLRA 2YV7A 5A4UA 1FW1A 1IYIA 3O6TA 5J5NA 4Z7XA 1A8LA 3BBYA 3QOUA 1E2YA 2I1UA 4MF6A 5KN1A 1XWGA 1A0FA 5DVBA 2FWFA 4MF5A 4IELA 8GSSA 1K0OA 4GSSA 5G31A 4EDZA 3F6DA 4GTUA 4OMVA 5D73A 3CTGA 2DJ3A 3LWAA 2R2JA 3A2WA 1AC1A 1OYJA 1NSWA 3LGCA 5D9TA 3ZFLA 1SKSB 2VOCA 3S9FA 4ZBBA 1MD3A 3IHQA 2GGTA 16GSA 1XWCA 1JZOA 5KN3A 3QR6A 2LV3A 2ON7A 3UJ1A 1FVKA 1GSFA 3DXBA 1PKWA 3A3TA 4I2TA 5DAKB 3PGTA 2HLSA 4LA1A 2GS3A 2YOIA 1M7TA 4TR0A 3CRTA 1S3CA 3FZ4A 2XPEA 3A5WA 3L9VA 3ZVJD 3F0IA 5B8AA 5J9CA 1X9SB 2H1DA 5J3RA 4K2DA 2V32A 4DVCA 1EGRA 1J9BA 1AQXA 1M2BA 3VPQA 1TI3A 4V2MA 4HOJA 1K0MA 1PQNA 9GSSA 4BPYA 3HHVA 1YJ6A 4TR3A 2IJYA 3PINA 4BL7A 3F9UA 1WIKA 22GSA 3MSZA 1XVQA
chains in the Genus database with same CATH superfamily
3M3MA 4MJAA 1N2AA 2C80A 4PGTA 1HYUA 4EKZA 1EEJA 1TRSA 2RLIA 1WOUA 4TR4A 4N11A 2RUFA 2VM2A 5ECRB 3HA9A 3ZVJA 3L4NA 2DMMA 1ZYPA 3C73A 3J7Yk 2YZUA 2OBIA 3KGKA 1XZOA 2MMOA 2JADA 3APSA 1OAZA 3FY7A 5DCGA 3TRPA 4OO4A 5AN1A 5EVOA 2PGTA 4EUYA 3EMXA 3GX8A 3GRXA 2IFQA 2H73A 1N8JA 1ZOFA 1SD8A 1R5AA 12GSA 4EIPA 1NW2A 5GAPD 4EXJA 1PKZA 1TI1A 3GKKA 1PRXA 2DLXA 3FZ9A 2P5RA 2C0GA 1U3IA 3EURA 1EOGA 1H4OA 2K8VA 6GSTA 4JRRA 10GSA 2VCZA 2KHPA 3MDKA 4NHZA 2R37A 4J56E 3D6IA 4YKFA 5DBQA 5B7CA 4FH8A 4NXIA 2J9HA 5G1LA 5DDLA 3WYWA 1X5CA 2PWJA 1A23A 4WR4A 1VF3A 4TRXA 4MP4A 2WB9A 2HE3A 1OKDA 4IJ3A 2C3TA 3CSJA 3G7JA 1KEBA 1Z9HA 3F3QA 1X0RA 2MMNA 3VLNA 3I43A 1USBA 2Z9SA 3FW2A 3F8UA 2QA2A 1PL2A 5IM9A 2LKUA 2OJLA 3VWVA 2FWHA 2YPMA 4G0IA 2DSAA 5IIZA 1F37A 2DJJA 2G0FA 2QC7A 2WS2A 1ACVA 2FUG2 2BJXA 1Q98A 3U6VA 5DALB 5KN2A 4I5QA 5CREA 2JU5A 4NV2A 4XIHA 3HCZA 3U5RE 3QAVA 3IXRA 3TKQA 1J08A 14GSA 2YV9A 2TRXA 2WJUA 1URMA 3H1NA 3GSSA 4ZL8A 1OE7A 1T7PB 1V98A 5ECPB 1O85A 3UBKA 1PD21 2X64A 3CYNA 1G6YA 5DCHA 4V1Ap 4Q5FA 3HY2A 4IP1A 3CBUA 4KW6A 1PGTA 3D0ZA 3KP9A 1IYHA 4P3YB 4D73A 3UAPA 5HR3A 3LG6A 3ZMKA 1K0NA 2N5FA 1VF2A 1SYRA 1OVNA 2XBIA 2IPAA 1GTIA 3M0FA 3E3EA 4LL4B 3C71A 2A2RA 4N0ZA 3L9SA 4KCAA 4MABA 1NHOA 4HDEA 4MLYA 4MNNA 3BJ5A 3ZMLA 1PSQA 3LFLA 2LRTA 1SKRB 3P90A 5LNKe 5CYYA 2FGXA 1G7EA 4QL7A 1F2EA 1LBKA 3QAWA 2B1LA 2WZ9A 4FO5A 4X0XA 1PMTA 3PR8A 2OE1A 2VL9A 4OCEA 1MD4A 2HI7A 3GKMA 3D4TA 4MMMA 4YAPA 3KIJA 3ZIJA 3PH9A 2EIQA 1EWXA 5CRWA 3IK9A 1GUHA 5J9BA 4ZBAA 2RIIA 3F3RA 4WF5A 2WCIA 1T3BA 1V58A 2ZNMA 2HRNA 5ELAA 1Z3EA 5LD0A 1EV9A 3KH7A 4N0VA 3HKRA 4EE0A 4WKWA 3EC3A 1A2LA 3HVNA 3NZNA 3GTUA 3US3A 4EDYA 5KOWA 3QMXA 2UZ8A 1GUMA 2H0HA 3HXSA 3F4SA 1FHEA 3DVXA 4JE1A 5B6MA 2CZ2A 2IIYA 2K9FA 3HVXA 1YF1A 2PVQA 3E0UA 1GNWA 1ZL9A 3KP8A 4IVFA 2AYTA 3GH9A 3HJOA 4Q5QA 3ISOA 2DKIA 5GSSA 4IHUA 5COHA 3IHGA 1BG5A 4ZB6A 1SJZA 2LTKA 3HZ8A 2CA8A 4AJ8A 4L8EA 3GH6A 3ZL5A 4BA7A 1PN9A 2C3NA 2MBTA 3FK8A 1DE2A 3HDCA 1VF1A 2F51A 1ABAA 5CO3A 1XFLA 1AAZA 4K7IA 2QKEA 5JWRB 1RK4A 2AV4A 2HRFA 2L5OA 2YANA 1SL1B 1O81A 2PN8A 3TB2A 2MMAA 1VGLA 2V41A 4GXZA 3CSHA 3TKSE 3DKSA 4GQFA 3PPUA 3ME7A 4I8BA 1GL8A 4MH2A 1TK0B 1XOAA 2F9SA 4BVXA 4K9ZA 1YKCA 5KEJA 2N5AA 1XWAA 2R5GA 1THXA 5D9VA 1FVJA 1JHBA 3VWWA 3BCIA 2FD3A 1YZXA 3M8NA 1FOVA 1THOA 3WT1A 4NMUA 2AJQB 5JWOB 2LS5A 1CQGA 2DMLA 1QGVA 4WR5A 1QFNA 5D9WA 4X43A 4Q5RA 4PQ1A 4MH3A 4K8MA 3K8NA 2VL2A 4IGJA 2LQQA 5DAKA 1JZRA 4RQXA 4QL9A 4ML1A 2L6DA 4G0LA 3LQ7A 5DJLA 3DMLA 1PFOA 3P8WA 2GT6A 1SJIA 3R2QA 3RHBA 5IMZA 4CDOA 3FR3A 1EEMA 3N9JA 4LMWA 4KUNA 4MJEA 2H0GA 1DBYA 1NM3A 1F3BA 4G9HA 4PTSA 5L71A 2GDRA 4OFNA 1GLPA 1BJXA 2IWTA 3VWUA 3C7MA 20GSA 3RDWA 5E4WA 4KF9A 2CQ9A 2R6KA 2VCXA 1XWBA 1MEKA 1TJDA 4GQCA 3IBHA 4CY6A 1YKAA 4XHMA 5F0GA 4IW9A 4H86A 3DIEA 4ZL9A 5G2ZA 5J4UA 4PX1A 1GTUA 4KSMA 4YKGA 1MTCA 4MJCA 3OR5A 3ED3A 1ZZYA 4X1UA 2C1YA 3UEMA 2CT6A 3DD3A 2HSYA 2GZPA 3LW9A 5ECLB 2L6CA 1XBSA 5ECQB 4GSNA 2JL4A 2A4HA 4GF0A 4YQMA 3O3TA 1TRUA 5HR1A 2HXKA 2DKHA 2K18A 1W89A 5DQSA 1ZYEA 1DSBA 1JLVA 2E0QA 5CRGA 2ON5A 4DEJA 2PUKC 1F3AA 1T00A 1GH2A 1SK2A 4WEYA 3ERGA 2H01A 4EVMA 3C8EA 2AUVA 4HSCX 2B5YA 4X4JA 3RPPA 1QK8A 1OKTA 2CVDA 4JBBA 3MAKA 2IMKA 4IS0A 4MPGA 5E59A 5GAND 4PQHA 3TJFA 3GA4A 2V2GA 3NIVA 4WBRD 1TU8A 2BMXA 1V2AA 1GTBA 1R5PA 3TRXA 1CQHA 1MDKA 5F07A 2DIZA 3GL5A 1GTAA 5FT3A 2H76A 1M2AA 4KAEA 7GSSA 2YZHA 1XOBA 3EPTA 3TKSC 3APOA 1JZDA 3LYKA 2F8FA 2H74A 4EO3A 2AHEA 1K0CA 4O32A 3SBCA 1DE1A 2DJ2A 3EVIA 5GSTA 1J0FA 2CZ3A 4K2XA 1FB6A 2C3QA 3DRNA 4E8EA 3V1WA 1I9DA 1EZKA 4Q5NA 3TDGA 5ECHB 1B4PA 5ECMB 2B5XA 2VLTA 4F0BA 1O8XA 3UVTA 5DALA 3C1RA 1SK0A 4GLTA 3I9V2 5IO0A 1E6BA 1EV4A 4O5UA 1X9WB 3LXZA 4O7HA 2O85A 4I2UA 1TRWA 1XVWA 5EPFA 4XCSA 6GSVA 5IO2A 3KD0A 2H6YA 2KLXA 1SL2B 4G19A 1M9AA 3EMPA 4TN8A 3J7Yb 2TRCP 2B1KA 3GL3A 1LU4A 4GSTA 3BD2A 1A8YA 2IMDA 2YJHA 5ID2B 5IQYA 4MK3A 3F4RA 3D5JA 2H72A 4HZ4A 2B5EA 1M2DA 2FCHA 3QDNA 3EINA 3DWVA 2GTUA 5IMCA 3KZQA 3LXTA 4BWSA 2VM1A 1SD9A 2VCTA 4XTSA 2GZYA 3DGQA 5AIXA 4EIQA 1A2MA 19GSA 1GRXA 4BL7B 4GCIA 4OFMA 4ECBA 2FA8A 3FZAA 4TKYA 1ZMAA 3MIXA 4TR1B 3ZREA 1SKWB 2GT5A 4Z2RA 5LCZA 1O73A 3KMOA 1ZYQB 2HZEB 4F2IA 3QD9A 2R0PA 4XS4B 1KNGA 4IQ1A 1WPIA 2NDOA 2JSYA 3GYKA 2NBSA 5C04A 1AUCA 3FEUA 5ENUA 3ZZXA 1M99A 5JCWA 3L0HA 4WETA 3LSZA 18GSA 1EP7A 2VLVA 1AW9A 1SJ6A 2BTOT 2CVBA 3IC8A 2GZZA 2HFDA 2FWGA 3BCKA 4ZB8A 3W6GA 2O8VB 3ZITA 4YQVA 1FG4A 2HRKA 4KDUA 3GMFA 3ZLPA 6GSWA 2RUEA 1SK1A 3DVWA 3IC4A 1BYEA 3GKNA 3CSIA 1AQVA 2IMIA 2A2SA 2FWEA 3KCMA 4RI6A 2YP6A 1PA3A 4KSOA 5B8BA 3E9JB 4DSSB 1YY7A 5D93A 1TTZA 2LJKA 4TXVA 1T4YA 4WBJA 4HQZA 2IMEA 4K1FA 4I97A 1B9XC 2B7JA 2EIOA 1XPVA 5KOXA 4HI7A 4HQSA 1MDIA 1ZGNA 4MCUA 5HFKA 2DJ0A 1KBNA 2WDUA 3UVHA 1Z6NA 1U6TA 6GSXA 1QUWA 3KTLA 5IMDA 3GURA 3G9BA 4V1Ag 2ZUPA 3ZTLA 3TJJA 3UOMA 3EE2A 4IJIA 2XPDA 2IN3A 3FHKA 1VRSD 2O7KA 4XRDA 2JACA 4POBA 3FZ5A 1O6JA 2KP2A 2L5LA 3N5OA 1UA5A 3TRQA 3VPTA 2CAQA 1WE0A 3LEFA 5IMFA 2H66A 3MWHA 2YWNA 2X8GA 1JLWA 3BOAA 3H79A 4LL1B 5EL8A 2PERA 1YDKA 4GRFA 1TK8B 3VI7A 1S3DA 2LJRA 4ML6A 4PUFC 1M3JA 1FAAA 4TXOB 3L78A 2GQMA 4KB3A 2C4JA 4MZWA 1TK5B 1ST9A 1A24A 3UBLA 1A0RP 2GQLA 1GWCA 2VUPA 2X8CA 2C0DA 2D2ZA 3KEBA 2FY6A 4XS6A 3R3EA 4KNDA 4TOPA 2M46A 2P31A 2O89A 1V57A 2L4CA 2M80A 2B3SA 1AXDA 3W8JA 1V9WA 4HJMA 4ICYA 5H5RA 2C0EA 2QSIA 3NOFA 3CMIA 4K5RA 1U87A 3APQA 5FHIA 1GULA 4KE3A 2GSTA 6GSSA 3HVVA 4ID0A 5ECKB 2LUSA 2R3XA 1F9MA 1X5DA 2XBQA 2LRNA 4OO5A 3GFKA 3HJMA 1BX9A 2R0GA 3CTFA 1OC3A 2F3MA 4NWYA 3WD6A 3QAGA 3P7XA 3JCML 2A2PA 4AF2A 5IPHA 5A5KA 1W4VA 2E2GA 3FYGA 3UL3A 4BVYB 2R4VA 1WWJA 2OE0A 4JR4A 5DJMA 4LMVA 3WGXA 5J41A 4EF0A 2X99A 3GUSA 4O5RA 1RQMA 3CRUA 3TKPA 3HJPA 1UN2A 3P2AA 5IPGA 3A2VA 2HYXA 1PL1A 4POKA 3WT2A 5D8IA 4HZ2A 2VL3A 3IR4A 3VFIA 3QCPA 3DYRA 4MJBA 3G7IA 2L57A 4BIKA 3Q6OA 3ZIVA 4ZIJA 2V6OA 2AAWA 3RAZA 1JFUA 2HZFA 2J23A 4HJ2A 3TUEA 3IAM2 3F4TA 1KTEA 1XW6A 1F6MC 1HQOA 1OC9B 1K0AA 2YWOA 2A4VA 2YNXA 2QGVA 3D4MA 1T8EB 1U88A 2E7PA 4KA0A 4KDYA 1Z7PA 2MYGA 3IK7A 4KX4A 1K0DA 5JCGA 2HSHA 4LLRA 3WGEA 1K3YA 2R0CA 1XW5A 1PX6A 3TCOA 1YF0A 2H30A 4A5PA 3GX0A 1FO5A 1H75A 4OD7A 1TOFA 1ERVA 5CNWA 4HU7A 3FRCA 3IPZA 1K3LA 1OC8A 1SYXA 2OKAA 4F0CA 4CW9A 3KJYA 5D9XA 2LNTA 3VURA 4ILFA 3CXGA 4ZXGA 1AIUA 1XIYA 4TVEA 3D21A 3GV1A 3F63A 4OWYA 2V1MA 3UIWA 4OFTA 3VK9A 4PNFA 3FKFA 5HR2A 1TP9A 1GSQA 4ECJA 4IKHA 3IOSA 1HNCA 4J2FA 4ECIA 1R7HA 3VI5A 1GSYA 3HD5A 4HEA2 2CVKA 3M9KA 1AQWA 1ZCPA 4FYUA 4PQIA 4G0KA 2B6MA 1R26A 2YWMA 4G10A 1TU7A 1ERTA 1UC7A 1GSEA 2HT9A 2PVOC 3H8QA 1K0BA 1Y25A 2GQKA 4IP6A 2ALBA 2VLUA 3I69A 5D96A 2K6VA 1TRVA 2E2MA 1ZYNA 3TJBA 2PPTA 4IN0A 5A4WA 1ILOA 2P0GA 4ECCA 5ID2A 1DUGA 3D22A 1XW9A 4YAVA 2X8HA 3L9UA 2P5QA 4MF7A 2VIMA 2XHFA 4L5OA 2VCWA 5FWGA 1ML6A 2X49A 4QQ7A 4NHWA 2H8LA 4K6XA 4K0GA 5IMAA 2OACA 1YEXA 4JU5A 3TOUA 4FIWA 4F82A 1O8WA 2OE3A 2H75A 5IOXA 1NHYA 1ERUA 5BRTA 4WF4A 4HUAA 2GSRA 2H1GA 1V40A 1EP8A 1R4WA 3CQFA 5G5FA 2IL3A 4TR1A 1GSSA 4DSRA 3FMWA 1BAYA 2F8AA 2C8UA 5INYA 1GSUA 4XRAA 2HRAA 1LJRA 2HZEA 4MZBA 2NTOA 1Z7RA 5JWQB 2VO4A 3GN3A 4FYBA 3F6FA 2LJAA 4XS4A 1X9MB 2DJ1A 4ZBDA 2V6KA 4MPFA 3ZFBA 1B4QA 2VCQA 2NPBA 1M9BA 2H1BA 4F9ZA 1Q4JA 1VF4A 4ACSA 4J57E 4AGSA 3AY8A 3GKXA 3QFBC 5GZZB 1TKDB 3I6AA 2YJ7A 17GSA 3EYTA 2M72A 4BWQA 2AB6A 3TOTA 3GSTA 1GSDA 3Q18A 1WP0A 2HSMA 5CRHA 2EIRA 4NPBA 1WMJA 4POLA 1G7OA 2I3YA 5A4VA 4JZQA 5KN0A 4DSSA 1ERWA 4E8HA 5F05A 2DIYA 4JEDA 