2HSHA

Crystal structure of c73s mutant of human thioredoxin-1 oxidized with h2o2
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
105
structure length
105
Chain Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title Buried s-nitrosocysteine revealed in crystal structures of human thioredoxin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 40
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2006-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2hshA00
4XRDA 4HUAA 2ES7A 2HYXA 1YEXA 1SYRA 4BVYA 3GV1A 3DXBA 2M46A 1A2JA 3QR6A 5B6NA 4KCEA 2OBIA 1GSSA 4MZCA 2CA8A 2JZTA 2GQMA 3DD3A 2L6CA 1J08A 1GSFA 4GSNA 5JCGA 2R4VA 20GSA 3TKSC 1LU4A 3GRXA 4AGSA 2PVQA 2MMZA 5D73A 1BX9A 6GSXA 2IMKA 16GSA 1JZWA 3H1NA 5JCWA 2H30A 2IMFA 4IN0A 5A5KA 4I97A 4KGIA 4PX1A 2N5AA 3M0FA 2R3XA 3DYRA 3CXGA 11GSA 2DC5A 5DAKB 3HVSA 3WGDA 5AGYA 3VLNA 4HQSA 1S3AA 2L4QA 5DJMA 4OCFA 2VCXA 1BYEA 1QMVA 1Z3EA 4ILFA 4K1FA 1F37A 1X9WB 4F03A 2GSQA 1V40A 8GSSA 3QD9A 1HNBA 3UIWA 3GYKA 2HRFA 4KE3A 1TDIA 5DDLA 3F6DA 3E3EA 3GKMA 1O81A 5DQSA 2VLVA 1PX7A 3CRTA 3VWXA 1R26A 1U6TA 2K8SA 4K0NA 2DBCA 4BL7A 4TKYA 4KAEA 2H1BA 3WD6A 1XIYA 4N0ZA 2JSZA 2LKUA 3FZ9A 5IMCA 1SKSB 2HXKA 1O8XA 2LRCA 2B6MA 2V6OA 4GXZA 1GNWA 1PL2A 5ECQB 1A8LA 1GSYA 3ZVJA 1OAZA 2LJRA 3GL3A 3G7YA 4ZBDA 1FVJA 1S3CA 3HVXA 3RPPA 3IC4A 2E0QA 3GIXA 1G7OA 4QL7A 2JSYA 3LG6A 3VURA 2VO4A 4MLYA 4LLRA 5IPGA 1O85A 3TKPA 5GSSA 2EIOA 1B4PA 2LNSA 1PRXA 3TJJA 5IQYA 1AUCA 3IAS2 3TB2A 2LJKA 3IHQA 2X64A 3FHKA 1F3AA 5F06A 2LTKA 1TU8A 4XCSA 1X5EA 4MH3A 2WULA 3R2QA 5G30A 3G7JA 3C1RA 1DUGA 3HKRA 1XWKA 5IOWA 1Q98A 1ZCPA 2A2RA 4ZILA 5GAND 4Q5FA 2F9SA 4TXOA 1UA5A 5G5FA 3A2VA 3LXZA 5J9CA 4K6XA 18GSA 2ZCTA 3ZYWA 2K6VA 5B8AA 5DCGA 1FOVA 2PN8A 3QAVA 2C80A 3HZ8A 1ZYQB 1PL1A 3M9KA 2V6KA 5EVOA 4TVEA 5GAPD 5HFIA 22GSA 5ECLB 4I2TA 3KIJA 2J23A 4RI7A 2H1AA 1TK0B 1QGVA 2B5EA 2PMTA 1OVNA 3GKKA 2OACA 4YAVA 4DSSB 4HS1A 2VM2A 1OKDA 4Q5RA 1SKWB 2DJ2A 4OMVA 2X8HA 5J41A 3W6GA 2XBQA 2WGRA 4FIWA 4NV5A 3H79A 1EP8A 2LSTA 1SL2B 5AIXA 2XPEA 1A24A 4JZQA 3TKSE 1NHYA 4F0CA 3S9FA 2YANA 2RM6A 2QGVA 3CSIA 4GCIA 3LGCA 5CYYA 5CP1A 5COHA 3K8NA 2LQOA 1SENA 3OR5A 5KEJA 7GSSA 2CZ2A 2CX4A 1KTEA 3Q6OA 2WJUA 2FD3A 1B9XC 2X99A 1GULA 2H0GA 3KTLA 3M9JA 3TUEA 3D0ZA 1B48A 4IKHA 1UN2A 4GWRA 2FWEA 1GTIA 2BJXA 4G10A 2VL2A 1M2DA 1EEJA 2MMNA 1MDKA 3IK9A 4HI7A 4J2FA 1K0NA 3UEMA 1NHOA 1ZZYA 1LBKA 2YV7A 3HDCA 4MF5A 1USBA 3GKXA 3FR9A 3C71A 3KZQA 6GSVA 3L78A 4KSMA 2V41A 2B7KA 1MDJA 4YQUA 1GTAA 2C0FA 5ECHB 1M7TA 2HZEA 3WT2A 6GSYA 2LUSA 2H6ZA 4IJ3A 5ECNB 2L5LA 1WJKA 3F3QA 1PX6A 3DGQA 2ON5A 1SK0A 5ELGA 1M2BA 3TJFA 2C3TA 1C72A 3FR3A 1AIUA 3H93A 1G0TA 2K8VA 2MYGA 3ZVJD 2A4VA 1B4QA 2RUEA 2P5QA 5CNWA 3L4NA 5KN2A 1HNCA 3ZIJA 1FHEA 3TKRA 4DVCA 4H86A 5D96A 2V2GA 2O89A 2REMA 5F8BA 3Q18A 2B7JA 4IW9A 3UVTA 2WRTA 4XS6A 2B5XA 1EZKA 4MDCA 3QCPA 3GH6A 5JWQB 2GVPA 1T1VA 3APOA 3DWVA 4MF7A 1A0RP 2AAWA 3MAKA 1MD4A 4J56E 5IPHA 1A8YA 3ME8A 3U5RE 3W8JA 2XC2A 4JR6A 1JZOA 1MTCA 5F05A 2O85A 3H8QA 5D9TA 5KN3A 1THXA 3EURA 1XWGA 4GF0A 3EMXA 3LJRA 4DEJA 1SKRB 4TR1B 1O73A 3FEUA 1XW9A 1ERUA 3F6FA 5LCZA 4PNGA 4IS0A 3FZ4A 3VI5A 2PBJA 1QXHA 3HJOA 1ERTA 1EV9A 4TOPA 4OO4A 3APQA 4LL4B 1TKDB 5HFGA 4TRXA 2WFCA 3APSA 2VCVA 3QFBC 4IELA 4Q5NA 1Y25A 5LD0A 4I6XA 4TW5A 5D9WA 4MK3A 5D93A 1GRXA 4D73B 2B1LA 3EYTA 2LRTA 1WPIA 1A0FA 1TXXA 5IOXA 1ZMAA 2HFDA 1WIKA 3UL3A 4XRAA 2JZRA 1K0AA 3KCMA 3GFKA 2AJQB 1ILOA 4K7IA 2RIIA 2YJHA 6GSUA 2OKAA 4OFTA 2DJ3A 3DVWA 1F2EA 2F3MA 4O32A 1YJ6A 3VK9A 4RQXA 4G9HA 2E7PA 4HZ4A 2KHPA 1SYXA 3J7Yk 2VL2C 3MWHA 3G7IA 2F8AA 4ECIA 5EY6A 3BJ5A 17GSA 4ZB9A 3GH9A 1TI1A 3D6IA 3DEXA 5ECIB 1QK8A 5DAKA 3TRQA 3GA4A 4TR3A 5F07A 2M72A 4XS4B 1CQHA 4I5QA 3TRXA 4IP1A 4O5RA 3US3A 2E2MA 4KNDA 3J7Yb 4LA1A 3VWUA 1UC7A 5FT3A 2TRCP 1V9WA 4MF6A 1J0FA 1SD9A 2WZ9A 1Z6MA 3IDVA 3UMAA 4PGTA 2PVOC 1DBYA 2N5BA 2LQQA 3QAWA 4EF0A 2I1UA 2RUFA 2KOKA 1V2AA 2P5RA 3ZMKA 4NV2A 5JWRB 2PPTA 1TRVA 1K0DA 1F3BA 2H0IA 4GRFA 2XPDA 2O8VB 2YPMA 3UVHA 6GSWA 2IPAA 3TDGA 2DMLA 4K2DA 1GWCA 4K7NA 3A5WA 1I9DA 5JWOB 1XPVA 4GLTA 2IMDA 4ML1A 3DVXA 4KX4A 3TOUA 1XVQA 4JEDA 3C73A 1SL1B 3AY8A 4MPFA 5IM9A 4POBA 4BA7A 1XVWA 3HZ4A 4POMA 4KDYA 2DJKA 3RHCA 3ZTLA 1EOGA 2VAFA 5B7CA 4RQRA 1GSQA 2AHEA 5H5SA 3VPQA 2FCHA 3CBUA 3UBLA 5J3RA 1X0RA 3E0UA 3QAGA 3TJGA 3CRUA 5DQYA 4YAPA 3O3TA 5FWGA 4XTSA 2FA4A 4PQ1A 1I5GA 1M0UA 4IQAA 1OE7A 1E2YA 5KN1A 3M3MA 1X5DA 4CW9A 3IXRA 1EOHA 4EDZA 4G19A 4ECJA 4FH8A 4OD7A 1Y6EA 1MD3A 1XFLA 2GGTA 3I43A 1H4OA 2IFQA 5G2ZA 3KH9A 1DE2A 2XHFA 3A3TA 3HYPA 2LV3A 3QPMA 2LNTA 3TGZA 2ON7A 1WE0A 4F82A 1JZRA 1JHBA 2IWTA 3BOAA 1EGRA 2I81A 4E8EA 3ERFA 1E6BA 1BQ7A 3ZIVA 4WF4A 3I9V2 4DSSA 2H01A 3EC3A 2PGTA 3L9SA 1XBSA 4MJAA 2RLIA 2VCWA 3KP8A 4WETA 3WGEA 1K3LA 3F63A 3GTUB 2YV9A 3GL5A 2YOIA 1DE1A 2X8GA 3C1SA 4WEYA 3IBHA 5HR3A 4WF5A 5DALA 2FUG2 1J9BA 2ALBA 1B9YC 5C00A 2CZ3A 3G9BA 5LNKe 1JLVA 2IFQB 1YQ1A 2I3YA 4YH2A 2JACA 1OC8A 2K18A 3IK7A 3IA1A 5G1KA 1RW1A 3IE3A 3IOSA 1PKZA 3I69A 2PU9C 2OE0A 4IQ1A 1V98A 1WP0A 4MJCA 2YCDA 1A2LA 3C7MA 1JLWA 5DVBA 3N9JA 2Z9SA 4TXVA 4F0BA 3TJBA 1TK8B 3WT1A 2GTUA 3A2WA 2YWIA 1K3YA 2HT9A 2B5YA 1PN9A 5EPFA 1ZGNA 1T4ZA 2I9HA 3RHBA 3IAM2 3GX0A 2H75A 4ZBAA 5HR2A 2QSIA 4GSSA 5DALB 3GMFA 4L0WA 2C3QA 1FVKA 5ECSA 4EVMA 2FWHA 1YEPA 5A4VA 2PUKC 1BJXA 3TCOA 1QQ2A 2H6XA 3L0HA 3EU3A 1UVZA 2GDRA 5ID2B 3F9UA 2YZUA 5IMAA 1OKTA 1GL8A 2H8LA 3LORA 2DIYA 1X9SB 3QFAC 4HJMA 2VUPA 1SJ6A 2HSYA 3VWVA 2AB6A 4GQCA 1H75A 3D4TA 1OC9A 2IMEA 3V1WA 2IIYA 3HD5A 2DJJA 4ECBA 1YDKA 1PMTA 2H19A 1GLPA 3GN3A 3ZRDA 4JR4A 4GQFA 4MH2A 4Q5QA 3BBYA 2PERA 1NW2A 2H6YA 3KTBA 4KCAA 1Z9HA 4JBBA 4QL9A 2C3NA 3EU4A 1M99A 3MSZA 1HNAA 4OFNA 2OE3A 4XS1A 2LS5A 4L0UA 4HDEA 3IV4A 1V57A 5H5QA 4BWQA 4X0XA 1AQXA 1F6MC 4IP6A 2YP6A 4TR1A 4V2LA 1R7HA 3CMIA 2V32A 5HFKA 2LJAA 4MJBA 3EINA 4PNFA 2CX3A 4KUNA 3U6VA 3QOUA 1XCCA 3PINA 2L57A 2MBTA 1XXUA 2GZZA 4IGJA 1AQWA 4K8MA 1ZYEA 3BD2A 1K0MA 2YZHA 3IPZA 1BEDA 5D9XA 2A2SA 3UJ1A 1OC9B 2MBSA 4D73A 2HI7A 4JRRA 1GUKA 2F51A 5ABRA 3P2AA 3BCIA 1PKWA 3GNJA 3HJPA 3KGKA 1TU7A 2DJ1A 3GX8A 2OE1A 5DBQA 3HXSA 3UBKA 3ZZXA 3HJMA 3LSZA 4MZBA 3LYPA 3ISOA 3ME7A 3F0IA 5D9VA 1AC1A 4EKZA 2KUCA 1K3OA 1K0CA 2C0GA 1XW5A 4ACSA 3DRNA 3FYGA 1Q4JA 4ZIJA 1G7EA 1AW9A 12GSA 2NVLA 1EWXA 2AYTA 2BTOT 2HRNA 2C0DA 1PSQA 3FZ5A 4XS4A 4OO5A 1M9AA 1TK5B 1GLQA 5EL8A 3ZMLA 4KB3A 2IL3A 1WOUA 1Z7PA 3FRCA 1FB0A 4AF2A 4V1Ap 3KH7A 5DCHA 1A2MA 5IIZA 3CSHA 1M2AA 1A23A 5HR0A 1GSUA 2G0FA 2O87A 2WS2A 4CDOA 3F8UA 2IMIA 3TOTA 1CQGA 14GSA 2GSSA 3ZREA 1FG4A 4AJ7A 4X43A 3GKNA 4ID0A 4JE1A 3ZFBA 3KJYA 4WBJA 2VL3A 2B3SA 4MMMA 1T8EB 3NIVA 2DLXA 3E9JB 1AQVA 4X1UA 5E59A 1NM3A 3RBTA 3ZITA 4PQHA 1NSWA 1PGTA 4ZB6A 4AJ8A 2JL4A 1YZXA 3CTFA 4LMVA 3HA9A 2CVKA 1MDIA 1U88A 3WGXA 1XWCA 2GQLA 3HVVA 1SK1A 3LEFA 3GURA 5J9BA 1YF0A 4BPYA 4POLA 5AISA 2D2ZA 2N5FA 3FW2A 1GUMA 2QKEA 5H5RA 1G6YA 1EV4A 1GSDA 3DIEA 4HU7A 3PR8A 2IJYA 2L59A 5DJLA 3FZAA 3D22A 1AXDA 4CHSA 4OFMA 4EE0A 4EO3A 2VLTA 4ZL9A 3QMXA 1ST9A 1XW6A 4RUVA 1ERWA 6GSTA 5A4UA 4I2UA 3HHVA 5HR1A 4TR0A 4NAXA 1TTZA 2AV4A 1KBNA 2PWJA 4NMUA 1OC3A 5ECKB 2VIMA 2O7KA 1U87A 3TRPA 2CVDA 5CREA 5E4WA 3VI7A 5ELAA 2H1DA 2NDOA 1X9MB 5FHIA 4G2EA 1GNEA 4RI6A 1JFUA 1T3BA 4FYCA 4K9ZA 1IYIA 3LQ7A 4FYBA 5G5EA 1AAZA 2OJLA 1VGLA 3D4MA 2GZYA 2NBSA 3M8NA 1BAYA 1OE8A 1S3DA 2R37A 5IO0A 5A4WA 2I4AA 3FKFA 1XOBA 4V2MA 3GTUA 1GP1A 3P90A 1KNGA 2FHEA 4ZBBA 4WR4A 4F2IA 4PUAA 3CTGA 5IMFA 1U3IA 4KSOA 2VCQA 4KDXA 1GH2A 1FAAA 3MDKA 3CSJA 3LYKA 2BMXA 1SJIA 5IO2A 2FNOA 4IBPA 1VF3A 2VM1A 1SL0B 4BWSA 3GSTA 1SD8A 3C8EA 2XBIA 1Z7RA 3WYWA 4POKA 3N5OA 2VL9A 1TRSA 4PUFC 4KA0A 4PURA 3FR6A 4ZB8A 1WMJA 4HJ2A 2MMAA 4ML6A 4KH7A 2CAQA 4I8BA 3SWLA 2H73A 2VLUA 3KXOA 2GS3A 4NHZA 2C4JA 4L5OA 3M1GA 3NOFA 3DMLA 4KW6A 2J9HA 4N10A 5G31A 1QUWA 5ENUA 4P3YB 1K0BA 5ECMB 2M80A 3LFLA 2GSRA 4NXIA 4WXTA 1B8XA 5JCUA 3P7XA 5GSTA 2KLXA 2L4CA 2FLSA 4N11A 2DIZA 2GSTA 2JADA 1O6JA 4LMWA 1VF4A 2GLRA 3ERWA 1TI3A 3PGTA 1XOAA 4FYUA 2AUVA 3O6TA 4MCUA 1BG5A 1TRWA 1RQMA 4TN8A 3Q74A 4JU5A 4AJ6A 1WWJA 1OYJA 3MNGA 2F8FA 5ID2A 4KDUA 4V2NA 4MZWA 4BVXA 2DSAA 2R5GA 2YWOA 3D21A 2V1MA 3EE2A 5CO3A 3F4TA 1TP9A 4ZXGA 1URMA 2VCZA 2GQKA 2CQ9A 4YQVA 4EC0A 3RDWA 2GT6A 2WB9A 1T4YA 1IYHA 1Z6NA 2FGXA 1F9MA 2FY6A 3PH9A 2WDUA 3UAPA 4MA9A 3I6AA 3CYNA 4PXOA 1XWBA 1SK2A 3W8SA 1EP7A 2K9FA 5D8IA 2H76A 5INYA 2HE3A 1FB6A 4HQZA 2CV4A 1R5AA 4HEA2 4O92A 5KN0A 3SBCA 1EGOA 4HOJA 2H74A 1LJRA 1W4VA 4F9ZA 4K7OA 2CT6A 4OCEA 2OADA 2C1YA 1FO5A 2H71A 1U3AA 3LWAA 4TXOB 4ULXA 2NPBA 2R6KA 1Z5YE 1DSBA 3F4RA 3DKSA 5B6MA 1WRYA 3ERGA 2YWMA 3VWWA 2GT5A 3L9UA 2TRXA 2VD1A 4ZL8A 2LRNA 4WR5A 3A2XA 2LEGA 1YF1A 4N30A 1FW1A 1TW9A 2VOCA 3VPTA 5CRGA 3HCZA 2HNLA 4HU9A 1ZOFA 4NWYA 4ECCA 5ECPB 5ECOB 1W89A 4GTUA 3H4KA 1YKAA 5AN1A 3GHAA 1THOA 3BCKA 1TOFA 2IN3A 2HLSA 5CRDA 5C04A 1EEMA 2NTOA 2EIQA 1HD2A 1QFNA 2FA8A 3P8WA 4WBRD 1GTUA 5G1LA 3VFIA 2R2JA 1HQOA 2MMOA 1ZL9A 5B8BA 3EWLA 2OBKA 1JZDA 3KP9A 4LL1B 1PD21 1ML6A 1ABAA 4EDYA 4MJEA 1HYUA 1O7UA 3L9VA 1KEBA 4QQ7A 1YKCA 3UOMA 2DJ0A 2H66A 1SU9A 3KMNA 5AIVA 3TJKA 1R4WA 10GSA 4K0GA 3TKSA 1G6WA 1ACVA 1SJZA 4XIHA 3HY2A 2P31A 3ZFLA 3ED3A 1V58A 1XZOA 4DSQA 1TRUA 3IRAA 1VRSD 4ISDA 2FWFA 4O7HA 3GSSA 2DMMA 5GZZB 2CVBA 2H1GA 2QC7A 4MABA 2FWGA 9GSSA 5CAXA 1ON4A 2MZCA 4GSTA 2GZPA 4V1Ag 5IMVA 2YWNA 4OWYA 1PA3A 2VCTA 2H72A 2H0HA 2RM5A 2CAIA 3O76A 1GSEA 5J5NA 13GSA 4J57E 2E2GA 5IMZA 5CRWA 3ZL5A 2YJ7A 2P0GA 2HZEB 3TKQA 1XWAA 2L5OA 4E8HA 4L5LA 4L8EA 1RK4A 19GSA 1R5PA 3LXTA 3EVIA 2HSHA 2WCIA 2EIRA 1GUHA 5CRHA 1ERVA 5HQPA 1M9BA 4YQMA 3GUSA 3ZLPA 4IJIA 3EMPA 1K0OA 4IHUA 5IMDA 4EUYA 1N2AA 2JZSA 4MP4A 5F0GA 2KP2A 3FY7A 2B1KA 4ZL7A 2EC4A 1YY7A 4MPGA 1MEKA 2L6DA 3NZNA 2HZFA 2G2QA 3KEBA 2H70A 4XHMA 2JU5A 2OA7A 3IR4A 2YN1A 2KP1A 3Q19A 4EL1A 3RAZA 4Z7XA 3KD0A 4TR4A 3JCML 4WKWA 2C0EA 2C8UA 3D5JA 2TIRA 5L71A 4IVFA 3F3RA 5J4UA 6GSSA 4N0VA 4FO5A 1GTBA 1PQNA 3FK8A 4DSRA 2VD0A 2X8CA 4PQIA 1VF1A 3KM6A 4HZ2A 1TJDA 1N8JA 1O8WA 3QDNA 3UARA 4EXJA 1T00A 1X5CA 4NPBA 3RPNA 3F4SA 4NHWA 2ZNMA 2YNXA 1T7PB 5ECRB 3KMOA 2ZUPA 1VF2A
