2HSHA

Crystal structure of c73s mutant of human thioredoxin-1 oxidized with h2o2
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
105
structure length
105
Chain Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin
publication title Buried s-nitrosocysteine revealed in crystal structures of human thioredoxin.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2006-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2hshA00
3DMLA 3BCKA 3IPZA 5DCGA 4BVXA 4I97A 3LG6A 5COHA 4F0CA 1M7TA 1O8WA 1SU9A 3F6DA 5AIVA 2C8UA 3TRQA 1SJ6A 3ZMLA 2FY6A 2KHPA 3GV1A 4X0XA 3KZQA 4TKYA 3EE2A 1THXA 2B5YA 4XS4A 3CXGA 4MCUA 3M0FA 5D9WA 4ZL8A 1AQWA 3U6VA 3G7YA 2FUG2 2R3XA 5DCHA 2LRCA 3DVWA 4WKWA 4MF6A 1ERWA 1K0BA 1QQ2A 3P90A 3BD2A 1WPIA 1HYUA 5ECIB 1V57A 5GZZB 2X8HA 3D5JA 1GTIA 2DLXA 2DC5A 12GSA 1PN9A 2LQQA 2CV4A 1PX7A 1Q4JA 1VF2A 2N5BA 1K0DA 2H72A 2V6OA 2LEGA 1BX9A 1TTZA 5G1LA 1SYRA 5IM9A 1EGRA 2F3MA 20GSA 4Z7XA 1SL0B 1THOA 3IDVA 2HZFA 3WT1A 3TRPA 4AGSA 2X8GA 1PD21 4KDUA 3D4TA 1X5DA 2MBTA 4K7NA 1YKCA 1V40A 2OE3A 3IAS2 2OBIA 3C8EA 2IFQB 4GSNA 3DGQA 1R26A 1F37A 4TR4A 4GXZA 3VLNA 3ERWA 3VWVA 4MPFA 2PERA 5CO3A 4ZBAA 2I9HA 2WFCA 3FHKA 2N5AA 3FR6A 4HDEA 1MDKA 1K3LA 3CSIA 3DIEA 2D2ZA 2NDOA 3I43A 1YJ6A 2DJ3A 1H4OA 4PNFA 2BMXA 2CA8A 3HY2A 3SWLA 3TJKA 5IQYA 3TKPA 4KAEA 4V2MA 5A5KA 4IW9A 6GSSA 16GSA 2H19A 2VCVA 2F8FA 2YN1A 2YANA 1SJZA 4NPBA 5A4UA 3TOTA 5ECSA 2O89A 1SENA 3QAWA 3L78A 4JE1A 5KN3A 2HI7A 3GNJA 4PURA 2GQLA 4V1Ag 1URMA 3KJYA 3VFIA 5G5EA 4QQ7A 4KE3A 4YQUA 1WE0A 4ULXA 3MWHA 5IIZA 4I5QA 4X1UA 4MF5A 3GX8A 3TJFA 4FH8A 3KH7A 4MZCA 2YWIA 1YZXA 2VD0A 2IJYA 3M1GA 1PKZA 3M3MA 3P8WA 2PGTA 5J9BA 4PNGA 2CX3A 1TP9A 3LGCA 4PGTA 1ST9A 3FZ4A 5F8BA 1PGTA 4XRAA 4F2IA 3IK9A 3UIWA 1FO5A 1A2JA 2VCXA 1TJDA 1R4WA 1DSBA 3PR8A 5H5QA 4WXTA 1BEDA 4IHUA 2WGRA 1F6MC 2V6KA 3TCOA 5KEJA 2B7JA 1XVWA 4EE0A 4G10A 1JZRA 2H6ZA 1AC1A 4GQCA 1SK0A 5ECLB 3L0HA 3PGTA 1YF0A 1GLQA 3GH6A 1TI1A 3UARA 2CT6A 9GSSA 2GSTA 4Q5QA 1W89A 2LV3A 4Q5RA 1AQVA 3ERFA 2RUFA 5FWGA 2FWEA 3UAPA 2AB6A 2R37A 4PQIA 5DJMA 1EEMA 2OACA 2BTOT 4HJMA 4PUAA 1Z7PA 4CW9A 4HI7A 3IK7A 1PL2A 4IJIA 4DEJA 3FZAA 2K8SA 4L8EA 4O7HA 4GSTA 3UL3A 8GSSA 3RBTA 2B3SA 1NHOA 5DALA 4FIWA 3EVIA 3CRUA 1XWGA 3CSHA 1ILOA 4KGIA 2XPDA 5ELAA 3IRAA 3IHQA 4LA1A 1T1VA 2X99A 1J9BA 1X5CA 2C3TA 4GQFA 2H1DA 1EV9A 2RM5A 1F3AA 1KTEA 2LQOA 1AIUA 1K0AA 4GWRA 4TXOA 2AV4A 2LJRA 5J9CA 3DD3A 2V1MA 2K9FA 2YCDA 2RUEA 2V41A 6GSYA 5HFIA 3UVTA 4XS1A 3CTFA 1XPVA 3EC3A 3HJMA 2H30A 1B48A 1BJXA 3LEFA 3C7MA 3Q6OA 4RI6A 4POMA 4MLYA 1O73A 5G5FA 1G6YA 3KTLA 1I5GA 3E3EA 2X64A 3FYGA 3IE3A 3VPTA 3P7XA 3HJPA 5IO2A 5IOWA 4N0ZA 3UOMA 2MMNA 1YF1A 3VI5A 3F4RA 3KTBA 1WIKA 2YWNA 1VF1A 3FR9A 2C1YA 3SBCA 4POKA 3J7Yb 1YY7A 1Z5YE 1MTCA 1RW1A 3KP9A 2A4VA 1PA3A 2PPTA 4ZXGA 3LQ7A 3PINA 1V9WA 5LCZA 5DQSA 5GAPD 5DAKB 1YEPA 2I4AA 1GLPA 1GL8A 2H74A 5HR0A 3I6AA 1OAZA 2LJAA 1ABAA 1JZOA 4PQHA 3VURA 3ZZXA 2F9SA 4JRRA 5J3RA 4F82A 4KUNA 4MH2A 2O87A 1S3AA 4HEA2 4NHZA 1QXHA 2VM2A 1TRVA 4MA9A 3EURA 2JL4A 2A2RA 1SKWB 4E8HA 1Z7RA 1O85A 3HA9A 2YPMA 2XPEA 3RPPA 2KLXA 1TU8A 3LFLA 4F03A 4KDYA 4OFNA 3D21A 4X43A 5B8BA 4BWQA 3FEUA 3H8QA 2E2GA 2YNXA 6GSTA 4LL4B 4TR0A 1NSWA 1IYHA 1KBNA 5IMFA 2R2JA 2VL2A 3ISOA 4ECBA 2C3NA 2C0DA 2GTUA 3QFAC 4FO5A 3KIJA 3IA1A 3HYPA 3V1WA 2P5QA 5F05A 5JWQB 2IWTA 2FCHA 2LTKA 2VLTA 2HFDA 5FT3A 1UA5A 11GSA 3ZLPA 4CHSA 3HVVA 1KEBA 4TOPA 1OKDA 1EOGA 3WGDA 1TU7A 3J7Yk 3DEXA 3S9FA 6GSVA 4TN8A 4JU5A 3ZMKA 1J08A 2RIIA 4ML6A 3F3RA 3GL5A 1G7OA 2CX4A 5CRGA 3F6FA 2L6CA 2GZYA 4O5RA 3EMXA 5IPGA 5E4WA 2GT6A 4K8MA 2GSRA 1GRXA 5H5SA 1X9SB 1EV4A 3EINA 3F0IA 3WT2A 5ECMB 1O81A 4HS1A 1QGVA 4ISDA 2E7PA 1XWKA 4FYCA 3G7IA 1EP8A 2LKUA 2GVPA 1LBKA 4PQ1A 2L4CA 4TRXA 2IMIA 4I2UA 3E0UA 2C4JA 2HRNA 3UBKA 2PU9C 4KB3A 4G9HA 4OMVA 1GUHA 3GHAA 2REMA 5JWRB 4EVMA 1GSSA 2H70A 2WCIA 1C72A 1U3AA 5AIXA 4KA0A 2L5LA 1UC7A 2L6DA 3VK9A 2JADA 4L0UA 1GULA 2LNTA 3GUSA 3O6TA 4E8EA 2FWFA 2OE0A 4WF4A 3FZ9A 3DYRA 2I3YA 2B7KA 2YWMA 1GSFA 1QK8A 3R2QA 3GFKA 3FRCA 2WULA 1KNGA 3MAKA 1RK4A 4EDZA 2V32A 2VO4A 1B9YC 2GZPA 1EZKA 19GSA 1YDKA 4DSRA 3DKSA 1O8XA 4IP1A 2DSAA 3PH9A 3FW2A 2GDRA 3WGEA 3CYNA 5HQPA 3BBYA 4AJ8A 4KH7A 1RQMA 1OVNA 2AYTA 2G2QA 4KCAA 2VCZA 5IMDA 3GN3A 1TW9A 5JCUA 4LMWA 5ELGA 4GCIA 5HR1A 3ERGA 4QL9A 5F06A 2FHEA 1FVJA 2ZUPA 1I9DA 1HNAA 1JZDA 2MMZA 1J0FA 4OWYA 1GTUA 2NPBA 1CQHA 1OYJA 4POBA 3BOAA 5AGYA 2TRCP 2GSQA 5IMZA 5AN1A 1T8EB 1K0NA 4IELA 4JZQA 4MJEA 3IXRA 3TOUA 5CRHA 3N9JA 2GGTA 2I1UA 3HKRA 4YAVA 2ZNMA 1VF4A 1OC9B 5HR2A 1Z6NA 3LJRA 1R5AA 2WZ9A 4OO5A 2JACA 3LXZA 3WGXA 3D6IA 2LNSA 3M9KA 5H5RA 2WB9A 5ENUA 2HE3A 2M46A 1ZCPA 1Z3EA 4OFMA 1G0TA 1X0RA 1QUWA 1BAYA 4TW5A 1OE8A 4K9ZA 4XTSA 1ZL9A 2OADA 4J2FA 2O85A 5DAKA 1K3YA 2JSYA 5CAXA 4L5LA 4OO4A 3QAVA 1T3BA 1U6TA 3GA4A 2AUVA 3HDCA 3DWVA 4ID0A 1TI3A 3QPMA 1ZYQB 2VLVA 2K18A 3KGKA 1U88A 1NM3A 4AJ7A 4GSSA 3HCZA 4BA7A 1QMVA 2GT5A 2LSTA 4PXOA 1A0FA 1A8YA 1UN2A 2M80A 1GSQA 3LWAA 1SKSB 1M99A 2H1BA 4YQMA 1A2LA 1TRSA 1FVKA 3I69A 4MZWA 3EU4A 2IMEA 2OE1A 1EOHA 2MMOA 1FB6A 5IPHA 1XOAA 1SKRB 2FWHA 1V2AA 2YJ7A 5ECQB 4D73B 2H0IA 3M8NA 1XZOA 2DJ2A 1R7HA 2HLSA 3D0ZA 3LSZA 10GSA 3FKFA 5C04A 2C80A 3APOA 2KOKA 3HXSA 1X5EA 2HNLA 2XHFA 1MD3A 4NXIA 3IAM2 4HUAA 5CREA 1AXDA 2E2MA 1EP7A 3C73A 2DIYA 4GTUA 3APSA 3ZL5A 4DVCA 1EGOA 3ZIVA 5IMAA 3TKRA 4I2TA 6GSXA 5B6MA 4ILFA 1Q98A 4WF5A 3HD5A 3O3TA 4MJBA 3DRNA 3VI7A 2IL3A 1SK1A 2C0FA 4HU7A 4HZ2A 3C71A 3KMOA 3G9BA 2ON7A 1ERVA 2PVOC 1TKDB 1SD8A 2H73A 4FYUA 3ZVJD 1HQOA 2R4VA 1M0UA 2VCTA 1GSEA 3UBLA 1PQNA 1GSDA 1OC8A 4I8BA 5CYYA 3GSTA 2LJKA 1K0OA 2N5FA 4LMVA 2DIZA 2NVLA 1XWBA 4EKZA 3EU3A 1ACVA 4PUFC 1SD9A 2RM6A 4XIHA 4KX4A 1YEXA 4OCFA 3TDGA 1XWCA 4ZIJA 4EF0A 5E59A 1WRYA 2PN8A 4O32A 3CTGA 1U87A 5GSSA 2DBCA 5ECPB 2CZ3A 1ON4A 3GX0A 2HT9A 2HZEB 3TKSC 3Q19A 1AAZA 5ID2B 3ZRDA 1A0RP 1GSUA 5KN1A 2P31A 4IS0A 1B8XA 3HVSA 1ZYEA 3FR3A 2AJQB 2CQ9A 2TIRA 5ECNB 2JU5A 1GSYA 4WBRD 2VL9A 2EIQA 2RLIA 4TXVA 2J9HA 3KXOA 2CVBA 5D96A 1SL1B 1E2YA 2DMLA 1K0CA 1XVQA 3NIVA 3GKMA 3U5RE 7GSSA 3A5WA 1MDJA 1LU4A 3W8SA 1WJKA 1OC3A 3OR5A 4KW6A 1XIYA 4KNDA 1SK2A 14GSA 1U3IA 3IBHA 5KN2A 1UVZA 2XBIA 1O6JA 1S3CA 2FWGA 2H0HA 3NZNA 1T4YA 4ZB9A 2JZRA 2GS3A 3IOSA 4CDOA 5G31A 2C3QA 3ZIJA 4IGJA 4NAXA 1WMJA 1GUMA 4OCEA 4GF0A 2PUKC 4N10A 4XRDA 3O76A 2IIYA 4YH2A 3GURA 2PMTA 3MNGA 3LXTA 1WOUA 5ABRA 1XW6A 4HZ4A 2FNOA 1FAAA 2GSSA 2FD3A 4DSSB 2X8CA 4IN0A 2H01A 2QGVA 2EIRA 2DMMA 2Z9SA 3CRTA 2PBJA 4O92A 3GMFA 2XC2A 1OC9A 5AISA 4GRFA 3ZFLA 5KN0A 4EXJA 2JZTA 2P5RA 2DJ0A 1ERTA 3IV4A 4K0NA 2VOCA 1JLVA 4XHMA 4EL1A 2GLRA 1TK8B 3TJJA 2JSZA 3ZITA 2FGXA 3HVXA 1TXXA 4BL7A 1EWXA 2H71A 5G1KA 4EDYA 1FB0A 1K0MA 1S3DA 2NTOA 5D93A 5EPFA 2H0GA 1SJIA 5A4WA 1T4ZA 3NOFA 2B1KA 3E9JB 2IMDA 2EC4A 5D8IA 4HJ2A 1M9BA 4ECIA 3A2VA 2MBSA 3KD0A 3GKKA 3GKNA 1OKTA 2QKEA 2NBSA 4NV2A 1M2BA 2P0GA 1TOFA 5C00A 3P2AA 1GNWA 4JEDA 1DUGA 1V58A 1DE1A 5LNKe 1N2AA 3UMAA 5LD0A 3TKSE 5DQYA 2PWJA 2FLSA 2FA8A 3GSSA 3ZTLA 5JCGA 1QFNA 4TR1B 1T00A 3RHBA 2H1GA 2IMFA 5B6NA 3GL3A 4WBJA 2YWOA 3W6GA 5IMVA 4D73A 5ECHB 5ECOB 4ML1A 2QSIA 2ZCTA 1BG5A 3K8NA 3TGZA 2L59A 3H1NA 3TJGA 4H86A 4ACSA 3QMXA 2VL2C 4F0BA 2IMKA 4F9ZA 2HYXA 3RDWA 3FZ5A 1HD2A 2L5OA 3RAZA 4JBBA 3F63A 2OKAA 2O7KA 3GIXA 2K8VA 4ZILA 2L4QA 2CZ2A 1VF3A 4ZBBA 2ON5A 5ECRB 4MJAA 3EMPA 2YJHA 3ZFBA 3QFBC 1XWAA 2JZSA 4DSQA 5HFGA 2DJJA 3GTUB 4V1Ap 2C0GA 4G2EA 5GAND 18GSA 2H6YA 4ZL9A 1ZZYA 6GSWA 1SYXA 1PMTA 5B8AA 3F4TA 1ZMAA 3HZ4A 4XS6A 1PX6A 2VAFA 3L9VA 3US3A 5HFKA 2H75A 2DJ1A 1PSQA 1YKAA 3L4NA 3HHVA 3LORA 2F51A 3VWUA 5DBQA 4ECCA 1H75A 1B4PA 3CBUA 4K2DA 2YOIA 1B4QA 4N0VA 3IC4A 3EYTA 2TRXA 5J41A 5CP1A 1Y25A 5JWOB 4L0WA 2HRFA 5CRDA 3TB2A 2GQMA 2HSYA 3IR4A 4Q5NA 3GKXA 4N30A 1T7PB 3WYWA 3D4MA 1FHEA 3KP8A 2HSHA 2MZCA 1W4VA 1XW9A 2IN3A 4IKHA 1OE7A 1FG4A 3CSJA 2HZEA 5ECKB 2IPAA 5ID2A 5EY6A 3BCIA 1HNCA 4IQ1A 2DJKA 3FK8A 1NW2A 1TK5B 3N5OA 2J23A 4IQAA 2ES7A 3BJ5A 2CVDA 4G19A 4AJ6A 4MP4A 5GSTA 2OJLA 3ZYWA 3H4KA 1PKWA 2AAWA 3KH9A 3UEMA 3QDNA 1Y6EA 3ME8A 1GTAA 4Q5FA 4N11A 22GSA 3JCML 1SL2B 3H93A 3CMIA 3HJOA 2WS2A 3C1RA 1GH2A 3ME7A 5F07A 2OBKA 3Q74A 4WEYA 4XS4B 3D22A 4RQXA 2KUCA 5D9XA 3C1SA 2QC7A 3I9V2 2CAQA 4TR3A 4V2LA 3EWLA 3ED3A 1ZGNA 3F9UA 3TJBA 2B6MA 17GSA 1BYEA 3F8UA 1GUKA 3H79A 2E0QA 3VWXA 5L71A 5D9TA 4RI7A 3RHCA 3TKSA 4KCEA 3VWWA 4NHWA 1XXUA 3GYKA 3AY8A 4OD7A 1IYIA 3A2XA 1AUCA 4TVEA 3QAGA 3MDKA 1A23A 4QL7A 2VCQA 1N8JA 1JZWA 4BVYA 2FA4A 2O8VB 1FW1A 4ECJA 4DSSA 1ERUA 5DDLA 4MF7A 3W8JA 1LJRA 1FOVA 4RUVA 4J56E 2YZHA 1TRWA 1GNEA 5G30A 2H6XA 4KDXA 1Z6MA 5IMCA 1BQ7A 2VUPA 1XW5A 1WWJA 2LS5A 3MSZA 1GWCA 5FHIA 1DBYA 4K0GA 1ZOFA 2GQKA 2MMAA 3KM6A 2CVKA 2KP2A 4HU9A 2GZZA 1F9MA 3F3QA 4K7OA 3M9JA 2B5EA 3Q18A 5J4UA 2VIMA 4HQZA 1JHBA 4MZBA 4NMUA 3LYKA 5JCWA 5D9VA 5DVBA 4BWSA 1TDIA 5G2ZA 4KSMA 1Z9HA 2ALBA 1CQGA 2WDUA 4FYBA 4HOJA 3DVXA 5CRWA 1VGLA 5D73A 5F0GA 3QCPA 4IJ3A 1HNBA 1R5PA 1PRXA 3UVHA 3KEBA 4IBPA 1M2DA 3A3TA 2YZUA 3L9SA 1O7UA 13GSA 4ZL7A 5IOXA 4JR4A 1GTBA 4K7IA 5DJLA 1YQ1A 1DE2A 3VPQA 1A24A 2LUSA 1TK0B 4MJCA 1XCCA 2C0EA 1F3BA 4ZB6A 4IVFA 4NV5A 2B5XA 4TR1A 2EIOA 5J5NA 1MDIA 4LL1B 2PVQA 4MPGA 2H66A 1X9WB 4NWYA 2WRTA 1M9AA 3APQA 3ZVJA 2HXKA 4GLTA 2B1LA 3KMNA 6GSUA 2AHEA 1G6WA 1X9MB 4WETA 3LYPA 4MK3A 2OA7A 2YV9A 3GRXA 1AQXA 4MH3A 3DXBA 1MD4A 3RPNA 1WP0A 1JLWA 2VM1A 2F8AA 5B7CA 3QOUA 2WJUA 2MYGA 4V2NA 1USBA 1A8LA 4YAPA 1K3OA 2LRTA 2YV7A 2H1AA 4L5OA 1VRSD 4P3YB 2VL3A 1MEKA 4J57E 2VLUA 4OFTA 2R5GA 1V98A 2V2GA 2H8LA 4KSOA 1E6BA 3QR6A 4JR6A 2LRNA 3GTUA 4MMMA 2BJXA 3G7JA 5EVOA 4HQSA 4EUYA 2K6VA 3UJ1A 3A2WA 4K6XA 4YQVA 2IFQA 1GP1A 4ZB8A 4WR5A 3WD6A 4POLA 1F2EA 1XFLA 1EEJA 2L57A 2VD1A 2H76A 2I81A 1B9XC 3HZ8A 4K1FA 1ML6A 4ZBDA 1XOBA 3GH9A 1G7EA 4EO3A 4I6XA 5HR3A 1NHYA 5INYA 4MABA 5IO0A 4XCSA 1XBSA 2VCWA 1M2AA 4EC0A 2XBQA 5DALB 3F4SA 2A2SA 2YP6A 4RQRA 2R6KA 4MDCA 3ZREA 1JFUA 3TKQA 4IP6A 2G0FA 3TUEA 2M72A 1A2MA 5A4VA 4LLRA 5CNWA 3TRXA 1AW9A 4PX1A 3QD9A 5EL8A 4BPYA 1TRUA 3L9UA 4TXOB 1PL1A 3FY7A 4AF2A 3KCMA 2CAIA 2KP1A 4WR4A
