2HSHA

Crystal structure of c73s mutant of human thioredoxin-1 oxidized with h2o2
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
105
structure length
105
Chain Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title Buried s-nitrosocysteine revealed in crystal structures of human thioredoxin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 40
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2006-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2hshA00
5DCGA 1VF2A 1F6MC 1PL1A 3TOUA 3GL5A 4TXOA 1DUGA 3F4TA 4TKYA 1SD9A 19GSA 3RPPA 3MDKA 1XWGA 4GSSA 2FA8A 2K9FA 2K18A 2GSQA 3UBKA 3IOSA 1TI1A 5JWRB 2ALBA 2B1KA 5DAKB 3ZLPA 2VL2A 3Q6OA 5CO3A 2NBSA 1XPVA 1S3DA 1T00A 4YH2A 1E6BA 4AJ8A 2PMTA 3HY2A 5LD0A 1XVWA 2FHEA 5HR0A 1U3AA 1EEMA 1SJIA 2O89A 4N0VA 2E7PA 1N2AA 1AAZA 3R2QA 2HI7A 2Z9SA 1S3AA 3HCZA 3M9JA 3MNGA 3ZFLA 2V32A 3UMAA 3WT2A 1V2AA 1T8EB 2VCZA 1GTIA 2E2MA 3TKSC 3D4TA 4BVYA 2B3SA 3TB2A 3ZMLA 1GUKA 3VLNA 3DRNA 4FIWA 4MF7A 2YJ7A 4MPFA 3P8WA 1XOAA 1O7UA 2DJ1A 4L0UA 5AN1A 10GSA 2WCIA 1BYEA 5B8AA 2DJ3A 5HFIA 5GAPD 4Q5QA 4RQRA 5ECQB 3G7JA 4PXOA 1XIYA 1Y25A 1VF4A 4MLYA 1XWKA 2HT9A 1XW6A 1BX9A 5F07A 2LEGA 4I2UA 1KNGA 2C3NA 2V2GA 4FYCA 3APOA 4JR6A 2WFCA 3VWUA 4ID0A 2F3MA 4TN8A 1OVNA 4N30A 4P3YB 2NPBA 2MYGA 4ZXGA 2HRNA 1ERTA 2H75A 3ED3A 4MJEA 3H8QA 4LLRA 5A5KA 2TIRA 1T7PB 3WGXA 3H1NA 4EKZA 4GCIA 1X0RA 5GAND 2LRCA 3P2AA 1XW9A 4OD7A 2B7JA 4HZ2A 3TKQA 2H1AA 3L9SA 3UBLA 1A2JA 3EMPA 1A24A 4POLA 1ON4A 5AGYA 2IWTA 2GZZA 1V98A 1OKDA 5D9VA 6GSSA 3TOTA 1V57A 4JR4A 5F06A 2H1DA 1NM3A 1GUMA 4XS1A 4GLTA 4ZIJA 3GURA 2JSYA 5IMVA 2F9SA 1RW1A 3ZYWA 5IQYA 3GKNA 5H5SA 2NTOA 4PNFA 4KDYA 5ELGA 2GQKA 2N5BA 2O7KA 4GQFA 3VI7A 1NHOA 6GSXA 3LJRA 3WGEA 4IP6A 5IPHA 1MEKA 1TJDA 2V6KA 4GXZA 1CQGA 3H4KA 7GSSA 4ZBDA 3HJPA 3KMNA 2B5XA 2E2GA 1GSFA 1EGOA 2LUSA 3KIJA 2LQOA 5CNWA 1GP1A 1FB0A 2H76A 1ZZYA 2DC5A 2H70A 4J2FA 2RLIA 3DVWA 2C1YA 5JCGA 4O5RA 3RHBA 3DXBA 2A4VA 2OJLA 3F4SA 1G7OA 3CTFA 1EGRA 2VO4A 5ECIB 1Z5YE 1TOFA 2LV3A 1YDKA 5CRHA 3C1SA 5J9BA 2VCXA 2H6YA 2I9HA 3HXSA 1NW2A 2H72A 3W6GA 4G2EA 4IHUA 4KNDA 3IBHA 2OE3A 2REMA 3KMOA 4ZBBA 2KLXA 3N5OA 3HD5A 4IQ1A 1UA5A 1JZRA 5HR1A 2VLUA 5D93A 1WMJA 1MDJA 4KAEA 3GX0A 2C3TA 4V2MA 1SYXA 4X1UA 3A3TA 2QC7A 3IC4A 1G6YA 3GL3A 1SL1B 3GNJA 2PVOC 3FR3A 1F9MA 3ME8A 1V40A 4L0WA 2YOIA 1M9BA 2EIOA 3VURA 2IMKA 2H01A 1T3BA 4HJ2A 1O8XA 3EINA 2HLSA 5GZZB 3GX8A 2LTKA 5IMAA 4IS0A 1Z3EA 3UOMA 1M2AA 1ERWA 1GNWA 5D9WA 3W8JA 2YNXA 4EL1A 1QK8A 3C7MA 1GTAA 1THOA 3TKSA 4MF6A 1ML6A 4HUAA 2H66A 2CA8A 1T4ZA 3E3EA 4POMA 3D6IA 1DE2A 3LGCA 3LORA 3CTGA 3LYKA 4YAVA 4ZL8A 2FGXA 3DWVA 5G5EA 5JWQB 1OKTA 1SL2B 1EP8A 4WKWA 2G2QA 2KHPA 3UARA 2L57A 4WBRD 5C00A 3F6FA 2L6CA 3ZIJA 1OC8A 3KEBA 4BVXA 2HRFA 3GKXA 1EOHA 4OWYA 2OACA 20GSA 4NPBA 1S3CA 3HKRA 4YQUA 3KD0A 5KN0A 2DBCA 4G9HA 5ENUA 3IPZA 2VCTA 2MMNA 3LXTA 1QGVA 1T1VA 1KTEA 3FRCA 4K8MA 2XC2A 2C80A 4LL1B 2KP1A 4KB3A 5ABRA 1N8JA 3CXGA 4E8EA 3GRXA 4QL9A 3ZTLA 3UVTA 2VD0A 2O87A 1ZYEA 2VM2A 6GSUA 2GLRA 13GSA 4PNGA 1YEPA 2CVDA 2H30A 2RM6A 2ZNMA 1YY7A 2N5FA 2E0QA 1XBSA 3BCKA 3DIEA 2ZUPA 1B8XA 4I8BA 3H93A 1WOUA 1TKDB 1EV9A 5ELAA 3KGKA 3P7XA 4J57E 1BG5A 4K9ZA 2K6VA 1GULA 2DJ0A 1O73A 5F8BA 3Q18A 3ZRDA 3BCIA 3CSIA 3C73A 2QSIA 2DJ2A 4TR1B 2H0HA 3GMFA 2R2JA 2A2RA 4V1Ap 2GGTA 1ZMAA 5J9CA 4PQIA 4OFTA 3ISOA 3QFAC 5G5FA 5ID2A 3Q74A 3GSSA 5DQSA 4JBBA 1SKWB 5D8IA 1GSEA 4GWRA 4MPGA 3GYKA 3IA1A 3I69A 5DJLA 1EWXA 1DBYA 1JZWA 5D96A 1LJRA 5IM9A 4NV2A 14GSA 2LRTA 5AIVA 2H71A 1JZOA 5ECHB 5GSTA 2CX3A 4WBJA 2VM1A 3GA4A 4MH3A 2G0FA 2OE0A 2M80A 4PQ1A 3ZREA 2X64A 3US3A 4F0BA 1GSQA 4NAXA 1URMA 3CRTA 4I2TA 3HZ8A 3TUEA 3LFLA 4HQZA 3DEXA 4KH7A 1K3LA 1Y6EA 2LKUA 2FWGA 3M1GA 2DMMA 3HVSA 3DKSA 4DEJA 3Q19A 1A8YA 1G7EA 1SD8A 3QD9A 2OE1A 3NOFA 2B6MA 2PVQA 5DBQA 3LYPA 4KW6A 5IMFA 3FR9A 4OFMA 4HQSA 3U6VA 5EY6A 12GSA 4TXOB 1VGLA 5GSSA 4TW5A 1JHBA 1SYRA 3QPMA 3APQA 1YEXA 2N5AA 1GSSA 1K0BA 3ERWA 2MMZA 3I9V2 3NIVA 4EUYA 2IMIA 2JZTA 1M2DA 5INYA 2IPAA 1X5DA 22GSA 1U6TA 2CVBA 5HFKA 3DMLA 3GKKA 3DVXA 1PSQA 3LQ7A 3WD6A 2C8UA 4K7IA 3F0IA 4K0GA 1OYJA 3I6AA 4WEYA 2VIMA 3ZMKA 3CSHA 1UC7A 2KOKA 1TI3A 2YJHA 2I1UA 5DCHA 5ECKB 6GSWA 1U88A 2WS2A 5G1LA 1NHYA 2L4QA 2X8HA 1R7HA 2C0DA 3GIXA 1JLWA 3E9JB 2JACA 4GRFA 1IYHA 4ZB6A 4CDOA 1YJ6A 3IR4A 4N10A 3S9FA 2H6ZA 2H8LA 2VCWA 1M2BA 4Q5FA 1G0TA 2WB9A 2TRCP 1SKSB 3DGQA 3HJOA 5HR3A 1ERUA 3ERFA 1HYUA 3VPQA 3IDVA 1MD4A 1PKZA 2VAFA 5IPGA 4OCEA 3TJBA 4K7OA 1HNBA 3GHAA 3L0HA 2CX4A 2WZ9A 1QXHA 2X8GA 5FWGA 5E59A 1YQ1A 11GSA 2GS3A 4ECIA 3HHVA 3FZAA 1TRVA 1XOBA 2EIRA 1M99A 4ZL9A 2GT6A 4AJ6A 4KGIA 2V6OA 4ACSA 1F37A 2XBIA 2J9HA 5IMCA 3FZ5A 3TKPA 2B5YA 4L8EA 4IJ3A 1K3YA 2VUPA 5G2ZA 2F8FA 1A23A 1TXXA 4I97A 1EZKA 2WRTA 1BEDA 1F3AA 4K2DA 1QFNA 2CQ9A 2MMOA 3IV4A 4HJMA 2AYTA 2O8VB 5J41A 1ZL9A 1U3IA 2GQLA 4MZCA 4K6XA 4WETA 2YZUA 1HD2A 2ON7A 2YZHA 4NHZA 3RDWA 2PGTA 2BMXA 2LQQA 5ECOB 3VFIA 1GLQA 1EOGA 4OO4A 5HR2A 2PUKC 4HS1A 1FB6A 1WIKA 3A5WA 1TTZA 1XCCA 2BTOT 4H86A 2HNLA 2PN8A 2H0IA 1B4PA 3IE3A 1MD3A 5IO0A 5A4WA 1R5AA 5KN1A 2KUCA 2X8CA 2C4JA 3CRUA 3JCML 4MH2A 2GTUA 1GSDA 3D0ZA 1YF0A 2P0GA 4KSMA 3RHCA 1FO5A 1Q4JA 2JZSA 4HDEA 3M0FA 5DQYA 5EVOA 5H5RA 4IP1A 4EDYA 4TR0A 