chains in the Genus database with same CATH superfamily
4XRDA 4HUAA 2ES7A 2HYXA 1YEXA 1SYRA 4BVYA 3GV1A 3DXBA 2M46A 4Z2RA 1A2JA 3QR6A 5B6NA 4KCEA 2OBIA 1GSSA 4MZCA 2CA8A 2JZTA 2GQMA 3DD3A 2L6CA 1J08A 1GSFA 4GSNA 5JCGA 2R4VA 20GSA 3TKSC 5BRTA 1LU4A 3GRXA 4AGSA 2PVQA 2MMZA 4O5UA 5D73A 1BX9A 6GSXA 2IMKA 16GSA 1JZWA 3H1NA 5JCWA 2H30A 2IMFA 4IN0A 5A5KA 4I97A 4KGIA 4PX1A 2N5AA 3M0FA 2R3XA 3DYRA 3CXGA 11GSA 2DC5A 5DAKB 3HVSA 3WGDA 5AGYA 3VLNA 4HQSA 1S3AA 2L4QA 5DJMA 4OCFA 1PFOA 2VCXA 1BYEA 1QMVA 1Z3EA 4ILFA 4K1FA 1F37A 1X9WB 4F03A 2GSQA 1V40A 8GSSA 3QD9A 1HNBA 3UIWA 3GYKA 2HRFA 4KE3A 1TDIA 5DDLA 3F6DA 3E3EA 3GKMA 1O81A 5DQSA 2VLVA 1PX7A 3CRTA 3VWXA 1R26A 1U6TA 2K8SA 4K0NA 2DBCA 4BL7A 4TKYA 4KAEA 2H1BA 3WD6A 1XIYA 4N0ZA 2JSZA 2LKUA 3FZ9A 5IMCA 1SKSB 2HXKA 1O8XA 2LRCA 2B6MA 2V6OA 4GXZA 1GNWA 1PL2A 5ECQB 1A8LA 1GSYA 3ZVJA 1OAZA 2LJRA 3GL3A 3G7YA 4ZBDA 1FVJA 1S3CA 3HVXA 3RPPA 3IC4A 2E0QA 3GIXA 1G7OA 4QL7A 2JSYA 3LG6A 3VURA 2VO4A 4MLYA 4LLRA 5IPGA 1O85A 3TKPA 5GSSA 2EIOA 1B4PA 2LNSA 1PRXA 3TJJA 5IQYA 1AUCA 3IAS2 3TB2A 2LJKA 2HSMA 3PPUA 3IHQA 2X64A 3FHKA 1F3AA 5F06A 2LTKA 1TU8A 4XCSA 1X5EA 4MH3A 2WULA 3R2QA 5G30A 3G7JA 3C1RA 4BL7B 1DUGA 3HKRA 1XWKA 5IOWA 1Q98A 1ZCPA 2A2RA 4ZILA 5GAND 4Q5FA 2F9SA 4TXOA 1UA5A 5G5FA 3A2VA 3LXZA 5J9CA 4K6XA 4EIPA 18GSA 2ZCTA 3ZYWA 2K6VA 5B8AA 5DCGA 1FOVA 2PN8A 3QAVA 2C80A 3HZ8A 1ZYQB 1PL1A 3M9KA 2R0CA 2V6KA 3MYDA 5EVOA 4TVEA 5GAPD 5HFIA 22GSA 5ECLB 4I2TA 3KIJA 2J23A 4RI7A 2H1AA 1TK0B 1QGVA 2B5EA 2PMTA 1OVNA 3GKKA 2OACA 4YAVA 4DSSB 4HS1A 2VM2A 1OKDA 4Q5RA 1SKWB 2DJ2A 4OMVA 2X8HA 5J41A 3W6GA 2XBQA 2WGRA 4FIWA 4NV5A 3H79A 1EP8A 2LSTA 1SL2B 5AIXA 2XPEA 1A24A 4JZQA 3TKSE 1NHYA 4F0CA 3S9FA 2YANA 2RM6A 2QGVA 3CSIA 4GCIA 3LGCA 5CYYA 5CP1A 5COHA 3K8NA 2LQOA 1SENA 3OR5A 5KEJA 7GSSA 2CZ2A 2CX4A 1KTEA 3Q6OA 2WJUA 2FD3A 1B9XC 2X99A 1GULA 2H0GA 3KTLA 3M9JA 3TUEA 3D0ZA 1B48A 4HSCX 4IKHA 1UN2A 4GWRA 2FWEA 1GTIA 2BJXA 4G10A 2VL2A 1M2DA 1EEJA 2MMNA 1MDKA 3IK9A 4HI7A 4J2FA 1K0NA 3UEMA 2DKHA 1NHOA 1ZZYA 1LBKA 2YV7A 3HDCA 4MF5A 1USBA 3GKXA 3FR9A 3C71A 3KZQA 6GSVA 3L78A 4KSMA 2V41A 2B7KA 1MDJA 4YQUA 1GTAA 2C0FA 5ECHB 1M7TA 2HZEA 3WT2A 6GSYA 2LUSA 2H6ZA 4IJ3A 5ECNB 2L5LA 1WJKA 3F3QA 1PX6A 3DGQA 2ON5A 1SK0A 5ELGA 1M2BA 3TJFA 2C3TA 1C72A 3FR3A 1AIUA 3H93A 1G0TA 2K8VA 2MYGA 3ZVJD 2A4VA 1B4QA 2RUEA 2P5QA 5CNWA 3L4NA 5KN2A 1HNCA 3ZIJA 4EIQA 1FHEA 3TKRA 4DVCA 4H86A 5D96A 2V2GA 2O89A 2REMA 2X49A 5F8BA 3Q18A 2B7JA 4IW9A 3UVTA 2WRTA 4XS6A 2B5XA 1EZKA 4MDCA 3QCPA 3GH6A 5JWQB 2GVPA 1T1VA 3APOA 3DWVA 4MF7A 1A0RP 2AAWA 3MAKA 1MD4A 4J56E 5IPHA 1A8YA 3IHGA 3ME8A 3U5RE 3W8JA 2XC2A 4JR6A 1JZOA 1MTCA 5F05A 2O85A 3H8QA 5D9TA 5KN3A 1THXA 3EURA 1XWGA 4GF0A 3EMXA 3LJRA 4DEJA 1SKRB 4TR1B 1O73A 3FEUA 1XW9A 1ERUA 3F6FA 5LCZA 4PNGA 4IS0A 3FZ4A 3VI5A 2PBJA 2HRKA 1QXHA 3HJOA 1ERTA 1EV9A 4TOPA 4OO4A 3APQA 4LL4B 1TKDB 5HFGA 4TRXA 2WFCA 3APSA 2VCVA 3QFBC 4IELA 4Q5NA 1Y25A 5LD0A 4I6XA 1ZYNA 4TW5A 5D9WA 4MK3A 5D93A 1GRXA 4D73B 2B1LA 3EYTA 2LRTA 1WPIA 1A0FA 1TXXA 5IOXA 1ZMAA 2HFDA 1WIKA 3UL3A 4XRAA 2JZRA 4ICYA 1K0AA 3KCMA 4YKGA 3GFKA 2AJQB 1ILOA 4K7IA 2RIIA 2YJHA 6GSUA 2OKAA 4FQUA 4OFTA 2DJ3A 3DVWA 1F2EA 2F3MA 4O32A 1YJ6A 3VK9A 4RQXA 4G9HA 2E7PA 4HZ4A 2KHPA 1SYXA 3J7Yk 2VL2C 3MWHA 3G7IA 2F8AA 4ECIA 5EY6A 3BJ5A 17GSA 4ZB9A 3GH9A 1TI1A 3D6IA 3DEXA 5ECIB 1QK8A 5DAKA 2QA1A 3TRQA 3GA4A 4TR3A 5F07A 2M72A 4XS4B 1CQHA 4I5QA 3TRXA 4IP1A 4O5RA 3US3A 2E2MA 4KNDA 3J7Yb 4LA1A 3VWUA 1UC7A 5FT3A 2TRCP 1V9WA 4MF6A 1J0FA 1SD9A 2WZ9A 1Z6MA 3IDVA 3UMAA 4PGTA 2PVOC 1DBYA 2N5BA 2LQQA 3QAWA 4EF0A 2I1UA 2RUFA 2KOKA 1V2AA 2P5RA 3ZMKA 4NV2A 5JWRB 2PPTA 1TRVA 1K0DA 1F3BA 2H0IA 4GRFA 2XPDA 2O8VB 2YPMA 3UVHA 6GSWA 2IPAA 3TDGA 2DMLA 4K2DA 1GWCA 4K7NA 3A5WA 1I9DA 5JWOB 1XPVA 3LW9A 4GLTA 2IMDA 4ML1A 3DVXA 4KX4A 3TOUA 1XVQA 4JEDA 3C73A 1SL1B 3AY8A 4MPFA 5IM9A 4POBA 4BA7A 1XVWA 3HZ4A 4POMA 4KDYA 2DJKA 3RHCA 3ZTLA 1EOGA 2VAFA 5B7CA 4RQRA 1GSQA 2AHEA 5H5SA 3VPQA 3CQFA 2FCHA 3CBUA 3UBLA 3A5IA 5J3RA 1X0RA 3E0UA 3QAGA 3TJGA 3CRUA 5DQYA 4YAPA 3O3TA 5FWGA 4XTSA 2FA4A 4PQ1A 1I5GA 4K2XA 4KF9A 1M0UA 1M3IA 4IQAA 1OE7A 1E2YA 5KN1A 3M3MA 1X5DA 4CW9A 3IXRA 1EOHA 4EDZA 4G19A 4ECJA 4FH8A 4OD7A 1Y6EA 1MD3A 1XFLA 2GGTA 3I43A 1H4OA 2IFQA 5G2ZA 3KH9A 1DE2A 3HVNA 2XHFA 3A3TA 3HYPA 2LV3A 3QPMA 2LNTA 3TGZA 2ON7A 1FOHA 1WE0A 4F82A 1JZRA 1JHBA 2IWTA 3BOAA 1EGRA 2I81A 4E8EA 3ERFA 1E6BA 1BQ7A 3ZIVA 3IC8A 4WF4A 4USSA 3I9V2 4DSSA 2H01A 3EC3A 2PGTA 3L9SA 1XBSA 4MJAA 2RLIA 2VCWA 3KP8A 4WETA 1PN0A 3WGEA 1K3LA 3F63A 3GTUB 2YV9A 3GL5A 2YOIA 1DE1A 2X8GA 3C1SA 4WEYA 3IBHA 5HR3A 4WF5A 5DALA 2FUG2 1J9BA 2ALBA 1B9YC 5C00A 2CZ3A 3G9BA 5LNKe 1JLVA 2IFQB 1YQ1A 2I3YA 4YH2A 2JACA 1OC8A 2K18A 3IK7A 3IA1A 5G1KA 1RW1A 3IE3A 3IOSA 1PKZA 3I69A 2PU9C 2OE0A 4IQ1A 1V98A 1WP0A 4MJCA 2YCDA 1A2LA 3C7MA 1JLWA 5DVBA 3N9JA 2Z9SA 4TXVA 4F0BA 3TJBA 1TK8B 3WT1A 2GTUA 3A2WA 2YWIA 1K3YA 2HT9A 2B5YA 1PN9A 5EPFA 1ZGNA 1T4ZA 2I9HA 3RHBA 3IAM2 3GX0A 2H75A 4ZBAA 5HR2A 2QSIA 4GSSA 5DALB 3GMFA 4L0WA 2C3QA 1FVKA 5ECSA 4EVMA 2FWHA 1YEPA 5A4VA 2PUKC 1BJXA 3TCOA 1QQ2A 2H6XA 3L0HA 3EU3A 1UVZA 2GDRA 5ID2B 3F9UA 2YZUA 5IMAA 1OKTA 4BVXB 1GL8A 2H8LA 3LORA 2DIYA 1X9SB 3QFAC 4HJMA 2VUPA 1SJ6A 2HSYA 3VWVA 2AB6A 4GQCA 1H75A 3D4TA 1OC9A 2IMEA 3V1WA 2IIYA 3HD5A 2DJJA 4ECBA 1YDKA 1PMTA 2H19A 1GLPA 3GN3A 3ZRDA 4JR4A 4GQFA 4MH2A 4Q5QA 3BBYA 2PERA 1NW2A 2H6YA 3KTBA 4KCAA 1Z9HA 4JBBA 4QL9A 2C3NA 3EU4A 1M99A 3MSZA 1HNAA 4OFNA 1ZYPA 2OE3A 4XS1A 2LS5A 4L0UA 4HDEA 3IV4A 1V57A 5H5QA 4BWQA 2HRAA 4X0XA 1AQXA 1F6MC 4IP6A 2YP6A 4TR1A 4V2LA 1R7HA 3CMIA 2V32A 5HFKA 2LJAA 4MJBA 3EINA 4PNFA 2CX3A 4KUNA 3U6VA 3R3EA 3QOUA 1XCCA 3PINA 2L57A 2MBTA 1XXUA 2GZZA 4IGJA 1AQWA 4K8MA 1ZYEA 3BD2A 1K0MA 2YZHA 3IPZA 1BEDA 5D9XA 2A2SA 3UJ1A 1OC9B 2MBSA 4D73A 2HI7A 4JRRA 1GUKA 2F51A 5ABRA 3P2AA 3BCIA 1PKWA 3GNJA 3HJPA 3KGKA 1TU7A 2DJ1A 3GX8A 2OE1A 5DBQA 1XG8A 3HXSA 3UBKA 3ZZXA 3HJMA 3LSZA 4MZBA 3LYPA 3ISOA 3ME7A 3F0IA 5D9VA 1AC1A 4EKZA 2KUCA 1K3OA 1K0CA 2C0GA 1XW5A 4ACSA 3DRNA 3FYGA 1Q4JA 4ZIJA 1G7EA 4O5QA 1AW9A 12GSA 2NVLA 1EWXA 2AYTA 2BTOT 2HRNA 2C0DA 1PSQA 3FZ5A 4XS4A 4OO5A 1M9AA 1TK5B 1GLQA 5EL8A 3MIXA 3ZMLA 4KB3A 2IL3A 1WOUA 1Z7PA 3FRCA 1FB0A 4AF2A 4V1Ap 3KH7A 5DCHA 1A2MA 5IIZA 3CSHA 1M2AA 1A23A 5HR0A 1GSUA 2G0FA 2O87A 2WS2A 4CDOA 3F8UA 2IMIA 4CY8A 3TOTA 1CQGA 2X4AA 14GSA 2GSSA 2R0GA 3ZREA 1FG4A 4AJ7A 4X43A 3GKNA 4ID0A 4JE1A 3ZFBA 3KJYA 4WBJA 2VL3A 2B3SA 4MMMA 1T8EB 3NIVA 2DLXA 3E9JB 1AQVA 4X1UA 5E59A 1NM3A 3RBTA 2QA2A 3ZITA 4PQHA 1NSWA 1PGTA 4ZB6A 4AJ8A 2JL4A 1YZXA 3CTFA 4LMVA 3HA9A 4K5SA 2CVKA 1MDIA 1U88A 3WGXA 1XWCA 5KOWA 2GQLA 3HVVA 1SK1A 3LEFA 3GURA 5J9BA 1YF0A 4BPYA 4POLA 5AISA 2D2ZA 2N5FA 3FW2A 1GUMA 2QKEA 5H5RA 1G6YA 1EV4A 1GSDA 3DIEA 4HU7A 3PR8A 2IJYA 2L59A 5DJLA 3FZAA 3D22A 1AXDA 4CHSA 4OFMA 4EE0A 4EO3A 2VLTA 4ZL9A 3QMXA 1ST9A 1XW6A 4RUVA 1ERWA 6GSTA 5A4UA 4I2UA 2A2PA 3HHVA 5HR1A 4TR0A 4Z2TA 4NAXA 1TTZA 2AV4A 1KBNA 2PWJA 4NMUA 1OC3A 5ECKB 2VIMA 2O7KA 4G0IA 1U87A 3TRPA 2CVDA 5CREA 4PTSA 5E4WA 3VI7A 5ELAA 2H1DA 2NDOA 1X9MB 5FHIA 4G2EA 1GNEA 4RI6A 1JFUA 1T3BA 4FYCA 4K9ZA 1IYIA 3LQ7A 4FYBA 5G5EA 1AAZA 2OJLA 1VGLA 3D4MA 2GZYA 2NBSA 3M8NA 1BAYA 1OE8A 1S3DA 2R37A 5IO0A 5A4WA 2I4AA 3FKFA 1XOBA 4V2MA 3GTUA 1GP1A 3P90A 1KNGA 2FHEA 4BVYB 4ZBBA 4WR4A 4F2IA 4PUAA 3CTGA 5IMFA 1U3IA 4KSOA 2VCQA 4KDXA 1GH2A 4CY6A 1FAAA 3MDKA 3CSJA 3LYKA 2BMXA 1SJIA 5IO2A 2FNOA 4IBPA 1VF3A 2VM1A 1SL0B 4BWSA 3GSTA 1SD8A 3C8EA 2XBIA 1Z7RA 3WYWA 4POKA 3N5OA 2VL9A 1TRSA 4PUFC 4KA0A 4PURA 3FR6A 4ZB8A 1WMJA 4HJ2A 2MMAA 4ML6A 1M3JA 4KH7A 2CAQA 4I8BA 2R0PA 3SWLA 2H73A 2VLUA 3KXOA 2GS3A 4NHZA 2C4JA 4L5OA 3M1GA 3NOFA 3DMLA 4KW6A 2J9HA 4N10A 5G31A 1QUWA 5ENUA 4P3YB 1K0BA 5ECMB 2M80A 3LFLA 4BIKA 2GSRA 4NXIA 4WXTA 1B8XA 5JCUA 3P7XA 5GSTA 2KLXA 2L4CA 2FLSA 4N11A 2DIZA 2GSTA 2JADA 1O6JA 4LMWA 1VF4A 2GLRA 3FMWA 3ERWA 1TI3A 3PGTA 1XOAA 4FYUA 4A5PA 2AUVA 3O6TA 4MCUA 1BG5A 1TRWA 1RQMA 4TN8A 3Q74A 4JU5A 4AJ6A 1WWJA 1OYJA 3MNGA 2F8FA 5ID2A 4KDUA 4V2NA 4MZWA 4BVXA 2DSAA 2R5GA 2YWOA 3D21A 4K5RA 2V1MA 3EE2A 5CO3A 3F4TA 1TP9A 4ZXGA 1URMA 4YKFA 2VCZA 2GQKA 2CQ9A 4YQVA 4EC0A 5KOXA 3RDWA 2GT6A 2WB9A 1T4YA 1IYHA 1Z6NA 2FGXA 1F9MA 2DKIA 2FY6A 3PH9A 2WDUA 3UAPA 4MA9A 3I6AA 4X4JA 3CYNA 4PXOA 1XWBA 1SK2A 3W8SA 1EP7A 2K9FA 5D8IA 2H76A 5INYA 2HE3A 1FB6A 4HQZA 2CV4A 2UZ8A 5BMUA 1R5AA 4HEA2 4O92A 5KN0A 3SBCA 1EGOA 4HOJA 2H74A 1LJRA 1W4VA 4F9ZA 4K7OA 2CT6A 4OCEA 2OADA 2C1YA 1FO5A 2H71A 1U3AA 3LWAA 4TXOB 4ULXA 2NPBA 2R6KA 1Z5YE 1DSBA 3F4RA 3DKSA 5B6MA 1WRYA 3ERGA 2YWMA 3VWWA 2GT5A 3L9UA 2TRXA 2VD1A 4ZL8A 2LRNA 4WR5A 3A2XA 