chains in the Genus database with same CATH superfamily
3DMLA 3BCKA 3IPZA 5DCGA 4BVXA 4I97A 3LG6A 4USSA 5COHA 4F0CA 1M7TA 1O8WA 1SU9A 3F6DA 5AIVA 2C8UA 3TRQA 1SJ6A 3ZMLA 2FY6A 2KHPA 3GV1A 4X0XA 3KZQA 4TKYA 3EE2A 1THXA 2B5YA 4XS4A 3CXGA 4MCUA 3M0FA 5D9WA 4ZL8A 1AQWA 3U6VA 3G7YA 2FUG2 2R3XA 5DCHA 2LRCA 3DVWA 4WKWA 4MF6A 1ERWA 1K0BA 1QQ2A 3P90A 3BD2A 1WPIA 1HYUA 5ECIB 1V57A 5GZZB 2X8HA 3D5JA 1GTIA 2DLXA 2DC5A 12GSA 1PN9A 2LQQA 2CV4A 1PX7A 1Q4JA 1VF2A 2N5BA 1K0DA 3PPUA 2H72A 2V6OA 2LEGA 1BX9A 1TTZA 5G1LA 1SYRA 5IM9A 1EGRA 2F3MA 20GSA 4Z7XA 1SL0B 1THOA 3IDVA 2HZFA 3WT1A 3TRPA 4AGSA 2X8GA 1PD21 2DKIA 4KDUA 4G0KA 3D4TA 1X5DA 2MBTA 4K7NA 1YKCA 1V40A 2OE3A 3IAS2 2OBIA 3C8EA 2IFQB 4GSNA 3DGQA 1R26A 1F37A 4TR4A 4GXZA 3VLNA 3ERWA 3VWVA 2HRAA 4MPFA 2PERA 5CO3A 3IC8A 4ZBAA 4ICYA 2I9HA 2WFCA 3FHKA 2N5AA 3FR6A 4HDEA 1MDKA 1K3LA 3CSIA 3DIEA 2D2ZA 2NDOA 3I43A 1YJ6A 2DJ3A 1H4OA 4PNFA 2BMXA 2CA8A 3HY2A 4O5UA 3SWLA 3TJKA 5IQYA 3TKPA 4KAEA 4V2MA 5A5KA 4IW9A 6GSSA 16GSA 2H19A 2VCVA 2F8FA 2YN1A 2YANA 1SJZA 4NPBA 5A4UA 3TOTA 5ECSA 1FOHA 2O89A 1SENA 3QAWA 3L78A 4JE1A 5KN3A 2HI7A 3GNJA 4PURA 2GQLA 4V1Ag 1URMA 3KJYA 3VFIA 5G5EA 4QQ7A 4KE3A 4YQUA 1WE0A 4ULXA 3MWHA 4BVXB 5IIZA 4CY6A 4I5QA 4X1UA 4MF5A 3GX8A 3TJFA 4FH8A 3KH7A 4MZCA 2YWIA 1YZXA 2VD0A 2IJYA 3M1GA 1PKZA 3M3MA 3P8WA 2PGTA 5J9BA 4PNGA 2CX3A 1TP9A 3LGCA 3LW9A 4PGTA 1ST9A 3FZ4A 5F8BA 1PGTA 4XRAA 4F2IA 3IK9A 3UIWA 1FO5A 1A2JA 2VCXA 1TJDA 1R4WA 1DSBA 3PR8A 5H5QA 4WXTA 1BEDA 4IHUA 2WGRA 1F6MC 2V6KA 3TCOA 5KEJA 2B7JA 1XVWA 4EE0A 4G10A 1JZRA 2H6ZA 1AC1A 4GQCA 1SK0A 5ECLB 3L0HA 3PGTA 1GLQA 1YF0A 3GH6A 1TI1A 3UARA 2CT6A 9GSSA 2GSTA 4Q5QA 1W89A 2LV3A 4Q5RA 1AQVA 2HSMA 3ERFA 2RUFA 5FWGA 2FWEA 3UAPA 2AB6A 2R37A 4PQIA 5DJMA 1EEMA 2OACA 2BTOT 4HJMA 4PUAA 1Z7PA 4CW9A 3MIXA 4HI7A 3IK7A 1PL2A 4IJIA 4DEJA 4FQUA 3FZAA 2K8SA 4L8EA 2X49A 4O7HA 4GSTA 3UL3A 8GSSA 3RBTA 2B3SA 1NHOA 5DALA 4FIWA 3EVIA 3CRUA 1XWGA 3CSHA 1ILOA 4KGIA 2XPDA 5ELAA 3IRAA 3IHQA 4LA1A 2R0PA 1T1VA 4X4JA 2X99A 1J9BA 1X5CA 2C3TA 4GQFA 2H1DA 1EV9A 2RM5A 1F3AA 1KTEA 2LQOA 1AIUA 1K0AA 4GWRA 4TXOA 2AV4A 2LJRA 5J9CA 3DD3A 2V1MA 2K9FA 2YCDA 2RUEA 2V41A 6GSYA 5HFIA 3UVTA 4XS1A 2DKHA 3CTFA 1XPVA 3EC3A 3HJMA 2H30A 2HRKA 1B48A 4K2XA 1BJXA 3LEFA 3C7MA 3Q6OA 4RI6A 4POMA 4MLYA 1O73A 3IHGA 5G5FA 1G6YA 3KTLA 1I5GA 3E3EA 2X64A 2A4HA 3FYGA 3IE3A 3VPTA 3P7XA 3HJPA 5IO2A 5IOWA 4N0ZA 3UOMA 2MMNA 1YF1A 3VI5A 3F4RA 3KTBA 1WIKA 2YWNA 1VF1A 3FR9A 2C1YA 3SBCA 4POKA 3J7Yb 1YY7A 1Z5YE 1MTCA 1RW1A 3KP9A 2A4VA 1PA3A 2PPTA 4ZXGA 3LQ7A 3PINA 1V9WA 5LCZA 5DQSA 5GAPD 5DAKB 1YEPA 2I4AA 4Z2UA 1GLPA 1GL8A 2H74A 5HR0A 3I6AA 1OAZA 2LJAA 1ABAA 1JZOA 4PQHA 3VURA 3ZZXA 2F9SA 4JRRA 5J3RA 3EPTA 4F82A 4KUNA 4MH2A 2O87A 1S3AA 4HEA2 4NHZA 1QXHA 4G0IA 2VM2A 1TRVA 4MA9A 3EURA 2JL4A 2A2RA 1SKWB 4K5RA 4E8HA 1Z7RA 1O85A 3HA9A 2YPMA 2XPEA 3RPPA 2KLXA 1TU8A 3LFLA 4F03A 4KDYA 4OFNA 3D21A 4X43A 5B8BA 4BWQA 3FEUA 3H8QA 2E2GA 2YNXA 6GSTA 4LL4B 4TR0A 1NSWA 1IYHA 1KBNA 5IMFA 2R2JA 2VL2A 3ISOA 4ECBA 2C3NA 2C0DA 2GTUA 3QFAC 4FO5A 3KIJA 3IA1A 3HYPA 3V1WA 2P5QA 5F05A 5JWQB 2IWTA 2FCHA 2LTKA 2VLTA 2HFDA 5FT3A 1UA5A 11GSA 3ZLPA 4CHSA 3HVVA 1KEBA 4TOPA 1OKDA 1EOGA 3WGDA 1TU7A 3J7Yk 3DEXA 3S9FA 6GSVA 4TN8A 4JU5A 3ZMKA 1J08A 1XG8A 2RIIA 4ML6A 3F3RA 3GL5A 1G7OA 2CX4A 5CRGA 3F6FA 2L6CA 2GZYA 4O5RA 3EMXA 5IPGA 5E4WA 2GT6A 4K8MA 2GSRA 1GRXA 5H5SA 2R0CA 1X9SB 1EV4A 3EINA 3F0IA 3WT2A 5ECMB 1O81A 4HS1A 1QGVA 4ISDA 2E7PA 1XWKA 3HVNA 4FYCA 3G7IA 1EP8A 2LKUA 2GVPA 1LBKA 4PQ1A 2L4CA 4TRXA 2IMIA 5KOXA 4I2UA 3E0UA 2C4JA 2HRNA 3UBKA 2PU9C 4KB3A 4G9HA 4OMVA 1GUHA 3GHAA 2A2PA 2REMA 4PTSA 5JWRB 4EVMA 1GSSA 2H70A 2WCIA 1C72A 1U3AA 5AIXA 4KA0A 2L5LA 1UC7A 2L6DA 3VK9A 2JADA 4L0UA 1GULA 2LNTA 3GUSA 3O6TA 4E8EA 2FWFA 2OE0A 4WF4A 3FZ9A 3DYRA 2I3YA 2B7KA 2YWMA 1GSFA 1QK8A 3R2QA 3GFKA 3FRCA 2WULA 1KNGA 3MAKA 1RK4A 4EDZA 2V32A 2VO4A 1B9YC 2GZPA 1EZKA 19GSA 1YDKA 4DSRA 3DKSA 1O8XA 4IP1A 2DSAA 3PH9A 3FW2A 2GDRA 3WGEA 3CYNA 4G0LA 5HQPA 3BBYA 4AJ8A 4KH7A 1RQMA 1OVNA 2AYTA 2G2QA 4KCAA 2VCZA 5IMDA 3GN3A 1TW9A 5JCUA 4LMWA 5ELGA 4GCIA 5HR1A 3ERGA 4QL9A 5F06A 2FHEA 1FVJA 2ZUPA 1I9DA 1HNAA 1JZDA 2MMZA 3R3EA 1J0FA 4OWYA 1GTUA 2NPBA 1CQHA 1OYJA 4POBA 3BOAA 5AGYA 2TRCP 2GSQA 5IMZA 5AN1A 1T8EB 1K0NA 4IELA 4JZQA 4MJEA 3IXRA 3TOUA 5CRHA 3N9JA 2GGTA 2I1UA 2QA1A 3HKRA 4YAVA 2ZNMA 1VF4A 1OC9B 5HR2A 1Z6NA 3LJRA 1R5AA 2WZ9A 4OO5A 2JACA 3LXZA 3WGXA 3D6IA 2LNSA 3M9KA 5H5RA 2WB9A 5ENUA 2HE3A 2M46A 1ZCPA 1Z3EA 4OFMA 1G0TA 1X0RA 1QUWA 1BAYA 1M3JA 4TW5A 1OE8A 4K9ZA 4XTSA 1ZL9A 2OADA 4J2FA 2O85A 2UZ8A 5DAKA 1K3YA 2JSYA 5CAXA 4L5LA 4OO4A 3QAVA 1T3BA 1U6TA 3GA4A 2AUVA 3HDCA 3DWVA 5BRTA 4ID0A 1TI3A 3QPMA 1ZYQB 2VLVA 2K18A 3KGKA 1U88A 1NM3A 4AJ7A 4GSSA 3HCZA 4BA7A 1QMVA 2GT5A 2LSTA 4PXOA 1A0FA 1A8YA 1UN2A 2M80A 1GSQA 3LWAA 1SKSB 1M99A 2H1BA 4YQMA 1A2LA 1TRSA 1FVKA 3I69A 4KF9A 3EU4A 4MZWA 2IMEA 2OE1A 1EOHA 2MMOA 1FB6A 5IPHA 1XOAA 1SKRB 2FWHA 1V2AA 2YJ7A 5ECQB 4D73B 2H0IA 3M8NA 1XZOA 2DJ2A 1R7HA 2HLSA 3D0ZA 3LSZA 10GSA 3FKFA 5C04A 2C80A 3APOA 2KOKA 3HXSA 1X5EA 2HNLA 2XHFA 1MD3A 4NXIA 3IAM2 4HUAA 5CREA 1AXDA 2E2MA 1EP7A 3C73A 2DIYA 4GTUA 3APSA 3ZL5A 4DVCA 1EGOA 3ZIVA 5IMAA 3TKRA 4I2TA 6GSXA 5B6MA 4ILFA 1Q98A 4WF5A 3HD5A 3O3TA 4MJBA 3DRNA 3VI7A 2IL3A 1SK1A 2C0FA 4HZ2A 4HU7A 3C71A 3KMOA 3G9BA 2ON7A 1ERVA 2PVOC 1TKDB 1SD8A 2H73A 4FYUA 3ZVJD 1HQOA 2R4VA 1M0UA 2VCTA 1GSEA 3UBLA 1PQNA 1GSDA 1OC8A 4HSCX 4I8BA 5CYYA 3GSTA 2LJKA 1K0OA 3MYDA 2N5FA 4LMVA 2DIZA 2NVLA 1XWBA 1ZYNA 4EKZA 3EU3A 1ACVA 4PUFC 1SD9A 2RM6A 4XIHA 4KX4A 1YEXA 4OCFA 3TDGA 1XWCA 4ZIJA 1ZYPA 4EF0A 5E59A 1WRYA 2PN8A 4O32A 3CTGA 1U87A 2X4AA 5GSSA 2DBCA 5ECPB 2CZ3A 1ON4A 3GX0A 2HT9A 2HZEB 3TKSC 3Q19A 1AAZA 5ID2B 4A5PA 3ZRDA 1A0RP 1GSUA 5KN1A 2P31A 4IS0A 1B8XA 3HVSA 1ZYEA 3FR3A 2AJQB 2CQ9A 2TIRA 5ECNB 2JU5A 1GSYA 4WBRD 2VL9A 2EIQA 2RLIA 5BMUA 4TXVA 2J9HA 3KXOA 2CVBA 5D96A 1SL1B 1E2YA 2DMLA 1K0CA 1XVQA 3NIVA 3GKMA 3U5RE 7GSSA 3A5WA 1MDJA 1LU4A 3W8SA 1WJKA 1OC3A 3OR5A 4KW6A 4Z2RA 1XIYA 4KNDA 1SK2A 14GSA 1U3IA 3IBHA 5KN2A 1UVZA 2XBIA 1O6JA 1S3CA 2FWGA 2H0HA 3NZNA 1T4YA 4ZB9A 2JZRA 2GS3A 3IOSA 4CDOA 5G31A 2C3QA 3ZIJA 4IGJA 4NAXA 1WMJA 1GUMA 4OCEA 4GF0A 2PUKC 4N10A 4XRDA 3O76A 2IIYA 4YH2A 3GURA 2PMTA 3MNGA 3LXTA 1WOUA 5ABRA 4BVYB 1XW6A 4HZ4A 2FNOA 1FAAA 2GSSA 4EIPA 2FD3A 4DSSB 4CY8A 2X8CA 4IN0A 2H01A 4EIQA 2QGVA 2EIRA 4YKGA 4BIKA 2DMMA 2Z9SA 3CRTA 2PBJA 4O92A 3GMFA 2XC2A 1OC9A 5AISA 4GRFA 3ZFLA 5KN0A 4EXJA 2JZTA 2P5RA 2DJ0A 1ERTA 3IV4A 4K0NA 2VOCA 1JLVA 4XHMA 4EL1A 2GLRA 1TK8B 3TJJA 2JSZA 3ZITA 2FGXA 3HVXA 1TXXA 4BL7A 1EWXA 2H71A 5G1KA 4EDYA 1FB0A 1K0MA 1S3DA 2NTOA 5D93A 5EPFA 2H0GA 1SJIA 5A4WA 1T4ZA 3NOFA 2B1KA 3E9JB 2IMDA 2EC4A 5D8IA 4HJ2A 1M9BA 4ECIA 3A2VA 2MBSA 3KD0A 3GKKA 3GKNA 1OKTA 2QKEA 2NBSA 4NV2A 1M2BA 2P0GA 1TOFA 5C00A 3P2AA 1GNWA 4JEDA 1DUGA 1V58A 1DE1A 5LNKe 1N2AA 3UMAA 5LD0A 3TKSE 5DQYA 2PWJA 2FLSA 2FA8A 3GSSA 3ZTLA 5JCGA 1QFNA 4TR1B 1T00A 3RHBA 2H1GA 2IMFA 4K5SA 5B6NA 3GL3A 4WBJA 2YWOA 3W6GA 5IMVA 4D73A 5ECHB 5ECOB 4ML1A 2QSIA 2ZCTA 1BG5A 4O5QA 3K8NA 3A5IA 3TGZA 2L59A 3H1NA 3TJGA 4H86A 4ACSA 3QMXA 2VL2C 4F0BA 2IMKA 4F9ZA 2HYXA 3RDWA 3FZ5A 1HD2A 2L5OA 3RAZA 4JBBA 3F63A 2OKAA 2O7KA 3GIXA 2K8VA 4ZILA 2L4QA 2CZ2A 1VF3A 4ZBBA 2ON5A 5ECRB 4MJAA 3EMPA 2YJHA 3ZFBA 3QFBC 1XWAA 2JZSA 4DSQA 5HFGA 2R0GA 2DJJA 3GTUB 4V1Ap 2C0GA 4G2EA 5GAND 18GSA 2H6YA 4ZL9A 1ZZYA 6GSWA 1SYXA 1PMTA 5B8AA 3F4TA 1ZMAA 3HZ4A 4XS6A 1PX6A 2VAFA 3L9VA 3US3A 5HFKA 2H75A 2DJ1A 1PSQA 1YKAA 3L4NA 3HHVA 3LORA 2F51A 3VWUA 5DBQA 4ECCA 1H75A 1B4PA 3CBUA 4K2DA 2YOIA 1B4QA 4N0VA 3IC4A 3EYTA 2TRXA 5J41A 5CP1A 1Y25A 5JWOB 4L0WA 2HRFA 5CRDA 3TB2A 2GQMA 2HSYA 3IR4A 4Q5NA 3GKXA 4N30A 1T7PB 3WYWA 3D4MA 1FHEA 1PFOA 3KP8A 2HSHA 2MZCA 1W4VA 1XW9A 4BL7B 2IN3A 4IKHA 1OE7A 1FG4A 3CSJA 2HZEA 5ECKB 2IPAA 5ID2A 5EY6A 3BCIA 1HNCA 4IQ1A 2DJKA 3FK8A 1NW2A 1TK5B 3N5OA 2J23A 4IQAA 2ES7A 3BJ5A 2CVDA 4G19A 4AJ6A 4MP4A 5GSTA 2OJLA 3ZYWA 3H4KA 1PKWA 2AAWA 3KH9A 3UEMA 3QDNA 1Y6EA 3ME8A 1GTAA 4Q5FA 4N11A 22GSA 3JCML 1SL2B 3H93A 3CMIA 3HJOA 2WS2A 3C1RA 1GH2A 3ME7A 5F07A 2OBKA 3Q74A 4WEYA 4XS4B 3D22A 4RQXA 2KUCA 5D9XA 3C1SA 2QC7A 3I9V2 2CAQA 4TR3A 4V2LA 3EWLA 3ED3A 1ZGNA 3F9UA 3TJBA 2B6MA 17GSA 1BYEA 3F8UA 1GUKA 3H79A 2E0QA 3VWXA 5L71A 5D9TA 4RI7A 1S3RA 3RHCA 3TKSA 4KCEA 3VWWA 4NHWA 1XXUA 3GYKA 4Z2TA 3AY8A 4OD7A 1IYIA 3A2XA 3FMWA 1AUCA 4TVEA 3QAGA 3MDKA 1A23A 4QL7A 2VCQA 1N8JA 1JZWA 4BVYA 2FA4A 2O8VB 1FW1A 4ECJA 4DSSA 1ERUA 5DDLA 4MF7A 3W8JA 1LJRA 1FOVA 4RUVA 4J56E 2YZHA 1TRWA 1GNEA 5G30A 2H6XA 4KDXA 1Z6MA 5IMCA 1BQ7A 2VUPA 1XW5A 1WWJA 2LS5A 3MSZA 1GWCA 5FHIA 1DBYA 