5G31A 4ZB8A 4EC0A 4ISDA 3TJGA 3A2XA 3TJKA 3AY8A 3F8UA 1AC1A 5FHIA 1ERVA 2WULA 2DLXA 2KP2A 2EC4A 2LJKA 3IRAA 4PUAA 9GSSA 2CT6A 3HVXA 1Q98A 2HE3A 1PMTA 2DMLA 2XBQA 3TJFA 3TRPA 2DIYA 2PU9C 5J3RA 4K7NA 4EVMA 1AQVA 3QMXA 1RK4A 4MP4A 1PL2A 1DE1A 1Z6MA 4MJCA 1EP7A 4L5OA 1ZCPA 3BJ5A 1TRSA 3BBYA 2LRNA 4POBA 3UVHA 2GSSA 1Z6NA 3OR5A 4JU5A 4EF0A 3F63A 1MTCA 1W89A 5L71A 4KE3A 1GRXA 2GSTA 2VL3A 3EU4A 2QGVA 2PPTA 4PURA 5ECNB 4F82A 4NV5A 3ZL5A 3NZNA 3FR6A 1T4YA 4L5LA 2I4AA 4DSRA 2FNOA 5IMZA 1GSYA 3D5JA 1TW9A 4ULXA 1BQ7A 4MMMA 1XVQA 4DVCA 4MZWA 1GTBA 3EC3A 2IFQA 4LL4B 1AQWA 1XWBA 5A4UA 1EV4A 4HI7A 3KP8A 3N9JA 3KXOA 3DD3A 4QL7A 5F05A 4O92A 1GUHA 4KUNA 2FWFA 5FT3A 2L59A 3CSJA 3D4MA 3GN3A 2K8SA 1USBA 4J56E 5CAXA 4JEDA 3GV1A 1K0AA 4MZBA 2R5GA 2V41A 1XW5A 1SL0B 3BOAA 3PINA 2JADA 2IFQB 1GH2A 4TOPA 3HVVA 2XPEA 1R4WA 4KSOA 2VLVA 1V58A 3TCOA 1QQ2A 4IGJA 3MAKA 1JLVA 1PQNA 5J4UA 2CAIA 4EDZA 1SJ6A 2HFDA 4ILFA 3VWWA 3APSA 4FO5A 2WGRA 2VOCA 5ECPB 3CYNA 2AV4A 1F3BA 2XPDA 1PX7A 1ABAA 2RUFA 3EU3A 2EIQA 2R4VA 1FAAA 3QCPA 2YN1A 4ML1A 1YZXA 1WPIA 3QFBC 4X43A 5H5QA 1AXDA 1J08A 4V1Ag 5D9TA 4JRRA 2IJYA 3WYWA 1B9YC 2D2ZA 5CRDA 6GSVA 2AUVA 1K3OA 4MA9A 1TU8A 3GH9A 8GSSA 3C1RA 3G9BA 4EE0A 3BD2A 2IN3A 1TU7A 3CBUA 1GWCA 4MDCA 3KZQA 2OA7A 1X9MB 1TK0B 2AJQB 2GZYA 5J5NA 1OC9A 3L4NA 3L9VA 1WE0A 5DVBA 1W4VA 1XXUA 4OCFA 1UVZA 3FW2A 1OAZA 2HZEA 1A8LA 5B6NA 4BWQA 5COHA 3A2WA 1QUWA 4WR5A 4GF0A 5ECSA 1MDKA 2TRXA 3WGDA 5CRGA 3F9UA 4TVEA 3SWLA 5B6MA 4CHSA 5D73A 3A2VA 2F51A 3RAZA 3FZ9A 5ID2B 2YWOA 1TRWA 1TDIA 2I81A 4XRAA 1OC9B 2HZEB 1BAYA 3FKFA 5C04A 3WT1A 2HYXA 4XCSA 4IVFA 2NVLA 3GKMA 4ZILA 5E4WA 5DDLA 2ZCTA 4GTUA 3ME7A 1G6WA 2FWHA 2LJAA 1DSBA 5JCUA 4TXVA 2MMAA 4MABA 2XHFA 1TRUA 1X9WB 1SJZA 4ECCA 2M46A 1HNCA 2YWNA 2LNSA 2MZCA 5LNKe 2GZPA 2DSAA 4BPYA 1K0OA 4WF4A 1CQHA 1SU9A 2CAQA 3UEMA 2H0GA 2VL9A 2H1GA 2VCVA 3TKSE 1O85A 1TK8B 3C71A 1B9XC 3F6DA 3TRQA 2YP6A 1R26A 3J7Yk 2RM5A 6GSYA 2YANA 4I6XA 3RPNA 2LNTA 1GSUA 6GSTA 5CYYA 2C0EA 2IMDA 1ILOA 1J0FA 4MCUA 5DJMA 4NMUA 2VD1A 4KX4A 1VF3A 1FVKA 1K0DA 4TRXA 1E2YA 2GVPA 2J23A 1YF1A 2P5RA 1PA3A 3D21A 3M9KA 1GL8A 1TK5B 1PGTA 1A0FA 1B4QA 1J9BA 4LMWA 1PX6A 4ZBAA 3ZZXA 4XIHA 3W8SA 1O8WA 3ZVJA 5G1KA 4FH8A 3ZFBA 3GFKA 3EMXA 1XWCA 3F4RA 2HSHA 4ZL7A 5A4VA 2V1MA 5KEJA 2R37A 3D22A 1XFLA 3IXRA 2OBKA 2IIYA 4KCEA 5JWOB 1YKCA 2JSZA 5B7CA 2FCHA 2PWJA 4F0CA 1H4OA 5DALA 1GLPA 1I5GA 4OFNA 2C3QA 1O81A 2B5EA 4WF5A 3MWHA 1YKAA 3KM6A 1ZOFA 3RBTA 1I9DA 2FUG2 1JFUA 3C8EA 3PGTA 2YWMA 3GUSA 2A2SA 1M0UA 5D9XA 4KDXA 2YPMA 1Z7RA 3HYPA 4V2LA 4Z7XA 3ZITA 4XHMA 2HZFA 5G30A 5JCWA 3TJJA 2VCQA 4QQ7A 4BL7A 4G19A 3EVIA 1A0RP 2DJKA 4PQHA 4NXIA 4PGTA 2CZ3A 5DALB 1K0MA 3KTBA 4IW9A 4HU7A 2FA4A 3HDCA 1FHEA 18GSA 4DSQA 5ECLB 2CVKA 3KH7A 1GNEA 1LU4A 4XTSA 3KP9A 1FW1A 4GSNA 1ZYQB 5CREA 4O7HA 3UAPA 1PD21 4ML6A 4HEA2 3LXZA 4F2IA 3LWAA 1BJXA 4N11A 2MBTA 5CRWA 2LSTA 4NWYA 2GQMA 4GQCA 1LBKA 1WP0A 2IL3A 4HZ4A 2PERA 2L6DA 2HSYA 1ACVA 3EE2A 4JE1A 2YCDA 3QDNA 1O6JA 3O3TA 4OO5A 2DIZA 4MK3A 1VRSD 3GSTA 4IKHA 1GTUA 3HA9A 4F03A 4KA0A 4CW9A 1QMVA 4BWSA 3TDGA 4EO3A 4IELA 4HOJA 4OMVA 1M9AA 2DJJA 1B48A 5F0GA 3G7IA 1AIUA 2C0FA 3MSZA 1X9SB 3HZ4A 4MJAA 2C0GA 1SK1A 1SENA 4KCAA 2PBJA 2HXKA 2FY6A 4G10A 2VLTA 4NHWA 3TRXA 1K0CA 3KTLA 3L78A 2OBIA 4FYUA 1PKWA 1HNAA 4KDUA 3J7Yb 1JZDA 3K8NA 2VL2C 4MJBA 4F9ZA 2YWIA 5B8BA 2YV9A 4RQXA 1FOVA 1WJKA 2JL4A 5HFGA 1XWAA 3UL3A 2CV4A 3TKRA 4FYBA 2H73A 3M8NA 2RIIA 2CZ2A 5IOWA 1MDIA 2R6KA 3QAWA 3E0UA 4YQVA 3FYGA 3LEFA 3QAGA 3VK9A 1H75A 3PR8A 2OADA 1K0NA 4AGSA 1OE7A 2AAWA 1U87A 17GSA 2GSRA 3P90A 4ZB9A 1EEJA 3FHKA 16GSA 1PN9A 2LS5A 3F3QA 1FG4A 1OC3A 5HQPA 3EURA 1C72A 1THXA 1UN2A 4I5QA 4RUVA 2H74A 1RQMA 4POKA 4RI6A 4V2NA 2NDOA 3H79A 2YV7A 4JZQA 1TP9A 4LMVA 1NSWA 1SKRB 2IMFA 3UIWA 2L5LA 3CMIA 3I43A 4K1FA 4MF5A 3VWXA 5IMDA 3QR6A 4ECJA 4GSTA 1X5EA 3IK9A 4X0XA 1AUCA 3HJMA 5IOXA 3EWLA 5EL8A 4HU9A 4K0NA 2R3XA 4WXTA 2M72A 3FEUA 5KN2A 2AB6A 3GTUA 3KCMA 3QAVA 3DYRA 2ON5A 3ZVJD 4XRDA 3EYTA 3M3MA 3VPTA 2FWEA 3LG6A 4WR4A 4IBPA 1SK0A 4EXJA 3IHQA 1M7TA 4BA7A 2X99A 3SBCA 4ECBA 3QOUA 2QKEA 3V1WA 1HQOA 1AW9A 3FY7A 2FLSA 4PX1A 2BJXA 2LJRA 1Z9HA 3ZIVA 3L9UA 1F2EA 3UJ1A 2IMEA 3FZ4A 4LA1A 1A2LA 4TR1A 1ST9A 2P5QA 1R5PA 2OKAA 5ECMB 3ERGA 2H6XA 4IQAA 2JU5A 3PH9A 1FVJA 1Z7PA 3GTUB 4TR3A 5AIXA 4O32A 2ES7A 3KJYA 2H1BA 4XS4A 3F3RA 1VF1A 1PRXA 2WJUA 3VI5A 4E8HA 1A2MA 4Q5RA 1V9WA 5ECRB 4RI7A 4DSSA 2I3YA 4YAPA 4AF2A 3VWVA 1IYIA 4D73A 1WRYA 2H19A 1KEBA 2P31A 2JZRA 2K8VA 4Q5NA 4XS6A 4AJ7A 2WDUA 3FK8A 5KN3A 3TGZA 3IAS2 5CP1A 2GT5A 5EPFA 1AQXA 4N0ZA 2L5OA 2FD3A 3G7YA 3KH9A 1X5CA 2O85A 3IK7A 2MBSA 2B7KA 4XS4B 1KBNA 2RUEA 4TR4A 4IJIA 1OE8A 1WWJA 5LCZA 1SK2A 2L4CA 4DSSB 5IO2A 3GH6A 5AISA 2GDRA 4PUFC 3LSZA 5IIZA 1XZOA 4D73B 3U5RE 3O6TA 4IN0A 3IAM2 5DAKA 2F8AA 4YQMA 1ZGNA 2B1LA 3O76A 2AHEA
chains in the Genus database with same CATH superfamily