2LEGA 1YF1A 4N30A 1FW1A 1TW9A 2VOCA 3VPTA 5CRGA 3HCZA 2HNLA 4HU9A 1ZOFA 4NWYA 4ECCA 5ECPB 5ECOB 1W89A 4GTUA 3H4KA 1YKAA 5AN1A 3GHAA 1THOA 3BCKA 1TOFA 2IN3A 2HLSA 4MNNA 5CRDA 5C04A 1EEMA 2NTOA 2EIQA 1HD2A 1QFNA 2FA8A 3P8WA 4WBRD 4Z2UA 1GTUA 5G1LA 3VFIA 2R2JA 1HQOA 2MMOA 1ZL9A 5B8BA 3EWLA 1S3RA 2OBKA 1JZDA 3KP9A 4LL1B 1PD21 1ML6A 1ABAA 4EDYA 4MJEA 1HYUA 1O7UA 3L9VA 1KEBA 4QQ7A 1YKCA 3UOMA 2DJ0A 2H66A 1SU9A 3KMNA 5AIVA 3TJKA 1R4WA 10GSA 4K0GA 3TKSA 1G6WA 1ACVA 1SJZA 4XIHA 3HY2A 2P31A 3ZFLA 3ED3A 1V58A 1XZOA 4DSQA 1TRUA 3IRAA 1VRSD 4ISDA 2FWFA 4O7HA 3GSSA 2DMMA 5GZZB 2CVBA 2H1GA 2QC7A 4MABA 2FWGA 4G0LA 9GSSA 5CAXA 1ON4A 2MZCA 4G0KA 4GSTA 2GZPA 4V1Ag 5IMVA 2YWNA 4OWYA 1PA3A 2VCTA 2H72A 2H0HA 2RM5A 2CAIA 3O76A 1GSEA 5J5NA 13GSA 4J57E 2E2GA 5IMZA 5CRWA 3ZL5A 2YJ7A 2P0GA 2HZEB 3TKQA 1XWAA 2L5OA 4E8HA 4L5LA 4L8EA 1RK4A 19GSA 1R5PA 3LXTA 3EVIA 2HSHA 2WCIA 2EIRA 1GUHA 5CRHA 1ERVA 5HQPA 1M9BA 2A4HA 4YQMA 3GUSA 3ZLPA 4IJIA 3EMPA 1K0OA 4IHUA 5IMDA 4EUYA 1N2AA 2JZSA 4MP4A 5F0GA 2KP2A 3FY7A 2B1KA 4ZL7A 2EC4A 1YY7A 4MPGA 1MEKA 2L6DA 3NZNA 2HZFA 2G2QA 3KEBA 2H70A 4XHMA 2JU5A 2OA7A 3IR4A 2YN1A 2KP1A 3Q19A 4EL1A 3RAZA 4Z7XA 3KD0A 4TR4A 3JCML 4WKWA 2C0EA 2C8UA 3D5JA 2TIRA 5L71A 4IVFA 3F3RA 5J4UA 6GSSA 4N0VA 4FO5A 3EPTA 1GTBA 1PQNA 3FK8A 4DSRA 2VD0A 2X8CA 4PQIA 1VF1A 3KM6A 4HZ2A 1TJDA 1N8JA 1O8WA 3QDNA 3UARA 4EXJA 1T00A 1X5CA 4NPBA 3RPNA 3F4SA 4NHWA 2ZNMA 2YNXA 1T7PB 5ECRB 3KMOA 2ZUPA 1VF2A
chains in the Genus database with same CATH topology
4XRDA 4HUAA 2ES7A 2HYXA 1YEXA 1SYRA 4BVYA 3GV1A 3DXBA 2M46A 4Z2RA 1A2JA 3QR6A 5B6NA 4KCEA 2OBIA 1GSSA 4MZCA 2CA8A 2JZTA 2GQMA 3DD3A 2L6CA 1J08A 1GSFA 4GSNA 5JCGA 2R4VA 20GSA 3TKSC 5BRTA 1LU4A 3GRXA 4AGSA 2PVQA 2MMZA 4O5UA 5D73A 1BX9A 6GSXA 2IMKA 16GSA 1JZWA 3H1NA 5JCWA 2H30A 2IMFA 4IN0A 5A5KA 4I97A 4KGIA 4PX1A 2N5AA 3M0FA 2R3XA 3DYRA 3CXGA 11GSA 2DC5A 5DAKB 3HVSA 3WGDA 5AGYA 3VLNA 4HQSA 1S3AA 2L4QA 5DJMA 4OCFA 2VCXA 1BYEA 1QMVA 1Z3EA 4ILFA 4K1FA 1F37A 1X9WB 4F03A 2GSQA 1V40A 8GSSA 3QD9A 1HNBA 3UIWA 3GYKA 2HRFA 4KE3A 1TDIA 5DDLA 3F6DA 3E3EA 3GKMA 1O81A 5DQSA 2VLVA 1PX7A 3CRTA 3VWXA 1R26A 1U6TA 2K8SA 4K0NA 2DBCA 4BL7A 4TKYA 4KAEA 2H1BA 3WD6A 1XIYA 4N0ZA 2JSZA 2LKUA 3FZ9A 5IMCA 1SKSB 2HXKA 1O8XA 2LRCA 2B6MA 2V6OA 4GXZA 1GNWA 1PL2A 5ECQB 1A8LA 1GSYA 3ZVJA 1OAZA 2LJRA 3GL3A 3G7YA 4ZBDA 1FVJA 1S3CA 3HVXA 3RPPA 3IC4A 2E0QA 3GIXA 1G7OA 4QL7A 2JSYA 3LG6A 3VURA 2VO4A 4MLYA 4LLRA 5IPGA 1O85A 3TKPA 5GSSA 2EIOA 1B4PA 2LNSA 1PRXA 3TJJA 5IQYA 1AUCA 3IAS2 3TB2A 2LJKA 2HSMA 3PPUA 3IHQA 2X64A 3FHKA 1F3AA 5F06A 2LTKA 1TU8A 4XCSA 1X5EA 4MH3A 2WULA 3R2QA 5G30A 3G7JA 3C1RA 4BL7B 1DUGA 3HKRA 1XWKA 5IOWA 1Q98A 1ZCPA 2A2RA 4ZILA 5GAND 4Q5FA 2F9SA 4TXOA 1UA5A 5G5FA 3A2VA 3LXZA 5J9CA 4K6XA 4EIPA 18GSA 2ZCTA 3ZYWA 2K6VA 5B8AA 5DCGA 1FOVA 2PN8A 3QAVA 2C80A 3HZ8A 1ZYQB 1PL1A 3M9KA 2R0CA 2V6KA 3MYDA 5EVOA 4TVEA 5GAPD 5HFIA 22GSA 5ECLB 4I2TA 3KIJA 2J23A 4RI7A 2H1AA 1TK0B 1QGVA 2B5EA 2PMTA 1OVNA 3GKKA 2OACA 4YAVA 4DSSB 4HS1A 2VM2A 1OKDA 4Q5RA 1SKWB 2DJ2A 4OMVA 2X8HA 5J41A 3W6GA 2XBQA 2WGRA 4FIWA 4NV5A 3H79A 1EP8A 2LSTA 1SL2B 5AIXA 2XPEA 1A24A 4JZQA 3TKSE 1NHYA 4F0CA 3S9FA 2YANA 2RM6A 2QGVA 3CSIA 4GCIA 3LGCA 5CYYA 5CP1A 5COHA 3K8NA 2LQOA 1SENA 3OR5A 5KEJA 7GSSA 2CZ2A 2CX4A 1KTEA 3Q6OA 2WJUA 2FD3A 1B9XC 2X99A 1GULA 2H0GA 3KTLA 3M9JA 3TUEA 3D0ZA 1B48A 4IKHA 1UN2A 4GWRA 2FWEA 1GTIA 2BJXA 4G10A 2VL2A 1M2DA 1EEJA 2MMNA 1MDKA 3IK9A 4HI7A 4J2FA 1K0NA 3UEMA 2DKHA 1NHOA 1ZZYA 1LBKA 2YV7A 3HDCA 4MF5A 1USBA 3GKXA 3FR9A 3C71A 3KZQA 6GSVA 3L78A 4KSMA 2V41A 2B7KA 1MDJA 4YQUA 1GTAA 2C0FA 5ECHB 1M7TA 2HZEA 3WT2A 6GSYA 2LUSA 2H6ZA 4IJ3A 5ECNB 2L5LA 1WJKA 3F3QA 1PX6A 3DGQA 2ON5A 1SK0A 5ELGA 1M2BA 3TJFA 2C3TA 1C72A 3FR3A 1AIUA 3H93A 1G0TA 2K8VA 2MYGA 3ZVJD 2A4VA 1B4QA 2RUEA 2P5QA 5CNWA 3L4NA 5KN2A 1HNCA 3ZIJA 4EIQA 1FHEA 3TKRA 4DVCA 4H86A 5D96A 2V2GA 2O89A 2REMA 2X49A 5F8BA 3Q18A 2B7JA 4IW9A 3UVTA 2WRTA 4XS6A 2B5XA 1EZKA 4MDCA 3QCPA 3GH6A 5JWQB 2GVPA 1T1VA 3APOA 3DWVA 4MF7A 1A0RP 2AAWA 3MAKA 1MD4A 4J56E 5IPHA 1A8YA 3IHGA 3ME8A 3U5RE 3W8JA 2XC2A 4JR6A 1JZOA 1MTCA 5F05A 2O85A 3H8QA 5D9TA 5KN3A 1THXA 3EURA 1XWGA 4GF0A 3EMXA 3LJRA 4DEJA 1SKRB 4TR1B 1O73A 3FEUA 1XW9A 1ERUA 3F6FA 5LCZA 4PNGA 4IS0A 3FZ4A 3VI5A 2PBJA 2HRKA 1QXHA 3HJOA 1ERTA 1EV9A 4TOPA 4OO4A 3APQA 4LL4B 1TKDB 5HFGA 4TRXA 2WFCA 3APSA 2VCVA 3QFBC 4IELA 4Q5NA 1Y25A 5LD0A 4I6XA 1ZYNA 4TW5A 5D9WA 4MK3A 5D93A 1GRXA 4D73B 2B1LA 3EYTA 2LRTA 1WPIA 1A0FA 1TXXA 5IOXA 1ZMAA 2HFDA 1WIKA 3UL3A 4XRAA 2JZRA 4ICYA 1K0AA 3KCMA 4YKGA 3GFKA 2AJQB 1ILOA 4K7IA 2RIIA 2YJHA 6GSUA 2OKAA 4FQUA 4OFTA 2DJ3A 3DVWA 1F2EA 2F3MA 4O32A 1YJ6A 3VK9A 4RQXA 4G9HA 2E7PA 4HZ4A 2KHPA 1SYXA 3J7Yk 2VL2C 3MWHA 3G7IA 2F8AA 4ECIA 5EY6A 3BJ5A 17GSA 4ZB9A 3GH9A 1TI1A 3D6IA 3DEXA 5ECIB 1QK8A 5DAKA 2QA1A 3TRQA 3GA4A 4TR3A 5F07A 2M72A 4XS4B 1CQHA 4I5QA 3TRXA 4IP1A 4O5RA 3US3A 2E2MA 4KNDA 3J7Yb 4LA1A 3VWUA 1UC7A 5FT3A 2TRCP 1V9WA 4MF6A 1J0FA 1SD9A 2WZ9A 1Z6MA 3IDVA 3UMAA 4PGTA 2PVOC 1DBYA 2N5BA 2LQQA 3QAWA 4EF0A 2I1UA 2RUFA 2KOKA 1V2AA 2P5RA 3ZMKA 4NV2A 5JWRB 2PPTA 1TRVA 1K0DA 1F3BA 2H0IA 4GRFA 2XPDA 2O8VB 2YPMA 3UVHA 6GSWA 2IPAA 3TDGA 2DMLA 4K2DA 1GWCA 4K7NA 3A5WA 1I9DA 5JWOB 1XPVA 3LW9A 4GLTA 2IMDA 4ML1A 3DVXA 4KX4A 3TOUA 1XVQA 4JEDA 3C73A 1SL1B 3AY8A 4MPFA 5IM9A 4POBA 4BA7A 1XVWA 3HZ4A 4POMA 4KDYA 2DJKA 3RHCA 3ZTLA 1EOGA 2VAFA 5B7CA 4RQRA 1GSQA 2AHEA 5H5SA 3VPQA 2FCHA 3CBUA 3UBLA 3A5IA 5J3RA 1X0RA 3E0UA 3QAGA 3TJGA 3CRUA 5DQYA 4YAPA 3O3TA 5FWGA 4XTSA 2FA4A 4PQ1A 1I5GA 4K2XA 4KF9A 1M0UA 4IQAA 1OE7A 1E2YA 5KN1A 3M3MA 1X5DA 4CW9A 3IXRA 1EOHA 4EDZA 4G19A 4ECJA 4FH8A 4OD7A 1Y6EA 1MD3A 1XFLA 2GGTA 3I43A 1H4OA 2IFQA 5G2ZA 3KH9A 1DE2A 2XHFA 3A3TA 3HYPA 2LV3A 3QPMA 2LNTA 3TGZA 2ON7A 1FOHA 1WE0A 4F82A 1JZRA 1JHBA 2IWTA 3BOAA 1EGRA 2I81A 4E8EA 3ERFA 1E6BA 1BQ7A 3ZIVA 3IC8A 4WF4A 4USSA 3I9V2 4DSSA 2H01A 3EC3A 2PGTA 3L9SA 1XBSA 4MJAA 2RLIA 2VCWA 3KP8A 4WETA 1PN0A 3WGEA 1K3LA 3F63A 3GTUB 2YV9A 3GL5A 2YOIA 1DE1A 2X8GA 3C1SA 4WEYA 3IBHA 5HR3A 4WF5A 5DALA 2FUG2 1J9BA 2ALBA 1B9YC 5C00A 2CZ3A 3G9BA 5LNKe 1JLVA 2IFQB 1YQ1A 2I3YA 4YH2A 2JACA 1OC8A 2K18A 3IK7A 3IA1A 5G1KA 1RW1A 3IE3A 3IOSA 1PKZA 3I69A 2PU9C 2OE0A 4IQ1A 1V98A 1WP0A 4MJCA 2YCDA 1A2LA 3C7MA 1JLWA 5DVBA 3N9JA 2Z9SA 4TXVA 4F0BA 3TJBA 1TK8B 3WT1A 2GTUA 3A2WA 2YWIA 1K3YA 2HT9A 2B5YA 1PN9A 5EPFA 1ZGNA 1T4ZA 2I9HA 3RHBA 3IAM2 3GX0A 2H75A 4ZBAA 5HR2A 2QSIA 4GSSA 5DALB 3GMFA 4L0WA 2C3QA 1FVKA 5ECSA 4EVMA 2FWHA 1YEPA 5A4VA 2PUKC 1BJXA 3TCOA 1QQ2A 2H6XA 3L0HA 3EU3A 1UVZA 2GDRA 5ID2B 3F9UA 2YZUA 5IMAA 1OKTA 4BVXB 1GL8A 2H8LA 3LORA 2DIYA 1X9SB 3QFAC 4HJMA 2VUPA 1SJ6A 2HSYA 3VWVA 2AB6A 4GQCA 1H75A 3D4TA 1OC9A 2IMEA 3V1WA 2IIYA 3HD5A 2DJJA 4ECBA 1YDKA 1PMTA 2H19A 1GLPA 3GN3A 3ZRDA 4JR4A 4GQFA 4MH2A 4Q5QA 3BBYA 2PERA 1NW2A 2H6YA 3KTBA 4KCAA 1Z9HA 4JBBA 4QL9A 2C3NA 3EU4A 1M99A 3MSZA 1HNAA 4OFNA 1ZYPA 2OE3A 4XS1A 2LS5A 4L0UA 4HDEA 3IV4A 1V57A 5H5QA 4BWQA 2HRAA 4X0XA 1AQXA 1F6MC 4IP6A 2YP6A 4TR1A 4V2LA 1R7HA 3CMIA 2V32A 5HFKA 2LJAA 4MJBA 3EINA 4PNFA 2CX3A 4KUNA 3U6VA 3R3EA 3QOUA 1XCCA 3PINA 2L57A 2MBTA 1XXUA 2GZZA 4IGJA 1AQWA 4K8MA 1ZYEA 3BD2A 1K0MA 2YZHA 3IPZA 1BEDA 5D9XA 2A2SA 3UJ1A 1OC9B 2MBSA 4D73A 2HI7A 4JRRA 1GUKA 2F51A 5ABRA 3P2AA 3BCIA 1PKWA 3GNJA 3HJPA 3KGKA 1TU7A 2DJ1A 3GX8A 2OE1A 5DBQA 3HXSA 3UBKA 3ZZXA 3HJMA 3LSZA 4MZBA 3LYPA 3ISOA 3ME7A 3F0IA 5D9VA 1AC1A 4EKZA 2KUCA 1K3OA 1K0CA 2C0GA 1XW5A 4ACSA 3DRNA 3FYGA 1Q4JA 4ZIJA 1G7EA 4O5QA 1AW9A 12GSA 2NVLA 1EWXA 2AYTA 2BTOT 2HRNA 2C0DA 1PSQA 3FZ5A 4XS4A 4OO5A 1M9AA 1TK5B 1GLQA 5EL8A 3MIXA 3ZMLA 4KB3A 2IL3A 1WOUA 1Z7PA 3FRCA 1FB0A 4AF2A 4V1Ap 3KH7A 5DCHA 1A2MA 5IIZA 3CSHA 1M2AA 1A23A 5HR0A 1GSUA 2G0FA 2O87A 2WS2A 4CDOA 3F8UA 2IMIA 4CY8A 3TOTA 1CQGA 2X4AA 14GSA 2GSSA 2R0GA 3ZREA 1FG4A 4AJ7A 4X43A 3GKNA 4ID0A 4JE1A 3ZFBA 3KJYA 4WBJA 2VL3A 2B3SA 4MMMA 1T8EB 3NIVA 2DLXA 3E9JB 1AQVA 4X1UA 5E59A 1NM3A 3RBTA 2QA2A 3ZITA 4PQHA 1NSWA 1PGTA 4ZB6A 4AJ8A 2JL4A 1YZXA 3CTFA 4LMVA 3HA9A 4K5SA 2CVKA 1MDIA 1U88A 3WGXA 1XWCA 5KOWA 2GQLA 3HVVA 1SK1A 3LEFA 3GURA 5J9BA 1YF0A 4BPYA 4POLA 5AISA 2D2ZA 2N5FA 3FW2A 1GUMA 2QKEA 5H5RA 1G6YA 1EV4A 1GSDA 3DIEA 4HU7A 3PR8A 2IJYA 2L59A 5DJLA 3FZAA 3D22A 1AXDA 4CHSA 4OFMA 4EE0A 4EO3A 2VLTA 4ZL9A 3QMXA 1ST9A 1XW6A 4RUVA 1ERWA 6GSTA 5A4UA 4I2UA 2A2PA 3HHVA 5HR1A 4TR0A 4Z2TA 4NAXA 1TTZA 2AV4A 1KBNA 2PWJA 4NMUA 1OC3A 5ECKB 2VIMA 2O7KA 4G0IA 1U87A 3TRPA 2CVDA 5CREA 4PTSA 5E4WA 3VI7A 5ELAA 2H1DA 2NDOA 1X9MB 5FHIA 4G2EA 1GNEA 4RI6A 1JFUA 1T3BA 4FYCA 4K9ZA 1IYIA 3LQ7A 4FYBA 5G5EA 1AAZA 2OJLA 1VGLA 3D4MA 2GZYA 2NBSA 3M8NA 1BAYA 1OE8A 1S3DA 2R37A 5IO0A 5A4WA 2I4AA 3FKFA 1XOBA 4V2MA 3GTUA 1GP1A 3P90A 1KNGA 2FHEA 4BVYB 4ZBBA 4WR4A 4F2IA 4PUAA 3CTGA 5IMFA 1U3IA 4KSOA 2VCQA 4KDXA 1GH2A 4CY6A 1FAAA 3MDKA 3CSJA 3LYKA 2BMXA 1SJIA 5IO2A 2FNOA 4IBPA 1VF3A 2VM1A 1SL0B 4BWSA 3GSTA 1SD8A 3C8EA 2XBIA 1Z7RA 3WYWA 4POKA 3N5OA 2VL9A 1TRSA 4PUFC 4KA0A 4PURA 3FR6A 4ZB8A 1WMJA 4HJ2A 2MMAA 4ML6A 4KH7A 2CAQA 4I8BA 2R0PA 3SWLA 2H73A 2VLUA 3KXOA 2GS3A 4NHZA 2C4JA 4L5OA 3M1GA 3NOFA 3DMLA 4KW6A 2J9HA 4N10A 5G31A 1QUWA 5ENUA 4P3YB 1K0BA 5ECMB 2M80A 3LFLA 2GSRA 4NXIA 4WXTA 1B8XA 5JCUA 3P7XA 5GSTA 2KLXA 2L4CA 2FLSA 4N11A 2DIZA 2GSTA 2JADA 1O6JA 4LMWA 1VF4A 2GLRA 3FMWA 3ERWA 1TI3A 3PGTA 1XOAA 4FYUA 4A5PA 2AUVA 3O6TA 4MCUA 