4K0GA 1ZOFA 2GQKA 2MMAA 3KM6A 2CVKA 2KP2A 4HU9A 2GZZA 1F9MA 3F3QA 4K7OA 3M9JA 2B5EA 3Q18A 5J4UA 2VIMA 4HQZA 1JHBA 4MZBA 4NMUA 3LYKA 5JCWA 5D9VA 5DVBA 4BWSA 1TDIA 5G2ZA 4KSMA 1Z9HA 2ALBA 1CQGA 2WDUA 4FYBA 4HOJA 3DVXA 5CRWA 1VGLA 5D73A 5F0GA 3QCPA 4IJ3A 1HNBA 1R5PA 1PRXA 3UVHA 3KEBA 4IBPA 1M2DA 3A3TA 2YZUA 3L9SA 1O7UA 13GSA 4ZL7A 5IOXA 4JR4A 1GTBA 4K7IA 5DJLA 1YQ1A 1DE2A 3VPQA 3CQFA 1A24A 2LUSA 1TK0B 4MJCA 1XCCA 2C0EA 1F3BA 4ZB6A 4IVFA 4NV5A 2B5XA 4TR1A 2EIOA 5J5NA 1MDIA 4LL1B 2PVQA 4MPGA 2H66A 1X9WB 4NWYA 2WRTA 1M9AA 3APQA 3ZVJA 2HXKA 4GLTA 2B1LA 3KMNA 6GSUA 2AHEA 1G6WA 1X9MB 4WETA 3LYPA 4MK3A 2OA7A 2YV9A 3GRXA 1AQXA 4MH3A 3DXBA 1MD4A 3RPNA 1PN0A 1WP0A 1JLWA 2VM1A 2F8AA 5B7CA 5KOWA 4YKFA 3QOUA 2WJUA 2MYGA 4V2NA 1USBA 1A8LA 4YAPA 1K3OA 2LRTA 2YV7A 2H1AA 4L5OA 1VRSD 4P3YB 1M3IA 2VL3A 1MEKA 4J57E 2VLUA 4OFTA 2R5GA 1V98A 2V2GA 2H8LA 4KSOA 1E6BA 3QR6A 4JR6A 2LRNA 3GTUA 4MMMA 2BJXA 3G7JA 5EVOA 4HQSA 4EUYA 2K6VA 3UJ1A 3A2WA 4K6XA 4YQVA 2IFQA 1GP1A 4ZB8A 4MNNA 4WR5A 3WD6A 2QA2A 1F2EA 4POLA 1XFLA 1EEJA 2L57A 2VD1A 2H76A 2I81A 1B9XC 3HZ8A 4K1FA 1ML6A 4ZBDA 1XOBA 3GH9A 1G7EA 4EO3A 4I6XA 5HR3A 1NHYA 5INYA 4MABA 5IO0A 4XCSA 1XBSA 2VCWA 1M2AA 4EC0A 2XBQA 5DALB 3F4SA 2A2SA 2YP6A 4RQRA 2R6KA 4MDCA 3ZREA 1JFUA 3TKQA 4IP6A 2G0FA 3TUEA 2M72A 1A2MA 5A4VA 4LLRA 5CNWA 3TRXA 1AW9A 4PX1A 3QD9A 5EL8A 4BPYA 1TRUA 3L9UA 4TXOB 1PL1A 3FY7A 4AF2A 3KCMA 2CAIA 2KP1A 4WR4A
chains in the Genus database with same CATH topology
3DMLA 3BCKA 3IPZA 5DCGA 4BVXA 4I97A 3LG6A 4USSA 5COHA 4F0CA 1M7TA 1O8WA 1SU9A 3F6DA 5AIVA 2C8UA 3TRQA 1SJ6A 3ZMLA 2FY6A 2KHPA 3GV1A 4X0XA 3KZQA 4TKYA 3EE2A 1THXA 2B5YA 4XS4A 3CXGA 4MCUA 3M0FA 5D9WA 4ZL8A 1AQWA 3U6VA 3G7YA 2FUG2 2R3XA 5DCHA 2LRCA 3DVWA 4WKWA 4MF6A 1ERWA 1K0BA 1QQ2A 3P90A 3BD2A 1WPIA 1HYUA 5ECIB 1V57A 5GZZB 2X8HA 3D5JA 1GTIA 2DLXA 2DC5A 12GSA 1PN9A 2LQQA 2CV4A 1PX7A 1Q4JA 1VF2A 2N5BA 1K0DA 3PPUA 2H72A 2V6OA 2LEGA 1BX9A 1TTZA 5G1LA 1SYRA 5IM9A 1EGRA 2F3MA 20GSA 4Z7XA 1SL0B 1THOA 3IDVA 2HZFA 3WT1A 3TRPA 4AGSA 2X8GA 1PD21 2DKIA 4KDUA 4G0KA 3D4TA 1X5DA 2MBTA 4K7NA 1YKCA 1V40A 2OE3A 3IAS2 2OBIA 3C8EA 2IFQB 4GSNA 3DGQA 1R26A 1F37A 4TR4A 4GXZA 3VLNA 3ERWA 3VWVA 2HRAA 4MPFA 2PERA 5CO3A 3IC8A 4ZBAA 4ICYA 2I9HA 2WFCA 3FHKA 2N5AA 3FR6A 4HDEA 1MDKA 1K3LA 3CSIA 3DIEA 2D2ZA 2NDOA 3I43A 1YJ6A 2DJ3A 1H4OA 4PNFA 2BMXA 2CA8A 3HY2A 4O5UA 3SWLA 3TJKA 5IQYA 3TKPA 4KAEA 4V2MA 5A5KA 4IW9A 6GSSA 16GSA 2H19A 2VCVA 2F8FA 2YN1A 2YANA 1SJZA 4NPBA 5A4UA 3TOTA 5ECSA 1FOHA 2O89A 1SENA 3QAWA 3L78A 4JE1A 5KN3A 2HI7A 3GNJA 4PURA 2GQLA 4V1Ag 1URMA 3KJYA 3VFIA 5G5EA 4QQ7A 4KE3A 4YQUA 1WE0A 4ULXA 3MWHA 4BVXB 5IIZA 4CY6A 4I5QA 4X1UA 4MF5A 3GX8A 3TJFA 4FH8A 3KH7A 4MZCA 2YWIA 1YZXA 2VD0A 2IJYA 3M1GA 1PKZA 3M3MA 3P8WA 2PGTA 5J9BA 4PNGA 2CX3A 1TP9A 3LGCA 3LW9A 4PGTA 1ST9A 3FZ4A 5F8BA 1PGTA 4XRAA 4F2IA 3IK9A 3UIWA 1FO5A 1A2JA 2VCXA 1TJDA 1R4WA 1DSBA 3PR8A 5H5QA 4WXTA 1BEDA 4IHUA 2WGRA 1F6MC 2V6KA 3TCOA 5KEJA 2B7JA 1XVWA 4EE0A 4G10A 1JZRA 2H6ZA 1AC1A 4GQCA 1SK0A 5ECLB 3L0HA 3PGTA 1GLQA 1YF0A 3GH6A 1TI1A 3UARA 2CT6A 9GSSA 2GSTA 4Q5QA 1W89A 2LV3A 4Q5RA 1AQVA 2HSMA 3ERFA 2RUFA 5FWGA 2FWEA 3UAPA 2AB6A 2R37A 4PQIA 5DJMA 1EEMA 2OACA 2BTOT 4HJMA 4PUAA 1Z7PA 4CW9A 3MIXA 4HI7A 3IK7A 1PL2A 4IJIA 4DEJA 4FQUA 3FZAA 2K8SA 4L8EA 2X49A 4O7HA 4GSTA 3UL3A 8GSSA 3RBTA 2B3SA 1NHOA 5DALA 4FIWA 3EVIA 3CRUA 1XWGA 3CSHA 1ILOA 4KGIA 2XPDA 5ELAA 3IRAA 3IHQA 4LA1A 2R0PA 1T1VA 4X4JA 2X99A 1J9BA 1X5CA 2C3TA 4GQFA 2H1DA 1EV9A 2RM5A 1F3AA 1KTEA 2LQOA 1AIUA 1K0AA 4GWRA 4TXOA 2AV4A 2LJRA 5J9CA 3DD3A 2V1MA 2K9FA 2YCDA 2RUEA 2V41A 6GSYA 5HFIA 3UVTA 4XS1A 2DKHA 3CTFA 1XPVA 3EC3A 3HJMA 2H30A 2HRKA 1B48A 4K2XA 1BJXA 3LEFA 3C7MA 3Q6OA 4RI6A 4POMA 4MLYA 1O73A 3IHGA 5G5FA 1G6YA 3KTLA 1I5GA 3E3EA 2X64A 2A4HA 3FYGA 3IE3A 3VPTA 3P7XA 3HJPA 5IO2A 5IOWA 4N0ZA 3UOMA 2MMNA 1YF1A 3VI5A 3F4RA 3KTBA 1WIKA 2YWNA 1VF1A 3FR9A 2C1YA 3SBCA 4POKA 3J7Yb 1YY7A 1Z5YE 1MTCA 1RW1A 3KP9A 2A4VA 1PA3A 2PPTA 4ZXGA 3LQ7A 3PINA 1V9WA 5LCZA 5DQSA 5GAPD 5DAKB 1YEPA 2I4AA 4Z2UA 1GLPA 1GL8A 2H74A 5HR0A 3I6AA 1OAZA 2LJAA 1ABAA 1JZOA 4PQHA 3VURA 3ZZXA 2F9SA 4JRRA 5J3RA 3EPTA 4F82A 4KUNA 4MH2A 2O87A 1S3AA 4HEA2 4NHZA 1QXHA 4G0IA 2VM2A 1TRVA 4MA9A 3EURA 2JL4A 2A2RA 1SKWB 4K5RA 4E8HA 1Z7RA 1O85A 3HA9A 2YPMA 2XPEA 3RPPA 2KLXA 1TU8A 3LFLA 4F03A 4KDYA 4OFNA 3D21A 4X43A 5B8BA 4BWQA 3FEUA 3H8QA 2E2GA 2YNXA 6GSTA 4LL4B 4TR0A 1NSWA 1IYHA 1KBNA 5IMFA 2R2JA 2VL2A 3ISOA 4ECBA 2C3NA 2C0DA 2GTUA 3QFAC 4FO5A 3KIJA 3IA1A 3HYPA 3V1WA 2P5QA 5F05A 5JWQB 2IWTA 2FCHA 2LTKA 2VLTA 2HFDA 5FT3A 1UA5A 11GSA 3ZLPA 4CHSA 3HVVA 1KEBA 4TOPA 1OKDA 1EOGA 3WGDA 1TU7A 3J7Yk 3DEXA 3S9FA 6GSVA 4TN8A 4JU5A 3ZMKA 1J08A 2RIIA 4ML6A 3F3RA 3GL5A 1G7OA 2CX4A 5CRGA 3F6FA 2L6CA 2GZYA 4O5RA 3EMXA 5IPGA 5E4WA 2GT6A 4K8MA 2GSRA 1GRXA 5H5SA 2R0CA 1X9SB 1EV4A 3EINA 3F0IA 3WT2A 5ECMB 1O81A 4HS1A 1QGVA 4ISDA 2E7PA 1XWKA 4FYCA 3G7IA 1EP8A 2LKUA 2GVPA 1LBKA 4PQ1A 2L4CA 4TRXA 2IMIA 5KOXA 4I2UA 3E0UA 2C4JA 2HRNA 3UBKA 2PU9C 4KB3A 4G9HA 4OMVA 1GUHA 3GHAA 2A2PA 2REMA 4PTSA 5JWRB 4EVMA 1GSSA 2H70A 2WCIA 1C72A 1U3AA 5AIXA 4KA0A 2L5LA 1UC7A 2L6DA 3VK9A 2JADA 4L0UA 1GULA 2LNTA 3GUSA 3O6TA 4E8EA 2FWFA 2OE0A 4WF4A 3FZ9A 3DYRA 2I3YA 2B7KA 2YWMA 1GSFA 1QK8A 3R2QA 3GFKA 3FRCA 2WULA 1KNGA 3MAKA 1RK4A 4EDZA 2V32A 2VO4A 1B9YC 2GZPA 1EZKA 19GSA 1YDKA 4DSRA 3DKSA 1O8XA 4IP1A 2DSAA 3PH9A 3FW2A 2GDRA 3WGEA 3CYNA 4G0LA 5HQPA 3BBYA 4AJ8A 4KH7A 1RQMA 1OVNA 2AYTA 2G2QA 4KCAA 2VCZA 5IMDA 3GN3A 1TW9A 5JCUA 4LMWA 5ELGA 4GCIA 5HR1A 3ERGA 4QL9A 5F06A 2FHEA 1FVJA 2ZUPA 1I9DA 1HNAA 1JZDA 2MMZA 3R3EA 1J0FA 4OWYA 1GTUA 2NPBA 1CQHA 1OYJA 4POBA 3BOAA 5AGYA 2TRCP 2GSQA 5IMZA 5AN1A 1T8EB 1K0NA 4IELA 4JZQA 4MJEA 3IXRA 3TOUA 5CRHA 3N9JA 2GGTA 2I1UA 2QA1A 3HKRA 4YAVA 2ZNMA 1VF4A 1OC9B 5HR2A 1Z6NA 3LJRA 1R5AA 2WZ9A 4OO5A 2JACA 3LXZA 3WGXA 3D6IA 2LNSA 3M9KA 5H5RA 2WB9A 5ENUA 2HE3A 2M46A 1ZCPA 1Z3EA 4OFMA 1G0TA 1X0RA 1QUWA 1BAYA 4TW5A 1OE8A 4K9ZA 4XTSA 1ZL9A 2OADA 4J2FA 2O85A 2UZ8A 5DAKA 1K3YA 2JSYA 5CAXA 4L5LA 4OO4A 3QAVA 1T3BA 1U6TA 3GA4A 2AUVA 3HDCA 3DWVA 5BRTA 4ID0A 1TI3A 3QPMA 1ZYQB 2VLVA 2K18A 3KGKA 1U88A 1NM3A 4AJ7A 4GSSA 3HCZA 4BA7A 1QMVA 2GT5A 2LSTA 4PXOA 1A0FA 1A8YA 1UN2A 2M80A 1GSQA 3LWAA 1SKSB 1M99A 2H1BA 4YQMA 1A2LA 1TRSA 1FVKA 3I69A 4KF9A 3EU4A 4MZWA 2IMEA 2OE1A 1EOHA 2MMOA 1FB6A 5IPHA 1XOAA 1SKRB 2FWHA 1V2AA 2YJ7A 5ECQB 4D73B 2H0IA 3M8NA 1XZOA 2DJ2A 1R7HA 2HLSA 3D0ZA 3LSZA 10GSA 3FKFA 5C04A 2C80A 3APOA 2KOKA 3HXSA 1X5EA 2HNLA 2XHFA 1MD3A 4NXIA 3IAM2 4HUAA 5CREA 1AXDA 2E2MA 1EP7A 3C73A 2DIYA 4GTUA 3APSA 3ZL5A 4DVCA 1EGOA 3ZIVA 5IMAA 3TKRA 4I2TA 6GSXA 5B6MA 4ILFA 1Q98A 4WF5A 3HD5A 3O3TA 4MJBA 3DRNA 3VI7A 2IL3A 1SK1A 2C0FA 4HU7A 4HZ2A 3C71A 3KMOA 3G9BA 2ON7A 1ERVA 2PVOC 1TKDB 1SD8A 2H73A 4FYUA 3ZVJD 1HQOA 2R4VA 1M0UA 2VCTA 1GSEA 3UBLA 1PQNA 1GSDA 1OC8A 4I8BA 5CYYA 3GSTA 2LJKA 1K0OA 3MYDA 2N5FA 4LMVA 2DIZA 2NVLA 1XWBA 1ZYNA 4EKZA 3EU3A 1ACVA 4PUFC 1SD9A 2RM6A 4XIHA 4KX4A 1YEXA 4OCFA 3TDGA 1XWCA 4ZIJA 1ZYPA 4EF0A 5E59A 1WRYA 2PN8A 4O32A 3CTGA 1U87A 2X4AA 5GSSA 2DBCA 5ECPB 2CZ3A 1ON4A 3GX0A 2HT9A 2HZEB 3TKSC 3Q19A 1AAZA 5ID2B 4A5PA 3ZRDA 1A0RP 1GSUA 5KN1A 2P31A 4IS0A 1B8XA 3HVSA 1ZYEA 3FR3A 2AJQB 2CQ9A 2TIRA 5ECNB 2JU5A 1GSYA 4WBRD 2VL9A 2EIQA 2RLIA 5BMUA 4TXVA 2J9HA 3KXOA 2CVBA 5D96A 1SL1B 1E2YA 2DMLA 1K0CA 1XVQA 3NIVA 3GKMA 3U5RE 7GSSA 3A5WA 1MDJA 1LU4A 3W8SA 1WJKA 1OC3A 3OR5A 4KW6A 4Z2RA 1XIYA 4KNDA 1SK2A 14GSA 1U3IA 3IBHA 5KN2A 1UVZA 2XBIA 1O6JA 1S3CA 2FWGA 2H0HA 3NZNA 1T4YA 4ZB9A 2JZRA 2GS3A 3IOSA 4CDOA 5G31A 2C3QA 3ZIJA 4IGJA 4NAXA 1WMJA 1GUMA 4OCEA 4GF0A 2PUKC 4N10A 4XRDA 3O76A 2IIYA 4YH2A 3GURA 2PMTA 3MNGA 3LXTA 1WOUA 5ABRA 4BVYB 1XW6A 4HZ4A 2FNOA 1FAAA 2GSSA 4EIPA 2FD3A 4DSSB 4CY8A 2X8CA 4IN0A 2H01A 4EIQA 2QGVA 2EIRA 4YKGA 2DMMA 2Z9SA 3CRTA 2PBJA 4O92A 3GMFA 2XC2A 1OC9A 5AISA 4GRFA 3ZFLA 5KN0A 4EXJA 2JZTA 2P5RA 2DJ0A 1ERTA 3IV4A 4K0NA 2VOCA 1JLVA 4XHMA 4EL1A 2GLRA 1TK8B 3TJJA 2JSZA 3ZITA 2FGXA 3HVXA 1TXXA 4BL7A 1EWXA 2H71A 5G1KA 4EDYA 1FB0A 1K0MA 1S3DA 2NTOA 5D93A 5EPFA 2H0GA 1SJIA 5A4WA 1T4ZA 3NOFA 2B1KA 3E9JB 2IMDA 2EC4A 5D8IA 4HJ2A 1M9BA 4ECIA 3A2VA 2MBSA 3KD0A 3GKKA 3GKNA 1OKTA 2QKEA 2NBSA 4NV2A 1M2BA 2P0GA 1TOFA 5C00A 3P2AA 1GNWA 4JEDA 1DUGA 1V58A 1DE1A 5LNKe 1N2AA 3UMAA 5LD0A 3TKSE 5DQYA 2PWJA 2FLSA 2FA8A 3GSSA 3ZTLA 5JCGA 1QFNA 4TR1B 1T00A 3RHBA 2H1GA 2IMFA 4K5SA 5B6NA 3GL3A 4WBJA 2YWOA 3W6GA 5IMVA 4D73A 5ECHB 5ECOB 4ML1A 2QSIA 2ZCTA 1BG5A 4O5QA 3K8NA 3A5IA 3TGZA 2L59A 3H1NA 3TJGA 4H86A 4ACSA 3QMXA 2VL2C 4F0BA 2IMKA 4F9ZA 2HYXA 3RDWA 3FZ5A 1HD2A 2L5OA 3RAZA 4JBBA 3F63A 2OKAA 2O7KA 3GIXA 2K8VA 4ZILA 2L4QA 2CZ2A 1VF3A 4ZBBA 2ON5A 5ECRB 4MJAA 3EMPA 2YJHA 3ZFBA 3QFBC 1XWAA 2JZSA 4DSQA 5HFGA 2R0GA 2DJJA 3GTUB 4V1Ap 2C0GA 4G2EA 5GAND 18GSA 2H6YA 4ZL9A 1ZZYA 6GSWA 1SYXA 1PMTA 5B8AA 3F4TA 1ZMAA 3HZ4A 4XS6A 1PX6A 2VAFA 3L9VA 3US3A 5HFKA 2H75A 2DJ1A 1PSQA 1YKAA 3L4NA 3HHVA 3LORA 2F51A 3VWUA 5DBQA 4ECCA 1H75A 1B4PA 3CBUA 4K2DA 2YOIA 1B4QA 4N0VA 3IC4A 3EYTA 2TRXA 5J41A 5CP1A 1Y25A 5JWOB 4L0WA 2HRFA 5CRDA 3TB2A 2GQMA 2HSYA 3IR4A 4Q5NA 3GKXA 4N30A 1T7PB 3WYWA 3D4MA 1FHEA 3KP8A 2HSHA 2MZCA 1W4VA 1XW9A 4BL7B 2IN3A 4IKHA 1OE7A 1FG4A 3CSJA 2HZEA 5ECKB 2IPAA 5ID2A 5EY6A 3BCIA 1HNCA 4IQ1A 2DJKA 3FK8A 1NW2A 1TK5B 3N5OA 2J23A 4IQAA 2ES7A 3BJ5A 2CVDA 4G19A 