5DCGA 1VF2A 4Z2TA 1F6MC 1PL1A 3TOUA 3GL5A 4TXOA 4YKFA 1DUGA 3F4TA 4TKYA 1SD9A 19GSA 3RPPA 3MDKA 1XWGA 4GSSA 2FA8A 2K9FA 2K18A 2GSQA 3UBKA 3IOSA 1TI1A 5JWRB 2ALBA 2B1KA 5DAKB 3ZLPA 2VL2A 3Q6OA 5CO3A 2NBSA 1XPVA 1S3DA 1T00A 5KOWA 4YH2A 1E6BA 4AJ8A 3EPTA 2PMTA 3HY2A 5LD0A 1XVWA 2FHEA 5HR0A 1U3AA 1EEMA 1SJIA 2O89A 4FQUA 4N0VA 2E7PA 1N2AA 1AAZA 3R2QA 2HI7A 2Z9SA 1S3AA 3HCZA 3M9JA 3MNGA 3ZFLA 2V32A 3UMAA 3WT2A 1V2AA 1T8EB 2VCZA 1GTIA 2E2MA 3TKSC 2R0PA 3D4TA 4BVYA 2B3SA 3TB2A 3ZMLA 1GUKA 3VLNA 3DRNA 4FIWA 4MF7A 4Z2UA 2YJ7A 4MPFA 3P8WA 1XOAA 1O7UA 2DJ1A 4L0UA 5AN1A 10GSA 2WCIA 1BYEA 5B8AA 2DJ3A 5HFIA 5GAPD 4Q5QA 4RQRA 5ECQB 3G7JA 4PXOA 1XIYA 1Y25A 1VF4A 4MLYA 1XWKA 2HT9A 1XW6A 1BX9A 4O5QA 5F07A 2LEGA 4I2UA 1KNGA 2C3NA 2V2GA 4FYCA 3APOA 4JR6A 2WFCA 3VWUA 4ID0A 4BVYB 2F3MA 4TN8A 1OVNA 4N30A 4P3YB 2NPBA 2MYGA 4ZXGA 2HRNA 1ERTA 2H75A 3ED3A 4MJEA 3H8QA 4LLRA 5A5KA 2TIRA 1T7PB 3WGXA 3H1NA 4EKZA 4GCIA 1X0RA 5GAND 2LRCA 3P2AA 1XW9A 4OD7A 2B7JA 4HZ2A 3TKQA 2H1AA 3L9SA 3UBLA 1A2JA 3EMPA 1A24A 4POLA 1ON4A 5AGYA 2IWTA 2GZZA 1V98A 1OKDA 5D9VA 6GSSA 3TOTA 1V57A 4JR4A 5F06A 2H1DA 1NM3A 1GUMA 4XS1A 4GLTA 4ZIJA 3GURA 2JSYA 5IMVA 2F9SA 1RW1A 3ZYWA 5IQYA 3GKNA 5H5SA 2NTOA 4PNFA 4KDYA 5ELGA 2GQKA 2N5BA 2O7KA 4GQFA 3VI7A 1NHOA 6GSXA 3LJRA 3WGEA 4IP6A 5IPHA 1MEKA 1TJDA 2V6KA 4GXZA 1CQGA 3H4KA 7GSSA 4ZBDA 3HJPA 4KF9A 3MIXA 3KMNA 2B5XA 2E2GA 1GSFA 1EGOA 2LUSA 3KIJA 2LQOA 5CNWA 1GP1A 1FB0A 2H76A 1ZZYA 2DC5A 2H70A 4J2FA 2RLIA 3DVWA 2C1YA 5JCGA 4O5RA 3RHBA 3DXBA 2A4VA 2OJLA 3F4SA 1G7OA 3CTFA 1EGRA 2VO4A 5ECIB 1Z5YE 1TOFA 2LV3A 1YDKA 5CRHA 3C1SA 5J9BA 2VCXA 2H6YA 2I9HA 3HXSA 1NW2A 2H72A 3W6GA 4G2EA 4IHUA 4KNDA 3IBHA 2OE3A 2REMA 3KMOA 4ZBBA 2KLXA 3N5OA 3HD5A 4IQ1A 1UA5A 1JZRA 5HR1A 2VLUA 5D93A 1WMJA 1MDJA 4KAEA 3GX0A 2C3TA 4V2MA 1SYXA 4X1UA 3A3TA 2QC7A 3IC4A 1G6YA 3GL3A 1SL1B 3GNJA 2PVOC 3FR3A 1F9MA 3ME8A 1V40A 4L0WA 2YOIA 1M9BA 2EIOA 3VURA 2IMKA 2H01A 1T3BA 4HJ2A 1O8XA 3EINA 2HLSA 5GZZB 3GX8A 2LTKA 5IMAA 4IS0A 1Z3EA 3UOMA 1M2AA 1ERWA 1GNWA 5D9WA 3W8JA 2YNXA 4EL1A 1QK8A 3C7MA 1GTAA 1THOA 3TKSA 4MF6A 1ML6A 4HUAA 2H66A 2CA8A 1T4ZA 3E3EA 4POMA 3D6IA 1PFOA 1DE2A 3LGCA 3LORA 4BIKA 3CTGA 3LYKA 4YAVA 4ZL8A 2FGXA 3DWVA 5G5EA 5JWQB 1OKTA 1SL2B 1EP8A 4WKWA 2G2QA 2KHPA 3UARA 2L57A 4WBRD 5C00A 3F6FA 2L6CA 3ZIJA 1OC8A 3KEBA 4BVXA 1M3IA 2HRFA 3GKXA 3LW9A 1EOHA 4OWYA 2OACA 20GSA 4NPBA 1S3CA 3HKRA 4YQUA 3KD0A 5KN0A 2DBCA 4G9HA 5ENUA 3IPZA 2VCTA 2MMNA 3LXTA 1QGVA 1T1VA 1KTEA 3FRCA 4K8MA 2XC2A 2C80A 4LL1B 2KP1A 4KB3A 5ABRA 1N8JA 3CXGA 4E8EA 3GRXA 4QL9A 3ZTLA 3UVTA 2VD0A 4K5RA 4BVXB 2O87A 1ZYEA 2VM2A 6GSUA 2GLRA 13GSA 4PNGA 1YEPA 4G0KA 2CVDA 2H30A 2RM6A 2ZNMA 2HRAA 1YY7A 2N5FA 2E0QA 1XBSA 3BCKA 3DIEA 2ZUPA 1B8XA 4I8BA 3H93A 1WOUA 1TKDB 1EV9A 5ELAA 3KGKA 3P7XA 4J57E 1BG5A 4K9ZA 2K6VA 2QA2A 1GULA 2DJ0A 1O73A 5F8BA 3Q18A 3ZRDA 3BCIA 3CSIA 3C73A 2QSIA 2DJ2A 4TR1B 2H0HA 3GMFA 2R2JA 2A2RA 4V1Ap 2GGTA 1ZMAA 5J9CA 4PQIA 4OFTA 3ISOA 3QFAC 5G5FA 5ID2A 3Q74A 3GSSA 5DQSA 4JBBA 1SKWB 5D8IA 1GSEA 4GWRA 4MPGA 3GYKA 3IA1A 3I69A 5DJLA 1EWXA 1DBYA 1JZWA 5D96A 1LJRA 5IM9A 4NV2A 14GSA 2LRTA 5AIVA 2H71A 1JZOA 5ECHB 5GSTA 2CX3A 4WBJA 2VM1A 3GA4A 4MH3A 2G0FA 2OE0A 2M80A 4PQ1A 3ZREA 2X64A 3US3A 4F0BA 1GSQA 4NAXA 1URMA 3CRTA 4I2TA 3HZ8A 3TUEA 3LFLA 4HQZA 3DEXA 4KH7A 1K3LA 1Y6EA 2LKUA 2FWGA 3M1GA 2DMMA 3HVSA 3DKSA 4DEJA 3Q19A 1A8YA 1G7EA 1SD8A 3QD9A 2OE1A 3NOFA 2B6MA 2PVQA 5DBQA 3LYPA 4KW6A 5IMFA 3FR9A 4OFMA 4HQSA 3U6VA 5EY6A 12GSA 4TXOB 1VGLA 5GSSA 4TW5A 1JHBA 1SYRA 4CY8A 3QPMA 3APQA 1YEXA 2N5AA 1GSSA 1K0BA 3ERWA 2MMZA 3I9V2 3NIVA 4EUYA 2IMIA 2JZTA 1M2DA 5INYA 2IPAA 1X5DA 22GSA 1U6TA 2CVBA 5HFKA 3DMLA 3GKKA 3DVXA 1PSQA 3LQ7A 3WD6A 2C8UA 4K7IA 3F0IA 4K0GA 1OYJA 3I6AA 4WEYA 2VIMA 3ZMKA 3CSHA 1UC7A 2KOKA 1TI3A 2YJHA 2I1UA 5DCHA 5ECKB 6GSWA 1U88A 2WS2A 5G1LA 1NHYA 2L4QA 2X8HA 1R7HA 2C0DA 3GIXA 1JLWA 3E9JB 2JACA 4GRFA 1IYHA 4ZB6A 4CDOA 1YJ6A 3IR4A 4A5PA 4N10A 3S9FA 2H6ZA 2H8LA 2VCWA 1M2BA 4Q5FA 1G0TA 2WB9A 2TRCP 1SKSB 3DGQA 3HJOA 5HR3A 1ERUA 3ERFA 1FOHA 1HYUA 3VPQA 3IDVA 1MD4A 1PKZA 2VAFA 5IPGA 4OCEA 3TJBA 4K7OA 1HNBA 3GHAA 3L0HA 2CX4A 2WZ9A 1QXHA 2X8GA 5FWGA 5E59A 1YQ1A 11GSA 2GS3A 4ECIA 3HHVA 3FZAA 1TRVA 1XOBA 2EIRA 1M99A 2DKHA 4ZL9A 2GT6A 4AJ6A 4YKGA 4KGIA 2V6OA 4ACSA 1F37A 2XBIA 2J9HA 5IMCA 3FZ5A 3TKPA 2B5YA 4L8EA 4IJ3A 1K3YA 2VUPA 5G2ZA 2F8FA 1A23A 1TXXA 4X4JA 4I97A 1EZKA 2WRTA 1BEDA 1F3AA 4K2DA 1QFNA 2CQ9A 2MMOA 4Z2RA 3IV4A 4HJMA 2AYTA 2O8VB 5J41A 1ZL9A 1U3IA 2GQLA 4MZCA 4K6XA 4WETA 2YZUA 1HD2A 2ON7A 2YZHA 4NHZA 3RDWA 2PGTA 2BMXA 2LQQA 5ECOB 3VFIA 1GLQA 1EOGA 4OO4A 5HR2A 2PUKC 4HS1A 4ICYA 1FB6A 1WIKA 3A5WA 1TTZA 1XCCA 2BTOT 4H86A 2HNLA 2PN8A 2H0IA 1B4PA 3IE3A 1MD3A 5IO0A 5A4WA 1R5AA 5KN1A 2KUCA 2X8CA 2C4JA 3CRUA 3JCML 4MH2A 2GTUA 1GSDA 3D0ZA 1YF0A 2P0GA 4KSMA 3RHCA 1FO5A 1Q4JA 2JZSA 4HDEA 3M0FA 5DQYA 5EVOA 5H5RA 4IP1A 4EDYA 4TR0A 5G31A 4ZB8A 4EC0A 4ISDA 3TJGA 3A2XA 3TJKA 3AY8A 3F8UA 1AC1A 5FHIA 1ERVA 3IC8A 2WULA 2DLXA 2KP2A 2EC4A 2LJKA 3IRAA 3CQFA 4PUAA 9GSSA 2CT6A 3HVXA 1Q98A 4MNNA 2HE3A 2X4AA 1PMTA 2DMLA 2XBQA 3TJFA 3TRPA 2DIYA 2PU9C 5J3RA 4K7NA 4EVMA 1AQVA 3QMXA 1RK4A 4MP4A 1PL2A 1DE1A 1Z6MA 4MJCA 1EP7A 4L5OA 1ZCPA 3BJ5A 1TRSA 3BBYA 2LRNA 4POBA 3UVHA 2GSSA 1Z6NA 3OR5A 4JU5A 4EF0A 4G0LA 3F63A 1MTCA 1W89A 5L71A 4KE3A 1GRXA 2GSTA 2VL3A 3EU4A 2QGVA 2PPTA 4PURA 5ECNB 4F82A 1S3RA 4NV5A 3ZL5A 3NZNA 3FR6A 1T4YA 4L5LA 2I4AA 4DSRA 2FNOA 5IMZA 1GSYA 3D5JA 1TW9A 4ULXA 1BQ7A 4MMMA 1XVQA 4DVCA 4MZWA 1GTBA 3EC3A 2IFQA 4LL4B 1AQWA 1XWBA 5A4UA 1EV4A 