1BG5A 1TRWA 1RQMA 4TN8A 3Q74A 4JU5A 4AJ6A 1WWJA 1OYJA 3MNGA 2F8FA 5ID2A 4KDUA 4V2NA 4MZWA 4BVXA 2DSAA 2R5GA 2YWOA 3D21A 4K5RA 2V1MA 3EE2A 5CO3A 3F4TA 1TP9A 4ZXGA 1URMA 4YKFA 2VCZA 2GQKA 2CQ9A 4YQVA 4EC0A 5KOXA 3RDWA 2GT6A 2WB9A 1T4YA 1IYHA 1Z6NA 2FGXA 1F9MA 2DKIA 2FY6A 3PH9A 2WDUA 3UAPA 4MA9A 3I6AA 4X4JA 3CYNA 4PXOA 1XWBA 1SK2A 3W8SA 1EP7A 2K9FA 5D8IA 2H76A 5INYA 2HE3A 1FB6A 4HQZA 2CV4A 2UZ8A 5BMUA 1R5AA 4HEA2 4O92A 5KN0A 3SBCA 1EGOA 4HOJA 2H74A 1LJRA 1W4VA 4F9ZA 4K7OA 2CT6A 4OCEA 2OADA 2C1YA 1FO5A 2H71A 1U3AA 3LWAA 4TXOB 4ULXA 2NPBA 2R6KA 1Z5YE 1DSBA 3F4RA 3DKSA 5B6MA 1WRYA 3ERGA 2YWMA 3VWWA 2GT5A 3L9UA 2TRXA 2VD1A 4ZL8A 2LRNA 4WR5A 3A2XA 2LEGA 1YF1A 4N30A 1FW1A 1TW9A 2VOCA 3VPTA 5CRGA 3HCZA 2HNLA 4HU9A 1ZOFA 4NWYA 4ECCA 5ECPB 5ECOB 1W89A 4GTUA 3H4KA 1YKAA 5AN1A 3GHAA 1THOA 3BCKA 1TOFA 2IN3A 2HLSA 4MNNA 5CRDA 5C04A 1EEMA 2NTOA 2EIQA 1HD2A 1QFNA 2FA8A 3P8WA 4WBRD 4Z2UA 1GTUA 5G1LA 3VFIA 2R2JA 1HQOA 2MMOA 1ZL9A 5B8BA 3EWLA 2OBKA 1JZDA 3KP9A 4LL1B 1PD21 1ML6A 1ABAA 4EDYA 4MJEA 1HYUA 1O7UA 3L9VA 1KEBA 4QQ7A 1YKCA 3UOMA 2DJ0A 2H66A 1SU9A 3KMNA 5AIVA 3TJKA 1R4WA 10GSA 4K0GA 3TKSA 1G6WA 1ACVA 1SJZA 4XIHA 3HY2A 2P31A 3ZFLA 3ED3A 1V58A 1XZOA 4DSQA 1TRUA 3IRAA 1VRSD 4ISDA 2FWFA 4O7HA 3GSSA 2DMMA 5GZZB 2CVBA 2H1GA 2QC7A 4MABA 2FWGA 4G0LA 9GSSA 5CAXA 1ON4A 2MZCA 4G0KA 4GSTA 2GZPA 4V1Ag 5IMVA 2YWNA 4OWYA 1PA3A 2VCTA 2H72A 2H0HA 2RM5A 2CAIA 3O76A 1GSEA 5J5NA 13GSA 4J57E 2E2GA 5IMZA 5CRWA 3ZL5A 2YJ7A 2P0GA 2HZEB 3TKQA 1XWAA 2L5OA 4E8HA 4L5LA 4L8EA 1RK4A 19GSA 1R5PA 3LXTA 3EVIA 2HSHA 2WCIA 2EIRA 1GUHA 5CRHA 1ERVA 5HQPA 1M9BA 2A4HA 4YQMA 3GUSA 3ZLPA 4IJIA 3EMPA 1K0OA 4IHUA 5IMDA 4EUYA 1N2AA 2JZSA 4MP4A 5F0GA 2KP2A 3FY7A 2B1KA 4ZL7A 2EC4A 1YY7A 4MPGA 1MEKA 2L6DA 3NZNA 2HZFA 2G2QA 3KEBA 2H70A 4XHMA 2JU5A 2OA7A 3IR4A 2YN1A 2KP1A 3Q19A 4EL1A 3RAZA 4Z7XA 3KD0A 4TR4A 3JCML 4WKWA 2C0EA 2C8UA 3D5JA 2TIRA 5L71A 4IVFA 3F3RA 5J4UA 6GSSA 4N0VA 4FO5A 3EPTA 1GTBA 1PQNA 3FK8A 4DSRA 2VD0A 2X8CA 4PQIA 1VF1A 3KM6A 4HZ2A 1TJDA 1N8JA 1O8WA 3QDNA 3UARA 4EXJA 1T00A 1X5CA 4NPBA 3RPNA 3F4SA 4NHWA 2ZNMA 2YNXA 1T7PB 5ECRB 3KMOA 2ZUPA 1VF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XRD A;  4HUA A;  2ES7 A;  2HYX A;  1YEX A;  1SYR A;  4BVY A;  3GV1 A;  3DXB A;  2M46 A;  1A2J A;  3QR6 A;  5B6N A;  4KCE A;  2OBI A;  1GSS A;  4MZC A;  2CA8 A;  2JZT A;  2GQM A;  3DD3 A;  2L6C A;  1J08 A;  1GSF A;  4GSN A;  5JCG A;  2R4V A;  20GS A;  3TKS C;  1LU4 A;  3GRX A;  4AGS A;  2PVQ A;  2MMZ A;  5D73 A;  1BX9 A;  6GSX A;  2IMK A;  16GS A;  1JZW A;  3H1N A;  5JCW A;  2H30 A;  2IMF A;  4IN0 A;  5A5K A;  4I97 A;  4KGI A;  4PX1 A;  2N5A A;  3M0F A;  2R3X A;  3DYR A;  3CXG A;  11GS A;  2DC5 A;  5DAK B;  3HVS A;  3WGD A;  5AGY A;  3VLN A;  4HQS A;  1S3A A;  2L4Q A;  5DJM A;  4OCF A;  2VCX A;  1BYE A;  1QMV A;  1Z3E A;  4ILF A;  4K1F A;  1F37 A;  1X9W B;  4F03 A;  2GSQ A;  1V40 A;  8GSS A;  3QD9 A;  1HNB A;  3UIW A;  3GYK A;  2HRF A;  4KE3 A;  1TDI A;  5DDL A;  3F6D A;  3E3E A;  3GKM A;  1O81 A;  5DQS A;  2VLV A;  1PX7 A;  3CRT A;  3VWX A;  1R26 A;  1U6T A;  2K8S A;  4K0N A;  2DBC A;  4BL7 A;  4TKY A;  4KAE A;  2H1B A;  3WD6 A;  1XIY A;  4N0Z A;  2JSZ A;  2LKU A;  3FZ9 A;  5IMC A;  1SKS B;  2HXK A;  1O8X A;  2LRC A;  2B6M A;  2V6O A;  4GXZ A;  1GNW A;  1PL2 A;  5ECQ B;  1A8L A;  1GSY A;  3ZVJ A;  1OAZ A;  2LJR A;  3GL3 A;  3G7Y A;  4ZBD A;  1FVJ A;  1S3C A;  3HVX A;  3RPP A;  3IC4 A;  2E0Q A;  3GIX A;  1G7O A;  4QL7 A;  2JSY A;  3LG6 A;  3VUR A;  2VO4 A;  4MLY A;  4LLR A;  5IPG A;  1O85 A;  3TKP A;  5GSS A;  2EIO A;  1B4P A;  2LNS A;  1PRX A;  3TJJ A;  5IQY A;  1AUC A;  3IAS 2;  3TB2 A;  2LJK A;  3IHQ A;  2X64 A;  3FHK A;  1F3A A;  5F06 A;  2LTK A;  1TU8 A;  4XCS A;  1X5E A;  4MH3 A;  2WUL A;  3R2Q A;  5G30 A;  3G7J A;  3C1R A;  1DUG A;  3HKR A;  1XWK A;  5IOW A;  1Q98 A;  1ZCP A;  2A2R A;  4ZIL A;  5GAN D;  4Q5F A;  2F9S A;  4TXO A;  1UA5 A;  5G5F A;  3A2V A;  3LXZ A;  5J9C A;  4K6X A;  18GS A;  2ZCT A;  3ZYW A;  2K6V A;  5B8A A;  5DCG A;  1FOV A;  2PN8 A;  3QAV A;  2C80 A;  3HZ8 A;  1ZYQ B;  1PL1 A;  3M9K A;  2V6K A;  5EVO A;  4TVE A;  5GAP D;  5HFI A;  22GS A;  5ECL B;  4I2T A;  3KIJ A;  2J23 A;  4RI7 A;  2H1A A;  1TK0 B;  1QGV A;  2B5E A;  2PMT A;  1OVN A;  3GKK A;  2OAC A;  4YAV A;  4DSS B;  4HS1 A;  2VM2 A;  1OKD A;  4Q5R A;  1SKW B;  2DJ2 A;  4OMV A;  2X8H A;  5J41 A;  3W6G A;  2XBQ A;  2WGR A;  4FIW A;  4NV5 A;  3H79 A;  1EP8 A;  2LST A;  1SL2 B;  5AIX A;  2XPE A;  1A24 A;  4JZQ A;  3TKS E;  1NHY A;  4F0C A;  3S9F A;  2YAN A;  2RM6 A;  2QGV A;  3CSI A;  4GCI A;  3LGC A;  5CYY A;  5CP1 A;  5COH A;  3K8N A;  2LQO A;  1SEN A;  3OR5 A;  5KEJ A;  7GSS A;  2CZ2 A;  2CX4 A;  1KTE A;  3Q6O A;  2WJU A;  2FD3 A;  1B9X C;  2X99 A;  1GUL A;  2H0G A;  3KTL A;  3M9J A;  3TUE A;  3D0Z A;  1B48 A;  4IKH A;  1UN2 A;  4GWR A;  2FWE A;  1GTI A;  2BJX A;  4G10 A;  2VL2 A;  1M2D A;  1EEJ A;  2MMN A;  1MDK A;  3IK9 A;  4HI7 A;  4J2F A;  1K0N A;  3UEM A;  1NHO A;  1ZZY A;  1LBK A;  2YV7 A;  3HDC A;  4MF5 A;  1USB A;  3GKX A;  3FR9 A;  3C71 A;  3KZQ A;  6GSV A;  3L78 A;  4KSM A;  2V41 A;  2B7K A;  1MDJ A;  4YQU A;  1GTA A;  2C0F A;  5ECH B;  1M7T A;  2HZE A;  3WT2 A;  6GSY A;  2LUS A;  2H6Z A;  4IJ3 A;  5ECN B;  2L5L A;  1WJK A;  3F3Q A;  1PX6 A;  3DGQ A;  2ON5 A;  1SK0 A;  5ELG A;  1M2B A;  3TJF A;  2C3T A;  1C72 A;  3FR3 A;  1AIU A;  3H93 A;  1G0T A;  2K8V A;  2MYG A;  3ZVJ D;  2A4V A;  1B4Q A;  2RUE A;  2P5Q A;  5CNW A;  3L4N A;  5KN2 A;  1HNC A;  3ZIJ A;  1FHE A;  3TKR A;  4DVC A;  4H86 A;  5D96 A;  2V2G A;  2O89 A;  2REM A;  5F8B A;  3Q18 A;  2B7J A;  4IW9 A;  3UVT A;  2WRT A;  4XS6 A;  2B5X A;  1EZK A;  4MDC A;  3QCP A;  3GH6 A;  5JWQ B;  2GVP A;  1T1V A;  3APO A;  3DWV A;  4MF7 A;  1A0R P;  2AAW A;  3MAK A;  1MD4 A;  4J56 E;  5IPH A;  1A8Y A;  3ME8 A;  3U5R E;  3W8J A;  2XC2 A;  4JR6 A;  1JZO A;  1MTC A;  5F05 A;  2O85 A;  3H8Q A;  5D9T A;  5KN3 A;  1THX A;  3EUR A;  1XWG A;  4GF0 A;  3EMX A;  3LJR A;  4DEJ A;  1SKR B;  4TR1 B;  1O73 A;  3FEU A;  1XW9 A;  1ERU A;  3F6F A;  5LCZ A;  4PNG A;  4IS0 A;  3FZ4 A;  3VI5 A;  2PBJ A;  1QXH A;  3HJO A;  1ERT A;  1EV9 A;  4TOP A;  4OO4 A;  3APQ A;  4LL4 B;  1TKD B;  5HFG A;  4TRX A;  2WFC A;  3APS A;  2VCV A;  3QFB C;  4IEL A;  4Q5N A;  1Y25 A;  5LD0 A;  4I6X A;  4TW5 A;  5D9W A;  4MK3 A;  5D93 A;  1GRX A;  4D73 B;  2B1L A;  3EYT A;  2LRT A;  1WPI A;  1A0F A;  1TXX A;  5IOX A;  1ZMA A;  2HFD A;  1WIK A;  3UL3 A;  4XRA A;  2JZR A;  1K0A A;  3KCM A;  3GFK A;  2AJQ B;  1ILO A;  4K7I A;  2RII A;  2YJH A;  6GSU A;  2OKA A;  4OFT A;  2DJ3 A;  3DVW A;  1F2E A;  2F3M A;  4O32 A;  1YJ6 A;  3VK9 A;  4RQX A;  4G9H A;  2E7P A;  4HZ4 A;  2KHP A;  1SYX A;  3J7Y k;  2VL2 C;  3MWH A;  3G7I A;  2F8A A;  4ECI A;  5EY6 A;  3BJ5 A;  17GS A;  4ZB9 A;  3GH9 A;  1TI1 A;  3D6I A;  3DEX A;  5ECI B;  1QK8 A;  5DAK A;  3TRQ A;  3GA4 A;  4TR3 A;  5F07 A;  2M72 A;  4XS4 B;  1CQH A;  4I5Q A;  3TRX A;  4IP1 A;  4O5R A;  3US3 A;  2E2M A;  4KND A;  3J7Y b;  4LA1 A;  3VWU A;  1UC7 A;  5FT3 A;  2TRC P;  1V9W A;  4MF6 A;  1J0F A;  1SD9 A;  2WZ9 A;  1Z6M A;  3IDV A;  3UMA A;  4PGT A;  2PVO C;  1DBY A;  2N5B A;  2LQQ A;  3QAW A;  4EF0 A;  2I1U A;  2RUF A;  2KOK A;  1V2A A;  2P5R A;  3ZMK A;  4NV2 A;  5JWR B;  2PPT A;  1TRV A;  1K0D A;  1F3B A;  2H0I A;  4GRF A;  2XPD A;  2O8V B;  2YPM A;  3UVH A;  6GSW A;  2IPA A;  3TDG A;  2DML A;  4K2D A;  1GWC A;  4K7N A;  3A5W A;  1I9D A;  5JWO B;  1XPV A;  4GLT A;  2IMD A;  4ML1 A;  3DVX A;  4KX4 A;  3TOU A;  1XVQ A;  4JED A;  3C73 A;  1SL1 B;  3AY8 A;  4MPF A;  5IM9 A;  4POB A;  4BA7 A;  1XVW A;  3HZ4 A;  4POM A;  4KDY A;  2DJK A;  3RHC A;  3ZTL A;  1EOG A;  2VAF A;  5B7C A;  4RQR A;  1GSQ A;  2AHE A;  5H5S A;  3VPQ A;  2FCH A;  3CBU A;  3UBL A;  5J3R A;  1X0R A;  3E0U A;  3QAG A;  3TJG A;  3CRU A;  5DQY A;  4YAP A;  3O3T A;  5FWG A;  4XTS A;  2FA4 A;  4PQ1 A;  1I5G A;  1M0U A;  4IQA A;  1OE7 A;  1E2Y A;  5KN1 A;  3M3M A;  1X5D A;  4CW9 A;  3IXR A;  1EOH A;  4EDZ A;  4G19 A;  4ECJ A;  4FH8 A;  4OD7 A;  1Y6E A;  1MD3 A;  1XFL A;  2GGT A;  3I43 A;  1H4O A;  2IFQ A;  5G2Z A;  3KH9 A;  1DE2 A;  2XHF A;  3A3T A;  3HYP A;  2LV3 A;  3QPM A;  2LNT A;  3TGZ A;  2ON7 A;  1WE0 A;  4F82 A;  1JZR A;  1JHB A;  2IWT A;  3BOA A;  1EGR A;  2I81 A;  4E8E A;  3ERF A;  1E6B A;  1BQ7 A;  3ZIV A;  4WF4 A;  3I9V 2;  4DSS A;  2H01 A;  3EC3 A;  2PGT A;  3L9S A;  1XBS A;  4MJA A;  2RLI A;  2VCW A;  3KP8 A;  4WET A;  3WGE A;  1K3L A;  3F63 A;  3GTU B;  2YV9 A;  3GL5 A;  2YOI A;  1DE1 A;  2X8G A;  3C1S A;  4WEY A;  3IBH A;  5HR3 A;  4WF5 A;  5DAL A;  2FUG 2;  1J9B A;  2ALB A;  1B9Y C;  5C00 A;  2CZ3 A;  3G9B A;  5LNK e;  1JLV A;  2IFQ B;  1YQ1 A;  2I3Y A;  4YH2 A;  2JAC A;  1OC8 A;  2K18 A;  3IK7 A;  3IA1 A;  5G1K A;  1RW1 A;  3IE3 A;  3IOS A;  1PKZ A;  3I69 A;  2PU9 C;  2OE0 A;  4IQ1 A;  1V98 A;  1WP0 A;  4MJC A;  2YCD A;  1A2L A;  3C7M A;  1JLW A;  5DVB A;  3N9J A;  2Z9S A;  4TXV A;  4F0B A;  3TJB A;  1TK8 B;  3WT1 A;  2GTU A;  3A2W A;  2YWI A;  1K3Y A;  2HT9 A;  2B5Y A;  1PN9 A;  5EPF A;  1ZGN A;  1T4Z A;  2I9H A;  3RHB A;  3IAM 2;  3GX0 A;  2H75 A;  4ZBA A;  5HR2 A;  2QSI A;  4GSS A;  5DAL B;  3GMF A;  4L0W