4AJ6A 4MP4A 5GSTA 2OJLA 3ZYWA 3H4KA 1PKWA 2AAWA 3KH9A 3UEMA 3QDNA 1Y6EA 3ME8A 1GTAA 4Q5FA 4N11A 22GSA 3JCML 1SL2B 3H93A 3CMIA 3HJOA 2WS2A 3C1RA 1GH2A 3ME7A 5F07A 2OBKA 3Q74A 4WEYA 4XS4B 3D22A 4RQXA 2KUCA 5D9XA 3C1SA 2QC7A 3I9V2 2CAQA 4TR3A 4V2LA 3EWLA 3ED3A 1ZGNA 3F9UA 3TJBA 2B6MA 17GSA 1BYEA 3F8UA 1GUKA 3H79A 2E0QA 3VWXA 5L71A 5D9TA 4RI7A 3RHCA 3TKSA 4KCEA 3VWWA 4NHWA 1XXUA 3GYKA 4Z2TA 3AY8A 4OD7A 1IYIA 3A2XA 3FMWA 1AUCA 4TVEA 3QAGA 3MDKA 1A23A 4QL7A 2VCQA 1N8JA 1JZWA 4BVYA 2FA4A 2O8VB 1FW1A 4ECJA 4DSSA 1ERUA 5DDLA 4MF7A 3W8JA 1LJRA 1FOVA 4RUVA 4J56E 2YZHA 1TRWA 1GNEA 5G30A 2H6XA 4KDXA 1Z6MA 5IMCA 1BQ7A 2VUPA 1XW5A 1WWJA 2LS5A 3MSZA 1GWCA 5FHIA 1DBYA 4K0GA 1ZOFA 2GQKA 2MMAA 3KM6A 2CVKA 2KP2A 4HU9A 2GZZA 1F9MA 3F3QA 4K7OA 3M9JA 2B5EA 3Q18A 5J4UA 2VIMA 4HQZA 1JHBA 4MZBA 4NMUA 3LYKA 5JCWA 5D9VA 5DVBA 4BWSA 1TDIA 5G2ZA 4KSMA 1Z9HA 2ALBA 1CQGA 2WDUA 4FYBA 4HOJA 3DVXA 5CRWA 1VGLA 5D73A 5F0GA 3QCPA 4IJ3A 1HNBA 1R5PA 1PRXA 3UVHA 3KEBA 4IBPA 1M2DA 3A3TA 2YZUA 3L9SA 1O7UA 13GSA 4ZL7A 5IOXA 4JR4A 1GTBA 4K7IA 5DJLA 1YQ1A 1DE2A 3VPQA 1A24A 2LUSA 1TK0B 4MJCA 1XCCA 2C0EA 1F3BA 4ZB6A 4IVFA 4NV5A 2B5XA 4TR1A 2EIOA 5J5NA 1MDIA 4LL1B 2PVQA 4MPGA 2H66A 1X9WB 4NWYA 2WRTA 1M9AA 3APQA 3ZVJA 2HXKA 4GLTA 2B1LA 3KMNA 6GSUA 2AHEA 1G6WA 1X9MB 4WETA 3LYPA 4MK3A 2OA7A 2YV9A 3GRXA 1AQXA 4MH3A 3DXBA 1MD4A 3RPNA 1PN0A 1WP0A 1JLWA 2VM1A 2F8AA 5B7CA 5KOWA 4YKFA 3QOUA 2WJUA 2MYGA 4V2NA 1USBA 1A8LA 4YAPA 1K3OA 2LRTA 2YV7A 2H1AA 4L5OA 1VRSD 4P3YB 2VL3A 1MEKA 4J57E 2VLUA 4OFTA 2R5GA 1V98A 2V2GA 2H8LA 4KSOA 1E6BA 3QR6A 4JR6A 2LRNA 3GTUA 4MMMA 2BJXA 3G7JA 5EVOA 4HQSA 4EUYA 2K6VA 3UJ1A 3A2WA 4K6XA 4YQVA 2IFQA 1GP1A 4ZB8A 4MNNA 4WR5A 3WD6A 2QA2A 1F2EA 4POLA 1XFLA 1EEJA 2L57A 2VD1A 2H76A 2I81A 1B9XC 3HZ8A 4K1FA 1ML6A 4ZBDA 1XOBA 3GH9A 1G7EA 4EO3A 4I6XA 5HR3A 1NHYA 5INYA 4MABA 5IO0A 4XCSA 1XBSA 2VCWA 1M2AA 4EC0A 2XBQA 5DALB 3F4SA 2A2SA 2YP6A 4RQRA 2R6KA 4MDCA 3ZREA 1JFUA 3TKQA 4IP6A 2G0FA 3TUEA 2M72A 1A2MA 5A4VA 4LLRA 5CNWA 3TRXA 1AW9A 4PX1A 3QD9A 5EL8A 4BPYA 1TRUA 3L9UA 4TXOB 1PL1A 3FY7A 4AF2A 3KCMA 2CAIA 2KP1A 4WR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DML A;  3BCK A;  3IPZ A;  5DCG A;  4BVX A;  4I97 A;  3LG6 A;  5COH A;  4F0C A;  1M7T A;  1O8W A;  1SU9 A;  3F6D A;  5AIV A;  2C8U A;  3TRQ A;  1SJ6 A;  3ZML A;  2FY6 A;  2KHP A;  3GV1 A;  4X0X A;  3KZQ A;  4TKY A;  3EE2 A;  1THX A;  2B5Y A;  4XS4 A;  3CXG A;  4MCU A;  3M0F A;  5D9W A;  4ZL8 A;  1AQW A;  3U6V A;  3G7Y A;  2FUG 2;  2R3X A;  5DCH A;  2LRC A;  3DVW A;  4WKW A;  4MF6 A;  1ERW A;  1K0B A;  1QQ2 A;  3P90 A;  3BD2 A;  1WPI A;  1HYU A;  5ECI B;  1V57 A;  5GZZ B;  2X8H A;  3D5J A;  1GTI A;  2DLX A;  2DC5 A;  12GS A;  1PN9 A;  2LQQ A;  2CV4 A;  1PX7 A;  1Q4J A;  1VF2 A;  2N5B A;  1K0D A;  2H72 A;  2V6O A;  2LEG A;  1BX9 A;  1TTZ A;  5G1L A;  1SYR A;  5IM9 A;  1EGR A;  2F3M A;  20GS A;  4Z7X A;  1SL0 B;  1THO A;  3IDV A;  2HZF A;  3WT1 A;  3TRP A;  4AGS A;  2X8G A;  1PD2 1;  4KDU A;  3D4T A;  1X5D A;  2MBT A;  4K7N A;  1YKC A;  1V40 A;  2OE3 A;  3IAS 2;  2OBI A;  3C8E A;  2IFQ B;  4GSN A;  3DGQ A;  1R26 A;  1F37 A;  4TR4 A;  4GXZ A;  3VLN A;  3ERW A;  3VWV A;  4MPF A;  2PER A;  5CO3 A;  4ZBA A;  2I9H A;  2WFC A;  3FHK A;  2N5A A;  3FR6 A;  4HDE A;  1MDK A;  1K3L A;  3CSI A;  3DIE A;  2D2Z A;  2NDO A;  3I43 A;  1YJ6 A;  2DJ3 A;  1H4O A;  4PNF A;  2BMX A;  2CA8 A;  3HY2 A;  3SWL A;  3TJK A;  5IQY A;  3TKP A;  4KAE A;  4V2M A;  5A5K A;  4IW9 A;  6GSS A;  16GS A;  2H19 A;  2VCV A;  2F8F A;  2YN1 A;  2YAN A;  1SJZ A;  4NPB A;  5A4U A;  3TOT A;  5ECS A;  2O89 A;  1SEN A;  3QAW A;  3L78 A;  4JE1 A;  5KN3 A;  2HI7 A;  3GNJ A;  4PUR A;  2GQL A;  4V1A g;  1URM A;  3KJY A;  3VFI A;  5G5E A;  4QQ7 A;  4KE3 A;  4YQU A;  1WE0 A;  4ULX A;  3MWH A;  5IIZ A;  4I5Q A;  4X1U A;  4MF5 A;  3GX8 A;  3TJF A;  4FH8 A;  3KH7 A;  4MZC A;  2YWI A;  1YZX A;  2VD0 A;  2IJY A;  3M1G A;  1PKZ A;  3M3M A;  3P8W A;  2PGT A;  5J9B A;  4PNG A;  2CX3 A;  1TP9 A;  3LGC A;  4PGT A;  1ST9 A;  3FZ4 A;  5F8B A;  1PGT A;  4XRA A;  4F2I A;  3IK9 A;  3UIW A;  1FO5 A;  1A2J A;  2VCX A;  1TJD A;  1R4W A;  1DSB A;  3PR8 A;  5H5Q A;  4WXT A;  1BED A;  4IHU A;  2WGR A;  1F6M C;  2V6K A;  3TCO A;  5KEJ A;  2B7J A;  1XVW A;  4EE0 A;  4G10 A;  1JZR A;  2H6Z A;  1AC1 A;  4GQC A;  1SK0 A;  5ECL B;  3L0H A;  3PGT A;  1YF0 A;  1GLQ A;  3GH6 A;  1TI1 A;  3UAR A;  2CT6 A;  9GSS A;  2GST A;  4Q5Q A;  1W89 A;  2LV3 A;  4Q5R A;  1AQV A;  3ERF A;  2RUF A;  5FWG A;  2FWE A;  3UAP A;  2AB6 A;  2R37 A;  4PQI A;  5DJM A;  1EEM A;  2OAC A;  2BTO T;  4HJM A;  4PUA A;  1Z7P A;  4CW9 A;  4HI7 A;  3IK7 A;  1PL2 A;  4IJI A;  4DEJ A;  3FZA A;  2K8S A;  4L8E A;  4O7H A;  4GST A;  3UL3 A;  8GSS A;  3RBT A;  2B3S A;  1NHO A;  5DAL A;  4FIW A;  3EVI A;  3CRU A;  1XWG A;  3CSH A;  1ILO A;  4KGI A;  2XPD A;  5ELA A;  3IRA A;  3IHQ A;  4LA1 A;  1T1V A;  2X99 A;  1J9B A;  1X5C A;  2C3T A;  4GQF A;  2H1D A;  1EV9 A;  2RM5 A;  1F3A A;  1KTE A;  2LQO A;  1AIU A;  1K0A A;  4GWR A;  4TXO A;  2AV4 A;  2LJR A;  5J9C A;  3DD3 A;  2V1M A;  2K9F A;  2YCD A;  2RUE A;  2V41 A;  6GSY A;  5HFI A;  3UVT A;  4XS1 A;  3CTF A;  1XPV A;  3EC3 A;  3HJM A;  2H30 A;  1B48 A;  1BJX A;  3LEF A;  3C7M A;  3Q6O A;  4RI6 A;  4POM A;  4MLY A;  1O73 A;  5G5F A;  1G6Y A;  3KTL A;  1I5G A;  3E3E A;  2X64 A;  3FYG A;  3IE3 A;  3VPT A;  3P7X A;  3HJP A;  5IO2 A;  5IOW A;  4N0Z A;  3UOM A;  2MMN A;  1YF1 A;  3VI5 A;  3F4R A;  3KTB A;  1WIK A;  2YWN A;  1VF1 A;  3FR9 A;  2C1Y A;  3SBC A;  4POK A;  3J7Y b;  1YY7 A;  1Z5Y E;  1MTC A;  1RW1 A;  3KP9 A;  2A4V A;  1PA3 A;  2PPT A;  4ZXG A;  3LQ7 A;  3PIN A;  1V9W A;  5LCZ A;  5DQS A;  5GAP D;  5DAK B;  1YEP A;  2I4A A;  1GLP A;  1GL8 A;  2H74 A;  5HR0 A;  3I6A A;  1OAZ A;  2LJA A;  1ABA A;  1JZO A;  4PQH A;  3VUR A;  3ZZX A;  2F9S A;  4JRR A;  5J3R A;  4F82 A;  4KUN A;  4MH2 A;  2O87 A;  1S3A A;  4HEA 2;  4NHZ A;  1QXH A;  2VM2 A;  1TRV A;  4MA9 A;  3EUR A;  2JL4 A;  2A2R A;  1SKW B;  4E8H A;  1Z7R A;  1O85 A;  3HA9 A;  2YPM A;  2XPE A;  3RPP A;  2KLX A;  1TU8 A;  3LFL A;  4F03 A;  4KDY A;  4OFN A;  3D21 A;  4X43 A;  5B8B A;  4BWQ A;  3FEU A;  3H8Q A;  2E2G A;  2YNX A;  6GST A;  4LL4 B;  4TR0 A;  1NSW A;  1IYH A;  1KBN A;  5IMF A;  2R2J A;  2VL2 A;  3ISO A;  4ECB A;  2C3N A;  2C0D A;  2GTU A;  3QFA C;  4FO5 A;  3KIJ A;  3IA1 A;  3HYP A;  3V1W A;  2P5Q A;  5F05 A;  5JWQ B;  2IWT A;  2FCH A;  2LTK A;  2VLT A;  2HFD A;  5FT3 A;  1UA5 A;  11GS A;  3ZLP A;  4CHS A;  3HVV A;  1KEB A;  4TOP A;  1OKD A;  1EOG A;  3WGD A;  1TU7 A;  3J7Y k;  3DEX A;  3S9F A;  6GSV A;  4TN8 A;  4JU5 A;  3ZMK A;  1J08 A;  2RII A;  4ML6 A;  3F3R A;  3GL5 A;  1G7O A;  2CX4 A;  5CRG A;  3F6F A;  2L6C A;  2GZY A;  4O5R A;  3EMX A;  5IPG A;  5E4W A;  2GT6 A;  4K8M A;  2GSR A;  1GRX A;  5H5S A;  1X9S B;  1EV4 A;  3EIN A;  3F0I A;  3WT2 A;  5ECM B;  1O81 A;  4HS1 A;  1QGV A;  4ISD A;  2E7P A;  1XWK A;  4FYC A;  3G7I A;  1EP8 A;  2LKU A;  2GVP A;  1LBK A;  4PQ1 A;  2L4C A;  4TRX A;  2IMI A;  4I2U A;  3E0U A;  2C4J A;  2HRN A;  3UBK A;  2PU9 C;  4KB3 A;  4G9H A;  4OMV A;  1GUH A;  3GHA A;  2REM A;  5JWR B;  4EVM A;  1GSS A;  2H70 A;  2WCI A;  1C72 A;  1U3A A;  5AIX A;  4KA0 A;  2L5L A;  1UC7 A;  2L6D A;  3VK9 A;  2JAD A;  4L0U A;  1GUL A;  2LNT A;  3GUS A;  3O6T A;  4E8E A;  2FWF A;  2OE0 A;  4WF4 A;  3FZ9 A;  3DYR A;  2I3Y A;  2B7K A;  2YWM A;  1GSF A;  1QK8 A;  3R2Q A;  3GFK A;  3FRC A;  2WUL A;  1KNG A;  3MAK A;  1RK4 A;  4EDZ A;  2V32 A;  2VO4 A;  1B9Y C;  2GZP A;  1EZK A;  19GS A;  1YDK A;  4DSR A;  3DKS A;  1O8X A;  4IP1 A;  2DSA A;  3PH9 A;  3FW2 A;  2GDR A;  3WGE A;  3CYN A;  5HQP A;  3BBY A;  4AJ8 A;  4KH7 A;  1RQM A;  1OVN A;  2AYT A;  2G2Q A;  4KCA A;  2VCZ A;  5IMD A;  3GN3 A;  1TW9 A;  5JCU A;  4LMW A;  5ELG A;  4GCI A;  5HR1 A;  3ERG A;  4QL9 A;  5F06 A;  2FHE A;  1FVJ A;  2ZUP A;  1I9D A;  1HNA A;  1JZD A;  2MMZ A;  1J0F A;  4OWY A;  1GTU A;  2NPB A;  1CQH A;  1OYJ A;  4POB A;  3BOA A;  5AGY A;  2TRC P;  2GSQ A;  5IMZ A;  5AN1 A;  1T8E B;  1K0N A;  4IEL A;  4JZQ A;  4MJE A;  3IXR A;  3TOU A;  5CRH A;  3N9J A;  2GGT A;  2I1U A;  3HKR A;  4YAV A;  2ZNM A;  1VF4 A;  1OC9 B;  5HR2 A;  1Z6N A;  3LJR A;  1R5A A;  2WZ9 A;  4OO5 A;  2JAC A;  3LXZ A;  3WGX A;  3D6I A;  2LNS A;  3M9K A;  5H5R A;  2WB9 A;  5ENU A;  2HE3 A;  2M46 A;  1ZCP A;  1Z3E A;  4OFM A;  1G0T A;  1X0R A;  1QUW A;  1BAY A;  4TW5 A;  1OE8 A;  4K9Z A;  4XTS A;  1ZL9 A;  2OAD A;  4J2F A;  2O85 A;  5DAK A;  1K3Y A;  2JSY A;  5CAX A;  4L5L A;  4OO4 A;  3QAV A;  1T3B A;  1U6T A;  3GA4 A;  2AUV A;  3HDC A;  3DWV A;  4ID0 A;  1TI3 A;  3QPM A;  1ZYQ B;  2VLV A;  2K18 A;  3KGK A;  1U88 A;  1NM3 A;  4AJ7 A;  4GSS A;  3HCZ A;  4BA7 A;  1QMV A;  2GT5 A;  2LST A;  4PXO A;  1A0F A;  1A8Y A;  1UN2 A;  2M80 A;  1GSQ A;  3LWA A;  1SKS B;  1M99 A;  2H1B A;  4YQM A;  1A2L A;  1TRS A;  1FVK A;  3I69 A;  4MZW A;  3EU4 A;  2IME A;  2OE1 A;  1EOH A;  2MMO A;  1FB6 A;  5IPH A;  1XOA A;  1SKR B;  2FWH A;  1V2A A;  2YJ7 A;  5ECQ B;  4D73 B;  2H0I A;  3M8N A;  1XZO A;  2DJ2 A;  1R7H A;  2HLS A;  3D0Z A;  3LSZ A;  10GS A;  3FKF A;  5C04 A;  2C80 A;  3APO A;  2KOK A;  3HXS A;  1X5E A;  2HNL