4HI7A 3KP8A 3N9JA 3KXOA 5KOXA 3DD3A 4QL7A 5F05A 4O92A 1GUHA 4KUNA 2FWFA 5FT3A 2L59A 3CSJA 3D4MA 3GN3A 2A4HA 2K8SA 1USBA 4J56E 5CAXA 4JEDA 3GV1A 1K0AA 4MZBA 2R5GA 2V41A 1XW5A 1SL0B 3BOAA 3PINA 2JADA 2IFQB 1GH2A 4TOPA 3HVVA 2XPEA 4PTSA 2X49A 1R4WA 4KSOA 2VLVA 1V58A 3TCOA 1QQ2A 4IGJA 3MAKA 1JLVA 1PQNA 5J4UA 2CAIA 4EDZA 1SJ6A 2HFDA 4ILFA 3VWWA 3APSA 4FO5A 4EIPA 2WGRA 1ZYPA 2VOCA 5ECPB 3CYNA 2AV4A 1F3BA 2XPDA 1PX7A 1ABAA 2RUFA 3EU3A 2EIQA 2R4VA 1FAAA 3QCPA 2YN1A 4ML1A 1YZXA 1WPIA 3QFBC 4X43A 5H5QA 1AXDA 1J08A 4G0IA 4V1Ag 5D9TA 4JRRA 2IJYA 3WYWA 1B9YC 2D2ZA 5CRDA 6GSVA 2AUVA 1K3OA 4K2XA 4MA9A 1TU8A 3GH9A 8GSSA 3C1RA 3G9BA 4EE0A 3BD2A 2IN3A 2HSMA 1TU7A 3CBUA 1GWCA 4MDCA 3KZQA 2OA7A 1X9MB 1TK0B 2AJQB 2GZYA 5J5NA 1OC9A 3L4NA 3L9VA 1WE0A 5DVBA 1W4VA 1XXUA 4OCFA 1UVZA 3FW2A 1OAZA 2HZEA 1A8LA 5B6NA 4BWQA 5COHA 3A2WA 1QUWA 4WR5A 4GF0A 5ECSA 1MDKA 2TRXA 3WGDA 5CRGA 3F9UA 4TVEA 3SWLA 5B6MA 4CHSA 5D73A 3A2VA 2F51A 3RAZA 3FZ9A 5ID2B 2YWOA 1TRWA 1TDIA 2I81A 4XRAA 1OC9B 4USSA 1M3JA 2HZEB 1BAYA 3FKFA 5C04A 3WT1A 2HYXA 1PN0A 4XCSA 4IVFA 2NVLA 3GKMA 4ZILA 2DKIA 5E4WA 5DDLA 2ZCTA 4GTUA 3ME7A 1G6WA 2FWHA 2LJAA 1DSBA 5JCUA 4TXVA 2MMAA 4MABA 2XHFA 1TRUA 1X9WB 1SJZA 4ECCA 2M46A 1HNCA 2YWNA 4K5SA 2LNSA 2MZCA 5LNKe 2GZPA 2DSAA 4BPYA 1K0OA 4WF4A 5BRTA 1CQHA 1SU9A 2CAQA 3UEMA 2H0GA 2VL9A 2H1GA 2VCVA 3TKSE 1O85A 1TK8B 3C71A 1B9XC 3F6DA 3TRQA 2A2PA 2YP6A 1R26A 3J7Yk 2RM5A 6GSYA 2YANA 4I6XA 3RPNA 2LNTA 1GSUA 6GSTA 5CYYA 2C0EA 2IMDA 1ILOA 1J0FA 4MCUA 5DJMA 4NMUA 2VD1A 4KX4A 1VF3A 1FVKA 1K0DA 4TRXA 1E2YA 2GVPA 2J23A 1YF1A 2P5RA 1PA3A 3D21A 3M9KA 1GL8A 1TK5B 1PGTA 1A0FA 1B4QA 1J9BA 4LMWA 1PX6A 4ZBAA 3ZZXA 4XIHA 3W8SA 1O8WA 3R3EA 3ZVJA 5G1KA 4FH8A 3ZFBA 3GFKA 3EMXA 1XWCA 3F4RA 2HSHA 4ZL7A 5A4VA 2V1MA 5KEJA 2R37A 3D22A 1XFLA 3IXRA 2OBKA 2IIYA 3MYDA 4KCEA 5JWOB 1YKCA 2JSZA 5B7CA 2FCHA 2PWJA 4F0CA 1H4OA 5DALA 1GLPA 1I5GA 4OFNA 2C3QA 1O81A 2B5EA 4WF5A 3MWHA 1YKAA 3KM6A 1ZOFA 3RBTA 1I9DA 2FUG2 1JFUA 3C8EA 3PGTA 2YWMA 3GUSA 2A2SA 1M0UA 4KDXA 5D9XA 2YPMA 2R0CA 1Z7RA 3HYPA 4V2LA 4Z7XA 3ZITA 4XHMA 2HZFA 5G30A 5JCWA 3TJJA 2VCQA 4QQ7A 4BL7A 4G19A 3EVIA 1A0RP 2DJKA 4PQHA 4NXIA 4PGTA 2CZ3A 5DALB 1K0MA 3KTBA 4IW9A 4HU7A 2FA4A 3HDCA 1FHEA 18GSA 4DSQA 5ECLB 2CVKA 3KH7A 1GNEA 1LU4A 4XTSA 3KP9A 1FW1A 4GSNA 1ZYQB 5CREA 4O7HA 3UAPA 1PD21 4ML6A 4HEA2 3LXZA 4F2IA 3LWAA 1BJXA 4N11A 2MBTA 5CRWA 4BL7B 2LSTA 4NWYA 2GQMA 4GQCA 1LBKA 1WP0A 2IL3A 4HZ4A 2PERA 2L6DA 2HSYA 1ACVA 3EE2A 4JE1A 2YCDA 3QDNA 1O6JA 3O3TA 4OO5A 2DIZA 4MK3A 1VRSD 3GSTA 4IKHA 1GTUA 3HA9A 4F03A 4KA0A 4CW9A 1QMVA 4BWSA 3TDGA 4EO3A 4IELA 4HOJA 4OMVA 1M9AA 2DJJA 1B48A 5F0GA 3G7IA 1AIUA 2C0FA 3MSZA 1X9SB 3HZ4A 4MJAA 2C0GA 1SK1A 1SENA 2HRKA 4KCAA 2PBJA 2HXKA 4O5UA 2FY6A 4G10A 2VLTA 4NHWA 3TRXA 1K0CA 3KTLA 3L78A 2OBIA 4FYUA 1PKWA 1HNAA 4KDUA 3J7Yb 1JZDA 3K8NA 2VL2C 4MJBA 4F9ZA 2YWIA 5B8BA 2YV9A 4RQXA 1FOVA 1WJKA 2JL4A 5HFGA 1XWAA 3UL3A 2CV4A 3TKRA 4FYBA 2H73A 3M8NA 2RIIA 2CZ2A 5IOWA 1MDIA 2R6KA 3QAWA 3E0UA 4YQVA 3FYGA 3LEFA 3QAGA 3VK9A 1H75A 3PR8A 2OADA 1K0NA 4AGSA 1OE7A 2AAWA 1U87A 17GSA 2GSRA 3HVNA 3P90A 4ZB9A 1EEJA 3FHKA 16GSA 1PN9A 2LS5A 3F3QA 1FG4A 2R0GA 1OC3A 5HQPA 4CY6A 1ZYNA 3EURA 1C72A 1THXA 1UN2A 4I5QA 4RUVA 2H74A 1RQMA 4POKA 4RI6A 4V2NA 2NDOA 3H79A 4EIQA 2YV7A 4JZQA 1TP9A 4LMVA 1NSWA 1SKRB 2IMFA 3UIWA 2L5LA 3CMIA 3I43A 4K1FA 4MF5A 3VWXA 5IMDA 3QR6A 4ECJA 4GSTA 1X5EA 3IK9A 4X0XA 1AUCA 2QA1A 3HJMA 5IOXA 3EWLA 5EL8A 4HU9A 4K0NA 2R3XA 4WXTA 2M72A 3FEUA 5KN2A 2AB6A 3GTUA 3KCMA 3QAVA 3DYRA 2ON5A 3ZVJD 4XRDA 3EYTA 3M3MA 3VPTA 2FWEA 3LG6A 4WR4A 4IBPA 1SK0A 4EXJA 3IHQA 1M7TA 4BA7A 2X99A 3SBCA 4ECBA 3FMWA 3QOUA 2QKEA 3V1WA 1HQOA 1AW9A 3FY7A 2FLSA 4PX1A 2BJXA 2LJRA 1Z9HA 3ZIVA 3L9UA 1F2EA 3UJ1A 2IMEA 3FZ4A 4LA1A 1A2LA 4TR1A 1ST9A 2P5QA 1R5PA 2OKAA 5ECMB 3ERGA 2H6XA 4IQAA 2JU5A 3PH9A 1FVJA 1Z7PA 3GTUB 4TR3A 5AIXA 4O32A 2ES7A 3KJYA 2H1BA 4XS4A 3F3RA 1VF1A 1PRXA 2WJUA 3VI5A 4E8HA 1A2MA 4Q5RA 1V9WA 5ECRB 4RI7A 4DSSA 2I3YA 4YAPA 4AF2A 3VWVA 4HSCX 1IYIA 4D73A 1WRYA 2H19A 1KEBA 2P31A 2JZRA 2K8VA 4Q5NA 3A5IA 4XS6A 4AJ7A 2WDUA 3FK8A 5KN3A 3TGZA 3IAS2 5CP1A 2GT5A 5EPFA 1AQXA 4N0ZA 2L5OA 2FD3A 3G7YA 3PPUA 3KH9A 1X5CA 2O85A 3IK7A 3IHGA 5BMUA 2MBSA 2B7KA 4XS4B 1KBNA 1XG8A 2RUEA 4TR4A 4IJIA 1OE8A 1WWJA 5LCZA 1SK2A 2L4CA 4DSSB 5IO2A 3GH6A 5AISA 2GDRA 4PUFC 3LSZA 5IIZA 1XZOA 4D73B 3U5RE 3O6TA 4IN0A 3IAM2 2UZ8A 5DAKA 2F8AA 4YQMA 1ZGNA 2B1LA 3O76A 2AHEA
chains in the Genus database with same CATH topology