A;  2C3Q A;  1FVK A;  5ECS A;  4EVM A;  2FWH A;  1YEP A;  5A4V A;  2PUK C;  1BJX A;  3TCO A;  1QQ2 A;  2H6X A;  3L0H A;  3EU3 A;  1UVZ A;  2GDR A;  5ID2 B;  3F9U A;  2YZU A;  5IMA A;  1OKT A;  1GL8 A;  2H8L A;  3LOR A;  2DIY A;  1X9S B;  3QFA C;  4HJM A;  2VUP A;  1SJ6 A;  2HSY A;  3VWV A;  2AB6 A;  4GQC A;  1H75 A;  3D4T A;  1OC9 A;  2IME A;  3V1W A;  2IIY A;  3HD5 A;  2DJJ A;  4ECB A;  1YDK A;  1PMT A;  2H19 A;  1GLP A;  3GN3 A;  3ZRD A;  4JR4 A;  4GQF A;  4MH2 A;  4Q5Q A;  3BBY A;  2PER A;  1NW2 A;  2H6Y A;  3KTB A;  4KCA A;  1Z9H A;  4JBB A;  4QL9 A;  2C3N A;  3EU4 A;  1M99 A;  3MSZ A;  1HNA A;  4OFN A;  2OE3 A;  4XS1 A;  2LS5 A;  4L0U A;  4HDE A;  3IV4 A;  1V57 A;  5H5Q A;  4BWQ A;  4X0X A;  1AQX A;  1F6M C;  4IP6 A;  2YP6 A;  4TR1 A;  4V2L A;  1R7H A;  3CMI A;  2V32 A;  5HFK A;  2LJA A;  4MJB A;  3EIN A;  4PNF A;  2CX3 A;  4KUN A;  3U6V A;  3QOU A;  1XCC A;  3PIN A;  2L57 A;  2MBT A;  1XXU A;  2GZZ A;  4IGJ A;  1AQW A;  4K8M A;  1ZYE A;  3BD2 A;  1K0M A;  2YZH A;  3IPZ A;  1BED A;  5D9X A;  2A2S A;  3UJ1 A;  1OC9 B;  2MBS A;  4D73 A;  2HI7 A;  4JRR A;  1GUK A;  2F51 A;  5ABR A;  3P2A A;  3BCI A;  1PKW A;  3GNJ A;  3HJP A;  3KGK A;  1TU7 A;  2DJ1 A;  3GX8 A;  2OE1 A;  5DBQ A;  3HXS A;  3UBK A;  3ZZX A;  3HJM A;  3LSZ A;  4MZB A;  3LYP A;  3ISO A;  3ME7 A;  3F0I A;  5D9V A;  1AC1 A;  4EKZ A;  2KUC A;  1K3O A;  1K0C A;  2C0G A;  1XW5 A;  4ACS A;  3DRN A;  3FYG A;  1Q4J A;  4ZIJ A;  1G7E A;  1AW9 A;  12GS A;  2NVL A;  1EWX A;  2AYT A;  2BTO T;  2HRN A;  2C0D A;  1PSQ A;  3FZ5 A;  4XS4 A;  4OO5 A;  1M9A A;  1TK5 B;  1GLQ A;  5EL8 A;  3ZML A;  4KB3 A;  2IL3 A;  1WOU A;  1Z7P A;  3FRC A;  1FB0 A;  4AF2 A;  4V1A p;  3KH7 A;  5DCH A;  1A2M A;  5IIZ A;  3CSH A;  1M2A A;  1A23 A;  5HR0 A;  1GSU A;  2G0F A;  2O87 A;  2WS2 A;  4CDO A;  3F8U A;  2IMI A;  3TOT A;  1CQG A;  14GS A;  2GSS A;  3ZRE A;  1FG4 A;  4AJ7 A;  4X43 A;  3GKN A;  4ID0 A;  4JE1 A;  3ZFB A;  3KJY A;  4WBJ A;  2VL3 A;  2B3S A;  4MMM A;  1T8E B;  3NIV A;  2DLX A;  3E9J B;  1AQV A;  4X1U A;  5E59 A;  1NM3 A;  3RBT A;  3ZIT A;  4PQH A;  1NSW A;  1PGT A;  4ZB6 A;  4AJ8 A;  2JL4 A;  1YZX A;  3CTF A;  4LMV A;  3HA9 A;  2CVK A;  1MDI A;  1U88 A;  3WGX A;  1XWC A;  2GQL A;  3HVV A;  1SK1 A;  3LEF A;  3GUR A;  5J9B A;  1YF0 A;  4BPY A;  4POL A;  5AIS A;  2D2Z A;  2N5F A;  3FW2 A;  1GUM A;  2QKE A;  5H5R A;  1G6Y A;  1EV4 A;  1GSD A;  3DIE A;  4HU7 A;  3PR8 A;  2IJY A;  2L59 A;  5DJL A;  3FZA A;  3D22 A;  1AXD A;  4CHS A;  4OFM A;  4EE0 A;  4EO3 A;  2VLT A;  4ZL9 A;  3QMX A;  1ST9 A;  1XW6 A;  4RUV A;  1ERW A;  6GST A;  5A4U A;  4I2U A;  3HHV A;  5HR1 A;  4TR0 A;  4NAX A;  1TTZ A;  2AV4 A;  1KBN A;  2PWJ A;  4NMU A;  1OC3 A;  5ECK B;  2VIM A;  2O7K A;  1U87 A;  3TRP A;  2CVD A;  5CRE A;  5E4W A;  3VI7 A;  5ELA A;  2H1D A;  2NDO A;  1X9M B;  5FHI A;  4G2E A;  1GNE A;  4RI6 A;  1JFU A;  1T3B A;  4FYC A;  4K9Z A;  1IYI A;  3LQ7 A;  4FYB A;  5G5E A;  1AAZ A;  2OJL A;  1VGL A;  3D4M A;  2GZY A;  2NBS A;  3M8N A;  1BAY A;  1OE8 A;  1S3D A;  2R37 A;  5IO0 A;  5A4W A;  2I4A A;  3FKF A;  1XOB A;  4V2M A;  3GTU A;  1GP1 A;  3P90 A;  1KNG A;  2FHE A;  4ZBB A;  4WR4 A;  4F2I A;  4PUA A;  3CTG A;  5IMF A;  1U3I A;  4KSO A;  2VCQ A;  4KDX A;  1GH2 A;  1FAA A;  3MDK A;  3CSJ A;  3LYK A;  2BMX A;  1SJI A;  5IO2 A;  2FNO A;  4IBP A;  1VF3 A;  2VM1 A;  1SL0 B;  4BWS A;  3GST A;  1SD8 A;  3C8E A;  2XBI A;  1Z7R A;  3WYW A;  4POK A;  3N5O A;  2VL9 A;  1TRS A;  4PUF C;  4KA0 A;  4PUR A;  3FR6 A;  4ZB8 A;  1WMJ A;  4HJ2 A;  2MMA A;  4ML6 A;  4KH7 A;  2CAQ A;  4I8B A;  3SWL A;  2H73 A;  2VLU A;  3KXO A;  2GS3 A;  4NHZ A;  2C4J A;  4L5O A;  3M1G A;  3NOF A;  3DML A;  4KW6 A;  2J9H A;  4N10 A;  5G31 A;  1QUW A;  5ENU A;  4P3Y B;  1K0B A;  5ECM B;  2M80 A;  3LFL A;  2GSR A;  4NXI A;  4WXT A;  1B8X A;  5JCU A;  3P7X A;  5GST A;  2KLX A;  2L4C A;  2FLS A;  4N11 A;  2DIZ A;  2GST A;  2JAD A;  1O6J A;  4LMW A;  1VF4 A;  2GLR A;  3ERW A;  1TI3 A;  3PGT A;  1XOA A;  4FYU A;  2AUV A;  3O6T A;  4MCU A;  1BG5 A;  1TRW A;  1RQM A;  4TN8 A;  3Q74 A;  4JU5 A;  4AJ6 A;  1WWJ A;  1OYJ A;  3MNG A;  2F8F A;  5ID2 A;  4KDU A;  4V2N A;  4MZW A;  4BVX A;  2DSA A;  2R5G A;  2YWO A;  3D21 A;  2V1M A;  3EE2 A;  5CO3 A;  3F4T A;  1TP9 A;  4ZXG A;  1URM A;  2VCZ A;  2GQK A;  2CQ9 A;  4YQV A;  4EC0 A;  3RDW A;  2GT6 A;  2WB9 A;  1T4Y A;  1IYH A;  1Z6N A;  2FGX A;  1F9M A;  2FY6 A;  3PH9 A;  2WDU A;  3UAP A;  4MA9 A;  3I6A A;  3CYN A;  4PXO A;  1XWB A;  1SK2 A;  3W8S A;  1EP7 A;  2K9F A;  5D8I A;  2H76 A;  5INY A;  2HE3 A;  1FB6 A;  4HQZ A;  2CV4 A;  1R5A A;  4HEA 2;  4O92 A;  5KN0 A;  3SBC A;  1EGO A;  4HOJ A;  2H74 A;  1LJR A;  1W4V A;  4F9Z A;  4K7O A;  2CT6 A;  4OCE A;  2OAD A;  2C1Y A;  1FO5 A;  2H71 A;  1U3A A;  3LWA A;  4TXO B;  4ULX A;  2NPB A;  2R6K A;  1Z5Y E;  1DSB A;  3F4R A;  3DKS A;  5B6M A;  1WRY A;  3ERG A;  2YWM A;  3VWW A;  2GT5 A;  3L9U A;  2TRX A;  2VD1 A;  4ZL8 A;  2LRN A;  4WR5 A;  3A2X A;  2LEG A;  1YF1 A;  4N30 A;  1FW1 A;  1TW9 A;  2VOC A;  3VPT A;  5CRG A;  3HCZ A;  2HNL A;  4HU9 A;  1ZOF A;  4NWY A;  4ECC A;  5ECP B;  5ECO B;  1W89 A;  4GTU A;  3H4K A;  1YKA A;  5AN1 A;  3GHA A;  1THO A;  3BCK A;  1TOF A;  2IN3 A;  2HLS A;  5CRD A;  5C04 A;  1EEM A;  2NTO A;  2EIQ A;  1HD2 A;  1QFN A;  2FA8 A;  3P8W A;  4WBR D;  1GTU A;  5G1L A;  3VFI A;  2R2J A;  1HQO A;  2MMO A;  1ZL9 A;  5B8B A;  3EWL A;  2OBK A;  1JZD A;  3KP9 A;  4LL1 B;  1PD2 1;  1ML6 A;  1ABA A;  4EDY A;  4MJE A;  1HYU A;  1O7U A;  3L9V A;  1KEB A;  4QQ7 A;  1YKC A;  3UOM A;  2DJ0 A;  2H66 A;  1SU9 A;  3KMN A;  5AIV A;  3TJK A;  1R4W A;  10GS A;  4K0G A;  3TKS A;  1G6W A;  1ACV A;  1SJZ A;  4XIH A;  3HY2 A;  2P31 A;  3ZFL A;  3ED3 A;  1V58 A;  1XZO A;  4DSQ A;  1TRU A;  3IRA A;  1VRS D;  4ISD A;  2FWF A;  4O7H A;  3GSS A;  2DMM A;  5GZZ B;  2CVB A;  2H1G A;  2QC7 A;  4MAB A;  2FWG A;  9GSS A;  5CAX A;  1ON4 A;  2MZC A;  4GST A;  2GZP A;  4V1A g;  5IMV A;  2YWN A;  4OWY A;  1PA3 A;  2VCT A;  2H72 A;  2H0H A;  2RM5 A;  2CAI A;  3O76 A;  1GSE A;  5J5N A;  13GS A;  4J57 E;  2E2G A;  5IMZ A;  5CRW A;  3ZL5 A;  2YJ7 A;  2P0G A;  2HZE B;  3TKQ A;  1XWA A;  2L5O A;  4E8H A;  4L5L A;  4L8E A;  1RK4 A;  19GS A;  1R5P A;  3LXT A;  3EVI A;  2HSH A;  2WCI A;  2EIR A;  1GUH A;  5CRH A;  1ERV A;  5HQP A;  1M9B A;  4YQM A;  3GUS A;  3ZLP A;  4IJI A;  3EMP A;  1K0O A;  4IHU A;  5IMD A;  4EUY A;  1N2A A;  2JZS A;  4MP4 A;  5F0G A;  2KP2 A;  3FY7 A;  2B1K A;  4ZL7 A;  2EC4 A;  1YY7 A;  4MPG A;  1MEK A;  2L6D A;  3NZN A;  2HZF A;  2G2Q A;  3KEB A;  2H70 A;  4XHM A;  2JU5 A;  2OA7 A;  3IR4 A;  2YN1 A;  2KP1 A;  3Q19 A;  4EL1 A;  3RAZ A;  4Z7X A;  3KD0 A;  4TR4 A;  3JCM L;  4WKW A;  2C0E A;  2C8U A;  3D5J A;  2TIR A;  5L71 A;  4IVF A;  3F3R A;  5J4U A;  6GSS A;  4N0V A;  4FO5 A;  1GTB A;  1PQN A;  3FK8 A;  4DSR A;  2VD0 A;  2X8C A;  4PQI A;  1VF1 A;  3KM6 A;  4HZ2 A;  1TJD A;  1N8J A;  1O8W A;  3QDN A;  3UAR A;  4EXJ A;  1T00 A;  1X5C A;  4NPB A;  3RPN A;  3F4S A;  4NHW A;  2ZNM A;  2YNX A;  1T7P B;  5ECR B;  3KMO A;  2ZUP A;  1VF2 A; 
#chains in the Genus database with same CATH topology
 4XRD A;  4HUA A;  2ES7 A;  2HYX A;  1YEX A;  1SYR A;  4BVY A;  3GV1 A;  3DXB A;  2M46 A;  4Z2R A;  1A2J A;  3QR6 A;  5B6N A;  4KCE A;  2OBI A;  1GSS A;  4MZC A;  2CA8 A;  2JZT A;  2GQM A;  3DD3 A;  2L6C A;  1J08 A;  1GSF A;  4GSN A;  5JCG A;  2R4V A;  20GS A;  3TKS C;  5BRT A;  1LU4 A;  3GRX A;  4AGS A;  2PVQ A;  2MMZ A;  4O5U A;  5D73 A;  1BX9 A;  6GSX A;  2IMK A;  16GS A;  1JZW A;  3H1N A;  5JCW A;  2H30 A;  2IMF A;  4IN0 A;  5A5K A;  4I97 A;  4KGI A;  4PX1 A;  2N5A A;  3M0F A;  2R3X A;  3DYR A;  3CXG A;  11GS A;  2DC5 A;  5DAK B;  3HVS A;  3WGD A;  5AGY A;  3VLN A;  4HQS A;  1S3A A;  2L4Q A;  5DJM A;  4OCF A;  1PFO A;  2VCX A;  1BYE A;  1QMV A;  1Z3E A;  4ILF A;  4K1F A;  1F37 A;  1X9W B;  4F03 A;  2GSQ A;  1V40 A;  8GSS A;  3QD9 A;  1HNB A;  3UIW A;  3GYK A;  2HRF A;  4KE3 A;  1TDI A;  5DDL A;  3F6D A;  3E3E A;  3GKM A;  1O81 A;  5DQS A;  2VLV A;  1PX7 A;  3CRT A;  3VWX A;  1R26 A;  1U6T A;  2K8S A;  4K0N A;  2DBC A;  4BL7 A;  4TKY A;  4KAE A;  2H1B A;  3WD6 A;  1XIY A;  4N0Z A;  2JSZ A;  2LKU A;  3FZ9 A;  5IMC A;  1SKS B;  2HXK A;  1O8X A;  2LRC A;  2B6M A;  2V6O A;  4GXZ A;  1GNW A;  1PL2 A;  5ECQ B;  1A8L A;  1GSY A;  3ZVJ A;  1OAZ A;  2LJR A;  3GL3 A;  3G7Y A;  4ZBD A;  1FVJ A;  1S3C A;  3HVX A;  3RPP A;  3IC4 A;  2E0Q A;  3GIX A;  1G7O A;  4QL7 A;  2JSY A;  3LG6 A;  3VUR A;  2VO4 A;  4MLY A;  4LLR A;  5IPG A;  1O85 A;  3TKP A;  5GSS A;  2EIO A;  1B4P A;  2LNS A;  1PRX A;  3TJJ A;  5IQY A;  1AUC A;  3IAS 2;  3TB2 A;  2LJK A;  2HSM A;  3PPU A;  3IHQ A;  2X64 A;  3FHK A;  1F3A A;  5F06 A;  2LTK A;  1TU8 A;  4XCS A;  1X5E A;  4MH3 A;  2WUL A;  3R2Q A;  5G30 A;  3G7J A;  3C1R A;  4BL7 B;  1DUG A;  3HKR A;  1XWK A;  5IOW A;  1Q98 A;  1ZCP A;  2A2R A;  4ZIL A;  5GAN D;  4Q5F A;  2F9S A;  4TXO A;  1UA5 A;  5G5F A;  3A2V A;  3LXZ A;  5J9C A;  4K6X A;  4EIP A;  18GS A;  2ZCT A;  3ZYW A;  2K6V A;  5B8A A;  5DCG A;  1FOV A;  2PN8 A;  3QAV A;  2C80 A;  3HZ8 A;  1ZYQ B;  1PL1 A;  3M9K A;  2R0C A;  2V6K A;  3MYD A;  