1JZWA 1TW9A 3RHCA 5F8BA 5ECOB 4Z2TA 4XS1A 2H19A 3IA1A 4MA9A 2CV4A 5AGYA 2OBKA 3M9JA 4IBPA 2XC2A 1HNAA 1Z5YE 4ULXA 1GLQA 3KMNA 2VD1A 1ON4A 2H6ZA 5HFIA 5IMVA 5G1KA 1C72A 2MZCA 4V2NA 4RI7A 2H71A 5ELGA 4ZL7A 4I6XA 1EOHA 4ZB9A 4WXTA 2CAIA 2FNOA 2VD0A 5H5SA 4PNGA 4NAXA 4MDCA 5ABRA 2WFCA 1O7UA 3KM6A 2GVPA 4K0NA 3IAS2 3FR6A 1YEPA 3MYDA 1B8XA 2YCDA 2K8SA 2KOKA 4EL1A 3IRAA 2L59A 2MMZA 3KH9A 1FOHA 2IFQB 4TXOA 2I9HA 4HS1A 4ISDA 2LNSA 3WGDA 3GHAA 2WGRA 5F06A 5BMUA 5ECNB 6GSUA 3TKRA 1EGOA 3Q19A 3EWLA 5AISA 2HNLA 3HZ4A 3EU4A 3A5IA 4KGIA 1X5EA 5DQYA 4CHSA 1GNEA 4L0WA 1SENA 1S3RA 2MBSA 2VL2C 4FYCA 2X4AA 1WRYA 1WJKA 5JCUA 2L4QA 3TKSA 4FQUA 1HNBA 3RPNA 4KCEA 3ERWA 4OCFA 3G7YA 4N10A 3MNGA 4Z2UA 2B7KA 5HR0A 1GUKA 4K7NA 1YQ1A 2FHEA 2QA1A 2JSZA 2JZSA 3UMAA 1XG8A 4G2EA 3TJGA 2YWIA 3VWXA 4HU9A 2DBCA 4ZILA 2DJKA 4PUAA 1RW1A 1BQ7A 3LJRA 4BVYA 3KXOA 1M0UA 3O76A 3GIXA 2TIRA 2LQOA 2ES7A 2PMTA 5EY6A 1S3AA 4RUVA 3TGZA 2WULA 4TW5A 2PBJA 4PURA 1XXUA 5G5EA 4K7OA 4YH2A 3GNJA 4PXOA 3LORA 3UARA 5C00A 3ERFA 1XWKA 3ME8A 1K3OA 4D73B 4N30A 1XCCA 4YQUA 3RBTA 1TDIA 3W8SA 1TXXA 4O92A 1HD2A 3TJKA 4EC0A 1PX7A 3ZYWA 3C1SA 5G30A 2KP1A 4IQAA 11GSA 1PN0A 2H70A 1OC9A 2IMFA 2YN1A 3FR9A 4MZCA 13GSA 4KH7A 1SL0B 1G0TA 2H6XA 5ECIB 5ECSA 1MDJA 3IV4A 2JZRA 2H1AA 2REMA 3ZRDA 4GWRA 2C0FA 5B6NA 2VAFA 3Q74A 4RQRA 1A2JA 2I4AA 1BEDA 1Y6EA 2N5BA 3H4KA 5IOWA 1B48A 2NVLA 2WRTA 2KUCA 2CX3A 2GSSA 2LRCA 5H5QA 2VCVA 1GP1A 2FLSA 1T4ZA 1U3AA 1Z6MA 3H93A 3QFAC 3LYPA 3M1GA 4NV5A 4L5LA 4KDXA 3SWLA 3A2XA 5HQPA 2LSTA 2RM5A 1I5GA 3GTUB 5HFGA 4AJ6A 4DSQA 3IDVA 4L0UA 1SU9A 2EC4A 1G6WA 5CRDA 5CAXA 2RM6A 1QMVA 5CP1A 4AJ7A 4USSA 3KTBA 1OE8A 2LEGA 1QXHA 2PU9C 5AIVA 4V2LA 2FA4A 2G2QA 3HYPA 4F03A 3QPMA 2DC5A 4POMA 6GSYA 2H0IA 2CX4A 1B9YC 2GSQA 2JZTA 2OA7A 2ZCTA 3IE3A 2OADA 1T1VA 1FB0A 3EU3A 2O87A 2I81A 4JR6A 3HVSA 1UVZA 1QQ2A 3DEXA 2GLRA 2YV7A 5A4UA 1FW1A 1IYIA 3O6TA 5J5NA 1M3IA 4Z7XA 1A8LA 3BBYA 3QOUA 1E2YA 2I1UA 4MF6A 5KN1A 1XWGA 1A0FA 5DVBA 2FWFA 4MF5A 4IELA 8GSSA 1K0OA 4BVXB 4GSSA 5G31A 4EDZA 3F6DA 4GTUA 4OMVA 5D73A 3CTGA 2DJ3A 3LWAA 2R2JA 3A2WA 1AC1A 1OYJA 1NSWA 3LGCA 5D9TA 3ZFLA 1SKSB 2VOCA 3S9FA 4ZBBA 1MD3A 3IHQA 2GGTA 16GSA 1XWCA 1JZOA 5KN3A 3QR6A 2LV3A 2ON7A 3UJ1A 1FVKA 1GSFA 3DXBA 1PKWA 3A3TA 4I2TA 5DAKB 3PGTA 4CY8A 2HLSA 4LA1A 2GS3A 2YOIA 1M7TA 4TR0A 3CRTA 1S3CA 3FZ4A 2XPEA 3A5WA 3L9VA 3ZVJD 3F0IA 5B8AA 5J9CA 1X9SB 2H1DA 5J3RA 4K2DA 2V32A 4DVCA 1EGRA 1J9BA 1AQXA 1M2BA 3VPQA 4O5QA 1TI3A 4V2MA 4HOJA 1K0MA 1PQNA 4K5SA 9GSSA 4BPYA 3HHVA 1YJ6A 4TR3A 2IJYA 3PINA 4BL7A 3F9UA 1WIKA 22GSA 3MSZA 1XVQA
chains in the Genus database with same CATH topology
3M3MA 4MJAA 1N2AA 2C80A 4PGTA 1HYUA 4EKZA 1EEJA 1TRSA 2RLIA 1WOUA 4TR4A 4N11A 2RUFA 2VM2A 5ECRB 3HA9A 3ZVJA 3L4NA 2DMMA 1ZYPA 3C73A 3J7Yk 2YZUA 2OBIA 3KGKA 1XZOA 2MMOA 2JADA 3APSA 1OAZA 3FY7A 5DCGA 3TRPA 4OO4A 5AN1A 5EVOA 2PGTA 4EUYA 3EMXA 3GX8A 3GRXA 2IFQA 2H73A 1N8JA 1ZOFA 1SD8A 1R5AA 12GSA 4EIPA 1NW2A 5GAPD 4EXJA 1PKZA 1TI1A 3GKKA 1PRXA 2DLXA 3FZ9A 2P5RA 2C0GA 1U3IA 3EURA 1EOGA 1H4OA 2K8VA 6GSTA 4JRRA 10GSA 2VCZA 2KHPA 3MDKA 4NHZA 2R37A 4J56E 3D6IA 4YKFA 5DBQA 5B7CA 4FH8A 4NXIA 2J9HA 5G1LA 5DDLA 3WYWA 1X5CA 2PWJA 1A23A 4WR4A 1VF3A 4TRXA 4MP4A 2WB9A 2HE3A 1OKDA 4IJ3A 2C3TA 3CSJA 3G7JA 1KEBA 1Z9HA 3F3QA 1X0RA 2MMNA 3VLNA 3I43A 1USBA 2Z9SA 3FW2A 3F8UA 2QA2A 1PL2A 5IM9A 2LKUA 2OJLA 3VWVA 2FWHA 2YPMA 4G0IA 2DSAA 5IIZA 1F37A 2DJJA 2G0FA 2QC7A 2WS2A 1ACVA 2FUG2 2BJXA 1Q98A 3U6VA 5DALB 5KN2A 4I5QA 5CREA 2JU5A 4NV2A 4XIHA 3HCZA 3U5RE 3QAVA 3IXRA 3TKQA 1J08A 14GSA 2YV9A 2TRXA 2WJUA 1URMA 3H1NA 3GSSA 4ZL8A 1OE7A 1T7PB 1V98A 5ECPB 1O85A 3UBKA 1PD21 2X64A 3CYNA 1G6YA 5DCHA 4V1Ap 4Q5FA 3HY2A 4IP1A 3CBUA 4KW6A 1PGTA 3D0ZA 3KP9A 1IYHA 4P3YB 4D73A 3UAPA 5HR3A 3LG6A 3ZMKA 1K0NA 2N5FA 1VF2A 1SYRA 1OVNA 2XBIA 2IPAA 1GTIA 3M0FA 3E3EA 4LL4B 3C71A 2A2RA 4N0ZA 3L9SA 4KCAA 4MABA 1NHOA 4HDEA 4MLYA 4MNNA 3BJ5A 3ZMLA 1PSQA 3LFLA 2LRTA 1SKRB 3P90A 5LNKe 5CYYA 2FGXA 1G7EA 4QL7A 1F2EA 1LBKA 3QAWA 2B1LA 2WZ9A 4FO5A 4X0XA 1PMTA 3PR8A 2OE1A 2VL9A 4OCEA 1MD4A 2HI7A 3GKMA 3D4TA 4MMMA 4YAPA 3KIJA 3ZIJA 3PH9A 2EIQA 1EWXA 5CRWA 3IK9A 1GUHA 5J9BA 4ZBAA 2RIIA 3F3RA 4WF5A 2WCIA 1T3BA 1V58A 2ZNMA 2HRNA 5ELAA 1Z3EA 5LD0A 1EV9A 3KH7A 4N0VA 3HKRA 4EE0A 4WKWA 3EC3A 1A2LA 3NZNA 3GTUA 3US3A 4EDYA 5KOWA 3QMXA 2UZ8A 1GUMA 2H0HA 3HXSA 3F4SA 1FHEA 3DVXA 4JE1A 5B6MA 2CZ2A 2IIYA 2K9FA 3HVXA 1YF1A 2PVQA 3E0UA 1GNWA 1ZL9A 3KP8A 4IVFA 2AYTA 3GH9A 3HJOA 4Q5QA 3ISOA 2DKIA 5GSSA 4IHUA 5COHA 3IHGA 1BG5A 4ZB6A 1SJZA 2LTKA 3HZ8A 2CA8A 4AJ8A 4L8EA 3GH6A 3ZL5A 4BA7A 1PN9A 2C3NA 2MBTA 3FK8A 1DE2A 3HDCA 1VF1A 2F51A 1ABAA 5CO3A 1XFLA 1AAZA 4K7IA 2QKEA 5JWRB 1RK4A 2AV4A 2HRFA 2L5OA 2YANA 1SL1B 1O81A 2PN8A 3TB2A 2MMAA 1VGLA 2V41A 4GXZA 3CSHA 3TKSE 3DKSA 4GQFA 3PPUA 3ME7A 4I8BA 1GL8A 4MH2A 1TK0B 1XOAA 2F9SA 4BVXA 4K9ZA 1YKCA 5KEJA 2N5AA 1XWAA 2R5GA 1THXA 5D9VA 1FVJA 1JHBA 3VWWA 3BCIA 2FD3A 1YZXA 3M8NA 1FOVA 1THOA 3WT1A 4NMUA 2AJQB 5JWOB 2LS5A 1CQGA 2DMLA 1QGVA 4WR5A 1QFNA 5D9WA 4X43A 4Q5RA 4PQ1A 4MH3A 4K8MA 3K8NA 2VL2A 4IGJA 2LQQA 5DAKA 1JZRA 4RQXA 4QL9A 4ML1A 2L6DA 4G0LA 3LQ7A 5DJLA 3DMLA 3P8WA 2GT6A 1SJIA 3R2QA 3RHBA 5IMZA 4CDOA 3FR3A 1EEMA 3N9JA 4LMWA 4KUNA 4MJEA 2H0GA 1DBYA 1NM3A 1F3BA 4G9HA 4PTSA 5L71A 2GDRA 4OFNA 1GLPA 1BJXA 2IWTA 3VWUA 3C7MA 20GSA 3RDWA 5E4WA 4KF9A 2CQ9A 2R6KA 2VCXA 1XWBA 1MEKA 1TJDA 4GQCA 3IBHA 4CY6A 1YKAA 4XHMA 5F0GA 4IW9A 4H86A 3DIEA 4ZL9A 5G2ZA 5J4UA 4PX1A 1GTUA 4KSMA 4YKGA 1MTCA 4MJCA 3OR5A 3ED3A 1ZZYA 4X1UA 2C1YA 3UEMA 2CT6A 3DD3A 2HSYA 2GZPA 3LW9A 5ECLB 2L6CA 1XBSA 5ECQB 4GSNA 2JL4A 2A4HA 4GF0A 4YQMA 3O3TA 1TRUA 5HR1A 2HXKA 2DKHA 2K18A 1W89A 5DQSA 1ZYEA 1DSBA 1JLVA 2E0QA 5CRGA 2ON5A 4DEJA 2PUKC 1F3AA 1T00A 1GH2A 1SK2A 4WEYA 3ERGA 2H01A 4EVMA 3C8EA 2AUVA 2B5YA 4X4JA 3RPPA 1QK8A 1OKTA 2CVDA 4JBBA 3MAKA 2IMKA 4IS0A 4MPGA 5E59A 5GAND 4PQHA 3TJFA 3GA4A 2V2GA 3NIVA 4WBRD 1TU8A 2BMXA 1V2AA 1GTBA 1R5PA 3TRXA 1CQHA 1MDKA 5F07A 2DIZA 3GL5A 1GTAA 5FT3A 2H76A 1M2AA 4KAEA 7GSSA 2YZHA 1XOBA 3EPTA 3TKSC 3APOA 1JZDA 3LYKA 2F8FA 2H74A 4EO3A 2AHEA 1K0CA 4O32A 3SBCA 1DE1A 2DJ2A 3EVIA 5GSTA 1J0FA 2CZ3A 4K2XA 1FB6A 2C3QA 3DRNA 4E8EA 3V1WA 1I9DA 1EZKA 4Q5NA 3TDGA 5ECHB 1B4PA 5ECMB 2B5XA 2VLTA 4F0BA 1O8XA 3UVTA 5DALA 3C1RA 1SK0A 4GLTA 3I9V2 5IO0A 1E6BA 1EV4A 4O5UA 1X9WB 3LXZA 4O7HA 2O85A 4I2UA 1TRWA 1XVWA 5EPFA 4XCSA 6GSVA 5IO2A 3KD0A 2H6YA 2KLXA 1SL2B 4G19A 1M9AA 3EMPA 4TN8A 3J7Yb 2TRCP 2B1KA 3GL3A 1LU4A 4GSTA 3BD2A 1A8YA 2IMDA 2YJHA 5ID2B 5IQYA 4MK3A 3F4RA 3D5JA 2H72A 4HZ4A 2B5EA 1M2DA 2FCHA 3QDNA 3EINA 3DWVA 2GTUA 5IMCA 3KZQA 3LXTA 4BWSA 2VM1A 1SD9A 2VCTA 4XTSA 2GZYA 3DGQA 5AIXA 4EIQA 1A2MA 19GSA 1GRXA 4BL7B 4GCIA 4OFMA 4ECBA 2FA8A 3FZAA 4TKYA 1ZMAA 3MIXA 4TR1B 3ZREA 1SKWB 2GT5A 4Z2RA 5LCZA 1O73A 3KMOA 1ZYQB 2HZEB 4F2IA 3QD9A 2R0PA 4XS4B 1KNGA 4IQ1A 1WPIA 2NDOA 2JSYA 3GYKA 2NBSA 5C04A 1AUCA 3FEUA 5ENUA 3ZZXA 1M99A 5JCWA 3L0HA 4WETA 3LSZA 18GSA 1EP7A 2VLVA 1AW9A 1SJ6A 2BTOT 2CVBA 3IC8A 2GZZA 2HFDA 2FWGA 3BCKA 4ZB8A 3W6GA 2O8VB 3ZITA 4YQVA 1FG4A 2HRKA 4KDUA 3GMFA 3ZLPA 6GSWA 2RUEA 1SK1A 3DVWA 3IC4A 1BYEA 3GKNA 3CSIA 1AQVA 2IMIA 2A2SA 2FWEA 3KCMA 4RI6A 2YP6A 1PA3A 4KSOA 5B8BA 3E9JB 4DSSB 1YY7A 5D93A 1TTZA 2LJKA 4TXVA 1T4YA 4WBJA 4HQZA 2IMEA 4K1FA 4I97A 1B9XC 2B7JA 2EIOA 1XPVA 5KOXA 4HI7A 4HQSA 1MDIA 1ZGNA 4MCUA 5HFKA 2DJ0A 1KBNA 2WDUA 3UVHA 1Z6NA 1U6TA 6GSXA 1QUWA 3KTLA 5IMDA 3GURA 3G9BA 4V1Ag 2ZUPA 3ZTLA 3TJJA 3UOMA 3EE2A 4IJIA 2XPDA 2IN3A 3FHKA 1VRSD 2O7KA 4XRDA 2JACA 4POBA 3FZ5A 1O6JA 2KP2A 2L5LA 3N5OA 1UA5A 3TRQA 3VPTA 2CAQA 1WE0A 3LEFA 5IMFA 2H66A 3MWHA 2YWNA 2X8GA 1JLWA 3BOAA 3H79A 4LL1B 5EL8A 2PERA 1YDKA 4GRFA 1TK8B 3VI7A 1S3DA 2LJRA 4ML6A 4PUFC 1FAAA 4TXOB 3L78A 2GQMA 4KB3A 2C4JA 4MZWA 1TK5B 1ST9A 1A24A 3UBLA 1A0RP 2GQLA 1GWCA 2VUPA 2X8CA 2C0DA 2D2ZA 3KEBA 2FY6A 4XS6A 3R3EA 4KNDA 4TOPA 2M46A 2P31A 2O89A 1V57A 2L4CA 2M80A 2B3SA 1AXDA 3W8JA 1V9WA 4HJMA 4ICYA 5H5RA 2C0EA 2QSIA 3NOFA 3CMIA 4K5RA 1U87A 3APQA 5FHIA 1GULA 4KE3A 2GSTA 6GSSA 3HVVA 4ID0A 5ECKB 2LUSA 2R3XA 1F9MA 1X5DA 2XBQA 2LRNA 4OO5A 3GFKA 3HJMA 1BX9A 2R0GA 3CTFA 1OC3A 2F3MA 4NWYA 3WD6A 3QAGA 3P7XA 3JCML 