5DCGA 1VF2A 4Z2TA 1F6MC 1PL1A 3TOUA 3GL5A 4TXOA 4YKFA 1DUGA 3F4TA 4TKYA 1SD9A 19GSA 3RPPA 3MDKA 1XWGA 4GSSA 2FA8A 2K9FA 2K18A 2GSQA 3UBKA 3IOSA 1TI1A 5JWRB 2ALBA 2B1KA 5DAKB 3ZLPA 2VL2A 3Q6OA 5CO3A 2NBSA 1XPVA 1S3DA 1T00A 5KOWA 4YH2A 1E6BA 4AJ8A 3EPTA 2PMTA 3HY2A 5LD0A 1XVWA 2FHEA 5HR0A 1U3AA 1EEMA 1SJIA 2O89A 4FQUA 4N0VA 2E7PA 1N2AA 1AAZA 3R2QA 2HI7A 2Z9SA 1S3AA 3HCZA 3M9JA 3MNGA 3ZFLA 2V32A 3UMAA 3WT2A 1V2AA 1T8EB 2VCZA 1GTIA 2E2MA 3TKSC 2R0PA 3D4TA 4BVYA 2B3SA 3TB2A 3ZMLA 1GUKA 3VLNA 3DRNA 4FIWA 4MF7A 4Z2UA 2YJ7A 4MPFA 3P8WA 1XOAA 1O7UA 2DJ1A 4L0UA 5AN1A 10GSA 2WCIA 1BYEA 5B8AA 2DJ3A 5HFIA 5GAPD 4Q5QA 4RQRA 5ECQB 3G7JA 4PXOA 1XIYA 1Y25A 1VF4A 4MLYA 1XWKA 2HT9A 1XW6A 1BX9A 4O5QA 5F07A 2LEGA 4I2UA 1KNGA 2C3NA 2V2GA 4FYCA 3APOA 4JR6A 2WFCA 3VWUA 4ID0A 4BVYB 2F3MA 4TN8A 1OVNA 4N30A 4P3YB 2NPBA 2MYGA 4ZXGA 2HRNA 1ERTA 2H75A 3ED3A 4MJEA 3H8QA 4LLRA 5A5KA 2TIRA 1T7PB 3WGXA 3H1NA 4EKZA 4GCIA 1X0RA 5GAND 2LRCA 3P2AA 1XW9A 4OD7A 2B7JA 4HZ2A 3TKQA 2H1AA 3L9SA 3UBLA 1A2JA 3EMPA 1A24A 4POLA 1ON4A 5AGYA 2IWTA 2GZZA 1V98A 1OKDA 5D9VA 6GSSA 3TOTA 1V57A 4JR4A 5F06A 2H1DA 1NM3A 1GUMA 4XS1A 4GLTA 4ZIJA 3GURA 2JSYA 5IMVA 2F9SA 1RW1A 3ZYWA 5IQYA 3GKNA 5H5SA 2NTOA 4PNFA 4KDYA 5ELGA 2GQKA 2N5BA 2O7KA 4GQFA 3VI7A 1NHOA 6GSXA 3LJRA 3WGEA 4IP6A 5IPHA 1MEKA 1TJDA 2V6KA 4GXZA 1CQGA 3H4KA 7GSSA 4ZBDA 3HJPA 4KF9A 3MIXA 3KMNA 2B5XA 2E2GA 1GSFA 1EGOA 2LUSA 3KIJA 2LQOA 5CNWA 1GP1A 1FB0A 2H76A 1ZZYA 2DC5A 2H70A 4J2FA 2RLIA 3DVWA 2C1YA 5JCGA 4O5RA 3RHBA 3DXBA 2A4VA 2OJLA 3F4SA 1G7OA 3CTFA 1EGRA 2VO4A 5ECIB 1Z5YE 1TOFA 2LV3A 1YDKA 5CRHA 3C1SA 5J9BA 2VCXA 2H6YA 2I9HA 3HXSA 1NW2A 2H72A 3W6GA 4G2EA 4IHUA 4KNDA 3IBHA 2OE3A 2REMA 3KMOA 4ZBBA 2KLXA 3N5OA 3HD5A 4IQ1A 1UA5A 1JZRA 5HR1A 2VLUA 5D93A 1WMJA 1MDJA 4KAEA 3GX0A 2C3TA 4V2MA 1SYXA 4X1UA 3A3TA 2QC7A 3IC4A 1G6YA 3GL3A 1SL1B 3GNJA 2PVOC 3FR3A 1F9MA 3ME8A 1V40A 4L0WA 2YOIA 1M9BA 2EIOA 3VURA 2IMKA 2H01A 1T3BA 4HJ2A 1O8XA 3EINA 2HLSA 5GZZB 3GX8A 2LTKA 5IMAA 4IS0A 1Z3EA 3UOMA 1M2AA 1ERWA 1GNWA 5D9WA 3W8JA 2YNXA 4EL1A 1QK8A 3C7MA 1GTAA 1THOA 3TKSA 4MF6A 1ML6A 4HUAA 2H66A 2CA8A 1T4ZA 3E3EA 4POMA 3D6IA 1DE2A 3LGCA 3LORA 3CTGA 3LYKA 4YAVA 4ZL8A 2FGXA 3DWVA 5G5EA 5JWQB 1OKTA 1SL2B 1EP8A 4WKWA 2G2QA 2KHPA 3UARA 2L57A 4WBRD 5C00A 3F6FA 2L6CA 3ZIJA 1OC8A 3KEBA 4BVXA 2HRFA 3GKXA 3LW9A 1EOHA 4OWYA 2OACA 20GSA 4NPBA 1S3CA 3HKRA 4YQUA 3KD0A 5KN0A 2DBCA 4G9HA 5ENUA 3IPZA 2VCTA 2MMNA 3LXTA 1QGVA 1T1VA 1KTEA 3FRCA 4K8MA 2XC2A 2C80A 4LL1B 2KP1A 4KB3A 5ABRA 1N8JA 3CXGA 4E8EA 3GRXA 4QL9A 3ZTLA 3UVTA 2VD0A 4K5RA 4BVXB 2O87A 1ZYEA 2VM2A 6GSUA 2GLRA 13GSA 4PNGA 1YEPA 4G0KA 2CVDA 2H30A 2RM6A 2ZNMA 2HRAA 1YY7A 2N5FA 2E0QA 1XBSA 3BCKA 3DIEA 2ZUPA 1B8XA 4I8BA 3H93A 1WOUA 1TKDB 1EV9A 5ELAA 3KGKA 3P7XA 4J57E 1BG5A 4K9ZA 2K6VA 2QA2A 1GULA 2DJ0A 1O73A 5F8BA 3Q18A 3ZRDA 3BCIA 3CSIA 3C73A 2QSIA 2DJ2A 4TR1B 2H0HA 3GMFA 2R2JA 2A2RA 4V1Ap 2GGTA 1ZMAA 5J9CA 4PQIA 4OFTA 3ISOA 3QFAC 5G5FA 5ID2A 3Q74A 3GSSA 5DQSA 4JBBA 1SKWB 5D8IA 1GSEA 4GWRA 4MPGA 3GYKA 3IA1A 3I69A 5DJLA 1EWXA 1DBYA 1JZWA 5D96A 1LJRA 5IM9A 4NV2A 14GSA 2LRTA 5AIVA 2H71A 1JZOA 5ECHB 5GSTA 2CX3A 4WBJA 2VM1A 3GA4A 4MH3A 2G0FA 2OE0A 2M80A 4PQ1A 3ZREA 2X64A 3US3A 4F0BA 1GSQA 4NAXA 1URMA 3CRTA 4I2TA 3HZ8A 3TUEA 3LFLA 4HQZA 3DEXA 4KH7A 1K3LA 1Y6EA 2LKUA 2FWGA 3M1GA 2DMMA 3HVSA 3DKSA 4DEJA 3Q19A 1A8YA 1G7EA 1SD8A 3QD9A 2OE1A 3NOFA 2B6MA 2PVQA 5DBQA 3LYPA 4KW6A 5IMFA 3FR9A 4OFMA 4HQSA 3U6VA 5EY6A 12GSA 4TXOB 1VGLA 5GSSA 4TW5A 1JHBA 1SYRA 4CY8A 3QPMA 3APQA 1YEXA 2N5AA 1GSSA 1K0BA 3ERWA 2MMZA 3I9V2 3NIVA 4EUYA 2IMIA 2JZTA 1M2DA 5INYA 2IPAA 1X5DA 22GSA 1U6TA 2CVBA 5HFKA 3DMLA 3GKKA 3DVXA 1PSQA 3LQ7A 3WD6A 2C8UA 4K7IA 3F0IA 4K0GA 1OYJA 3I6AA 4WEYA 2VIMA 3ZMKA 3CSHA 1UC7A 2KOKA 1TI3A 2YJHA 2I1UA 5DCHA 5ECKB 6GSWA 1U88A 2WS2A 5G1LA 1NHYA 2L4QA 2X8HA 1R7HA 2C0DA 3GIXA 1JLWA 3E9JB 2JACA 4GRFA 1IYHA 4ZB6A 4CDOA 1YJ6A 3IR4A 4A5PA 4N10A 3S9FA 2H6ZA 2H8LA 2VCWA 1M2BA 4Q5FA 1G0TA 2WB9A 2TRCP 1SKSB 3DGQA 3HJOA 5HR3A 1ERUA 3ERFA 1FOHA 1HYUA 3VPQA 3IDVA 1MD4A 1PKZA 2VAFA 5IPGA 4OCEA 3TJBA 4K7OA 1HNBA 3GHAA 3L0HA 2CX4A 2WZ9A 1QXHA 2X8GA 5FWGA 5E59A 1YQ1A 11GSA 2GS3A 4ECIA 3HHVA 3FZAA 1TRVA 1XOBA 2EIRA 1M99A 2DKHA 4ZL9A 2GT6A 4AJ6A 4YKGA 4KGIA 2V6OA 4ACSA 1F37A 2XBIA 2J9HA 5IMCA 3FZ5A 3TKPA 2B5YA 4L8EA 4IJ3A 1K3YA 2VUPA 5G2ZA 2F8FA 1A23A 1TXXA 4X4JA 4I97A 1EZKA 2WRTA 1BEDA 1F3AA 4K2DA 1QFNA 2CQ9A 2MMOA 4Z2RA 3IV4A 4HJMA 2AYTA 2O8VB 5J41A 1ZL9A 1U3IA 2GQLA 4MZCA 4K6XA 4WETA 2YZUA 1HD2A 2ON7A 2YZHA 4NHZA 3RDWA 2PGTA 2BMXA 2LQQA 5ECOB 3VFIA 1GLQA 1EOGA 4OO4A 5HR2A 2PUKC 4HS1A 4ICYA 1FB6A 1WIKA 3A5WA 1TTZA 1XCCA 2BTOT 4H86A 2HNLA 2PN8A 2H0IA 1B4PA 3IE3A 1MD3A 5IO0A 5A4WA 1R5AA 5KN1A 2KUCA 2X8CA 2C4JA 3CRUA 3JCML 4MH2A 2GTUA 1GSDA 3D0ZA 1YF0A 2P0GA 4KSMA 3RHCA 1FO5A 1Q4JA 2JZSA 4HDEA 3M0FA 5DQYA 5EVOA 5H5RA 4IP1A 4EDYA 4TR0A 5G31A 4ZB8A 4EC0A 4ISDA 3TJGA 3A2XA 3TJKA 3AY8A 3F8UA 1AC1A 5FHIA 1ERVA 3IC8A 2WULA 2DLXA 2KP2A 2EC4A 2LJKA 3IRAA 4PUAA 9GSSA 2CT6A 3HVXA 1Q98A 4MNNA 2HE3A 2X4AA 1PMTA 2DMLA 2XBQA 3TJFA 3TRPA 2DIYA 2PU9C 5J3RA 4K7NA 4EVMA 1AQVA 3QMXA 1RK4A 4MP4A 1PL2A 1DE1A 1Z6MA 4MJCA 1EP7A 4L5OA 1ZCPA 3BJ5A 1TRSA 3BBYA 2LRNA 4POBA 3UVHA 2GSSA 1Z6NA 3OR5A 4JU5A 4EF0A 4G0LA 3F63A 1MTCA 1W89A 5L71A 4KE3A 1GRXA 2GSTA 2VL3A 3EU4A 2QGVA 2PPTA 4PURA 5ECNB 4F82A 4NV5A 3ZL5A 3NZNA 3FR6A 1T4YA 4L5LA 2I4AA 4DSRA 2FNOA 5IMZA 1GSYA 3D5JA 1TW9A 4ULXA 1BQ7A 4MMMA 1XVQA 4DVCA 4MZWA 1GTBA 3EC3A 2IFQA 4LL4B 1AQWA 1XWBA 5A4UA 1EV4A 4HI7A 3KP8A 3N9JA 3KXOA 5KOXA 3DD3A 4QL7A 5F05A 4O92A 1GUHA 4KUNA 2FWFA 5FT3A 2L59A 3CSJA 3D4MA 3GN3A 2A4HA 2K8SA 1USBA 4J56E 5CAXA 4JEDA 3GV1A 1K0AA 4MZBA 2R5GA 2V41A 1XW5A 1SL0B 3BOAA 3PINA 2JADA 2IFQB 1GH2A 4TOPA 3HVVA 2XPEA 4PTSA 2X49A 1R4WA 4KSOA 2VLVA 1V58A 3TCOA 1QQ2A 4IGJA 3MAKA 1JLVA 1PQNA 5J4UA 2CAIA 4EDZA 1SJ6A 2HFDA 4ILFA 3VWWA 3APSA 4FO5A 4EIPA 2WGRA 1ZYPA 2VOCA 5ECPB 3CYNA 2AV4A 1F3BA 