5EVO A;  4TVE A;  5GAP D;  5HFI A;  22GS A;  5ECL B;  4I2T A;  3KIJ A;  2J23 A;  4RI7 A;  2H1A A;  1TK0 B;  1QGV A;  2B5E A;  2PMT A;  1OVN A;  3GKK A;  2OAC A;  4YAV A;  4DSS B;  4HS1 A;  2VM2 A;  1OKD A;  4Q5R A;  1SKW B;  2DJ2 A;  4OMV A;  2X8H A;  5J41 A;  3W6G A;  2XBQ A;  2WGR A;  4FIW A;  4NV5 A;  3H79 A;  1EP8 A;  2LST A;  1SL2 B;  5AIX A;  2XPE A;  1A24 A;  4JZQ A;  3TKS E;  1NHY A;  4F0C A;  3S9F A;  2YAN A;  2RM6 A;  2QGV A;  3CSI A;  4GCI A;  3LGC A;  5CYY A;  5CP1 A;  5COH A;  3K8N A;  2LQO A;  1SEN A;  3OR5 A;  5KEJ A;  7GSS A;  2CZ2 A;  2CX4 A;  1KTE A;  3Q6O A;  2WJU A;  2FD3 A;  1B9X C;  2X99 A;  1GUL A;  2H0G A;  3KTL A;  3M9J A;  3TUE A;  3D0Z A;  1B48 A;  4HSC X;  4IKH A;  1UN2 A;  4GWR A;  2FWE A;  1GTI A;  2BJX A;  4G10 A;  2VL2 A;  1M2D A;  1EEJ A;  2MMN A;  1MDK A;  3IK9 A;  4HI7 A;  4J2F A;  1K0N A;  3UEM A;  2DKH A;  1NHO A;  1ZZY A;  1LBK A;  2YV7 A;  3HDC A;  4MF5 A;  1USB A;  3GKX A;  3FR9 A;  3C71 A;  3KZQ A;  6GSV A;  3L78 A;  4KSM A;  2V41 A;  2B7K A;  1MDJ A;  4YQU A;  1GTA A;  2C0F A;  5ECH B;  1M7T A;  2HZE A;  3WT2 A;  6GSY A;  2LUS A;  2H6Z A;  4IJ3 A;  5ECN B;  2L5L A;  1WJK A;  3F3Q A;  1PX6 A;  3DGQ A;  2ON5 A;  1SK0 A;  5ELG A;  1M2B A;  3TJF A;  2C3T A;  1C72 A;  3FR3 A;  1AIU A;  3H93 A;  1G0T A;  2K8V A;  2MYG A;  3ZVJ D;  2A4V A;  1B4Q A;  2RUE A;  2P5Q A;  5CNW A;  3L4N A;  5KN2 A;  1HNC A;  3ZIJ A;  4EIQ A;  1FHE A;  3TKR A;  4DVC A;  4H86 A;  5D96 A;  2V2G A;  2O89 A;  2REM A;  2X49 A;  5F8B A;  3Q18 A;  2B7J A;  4IW9 A;  3UVT A;  2WRT A;  4XS6 A;  2B5X A;  1EZK A;  4MDC A;  3QCP A;  3GH6 A;  5JWQ B;  2GVP A;  1T1V A;  3APO A;  3DWV A;  4MF7 A;  1A0R P;  2AAW A;  3MAK A;  1MD4 A;  4J56 E;  5IPH A;  1A8Y A;  3IHG A;  3ME8 A;  3U5R E;  3W8J A;  2XC2 A;  4JR6 A;  1JZO A;  1MTC A;  5F05 A;  2O85 A;  3H8Q A;  5D9T A;  5KN3 A;  1THX A;  3EUR A;  1XWG A;  4GF0 A;  3EMX A;  3LJR A;  4DEJ A;  1SKR B;  4TR1 B;  1O73 A;  3FEU A;  1XW9 A;  1ERU A;  3F6F A;  5LCZ A;  4PNG A;  4IS0 A;  3FZ4 A;  3VI5 A;  2PBJ A;  2HRK A;  1QXH A;  3HJO A;  1ERT A;  1EV9 A;  4TOP A;  4OO4 A;  3APQ A;  4LL4 B;  1TKD B;  5HFG A;  4TRX A;  2WFC A;  3APS A;  2VCV A;  3QFB C;  4IEL A;  4Q5N A;  1Y25 A;  5LD0 A;  4I6X A;  1ZYN A;  4TW5 A;  5D9W A;  4MK3 A;  5D93 A;  1GRX A;  4D73 B;  2B1L A;  3EYT A;  2LRT A;  1WPI A;  1A0F A;  1TXX A;  5IOX A;  1ZMA A;  2HFD A;  1WIK A;  3UL3 A;  4XRA A;  2JZR A;  4ICY A;  1K0A A;  3KCM A;  4YKG A;  3GFK A;  2AJQ B;  1ILO A;  4K7I A;  2RII A;  2YJH A;  6GSU A;  2OKA A;  4FQU A;  4OFT A;  2DJ3 A;  3DVW A;  1F2E A;  2F3M A;  4O32 A;  1YJ6 A;  3VK9 A;  4RQX A;  4G9H A;  2E7P A;  4HZ4 A;  2KHP A;  1SYX A;  3J7Y k;  2VL2 C;  3MWH A;  3G7I A;  2F8A A;  4ECI A;  5EY6 A;  3BJ5 A;  17GS A;  4ZB9 A;  3GH9 A;  1TI1 A;  3D6I A;  3DEX A;  5ECI B;  1QK8 A;  5DAK A;  2QA1 A;  3TRQ A;  3GA4 A;  4TR3 A;  5F07 A;  2M72 A;  4XS4 B;  1CQH A;  4I5Q A;  3TRX A;  4IP1 A;  4O5R A;  3US3 A;  2E2M A;  4KND A;  3J7Y b;  4LA1 A;  3VWU A;  1UC7 A;  5FT3 A;  2TRC P;  1V9W A;  4MF6 A;  1J0F A;  1SD9 A;  2WZ9 A;  1Z6M A;  3IDV A;  3UMA A;  4PGT A;  2PVO C;  1DBY A;  2N5B A;  2LQQ A;  3QAW A;  4EF0 A;  2I1U A;  2RUF A;  2KOK A;  1V2A A;  2P5R A;  3ZMK A;  4NV2 A;  5JWR B;  2PPT A;  1TRV A;  1K0D A;  1F3B A;  2H0I A;  4GRF A;  2XPD A;  2O8V B;  2YPM A;  3UVH A;  6GSW A;  2IPA A;  3TDG A;  2DML A;  4K2D A;  1GWC A;  4K7N A;  3A5W A;  1I9D A;  5JWO B;  1XPV A;  3LW9 A;  4GLT A;  2IMD A;  4ML1 A;  3DVX A;  4KX4 A;  3TOU A;  1XVQ A;  4JED A;  3C73 A;  1SL1 B;  3AY8 A;  4MPF A;  5IM9 A;  4POB A;  4BA7 A;  1XVW A;  3HZ4 A;  4POM A;  4KDY A;  2DJK A;  3RHC A;  3ZTL A;  1EOG A;  2VAF A;  5B7C A;  4RQR A;  1GSQ A;  2AHE A;  5H5S A;  3VPQ A;  3CQF A;  2FCH A;  3CBU A;  3UBL A;  3A5I A;  5J3R A;  1X0R A;  3E0U A;  3QAG A;  3TJG A;  3CRU A;  5DQY A;  4YAP A;  3O3T A;  5FWG A;  4XTS A;  2FA4 A;  4PQ1 A;  1I5G A;  4K2X A;  4KF9 A;  1M0U A;  1M3I A;  4IQA A;  1OE7 A;  1E2Y A;  5KN1 A;  3M3M A;  1X5D A;  4CW9 A;  3IXR A;  1EOH A;  4EDZ A;  4G19 A;  4ECJ A;  4FH8 A;  4OD7 A;  1Y6E A;  1MD3 A;  1XFL A;  2GGT A;  3I43 A;  1H4O A;  2IFQ A;  5G2Z A;  3KH9 A;  1DE2 A;  3HVN A;  2XHF A;  3A3T A;  3HYP A;  2LV3 A;  3QPM A;  2LNT A;  3TGZ A;  2ON7 A;  1FOH A;  1WE0 A;  4F82 A;  1JZR A;  1JHB A;  2IWT A;  3BOA A;  1EGR A;  2I81 A;  4E8E A;  3ERF A;  1E6B A;  1BQ7 A;  3ZIV A;  3IC8 A;  4WF4 A;  4USS A;  3I9V 2;  4DSS A;  2H01 A;  3EC3 A;  2PGT A;  3L9S A;  1XBS A;  4MJA A;  2RLI A;  2VCW A;  3KP8 A;  4WET A;  1PN0 A;  3WGE A;  1K3L A;  3F63 A;  3GTU B;  2YV9 A;  3GL5 A;  2YOI A;  1DE1 A;  2X8G A;  3C1S A;  4WEY A;  3IBH A;  5HR3 A;  4WF5 A;  5DAL A;  2FUG 2;  1J9B A;  2ALB A;  1B9Y C;  5C00 A;  2CZ3 A;  3G9B A;  5LNK e;  1JLV A;  2IFQ B;  1YQ1 A;  2I3Y A;  4YH2 A;  2JAC A;  1OC8 A;  2K18 A;  3IK7 A;  3IA1 A;  5G1K A;  1RW1 A;  3IE3 A;  3IOS A;  1PKZ A;  3I69 A;  2PU9 C;  2OE0 A;  4IQ1 A;  1V98 A;  1WP0 A;  4MJC A;  2YCD A;  1A2L A;  3C7M A;  1JLW A;  5DVB A;  3N9J A;  2Z9S A;  4TXV A;  4F0B A;  3TJB A;  1TK8 B;  3WT1 A;  2GTU A;  3A2W A;  2YWI A;  1K3Y A;  2HT9 A;  2B5Y A;  1PN9 A;  5EPF A;  1ZGN A;  1T4Z A;  2I9H A;  3RHB A;  3IAM 2;  3GX0 A;  2H75 A;  4ZBA A;  5HR2 A;  2QSI A;  4GSS A;  5DAL B;  3GMF A;  4L0W A;  2C3Q A;  1FVK A;  5ECS A;  4EVM A;  2FWH A;  1YEP A;  5A4V A;  2PUK C;  1BJX A;  3TCO A;  1QQ2 A;  2H6X A;  3L0H A;  3EU3 A;  1UVZ A;  2GDR A;  5ID2 B;  3F9U A;  2YZU A;  5IMA A;  1OKT A;  4BVX B;  1GL8 A;  2H8L A;  3LOR A;  2DIY A;  1X9S B;  3QFA C;  4HJM A;  2VUP A;  1SJ6 A;  2HSY A;  3VWV A;  2AB6 A;  4GQC A;  1H75 A;  3D4T A;  1OC9 A;  2IME A;  3V1W A;  2IIY A;  3HD5 A;  2DJJ A;  4ECB A;  1YDK A;  1PMT A;  2H19 A;  1GLP A;  3GN3 A;  3ZRD A;  4JR4 A;  4GQF A;  4MH2 A;  4Q5Q A;  3BBY A;  2PER A;  1NW2 A;  2H6Y A;  3KTB A;  4KCA A;  1Z9H A;  4JBB A;  4QL9 A;  2C3N A;  3EU4 A;  1M99 A;  3MSZ A;  1HNA A;  4OFN A;  1ZYP A;  2OE3 A;  4XS1 A;  2LS5 A;  4L0U A;  4HDE A;  3IV4 A;  1V57 A;  5H5Q A;  4BWQ A;  2HRA A;  4X0X A;  1AQX A;  1F6M C;  4IP6 A;  2YP6 A;  4TR1 A;  4V2L A;  1R7H A;  3CMI A;  2V32 A;  5HFK A;  2LJA A;  4MJB A;  3EIN A;  4PNF A;  2CX3 A;  4KUN A;  3U6V A;  3R3E A;  3QOU A;  1XCC A;  3PIN A;  2L57 A;  2MBT A;  1XXU A;  2GZZ A;  4IGJ A;  1AQW A;  4K8M A;  1ZYE A;  3BD2 A;  1K0M A;  2YZH A;  3IPZ A;  1BED A;  5D9X A;  2A2S A;  3UJ1 A;  1OC9 B;  2MBS A;  4D73 A;  2HI7 A;  4JRR A;  1GUK A;  2F51 A;  5ABR A;  3P2A A;  3BCI A;  1PKW A;  3GNJ A;  3HJP A;  3KGK A;  1TU7 A;  2DJ1 A;  3GX8 A;  2OE1 A;  5DBQ A;  1XG8 A;  3HXS A;  3UBK A;  3ZZX A;  3HJM A;  3LSZ A;  4MZB A;  3LYP A;  3ISO A;  3ME7 A;  3F0I A;  5D9V A;  1AC1 A;  4EKZ A;  2KUC A;  1K3O A;  1K0C A;  2C0G A;  1XW5 A;  4ACS A;  3DRN A;  3FYG A;  1Q4J A;  4ZIJ A;  1G7E A;  4O5Q A;  1AW9 A;  12GS A;  2NVL A;  1EWX A;  2AYT A;  2BTO T;  2HRN A;  2C0D A;  1PSQ A;  3FZ5 A;  4XS4 A;  4OO5 A;  1M9A A;  1TK5 B;  1GLQ A;  5EL8 A;  3MIX A;  3ZML A;  4KB3 A;  2IL3 A;  1WOU A;  1Z7P A;  3FRC A;  1FB0 A;  4AF2 A;  4V1A p;  3KH7 A;  5DCH A;  1A2M A;  5IIZ A;  3CSH A;  1M2A A;  1A23 A;  5HR0 A;  1GSU A;  2G0F A;  2O87 A;  2WS2 A;  4CDO A;  3F8U A;  2IMI A;  4CY8 A;  3TOT A;  1CQG A;  2X4A A;  14GS A;  2GSS A;  2R0G A;  3ZRE A;  1FG4 A;  4AJ7 A;  4X43 A;  3GKN A;  4ID0 A;  4JE1 A;  3ZFB A;  3KJY A;  4WBJ A;  2VL3 A;  2B3S A;  4MMM A;  1T8E B;  3NIV A;  2DLX A;  3E9J B;  1AQV A;  4X1U A;  5E59 A;  1NM3 A;  3RBT A;  2QA2 A;  3ZIT A;  4PQH A;  1NSW A;  1PGT A;  4ZB6 A;  4AJ8 A;  2JL4 A;  1YZX A;  3CTF A;  4LMV A;  3HA9 A;  4K5S A;  2CVK A;  1MDI A;  1U88 A;  3WGX A;  1XWC A;  5KOW A;  2GQL A;  3HVV A;  1SK1 A;  3LEF A;  3GUR A;  5J9B A;  1YF0 A;  4BPY A;  4POL A;  5AIS A;  2D2Z A;  2N5F A;  3FW2 A;  1GUM A;  2QKE A;  5H5R A;  1G6Y A;  1EV4 A;  1GSD A;  3DIE A;  4HU7 A;  3PR8 A;  2IJY A;  2L59 A;  5DJL A;  3FZA A;  3D22 A;  1AXD A;  4CHS A;  4OFM A;  4EE0 A;  4EO3 A;  2VLT A;  4ZL9 A;  3QMX A;  1ST9 A;  1XW6 A;  4RUV A;  1ERW A;  6GST A;  5A4U A;  4I2U A;  2A2P A;  3HHV A;  5HR1 A;  4TR0 A;  4Z2T A;  4NAX A;  1TTZ A;  2AV4 A;  1KBN A;  2PWJ A;  4NMU A;  1OC3 A;  5ECK B;  2VIM A;  2O7K A;  4G0I A;  1U87 A;  3TRP A;  2CVD A;  5CRE A;  4PTS A;  5E4W A;  3VI7 A;  5ELA A;  2H1D A;  2NDO A;  1X9M B;  5FHI A;  4G2E A;  1GNE A;  4RI6 A;  1JFU A;  1T3B A;  4FYC A;  4K9Z A;  1IYI A;  3LQ7 A;  4FYB A;  5G5E A;  1AAZ A;  2OJL A;  1VGL A;  3D4M A;  2GZY A;  2NBS A;  3M8N A;  1BAY A;  1OE8 A;  1S3D A;  2R37 A;  5IO0 A;  5A4W A;  2I4A A;  3FKF A;  1XOB A;  4V2M A;  3GTU A;  1GP1 A;  3P90 A;  1KNG A;  2FHE A;  4BVY B;  4ZBB A;  4WR4 A;  4F2I A;  4PUA A;  3CTG A;  5IMF A;  1U3I A;  4KSO A;  2VCQ A;  4KDX A;  1GH2 A;  4CY6 A;  1FAA A;  3MDK A;  3CSJ A;  3LYK A;  2BMX A;  1SJI A;  5IO2 A;  2FNO A;  4IBP A;  1VF3 A;  2VM1 A;  1SL0 B;  4BWS A;  3GST A;  1SD8 A;  3C8E A;  2XBI A;  1Z7R A;  3WYW A;  4POK A;  3N5O A;  2VL9 A;  1TRS A;  4PUF C;  4KA0 A;  4PUR A;  3FR6 A;  4ZB8 A;  1WMJ A;  4HJ2 A;  2MMA A;  4ML6 A;  1M3J A;  4KH7 A;  2CAQ A;  4I8B A;  2R0P A;  3SWL A;  2H73 A;  2VLU A;  3KXO A;  2GS3 A;  4NHZ A;  2C4J A;  4L5O A;  3M1G A;  3NOF A;  