A;  2XHF A;  1MD3 A;  4NXI A;  3IAM 2;  4HUA A;  5CRE A;  1AXD A;  2E2M A;  1EP7 A;  3C73 A;  2DIY A;  4GTU A;  3APS A;  3ZL5 A;  4DVC A;  1EGO A;  3ZIV A;  5IMA A;  3TKR A;  4I2T A;  6GSX A;  5B6M A;  4ILF A;  1Q98 A;  4WF5 A;  3HD5 A;  3O3T A;  4MJB A;  3DRN A;  3VI7 A;  2IL3 A;  1SK1 A;  2C0F A;  4HU7 A;  4HZ2 A;  3C71 A;  3KMO A;  3G9B A;  2ON7 A;  1ERV A;  2PVO C;  1TKD B;  1SD8 A;  2H73 A;  4FYU A;  3ZVJ D;  1HQO A;  2R4V A;  1M0U A;  2VCT A;  1GSE A;  3UBL A;  1PQN A;  1GSD A;  1OC8 A;  4I8B A;  5CYY A;  3GST A;  2LJK A;  1K0O A;  2N5F A;  4LMV A;  2DIZ A;  2NVL A;  1XWB A;  4EKZ A;  3EU3 A;  1ACV A;  4PUF C;  1SD9 A;  2RM6 A;  4XIH A;  4KX4 A;  1YEX A;  4OCF A;  3TDG A;  1XWC A;  4ZIJ A;  4EF0 A;  5E59 A;  1WRY A;  2PN8 A;  4O32 A;  3CTG A;  1U87 A;  5GSS A;  2DBC A;  5ECP B;  2CZ3 A;  1ON4 A;  3GX0 A;  2HT9 A;  2HZE B;  3TKS C;  3Q19 A;  1AAZ A;  5ID2 B;  3ZRD A;  1A0R P;  1GSU A;  5KN1 A;  2P31 A;  4IS0 A;  1B8X A;  3HVS A;  1ZYE A;  3FR3 A;  2AJQ B;  2CQ9 A;  2TIR A;  5ECN B;  2JU5 A;  1GSY A;  4WBR D;  2VL9 A;  2EIQ A;  2RLI A;  4TXV A;  2J9H A;  3KXO A;  2CVB A;  5D96 A;  1SL1 B;  1E2Y A;  2DML A;  1K0C A;  1XVQ A;  3NIV A;  3GKM A;  3U5R E;  7GSS A;  3A5W A;  1MDJ A;  1LU4 A;  3W8S A;  1WJK A;  1OC3 A;  3OR5 A;  4KW6 A;  1XIY A;  4KND A;  1SK2 A;  14GS A;  1U3I A;  3IBH A;  5KN2 A;  1UVZ A;  2XBI A;  1O6J A;  1S3C A;  2FWG A;  2H0H A;  3NZN A;  1T4Y A;  4ZB9 A;  2JZR A;  2GS3 A;  3IOS A;  4CDO A;  5G31 A;  2C3Q A;  3ZIJ A;  4IGJ A;  4NAX A;  1WMJ A;  1GUM A;  4OCE A;  4GF0 A;  2PUK C;  4N10 A;  4XRD A;  3O76 A;  2IIY A;  4YH2 A;  3GUR A;  2PMT A;  3MNG A;  3LXT A;  1WOU A;  5ABR A;  1XW6 A;  4HZ4 A;  2FNO A;  1FAA A;  2GSS A;  2FD3 A;  4DSS B;  2X8C A;  4IN0 A;  2H01 A;  2QGV A;  2EIR A;  2DMM A;  2Z9S A;  3CRT A;  2PBJ A;  4O92 A;  3GMF A;  2XC2 A;  1OC9 A;  5AIS A;  4GRF A;  3ZFL A;  5KN0 A;  4EXJ A;  2JZT A;  2P5R A;  2DJ0 A;  1ERT A;  3IV4 A;  4K0N A;  2VOC A;  1JLV A;  4XHM A;  4EL1 A;  2GLR A;  1TK8 B;  3TJJ A;  2JSZ A;  3ZIT A;  2FGX A;  3HVX A;  1TXX A;  4BL7 A;  1EWX A;  2H71 A;  5G1K A;  4EDY A;  1FB0 A;  1K0M A;  1S3D A;  2NTO A;  5D93 A;  5EPF A;  2H0G A;  1SJI A;  5A4W A;  1T4Z A;  3NOF A;  2B1K A;  3E9J B;  2IMD A;  2EC4 A;  5D8I A;  4HJ2 A;  1M9B A;  4ECI A;  3A2V A;  2MBS A;  3KD0 A;  3GKK A;  3GKN A;  1OKT A;  2QKE A;  2NBS A;  4NV2 A;  1M2B A;  2P0G A;  1TOF A;  5C00 A;  3P2A A;  1GNW A;  4JED A;  1DUG A;  1V58 A;  1DE1 A;  5LNK e;  1N2A A;  3UMA A;  5LD0 A;  3TKS E;  5DQY A;  2PWJ A;  2FLS A;  2FA8 A;  3GSS A;  3ZTL A;  5JCG A;  1QFN A;  4TR1 B;  1T00 A;  3RHB A;  2H1G A;  2IMF A;  5B6N A;  3GL3 A;  4WBJ A;  2YWO A;  3W6G A;  5IMV A;  4D73 A;  5ECH B;  5ECO B;  4ML1 A;  2QSI A;  2ZCT A;  1BG5 A;  3K8N A;  3TGZ A;  2L59 A;  3H1N A;  3TJG A;  4H86 A;  4ACS A;  3QMX A;  2VL2 C;  4F0B A;  2IMK A;  4F9Z A;  2HYX A;  3RDW A;  3FZ5 A;  1HD2 A;  2L5O A;  3RAZ A;  4JBB A;  3F63 A;  2OKA A;  2O7K A;  3GIX A;  2K8V A;  4ZIL A;  2L4Q A;  2CZ2 A;  1VF3 A;  4ZBB A;  2ON5 A;  5ECR B;  4MJA A;  3EMP A;  2YJH A;  3ZFB A;  3QFB C;  1XWA A;  2JZS A;  4DSQ A;  5HFG A;  2DJJ A;  3GTU B;  4V1A p;  2C0G A;  4G2E A;  5GAN D;  18GS A;  2H6Y A;  4ZL9 A;  1ZZY A;  6GSW A;  1SYX A;  1PMT A;  5B8A A;  3F4T A;  1ZMA A;  3HZ4 A;  4XS6 A;  1PX6 A;  2VAF A;  3L9V A;  3US3 A;  5HFK A;  2H75 A;  2DJ1 A;  1PSQ A;  1YKA A;  3L4N A;  3HHV A;  3LOR A;  2F51 A;  3VWU A;  5DBQ A;  4ECC A;  1H75 A;  1B4P A;  3CBU A;  4K2D A;  2YOI A;  1B4Q A;  4N0V A;  3IC4 A;  3EYT A;  2TRX A;  5J41 A;  5CP1 A;  1Y25 A;  5JWO B;  4L0W A;  2HRF A;  5CRD A;  3TB2 A;  2GQM A;  2HSY A;  3IR4 A;  4Q5N A;  3GKX A;  4N30 A;  1T7P B;  3WYW A;  3D4M A;  1FHE A;  3KP8 A;  2HSH A;  2MZC A;  1W4V A;  1XW9 A;  2IN3 A;  4IKH A;  1OE7 A;  1FG4 A;  3CSJ A;  2HZE A;  5ECK B;  2IPA A;  5ID2 A;  5EY6 A;  3BCI A;  1HNC A;  4IQ1 A;  2DJK A;  3FK8 A;  1NW2 A;  1TK5 B;  3N5O A;  2J23 A;  4IQA A;  2ES7 A;  3BJ5 A;  2CVD A;  4G19 A;  4AJ6 A;  4MP4 A;  5GST A;  2OJL A;  3ZYW A;  3H4K A;  1PKW A;  2AAW A;  3KH9 A;  3UEM A;  3QDN A;  1Y6E A;  3ME8 A;  1GTA A;  4Q5F A;  4N11 A;  22GS A;  3JCM L;  1SL2 B;  3H93 A;  3CMI A;  3HJO A;  2WS2 A;  3C1R A;  1GH2 A;  3ME7 A;  5F07 A;  2OBK A;  3Q74 A;  4WEY A;  4XS4 B;  3D22 A;  4RQX A;  2KUC A;  5D9X A;  3C1S A;  2QC7 A;  3I9V 2;  2CAQ A;  4TR3 A;  4V2L A;  3EWL A;  3ED3 A;  1ZGN A;  3F9U A;  3TJB A;  2B6M A;  17GS A;  1BYE A;  3F8U A;  1GUK A;  3H79 A;  2E0Q A;  3VWX A;  5L71 A;  5D9T A;  4RI7 A;  3RHC A;  3TKS A;  4KCE A;  3VWW A;  4NHW A;  1XXU A;  3GYK A;  3AY8 A;  4OD7 A;  1IYI A;  3A2X A;  1AUC A;  4TVE A;  3QAG A;  3MDK A;  1A23 A;  4QL7 A;  2VCQ A;  1N8J A;  1JZW A;  4BVY A;  2FA4 A;  2O8V B;  1FW1 A;  4ECJ A;  4DSS A;  1ERU A;  5DDL A;  4MF7 A;  3W8J A;  1LJR A;  1FOV A;  4RUV A;  4J56 E;  2YZH A;  1TRW A;  1GNE A;  5G30 A;  2H6X A;  4KDX A;  1Z6M A;  5IMC A;  1BQ7 A;  2VUP A;  1XW5 A;  1WWJ A;  2LS5 A;  3MSZ A;  1GWC A;  5FHI A;  1DBY A;  4K0G A;  1ZOF A;  2GQK A;  2MMA A;  3KM6 A;  2CVK A;  2KP2 A;  4HU9 A;  2GZZ A;  1F9M A;  3F3Q A;  4K7O A;  3M9J A;  2B5E A;  3Q18 A;  5J4U A;  2VIM A;  4HQZ A;  1JHB A;  4MZB A;  4NMU A;  3LYK A;  5JCW A;  5D9V A;  5DVB A;  4BWS A;  1TDI A;  5G2Z A;  4KSM A;  1Z9H A;  2ALB A;  1CQG A;  2WDU A;  4FYB A;  4HOJ A;  3DVX A;  5CRW A;  1VGL A;  5D73 A;  5F0G A;  3QCP A;  4IJ3 A;  1HNB A;  1R5P A;  1PRX A;  3UVH A;  3KEB A;  4IBP A;  1M2D A;  3A3T A;  2YZU A;  3L9S A;  1O7U A;  13GS A;  4ZL7 A;  5IOX A;  4JR4 A;  1GTB A;  4K7I A;  5DJL A;  1YQ1 A;  1DE2 A;  3VPQ A;  1A24 A;  2LUS A;  1TK0 B;  4MJC A;  1XCC A;  2C0E A;  1F3B A;  4ZB6 A;  4IVF A;  4NV5 A;  2B5X A;  4TR1 A;  2EIO A;  5J5N A;  1MDI A;  4LL1 B;  2PVQ A;  4MPG A;  2H66 A;  1X9W B;  4NWY A;  2WRT A;  1M9A A;  3APQ A;  3ZVJ A;  2HXK A;  4GLT A;  2B1L A;  3KMN A;  6GSU A;  2AHE A;  1G6W A;  1X9M B;  4WET A;  3LYP A;  4MK3 A;  2OA7 A;  2YV9 A;  3GRX A;  1AQX A;  4MH3 A;  3DXB A;  1MD4 A;  3RPN A;  1WP0 A;  1JLW A;  2VM1 A;  2F8A A;  5B7C A;  3QOU A;  2WJU A;  2MYG A;  4V2N A;  1USB A;  1A8L A;  4YAP A;  1K3O A;  2LRT A;  2YV7 A;  2H1A A;  4L5O A;  1VRS D;  4P3Y B;  2VL3 A;  1MEK A;  4J57 E;  2VLU A;  4OFT A;  2R5G A;  1V98 A;  2V2G A;  2H8L A;  4KSO A;  1E6B A;  3QR6 A;  4JR6 A;  2LRN A;  3GTU A;  4MMM A;  2BJX A;  3G7J A;  5EVO A;  4HQS A;  4EUY A;  2K6V A;  3UJ1 A;  3A2W A;  4K6X A;  4YQV A;  2IFQ A;  1GP1 A;  4ZB8 A;  4WR5 A;  3WD6 A;  4POL A;  1F2E A;  1XFL A;  1EEJ A;  2L57 A;  2VD1 A;  2H76 A;  2I81 A;  1B9X C;  3HZ8 A;  4K1F A;  1ML6 A;  4ZBD A;  1XOB A;  3GH9 A;  1G7E A;  4EO3 A;  4I6X A;  5HR3 A;  1NHY A;  5INY A;  4MAB A;  5IO0 A;  4XCS A;  1XBS A;  2VCW A;  1M2A A;  4EC0 A;  2XBQ A;  5DAL B;  3F4S A;  2A2S A;  2YP6 A;  4RQR A;  2R6K A;  4MDC A;  3ZRE A;  1JFU A;  3TKQ A;  4IP6 A;  2G0F A;  3TUE A;  2M72 A;  1A2M A;  5A4V A;  4LLR A;  5CNW A;  3TRX A;  1AW9 A;  4PX1 A;  3QD9 A;  5EL8 A;  4BPY A;  1TRU A;  3L9U A;  4TXO B;  1PL1 A;  3FY7 A;  4AF2 A;  3KCM A;  2CAI A;  2KP1 A;  4WR4 A; 
#chains in the Genus database with same CATH topology
 3DML A;  3BCK A;  3IPZ A;  5DCG A;  4BVX A;  4I97 A;  3LG6 A;  4USS A;  5COH A;  4F0C A;  1M7T A;  1O8W A;  1SU9 A;  3F6D A;  5AIV A;  2C8U A;  3TRQ A;  1SJ6 A;  3ZML A;  2FY6 A;  2KHP A;  3GV1 A;  4X0X A;  3KZQ A;  4TKY A;  3EE2 A;  1THX A;  2B5Y A;  4XS4 A;  3CXG A;  4MCU A;  3M0F A;  5D9W A;  4ZL8 A;  1AQW A;  3U6V A;  3G7Y A;  2FUG 2;  2R3X A;  5DCH A;  2LRC A;  3DVW A;  4WKW A;  4MF6 A;  1ERW A;  1K0B A;  1QQ2 A;  3P90 A;  3BD2 A;  1WPI A;  1HYU A;  5ECI B;  1V57 A;  5GZZ B;  2X8H A;  3D5J A;  1GTI A;  2DLX A;  2DC5 A;  12GS A;  1PN9 A;  2LQQ A;  2CV4 A;  1PX7 A;  1Q4J A;  1VF2 A;  2N5B A;  1K0D A;  3PPU A;  2H72 A;  2V6O A;  2LEG A;  1BX9 A;  1TTZ A;  5G1L A;  1SYR A;  5IM9 A;  1EGR A;  2F3M A;  20GS A;  4Z7X A;  1SL0 B;  1THO A;  3IDV A;  2HZF A;  3WT1 A;  3TRP A;  4AGS A;  2X8G A;  1PD2 1;  2DKI A;  4KDU A;  4G0K A;  3D4T A;  1X5D A;  2MBT A;  4K7N A;  1YKC A;  1V40 A;  2OE3 A;  3IAS 2;  2OBI A;  3C8E A;  2IFQ B;  4GSN A;  3DGQ A;  1R26 A;  1F37 A;  4TR4 A;  4GXZ A;  3VLN A;  3ERW A;  3VWV A;  2HRA A;  4MPF A;  2PER A;  5CO3 A;  3IC8 A;  4ZBA A;  4ICY A;  2I9H A;  2WFC A;  3FHK A;  2N5A A;  3FR6 A;  4HDE A;  1MDK A;  1K3L A;  3CSI A;  3DIE A;  2D2Z A;  2NDO A;  3I43 A;  1YJ6 A;  2DJ3 A;  1H4O A;  4PNF A;  2BMX A;  2CA8 A;  3HY2 A;  4O5U A;  3SWL A;  3TJK A;  5IQY A;  3TKP A;  4KAE A;  4V2M A;  5A5K A;  4IW9 A;  6GSS A;  16GS A;  2H19 A;  2VCV A;  2F8F A;  2YN1 A;  2YAN A;  1SJZ A;  4NPB A;  5A4U A;  3TOT A;  5ECS A;  1FOH A;  2O89 A;  1SEN A;  3QAW A;  3L78 A;  4JE1 A;  5KN3 A;  2HI7 A;  3GNJ A;  4PUR A;  2GQL A;  4V1A g;  1URM A;  3KJY A;  3VFI A;  5G5E A;  4QQ7 A;  4KE3 A;  4YQU A;  1WE0 A;  4ULX A;  3MWH A;  4BVX B;  5IIZ A;  4CY6 A;  4I5Q A;  4X1U A;  4MF5 A;  3GX8 A;  3TJF A;  4FH8 A;  3KH7 A;  4MZC A;  2YWI A;  1YZX A;  2VD0 A;  2IJY A;  3M1G A;  1PKZ A;  3M3M A;  3P8W A;  2PGT A;  5J9B A;  4PNG A;  2CX3 A;  1TP9 A;  3LGC A;  3LW9 A;  4PGT A;  1ST9 A;  3FZ4 A;  5F8B A;  1PGT A;  4XRA A;  4F2I A;  3IK9 A;  3UIW A;  