2A2PA 4AF2A 5IPHA 5A5KA 1W4VA 2E2GA 3FYGA 3UL3A 4BVYB 2R4VA 1WWJA 2OE0A 4JR4A 5DJMA 4LMVA 3WGXA 5J41A 4EF0A 2X99A 3GUSA 4O5RA 1RQMA 3CRUA 3TKPA 3HJPA 1UN2A 3P2AA 5IPGA 3A2VA 2HYXA 1PL1A 4POKA 3WT2A 5D8IA 4HZ2A 2VL3A 3IR4A 3VFIA 3QCPA 3DYRA 4MJBA 3G7IA 2L57A 3Q6OA 3ZIVA 4ZIJA 2V6OA 2AAWA 3RAZA 1JFUA 2HZFA 2J23A 4HJ2A 3TUEA 3IAM2 3F4TA 1KTEA 1XW6A 1F6MC 1HQOA 1OC9B 1K0AA 2YWOA 2A4VA 2YNXA 2QGVA 3D4MA 1T8EB 1U88A 2E7PA 4KA0A 4KDYA 1Z7PA 2MYGA 3IK7A 4KX4A 1K0DA 5JCGA 2HSHA 4LLRA 3WGEA 1K3YA 2R0CA 1XW5A 1PX6A 3TCOA 1YF0A 2H30A 4A5PA 3GX0A 1FO5A 1H75A 4OD7A 1TOFA 1ERVA 5CNWA 4HU7A 3FRCA 3IPZA 1K3LA 1OC8A 1SYXA 2OKAA 4F0CA 4CW9A 3KJYA 5D9XA 2LNTA 3VURA 4ILFA 3CXGA 4ZXGA 1AIUA 1XIYA 4TVEA 3D21A 3GV1A 3F63A 4OWYA 2V1MA 3UIWA 4OFTA 3VK9A 4PNFA 3FKFA 5HR2A 1TP9A 1GSQA 4ECJA 4IKHA 3IOSA 1HNCA 4J2FA 4ECIA 1R7HA 3VI5A 1GSYA 3HD5A 4HEA2 2CVKA 3M9KA 1AQWA 1ZCPA 4FYUA 4PQIA 4G0KA 2B6MA 1R26A 2YWMA 4G10A 1TU7A 1ERTA 1UC7A 1GSEA 2HT9A 2PVOC 3H8QA 1K0BA 1Y25A 2GQKA 4IP6A 2ALBA 2VLUA 3I69A 5D96A 2K6VA 1TRVA 2E2MA 1ZYNA 3TJBA 2PPTA 4IN0A 5A4WA 1ILOA 2P0GA 4ECCA 5ID2A 1DUGA 3D22A 1XW9A 4YAVA 2X8HA 3L9UA 2P5QA 4MF7A 2VIMA 2XHFA 4L5OA 2VCWA 5FWGA 1ML6A 2X49A 4QQ7A 4NHWA 2H8LA 4K6XA 4K0GA 5IMAA 2OACA 1YEXA 4JU5A 3TOUA 4FIWA 4F82A 1O8WA 2OE3A 2H75A 5IOXA 1NHYA 1ERUA 5BRTA 4WF4A 4HUAA 2GSRA 2H1GA 1V40A 1EP8A 1R4WA 5G5FA 2IL3A 4TR1A 1GSSA 4DSRA 3FMWA 1BAYA 2F8AA 2C8UA 5INYA 1GSUA 4XRAA 2HRAA 1LJRA 2HZEA 4MZBA 2NTOA 1Z7RA 5JWQB 2VO4A 3GN3A 4FYBA 3F6FA 2LJAA 4XS4A 1X9MB 2DJ1A 4ZBDA 2V6KA 4MPFA 3ZFBA 1B4QA 2VCQA 2NPBA 1M9BA 2H1BA 4F9ZA 1Q4JA 1VF4A 4ACSA 4J57E 4AGSA 3AY8A 3GKXA 3QFBC 5GZZB 1TKDB 3I6AA 2YJ7A 17GSA 3EYTA 2M72A 4BWQA 2AB6A 3TOTA 3GSTA 1GSDA 3Q18A 1WP0A 2HSMA 5CRHA 2EIRA 4NPBA 1WMJA 4POLA 1G7OA 2I3YA 5A4VA 4JZQA 5KN0A 4DSSA 1ERWA 4E8HA 5F05A 2DIYA 4JEDA 1JZWA 1TW9A 3RHCA 5F8BA 5ECOB 4Z2TA 4XS1A 2H19A 3IA1A 4MA9A 2CV4A 5AGYA 2OBKA 3M9JA 4IBPA 2XC2A 1HNAA 1Z5YE 4ULXA 1GLQA 3KMNA 2VD1A 1ON4A 2H6ZA 5HFIA 5IMVA 5G1KA 1C72A 2MZCA 4V2NA 4RI7A 2H71A 5ELGA 4ZL7A 4I6XA 1EOHA 4ZB9A 4WXTA 2CAIA 2FNOA 2VD0A 5H5SA 4PNGA 4NAXA 4MDCA 5ABRA 2WFCA 1O7UA 3KM6A 2GVPA 4K0NA 3IAS2 3FR6A 1YEPA 3MYDA 1B8XA 2YCDA 2K8SA 2KOKA 4EL1A 3IRAA 2L59A 2MMZA 3KH9A 1FOHA 2IFQB 4TXOA 2I9HA 4HS1A 4ISDA 2LNSA 3WGDA 3GHAA 2WGRA 5F06A 5BMUA 5ECNB 6GSUA 3TKRA 1EGOA 3Q19A 3EWLA 5AISA 2HNLA 3HZ4A 3EU4A 3A5IA 4KGIA 1X5EA 5DQYA 4CHSA 1GNEA 4L0WA 1SENA 2MBSA 2VL2C 4FYCA 2X4AA 1WRYA 1WJKA 5JCUA 2L4QA 3TKSA 4FQUA 1HNBA 3RPNA 4KCEA 3ERWA 4OCFA 3G7YA 4N10A 3MNGA 4Z2UA 2B7KA 5HR0A 1GUKA 4K7NA 1YQ1A 2FHEA 2QA1A 2JSZA 2JZSA 3UMAA 4G2EA 3TJGA 2YWIA 3VWXA 4HU9A 2DBCA 4ZILA 2DJKA 4PUAA 1RW1A 1BQ7A 3LJRA 4BVYA 3KXOA 1M0UA 3O76A 3GIXA 2TIRA 2LQOA 2ES7A 2PMTA 5EY6A 1S3AA 4RUVA 3TGZA 2WULA 4TW5A 2PBJA 4PURA 1XXUA 5G5EA 4K7OA 4YH2A 3GNJA 4PXOA 3LORA 3UARA 5C00A 3ERFA 1XWKA 3ME8A 1K3OA 4D73B 4N30A 1XCCA 4YQUA 3RBTA 1TDIA 3W8SA 1TXXA 4O92A 1HD2A 3TJKA 4EC0A 1PX7A 3ZYWA 3C1SA 5G30A 2KP1A 4IQAA 11GSA 1PN0A 2H70A 1OC9A 2IMFA 2YN1A 3FR9A 4MZCA 13GSA 4KH7A 1SL0B 1G0TA 2H6XA 5ECIB 5ECSA 1MDJA 3IV4A 2JZRA 2H1AA 2REMA 3ZRDA 4GWRA 2C0FA 5B6NA 2VAFA 3Q74A 4RQRA 1A2JA 2I4AA 1BEDA 1Y6EA 2N5BA 3H4KA 5IOWA 1B48A 2NVLA 2WRTA 2KUCA 2CX3A 2GSSA 2LRCA 5H5QA 2VCVA 1GP1A 2FLSA 1T4ZA 1U3AA 1Z6MA 3H93A 3QFAC 3LYPA 3M1GA 4NV5A 4L5LA 4KDXA 3SWLA 3A2XA 5HQPA 2LSTA 2RM5A 1I5GA 3GTUB 5HFGA 4AJ6A 4DSQA 3IDVA 4L0UA 1SU9A 2EC4A 1G6WA 5CRDA 5CAXA 2RM6A 1QMVA 5CP1A 4AJ7A 4USSA 3KTBA 1OE8A 2LEGA 1QXHA 2PU9C 5AIVA 4V2LA 2FA4A 2G2QA 3HYPA 4F03A 3QPMA 2DC5A 4POMA 6GSYA 2H0IA 2CX4A 1B9YC 2GSQA 2JZTA 2OA7A 2ZCTA 3IE3A 2OADA 1T1VA 1FB0A 3EU3A 2O87A 2I81A 4JR6A 3HVSA 1UVZA 1QQ2A 3DEXA 2GLRA 2YV7A 5A4UA 1FW1A 1IYIA 3O6TA 5J5NA 4Z7XA 1A8LA 3BBYA 3QOUA 1E2YA 2I1UA 4MF6A 5KN1A 1XWGA 1A0FA 5DVBA 2FWFA 4MF5A 4IELA 8GSSA 1K0OA 4BVXB 4GSSA 5G31A 4EDZA 3F6DA 4GTUA 4OMVA 5D73A 3CTGA 2DJ3A 3LWAA 2R2JA 3A2WA 1AC1A 1OYJA 1NSWA 3LGCA 5D9TA 3ZFLA 1SKSB 2VOCA 3S9FA 4ZBBA 1MD3A 3IHQA 2GGTA 16GSA 1XWCA 1JZOA 5KN3A 3QR6A 2LV3A 2ON7A 3UJ1A 1FVKA 1GSFA 3DXBA 1PKWA 3A3TA 4I2TA 5DAKB 3PGTA 4CY8A 2HLSA 4LA1A 2GS3A 2YOIA 1M7TA 4TR0A 3CRTA 1S3CA 3FZ4A 2XPEA 3A5WA 3L9VA 3ZVJD 3F0IA 5B8AA 5J9CA 1X9SB 2H1DA 5J3RA 4K2DA 2V32A 4DVCA 1EGRA 1J9BA 1AQXA 1M2BA 3VPQA 4O5QA 1TI3A 4V2MA 4HOJA 1K0MA 1PQNA 4K5SA 9GSSA 4BPYA 3HHVA 1YJ6A 4TR3A 2IJYA 3PINA 4BL7A 3F9UA 1WIKA 22GSA 3MSZA 1XVQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M3M A;  4MJA A;  1N2A A;  2C80 A;  4PGT A;  1HYU A;  4EKZ A;  1EEJ A;  1TRS A;  2RLI A;  1WOU A;  4TR4 A;  4N11 A;  2RUF A;  2VM2 A;  5ECR B;  3HA9 A;  3ZVJ A;  3L4N A;  2DMM A;  3C73 A;  3J7Y k;  2YZU A;  2OBI A;  3KGK A;  1XZO A;  2MMO A;  2JAD A;  3APS A;  1OAZ A;  3FY7 A;  5DCG A;  3TRP A;  4OO4 A;  5AN1 A;  5EVO A;  2PGT A;  4EUY A;  3EMX A;  3GX8 A;  3GRX A;  2IFQ A;  2H73 A;  1N8J A;  1ZOF A;  1SD8 A;  1R5A A;  12GS A;  1NW2 A;  5GAP D;  4EXJ A;  1PKZ A;  1TI1 A;  3GKK A;  1PRX A;  2DLX A;  3FZ9 A;  2P5R A;  2C0G A;  1U3I A;  3EUR A;  1EOG A;  1H4O A;  2K8V A;  6GST A;  4JRR A;  10GS A;  2VCZ A;  2KHP A;  3MDK A;  4NHZ A;  2R37 A;  4J56 E;  3D6I A;  5DBQ A;  5B7C A;  4FH8 A;  4NXI A;  2J9H A;  5G1L A;  5DDL A;  3WYW A;  1X5C A;  2PWJ A;  1A23 A;  4WR4 A;  1VF3 A;  4TRX A;  4MP4 A;  2WB9 A;  2HE3 A;  1OKD A;  4IJ3 A;  2C3T A;  3CSJ A;  3G7J A;  1KEB A;  1Z9H A;  3F3Q A;  1X0R A;  2MMN A;  3VLN A;  3I43 A;  1USB A;  2Z9S A;  3FW2 A;  3F8U A;  1PL2 A;  5IM9 A;  2LKU A;  2OJL A;  3VWV A;  2FWH A;  2YPM A;  2DSA A;  5IIZ A;  1F37 A;  2DJJ A;  2G0F A;  2QC7 A;  2WS2 A;  1ACV A;  2FUG 2;  2BJX A;  1Q98 A;  3U6V A;  5DAL B;  5KN2 A;  4I5Q A;  5CRE A;  2JU5 A;  4NV2 A;  4XIH A;  3HCZ A;  3U5R E;  3QAV A;  3IXR A;  3TKQ A;  1J08 A;  14GS A;  2YV9 A;  2TRX A;  2WJU A;  1URM A;  3H1N A;  3GSS A;  4ZL8 A;  1OE7 A;  1T7P B;  1V98 A;  5ECP B;  1O85 A;  3UBK A;  1PD2 1;  2X64 A;  3CYN A;  1G6Y A;  5DCH A;  4V1A p;  4Q5F A;  3HY2 A;  4IP1 A;  3CBU A;  4KW6 A;  1PGT A;  3D0Z A;  3KP9 A;  1IYH A;  4P3Y B;  4D73 A;  3UAP A;  5HR3 A;  3LG6 A;  3ZMK A;  1K0N A;  2N5F A;  1VF2 A;  1SYR A;  1OVN A;  2XBI A;  2IPA A;  1GTI A;  3M0F A;  3E3E A;  4LL4 B;  3C71 A;  2A2R A;  4N0Z A;  3L9S A;  4KCA A;  4MAB A;  1NHO A;  4HDE A;  4MLY A;  3BJ5 A;  3ZML A;  1PSQ A;  3LFL A;  2LRT A;  1SKR B;  3P90 A;  5LNK e;  5CYY A;  2FGX A;  1G7E A;  4QL7 A;  1F2E A;  1LBK A;  3QAW A;  2B1L A;  2WZ9 A;  4FO5 A;  4X0X A;  1PMT A;  3PR8 A;  2OE1 A;  2VL9 A;  4OCE A;  1MD4 A;  2HI7 A;  3GKM A;  3D4T A;  4MMM A;  4YAP A;  3KIJ A;  3ZIJ A;  3PH9 A;  2EIQ A;  1EWX A;  5CRW A;  3IK9 A;  1GUH A;  5J9B A;  4ZBA A;  2RII A;  3F3R A;  4WF5 A;  2WCI A;  1T3B A;  1V58 A;  2ZNM A;  2HRN A;  5ELA A;  1Z3E A;  5LD0 A;  1EV9 A;  3KH7 A;  4N0V A;  3HKR A;  4EE0 A;  4WKW A;  3EC3 A;  1A2L A;  3NZN A;  3GTU A;  3US3 A;  4EDY A;  3QMX A;  1GUM A;  2H0H A;  3HXS A;  3F4S A;  1FHE A;  3DVX A;  4JE1 A;  5B6M A;  2CZ2 A;  2IIY A;  2K9F A;  3HVX A;  1YF1 A;  2PVQ A;  3E0U A;  1GNW A;  1ZL9 A;  3KP8 A;  4IVF A;  2AYT A;  3GH9 A;  3HJO A;  4Q5Q A;  3ISO A;  5GSS A;  4IHU A;  5COH A;  1BG5 A;  4ZB6 A;  1SJZ A;  2LTK A;  3HZ8 A;  2CA8 A;  4AJ8 A;  4L8E A;  3GH6 A;  3ZL5 A;  4BA7 A;  1PN9 A;  2C3N A;  2MBT A;  3FK8 A;  1DE2 A;  3HDC A;  1VF1 A;  2F51 A;  1ABA A;  5CO3 A;  1XFL A;  1AAZ A;  4K7I A;  2QKE A;  5JWR B;  1RK4 A;  2AV4 A;  2HRF A;  2L5O A;  2YAN A;  1SL1 B;  1O81 A;  2PN8 A;  3TB2 A;  2MMA A;  1VGL A;  2V41 A;  4GXZ A;  3CSH A;  3TKS E;  3DKS A;  4GQF A;  3ME7 A;  4I8B A;  1GL8 A;  4MH2 A;  1TK0 B;  1XOA A;  2F9S A;  4BVX A;  4K9Z A;  1YKC A;  5KEJ A;  2N5A A;  1XWA A;  2R5G A;  1THX A;  5D9V A;  1FVJ A;  1JHB A;  3VWW A;  3BCI A;  2FD3 A;  1YZX A;  3M8N A;  1FOV A;  1THO A;  3WT1 A;  4NMU A;  2AJQ B;  5JWO B;  2LS5 A;  1CQG A;  2DML A;  1QGV A;  4WR5 A;  1QFN A;  5D9W A;  4X43 A;  4Q5R A;  4PQ1 A;  4MH3 A;  4K8M A;  3K8N A;  2VL2 A;  4IGJ A;  2LQQ A;  5DAK A;  1JZR A;  4RQX A;  4QL9 A;  4ML1 A;  2L6D A;  3LQ7 A;  5DJL A;  3DML A;  3P8W A;  2GT6 A;  1SJI