3DML A;  4KW6 A;  2J9H A;  4N10 A;  5G31 A;  1QUW A;  5ENU A;  4P3Y B;  1K0B A;  5ECM B;  2M80 A;  3LFL A;  4BIK A;  2GSR A;  4NXI A;  4WXT A;  1B8X A;  5JCU A;  3P7X A;  5GST A;  2KLX A;  2L4C A;  2FLS A;  4N11 A;  2DIZ A;  2GST A;  2JAD A;  1O6J A;  4LMW A;  1VF4 A;  2GLR A;  3FMW A;  3ERW A;  1TI3 A;  3PGT A;  1XOA A;  4FYU A;  4A5P A;  2AUV A;  3O6T A;  4MCU A;  1BG5 A;  1TRW A;  1RQM A;  4TN8 A;  3Q74 A;  4JU5 A;  4AJ6 A;  1WWJ A;  1OYJ A;  3MNG A;  2F8F A;  5ID2 A;  4KDU A;  4V2N A;  4MZW A;  4BVX A;  2DSA A;  2R5G A;  2YWO A;  3D21 A;  4K5R A;  2V1M A;  3EE2 A;  5CO3 A;  3F4T A;  1TP9 A;  4ZXG A;  1URM A;  4YKF A;  2VCZ A;  2GQK A;  2CQ9 A;  4YQV A;  4EC0 A;  5KOX A;  3RDW A;  2GT6 A;  2WB9 A;  1T4Y A;  1IYH A;  1Z6N A;  2FGX A;  1F9M A;  2DKI A;  2FY6 A;  3PH9 A;  2WDU A;  3UAP A;  4MA9 A;  3I6A A;  4X4J A;  3CYN A;  4PXO A;  1XWB A;  1SK2 A;  3W8S A;  1EP7 A;  2K9F A;  5D8I A;  2H76 A;  5INY A;  2HE3 A;  1FB6 A;  4HQZ A;  2CV4 A;  2UZ8 A;  5BMU A;  1R5A A;  4HEA 2;  4O92 A;  5KN0 A;  3SBC A;  1EGO A;  4HOJ A;  2H74 A;  1LJR A;  1W4V A;  4F9Z A;  4K7O A;  2CT6 A;  4OCE A;  2OAD A;  2C1Y A;  1FO5 A;  2H71 A;  1U3A A;  3LWA A;  4TXO B;  4ULX A;  2NPB A;  2R6K A;  1Z5Y E;  1DSB A;  3F4R A;  3DKS A;  5B6M A;  1WRY A;  3ERG A;  2YWM A;  3VWW A;  2GT5 A;  3L9U A;  2TRX A;  2VD1 A;  4ZL8 A;  2LRN A;  4WR5 A;  3A2X A;  2LEG A;  1YF1 A;  4N30 A;  1FW1 A;  1TW9 A;  2VOC A;  3VPT A;  5CRG A;  3HCZ A;  2HNL A;  4HU9 A;  1ZOF A;  4NWY A;  4ECC A;  5ECP B;  5ECO B;  1W89 A;  4GTU A;  3H4K A;  1YKA A;  5AN1 A;  3GHA A;  1THO A;  3BCK A;  1TOF A;  2IN3 A;  2HLS A;  4MNN A;  5CRD A;  5C04 A;  1EEM A;  2NTO A;  2EIQ A;  1HD2 A;  1QFN A;  2FA8 A;  3P8W A;  4WBR D;  4Z2U A;  1GTU A;  5G1L A;  3VFI A;  2R2J A;  1HQO A;  2MMO A;  1ZL9 A;  5B8B A;  3EWL A;  1S3R A;  2OBK A;  1JZD A;  3KP9 A;  4LL1 B;  1PD2 1;  1ML6 A;  1ABA A;  4EDY A;  4MJE A;  1HYU A;  1O7U A;  3L9V A;  1KEB A;  4QQ7 A;  1YKC A;  3UOM A;  2DJ0 A;  2H66 A;  1SU9 A;  3KMN A;  5AIV A;  3TJK A;  1R4W A;  10GS A;  4K0G A;  3TKS A;  1G6W A;  1ACV A;  1SJZ A;  4XIH A;  3HY2 A;  2P31 A;  3ZFL A;  3ED3 A;  1V58 A;  1XZO A;  4DSQ A;  1TRU A;  3IRA A;  1VRS D;  4ISD A;  2FWF A;  4O7H A;  3GSS A;  2DMM A;  5GZZ B;  2CVB A;  2H1G A;  2QC7 A;  4MAB A;  2FWG A;  4G0L A;  9GSS A;  5CAX A;  1ON4 A;  2MZC A;  4G0K A;  4GST A;  2GZP A;  4V1A g;  5IMV A;  2YWN A;  4OWY A;  1PA3 A;  2VCT A;  2H72 A;  2H0H A;  2RM5 A;  2CAI A;  3O76 A;  1GSE A;  5J5N A;  13GS A;  4J57 E;  2E2G A;  5IMZ A;  5CRW A;  3ZL5 A;  2YJ7 A;  2P0G A;  2HZE B;  3TKQ A;  1XWA A;  2L5O A;  4E8H A;  4L5L A;  4L8E A;  1RK4 A;  19GS A;  1R5P A;  3LXT A;  3EVI A;  2HSH A;  2WCI A;  2EIR A;  1GUH A;  5CRH A;  1ERV A;  5HQP A;  1M9B A;  2A4H A;  4YQM A;  3GUS A;  3ZLP A;  4IJI A;  3EMP A;  1K0O A;  4IHU A;  5IMD A;  4EUY A;  1N2A A;  2JZS A;  4MP4 A;  5F0G A;  2KP2 A;  3FY7 A;  2B1K A;  4ZL7 A;  2EC4 A;  1YY7 A;  4MPG A;  1MEK A;  2L6D A;  3NZN A;  2HZF A;  2G2Q A;  3KEB A;  2H70 A;  4XHM A;  2JU5 A;  2OA7 A;  3IR4 A;  2YN1 A;  2KP1 A;  3Q19 A;  4EL1 A;  3RAZ A;  4Z7X A;  3KD0 A;  4TR4 A;  3JCM L;  4WKW A;  2C0E A;  2C8U A;  3D5J A;  2TIR A;  5L71 A;  4IVF A;  3F3R A;  5J4U A;  6GSS A;  4N0V A;  4FO5 A;  3EPT A;  1GTB A;  1PQN A;  3FK8 A;  4DSR A;  2VD0 A;  2X8C A;  4PQI A;  1VF1 A;  3KM6 A;  4HZ2 A;  1TJD A;  1N8J A;  1O8W A;  3QDN A;  3UAR A;  4EXJ A;  1T00 A;  1X5C A;  4NPB A;  3RPN A;  3F4S A;  4NHW A;  2ZNM A;  2YNX A;  1T7P B;  5ECR B;  3KMO A;  2ZUP A;  1VF2 A; 
#chains in the Genus database with same CATH homology
 4XRD A;  4HUA A;  2ES7 A;  2HYX A;  1YEX A;  1SYR A;  4BVY A;  3GV1 A;  3DXB A;  2M46 A;  4Z2R A;  1A2J A;  3QR6 A;  5B6N A;  4KCE A;  2OBI A;  1GSS A;  4MZC A;  2CA8 A;  2JZT A;  2GQM A;  3DD3 A;  2L6C A;  1J08 A;  1GSF A;  4GSN A;  5JCG A;  2R4V A;  20GS A;  3TKS C;  5BRT A;  1LU4 A;  3GRX A;  4AGS A;  2PVQ A;  2MMZ A;  4O5U A;  5D73 A;  1BX9 A;  6GSX A;  2IMK A;  16GS A;  1JZW A;  3H1N A;  5JCW A;  2H30 A;  2IMF A;  4IN0 A;  5A5K A;  4I97 A;  4KGI A;  4PX1 A;  2N5A A;  3M0F A;  2R3X A;  3DYR A;  3CXG A;  11GS A;  2DC5 A;  5DAK B;  3HVS A;  3WGD A;  5AGY A;  3VLN A;  4HQS A;  1S3A A;  2L4Q A;  5DJM A;  4OCF A;  2VCX A;  1BYE A;  1QMV A;  1Z3E A;  4ILF A;  4K1F A;  1F37 A;  1X9W B;  4F03 A;  2GSQ A;  1V40 A;  8GSS A;  3QD9 A;  1HNB A;  3UIW A;  3GYK A;  2HRF A;  4KE3 A;  1TDI A;  5DDL A;  3F6D A;  3E3E A;  3GKM A;  1O81 A;  5DQS A;  2VLV A;  1PX7 A;  3CRT A;  3VWX A;  1R26 A;  1U6T A;  2K8S A;  4K0N A;  2DBC A;  4BL7 A;  4TKY A;  4KAE A;  2H1B A;  3WD6 A;  1XIY A;  4N0Z A;  2JSZ A;  2LKU A;  3FZ9 A;  5IMC A;  1SKS B;  2HXK A;  1O8X A;  2LRC A;  2B6M A;  2V6O A;  4GXZ A;  1GNW A;  1PL2 A;  5ECQ B;  1A8L A;  1GSY A;  3ZVJ A;  1OAZ A;  2LJR A;  3GL3 A;  3G7Y A;  4ZBD A;  1FVJ A;  1S3C A;  3HVX A;  3RPP A;  3IC4 A;  2E0Q A;  3GIX A;  1G7O A;  4QL7 A;  2JSY A;  3LG6 A;  3VUR A;  2VO4 A;  4MLY A;  4LLR A;  5IPG A;  1O85 A;  3TKP A;  5GSS A;  2EIO A;  1B4P A;  2LNS A;  1PRX A;  3TJJ A;  5IQY A;  1AUC A;  3IAS 2;  3TB2 A;  2LJK A;  2HSM A;  3PPU A;  3IHQ A;  2X64 A;  3FHK A;  1F3A A;  5F06 A;  2LTK A;  1TU8 A;  4XCS A;  1X5E A;  4MH3 A;  2WUL A;  3R2Q A;  5G30 A;  3G7J A;  3C1R A;  4BL7 B;  1DUG A;  3HKR A;  1XWK A;  5IOW A;  1Q98 A;  1ZCP A;  2A2R A;  4ZIL A;  5GAN D;  4Q5F A;  2F9S A;  4TXO A;  1UA5 A;  5G5F A;  3A2V A;  3LXZ A;  5J9C A;  4K6X A;  4EIP A;  18GS A;  2ZCT A;  3ZYW A;  2K6V A;  5B8A A;  5DCG A;  1FOV A;  2PN8 A;  3QAV A;  2C80 A;  3HZ8 A;  1ZYQ B;  1PL1 A;  3M9K A;  2R0C A;  2V6K A;  3MYD A;  5EVO A;  4TVE A;  5GAP D;  5HFI A;  22GS A;  5ECL B;  4I2T A;  3KIJ A;  2J23 A;  4RI7 A;  2H1A A;  1TK0 B;  1QGV A;  2B5E A;  2PMT A;  1OVN A;  3GKK A;  2OAC A;  4YAV A;  4DSS B;  4HS1 A;  2VM2 A;  1OKD A;  4Q5R A;  1SKW B;  2DJ2 A;  4OMV A;  2X8H A;  5J41 A;  3W6G A;  2XBQ A;  2WGR A;  4FIW A;  4NV5 A;  3H79 A;  1EP8 A;  2LST A;  1SL2 B;  5AIX A;  2XPE A;  1A24 A;  4JZQ A;  3TKS E;  1NHY A;  4F0C A;  3S9F A;  2YAN A;  2RM6 A;  2QGV A;  3CSI A;  4GCI A;  3LGC A;  5CYY A;  5CP1 A;  5COH A;  3K8N A;  2LQO A;  1SEN A;  3OR5 A;  5KEJ A;  7GSS A;  2CZ2 A;  2CX4 A;  1KTE A;  3Q6O A;  2WJU A;  2FD3 A;  1B9X C;  2X99 A;  1GUL A;  2H0G A;  3KTL A;  3M9J A;  3TUE A;  3D0Z A;  1B48 A;  4IKH A;  1UN2 A;  4GWR A;  2FWE A;  1GTI A;  2BJX A;  4G10 A;  2VL2 A;  1M2D A;  1EEJ A;  2MMN A;  1MDK A;  3IK9 A;  4HI7 A;  4J2F A;  1K0N A;  3UEM A;  2DKH A;  1NHO A;  1ZZY A;  1LBK A;  2YV7 A;  3HDC A;  4MF5 A;  1USB A;  3GKX A;  3FR9 A;  3C71 A;  3KZQ A;  6GSV A;  3L78 A;  4KSM A;  2V41 A;  2B7K A;  1MDJ A;  4YQU A;  1GTA A;  2C0F A;  5ECH B;  1M7T A;  2HZE A;  3WT2 A;  6GSY A;  2LUS A;  2H6Z A;  4IJ3 A;  5ECN B;  2L5L A;  1WJK A;  3F3Q A;  1PX6 A;  3DGQ A;  2ON5 A;  1SK0 A;  5ELG A;  1M2B A;  3TJF A;  2C3T A;  1C72 A;  3FR3 A;  1AIU A;  3H93 A;  1G0T A;  2K8V A;  2MYG A;  3ZVJ D;  2A4V A;  1B4Q A;  2RUE A;  2P5Q A;  5CNW A;  3L4N A;  5KN2 A;  1HNC A;  3ZIJ A;  4EIQ A;  1FHE A;  3TKR A;  4DVC A;  4H86 A;  5D96 A;  2V2G A;  2O89 A;  2REM A;  2X49 A;  5F8B A;  3Q18 A;  2B7J A;  4IW9 A;  3UVT A;  2WRT A;  4XS6 A;  2B5X A;  1EZK A;  4MDC A;  3QCP A;  3GH6 A;  5JWQ B;  2GVP A;  1T1V A;  3APO A;  3DWV A;  4MF7 A;  1A0R P;  2AAW A;  3MAK A;  1MD4 A;  4J56 E;  5IPH A;  1A8Y A;  3IHG A;  3ME8 A;  3U5R E;  3W8J A;  2XC2 A;  4JR6 A;  1JZO A;  1MTC A;  5F05 A;  2O85 A;  3H8Q A;  5D9T A;  5KN3 A;  1THX A;  3EUR A;  1XWG A;  4GF0 A;  3EMX A;  3LJR A;  4DEJ A;  1SKR B;  4TR1 B;  1O73 A;  3FEU A;  1XW9 A;  1ERU A;  3F6F A;  5LCZ A;  4PNG A;  4IS0 A;  3FZ4 A;  3VI5 A;  2PBJ A;  2HRK A;  1QXH A;  3HJO A;  1ERT A;  1EV9 A;  4TOP A;  4OO4 A;  3APQ A;  4LL4 B;  1TKD B;  5HFG A;  4TRX A;  2WFC A;  3APS A;  2VCV A;  3QFB C;  4IEL A;  4Q5N A;  1Y25 A;  5LD0 A;  4I6X A;  1ZYN A;  4TW5 A;  5D9W A;  4MK3 A;  5D93 A;  1GRX A;  4D73 B;  2B1L A;  3EYT A;  2LRT A;  1WPI A;  1A0F A;  1TXX A;  5IOX A;  1ZMA A;  2HFD A;  1WIK A;  3UL3 A;  4XRA A;  2JZR A;  4ICY A;  1K0A A;  3KCM A;  4YKG A;  3GFK A;  2AJQ B;  1ILO A;  4K7I A;  2RII A;  2YJH A;  6GSU A;  2OKA A;  4FQU A;  4OFT A;  2DJ3 A;  3DVW A;  1F2E A;  2F3M A;  4O32 A;  1YJ6 A;  3VK9 A;  4RQX A;  4G9H A;  2E7P A;  4HZ4 A;  2KHP A;  1SYX A;  3J7Y k;  2VL2 C;  3MWH A;  3G7I A;  2F8A A;  4ECI A;  5EY6 A;  3BJ5 A;  17GS A;  4ZB9 A;  3GH9 A;  1TI1 A;  3D6I A;  3DEX A;  5ECI B;  1QK8 A;  5DAK A;  2QA1 A;  3TRQ A;  3GA4 A;  4TR3 A;  5F07 A;  2M72 A;  4XS4 B;  1CQH A;  4I5Q A;  3TRX A;  4IP1 A;  4O5R A;  3US3 A;  2E2M A;  4KND A;  3J7Y b;  4LA1 A;  3VWU A;  1UC7 A;  5FT3 A;  2TRC P;  1V9W A;  4MF6 A;  1J0F A;  1SD9 A;  2WZ9 A;  1Z6M A;  3IDV A;  3UMA A;  4PGT A;  2PVO C;  1DBY A;  2N5B A;  2LQQ A;  3QAW A;  4EF0 A;  2I1U A;  2RUF A;  2KOK A;  1V2A A;  2P5R A;  3ZMK A;  4NV2 A;  5JWR B;  2PPT A;  1TRV A;  1K0D A;  1F3B A;  2H0I A;  4GRF A;  2XPD A;  2O8V B;  2YPM A;  3UVH A;  6GSW A;  2IPA A;  3TDG A;  2DML A;  4K2D A;  1GWC A;  4K7N A;  3A5W A;  1I9D A;  5JWO B;  1XPV A;  3LW9 A;  4GLT A;  2IMD A;  4ML1 A;  3DVX A;  4KX4 A;  3TOU A;  1XVQ A;  4JED A;  3C73 