1FO5 A;  1A2J A;  2VCX A;  1TJD A;  1R4W A;  1DSB A;  3PR8 A;  5H5Q A;  4WXT A;  1BED A;  4IHU A;  2WGR A;  1F6M C;  2V6K A;  3TCO A;  5KEJ A;  2B7J A;  1XVW A;  4EE0 A;  4G10 A;  1JZR A;  2H6Z A;  1AC1 A;  4GQC A;  1SK0 A;  5ECL B;  3L0H A;  3PGT A;  1GLQ A;  1YF0 A;  3GH6 A;  1TI1 A;  3UAR A;  2CT6 A;  9GSS A;  2GST A;  4Q5Q A;  1W89 A;  2LV3 A;  4Q5R A;  1AQV A;  2HSM A;  3ERF A;  2RUF A;  5FWG A;  2FWE A;  3UAP A;  2AB6 A;  2R37 A;  4PQI A;  5DJM A;  1EEM A;  2OAC A;  2BTO T;  4HJM A;  4PUA A;  1Z7P A;  4CW9 A;  3MIX A;  4HI7 A;  3IK7 A;  1PL2 A;  4IJI A;  4DEJ A;  4FQU A;  3FZA A;  2K8S A;  4L8E A;  2X49 A;  4O7H A;  4GST A;  3UL3 A;  8GSS A;  3RBT A;  2B3S A;  1NHO A;  5DAL A;  4FIW A;  3EVI A;  3CRU A;  1XWG A;  3CSH A;  1ILO A;  4KGI A;  2XPD A;  5ELA A;  3IRA A;  3IHQ A;  4LA1 A;  2R0P A;  1T1V A;  4X4J A;  2X99 A;  1J9B A;  1X5C A;  2C3T A;  4GQF A;  2H1D A;  1EV9 A;  2RM5 A;  1F3A A;  1KTE A;  2LQO A;  1AIU A;  1K0A A;  4GWR A;  4TXO A;  2AV4 A;  2LJR A;  5J9C A;  3DD3 A;  2V1M A;  2K9F A;  2YCD A;  2RUE A;  2V41 A;  6GSY A;  5HFI A;  3UVT A;  4XS1 A;  2DKH A;  3CTF A;  1XPV A;  3EC3 A;  3HJM A;  2H30 A;  2HRK A;  1B48 A;  4K2X A;  1BJX A;  3LEF A;  3C7M A;  3Q6O A;  4RI6 A;  4POM A;  4MLY A;  1O73 A;  3IHG A;  5G5F A;  1G6Y A;  3KTL A;  1I5G A;  3E3E A;  2X64 A;  2A4H A;  3FYG A;  3IE3 A;  3VPT A;  3P7X A;  3HJP A;  5IO2 A;  5IOW A;  4N0Z A;  3UOM A;  2MMN A;  1YF1 A;  3VI5 A;  3F4R A;  3KTB A;  1WIK A;  2YWN A;  1VF1 A;  3FR9 A;  2C1Y A;  3SBC A;  4POK A;  3J7Y b;  1YY7 A;  1Z5Y E;  1MTC A;  1RW1 A;  3KP9 A;  2A4V A;  1PA3 A;  2PPT A;  4ZXG A;  3LQ7 A;  3PIN A;  1V9W A;  5LCZ A;  5DQS A;  5GAP D;  5DAK B;  1YEP A;  2I4A A;  4Z2U A;  1GLP A;  1GL8 A;  2H74 A;  5HR0 A;  3I6A A;  1OAZ A;  2LJA A;  1ABA A;  1JZO A;  4PQH A;  3VUR A;  3ZZX A;  2F9S A;  4JRR A;  5J3R A;  3EPT A;  4F82 A;  4KUN A;  4MH2 A;  2O87 A;  1S3A A;  4HEA 2;  4NHZ A;  1QXH A;  4G0I A;  2VM2 A;  1TRV A;  4MA9 A;  3EUR A;  2JL4 A;  2A2R A;  1SKW B;  4K5R A;  4E8H A;  1Z7R A;  1O85 A;  3HA9 A;  2YPM A;  2XPE A;  3RPP A;  2KLX A;  1TU8 A;  3LFL A;  4F03 A;  4KDY A;  4OFN A;  3D21 A;  4X43 A;  5B8B A;  4BWQ A;  3FEU A;  3H8Q A;  2E2G A;  2YNX A;  6GST A;  4LL4 B;  4TR0 A;  1NSW A;  1IYH A;  1KBN A;  5IMF A;  2R2J A;  2VL2 A;  3ISO A;  4ECB A;  2C3N A;  2C0D A;  2GTU A;  3QFA C;  4FO5 A;  3KIJ A;  3IA1 A;  3HYP A;  3V1W A;  2P5Q A;  5F05 A;  5JWQ B;  2IWT A;  2FCH A;  2LTK A;  2VLT A;  2HFD A;  5FT3 A;  1UA5 A;  11GS A;  3ZLP A;  4CHS A;  3HVV A;  1KEB A;  4TOP A;  1OKD A;  1EOG A;  3WGD A;  1TU7 A;  3J7Y k;  3DEX A;  3S9F A;  6GSV A;  4TN8 A;  4JU5 A;  3ZMK A;  1J08 A;  1XG8 A;  2RII A;  4ML6 A;  3F3R A;  3GL5 A;  1G7O A;  2CX4 A;  5CRG A;  3F6F A;  2L6C A;  2GZY A;  4O5R A;  3EMX A;  5IPG A;  5E4W A;  2GT6 A;  4K8M A;  2GSR A;  1GRX A;  5H5S A;  2R0C A;  1X9S B;  1EV4 A;  3EIN A;  3F0I A;  3WT2 A;  5ECM B;  1O81 A;  4HS1 A;  1QGV A;  4ISD A;  2E7P A;  1XWK A;  3HVN A;  4FYC A;  3G7I A;  1EP8 A;  2LKU A;  2GVP A;  1LBK A;  4PQ1 A;  2L4C A;  4TRX A;  2IMI A;  5KOX A;  4I2U A;  3E0U A;  2C4J A;  2HRN A;  3UBK A;  2PU9 C;  4KB3 A;  4G9H A;  4OMV A;  1GUH A;  3GHA A;  2A2P A;  2REM A;  4PTS A;  5JWR B;  4EVM A;  1GSS A;  2H70 A;  2WCI A;  1C72 A;  1U3A A;  5AIX A;  4KA0 A;  2L5L A;  1UC7 A;  2L6D A;  3VK9 A;  2JAD A;  4L0U A;  1GUL A;  2LNT A;  3GUS A;  3O6T A;  4E8E A;  2FWF A;  2OE0 A;  4WF4 A;  3FZ9 A;  3DYR A;  2I3Y A;  2B7K A;  2YWM A;  1GSF A;  1QK8 A;  3R2Q A;  3GFK A;  3FRC A;  2WUL A;  1KNG A;  3MAK A;  1RK4 A;  4EDZ A;  2V32 A;  2VO4 A;  1B9Y C;  2GZP A;  1EZK A;  19GS A;  1YDK A;  4DSR A;  3DKS A;  1O8X A;  4IP1 A;  2DSA A;  3PH9 A;  3FW2 A;  2GDR A;  3WGE A;  3CYN A;  4G0L A;  5HQP A;  3BBY A;  4AJ8 A;  4KH7 A;  1RQM A;  1OVN A;  2AYT A;  2G2Q A;  4KCA A;  2VCZ A;  5IMD A;  3GN3 A;  1TW9 A;  5JCU A;  4LMW A;  5ELG A;  4GCI A;  5HR1 A;  3ERG A;  4QL9 A;  5F06 A;  2FHE A;  1FVJ A;  2ZUP A;  1I9D A;  1HNA A;  1JZD A;  2MMZ A;  3R3E A;  1J0F A;  4OWY A;  1GTU A;  2NPB A;  1CQH A;  1OYJ A;  4POB A;  3BOA A;  5AGY A;  2TRC P;  2GSQ A;  5IMZ A;  5AN1 A;  1T8E B;  1K0N A;  4IEL A;  4JZQ A;  4MJE A;  3IXR A;  3TOU A;  5CRH A;  3N9J A;  2GGT A;  2I1U A;  2QA1 A;  3HKR A;  4YAV A;  2ZNM A;  1VF4 A;  1OC9 B;  5HR2 A;  1Z6N A;  3LJR A;  1R5A A;  2WZ9 A;  4OO5 A;  2JAC A;  3LXZ A;  3WGX A;  3D6I A;  2LNS A;  3M9K A;  5H5R A;  2WB9 A;  5ENU A;  2HE3 A;  2M46 A;  1ZCP A;  1Z3E A;  4OFM A;  1G0T A;  1X0R A;  1QUW A;  1BAY A;  1M3J A;  4TW5 A;  1OE8 A;  4K9Z A;  4XTS A;  1ZL9 A;  2OAD A;  4J2F A;  2O85 A;  2UZ8 A;  5DAK A;  1K3Y A;  2JSY A;  5CAX A;  4L5L A;  4OO4 A;  3QAV A;  1T3B A;  1U6T A;  3GA4 A;  2AUV A;  3HDC A;  3DWV A;  5BRT A;  4ID0 A;  1TI3 A;  3QPM A;  1ZYQ B;  2VLV A;  2K18 A;  3KGK A;  1U88 A;  1NM3 A;  4AJ7 A;  4GSS A;  3HCZ A;  4BA7 A;  1QMV A;  2GT5 A;  2LST A;  4PXO A;  1A0F A;  1A8Y A;  1UN2 A;  2M80 A;  1GSQ A;  3LWA A;  1SKS B;  1M99 A;  2H1B A;  4YQM A;  1A2L A;  1TRS A;  1FVK A;  3I69 A;  4KF9 A;  3EU4 A;  4MZW A;  2IME A;  2OE1 A;  1EOH A;  2MMO A;  1FB6 A;  5IPH A;  1XOA A;  1SKR B;  2FWH A;  1V2A A;  2YJ7 A;  5ECQ B;  4D73 B;  2H0I A;  3M8N A;  1XZO A;  2DJ2 A;  1R7H A;  2HLS A;  3D0Z A;  3LSZ A;  10GS A;  3FKF A;  5C04 A;  2C80 A;  3APO A;  2KOK A;  3HXS A;  1X5E A;  2HNL A;  2XHF A;  1MD3 A;  4NXI A;  3IAM 2;  4HUA A;  5CRE A;  1AXD A;  2E2M A;  1EP7 A;  3C73 A;  2DIY A;  4GTU A;  3APS A;  3ZL5 A;  4DVC A;  1EGO A;  3ZIV A;  5IMA A;  3TKR A;  4I2T A;  6GSX A;  5B6M A;  4ILF A;  1Q98 A;  4WF5 A;  3HD5 A;  3O3T A;  4MJB A;  3DRN A;  3VI7 A;  2IL3 A;  1SK1 A;  2C0F A;  4HZ2 A;  4HU7 A;  3C71 A;  3KMO A;  3G9B A;  2ON7 A;  1ERV A;  2PVO C;  1TKD B;  1SD8 A;  2H73 A;  4FYU A;  3ZVJ D;  1HQO A;  2R4V A;  1M0U A;  2VCT A;  1GSE A;  3UBL A;  1PQN A;  1GSD A;  1OC8 A;  4HSC X;  4I8B A;  5CYY A;  3GST A;  2LJK A;  1K0O A;  3MYD A;  2N5F A;  4LMV A;  2DIZ A;  2NVL A;  1XWB A;  1ZYN A;  4EKZ A;  3EU3 A;  1ACV A;  4PUF C;  1SD9 A;  2RM6 A;  4XIH A;  4KX4 A;  1YEX A;  4OCF A;  3TDG A;  1XWC A;  4ZIJ A;  1ZYP A;  4EF0 A;  5E59 A;  1WRY A;  2PN8 A;  4O32 A;  3CTG A;  1U87 A;  2X4A A;  5GSS A;  2DBC A;  5ECP B;  2CZ3 A;  1ON4 A;  3GX0 A;  2HT9 A;  2HZE B;  3TKS C;  3Q19 A;  1AAZ A;  5ID2 B;  4A5P A;  3ZRD A;  1A0R P;  1GSU A;  5KN1 A;  2P31 A;  4IS0 A;  1B8X A;  3HVS A;  1ZYE A;  3FR3 A;  2AJQ B;  2CQ9 A;  2TIR A;  5ECN B;  2JU5 A;  1GSY A;  4WBR D;  2VL9 A;  2EIQ A;  2RLI A;  5BMU A;  4TXV A;  2J9H A;  3KXO A;  2CVB A;  5D96 A;  1SL1 B;  1E2Y A;  2DML A;  1K0C A;  1XVQ A;  3NIV A;  3GKM A;  3U5R E;  7GSS A;  3A5W A;  1MDJ A;  1LU4 A;  3W8S A;  1WJK A;  1OC3 A;  3OR5 A;  4KW6 A;  4Z2R A;  1XIY A;  4KND A;  1SK2 A;  14GS A;  1U3I A;  3IBH A;  5KN2 A;  1UVZ A;  2XBI A;  1O6J A;  1S3C A;  2FWG A;  2H0H A;  3NZN A;  1T4Y A;  4ZB9 A;  2JZR A;  2GS3 A;  3IOS A;  4CDO A;  5G31 A;  2C3Q A;  3ZIJ A;  4IGJ A;  4NAX A;  1WMJ A;  1GUM A;  4OCE A;  4GF0 A;  2PUK C;  4N10 A;  4XRD A;  3O76 A;  2IIY A;  4YH2 A;  3GUR A;  2PMT A;  3MNG A;  3LXT A;  1WOU A;  5ABR A;  4BVY B;  1XW6 A;  4HZ4 A;  2FNO A;  1FAA A;  2GSS A;  4EIP A;  2FD3 A;  4DSS B;  4CY8 A;  2X8C A;  4IN0 A;  2H01 A;  4EIQ A;  2QGV A;  2EIR A;  4YKG A;  4BIK A;  2DMM A;  2Z9S A;  3CRT A;  2PBJ A;  4O92 A;  3GMF A;  2XC2 A;  1OC9 A;  5AIS A;  4GRF A;  3ZFL A;  5KN0 A;  4EXJ A;  2JZT A;  2P5R A;  2DJ0 A;  1ERT A;  3IV4 A;  4K0N A;  2VOC A;  1JLV A;  4XHM A;  4EL1 A;  2GLR A;  1TK8 B;  3TJJ A;  2JSZ A;  3ZIT A;  2FGX A;  3HVX A;  1TXX A;  4BL7 A;  1EWX A;  2H71 A;  5G1K A;  4EDY A;  1FB0 A;  1K0M A;  1S3D A;  2NTO A;  5D93 A;  5EPF A;  2H0G A;  1SJI A;  5A4W A;  1T4Z A;  3NOF A;  2B1K A;  3E9J B;  2IMD A;  2EC4 A;  5D8I A;  4HJ2 A;  1M9B A;  4ECI A;  3A2V A;  2MBS A;  3KD0 A;  3GKK A;  3GKN A;  1OKT A;  2QKE A;  2NBS A;  4NV2 A;  1M2B A;  2P0G A;  1TOF A;  5C00 A;  3P2A A;  1GNW A;  4JED A;  1DUG A;  1V58 A;  1DE1 A;  5LNK e;  1N2A A;  3UMA A;  5LD0 A;  3TKS E;  5DQY A;  2PWJ A;  2FLS A;  2FA8 A;  3GSS A;  3ZTL A;  5JCG A;  1QFN A;  4TR1 B;  1T00 A;  3RHB A;  2H1G A;  2IMF A;  4K5S A;  5B6N A;  3GL3 A;  4WBJ A;  2YWO A;  3W6G A;  5IMV A;  4D73 A;  5ECH B;  5ECO B;  4ML1 A;  2QSI A;  2ZCT A;  1BG5 A;  4O5Q A;  3K8N A;  3A5I A;  3TGZ A;  2L59 A;  3H1N A;  3TJG A;  4H86 A;  4ACS A;  3QMX A;  2VL2 C;  4F0B A;  2IMK A;  4F9Z A;  2HYX A;  3RDW A;  3FZ5 A;  1HD2 A;  2L5O A;  3RAZ A;  4JBB A;  3F63 A;  2OKA A;  2O7K A;  3GIX A;  2K8V A;  4ZIL A;  2L4Q A;  2CZ2 A;  1VF3 A;  4ZBB A;  2ON5 A;  5ECR B;  4MJA A;  3EMP A;  2YJH A;  3ZFB A;  3QFB C;  1XWA A;  2JZS A;  4DSQ A;  5HFG A;  2R0G A;  2DJJ A;  3GTU B;  4V1A p;  2C0G A;  4G2E A;  5GAN D;  18GS A;  2H6Y A;  4ZL9 A;  1ZZY A;  6GSW A;  1SYX A;  1PMT A;  5B8A A;  3F4T A;  1ZMA A;  3HZ4 A;  4XS6 A;  1PX6 A;  2VAF A;  3L9V A;  3US3 A;  5HFK A;  2H75 A;  2DJ1 A;  1PSQ A;  1YKA A;  3L4N A;  3HHV A;  3LOR A;  2F51 A;  3VWU A;  5DBQ A;  4ECC A;  1H75 A;  1B4P A;  3CBU A;  4K2D A;  2YOI A;  1B4Q A;  4N0V A;  3IC4 A;  3EYT A;  2TRX A;  5J41 A;  5CP1 A;  1Y25 A;  5JWO B;  4L0W A;  2HRF A;  5CRD A;  