A;  3R2Q A;  3RHB A;  5IMZ A;  4CDO A;  3FR3 A;  1EEM A;  3N9J A;  4LMW A;  4KUN A;  4MJE A;  2H0G A;  1DBY A;  1NM3 A;  1F3B A;  4G9H A;  5L71 A;  2GDR A;  4OFN A;  1GLP A;  1BJX A;  2IWT A;  3VWU A;  3C7M A;  20GS A;  3RDW A;  5E4W A;  2CQ9 A;  2R6K A;  2VCX A;  1XWB A;  1MEK A;  1TJD A;  4GQC A;  3IBH A;  1YKA A;  4XHM A;  5F0G A;  4IW9 A;  4H86 A;  3DIE A;  4ZL9 A;  5G2Z A;  5J4U A;  4PX1 A;  1GTU A;  4KSM A;  1MTC A;  4MJC A;  3OR5 A;  3ED3 A;  1ZZY A;  4X1U A;  2C1Y A;  3UEM A;  2CT6 A;  3DD3 A;  2HSY A;  2GZP A;  5ECL B;  2L6C A;  1XBS A;  5ECQ B;  4GSN A;  2JL4 A;  4GF0 A;  4YQM A;  3O3T A;  1TRU A;  5HR1 A;  2HXK A;  2K18 A;  1W89 A;  5DQS A;  1ZYE A;  1DSB A;  1JLV A;  2E0Q A;  5CRG A;  2ON5 A;  4DEJ A;  2PUK C;  1F3A A;  1T00 A;  1GH2 A;  1SK2 A;  4WEY A;  3ERG A;  2H01 A;  4EVM A;  3C8E A;  2AUV A;  2B5Y A;  3RPP A;  1QK8 A;  1OKT A;  2CVD A;  4JBB A;  3MAK A;  2IMK A;  4IS0 A;  4MPG A;  5E59 A;  5GAN D;  4PQH A;  3TJF A;  3GA4 A;  2V2G A;  3NIV A;  4WBR D;  1TU8 A;  2BMX A;  1V2A A;  1GTB A;  1R5P A;  3TRX A;  1CQH A;  1MDK A;  5F07 A;  2DIZ A;  3GL5 A;  1GTA A;  5FT3 A;  2H76 A;  1M2A A;  4KAE A;  7GSS A;  2YZH A;  1XOB A;  3TKS C;  3APO A;  1JZD A;  3LYK A;  2F8F A;  2H74 A;  4EO3 A;  2AHE A;  1K0C A;  4O32 A;  3SBC A;  1DE1 A;  2DJ2 A;  3EVI A;  5GST A;  1J0F A;  2CZ3 A;  1FB6 A;  2C3Q A;  3DRN A;  4E8E A;  3V1W A;  1I9D A;  1EZK A;  4Q5N A;  3TDG A;  5ECH B;  1B4P A;  5ECM B;  2B5X A;  2VLT A;  4F0B A;  1O8X A;  3UVT A;  5DAL A;  3C1R A;  1SK0 A;  4GLT A;  3I9V 2;  5IO0 A;  1E6B A;  1EV4 A;  1X9W B;  3LXZ A;  4O7H A;  2O85 A;  4I2U A;  1TRW A;  1XVW A;  5EPF A;  4XCS A;  6GSV A;  5IO2 A;  3KD0 A;  2H6Y A;  2KLX A;  1SL2 B;  4G19 A;  1M9A A;  3EMP A;  4TN8 A;  3J7Y b;  2TRC P;  2B1K A;  3GL3 A;  1LU4 A;  4GST A;  3BD2 A;  1A8Y A;  2IMD A;  2YJH A;  5ID2 B;  5IQY A;  4MK3 A;  3F4R A;  3D5J A;  2H72 A;  4HZ4 A;  2B5E A;  1M2D A;  2FCH A;  3QDN A;  3EIN A;  3DWV A;  2GTU A;  5IMC A;  3KZQ A;  3LXT A;  4BWS A;  2VM1 A;  1SD9 A;  2VCT A;  4XTS A;  2GZY A;  3DGQ A;  5AIX A;  1A2M A;  19GS A;  1GRX A;  4GCI A;  4OFM A;  4ECB A;  2FA8 A;  3FZA A;  4TKY A;  1ZMA A;  4TR1 B;  3ZRE A;  1SKW B;  2GT5 A;  5LCZ A;  1O73 A;  3KMO A;  1ZYQ B;  2HZE B;  4F2I A;  3QD9 A;  4XS4 B;  1KNG A;  4IQ1 A;  1WPI A;  2NDO A;  2JSY A;  3GYK A;  2NBS A;  5C04 A;  1AUC A;  3FEU A;  5ENU A;  3ZZX A;  1M99 A;  5JCW A;  3L0H A;  4WET A;  3LSZ A;  18GS A;  1EP7 A;  2VLV A;  1AW9 A;  1SJ6 A;  2BTO T;  2CVB A;  2GZZ A;  2HFD A;  2FWG A;  3BCK A;  4ZB8 A;  3W6G A;  2O8V B;  3ZIT A;  4YQV A;  1FG4 A;  4KDU A;  3GMF A;  3ZLP A;  6GSW A;  2RUE A;  1SK1 A;  3DVW A;  3IC4 A;  1BYE A;  3GKN A;  3CSI A;  1AQV A;  2IMI A;  2A2S A;  2FWE A;  3KCM A;  4RI6 A;  2YP6 A;  1PA3 A;  4KSO A;  5B8B A;  3E9J B;  4DSS B;  1YY7 A;  5D93 A;  1TTZ A;  2LJK A;  4TXV A;  1T4Y A;  4WBJ A;  4HQZ A;  2IME A;  4K1F A;  4I97 A;  1B9X C;  2B7J A;  2EIO A;  1XPV A;  4HI7 A;  4HQS A;  1MDI A;  1ZGN A;  4MCU A;  5HFK A;  2DJ0 A;  1KBN A;  2WDU A;  3UVH A;  1Z6N A;  1U6T A;  6GSX A;  1QUW A;  3KTL A;  5IMD A;  3GUR A;  3G9B A;  4V1A g;  2ZUP A;  3ZTL A;  3TJJ A;  3UOM A;  3EE2 A;  4IJI A;  2XPD A;  2IN3 A;  3FHK A;  1VRS D;  2O7K A;  4XRD A;  2JAC A;  4POB A;  3FZ5 A;  1O6J A;  2KP2 A;  2L5L A;  3N5O A;  1UA5 A;  3TRQ A;  3VPT A;  2CAQ A;  1WE0 A;  3LEF A;  5IMF A;  2H66 A;  3MWH A;  2YWN A;  2X8G A;  1JLW A;  3BOA A;  3H79 A;  4LL1 B;  5EL8 A;  2PER A;  1YDK A;  4GRF A;  1TK8 B;  3VI7 A;  1S3D A;  2LJR A;  4ML6 A;  4PUF C;  1FAA A;  4TXO B;  3L78 A;  2GQM A;  4KB3 A;  2C4J A;  4MZW A;  1TK5 B;  1ST9 A;  1A24 A;  3UBL A;  1A0R P;  2GQL A;  1GWC A;  2VUP A;  2X8C A;  2C0D A;  2D2Z A;  3KEB A;  2FY6 A;  4XS6 A;  4KND A;  4TOP A;  2M46 A;  2P31 A;  2O89 A;  1V57 A;  2L4C A;  2M80 A;  2B3S A;  1AXD A;  3W8J A;  1V9W A;  4HJM A;  5H5R A;  2C0E A;  2QSI A;  3NOF A;  3CMI A;  1U87 A;  3APQ A;  5FHI A;  1GUL A;  4KE3 A;  2GST A;  6GSS A;  3HVV A;  4ID0 A;  5ECK B;  2LUS A;  2R3X A;  1F9M A;  1X5D A;  2XBQ A;  2LRN A;  4OO5 A;  3GFK A;  3HJM A;  1BX9 A;  3CTF A;  4NWY A;  1OC3 A;  2F3M A;  3WD6 A;  3QAG A;  3P7X A;  3JCM L;  4AF2 A;  5IPH A;  5A5K A;  1W4V A;  2E2G A;  3FYG A;  3UL3 A;  2R4V A;  1WWJ A;  2OE0 A;  4JR4 A;  5DJM A;  4LMV A;  3WGX A;  5J41 A;  4EF0 A;  2X99 A;  3GUS A;  4O5R A;  1RQM A;  3CRU A;  3TKP A;  3HJP A;  1UN2 A;  3P2A A;  5IPG A;  3A2V A;  2HYX A;  1PL1 A;  4POK A;  3WT2 A;  5D8I A;  4HZ2 A;  2VL3 A;  3IR4 A;  3VFI A;  3QCP A;  3DYR A;  4MJB A;  3G7I A;  2L57 A;  3Q6O A;  3ZIV A;  4ZIJ A;  2V6O A;  2AAW A;  3RAZ A;  1JFU A;  2HZF A;  2J23 A;  4HJ2 A;  3TUE A;  3IAM 2;  3F4T A;  1KTE A;  1XW6 A;  1F6M C;  1HQO A;  1OC9 B;  1K0A A;  2YWO A;  2A4V A;  2YNX A;  2QGV A;  3D4M A;  1T8E B;  1U88 A;  2E7P A;  4KA0 A;  4KDY A;  1Z7P A;  2MYG A;  3IK7 A;  4KX4 A;  1K0D A;  5JCG A;  2HSH A;  4LLR A;  3WGE A;  1K3Y A;  1XW5 A;  1PX6 A;  3TCO A;  1YF0 A;  2H30 A;  3GX0 A;  1FO5 A;  1H75 A;  4OD7 A;  1TOF A;  1ERV A;  5CNW A;  4HU7 A;  3FRC A;  3IPZ A;  1K3L A;  1OC8 A;  1SYX A;  2OKA A;  4F0C A;  4CW9 A;  3KJY A;  5D9X A;  2LNT A;  3VUR A;  4ILF A;  3CXG A;  4ZXG A;  1AIU A;  1XIY A;  4TVE A;  3D21 A;  3GV1 A;  3F63 A;  4OWY A;  2V1M A;  3UIW A;  4OFT A;  3VK9 A;  4PNF A;  3FKF A;  5HR2 A;  1TP9 A;  1GSQ A;  4ECJ A;  4IKH A;  3IOS A;  1HNC A;  4J2F A;  4ECI A;  1R7H A;  3VI5 A;  1GSY A;  3HD5 A;  4HEA 2;  2CVK A;  3M9K A;  1AQW A;  1ZCP A;  4FYU A;  4PQI A;  2B6M A;  1R26 A;  2YWM A;  4G10 A;  1TU7 A;  1ERT A;  1UC7 A;  1GSE A;  2HT9 A;  2PVO C;  3H8Q A;  1K0B A;  1Y25 A;  2GQK A;  4IP6 A;  2ALB A;  2VLU A;  3I69 A;  5D96 A;  2K6V A;  1TRV A;  2E2M A;  3TJB A;  2PPT A;  4IN0 A;  5A4W A;  1ILO A;  2P0G A;  4ECC A;  5ID2 A;  1DUG A;  3D22 A;  1XW9 A;  4YAV A;  2X8H A;  3L9U A;  2P5Q A;  4MF7 A;  2VIM A;  2XHF A;  4L5O A;  2VCW A;  5FWG A;  1ML6 A;  4QQ7 A;  4NHW A;  2H8L A;  4K6X A;  4K0G A;  5IMA A;  2OAC A;  1YEX A;  4JU5 A;  3TOU A;  4FIW A;  4F82 A;  1O8W A;  2OE3 A;  2H75 A;  5IOX A;  1NHY A;  1ERU A;  4WF4 A;  4HUA A;  2GSR A;  2H1G A;  1V40 A;  1EP8 A;  1R4W A;  5G5F A;  2IL3 A;  4TR1 A;  1GSS A;  4DSR A;  1BAY A;  2F8A A;  2C8U A;  5INY A;  1GSU A;  4XRA A;  1LJR A;  2HZE A;  4MZB A;  2NTO A;  1Z7R A;  5JWQ B;  2VO4 A;  3GN3 A;  4FYB A;  3F6F A;  2LJA A;  4XS4 A;  1X9M B;  2DJ1 A;  4ZBD A;  2V6K A;  4MPF A;  3ZFB A;  1B4Q A;  2VCQ A;  2NPB A;  1M9B A;  2H1B A;  4F9Z A;  1Q4J A;  1VF4 A;  4ACS A;  4J57 E;  4AGS A;  3AY8 A;  3GKX A;  3QFB C;  5GZZ B;  1TKD B;  3I6A A;  2YJ7 A;  17GS A;  3EYT A;  2M72 A;  4BWQ A;  2AB6 A;  3TOT A;  3GST A;  1GSD A;  3Q18 A;  1WP0 A;  5CRH A;  2EIR A;  4NPB A;  1WMJ A;  4POL A;  1G7O A;  2I3Y A;  5A4V A;  4JZQ A;  5KN0 A;  4DSS A;  1ERW A;  4E8H A;  5F05 A;  2DIY A;  4JED A;  1JZW A;  1TW9 A;  3RHC A;  5F8B A;  5ECO B;  4XS1 A;  2H19 A;  3IA1 A;  4MA9 A;  2CV4 A;  5AGY A;  2OBK A;  3M9J A;  4IBP A;  2XC2 A;  1HNA A;  1Z5Y E;  4ULX A;  1GLQ A;  3KMN A;  2VD1 A;  1ON4 A;  2H6Z A;  5HFI A;  5IMV A;  5G1K A;  1C72 A;  2MZC A;  4V2N A;  4RI7 A;  2H71 A;  5ELG A;  4ZL7 A;  4I6X A;  1EOH A;  4ZB9 A;  4WXT A;  2CAI A;  2FNO A;  2VD0 A;  5H5S A;  4PNG A;  4NAX A;  4MDC A;  5ABR A;  2WFC A;  1O7U A;  3KM6 A;  2GVP A;  4K0N A;  3IAS 2;  3FR6 A;  1YEP A;  1B8X A;  2YCD A;  2K8S A;  2KOK A;  4EL1 A;  3IRA A;  2L59 A;  2MMZ A;  3KH9 A;  2IFQ B;  4TXO A;  2I9H A;  4HS1 A;  4ISD A;  2LNS A;  3WGD A;  3GHA A;  2WGR A;  5F06 A;  5ECN B;  6GSU A;  3TKR A;  1EGO A;  3Q19 A;  3EWL A;  5AIS A;  2HNL A;  3HZ4 A;  3EU4 A;  4KGI A;  1X5E A;  5DQY A;  4CHS A;  1GNE A;  4L0W A;  1SEN A;  2MBS A;  2VL2 C;  4FYC A;  1WRY A;  1WJK A;  5JCU A;  2L4Q A;  3TKS A;  1HNB A;  3RPN A;  4KCE A;  3ERW A;  4OCF A;  3G7Y A;  4N10 A;  3MNG A;  2B7K A;  5HR0 A;  1GUK A;  4K7N A;  1YQ1 A;  2FHE A;  2JSZ A;  2JZS A;  3UMA A;  4G2E A;  3TJG A;  2YWI A;  3VWX A;  4HU9 A;  2DBC A;  4ZIL A;  2DJK A;  4PUA A;  1RW1 A;  1BQ7 A;  3LJR A;  4BVY