A;  1SL1 B;  3AY8 A;  4MPF A;  5IM9 A;  4POB A;  4BA7 A;  1XVW A;  3HZ4 A;  4POM A;  4KDY A;  2DJK A;  3RHC A;  3ZTL A;  1EOG A;  2VAF A;  5B7C A;  4RQR A;  1GSQ A;  2AHE A;  5H5S A;  3VPQ A;  2FCH A;  3CBU A;  3UBL A;  3A5I A;  5J3R A;  1X0R A;  3E0U A;  3QAG A;  3TJG A;  3CRU A;  5DQY A;  4YAP A;  3O3T A;  5FWG A;  4XTS A;  2FA4 A;  4PQ1 A;  1I5G A;  4K2X A;  4KF9 A;  1M0U A;  4IQA A;  1OE7 A;  1E2Y A;  5KN1 A;  3M3M A;  1X5D A;  4CW9 A;  3IXR A;  1EOH A;  4EDZ A;  4G19 A;  4ECJ A;  4FH8 A;  4OD7 A;  1Y6E A;  1MD3 A;  1XFL A;  2GGT A;  3I43 A;  1H4O A;  2IFQ A;  5G2Z A;  3KH9 A;  1DE2 A;  2XHF A;  3A3T A;  3HYP A;  2LV3 A;  3QPM A;  2LNT A;  3TGZ A;  2ON7 A;  1FOH A;  1WE0 A;  4F82 A;  1JZR A;  1JHB A;  2IWT A;  3BOA A;  1EGR A;  2I81 A;  4E8E A;  3ERF A;  1E6B A;  1BQ7 A;  3ZIV A;  3IC8 A;  4WF4 A;  4USS A;  3I9V 2;  4DSS A;  2H01 A;  3EC3 A;  2PGT A;  3L9S A;  1XBS A;  4MJA A;  2RLI A;  2VCW A;  3KP8 A;  4WET A;  1PN0 A;  3WGE A;  1K3L A;  3F63 A;  3GTU B;  2YV9 A;  3GL5 A;  2YOI A;  1DE1 A;  2X8G A;  3C1S A;  4WEY A;  3IBH A;  5HR3 A;  4WF5 A;  5DAL A;  2FUG 2;  1J9B A;  2ALB A;  1B9Y C;  5C00 A;  2CZ3 A;  3G9B A;  5LNK e;  1JLV A;  2IFQ B;  1YQ1 A;  2I3Y A;  4YH2 A;  2JAC A;  1OC8 A;  2K18 A;  3IK7 A;  3IA1 A;  5G1K A;  1RW1 A;  3IE3 A;  3IOS A;  1PKZ A;  3I69 A;  2PU9 C;  2OE0 A;  4IQ1 A;  1V98 A;  1WP0 A;  4MJC A;  2YCD A;  1A2L A;  3C7M A;  1JLW A;  5DVB A;  3N9J A;  2Z9S A;  4TXV A;  4F0B A;  3TJB A;  1TK8 B;  3WT1 A;  2GTU A;  3A2W A;  2YWI A;  1K3Y A;  2HT9 A;  2B5Y A;  1PN9 A;  5EPF A;  1ZGN A;  1T4Z A;  2I9H A;  3RHB A;  3IAM 2;  3GX0 A;  2H75 A;  4ZBA A;  5HR2 A;  2QSI A;  4GSS A;  5DAL B;  3GMF A;  4L0W A;  2C3Q A;  1FVK A;  5ECS A;  4EVM A;  2FWH A;  1YEP A;  5A4V A;  2PUK C;  1BJX A;  3TCO A;  1QQ2 A;  2H6X A;  3L0H A;  3EU3 A;  1UVZ A;  2GDR A;  5ID2 B;  3F9U A;  2YZU A;  5IMA A;  1OKT A;  4BVX B;  1GL8 A;  2H8L A;  3LOR A;  2DIY A;  1X9S B;  3QFA C;  4HJM A;  2VUP A;  1SJ6 A;  2HSY A;  3VWV A;  2AB6 A;  4GQC A;  1H75 A;  3D4T A;  1OC9 A;  2IME A;  3V1W A;  2IIY A;  3HD5 A;  2DJJ A;  4ECB A;  1YDK A;  1PMT A;  2H19 A;  1GLP A;  3GN3 A;  3ZRD A;  4JR4 A;  4GQF A;  4MH2 A;  4Q5Q A;  3BBY A;  2PER A;  1NW2 A;  2H6Y A;  3KTB A;  4KCA A;  1Z9H A;  4JBB A;  4QL9 A;  2C3N A;  3EU4 A;  1M99 A;  3MSZ A;  1HNA A;  4OFN A;  1ZYP A;  2OE3 A;  4XS1 A;  2LS5 A;  4L0U A;  4HDE A;  3IV4 A;  1V57 A;  5H5Q A;  4BWQ A;  2HRA A;  4X0X A;  1AQX A;  1F6M C;  4IP6 A;  2YP6 A;  4TR1 A;  4V2L A;  1R7H A;  3CMI A;  2V32 A;  5HFK A;  2LJA A;  4MJB A;  3EIN A;  4PNF A;  2CX3 A;  4KUN A;  3U6V A;  3R3E A;  3QOU A;  1XCC A;  3PIN A;  2L57 A;  2MBT A;  1XXU A;  2GZZ A;  4IGJ A;  1AQW A;  4K8M A;  1ZYE A;  3BD2 A;  1K0M A;  2YZH A;  3IPZ A;  1BED A;  5D9X A;  2A2S A;  3UJ1 A;  1OC9 B;  2MBS A;  4D73 A;  2HI7 A;  4JRR A;  1GUK A;  2F51 A;  5ABR A;  3P2A A;  3BCI A;  1PKW A;  3GNJ A;  3HJP A;  3KGK A;  1TU7 A;  2DJ1 A;  3GX8 A;  2OE1 A;  5DBQ A;  3HXS A;  3UBK A;  3ZZX A;  3HJM A;  3LSZ A;  4MZB A;  3LYP A;  3ISO A;  3ME7 A;  3F0I A;  5D9V A;  1AC1 A;  4EKZ A;  2KUC A;  1K3O A;  1K0C A;  2C0G A;  1XW5 A;  4ACS A;  3DRN A;  3FYG A;  1Q4J A;  4ZIJ A;  1G7E A;  4O5Q A;  1AW9 A;  12GS A;  2NVL A;  1EWX A;  2AYT A;  2BTO T;  2HRN A;  2C0D A;  1PSQ A;  3FZ5 A;  4XS4 A;  4OO5 A;  1M9A A;  1TK5 B;  1GLQ A;  5EL8 A;  3MIX A;  3ZML A;  4KB3 A;  2IL3 A;  1WOU A;  1Z7P A;  3FRC A;  1FB0 A;  4AF2 A;  4V1A p;  3KH7 A;  5DCH A;  1A2M A;  5IIZ A;  3CSH A;  1M2A A;  1A23 A;  5HR0 A;  1GSU A;  2G0F A;  2O87 A;  2WS2 A;  4CDO A;  3F8U A;  2IMI A;  4CY8 A;  3TOT A;  1CQG A;  2X4A A;  14GS A;  2GSS A;  2R0G A;  3ZRE A;  1FG4 A;  4AJ7 A;  4X43 A;  3GKN A;  4ID0 A;  4JE1 A;  3ZFB A;  3KJY A;  4WBJ A;  2VL3 A;  2B3S A;  4MMM A;  1T8E B;  3NIV A;  2DLX A;  3E9J B;  1AQV A;  4X1U A;  5E59 A;  1NM3 A;  3RBT A;  2QA2 A;  3ZIT A;  4PQH A;  1NSW A;  1PGT A;  4ZB6 A;  4AJ8 A;  2JL4 A;  1YZX A;  3CTF A;  4LMV A;  3HA9 A;  4K5S A;  2CVK A;  1MDI A;  1U88 A;  3WGX A;  1XWC A;  5KOW A;  2GQL A;  3HVV A;  1SK1 A;  3LEF A;  3GUR A;  5J9B A;  1YF0 A;  4BPY A;  4POL A;  5AIS A;  2D2Z A;  2N5F A;  3FW2 A;  1GUM A;  2QKE A;  5H5R A;  1G6Y A;  1EV4 A;  1GSD A;  3DIE A;  4HU7 A;  3PR8 A;  2IJY A;  2L59 A;  5DJL A;  3FZA A;  3D22 A;  1AXD A;  4CHS A;  4OFM A;  4EE0 A;  4EO3 A;  2VLT A;  4ZL9 A;  3QMX A;  1ST9 A;  1XW6 A;  4RUV A;  1ERW A;  6GST A;  5A4U A;  4I2U A;  2A2P A;  3HHV A;  5HR1 A;  4TR0 A;  4Z2T A;  4NAX A;  1TTZ A;  2AV4 A;  1KBN A;  2PWJ A;  4NMU A;  1OC3 A;  5ECK B;  2VIM A;  2O7K A;  4G0I A;  1U87 A;  3TRP A;  2CVD A;  5CRE A;  4PTS A;  5E4W A;  3VI7 A;  5ELA A;  2H1D A;  2NDO A;  1X9M B;  5FHI A;  4G2E A;  1GNE A;  4RI6 A;  1JFU A;  1T3B A;  4FYC A;  4K9Z A;  1IYI A;  3LQ7 A;  4FYB A;  5G5E A;  1AAZ A;  2OJL A;  1VGL A;  3D4M A;  2GZY A;  2NBS A;  3M8N A;  1BAY A;  1OE8 A;  1S3D A;  2R37 A;  5IO0 A;  5A4W A;  2I4A A;  3FKF A;  1XOB A;  4V2M A;  3GTU A;  1GP1 A;  3P90 A;  1KNG A;  2FHE A;  4BVY B;  4ZBB A;  4WR4 A;  4F2I A;  4PUA A;  3CTG A;  5IMF A;  1U3I A;  4KSO A;  2VCQ A;  4KDX A;  1GH2 A;  4CY6 A;  1FAA A;  3MDK A;  3CSJ A;  3LYK A;  2BMX A;  1SJI A;  5IO2 A;  2FNO A;  4IBP A;  1VF3 A;  2VM1 A;  1SL0 B;  4BWS A;  3GST A;  1SD8 A;  3C8E A;  2XBI A;  1Z7R A;  3WYW A;  4POK A;  3N5O A;  2VL9 A;  1TRS A;  4PUF C;  4KA0 A;  4PUR A;  3FR6 A;  4ZB8 A;  1WMJ A;  4HJ2 A;  2MMA A;  4ML6 A;  4KH7 A;  2CAQ A;  4I8B A;  2R0P A;  3SWL A;  2H73 A;  2VLU A;  3KXO A;  2GS3 A;  4NHZ A;  2C4J A;  4L5O A;  3M1G A;  3NOF A;  3DML A;  4KW6 A;  2J9H A;  4N10 A;  5G31 A;  1QUW A;  5ENU A;  4P3Y B;  1K0B A;  5ECM B;  2M80 A;  3LFL A;  2GSR A;  4NXI A;  4WXT A;  1B8X A;  5JCU A;  3P7X A;  5GST A;  2KLX A;  2L4C A;  2FLS A;  4N11 A;  2DIZ A;  2GST A;  2JAD A;  1O6J A;  4LMW A;  1VF4 A;  2GLR A;  3FMW A;  3ERW A;  1TI3 A;  3PGT A;  1XOA A;  4FYU A;  4A5P A;  2AUV A;  3O6T A;  4MCU A;  1BG5 A;  1TRW A;  1RQM A;  4TN8 A;  3Q74 A;  4JU5 A;  4AJ6 A;  1WWJ A;  1OYJ A;  3MNG A;  2F8F A;  5ID2 A;  4KDU A;  4V2N A;  4MZW A;  4BVX A;  2DSA A;  2R5G A;  2YWO A;  3D21 A;  4K5R A;  2V1M A;  3EE2 A;  5CO3 A;  3F4T A;  1TP9 A;  4ZXG A;  1URM A;  4YKF A;  2VCZ A;  2GQK A;  2CQ9 A;  4YQV A;  4EC0 A;  5KOX A;  3RDW A;  2GT6 A;  2WB9 A;  1T4Y A;  1IYH A;  1Z6N A;  2FGX A;  1F9M A;  2DKI A;  2FY6 A;  3PH9 A;  2WDU A;  3UAP A;  4MA9 A;  3I6A A;  4X4J A;  3CYN A;  4PXO A;  1XWB A;  1SK2 A;  3W8S A;  1EP7 A;  2K9F A;  5D8I A;  2H76 A;  5INY A;  2HE3 A;  1FB6 A;  4HQZ A;  2CV4 A;  2UZ8 A;  5BMU A;  1R5A A;  4HEA 2;  4O92 A;  5KN0 A;  3SBC A;  1EGO A;  4HOJ A;  2H74 A;  1LJR A;  1W4V A;  4F9Z A;  4K7O A;  2CT6 A;  4OCE A;  2OAD A;  2C1Y A;  1FO5 A;  2H71 A;  1U3A A;  3LWA A;  4TXO B;  4ULX A;  2NPB A;  2R6K A;  1Z5Y E;  1DSB A;  3F4R A;  3DKS A;  5B6M A;  1WRY A;  3ERG A;  2YWM A;  3VWW A;  2GT5 A;  3L9U A;  2TRX A;  2VD1 A;  4ZL8 A;  2LRN A;  4WR5 A;  3A2X A;  2LEG A;  1YF1 A;  4N30 A;  1FW1 A;  1TW9 A;  2VOC A;  3VPT A;  5CRG A;  3HCZ A;  2HNL A;  4HU9 A;  1ZOF A;  4NWY A;  4ECC A;  5ECP B;  5ECO B;  1W89 A;  4GTU A;  3H4K A;  1YKA A;  5AN1 A;  3GHA A;  1THO A;  3BCK A;  1TOF A;  2IN3 A;  2HLS A;  4MNN A;  5CRD A;  5C04 A;  1EEM A;  2NTO A;  2EIQ A;  1HD2 A;  1QFN A;  2FA8 A;  3P8W A;  4WBR D;  4Z2U A;  1GTU A;  5G1L A;  3VFI A;  2R2J A;  1HQO A;  2MMO A;  1ZL9 A;  5B8B A;  3EWL A;  2OBK A;  1JZD A;  3KP9 A;  4LL1 B;  1PD2 1;  1ML6 A;  1ABA A;  4EDY A;  4MJE A;  1HYU A;  1O7U A;  3L9V A;  1KEB A;  4QQ7 A;  1YKC A;  3UOM A;  2DJ0 A;  2H66 A;  1SU9 A;  3KMN A;  5AIV A;  3TJK A;  1R4W A;  10GS A;  4K0G A;  3TKS A;  1G6W A;  1ACV A;  1SJZ A;  4XIH A;  3HY2 A;  2P31 A;  3ZFL A;  3ED3 A;  1V58 A;  1XZO A;  4DSQ A;  1TRU A;  3IRA A;  1VRS D;  4ISD A;  2FWF A;  4O7H A;  3GSS A;  2DMM A;  5GZZ B;  2CVB A;  2H1G A;  2QC7 A;  4MAB A;  2FWG A;  4G0L A;  9GSS A;  5CAX A;  1ON4 A;  2MZC A;  4G0K A;  4GST A;  2GZP A;  4V1A g;  5IMV A;  2YWN A;  4OWY A;  1PA3 A;  2VCT A;  2H72 A;  2H0H A;  2RM5 A;  2CAI A;  3O76 A;  1GSE A;  5J5N A;  13GS A;  4J57 E;  2E2G A;  5IMZ A;  5CRW A;  3ZL5 A;  2YJ7 A;  2P0G A;  2HZE B;  3TKQ A;  1XWA A;  2L5O A;  4E8H A;  4L5L A;  4L8E A;  1RK4 A;  19GS A;  1R5P A;  3LXT A;  3EVI A;  2HSH A;  2WCI A;  2EIR A;  1GUH A;  5CRH A;  1ERV A;  5HQP A;  1M9B A;  2A4H A;  4YQM A;  3GUS A;  3ZLP A;  4IJI A;  3EMP A;  1K0O A;  4IHU A;  5IMD A;  4EUY A;  1N2A A;  2JZS A;  4MP4 A;  5F0G A;  2KP2 A;  3FY7 A;  2B1K A;  4ZL7 A;  2EC4 A;  1YY7 A;  4MPG A;  1MEK A;  2L6D A;  3NZN A;  2HZF A;  2G2Q A;  3KEB A;  2H70 A;  4XHM A;  2JU5 A;  2OA7 A;  3IR4 A;  2YN1 A;  2KP1 A;  3Q19 A;  4EL1 A;  3RAZ A;  4Z7X A;  3KD0 A;  4TR4 A;  3JCM L;  4WKW A;  2C0E A;  2C8U A;  3D5J A;  2TIR A;  5L71 A;  4IVF A;  3F3R A;  5J4U A;  6GSS A;  4N0V A;  4FO5 A;  3EPT A;  1GTB A;  1PQN A;  3FK8 A;  4DSR A;  2VD0 A;  2X8C A;  4PQI A;  1VF1 A;  3KM6 A;  4HZ2 A;  1TJD A;  1N8J A;  1O8W A;  3QDN A;  3UAR A;  4EXJ A;  1T00 A;  1X5C A;  4NPB A;  3RPN A;  3F4S A;  4NHW A;  2ZNM A;  2YNX A;  1T7P B;  5ECR B;  3KMO A;  2ZUP A;  1VF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...