3TB2 A;  2GQM A;  2HSY A;  3IR4 A;  4Q5N A;  3GKX A;  4N30 A;  1T7P B;  3WYW A;  3D4M A;  1FHE A;  1PFO A;  3KP8 A;  2HSH A;  2MZC A;  1W4V A;  1XW9 A;  4BL7 B;  2IN3 A;  4IKH A;  1OE7 A;  1FG4 A;  3CSJ A;  2HZE A;  5ECK B;  2IPA A;  5ID2 A;  5EY6 A;  3BCI A;  1HNC A;  4IQ1 A;  2DJK A;  3FK8 A;  1NW2 A;  1TK5 B;  3N5O A;  2J23 A;  4IQA A;  2ES7 A;  3BJ5 A;  2CVD A;  4G19 A;  4AJ6 A;  4MP4 A;  5GST A;  2OJL A;  3ZYW A;  3H4K A;  1PKW A;  2AAW A;  3KH9 A;  3UEM A;  3QDN A;  1Y6E A;  3ME8 A;  1GTA A;  4Q5F A;  4N11 A;  22GS A;  3JCM L;  1SL2 B;  3H93 A;  3CMI A;  3HJO A;  2WS2 A;  3C1R A;  1GH2 A;  3ME7 A;  5F07 A;  2OBK A;  3Q74 A;  4WEY A;  4XS4 B;  3D22 A;  4RQX A;  2KUC A;  5D9X A;  3C1S A;  2QC7 A;  3I9V 2;  2CAQ A;  4TR3 A;  4V2L A;  3EWL A;  3ED3 A;  1ZGN A;  3F9U A;  3TJB A;  2B6M A;  17GS A;  1BYE A;  3F8U A;  1GUK A;  3H79 A;  2E0Q A;  3VWX A;  5L71 A;  5D9T A;  4RI7 A;  1S3R A;  3RHC A;  3TKS A;  4KCE A;  3VWW A;  4NHW A;  1XXU A;  3GYK A;  4Z2T A;  3AY8 A;  4OD7 A;  1IYI A;  3A2X A;  3FMW A;  1AUC A;  4TVE A;  3QAG A;  3MDK A;  1A23 A;  4QL7 A;  2VCQ A;  1N8J A;  1JZW A;  4BVY A;  2FA4 A;  2O8V B;  1FW1 A;  4ECJ A;  4DSS A;  1ERU A;  5DDL A;  4MF7 A;  3W8J A;  1LJR A;  1FOV A;  4RUV A;  4J56 E;  2YZH A;  1TRW A;  1GNE A;  5G30 A;  2H6X A;  4KDX A;  1Z6M A;  5IMC A;  1BQ7 A;  2VUP A;  1XW5 A;  1WWJ A;  2LS5 A;  3MSZ A;  1GWC A;  5FHI A;  1DBY A;  4K0G A;  1ZOF A;  2GQK A;  2MMA A;  3KM6 A;  2CVK A;  2KP2 A;  4HU9 A;  2GZZ A;  1F9M A;  3F3Q A;  4K7O A;  3M9J A;  2B5E A;  3Q18 A;  5J4U A;  2VIM A;  4HQZ A;  1JHB A;  4MZB A;  4NMU A;  3LYK A;  5JCW A;  5D9V A;  5DVB A;  4BWS A;  1TDI A;  5G2Z A;  4KSM A;  1Z9H A;  2ALB A;  1CQG A;  2WDU A;  4FYB A;  4HOJ A;  3DVX A;  5CRW A;  1VGL A;  5D73 A;  5F0G A;  3QCP A;  4IJ3 A;  1HNB A;  1R5P A;  1PRX A;  3UVH A;  3KEB A;  4IBP A;  1M2D A;  3A3T A;  2YZU A;  3L9S A;  1O7U A;  13GS A;  4ZL7 A;  5IOX A;  4JR4 A;  1GTB A;  4K7I A;  5DJL A;  1YQ1 A;  1DE2 A;  3VPQ A;  3CQF A;  1A24 A;  2LUS A;  1TK0 B;  4MJC A;  1XCC A;  2C0E A;  1F3B A;  4ZB6 A;  4IVF A;  4NV5 A;  2B5X A;  4TR1 A;  2EIO A;  5J5N A;  1MDI A;  4LL1 B;  2PVQ A;  4MPG A;  2H66 A;  1X9W B;  4NWY A;  2WRT A;  1M9A A;  3APQ A;  3ZVJ A;  2HXK A;  4GLT A;  2B1L A;  3KMN A;  6GSU A;  2AHE A;  1G6W A;  1X9M B;  4WET A;  3LYP A;  4MK3 A;  2OA7 A;  2YV9 A;  3GRX A;  1AQX A;  4MH3 A;  3DXB A;  1MD4 A;  3RPN A;  1PN0 A;  1WP0 A;  1JLW A;  2VM1 A;  2F8A A;  5B7C A;  5KOW A;  4YKF A;  3QOU A;  2WJU A;  2MYG A;  4V2N A;  1USB A;  1A8L A;  4YAP A;  1K3O A;  2LRT A;  2YV7 A;  2H1A A;  4L5O A;  1VRS D;  4P3Y B;  1M3I A;  2VL3 A;  1MEK A;  4J57 E;  2VLU A;  4OFT A;  2R5G A;  1V98 A;  2V2G A;  2H8L A;  4KSO A;  1E6B A;  3QR6 A;  4JR6 A;  2LRN A;  3GTU A;  4MMM A;  2BJX A;  3G7J A;  5EVO A;  4HQS A;  4EUY A;  2K6V A;  3UJ1 A;  3A2W A;  4K6X A;  4YQV A;  2IFQ A;  1GP1 A;  4ZB8 A;  4MNN A;  4WR5 A;  3WD6 A;  2QA2 A;  1F2E A;  4POL A;  1XFL A;  1EEJ A;  2L57 A;  2VD1 A;  2H76 A;  2I81 A;  1B9X C;  3HZ8 A;  4K1F A;  1ML6 A;  4ZBD A;  1XOB A;  3GH9 A;  1G7E A;  4EO3 A;  4I6X A;  5HR3 A;  1NHY A;  5INY A;  4MAB A;  5IO0 A;  4XCS A;  1XBS A;  2VCW A;  1M2A A;  4EC0 A;  2XBQ A;  5DAL B;  3F4S A;  2A2S A;  2YP6 A;  4RQR A;  2R6K A;  4MDC A;  3ZRE A;  1JFU A;  3TKQ A;  4IP6 A;  2G0F A;  3TUE A;  2M72 A;  1A2M A;  5A4V A;  4LLR A;  5CNW A;  3TRX A;  1AW9 A;  4PX1 A;  3QD9 A;  5EL8 A;  4BPY A;  1TRU A;  3L9U A;  4TXO B;  1PL1 A;  3FY7 A;  4AF2 A;  3KCM A;  2CAI A;  2KP1 A;  4WR4 A; 
#chains in the Genus database with same CATH homology
 3DML A;  3BCK A;  3IPZ A;  5DCG A;  4BVX A;  4I97 A;  3LG6 A;  4USS A;  5COH A;  4F0C A;  1M7T A;  1O8W A;  1SU9 A;  3F6D A;  5AIV A;  2C8U A;  3TRQ A;  1SJ6 A;  3ZML A;  2FY6 A;  2KHP A;  3GV1 A;  4X0X A;  3KZQ A;  4TKY A;  3EE2 A;  1THX A;  2B5Y A;  4XS4 A;  3CXG A;  4MCU A;  3M0F A;  5D9W A;  4ZL8 A;  1AQW A;  3U6V A;  3G7Y A;  2FUG 2;  2R3X A;  5DCH A;  2LRC A;  3DVW A;  4WKW A;  4MF6 A;  1ERW A;  1K0B A;  1QQ2 A;  3P90 A;  3BD2 A;  1WPI A;  1HYU A;  5ECI B;  1V57 A;  5GZZ B;  2X8H A;  3D5J A;  1GTI A;  2DLX A;  2DC5 A;  12GS A;  1PN9 A;  2LQQ A;  2CV4 A;  1PX7 A;  1Q4J A;  1VF2 A;  2N5B A;  1K0D A;  3PPU A;  2H72 A;  2V6O A;  2LEG A;  1BX9 A;  1TTZ A;  5G1L A;  1SYR A;  5IM9 A;  1EGR A;  2F3M A;  20GS A;  4Z7X A;  1SL0 B;  1THO A;  3IDV A;  2HZF A;  3WT1 A;  3TRP A;  4AGS A;  2X8G A;  1PD2 1;  2DKI A;  4KDU A;  4G0K A;  3D4T A;  1X5D A;  2MBT A;  4K7N A;  1YKC A;  1V40 A;  2OE3 A;  3IAS 2;  2OBI A;  3C8E A;  2IFQ B;  4GSN A;  3DGQ A;  1R26 A;  1F37 A;  4TR4 A;  4GXZ A;  3VLN A;  3ERW A;  3VWV A;  2HRA A;  4MPF A;  2PER A;  5CO3 A;  3IC8 A;  4ZBA A;  4ICY A;  2I9H A;  2WFC A;  3FHK A;  2N5A A;  3FR6 A;  4HDE A;  1MDK A;  1K3L A;  3CSI A;  3DIE A;  2D2Z A;  2NDO A;  3I43 A;  1YJ6 A;  2DJ3 A;  1H4O A;  4PNF A;  2BMX A;  2CA8 A;  3HY2 A;  4O5U A;  3SWL A;  3TJK A;  5IQY A;  3TKP A;  4KAE A;  4V2M A;  5A5K A;  4IW9 A;  6GSS A;  16GS A;  2H19 A;  2VCV A;  2F8F A;  2YN1 A;  2YAN A;  1SJZ A;  4NPB A;  5A4U A;  3TOT A;  5ECS A;  1FOH A;  2O89 A;  1SEN A;  3QAW A;  3L78 A;  4JE1 A;  5KN3 A;  2HI7 A;  3GNJ A;  4PUR A;  2GQL A;  4V1A g;  1URM A;  3KJY A;  3VFI A;  5G5E A;  4QQ7 A;  4KE3 A;  4YQU A;  1WE0 A;  4ULX A;  3MWH A;  4BVX B;  5IIZ A;  4CY6 A;  4I5Q A;  4X1U A;  4MF5 A;  3GX8 A;  3TJF A;  4FH8 A;  3KH7 A;  4MZC A;  2YWI A;  1YZX A;  2VD0 A;  2IJY A;  3M1G A;  1PKZ A;  3M3M A;  3P8W A;  2PGT A;  5J9B A;  4PNG A;  2CX3 A;  1TP9 A;  3LGC A;  3LW9 A;  4PGT A;  1ST9 A;  3FZ4 A;  5F8B A;  1PGT A;  4XRA A;  4F2I A;  3IK9 A;  3UIW A;  1FO5 A;  1A2J A;  2VCX A;  1TJD A;  1R4W A;  1DSB A;  3PR8 A;  5H5Q A;  4WXT A;  1BED A;  4IHU A;  2WGR A;  1F6M C;  2V6K A;  3TCO A;  5KEJ A;  2B7J A;  1XVW A;  4EE0 A;  4G10 A;  1JZR A;  2H6Z A;  1AC1 A;  4GQC A;  1SK0 A;  5ECL B;  3L0H A;  3PGT A;  1GLQ A;  1YF0 A;  3GH6 A;  1TI1 A;  3UAR A;  2CT6 A;  9GSS A;  2GST A;  4Q5Q A;  1W89 A;  2LV3 A;  4Q5R A;  1AQV A;  2HSM A;  3ERF A;  2RUF A;  5FWG A;  2FWE A;  3UAP A;  2AB6 A;  2R37 A;  4PQI A;  5DJM A;  1EEM A;  2OAC A;  2BTO T;  4HJM A;  4PUA A;  1Z7P A;  4CW9 A;  3MIX A;  4HI7 A;  3IK7 A;  1PL2 A;  4IJI A;  4DEJ A;  4FQU A;  3FZA A;  2K8S A;  4L8E A;  2X49 A;  4O7H A;  4GST A;  3UL3 A;  8GSS A;  3RBT A;  2B3S A;  1NHO A;  5DAL A;  4FIW A;  3EVI A;  3CRU A;  1XWG A;  3CSH A;  1ILO A;  4KGI A;  2XPD A;  5ELA A;  3IRA A;  3IHQ A;  4LA1 A;  2R0P A;  1T1V A;  4X4J A;  2X99 A;  1J9B A;  1X5C A;  2C3T A;  4GQF A;  2H1D A;  1EV9 A;  2RM5 A;  1F3A A;  1KTE A;  2LQO A;  1AIU A;  1K0A A;  4GWR A;  4TXO A;  2AV4 A;  2LJR A;  5J9C A;  3DD3 A;  2V1M A;  2K9F A;  2YCD A;  2RUE A;  2V41 A;  6GSY A;  5HFI A;  3UVT A;  4XS1 A;  2DKH A;  3CTF A;  1XPV A;  3EC3 A;  3HJM A;  2H30 A;  2HRK A;  1B48 A;  4K2X A;  1BJX A;  3LEF A;  3C7M A;  3Q6O A;  4RI6 A;  4POM A;  4MLY A;  1O73 A;  3IHG A;  5G5F A;  1G6Y A;  3KTL A;  1I5G A;  3E3E A;  2X64 A;  2A4H A;  3FYG A;  3IE3 A;  3VPT A;  3P7X A;  3HJP A;  5IO2 A;  5IOW A;  4N0Z A;  3UOM A;  2MMN A;  1YF1 A;  3VI5 A;  3F4R A;  3KTB A;  1WIK A;  2YWN A;  1VF1 A;  3FR9 A;  2C1Y A;  3SBC A;  4POK A;  3J7Y b;  1YY7 A;  1Z5Y E;  1MTC A;  1RW1 A;  3KP9 A;  2A4V A;  1PA3 A;  2PPT A;  4ZXG A;  3LQ7 A;  3PIN A;  1V9W A;  5LCZ A;  5DQS A;  5GAP D;  5DAK B;  1YEP A;  2I4A A;  4Z2U A;  1GLP A;  1GL8 A;  2H74 A;  5HR0 A;  3I6A A;  1OAZ A;  2LJA A;  1ABA A;  1JZO A;  4PQH A;  3VUR A;  3ZZX A;  2F9S A;  4JRR A;  5J3R A;  3EPT A;  4F82 A;  4KUN A;  4MH2 A;  2O87 A;  1S3A A;  4HEA 2;  4NHZ A;  1QXH A;  4G0I A;  2VM2 A;  1TRV A;  4MA9 A;  3EUR A;  2JL4 A;  2A2R A;  1SKW B;  4K5R A;  4E8H A;  1Z7R A;  1O85 A;  3HA9 A;  2YPM A;  2XPE A;  3RPP A;  2KLX A;  1TU8 A;  3LFL A;  4F03 A;  4KDY A;  4OFN A;  3D21 A;  4X43 A;  5B8B A;  4BWQ A;  3FEU A;  3H8Q A;  2E2G A;  2YNX A;  6GST A;  4LL4 B;  4TR0 A;  1NSW A;  1IYH A;  1KBN A;  5IMF A;  2R2J A;  2VL2 A;  3ISO A;  4ECB A;  2C3N A;  2C0D A;  2GTU A;  3QFA C;  4FO5 A;  3KIJ A;  3IA1 A;  3HYP A;  3V1W A;  2P5Q A;  5F05 A;  5JWQ B;  2IWT A;  2FCH A;  2LTK A;  2VLT A;  2HFD A;  5FT3 A;  1UA5 A;  11GS A;  3ZLP A;  4CHS A;  3HVV A;  1KEB A;  4TOP A;  1OKD A;  1EOG A;  3WGD A;  1TU7 A;  3J7Y k;  3DEX A;  3S9F A;  6GSV A;  4TN8 A;  4JU5 A;  3ZMK A;  1J08 A;  2RII A;  4ML6 A;  3F3R A;  3GL5 A;  1G7O A;  2CX4 A;  5CRG A;  3F6F A;  2L6C A;  2GZY A;  4O5R A;  3EMX A;  5IPG A;  5E4W A;  2GT6 A;  4K8M A;  2GSR A;  1GRX A;  5H5S A;  2R0C A;  1X9S B;  1EV4 A;  3EIN A;  3F0I A;  3WT2 A;  5ECM B;  1O81 A;  4HS1 A;  1QGV A;  4ISD A;  2E7P A;  1XWK A;  4FYC A;  3G7I A;  1EP8 A;  2LKU A;  2GVP A;  1LBK A;  4PQ1 A;  2L4C A;  4TRX A;  2IMI A;  5KOX A;  4I2U A;  3E0U A;  2C4J A;  2HRN A;  3UBK A;  2PU9 C;  4KB3 A;  4G9H A;  4OMV A;  1GUH A;  3GHA A;  2A2P A;  2REM A;  4PTS A;  5JWR B;  4EVM A;  1GSS A;  2H70 A;  2WCI A;  1C72 A;  1U3A A;  5AIX A;  4KA0 A;  2L5L A;  1UC7 A;  2L6D A;  3VK9 A;  2JAD A;  4L0U A;  1GUL A;  2LNT A;  3GUS A;  3O6T A;  4E8E A;  2FWF A;  2OE0 A;  4WF4 A;  3FZ9 A;  3DYR A;  2I3Y A;  2B7K A;  2YWM A;  1GSF A;  1QK8 A;  3R2Q A;  3GFK