A;  3KXO A;  1M0U A;  3O76 A;  3GIX A;  2TIR A;  2LQO A;  2ES7 A;  2PMT A;  5EY6 A;  1S3A A;  4RUV A;  3TGZ A;  2WUL A;  4TW5 A;  2PBJ A;  4PUR A;  1XXU A;  5G5E A;  4K7O A;  4YH2 A;  3GNJ A;  4PXO A;  3LOR A;  3UAR A;  5C00 A;  3ERF A;  1XWK A;  3ME8 A;  1K3O A;  4D73 B;  4N30 A;  1XCC A;  4YQU A;  3RBT A;  1TDI A;  3W8S A;  1TXX A;  4O92 A;  1HD2 A;  3TJK A;  4EC0 A;  1PX7 A;  3ZYW A;  3C1S A;  5G30 A;  2KP1 A;  4IQA A;  11GS A;  2H70 A;  1OC9 A;  2IMF A;  2YN1 A;  3FR9 A;  4MZC A;  13GS A;  4KH7 A;  1SL0 B;  1G0T A;  2H6X A;  5ECI B;  5ECS A;  1MDJ A;  3IV4 A;  2JZR A;  2H1A A;  2REM A;  3ZRD A;  4GWR A;  2C0F A;  5B6N A;  2VAF A;  3Q74 A;  4RQR A;  1A2J A;  2I4A A;  1BED A;  1Y6E A;  2N5B A;  3H4K A;  5IOW A;  1B48 A;  2NVL A;  2WRT A;  2KUC A;  2CX3 A;  2GSS A;  2LRC A;  5H5Q A;  2VCV A;  1GP1 A;  2FLS A;  1T4Z A;  1U3A A;  1Z6M A;  3H93 A;  3QFA C;  3LYP A;  3M1G A;  4NV5 A;  4L5L A;  4KDX A;  3SWL A;  3A2X A;  5HQP A;  2LST A;  2RM5 A;  1I5G A;  3GTU B;  5HFG A;  4AJ6 A;  4DSQ A;  3IDV A;  4L0U A;  1SU9 A;  2EC4 A;  1G6W A;  5CRD A;  5CAX A;  2RM6 A;  1QMV A;  5CP1 A;  4AJ7 A;  3KTB A;  1OE8 A;  2LEG A;  1QXH A;  2PU9 C;  5AIV A;  4V2L A;  2FA4 A;  2G2Q A;  3HYP A;  4F03 A;  3QPM A;  2DC5 A;  4POM A;  6GSY A;  2H0I A;  2CX4 A;  1B9Y C;  2GSQ A;  2JZT A;  2OA7 A;  2ZCT A;  3IE3 A;  2OAD A;  1T1V A;  1FB0 A;  3EU3 A;  2O87 A;  2I81 A;  4JR6 A;  3HVS A;  1UVZ A;  1QQ2 A;  3DEX A;  2GLR A;  2YV7 A;  5A4U A;  1FW1 A;  1IYI A;  3O6T A;  5J5N A;  4Z7X A;  1A8L A;  3BBY A;  3QOU A;  1E2Y A;  2I1U A;  4MF6 A;  5KN1 A;  1XWG A;  1A0F A;  5DVB A;  2FWF A;  4MF5 A;  4IEL A;  8GSS A;  1K0O A;  4GSS A;  5G31 A;  4EDZ A;  3F6D A;  4GTU A;  4OMV A;  5D73 A;  3CTG A;  2DJ3 A;  3LWA A;  2R2J A;  3A2W A;  1AC1 A;  1OYJ A;  1NSW A;  3LGC A;  5D9T A;  3ZFL A;  1SKS B;  2VOC A;  3S9F A;  4ZBB A;  1MD3 A;  3IHQ A;  2GGT A;  16GS A;  1XWC A;  1JZO A;  5KN3 A;  3QR6 A;  2LV3 A;  2ON7 A;  3UJ1 A;  1FVK A;  1GSF A;  3DXB A;  1PKW A;  3A3T A;  4I2T A;  5DAK B;  3PGT A;  2HLS A;  4LA1 A;  2GS3 A;  2YOI A;  1M7T A;  4TR0 A;  3CRT A;  1S3C A;  3FZ4 A;  2XPE A;  3A5W A;  3L9V A;  3ZVJ D;  3F0I A;  5B8A A;  5J9C A;  1X9S B;  2H1D A;  5J3R A;  4K2D A;  2V32 A;  4DVC A;  1EGR A;  1J9B A;  1AQX A;  1M2B A;  3VPQ A;  1TI3 A;  4V2M A;  4HOJ A;  1K0M A;  1PQN A;  9GSS A;  4BPY A;  3HHV A;  1YJ6 A;  4TR3 A;  2IJY A;  3PIN A;  4BL7 A;  3F9U A;  1WIK A;  22GS A;  3MSZ A;  1XVQ A; 
#chains in the Genus database with same CATH topology
 3M3M A;  4MJA A;  1N2A A;  2C80 A;  4PGT A;  1HYU A;  4EKZ A;  1EEJ A;  1TRS A;  2RLI A;  1WOU A;  4TR4 A;  4N11 A;  2RUF A;  2VM2 A;  5ECR B;  3HA9 A;  3ZVJ A;  3L4N A;  2DMM A;  1ZYP A;  3C73 A;  3J7Y k;  2YZU A;  2OBI A;  3KGK A;  1XZO A;  2MMO A;  2JAD A;  3APS A;  1OAZ A;  3FY7 A;  5DCG A;  3TRP A;  4OO4 A;  5AN1 A;  5EVO A;  2PGT A;  4EUY A;  3EMX A;  3GX8 A;  3GRX A;  2IFQ A;  2H73 A;  1N8J A;  1ZOF A;  1SD8 A;  1R5A A;  12GS A;  4EIP A;  1NW2 A;  5GAP D;  4EXJ A;  1PKZ A;  1TI1 A;  3GKK A;  1PRX A;  2DLX A;  3FZ9 A;  2P5R A;  2C0G A;  1U3I A;  3EUR A;  1EOG A;  1H4O A;  2K8V A;  6GST A;  4JRR A;  10GS A;  2VCZ A;  2KHP A;  3MDK A;  4NHZ A;  2R37 A;  4J56 E;  3D6I A;  4YKF A;  5DBQ A;  5B7C A;  4FH8 A;  4NXI A;  2J9H A;  5G1L A;  5DDL A;  3WYW A;  1X5C A;  2PWJ A;  1A23 A;  4WR4 A;  1VF3 A;  4TRX A;  4MP4 A;  2WB9 A;  2HE3 A;  1OKD A;  4IJ3 A;  2C3T A;  3CSJ A;  3G7J A;  1KEB A;  1Z9H A;  3F3Q A;  1X0R A;  2MMN A;  3VLN A;  3I43 A;  1USB A;  2Z9S A;  3FW2 A;  3F8U A;  2QA2 A;  1PL2 A;  5IM9 A;  2LKU A;  2OJL A;  3VWV A;  2FWH A;  2YPM A;  4G0I A;  2DSA A;  5IIZ A;  1F37 A;  2DJJ A;  2G0F A;  2QC7 A;  2WS2 A;  1ACV A;  2FUG 2;  2BJX A;  1Q98 A;  3U6V A;  5DAL B;  5KN2 A;  4I5Q A;  5CRE A;  2JU5 A;  4NV2 A;  4XIH A;  3HCZ A;  3U5R E;  3QAV A;  3IXR A;  3TKQ A;  1J08 A;  14GS A;  2YV9 A;  2TRX A;  2WJU A;  1URM A;  3H1N A;  3GSS A;  4ZL8 A;  1OE7 A;  1T7P B;  1V98 A;  5ECP B;  1O85 A;  3UBK A;  1PD2 1;  2X64 A;  3CYN A;  1G6Y A;  5DCH A;  4V1A p;  4Q5F A;  3HY2 A;  4IP1 A;  3CBU A;  4KW6 A;  1PGT A;  3D0Z A;  3KP9 A;  1IYH A;  4P3Y B;  4D73 A;  3UAP A;  5HR3 A;  3LG6 A;  3ZMK A;  1K0N A;  2N5F A;  1VF2 A;  1SYR A;  1OVN A;  2XBI A;  2IPA A;  1GTI A;  3M0F A;  3E3E A;  4LL4 B;  3C71 A;  2A2R A;  4N0Z A;  3L9S A;  4KCA A;  4MAB A;  1NHO A;  4HDE A;  4MLY A;  4MNN A;  3BJ5 A;  3ZML A;  1PSQ A;  3LFL A;  2LRT A;  1SKR B;  3P90 A;  5LNK e;  5CYY A;  2FGX A;  1G7E A;  4QL7 A;  1F2E A;  1LBK A;  3QAW A;  2B1L A;  2WZ9 A;  4FO5 A;  4X0X A;  1PMT A;  3PR8 A;  2OE1 A;  2VL9 A;  4OCE A;  1MD4 A;  2HI7 A;  3GKM A;  3D4T A;  4MMM A;  4YAP A;  3KIJ A;  3ZIJ A;  3PH9 A;  2EIQ A;  1EWX A;  5CRW A;  3IK9 A;  1GUH A;  5J9B A;  4ZBA A;  2RII A;  3F3R A;  4WF5 A;  2WCI A;  1T3B A;  1V58 A;  2ZNM A;  2HRN A;  5ELA A;  1Z3E A;  5LD0 A;  1EV9 A;  3KH7 A;  4N0V A;  3HKR A;  4EE0 A;  4WKW A;  3EC3 A;  1A2L A;  3HVN A;  3NZN A;  3GTU A;  3US3 A;  4EDY A;  5KOW A;  3QMX A;  2UZ8 A;  1GUM A;  2H0H A;  3HXS A;  3F4S A;  1FHE A;  3DVX A;  4JE1 A;  5B6M A;  2CZ2 A;  2IIY A;  2K9F A;  3HVX A;  1YF1 A;  2PVQ A;  3E0U A;  1GNW A;  1ZL9 A;  3KP8 A;  4IVF A;  2AYT A;  3GH9 A;  3HJO A;  4Q5Q A;  3ISO A;  2DKI A;  5GSS A;  4IHU A;  5COH A;  3IHG A;  1BG5 A;  4ZB6 A;  1SJZ A;  2LTK A;  3HZ8 A;  2CA8 A;  4AJ8 A;  4L8E A;  3GH6 A;  3ZL5 A;  4BA7 A;  1PN9 A;  2C3N A;  2MBT A;  3FK8 A;  1DE2 A;  3HDC A;  1VF1 A;  2F51 A;  1ABA A;  5CO3 A;  1XFL A;  1AAZ A;  4K7I A;  2QKE A;  5JWR B;  1RK4 A;  2AV4 A;  2HRF A;  2L5O A;  2YAN A;  1SL1 B;  1O81 A;  2PN8 A;  3TB2 A;  2MMA A;  1VGL A;  2V41 A;  4GXZ A;  3CSH A;  3TKS E;  3DKS A;  4GQF A;  3PPU A;  3ME7 A;  4I8B A;  1GL8 A;  4MH2 A;  1TK0 B;  1XOA A;  2F9S A;  4BVX A;  4K9Z A;  1YKC A;  5KEJ A;  2N5A A;  1XWA A;  2R5G A;  1THX A;  5D9V A;  1FVJ A;  1JHB A;  3VWW A;  3BCI A;  2FD3 A;  1YZX A;  3M8N A;  1FOV A;  1THO A;  3WT1 A;  4NMU A;  2AJQ B;  5JWO B;  2LS5 A;  1CQG A;  2DML A;  1QGV A;  4WR5 A;  1QFN A;  5D9W A;  4X43 A;  4Q5R A;  4PQ1 A;  4MH3 A;  4K8M A;  3K8N A;  2VL2 A;  4IGJ A;  2LQQ A;  5DAK A;  1JZR A;  4RQX A;  4QL9 A;  4ML1 A;  2L6D A;  4G0L A;  3LQ7 A;  5DJL A;  3DML A;  1PFO A;  3P8W A;  2GT6 A;  1SJI A;  3R2Q A;  3RHB A;  5IMZ A;  4CDO A;  3FR3 A;  1EEM A;  3N9J A;  4LMW A;  4KUN A;  4MJE A;  2H0G A;  1DBY A;  1NM3 A;  1F3B A;  4G9H A;  4PTS A;  5L71 A;  2GDR A;  4OFN A;  1GLP A;  1BJX A;  2IWT A;  3VWU A;  3C7M A;  20GS A;  3RDW A;  5E4W A;  4KF9 A;  2CQ9 A;  2R6K A;  2VCX A;  1XWB A;  1MEK A;  1TJD A;  4GQC A;  3IBH A;  4CY6 A;  1YKA A;  4XHM A;  5F0G A;  4IW9 A;  4H86 A;  3DIE A;  4ZL9 A;  5G2Z A;  5J4U A;  4PX1 A;  1GTU A;  4KSM A;  4YKG A;  1MTC A;  4MJC A;  3OR5 A;  3ED3 A;  1ZZY A;  4X1U A;  2C1Y A;  3UEM A;  2CT6 A;  3DD3 A;  2HSY A;  2GZP A;  3LW9 A;  5ECL B;  2L6C A;  1XBS A;  5ECQ B;  4GSN A;  2JL4 A;  2A4H A;  4GF0 A;  4YQM A;  3O3T A;  1TRU A;  5HR1 A;  2HXK A;  2DKH A;  2K18 A;  1W89 A;  5DQS A;  1ZYE A;  1DSB A;  1JLV A;  2E0Q A;  5CRG A;  2ON5 A;  4DEJ A;  2PUK C;  1F3A A;  1T00 A;  1GH2 A;  1SK2 A;  4WEY A;  3ERG A;  2H01 A;  4EVM A;  3C8E A;  2AUV A;  4HSC X;  2B5Y A;  4X4J A;  3RPP A;  1QK8 A;  1OKT A;  2CVD A;  4JBB A;  3MAK A;  2IMK A;  4IS0 A;  4MPG A;  5E59 A;  5GAN D;  4PQH A;  3TJF A;  3GA4 A;  2V2G A;  3NIV A;  4WBR D;  1TU8 A;  2BMX A;  1V2A A;  1GTB A;  1R5P A;  3TRX A;  1CQH A;  1MDK A;  5F07 A;  2DIZ A;  3GL5 A;  1GTA A;  5FT3 A;  2H76 A;  1M2A A;  4KAE A;  7GSS A;  2YZH A;  1XOB A;  3EPT A;  3TKS C;  3APO A;  1JZD A;  3LYK A;  2F8F A;  2H74 A;  4EO3 A;  2AHE A;  1K0C A;  4O32 A;  3SBC A;  1DE1 A;  2DJ2 A;  3EVI A;  5GST A;  1J0F A;  2CZ3 A;  4K2X A;  1FB6 A;  2C3Q A;  3DRN A;  4E8E A;  3V1W A;  1I9D A;  1EZK A;  4Q5N A;  3TDG A;  5ECH B;  1B4P A;  5ECM B;  2B5X A;  2VLT A;  4F0B A;  1O8X A;  3UVT A;  5DAL A;  3C1R A;  1SK0 A;  4GLT A;  3I9V 2;  5IO0 A;  1E6B A;  1EV4 A;  4O5U A;  1X9W B;  3LXZ A;  4O7H A;  2O85 A;  4I2U A;  