2XPDA 1PX7A 1ABAA 2RUFA 3EU3A 2EIQA 2R4VA 1FAAA 3QCPA 2YN1A 4ML1A 1YZXA 1WPIA 3QFBC 4X43A 5H5QA 1AXDA 1J08A 4G0IA 4V1Ag 5D9TA 4JRRA 2IJYA 3WYWA 1B9YC 2D2ZA 5CRDA 6GSVA 2AUVA 1K3OA 4K2XA 4MA9A 1TU8A 3GH9A 8GSSA 3C1RA 3G9BA 4EE0A 3BD2A 2IN3A 2HSMA 1TU7A 3CBUA 1GWCA 4MDCA 3KZQA 2OA7A 1X9MB 1TK0B 2AJQB 2GZYA 5J5NA 1OC9A 3L4NA 3L9VA 1WE0A 5DVBA 1W4VA 1XXUA 4OCFA 1UVZA 3FW2A 1OAZA 2HZEA 1A8LA 5B6NA 4BWQA 5COHA 3A2WA 1QUWA 4WR5A 4GF0A 5ECSA 1MDKA 2TRXA 3WGDA 5CRGA 3F9UA 4TVEA 3SWLA 5B6MA 4CHSA 5D73A 3A2VA 2F51A 3RAZA 3FZ9A 5ID2B 2YWOA 1TRWA 1TDIA 2I81A 4XRAA 1OC9B 4USSA 2HZEB 1BAYA 3FKFA 5C04A 3WT1A 2HYXA 1PN0A 4XCSA 4IVFA 2NVLA 3GKMA 4ZILA 2DKIA 5E4WA 5DDLA 2ZCTA 4GTUA 3ME7A 1G6WA 2FWHA 2LJAA 1DSBA 5JCUA 4TXVA 2MMAA 4MABA 2XHFA 1TRUA 1X9WB 1SJZA 4ECCA 2M46A 1HNCA 2YWNA 4K5SA 2LNSA 2MZCA 5LNKe 2GZPA 2DSAA 4BPYA 1K0OA 4WF4A 5BRTA 1CQHA 1SU9A 2CAQA 3UEMA 2H0GA 2VL9A 2H1GA 2VCVA 3TKSE 1O85A 1TK8B 3C71A 1B9XC 3F6DA 3TRQA 2A2PA 2YP6A 1R26A 3J7Yk 2RM5A 6GSYA 2YANA 4I6XA 3RPNA 2LNTA 1GSUA 6GSTA 5CYYA 2C0EA 2IMDA 1ILOA 1J0FA 4MCUA 5DJMA 4NMUA 2VD1A 4KX4A 1VF3A 1FVKA 1K0DA 4TRXA 1E2YA 2GVPA 2J23A 1YF1A 2P5RA 1PA3A 3D21A 3M9KA 1GL8A 1TK5B 1PGTA 1A0FA 1B4QA 1J9BA 4LMWA 1PX6A 4ZBAA 3ZZXA 4XIHA 3W8SA 1O8WA 3R3EA 3ZVJA 5G1KA 4FH8A 3ZFBA 3GFKA 3EMXA 1XWCA 3F4RA 2HSHA 4ZL7A 5A4VA 2V1MA 5KEJA 2R37A 3D22A 1XFLA 3IXRA 2OBKA 2IIYA 3MYDA 4KCEA 5JWOB 1YKCA 2JSZA 5B7CA 2FCHA 2PWJA 4F0CA 1H4OA 5DALA 1GLPA 1I5GA 4OFNA 2C3QA 1O81A 2B5EA 4WF5A 3MWHA 1YKAA 3KM6A 1ZOFA 3RBTA 1I9DA 2FUG2 1JFUA 3C8EA 3PGTA 2YWMA 3GUSA 2A2SA 1M0UA 4KDXA 5D9XA 2YPMA 2R0CA 1Z7RA 3HYPA 4V2LA 4Z7XA 3ZITA 4XHMA 2HZFA 5G30A 5JCWA 3TJJA 2VCQA 4QQ7A 4BL7A 4G19A 3EVIA 1A0RP 2DJKA 4PQHA 4NXIA 4PGTA 2CZ3A 5DALB 1K0MA 3KTBA 4IW9A 4HU7A 2FA4A 3HDCA 1FHEA 18GSA 4DSQA 5ECLB 2CVKA 3KH7A 1GNEA 1LU4A 4XTSA 3KP9A 1FW1A 4GSNA 1ZYQB 5CREA 4O7HA 3UAPA 1PD21 4ML6A 4HEA2 3LXZA 4F2IA 3LWAA 1BJXA 4N11A 2MBTA 5CRWA 4BL7B 2LSTA 4NWYA 2GQMA 4GQCA 1LBKA 1WP0A 2IL3A 4HZ4A 2PERA 2L6DA 2HSYA 1ACVA 3EE2A 4JE1A 2YCDA 3QDNA 1O6JA 3O3TA 4OO5A 2DIZA 4MK3A 1VRSD 3GSTA 4IKHA 1GTUA 3HA9A 4F03A 4KA0A 4CW9A 1QMVA 4BWSA 3TDGA 4EO3A 4IELA 4HOJA 4OMVA 1M9AA 2DJJA 1B48A 5F0GA 3G7IA 1AIUA 2C0FA 3MSZA 1X9SB 3HZ4A 4MJAA 2C0GA 1SK1A 1SENA 2HRKA 4KCAA 2PBJA 2HXKA 4O5UA 2FY6A 4G10A 2VLTA 4NHWA 3TRXA 1K0CA 3KTLA 3L78A 2OBIA 4FYUA 1PKWA 1HNAA 4KDUA 3J7Yb 1JZDA 3K8NA 2VL2C 4MJBA 4F9ZA 2YWIA 5B8BA 2YV9A 4RQXA 1FOVA 1WJKA 2JL4A 5HFGA 1XWAA 3UL3A 2CV4A 3TKRA 4FYBA 2H73A 3M8NA 2RIIA 2CZ2A 5IOWA 1MDIA 2R6KA 3QAWA 3E0UA 4YQVA 3FYGA 3LEFA 3QAGA 3VK9A 1H75A 3PR8A 2OADA 1K0NA 4AGSA 1OE7A 2AAWA 1U87A 17GSA 2GSRA 3P90A 4ZB9A 1EEJA 3FHKA 16GSA 1PN9A 2LS5A 3F3QA 1FG4A 2R0GA 1OC3A 5HQPA 4CY6A 1ZYNA 3EURA 1C72A 1THXA 1UN2A 4I5QA 4RUVA 2H74A 1RQMA 4POKA 4RI6A 4V2NA 2NDOA 3H79A 4EIQA 2YV7A 4JZQA 1TP9A 4LMVA 1NSWA 1SKRB 2IMFA 3UIWA 2L5LA 3CMIA 3I43A 4K1FA 4MF5A 3VWXA 5IMDA 3QR6A 4ECJA 4GSTA 1X5EA 3IK9A 4X0XA 1AUCA 2QA1A 3HJMA 5IOXA 3EWLA 5EL8A 4HU9A 4K0NA 2R3XA 4WXTA 2M72A 3FEUA 5KN2A 2AB6A 3GTUA 3KCMA 3QAVA 3DYRA 2ON5A 3ZVJD 4XRDA 3EYTA 3M3MA 3VPTA 2FWEA 3LG6A 4WR4A 4IBPA 1SK0A 4EXJA 3IHQA 1M7TA 4BA7A 2X99A 3SBCA 4ECBA 3FMWA 3QOUA 2QKEA 3V1WA 1HQOA 1AW9A 3FY7A 2FLSA 4PX1A 2BJXA 2LJRA 1Z9HA 3ZIVA 3L9UA 1F2EA 3UJ1A 2IMEA 3FZ4A 4LA1A 1A2LA 4TR1A 1ST9A 2P5QA 1R5PA 2OKAA 5ECMB 3ERGA 2H6XA 4IQAA 2JU5A 3PH9A 1FVJA 1Z7PA 3GTUB 4TR3A 5AIXA 4O32A 2ES7A 3KJYA 2H1BA 4XS4A 3F3RA 1VF1A 1PRXA 2WJUA 3VI5A 4E8HA 1A2MA 4Q5RA 1V9WA 5ECRB 4RI7A 4DSSA 2I3YA 4YAPA 4AF2A 3VWVA 1IYIA 4D73A 1WRYA 2H19A 1KEBA 2P31A 2JZRA 2K8VA 4Q5NA 3A5IA 4XS6A 4AJ7A 2WDUA 3FK8A 5KN3A 3TGZA 3IAS2 5CP1A 2GT5A 5EPFA 1AQXA 4N0ZA 2L5OA 2FD3A 3G7YA 3PPUA 3KH9A 1X5CA 2O85A 3IK7A 3IHGA 5BMUA 2MBSA 2B7KA 4XS4B 1KBNA 2RUEA 4TR4A 4IJIA 1OE8A 1WWJA 5LCZA 1SK2A 2L4CA 4DSSB 5IO2A 3GH6A 5AISA 2GDRA 4PUFC 3LSZA 5IIZA 1XZOA 4D73B 3U5RE 3O6TA 4IN0A 3IAM2 2UZ8A 5DAKA 2F8AA 4YQMA 1ZGNA 2B1LA 3O76A 2AHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DCG A;  1VF2 A;  1F6M C;  1PL1 A;  3TOU A;  3GL5 A;  4TXO A;  1DUG A;  3F4T A;  4TKY A;  1SD9 A;  19GS A;  3RPP A;  3MDK A;  1XWG A;  4GSS A;  2FA8 A;  2K9F A;  2K18 A;  2GSQ A;  3UBK A;  3IOS A;  1TI1 A;  5JWR B;  2ALB A;  2B1K A;  5DAK B;  3ZLP A;  2VL2 A;  3Q6O A;  5CO3 A;  2NBS A;  1XPV A;  1S3D A;  1T00 A;  4YH2 A;  1E6B A;  4AJ8 A;  2PMT A;  3HY2 A;  5LD0 A;  1XVW A;  2FHE A;  5HR0 A;  1U3A A;  1EEM A;  1SJI A;  2O89 A;  4N0V A;  2E7P A;  1N2A A;  1AAZ A;  3R2Q A;  2HI7 A;  2Z9S A;  1S3A A;  3HCZ A;  3M9J A;  3MNG A;  3ZFL A;  2V32 A;  3UMA A;  3WT2 A;  1V2A A;  1T8E B;  2VCZ A;  1GTI A;  2E2M A;  3TKS C;  3D4T A;  4BVY A;  2B3S A;  3TB2 A;  3ZML A;  1GUK A;  3VLN A;  3DRN A;  4FIW A;  4MF7 A;  2YJ7 A;  4MPF A;  3P8W A;  1XOA A;  1O7U A;  2DJ1 A;  4L0U A;  5AN1 A;  10GS A;  2WCI A;  1BYE A;  5B8A A;  2DJ3 A;  5HFI A;  5GAP D;  4Q5Q A;  4RQR A;  5ECQ B;  3G7J A;  4PXO A;  1XIY A;  1Y25 A;  1VF4 A;  4MLY A;  1XWK A;  2HT9 A;  1XW6 A;  1BX9 A;  5F07 A;  2LEG A;  4I2U A;  1KNG A;  2C3N A;  2V2G A;  4FYC A;  3APO A;  4JR6 A;  2WFC A;  3VWU A;  4ID0 A;  2F3M A;  4TN8 A;  1OVN A;  4N30 A;  