A;  3FRC A;  2WUL A;  1KNG A;  3MAK A;  1RK4 A;  4EDZ A;  2V32 A;  2VO4 A;  1B9Y C;  2GZP A;  1EZK A;  19GS A;  1YDK A;  4DSR A;  3DKS A;  1O8X A;  4IP1 A;  2DSA A;  3PH9 A;  3FW2 A;  2GDR A;  3WGE A;  3CYN A;  4G0L A;  5HQP A;  3BBY A;  4AJ8 A;  4KH7 A;  1RQM A;  1OVN A;  2AYT A;  2G2Q A;  4KCA A;  2VCZ A;  5IMD A;  3GN3 A;  1TW9 A;  5JCU A;  4LMW A;  5ELG A;  4GCI A;  5HR1 A;  3ERG A;  4QL9 A;  5F06 A;  2FHE A;  1FVJ A;  2ZUP A;  1I9D A;  1HNA A;  1JZD A;  2MMZ A;  3R3E A;  1J0F A;  4OWY A;  1GTU A;  2NPB A;  1CQH A;  1OYJ A;  4POB A;  3BOA A;  5AGY A;  2TRC P;  2GSQ A;  5IMZ A;  5AN1 A;  1T8E B;  1K0N A;  4IEL A;  4JZQ A;  4MJE A;  3IXR A;  3TOU A;  5CRH A;  3N9J A;  2GGT A;  2I1U A;  2QA1 A;  3HKR A;  4YAV A;  2ZNM A;  1VF4 A;  1OC9 B;  5HR2 A;  1Z6N A;  3LJR A;  1R5A A;  2WZ9 A;  4OO5 A;  2JAC A;  3LXZ A;  3WGX A;  3D6I A;  2LNS A;  3M9K A;  5H5R A;  2WB9 A;  5ENU A;  2HE3 A;  2M46 A;  1ZCP A;  1Z3E A;  4OFM A;  1G0T A;  1X0R A;  1QUW A;  1BAY A;  4TW5 A;  1OE8 A;  4K9Z A;  4XTS A;  1ZL9 A;  2OAD A;  4J2F A;  2O85 A;  2UZ8 A;  5DAK A;  1K3Y A;  2JSY A;  5CAX A;  4L5L A;  4OO4 A;  3QAV A;  1T3B A;  1U6T A;  3GA4 A;  2AUV A;  3HDC A;  3DWV A;  5BRT A;  4ID0 A;  1TI3 A;  3QPM A;  1ZYQ B;  2VLV A;  2K18 A;  3KGK A;  1U88 A;  1NM3 A;  4AJ7 A;  4GSS A;  3HCZ A;  4BA7 A;  1QMV A;  2GT5 A;  2LST A;  4PXO A;  1A0F A;  1A8Y A;  1UN2 A;  2M80 A;  1GSQ A;  3LWA A;  1SKS B;  1M99 A;  2H1B A;  4YQM A;  1A2L A;  1TRS A;  1FVK A;  3I69 A;  4KF9 A;  3EU4 A;  4MZW A;  2IME A;  2OE1 A;  1EOH A;  2MMO A;  1FB6 A;  5IPH A;  1XOA A;  1SKR B;  2FWH A;  1V2A A;  2YJ7 A;  5ECQ B;  4D73 B;  2H0I A;  3M8N A;  1XZO A;  2DJ2 A;  1R7H A;  2HLS A;  3D0Z A;  3LSZ A;  10GS A;  3FKF A;  5C04 A;  2C80 A;  3APO A;  2KOK A;  3HXS A;  1X5E A;  2HNL A;  2XHF A;  1MD3 A;  4NXI A;  3IAM 2;  4HUA A;  5CRE A;  1AXD A;  2E2M A;  1EP7 A;  3C73 A;  2DIY A;  4GTU A;  3APS A;  3ZL5 A;  4DVC A;  1EGO A;  3ZIV A;  5IMA A;  3TKR A;  4I2T A;  6GSX A;  5B6M A;  4ILF A;  1Q98 A;  4WF5 A;  3HD5 A;  3O3T A;  4MJB A;  3DRN A;  3VI7 A;  2IL3 A;  1SK1 A;  2C0F A;  4HU7 A;  4HZ2 A;  3C71 A;  3KMO A;  3G9B A;  2ON7 A;  1ERV A;  2PVO C;  1TKD B;  1SD8 A;  2H73 A;  4FYU A;  3ZVJ D;  1HQO A;  2R4V A;  1M0U A;  2VCT A;  1GSE A;  3UBL A;  1PQN A;  1GSD A;  1OC8 A;  4I8B A;  5CYY A;  3GST A;  2LJK A;  1K0O A;  3MYD A;  2N5F A;  4LMV A;  2DIZ A;  2NVL A;  1XWB A;  1ZYN A;  4EKZ A;  3EU3 A;  1ACV A;  4PUF C;  1SD9 A;  2RM6 A;  4XIH A;  4KX4 A;  1YEX A;  4OCF A;  3TDG A;  1XWC A;  4ZIJ A;  1ZYP A;  4EF0 A;  5E59 A;  1WRY A;  2PN8 A;  4O32 A;  3CTG A;  1U87 A;  2X4A A;  5GSS A;  2DBC A;  5ECP B;  2CZ3 A;  1ON4 A;  3GX0 A;  2HT9 A;  2HZE B;  3TKS C;  3Q19 A;  1AAZ A;  5ID2 B;  4A5P A;  3ZRD A;  1A0R P;  1GSU A;  5KN1 A;  2P31 A;  4IS0 A;  1B8X A;  3HVS A;  1ZYE A;  3FR3 A;  2AJQ B;  2CQ9 A;  2TIR A;  5ECN B;  2JU5 A;  1GSY A;  4WBR D;  2VL9 A;  2EIQ A;  2RLI A;  5BMU A;  4TXV A;  2J9H A;  3KXO A;  2CVB A;  5D96 A;  1SL1 B;  1E2Y A;  2DML A;  1K0C A;  1XVQ A;  3NIV A;  3GKM A;  3U5R E;  7GSS A;  3A5W A;  1MDJ A;  1LU4 A;  3W8S A;  1WJK A;  1OC3 A;  3OR5 A;  4KW6 A;  4Z2R A;  1XIY A;  4KND A;  1SK2 A;  14GS A;  1U3I A;  3IBH A;  5KN2 A;  1UVZ A;  2XBI A;  1O6J A;  1S3C A;  2FWG A;  2H0H A;  3NZN A;  1T4Y A;  4ZB9 A;  2JZR A;  2GS3 A;  3IOS A;  4CDO A;  5G31 A;  2C3Q A;  3ZIJ A;  4IGJ A;  4NAX A;  1WMJ A;  1GUM A;  4OCE A;  4GF0 A;  2PUK C;  4N10 A;  4XRD A;  3O76 A;  2IIY A;  4YH2 A;  3GUR A;  2PMT A;  3MNG A;  3LXT A;  1WOU A;  5ABR A;  4BVY B;  1XW6 A;  4HZ4 A;  2FNO A;  1FAA A;  2GSS A;  4EIP A;  2FD3 A;  4DSS B;  4CY8 A;  2X8C A;  4IN0 A;  2H01 A;  4EIQ A;  2QGV A;  2EIR A;  4YKG A;  2DMM A;  2Z9S A;  3CRT A;  2PBJ A;  4O92 A;  3GMF A;  2XC2 A;  1OC9 A;  5AIS A;  4GRF A;  3ZFL A;  5KN0 A;  4EXJ A;  2JZT A;  2P5R A;  2DJ0 A;  1ERT A;  3IV4 A;  4K0N A;  2VOC A;  1JLV A;  4XHM A;  4EL1 A;  2GLR A;  1TK8 B;  3TJJ A;  2JSZ A;  3ZIT A;  2FGX A;  3HVX A;  1TXX A;  4BL7 A;  1EWX A;  2H71 A;  5G1K A;  4EDY A;  1FB0 A;  1K0M A;  1S3D A;  2NTO A;  5D93 A;  5EPF A;  2H0G A;  1SJI A;  5A4W A;  1T4Z A;  3NOF A;  2B1K A;  3E9J B;  2IMD A;  2EC4 A;  5D8I A;  4HJ2 A;  1M9B A;  4ECI A;  3A2V A;  2MBS A;  3KD0 A;  3GKK A;  3GKN A;  1OKT A;  2QKE A;  2NBS A;  4NV2 A;  1M2B A;  2P0G A;  1TOF A;  5C00 A;  3P2A A;  1GNW A;  4JED A;  1DUG A;  1V58 A;  1DE1 A;  5LNK e;  1N2A A;  3UMA A;  5LD0 A;  3TKS E;  5DQY A;  2PWJ A;  2FLS A;  2FA8 A;  3GSS A;  3ZTL A;  5JCG A;  1QFN A;  4TR1 B;  1T00 A;  3RHB A;  2H1G A;  2IMF A;  4K5S A;  5B6N A;  3GL3 A;  4WBJ A;  2YWO A;  3W6G A;  5IMV A;  4D73 A;  5ECH B;  5ECO B;  4ML1 A;  2QSI A;  2ZCT A;  1BG5 A;  4O5Q A;  3K8N A;  3A5I A;  3TGZ A;  2L59 A;  3H1N A;  3TJG A;  4H86 A;  4ACS A;  3QMX A;  2VL2 C;  4F0B A;  2IMK A;  4F9Z A;  2HYX A;  3RDW A;  3FZ5 A;  1HD2 A;  2L5O A;  3RAZ A;  4JBB A;  3F63 A;  2OKA A;  2O7K A;  3GIX A;  2K8V A;  4ZIL A;  2L4Q A;  2CZ2 A;  1VF3 A;  4ZBB A;  2ON5 A;  5ECR B;  4MJA A;  3EMP A;  2YJH A;  3ZFB A;  3QFB C;  1XWA A;  2JZS A;  4DSQ A;  5HFG A;  2R0G A;  2DJJ A;  3GTU B;  4V1A p;  2C0G A;  4G2E A;  5GAN D;  18GS A;  2H6Y A;  4ZL9 A;  1ZZY A;  6GSW A;  1SYX A;  1PMT A;  5B8A A;  3F4T A;  1ZMA A;  3HZ4 A;  4XS6 A;  1PX6 A;  2VAF A;  3L9V A;  3US3 A;  5HFK A;  2H75 A;  2DJ1 A;  1PSQ A;  1YKA A;  3L4N A;  3HHV A;  3LOR A;  2F51 A;  3VWU A;  5DBQ A;  4ECC A;  1H75 A;  1B4P A;  3CBU A;  4K2D A;  2YOI A;  1B4Q A;  4N0V A;  3IC4 A;  3EYT A;  2TRX A;  5J41 A;  5CP1 A;  1Y25 A;  5JWO B;  4L0W A;  2HRF A;  5CRD A;  3TB2 A;  2GQM A;  2HSY A;  3IR4 A;  4Q5N A;  3GKX A;  4N30 A;  1T7P B;  3WYW A;  3D4M A;  1FHE A;  3KP8 A;  2HSH A;  2MZC A;  1W4V A;  1XW9 A;  4BL7 B;  2IN3 A;  4IKH A;  1OE7 A;  1FG4 A;  3CSJ A;  2HZE A;  5ECK B;  2IPA A;  5ID2 A;  5EY6 A;  3BCI A;  1HNC A;  4IQ1 A;  2DJK A;  3FK8 A;  1NW2 A;  1TK5 B;  3N5O A;  2J23 A;  4IQA A;  2ES7 A;  3BJ5 A;  2CVD A;  4G19 A;  4AJ6 A;  4MP4 A;  5GST A;  2OJL A;  3ZYW A;  3H4K A;  1PKW A;  2AAW A;  3KH9 A;  3UEM A;  3QDN A;  1Y6E A;  3ME8 A;  1GTA A;  4Q5F A;  4N11 A;  22GS A;  3JCM L;  1SL2 B;  3H93 A;  3CMI A;  3HJO A;  2WS2 A;  3C1R A;  1GH2 A;  3ME7 A;  5F07 A;  2OBK A;  3Q74 A;  4WEY A;  4XS4 B;  3D22 A;  4RQX A;  2KUC A;  5D9X A;  3C1S A;  2QC7 A;  3I9V 2;  2CAQ A;  4TR3 A;  4V2L A;  3EWL A;  3ED3 A;  1ZGN A;  3F9U A;  3TJB A;  2B6M A;  17GS A;  1BYE A;  3F8U A;  1GUK A;  3H79 A;  2E0Q A;  3VWX A;  5L71 A;  5D9T A;  4RI7 A;  3RHC A;  3TKS A;  4KCE A;  3VWW A;  4NHW A;  1XXU A;  3GYK A;  4Z2T A;  3AY8 A;  4OD7 A;  1IYI A;  3A2X A;  3FMW A;  1AUC A;  4TVE A;  3QAG A;  3MDK A;  1A23 A;  4QL7 A;  2VCQ A;  1N8J A;  1JZW A;  4BVY A;  2FA4 A;  2O8V B;  1FW1 A;  4ECJ A;  4DSS A;  1ERU A;  5DDL A;  4MF7 A;  3W8J A;  1LJR A;  1FOV A;  4RUV A;  4J56 E;  2YZH A;  1TRW A;  1GNE A;  5G30 A;  2H6X A;  4KDX A;  1Z6M A;  5IMC A;  1BQ7 A;  2VUP A;  1XW5 A;  1WWJ A;  2LS5 A;  3MSZ A;  1GWC A;  5FHI A;  1DBY A;  4K0G A;  1ZOF A;  2GQK A;  2MMA A;  3KM6 A;  2CVK A;  2KP2 A;  4HU9 A;  2GZZ A;  1F9M A;  3F3Q A;  4K7O A;  3M9J A;  2B5E A;  3Q18 A;  5J4U A;  2VIM A;  4HQZ A;  1JHB A;  4MZB A;  4NMU A;  3LYK A;  5JCW A;  5D9V A;  5DVB A;  4BWS A;  1TDI A;  5G2Z A;  4KSM A;  1Z9H A;  2ALB A;  1CQG A;  2WDU A;  4FYB A;  4HOJ A;  3DVX A;  5CRW A;  1VGL A;  5D73 A;  5F0G A;  3QCP A;  4IJ3 A;  1HNB A;  1R5P A;  1PRX A;  3UVH A;  3KEB A;  4IBP A;  1M2D A;  3A3T A;  2YZU A;  3L9S A;  1O7U A;  13GS A;  4ZL7 A;  5IOX A;  4JR4 A;  1GTB A;  4K7I A;  5DJL A;  1YQ1 A;  1DE2 A;  3VPQ A;  1A24 A;  2LUS A;  1TK0 B;  4MJC A;  1XCC A;  2C0E A;  1F3B A;  4ZB6 A;  4IVF A;  4NV5 A;  2B5X A;  4TR1 A;  2EIO A;  5J5N A;  1MDI A;  4LL1 B;  2PVQ A;  4MPG A;  2H66 A;  1X9W B;  4NWY A;  2WRT A;  1M9A A;  3APQ A;  3ZVJ A;  2HXK A;  4GLT A;  2B1L A;  3KMN A;  6GSU A;  2AHE A;  1G6W A;  1X9M B;  4WET A;  3LYP A;  4MK3 A;  2OA7 A;  2YV9 A;  3GRX A;  1AQX A;  4MH3 A;  3DXB A;  1MD4 A;  3RPN A;  1PN0 A;  1WP0 A;  1JLW A;  2VM1 A;  2F8A A;  5B7C A;  5KOW A;  4YKF A;  3QOU A;  2WJU A;  2MYG A;  4V2N A;  1USB A;  1A8L A;  4YAP A;  1K3O A;  2LRT A;  2YV7 A;  2H1A A;  4L5O A;  1VRS D;  4P3Y B;  2VL3 A;  1MEK A;  4J57 E;  2VLU A;  4OFT A;  2R5G A;  1V98 A;  2V2G A;  2H8L A;  4KSO A;  1E6B A;  3QR6 A;  4JR6 A;  2LRN A;  3GTU A;  4MMM A;  2BJX A;  3G7J A;  5EVO A;  4HQS A;  4EUY A;  2K6V A;  3UJ1 A;  3A2W A;  4K6X A;  4YQV A;  2IFQ A;  1GP1 A;  4ZB8 A;  4MNN A;  4WR5 A;  3WD6 A;  2QA2 A;  1F2E A;  4POL A;  1XFL A;  1EEJ A;  2L57 A;  2VD1 A;  2H76 A;  2I81 A;  1B9X C;  3HZ8 A;  4K1F A;  1ML6 A;  4ZBD A;  1XOB A;  3GH9 A;  1G7E A;  4EO3 A;  4I6X A;  5HR3 A;  1NHY A;  5INY A;  4MAB A;  5IO0 A;  4XCS A;  1XBS A;  2VCW A;  1M2A A;  4EC0 A;  2XBQ A;  5DAL B;  3F4S A;  2A2S A;  2YP6 A;  4RQR A;  2R6K A;  4MDC A;  3ZRE A;  1JFU A;  3TKQ A;  4IP6 A;  2G0F A;  3TUE A;  2M72 A;  1A2M A;  5A4V A;  4LLR A;  5CNW A;  3TRX A;  1AW9 A;  4PX1 A;  3QD9 A;  5EL8 A;  4BPY A;  1TRU A;  3L9U A;  4TXO B;  1PL1 A;  3FY7 A;  4AF2 A;  3KCM A;  2CAI A;  2KP1 A;  4WR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...