1TRW A;  1XVW A;  5EPF A;  4XCS A;  6GSV A;  5IO2 A;  3KD0 A;  2H6Y A;  2KLX A;  1SL2 B;  4G19 A;  1M9A A;  3EMP A;  4TN8 A;  3J7Y b;  2TRC P;  2B1K A;  3GL3 A;  1LU4 A;  4GST A;  3BD2 A;  1A8Y A;  2IMD A;  2YJH A;  5ID2 B;  5IQY A;  4MK3 A;  3F4R A;  3D5J A;  2H72 A;  4HZ4 A;  2B5E A;  1M2D A;  2FCH A;  3QDN A;  3EIN A;  3DWV A;  2GTU A;  5IMC A;  3KZQ A;  3LXT A;  4BWS A;  2VM1 A;  1SD9 A;  2VCT A;  4XTS A;  2GZY A;  3DGQ A;  5AIX A;  4EIQ A;  1A2M A;  19GS A;  1GRX A;  4BL7 B;  4GCI A;  4OFM A;  4ECB A;  2FA8 A;  3FZA A;  4TKY A;  1ZMA A;  3MIX A;  4TR1 B;  3ZRE A;  1SKW B;  2GT5 A;  4Z2R A;  5LCZ A;  1O73 A;  3KMO A;  1ZYQ B;  2HZE B;  4F2I A;  3QD9 A;  2R0P A;  4XS4 B;  1KNG A;  4IQ1 A;  1WPI A;  2NDO A;  2JSY A;  3GYK A;  2NBS A;  5C04 A;  1AUC A;  3FEU A;  5ENU A;  3ZZX A;  1M99 A;  5JCW A;  3L0H A;  4WET A;  3LSZ A;  18GS A;  1EP7 A;  2VLV A;  1AW9 A;  1SJ6 A;  2BTO T;  2CVB A;  3IC8 A;  2GZZ A;  2HFD A;  2FWG A;  3BCK A;  4ZB8 A;  3W6G A;  2O8V B;  3ZIT A;  4YQV A;  1FG4 A;  2HRK A;  4KDU A;  3GMF A;  3ZLP A;  6GSW A;  2RUE A;  1SK1 A;  3DVW A;  3IC4 A;  1BYE A;  3GKN A;  3CSI A;  1AQV A;  2IMI A;  2A2S A;  2FWE A;  3KCM A;  4RI6 A;  2YP6 A;  1PA3 A;  4KSO A;  5B8B A;  3E9J B;  4DSS B;  1YY7 A;  5D93 A;  1TTZ A;  2LJK A;  4TXV A;  1T4Y A;  4WBJ A;  4HQZ A;  2IME A;  4K1F A;  4I97 A;  1B9X C;  2B7J A;  2EIO A;  1XPV A;  5KOX A;  4HI7 A;  4HQS A;  1MDI A;  1ZGN A;  4MCU A;  5HFK A;  2DJ0 A;  1KBN A;  2WDU A;  3UVH A;  1Z6N A;  1U6T A;  6GSX A;  1QUW A;  3KTL A;  5IMD A;  3GUR A;  3G9B A;  4V1A g;  2ZUP A;  3ZTL A;  3TJJ A;  3UOM A;  3EE2 A;  4IJI A;  2XPD A;  2IN3 A;  3FHK A;  1VRS D;  2O7K A;  4XRD A;  2JAC A;  4POB A;  3FZ5 A;  1O6J A;  2KP2 A;  2L5L A;  3N5O A;  1UA5 A;  3TRQ A;  3VPT A;  2CAQ A;  1WE0 A;  3LEF A;  5IMF A;  2H66 A;  3MWH A;  2YWN A;  2X8G A;  1JLW A;  3BOA A;  3H79 A;  4LL1 B;  5EL8 A;  2PER A;  1YDK A;  4GRF A;  1TK8 B;  3VI7 A;  1S3D A;  2LJR A;  4ML6 A;  4PUF C;  1M3J A;  1FAA A;  4TXO B;  3L78 A;  2GQM A;  4KB3 A;  2C4J A;  4MZW A;  1TK5 B;  1ST9 A;  1A24 A;  3UBL A;  1A0R P;  2GQL A;  1GWC A;  2VUP A;  2X8C A;  2C0D A;  2D2Z A;  3KEB A;  2FY6 A;  4XS6 A;  3R3E A;  4KND A;  4TOP A;  2M46 A;  2P31 A;  2O89 A;  1V57 A;  2L4C A;  2M80 A;  2B3S A;  1AXD A;  3W8J A;  1V9W A;  4HJM A;  4ICY A;  5H5R A;  2C0E A;  2QSI A;  3NOF A;  3CMI A;  4K5R A;  1U87 A;  3APQ A;  5FHI A;  1GUL A;  4KE3 A;  2GST A;  6GSS A;  3HVV A;  4ID0 A;  5ECK B;  2LUS A;  2R3X A;  1F9M A;  1X5D A;  2XBQ A;  2LRN A;  4OO5 A;  3GFK A;  3HJM A;  1BX9 A;  2R0G A;  3CTF A;  1OC3 A;  2F3M A;  4NWY A;  3WD6 A;  3QAG A;  3P7X A;  3JCM L;  2A2P A;  4AF2 A;  5IPH A;  5A5K A;  1W4V A;  2E2G A;  3FYG A;  3UL3 A;  4BVY B;  2R4V A;  1WWJ A;  2OE0 A;  4JR4 A;  5DJM A;  4LMV A;  3WGX A;  5J41 A;  4EF0 A;  2X99 A;  3GUS A;  4O5R A;  1RQM A;  3CRU A;  3TKP A;  3HJP A;  1UN2 A;  3P2A A;  5IPG A;  3A2V A;  2HYX A;  1PL1 A;  4POK A;  3WT2 A;  5D8I A;  4HZ2 A;  2VL3 A;  3IR4 A;  3VFI A;  3QCP A;  3DYR A;  4MJB A;  3G7I A;  2L57 A;  4BIK A;  3Q6O A;  3ZIV A;  4ZIJ A;  2V6O A;  2AAW A;  3RAZ A;  1JFU A;  2HZF A;  2J23 A;  4HJ2 A;  3TUE A;  3IAM 2;  3F4T A;  1KTE A;  1XW6 A;  1F6M C;  1HQO A;  1OC9 B;  1K0A A;  2YWO A;  2A4V A;  2YNX A;  2QGV A;  3D4M A;  1T8E B;  1U88 A;  2E7P A;  4KA0 A;  4KDY A;  1Z7P A;  2MYG A;  3IK7 A;  4KX4 A;  1K0D A;  5JCG A;  2HSH A;  4LLR A;  3WGE A;  1K3Y A;  2R0C A;  1XW5 A;  1PX6 A;  3TCO A;  1YF0 A;  2H30 A;  4A5P A;  3GX0 A;  1FO5 A;  1H75 A;  4OD7 A;  1TOF A;  1ERV A;  5CNW A;  4HU7 A;  3FRC A;  3IPZ A;  1K3L A;  1OC8 A;  1SYX A;  2OKA A;  4F0C A;  4CW9 A;  3KJY A;  5D9X A;  2LNT A;  3VUR A;  4ILF A;  3CXG A;  4ZXG A;  1AIU A;  1XIY A;  4TVE A;  3D21 A;  3GV1 A;  3F63 A;  4OWY A;  2V1M A;  3UIW A;  4OFT A;  3VK9 A;  4PNF A;  3FKF A;  5HR2 A;  1TP9 A;  1GSQ A;  4ECJ A;  4IKH A;  3IOS A;  1HNC A;  4J2F A;  4ECI A;  1R7H A;  3VI5 A;  1GSY A;  3HD5 A;  4HEA 2;  2CVK A;  3M9K A;  1AQW A;  1ZCP A;  4FYU A;  4PQI A;  4G0K A;  2B6M A;  1R26 A;  2YWM A;  4G10 A;  1TU7 A;  1ERT A;  1UC7 A;  1GSE A;  2HT9 A;  2PVO C;  3H8Q A;  1K0B A;  1Y25 A;  2GQK A;  4IP6 A;  2ALB A;  2VLU A;  3I69 A;  5D96 A;  2K6V A;  1TRV A;  2E2M A;  1ZYN A;  3TJB A;  2PPT A;  4IN0 A;  5A4W A;  1ILO A;  2P0G A;  4ECC A;  5ID2 A;  1DUG A;  3D22 A;  1XW9 A;  4YAV A;  2X8H A;  3L9U A;  2P5Q A;  4MF7 A;  2VIM A;  2XHF A;  4L5O A;  2VCW A;  5FWG A;  1ML6 A;  2X49 A;  4QQ7 A;  4NHW A;  2H8L A;  4K6X A;  4K0G A;  5IMA A;  2OAC A;  1YEX A;  4JU5 A;  3TOU A;  4FIW A;  4F82 A;  1O8W A;  2OE3 A;  2H75 A;  5IOX A;  1NHY A;  1ERU A;  5BRT A;  4WF4 A;  4HUA A;  2GSR A;  2H1G A;  1V40 A;  1EP8 A;  1R4W A;  3CQF A;  5G5F A;  2IL3 A;  4TR1 A;  1GSS A;  4DSR A;  3FMW A;  1BAY A;  2F8A A;  2C8U A;  5INY A;  1GSU A;  4XRA A;  2HRA A;  1LJR A;  2HZE A;  4MZB A;  2NTO A;  1Z7R A;  5JWQ B;  2VO4 A;  3GN3 A;  4FYB A;  3F6F A;  2LJA A;  4XS4 A;  1X9M B;  2DJ1 A;  4ZBD A;  2V6K A;  4MPF A;  3ZFB A;  1B4Q A;  2VCQ A;  2NPB A;  1M9B A;  2H1B A;  4F9Z A;  1Q4J A;  1VF4 A;  4ACS A;  4J57 E;  4AGS A;  3AY8 A;  3GKX A;  3QFB C;  5GZZ B;  1TKD B;  3I6A A;  2YJ7 A;  17GS A;  3EYT A;  2M72 A;  4BWQ A;  2AB6 A;  3TOT A;  3GST A;  1GSD A;  3Q18 A;  1WP0 A;  2HSM A;  5CRH A;  2EIR A;  4NPB A;  1WMJ A;  4POL A;  1G7O A;  2I3Y A;  5A4V A;  4JZQ A;  5KN0 A;  4DSS A;  1ERW A;  4E8H A;  5F05 A;  2DIY A;  4JED A;  1JZW A;  1TW9 A;  3RHC A;  5F8B A;  5ECO B;  4Z2T A;  4XS1 A;  2H19 A;  3IA1 A;  4MA9 A;  2CV4 A;  5AGY A;  2OBK A;  3M9J A;  4IBP A;  2XC2 A;  1HNA A;  1Z5Y E;  4ULX A;  1GLQ A;  3KMN A;  2VD1 A;  1ON4 A;  2H6Z A;  5HFI A;  5IMV A;  5G1K A;  1C72 A;  2MZC A;  4V2N A;  4RI7 A;  2H71 A;  5ELG A;  4ZL7 A;  4I6X A;  1EOH A;  4ZB9 A;  4WXT A;  2CAI A;  2FNO A;  2VD0 A;  5H5S A;  4PNG A;  4NAX A;  4MDC A;  5ABR A;  2WFC A;  1O7U A;  3KM6 A;  2GVP A;  4K0N A;  3IAS 2;  3FR6 A;  1YEP A;  3MYD A;  1B8X A;  2YCD A;  2K8S A;  2KOK A;  4EL1 A;  3IRA A;  2L59 A;  2MMZ A;  3KH9 A;  1FOH A;  2IFQ B;  4TXO A;  2I9H A;  4HS1 A;  4ISD A;  2LNS A;  3WGD A;  3GHA A;  2WGR A;  5F06 A;  5BMU A;  5ECN B;  6GSU A;  3TKR A;  1EGO A;  3Q19 A;  3EWL A;  5AIS A;  2HNL A;  3HZ4 A;  3EU4 A;  3A5I A;  4KGI A;  1X5E A;  5DQY A;  4CHS A;  1GNE A;  4L0W A;  1SEN A;  1S3R A;  2MBS A;  2VL2 C;  4FYC A;  2X4A A;  1WRY A;  1WJK A;  5JCU A;  2L4Q A;  3TKS A;  4FQU A;  1HNB A;  3RPN A;  4KCE A;  3ERW A;  4OCF A;  3G7Y A;  4N10 A;  3MNG A;  4Z2U A;  2B7K A;  5HR0 A;  1GUK A;  4K7N A;  1YQ1 A;  2FHE A;  2QA1 A;  2JSZ A;  2JZS A;  3UMA A;  1XG8 A;  4G2E A;  3TJG A;  2YWI A;  3VWX A;  4HU9 A;  2DBC A;  4ZIL A;  2DJK A;  4PUA A;  1RW1 A;  1BQ7 A;  3LJR A;  4BVY A;  3KXO A;  1M0U A;  3O76 A;  3GIX A;  2TIR A;  2LQO A;  2ES7 A;  2PMT A;  5EY6 A;  1S3A A;  4RUV A;  3TGZ A;  2WUL A;  4TW5 A;  2PBJ A;  4PUR A;  1XXU A;  5G5E A;  4K7O A;  4YH2 A;  3GNJ A;  4PXO A;  3LOR A;  3UAR A;  5C00 A;  3ERF A;  1XWK A;  3ME8 A;  1K3O A;  4D73 B;  4N30 A;  1XCC A;  4YQU A;  3RBT A;  1TDI A;  3W8S A;  1TXX A;  4O92 A;  1HD2 A;  3TJK A;  4EC0 A;  1PX7 A;  3ZYW A;  3C1S A;  5G30 A;  2KP1 A;  4IQA A;  11GS A;  1PN0 A;  2H70 A;  1OC9 A;  2IMF A;  2YN1 A;  3FR9 A;  4MZC A;  13GS A;  4KH7 A;  1SL0 B;  1G0T A;  2H6X A;  5ECI B;  5ECS A;  1MDJ A;  3IV4 A;  2JZR A;  2H1A A;  2REM A;  3ZRD A;  4GWR A;  2C0F A;  5B6N A;  2VAF A;  3Q74 A;  4RQR A;  1A2J A;  2I4A A;  1BED A;  1Y6E A;  2N5B A;  3H4K A;  5IOW A;  1B48 A;  2NVL A;  2WRT A;  2KUC A;  2CX3 A;  2GSS A;  2LRC A;  5H5Q A;  2VCV A;  1GP1 A;  2FLS A;  1T4Z A;  1U3A A;  1Z6M A;  3H93 A;  3QFA C;  3LYP A;  3M1G A;  4NV5 A;  4L5L A;  4KDX A;  3SWL A;  3A2X A;  5HQP A;  2LST A;  2RM5 A;  1I5G A;  3GTU B;  5HFG A;  4AJ6 A;  4DSQ A;  3IDV A;  4L0U A;  1SU9 A;  2EC4 A;  1G6W A;  5CRD A;  5CAX A;  2RM6 A;  1QMV A;  5CP1 A;  4AJ7 A;  4USS A;  3KTB A;  1OE8 A;  2LEG A;  1QXH A;  2PU9 C;  5AIV A;  4V2L A;  2FA4 A;  2G2Q A;  3HYP A;  4F03 A;  3QPM A;  2DC5 A;  4POM