4P3Y B;  2NPB A;  2MYG A;  4ZXG A;  2HRN A;  1ERT A;  2H75 A;  3ED3 A;  4MJE A;  3H8Q A;  4LLR A;  5A5K A;  2TIR A;  1T7P B;  3WGX A;  3H1N A;  4EKZ A;  4GCI A;  1X0R A;  5GAN D;  2LRC A;  3P2A A;  1XW9 A;  4OD7 A;  2B7J A;  4HZ2 A;  3TKQ A;  2H1A A;  3L9S A;  3UBL A;  1A2J A;  3EMP A;  1A24 A;  4POL A;  1ON4 A;  5AGY A;  2IWT A;  2GZZ A;  1V98 A;  1OKD A;  5D9V A;  6GSS A;  3TOT A;  1V57 A;  4JR4 A;  5F06 A;  2H1D A;  1NM3 A;  1GUM A;  4XS1 A;  4GLT A;  4ZIJ A;  3GUR A;  2JSY A;  5IMV A;  2F9S A;  1RW1 A;  3ZYW A;  5IQY A;  3GKN A;  5H5S A;  2NTO A;  4PNF A;  4KDY A;  5ELG A;  2GQK A;  2N5B A;  2O7K A;  4GQF A;  3VI7 A;  1NHO A;  6GSX A;  3LJR A;  3WGE A;  4IP6 A;  5IPH A;  1MEK A;  1TJD A;  2V6K A;  4GXZ A;  1CQG A;  3H4K A;  7GSS A;  4ZBD A;  3HJP A;  3KMN A;  2B5X A;  2E2G A;  1GSF A;  1EGO A;  2LUS A;  3KIJ A;  2LQO A;  5CNW A;  1GP1 A;  1FB0 A;  2H76 A;  1ZZY A;  2DC5 A;  2H70 A;  4J2F A;  2RLI A;  3DVW A;  2C1Y A;  5JCG A;  4O5R A;  3RHB A;  3DXB A;  2A4V A;  2OJL A;  3F4S A;  1G7O A;  3CTF A;  1EGR A;  2VO4 A;  5ECI B;  1Z5Y E;  1TOF A;  2LV3 A;  1YDK A;  5CRH A;  3C1S A;  5J9B A;  2VCX A;  2H6Y A;  2I9H A;  3HXS A;  1NW2 A;  2H72 A;  3W6G A;  4G2E A;  4IHU A;  4KND A;  3IBH A;  2OE3 A;  2REM A;  3KMO A;  4ZBB A;  2KLX A;  3N5O A;  3HD5 A;  4IQ1 A;  1UA5 A;  1JZR A;  5HR1 A;  2VLU A;  5D93 A;  1WMJ A;  1MDJ A;  4KAE A;  3GX0 A;  2C3T A;  4V2M A;  1SYX A;  4X1U A;  3A3T A;  2QC7 A;  3IC4 A;  1G6Y A;  3GL3 A;  1SL1 B;  3GNJ A;  2PVO C;  3FR3 A;  1F9M A;  3ME8 A;  1V40 A;  4L0W A;  2YOI A;  1M9B A;  2EIO A;  3VUR A;  2IMK A;  2H01 A;  1T3B A;  4HJ2 A;  1O8X A;  3EIN A;  2HLS A;  5GZZ B;  3GX8 A;  2LTK A;  5IMA A;  4IS0 A;  1Z3E A;  3UOM A;  1M2A A;  1ERW A;  1GNW A;  5D9W A;  3W8J A;  2YNX A;  4EL1 A;  1QK8 A;  3C7M A;  1GTA A;  1THO A;  3TKS A;  4MF6 A;  1ML6 A;  4HUA A;  2H66 A;  2CA8 A;  1T4Z A;  3E3E A;  4POM A;  3D6I A;  1DE2 A;  3LGC A;  3LOR A;  3CTG A;  3LYK A;  4YAV A;  4ZL8 A;  2FGX A;  3DWV A;  5G5E A;  5JWQ B;  1OKT A;  1SL2 B;  1EP8 A;  4WKW A;  2G2Q A;  2KHP A;  3UAR A;  2L57 A;  4WBR D;  5C00 A;  3F6F A;  2L6C A;  3ZIJ A;  1OC8 A;  3KEB A;  4BVX A;  2HRF A;  3GKX A;  1EOH A;  4OWY A;  2OAC A;  20GS A;  4NPB A;  1S3C A;  3HKR A;  4YQU A;  3KD0 A;  5KN0 A;  2DBC A;  4G9H A;  5ENU A;  3IPZ A;  2VCT A;  2MMN A;  3LXT A;  1QGV A;  1T1V A;  1KTE A;  3FRC A;  4K8M A;  2XC2 A;  2C80 A;  4LL1 B;  2KP1 A;  4KB3 A;  5ABR A;  1N8J A;  3CXG A;  4E8E A;  3GRX A;  4QL9 A;  3ZTL A;  3UVT A;  2VD0 A;  2O87 A;  1ZYE A;  2VM2 A;  6GSU A;  2GLR A;  13GS A;  4PNG A;  1YEP A;  2CVD A;  2H30 A;  2RM6 A;  2ZNM A;  1YY7 A;  2N5F A;  2E0Q A;  1XBS A;  3BCK A;  3DIE A;  2ZUP A;  1B8X A;  4I8B A;  3H93 A;  1WOU A;  1TKD B;  1EV9 A;  5ELA A;  3KGK A;  3P7X A;  4J57 E;  1BG5 A;  4K9Z A;  2K6V A;  1GUL A;  2DJ0 A;  1O73 A;  5F8B A;  3Q18 A;  3ZRD A;  3BCI A;  3CSI A;  3C73 A;  2QSI A;  2DJ2 A;  4TR1 B;  2H0H A;  3GMF A;  2R2J A;  2A2R A;  4V1A p;  2GGT A;  1ZMA A;  5J9C A;  4PQI A;  4OFT A;  3ISO A;  3QFA C;  5G5F A;  5ID2 A;  3Q74 A;  3GSS A;  5DQS A;  4JBB A;  1SKW B;  5D8I A;  1GSE A;  4GWR A;  4MPG A;  3GYK A;  3IA1 A;  3I69 A;  5DJL A;  1EWX A;  1DBY A;  1JZW A;  5D96 A;  1LJR A;  5IM9 A;  4NV2 A;  14GS A;  2LRT A;  5AIV A;  2H71 A;  1JZO A;  5ECH B;  5GST A;  2CX3 A;  4WBJ A;  2VM1 A;  3GA4 A;  4MH3 A;  2G0F A;  2OE0 A;  2M80 A;  4PQ1 A;  3ZRE A;  2X64 A;  3US3 A;  4F0B A;  1GSQ A;  4NAX A;  1URM A;  3CRT A;  4I2T A;  3HZ8 A;  3TUE A;  3LFL A;  4HQZ A;  3DEX A;  4KH7 A;  1K3L A;  1Y6E A;  2LKU A;  2FWG A;  3M1G A;  2DMM A;  3HVS A;  3DKS A;  4DEJ A;  3Q19 A;  1A8Y A;  1G7E A;  1SD8 A;  3QD9 A;  2OE1 A;  3NOF A;  2B6M A;  2PVQ A;  5DBQ A;  3LYP A;  4KW6 A;  5IMF A;  3FR9 A;  4OFM A;  4HQS A;  3U6V A;  5EY6 A;  12GS A;  4TXO B;  1VGL A;  5GSS A;  4TW5 A;  1JHB A;  1SYR A;  3QPM A;  3APQ A;  1YEX A;  2N5A A;  1GSS A;  1K0B A;  3ERW A;  2MMZ A;  3I9V 2;  3NIV A;  4EUY A;  2IMI A;  2JZT A;  1M2D A;  5INY A;  2IPA A;  1X5D A;  22GS A;  1U6T A;  2CVB A;  5HFK A;  3DML A;  3GKK A;  3DVX A;  1PSQ A;  3LQ7 A;  3WD6 A;  2C8U A;  4K7I A;  3F0I A;  4K0G A;  1OYJ A;  3I6A A;  4WEY A;  2VIM A;  3ZMK A;  3CSH A;  1UC7 A;  2KOK A;  1TI3 A;  2YJH A;  2I1U A;  5DCH A;  5ECK B;  6GSW A;  1U88 A;  2WS2 A;  5G1L A;  1NHY A;  2L4Q A;  2X8H A;  1R7H A;  2C0D A;  3GIX A;  1JLW A;  3E9J B;  2JAC A;  4GRF A;  1IYH A;  4ZB6 A;  4CDO A;  1YJ6 A;  3IR4 A;  4N10 A;  3S9F A;  2H6Z A;  2H8L A;  2VCW A;  1M2B A;  4Q5F A;  1G0T A;  2WB9 A;  2TRC P;  1SKS B;  3DGQ A;  3HJO A;  5HR3 A;  1ERU A;  3ERF A;  1HYU A;  3VPQ A;  3IDV A;  1MD4 A;  1PKZ A;  2VAF A;  5IPG A;  4OCE A;  3TJB A;  4K7O A;  1HNB A;  3GHA A;  3L0H A;  2CX4 A;  2WZ9 A;  1QXH A;  2X8G A;  5FWG A;  5E59 A;  1YQ1 A;  11GS A;  2GS3 A;  4ECI A;  3HHV A;  3FZA A;  1TRV A;  1XOB A;  2EIR A;  1M99 A;  4ZL9 A;  2GT6 A;  4AJ6 A;  4KGI A;  2V6O A;  4ACS A;  1F37 A;  2XBI A;  2J9H A;  5IMC A;  3FZ5 A;  3TKP A;  2B5Y A;  4L8E A;  4IJ3 A;  1K3Y A;  2VUP A;  5G2Z A;  2F8F A;  1A23 A;  1TXX A;  4I97 A;  1EZK A;  2WRT A;  1BED A;  1F3A A;  4K2D