A;  6GSY A;  2H0I A;  2CX4 A;  1B9Y C;  2GSQ A;  2JZT A;  2OA7 A;  2ZCT A;  3IE3 A;  2OAD A;  1T1V A;  1FB0 A;  3EU3 A;  2O87 A;  2I81 A;  4JR6 A;  3HVS A;  1UVZ A;  1QQ2 A;  3DEX A;  2GLR A;  2YV7 A;  5A4U A;  1FW1 A;  1IYI A;  3O6T A;  5J5N A;  1M3I A;  4Z7X A;  1A8L A;  3BBY A;  3QOU A;  1E2Y A;  2I1U A;  4MF6 A;  5KN1 A;  1XWG A;  1A0F A;  5DVB A;  2FWF A;  4MF5 A;  4IEL A;  8GSS A;  1K0O A;  4BVX B;  4GSS A;  5G31 A;  4EDZ A;  3F6D A;  4GTU A;  4OMV A;  5D73 A;  3CTG A;  2DJ3 A;  3LWA A;  2R2J A;  3A2W A;  1AC1 A;  1OYJ A;  1NSW A;  3LGC A;  5D9T A;  3ZFL A;  1SKS B;  2VOC A;  3S9F A;  4ZBB A;  1MD3 A;  3IHQ A;  2GGT A;  16GS A;  1XWC A;  1JZO A;  5KN3 A;  3QR6 A;  2LV3 A;  2ON7 A;  3UJ1 A;  1FVK A;  1GSF A;  3DXB A;  1PKW A;  3A3T A;  4I2T A;  5DAK B;  3PGT A;  4CY8 A;  2HLS A;  4LA1 A;  2GS3 A;  2YOI A;  1M7T A;  4TR0 A;  3CRT A;  1S3C A;  3FZ4 A;  2XPE A;  3A5W A;  3L9V A;  3ZVJ D;  3F0I A;  5B8A A;  5J9C A;  1X9S B;  2H1D A;  5J3R A;  4K2D A;  2V32 A;  4DVC A;  1EGR A;  1J9B A;  1AQX A;  1M2B A;  3VPQ A;  4O5Q A;  1TI3 A;  4V2M A;  4HOJ A;  1K0M A;  1PQN A;  4K5S A;  9GSS A;  4BPY A;  3HHV A;  1YJ6 A;  4TR3 A;  2IJY A;  3PIN A;  4BL7 A;  3F9U A;  1WIK A;  22GS A;  3MSZ A;  1XVQ A; 
#chains in the Genus database with same CATH homology
 3M3M A;  4MJA A;  1N2A A;  2C80 A;  4PGT A;  1HYU A;  4EKZ A;  1EEJ A;  1TRS A;  2RLI A;  1WOU A;  4TR4 A;  4N11 A;  2RUF A;  2VM2 A;  5ECR B;  3HA9 A;  3ZVJ A;  3L4N A;  2DMM A;  1ZYP A;  3C73 A;  3J7Y k;  2YZU A;  2OBI A;  3KGK A;  1XZO A;  2MMO A;  2JAD A;  3APS A;  1OAZ A;  3FY7 A;  5DCG A;  3TRP A;  4OO4 A;  5AN1 A;  5EVO A;  2PGT A;  4EUY A;  3EMX A;  3GX8 A;  3GRX A;  2IFQ A;  2H73 A;  1N8J A;  1ZOF A;  1SD8 A;  1R5A A;  12GS A;  4EIP A;  1NW2 A;  5GAP D;  4EXJ A;  1PKZ A;  1TI1 A;  3GKK A;  1PRX A;  2DLX A;  3FZ9 A;  2P5R A;  2C0G A;  1U3I A;  3EUR A;  1EOG A;  1H4O A;  2K8V A;  6GST A;  4JRR A;  10GS A;  2VCZ A;  2KHP A;  3MDK A;  4NHZ A;  2R37 A;  4J56 E;  3D6I A;  4YKF A;  5DBQ A;  5B7C A;  4FH8 A;  4NXI A;  2J9H A;  5G1L A;  5DDL A;  3WYW A;  1X5C A;  2PWJ A;  1A23 A;  4WR4 A;  1VF3 A;  4TRX A;  4MP4 A;  2WB9 A;  2HE3 A;  1OKD A;  4IJ3 A;  2C3T A;  3CSJ A;  3G7J A;  1KEB A;  1Z9H A;  3F3Q A;  1X0R A;  2MMN A;  3VLN A;  3I43 A;  1USB A;  2Z9S A;  3FW2 A;  3F8U A;  2QA2 A;  1PL2 A;  5IM9 A;  2LKU A;  2OJL A;  3VWV A;  2FWH A;  2YPM A;  4G0I A;  2DSA A;  5IIZ A;  1F37 A;  2DJJ A;  2G0F A;  2QC7 A;  2WS2 A;  1ACV A;  2FUG 2;  2BJX A;  1Q98 A;  3U6V A;  5DAL B;  5KN2 A;  4I5Q A;  5CRE A;  2JU5 A;  4NV2 A;  4XIH A;  3HCZ A;  3U5R E;  3QAV A;  3IXR A;  3TKQ A;  1J08 A;  14GS A;  2YV9 A;  2TRX A;  2WJU A;  1URM A;  3H1N A;  3GSS A;  4ZL8 A;  1OE7 A;  1T7P B;  1V98 A;  5ECP B;  1O85 A;  3UBK A;  1PD2 1;  2X64 A;  3CYN A;  1G6Y A;  5DCH A;  4V1A p;  4Q5F A;  3HY2 A;  4IP1 A;  3CBU A;  4KW6 A;  1PGT A;  3D0Z A;  3KP9 A;  1IYH A;  4P3Y B;  4D73 A;  3UAP A;  5HR3 A;  3LG6 A;  3ZMK A;  1K0N A;  2N5F A;  1VF2 A;  1SYR A;  1OVN A;  2XBI A;  2IPA A;  1GTI A;  3M0F A;  3E3E A;  4LL4 B;  3C71 A;  2A2R A;  4N0Z A;  3L9S A;  4KCA A;  4MAB A;  1NHO A;  4HDE A;  4MLY A;  4MNN A;  3BJ5 A;  3ZML A;  1PSQ A;  3LFL A;  2LRT A;  1SKR B;  3P90 A;  5LNK e;  5CYY A;  2FGX A;  1G7E A;  4QL7 A;  1F2E A;  1LBK A;  3QAW A;  2B1L A;  2WZ9 A;  4FO5 A;  4X0X A;  1PMT A;  3PR8 A;  2OE1 A;  2VL9 A;  4OCE A;  1MD4 A;  2HI7 A;  3GKM A;  3D4T A;  4MMM A;  4YAP A;  3KIJ A;  3ZIJ A;  3PH9 A;  2EIQ A;  1EWX A;  5CRW A;  3IK9 A;  1GUH A;  5J9B A;  4ZBA A;  2RII A;  3F3R A;  4WF5 A;  2WCI A;  1T3B A;  1V58 A;  2ZNM A;  2HRN A;  5ELA A;  1Z3E A;  5LD0 A;  1EV9 A;  3KH7 A;  4N0V A;  3HKR A;  4EE0 A;  4WKW A;  3EC3 A;  1A2L A;  3NZN A;  3GTU A;  3US3 A;  4EDY A;  5KOW A;  3QMX A;  2UZ8 A;  1GUM A;  2H0H A;  3HXS A;  3F4S A;  1FHE A;  3DVX A;  4JE1 A;  5B6M A;  2CZ2 A;  2IIY A;  2K9F A;  3HVX A;  1YF1 A;  2PVQ A;  3E0U A;  1GNW A;  1ZL9 A;  3KP8 A;  4IVF A;  2AYT A;  3GH9 A;  3HJO A;  4Q5Q A;  3ISO A;  2DKI A;  5GSS A;  4IHU A;  5COH A;  3IHG A;  1BG5 A;  4ZB6 A;  1SJZ A;  2LTK A;  3HZ8 A;  2CA8 A;  4AJ8 A;  4L8E A;  3GH6 A;  3ZL5 A;  4BA7 A;  1PN9 A;  2C3N A;  2MBT A;  3FK8 A;  1DE2 A;  3HDC A;  1VF1 A;  2F51 A;  1ABA A;  5CO3 A;  1XFL A;  1AAZ A;  4K7I A;  2QKE A;  5JWR B;  1RK4 A;  2AV4 A;  2HRF A;  2L5O A;  2YAN A;  1SL1 B;  1O81 A;  2PN8 A;  3TB2 A;  2MMA A;  1VGL A;  2V41 A;  4GXZ A;  3CSH A;  3TKS E;  3DKS A;  4GQF A;  3PPU A;  3ME7 A;  4I8B A;  1GL8 A;  4MH2 A;  1TK0 B;  1XOA A;  2F9S A;  4BVX A;  4K9Z A;  1YKC A;  5KEJ A;  2N5A A;  1XWA A;  2R5G A;  1THX A;  5D9V A;  1FVJ A;  1JHB A;  3VWW A;  3BCI A;  2FD3 A;  1YZX A;  3M8N A;  1FOV A;  1THO A;  3WT1 A;  4NMU A;  2AJQ B;  5JWO B;  2LS5 A;  1CQG A;  2DML A;  1QGV A;  4WR5 A;  1QFN A;  5D9W A;  4X43 A;  4Q5R A;  4PQ1 A;  4MH3 A;  4K8M A;  3K8N A;  2VL2 A;  4IGJ A;  2LQQ A;  5DAK A;  1JZR A;  4RQX A;  4QL9 A;  4ML1 A;  2L6D A;  4G0L A;  3LQ7 A;  5DJL A;  3DML A;  3P8W A;  2GT6 A;  1SJI A;  3R2Q A;  3RHB A;  5IMZ A;  4CDO A;  3FR3 A;  1EEM A;  3N9J A;  4LMW A;  4KUN A;  4MJE A;  2H0G A;  1DBY A;  1NM3 A;  1F3B A;  4G9H A;  4PTS A;  5L71 A;  2GDR A;  4OFN A;  1GLP A;  1BJX A;  2IWT A;  3VWU A;  3C7M A;  20GS A;  3RDW A;  5E4W A;  4KF9 A;  2CQ9 A;  2R6K A;  2VCX A;  1XWB A;  1MEK A;  1TJD A;  4GQC A;  3IBH A;  4CY6 A;  1YKA A;  4XHM A;  5F0G A;  4IW9 A;  4H86 A;  3DIE A;  4ZL9 A;  5G2Z A;  5J4U A;  4PX1 A;  1GTU A;  4KSM A;  4YKG A;  1MTC A;  4MJC A;  3OR5 A;  3ED3 A;  1ZZY A;  4X1U A;  2C1Y A;  3UEM A;  2CT6 A;  3DD3 A;  2HSY A;  2GZP A;  3LW9 A;  5ECL B;  2L6C A;  1XBS A;  5ECQ B;  4GSN A;  2JL4 A;  2A4H A;  4GF0 A;  4YQM A;  3O3T A;  1TRU A;  5HR1 A;  2HXK A;  2DKH A;  2K18 A;  1W89 A;  5DQS A;  1ZYE A;  1DSB A;  1JLV A;  2E0Q A;  5CRG A;  2ON5 A;  4DEJ A;  2PUK C;  1F3A A;  1T00 A;  1GH2 A;  1SK2 A;  4WEY A;  3ERG A;  2H01 A;  4EVM A;  3C8E A;  2AUV A;  2B5Y A;  4X4J A;  3RPP A;  1QK8 A;  1OKT A;  2CVD A;  4JBB A;  3MAK A;  2IMK A;  4IS0 A;  4MPG A;  5E59 A;  5GAN D;  4PQH A;  3TJF A;  3GA4 A;  2V2G A;  3NIV A;  4WBR D;  1TU8 A;  2BMX A;  1V2A A;  1GTB A;  1R5P A;  3TRX A;  1CQH A;  1MDK A;  5F07 A;  2DIZ A;  3GL5 A;  1GTA A;  5FT3 A;  2H76 A;  1M2A A;  4KAE A;  7GSS A;  2YZH A;  1XOB A;  3EPT A;  3TKS C;  3APO A;  1JZD A;  3LYK A;  2F8F A;  2H74 A;  4EO3 A;  2AHE A;  1K0C A;  4O32 A;  3SBC A;  1DE1 A;  2DJ2 A;  3EVI A;  5GST A;  1J0F A;  2CZ3 A;  4K2X A;  1FB6 A;  2C3Q A;  3DRN A;  4E8E A;  3V1W A;  1I9D A;  1EZK A;  4Q5N A;  3TDG A;  5ECH B;  1B4P A;  5ECM B;  2B5X A;  2VLT A;  4F0B A;  1O8X A;  3UVT A;  5DAL A;  3C1R A;  1SK0 A;  4GLT A;  3I9V 2;  5IO0 A;  1E6B A;  1EV4 A;  4O5U A;  1X9W B;  3LXZ A;  4O7H A;  2O85 A;  4I2U A;  1TRW A;  1XVW A;  5EPF A;  4XCS A;  6GSV A;  5IO2 A;  3KD0 A;  2H6Y A;  2KLX A;  1SL2 B;  4G19 A;  1M9A A;  3EMP A;  4TN8 A;  3J7Y b;  2TRC P;  2B1K A;  3GL3 A;  1LU4 A;  4GST A;  3BD2 A;  1A8Y A;  2IMD A;  2YJH A;  5ID2 B;  5IQY A;  4MK3 A;  3F4R A;  3D5J A;  2H72 A;  4HZ4 A;  2B5E A;  1M2D A;  2FCH A;  3QDN A;  3EIN A;  3DWV A;  2GTU A;  5IMC A;  3KZQ A;  3LXT A;  4BWS A;  2VM1 A;  1SD9 A;  2VCT A;  4XTS A;  2GZY A;  3DGQ A;  5AIX A;  4EIQ A;  1A2M A;  19GS A;  1GRX A;  4BL7 B;  4GCI A;  4OFM A;  4ECB A;  2FA8 A;  3FZA A;  4TKY A;  1ZMA A;  3MIX A;  4TR1 B;  3ZRE A;  1SKW B;  2GT5 A;  4Z2R A;  5LCZ A;  1O73 A;  3KMO A;  1ZYQ B;  2HZE B;  4F2I A;  3QD9 A;  2R0P A;  4XS4 B;  1KNG A;  4IQ1 A;  1WPI A;  2NDO A;  2JSY A;  3GYK A;  2NBS A;  5C04 A;  1AUC A;  3FEU A;  5ENU A;  3ZZX A;  1M99 A;  5JCW A;  3L0H A;  4WET A;  3LSZ A;  18GS A;  1EP7 A;  2VLV A;  1AW9 A;  1SJ6 A;  2BTO T;  2CVB A;  3IC8 A;  2GZZ A;  2HFD A;  2FWG A;  3BCK A;  4ZB8 A;  3W6G A;  2O8V B;  3ZIT A;  4YQV A;  1FG4 A;  2HRK A;  4KDU A;  3GMF A;  3ZLP A;  6GSW A;  2RUE A;  1SK1 A;  3DVW A;  3IC4 A;  1BYE A;  3GKN A;  3CSI A;  1AQV A;  2IMI A;  2A2S A;  2FWE A;  3KCM A;  4RI6 A;  2YP6 A;  1PA3 A;  4KSO A;  5B8B A;  3E9J B;  4DSS B;  1YY7 A;  5D93 A;  1TTZ A;  2LJK A;  4TXV A;  1T4Y A;  4WBJ A;  4HQZ A;  2IME A;  4K1F A;  4I97 A;  1B9X C;  2B7J A;  2EIO A;  1XPV A;  5KOX A;  4HI7 A;  4HQS A;  1MDI A;  1ZGN A;  4MCU A;  5HFK A;  2DJ0 A;  1KBN A;  2WDU A;  3UVH A;  1Z6N A;  1U6T A;  6GSX A;  1QUW A;  3KTL A;  5IMD A;  3GUR A;  3G9B A;  4V1A g;  2ZUP A;  3ZTL A;  3TJJ A;  3UOM A;  3EE2 A;  4IJI A;  2XPD A;  2IN3 A;  3FHK A;  1VRS D;  2O7K A;  4XRD A;  2JAC A;  4POB A;  3FZ5 A;  1O6J A;  2KP2 A;  2L5L A;  3N5O A;  1UA5 A;  3TRQ A;  3VPT A;  2CAQ A;  1WE0 A;  3LEF A;  5IMF A;  2H66 A;  3MWH A;  2YWN A;  2X8G A;  1JLW A;  3BOA A;  3H79 A;  4LL1 B;  5EL8 A;  2PER A;  1YDK A;  4GRF A;  1TK8 B;  3VI7 A;  1S3D A;  2LJR A;  4ML6 A;  4PUF C;  1FAA A;  4TXO B;  3L78 A;  2GQM A;  4KB3 A;  2C4J A;  4MZW A;  1TK5 B;  1ST9 A;  1A24 A;  3UBL A;  1A0R P;  2GQL A;  1GWC A;  2VUP A;  2X8C A;  2C0D A;  2D2Z A;  3KEB A;  2FY6 A;  4XS6 A;  3R3E A;  4KND A;  4TOP A;  2M46 A;  2P31 A;  2O89 A;  1V57 A;  2L4C A;  2M80 A;  2B3S A;  1AXD A;  3W8J A;  1V9W A;  4HJM A;  4ICY A;  5H5R A;  2C0E A;  2QSI A;  3NOF A;  3CMI A;  4K5R A;  1U87 A;  3APQ A;  5FHI A;  1GUL A;  4KE3 A;  2GST A;  6GSS A;  3HVV A;  4ID0 A;  5ECK B;  2LUS A;  2R3X A;  1F9M A;  1X5D A;  2XBQ A;  2LRN A;  4OO5 A;  3GFK A;  3HJM A;  1BX9 A;  2R0G A;  3CTF A;  1OC3 A;  2F3M A;  4NWY A;  3WD6 A;  3QAG A;  3P7X A;  3JCM L;  2A2P A;  4AF2 A;  5IPH A;  5A5K A;  1W4V A;  2E2G A;  3FYG A;  3UL3 A;  4BVY B;  2R4V A;  1WWJ A;  2OE0 A;  4JR4 A;  5DJM A;  4LMV A;  3WGX A;  5J41 A;  4EF0 A;  2X99 A;  3GUS A;  4O5R A;  1RQM A;  3CRU A;  3TKP A;  3HJP A;  1UN2 A;  3P2A A;  5IPG A;  3A2V A;  2HYX A;  1PL1 A;  4POK A;  3WT2 A;  5D8I A;  4HZ2 A;  2VL3 A;  3IR4 A;  3VFI A;  3QCP A;  3DYR A;  4MJB A;  3G7I A;  2L57 A;  3Q6O A;  3ZIV A;  4ZIJ A;  2V6O A;  2AAW A;  3RAZ A;  1JFU A;  2HZF A;  2J23 A;  4HJ2 A;  3TUE A;  3IAM 2;  3F4T A;  1KTE A;  1XW6 A;  1F6M C;  1HQO A;  1OC9 B;  1K0A A;  2YWO A;  2A4V A;  2YNX A;  2QGV A;  3D4M A;  1T8E B;  1U88 A;  2E7P A;  4KA0 A;  4KDY A;  1Z7P A;  2MYG A;  3IK7 A;  4KX4 A;  1K0D A;  5JCG A;  2HSH A;  4LLR A;  3WGE A;  1K3Y A;  2R0C A;  1XW5 A;  1PX6 A;  3TCO A;  1YF0 A;  2H30 A;  4A5P A;  3GX0 A;  1FO5 A;  1H75 A;  4OD7 A;  1TOF A;  1ERV A;  5CNW A;  4HU7 A;  3FRC A;  3IPZ A;  1K3L A;  1OC8 A;  1SYX A;  2OKA A;  4F0C A;  4CW9 A;  3KJY A;  5D9X A;  2LNT A;  3VUR A;  4ILF A;  3CXG A;  4ZXG A;  1AIU A;  1XIY A;  4TVE A;  3D21 A;  3GV1 A;  3F63 A;  4OWY A;  2V1M A;  3UIW A;  4OFT A;  3VK9 A;  4PNF A;  3FKF A;  5HR2 A;  1TP9 A;  1GSQ A;  4ECJ A;  4IKH A;  3IOS A;  1HNC A;  4J2F A;  4ECI A;  1R7H A;  3VI5 A;  1GSY A;  3HD5 A;  4HEA 2;  2CVK A;  3M9K A;  1AQW A;  1ZCP A;  4FYU A;  4PQI A;  4G0K A;  2B6M A;  1R26 A;  2YWM A;  4G10 A;  1TU7 A;  1ERT A;  1UC7 A;  1GSE A;  2HT9 A;  2PVO C;  3H8Q A;  1K0B A;  1Y25 A;  2GQK A;  4IP6 A;  2ALB A;  2VLU A;  3I69 A;  5D96 A;  2K6V A;  1TRV A;  2E2M A;  1ZYN A;  3TJB A;  2PPT A;  4IN0 A;  5A4W A;  1ILO A;  2P0G A;  4ECC A;  5ID2 A;  1DUG A;  3D22 A;  1XW9 A;  4YAV A;  2X8H A;  3L9U A;  2P5Q A;  4MF7 A;  2VIM A;  2XHF A;  4L5O A;  2VCW A;  5FWG A;  1ML6 A;  2X49 A;  4QQ7 A;  4NHW A;  2H8L A;  4K6X A;  4K0G A;  5IMA A;  2OAC A;  1YEX A;  4JU5 A;  3TOU A;  4FIW A;  4F82 A;  1O8W A;  2OE3 A;  2H75 A;  5IOX A;  1NHY A;  1ERU A;  5BRT A;  4WF4 A;  4HUA A;  2GSR A;  2H1G A;  1V40 A;  1EP8 A;  1R4W A;  5G5F A;  2IL3 A;  4TR1 A;  1GSS A;  4DSR A;  3FMW A;  1BAY A;  2F8A A;  2C8U A;  5INY A;  1GSU A;  4XRA A;  2HRA A;  1LJR A;  2HZE A;  4MZB A;  2NTO A;  1Z7R A;  5JWQ B;  2VO4 A;  3GN3 A;  4FYB A;  3F6F A;  2LJA A;  4XS4 A;  1X9M B;  2DJ1 A;  4ZBD A;  2V6K A;  4MPF A;  3ZFB A;  1B4Q A;  2VCQ A;  2NPB A;  1M9B A;  2H1B A;  4F9Z A;  1Q4J A;  1VF4 A;  4ACS A;  4J57 E;  4AGS A;  3AY8 A;  3GKX A;  3QFB C;  5GZZ B;  1TKD B;  3I6A A;  2YJ7 A;  17GS A;  3EYT A;  2M72 A;  4BWQ A;  2AB6 A;  3TOT A;  3GST A;  1GSD A;  3Q18 A;  1WP0 A;  2HSM A;  5CRH A;  2EIR A;  4NPB A;  1WMJ A;  4POL A;  1G7O A;  2I3Y A;  5A4V A;  4JZQ A;  5KN0 A;  4DSS A;  1ERW A;  4E8H A;  5F05 A;  2DIY A;  4JED A;  1JZW A;  1TW9 A;  3RHC A;  5F8B A;  5ECO B;  4Z2T A;  4XS1 A;  2H19 A;  3IA1 A;  4MA9 A;  2CV4 A;  5AGY A;  2OBK A;  3M9J A;  4IBP A;  2XC2 A;  1HNA A;  1Z5Y E;  4ULX A;  1GLQ A;  3KMN A;  2VD1 A;  1ON4 A;  2H6Z A;  5HFI A;  5IMV A;  5G1K A;  1C72 A;  2MZC A;  4V2N A;  4RI7 A;  2H71 A;  5ELG A;  4ZL7 A;  4I6X A;  1EOH A;  4ZB9 A;  4WXT A;  2CAI A;  2FNO A;  2VD0 A;  5H5S A;  4PNG A;  4NAX A;  4MDC A;  5ABR A;  2WFC A;  1O7U A;  3KM6 A;  2GVP A;  4K0N A;  3IAS 2;  3FR6 A;  1YEP A;  3MYD A;  1B8X A;  2YCD A;  2K8S A;  2KOK A;  4EL1 A;  3IRA A;  2L59 A;  2MMZ A;  3KH9 A;  1FOH A;  2IFQ B;  4TXO A;  2I9H A;  4HS1 A;  4ISD A;  2LNS A;  3WGD A;  3GHA A;  2WGR A;  5F06 A;  5BMU A;  5ECN B;  6GSU A;  3TKR A;  1EGO A;  3Q19 A;  3EWL A;  5AIS A;  2HNL A;  3HZ4 A;  3EU4 A;  3A5I A;  4KGI A;  1X5E A;  5DQY A;  4CHS A;  1GNE A;  4L0W A;  1SEN A;  2MBS A;  2VL2 C;  4FYC A;  2X4A A;  1WRY A;  1WJK A;  5JCU A;  2L4Q A;  3TKS A;  4FQU A;  1HNB A;  3RPN A;  4KCE A;  3ERW A;  4OCF A;  3G7Y A;  4N10 A;  3MNG A;  4Z2U A;  2B7K A;  5HR0 A;  1GUK A;  4K7N A;  1YQ1 A;  2FHE A;  2QA1 A;  2JSZ A;  2JZS A;  3UMA A;  4G2E A;  3TJG A;  2YWI A;  3VWX A;  4HU9 A;  2DBC A;  4ZIL A;  2DJK A;  4PUA A;  1RW1 A;  1BQ7 A;  3LJR A;  4BVY A;  3KXO A;  1M0U A;  3O76 A;  3GIX A;  2TIR A;  2LQO A;  2ES7 A;  2PMT A;  5EY6 A;  1S3A A;  4RUV A;  3TGZ A;  2WUL A;  4TW5 A;  2PBJ A;  4PUR A;  1XXU A;  5G5E A;  4K7O A;  4YH2 A;  3GNJ A;  4PXO A;  3LOR A;  3UAR A;  5C00 A;  3ERF A;  1XWK A;  3ME8 A;  1K3O A;  4D73 B;  4N30 A;  1XCC A;  4YQU A;  3RBT A;  1TDI A;  3W8S A;  1TXX A;  4O92 A;  1HD2 A;  3TJK A;  4EC0 A;  1PX7 A;  3ZYW A;  3C1S A;  5G30 A;  2KP1 A;  4IQA A;  11GS A;  1PN0 A;  2H70 A;  1OC9 A;  2IMF A;  2YN1 A;  3FR9 A;  4MZC A;  13GS A;  4KH7 A;  1SL0 B;  1G0T A;  2H6X A;  5ECI B;  5ECS A;  1MDJ A;  3IV4 A;  2JZR A;  2H1A A;  2REM A;  3ZRD A;  4GWR A;  2C0F A;  5B6N A;  2VAF A;  3Q74 A;  4RQR A;  1A2J A;  2I4A A;  1BED A;  1Y6E A;  2N5B A;  3H4K A;  5IOW A;  1B48 A;  2NVL A;  2WRT A;  2KUC A;  2CX3 A;  2GSS A;  2LRC A;  5H5Q A;  2VCV A;  1GP1 A;  2FLS A;  1T4Z A;  1U3A A;  1Z6M A;  3H93 A;  3QFA C;  3LYP A;  3M1G A;  4NV5 A;  4L5L A;  4KDX A;  3SWL A;  3A2X A;  5HQP A;  2LST A;  2RM5 A;  1I5G A;  3GTU B;  5HFG A;  4AJ6 A;  4DSQ A;  3IDV A;  4L0U A;  1SU9 A;  2EC4 A;  1G6W A;  5CRD A;  5CAX A;  2RM6 A;  1QMV A;  5CP1 A;  4AJ7 A;  4USS A;  3KTB A;  1OE8 A;  2LEG A;  1QXH A;  2PU9 C;  5AIV A;  4V2L A;  2FA4 A;  2G2Q A;  3HYP A;  4F03 A;  3QPM A;  2DC5 A;  4POM A;  6GSY A;  2H0I A;  2CX4 A;  1B9Y C;  2GSQ A;  2JZT A;  2OA7 A;  2ZCT A;  3IE3 A;  2OAD A;  1T1V A;  1FB0 A;  3EU3 A;  2O87 A;  2I81 A;  4JR6 A;  3HVS A;  1UVZ A;  1QQ2 A;  3DEX A;  2GLR A;  2YV7 A;  5A4U A;  1FW1 A;  1IYI A;  3O6T A;  5J5N A;  4Z7X A;  1A8L A;  3BBY A;  3QOU A;  1E2Y A;  2I1U A;  4MF6 A;  5KN1 A;  1XWG A;  1A0F A;  5DVB A;  2FWF A;  4MF5 A;  4IEL A;  8GSS A;  1K0O A;  4BVX B;  4GSS A;  5G31 A;  4EDZ A;  3F6D A;  4GTU A;  4OMV A;  5D73 A;  3CTG A;  2DJ3 A;  3LWA A;  2R2J A;  3A2W A;  1AC1 A;  1OYJ A;  1NSW A;  3LGC A;  5D9T A;  3ZFL A;  1SKS B;  2VOC A;  3S9F A;  4ZBB A;  1MD3 A;  3IHQ A;  2GGT A;  16GS A;  1XWC A;  1JZO A;  5KN3 A;  3QR6 A;  2LV3 A;  2ON7 A;  3UJ1 A;  1FVK A;  1GSF A;  3DXB A;  1PKW A;  3A3T A;  4I2T A;  5DAK B;  3PGT A;  4CY8 A;  2HLS A;  4LA1 A;  2GS3 A;  2YOI A;  1M7T A;  4TR0 A;  3CRT A;  1S3C A;  3FZ4 A;  2XPE A;  3A5W A;  3L9V A;  3ZVJ D;  3F0I A;  5B8A A;  5J9C A;  1X9S B;  2H1D A;  5J3R A;  4K2D A;  2V32 A;  4DVC A;  1EGR A;  1J9B A;  1AQX A;  1M2B A;  3VPQ A;  4O5Q A;  1TI3 A;  4V2M A;  4HOJ A;  1K0M A;  1PQN A;  4K5S A;  9GSS A;  4BPY A;  3HHV A;  1YJ6 A;  4TR3 A;  2IJY A;  3PIN A;  4BL7 A;  3F9U A;  1WIK A;  22GS A;  3MSZ A;  1XVQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...