A;  1QFN A;  2CQ9 A;  2MMO A;  3IV4 A;  4HJM A;  2AYT A;  2O8V B;  5J41 A;  1ZL9 A;  1U3I A;  2GQL A;  4MZC A;  4K6X A;  4WET A;  2YZU A;  1HD2 A;  2ON7 A;  2YZH A;  4NHZ A;  3RDW A;  2PGT A;  2BMX A;  2LQQ A;  5ECO B;  3VFI A;  1GLQ A;  1EOG A;  4OO4 A;  5HR2 A;  2PUK C;  4HS1 A;  1FB6 A;  1WIK A;  3A5W A;  1TTZ A;  1XCC A;  2BTO T;  4H86 A;  2HNL A;  2PN8 A;  2H0I A;  1B4P A;  3IE3 A;  1MD3 A;  5IO0 A;  5A4W A;  1R5A A;  5KN1 A;  2KUC A;  2X8C A;  2C4J A;  3CRU A;  3JCM L;  4MH2 A;  2GTU A;  1GSD A;  3D0Z A;  1YF0 A;  2P0G A;  4KSM A;  3RHC A;  1FO5 A;  1Q4J A;  2JZS A;  4HDE A;  3M0F A;  5DQY A;  5EVO A;  5H5R A;  4IP1 A;  4EDY A;  4TR0 A;  5G31 A;  4ZB8 A;  4EC0 A;  4ISD A;  3TJG A;  3A2X A;  3TJK A;  3AY8 A;  3F8U A;  1AC1 A;  5FHI A;  1ERV A;  2WUL A;  2DLX A;  2KP2 A;  2EC4 A;  2LJK A;  3IRA A;  4PUA A;  9GSS A;  2CT6 A;  3HVX A;  1Q98 A;  2HE3 A;  1PMT A;  2DML A;  2XBQ A;  3TJF A;  3TRP A;  2DIY A;  2PU9 C;  5J3R A;  4K7N A;  4EVM A;  1AQV A;  3QMX A;  1RK4 A;  4MP4 A;  1PL2 A;  1DE1 A;  1Z6M A;  4MJC A;  1EP7 A;  4L5O A;  1ZCP A;  3BJ5 A;  1TRS A;  3BBY A;  2LRN A;  4POB A;  3UVH A;  2GSS A;  1Z6N A;  3OR5 A;  4JU5 A;  4EF0 A;  3F63 A;  1MTC A;  1W89 A;  5L71 A;  4KE3 A;  1GRX A;  2GST A;  2VL3 A;  3EU4 A;  2QGV A;  2PPT A;  4PUR A;  5ECN B;  4F82 A;  4NV5 A;  3ZL5 A;  3NZN A;  3FR6 A;  1T4Y A;  4L5L A;  2I4A A;  4DSR A;  2FNO A;  5IMZ A;  1GSY A;  3D5J A;  1TW9 A;  4ULX A;  1BQ7 A;  4MMM A;  1XVQ A;  4DVC A;  4MZW A;  1GTB A;  3EC3 A;  2IFQ A;  4LL4 B;  1AQW A;  1XWB A;  5A4U A;  1EV4 A;  4HI7 A;  3KP8 A;  3N9J A;  3KXO A;  3DD3 A;  4QL7 A;  5F05 A;  4O92 A;  1GUH A;  4KUN A;  2FWF A;  5FT3 A;  2L59 A;  3CSJ A;  3D4M A;  3GN3 A;  2K8S A;  1USB A;  4J56 E;  5CAX A;  4JED A;  3GV1 A;  1K0A A;  4MZB A;  2R5G A;  2V41 A;  1XW5 A;  1SL0 B;  3BOA A;  3PIN A;  2JAD A;  2IFQ B;  1GH2 A;  4TOP A;  3HVV A;  2XPE A;  1R4W A;  4KSO A;  2VLV A;  1V58 A;  3TCO A;  1QQ2 A;  4IGJ A;  3MAK A;  1JLV A;  1PQN A;  5J4U A;  2CAI A;  4EDZ A;  1SJ6 A;  2HFD A;  4ILF A;  3VWW A;  3APS A;  4FO5 A;  2WGR A;  2VOC A;  5ECP B;  3CYN A;  2AV4 A;  1F3B A;  2XPD A;  1PX7 A;  1ABA A;  2RUF A;  3EU3 A;  2EIQ A;  2R4V A;  1FAA A;  3QCP A;  2YN1 A;  4ML1 A;  1YZX A;  1WPI A;  3QFB C;  4X43 A;  5H5Q A;  1AXD A;  1J08 A;  4V1A g;  5D9T A;  4JRR A;  2IJY A;  3WYW A;  1B9Y C;  2D2Z A;  5CRD A;  6GSV A;  2AUV A;  1K3O A;  4MA9 A;  1TU8 A;  3GH9 A;  8GSS A;  3C1R A;  3G9B A;  4EE0 A;  3BD2 A;  2IN3 A;  1TU7 A;  3CBU A;  1GWC A;  4MDC A;  3KZQ A;  2OA7 A;  1X9M B;  1TK0 B;  2AJQ B;  2GZY A;  5J5N A;  1OC9 A;  3L4N A;  3L9V A;  1WE0 A;  5DVB A;  1W4V A;  1XXU A;  4OCF A;  1UVZ A;  3FW2 A;  1OAZ A;  2HZE A;  1A8L A;  5B6N A;  4BWQ A;  5COH A;  3A2W A;  1QUW A;  4WR5 A;  4GF0 A;  5ECS A;  1MDK A;  2TRX A;  3WGD A;  5CRG A;  3F9U A;  4TVE A;  3SWL A;  5B6M A;  4CHS A;  5D73 A;  3A2V A;  2F51 A;  3RAZ A;  3FZ9 A;  5ID2 B;  2YWO A;  1TRW A;  1TDI A;  2I81 A;  4XRA A;  1OC9 B;  2HZE B;  1BAY A;  3FKF A;  5C04 A;  3WT1 A;  2HYX A;  4XCS A;  4IVF A;  2NVL A;  3GKM A;  4ZIL A;  5E4W A;  5DDL A;  2ZCT A;  4GTU A;  3ME7 A;  1G6W A;  2FWH A;  2LJA A;  1DSB A;  5JCU A;  4TXV A;  2MMA A;  4MAB A;  2XHF A;  1TRU A;  1X9W B;  1SJZ A;  4ECC A;  2M46 A;  1HNC A;  2YWN A;  2LNS A;  2MZC A;  5LNK e;  2GZP A;  2DSA A;  4BPY A;  1K0O A;  4WF4 A;  1CQH A;  1SU9 A;  2CAQ A;  3UEM A;  2H0G A;  2VL9 A;  2H1G A;  2VCV A;  3TKS E;  1O85 A;  1TK8 B;  3C71 A;  1B9X C;  3F6D A;  3TRQ A;  2YP6 A;  1R26 A;  3J7Y k;  2RM5 A;  6GSY A;  2YAN A;  4I6X A;  3RPN A;  2LNT A;  1GSU A;  6GST A;  5CYY A;  2C0E A;  2IMD A;  1ILO A;  1J0F A;  4MCU A;  5DJM A;  4NMU A;  2VD1 A;  4KX4 A;  1VF3 A;  1FVK A;  1K0D A;  4TRX A;  1E2Y A;  2GVP A;  2J23 A;  1YF1 A;  2P5R A;  1PA3 A;  3D21 A;  3M9K A;  1GL8 A;  1TK5 B;  1PGT A;  1A0F A;  1B4Q A;  1J9B A;  4LMW A;  1PX6 A;  4ZBA A;  3ZZX A;  4XIH A;  3W8S A;  1O8W A;  3ZVJ A;  5G1K A;  4FH8 A;  3ZFB A;  3GFK A;  3EMX A;  1XWC A;  3F4R A;  2HSH A;  4ZL7 A;  5A4V A;  2V1M A;  5KEJ A;  2R37 A;  3D22 A;  1XFL A;  3IXR A;  2OBK A;  2IIY A;  4KCE A;  5JWO B;  1YKC A;  2JSZ A;  5B7C A;  2FCH A;  2PWJ A;  4F0C A;  1H4O A;  5DAL A;  1GLP A;  1I5G A;  4OFN A;  2C3Q A;  1O81 A;  2B5E A;  4WF5 A;  3MWH A;  1YKA A;  3KM6 A;  1ZOF A;  3RBT A;  1I9D A;  2FUG 2;  1JFU A;  3C8E A;  3PGT A;  2YWM A;  3GUS A;  2A2S A;  1M0U A;  5D9X A;  4KDX A;  2YPM A;  1Z7R A;  3HYP A;  4V2L A;  4Z7X A;  3ZIT A;  4XHM A;  2HZF A;  5G30 A;  5JCW A;  3TJJ A;  2VCQ A;  4QQ7 A;  4BL7 A;  4G19 A;  3EVI A;  1A0R P;  2DJK A;  4PQH A;  4NXI A;  4PGT A;  2CZ3 A;  5DAL B;  1K0M A;  3KTB A;  4IW9 A;  4HU7 A;  2FA4 A;  3HDC A;  1FHE A;  18GS A;  4DSQ A;  5ECL B;  2CVK A;  3KH7 A;  1GNE A;  1LU4 A;  4XTS A;  3KP9 A;  1FW1 A;  4GSN A;  1ZYQ B;  5CRE A;  4O7H A;  3UAP A;  1PD2 1;  4ML6 A;  4HEA 2;  3LXZ A;  4F2I A;  3LWA A;  1BJX A;  4N11 A;  2MBT A;  5CRW A;  2LST A;  4NWY A;  2GQM A;  4GQC A;  1LBK A;  1WP0 A;  2IL3 A;  4HZ4 A;  2PER A;  2L6D A;  2HSY A;  1ACV A;  3EE2 A;  4JE1 A;  2YCD A;  3QDN A;  1O6J A;  3O3T A;  4OO5 A;  2DIZ A;  4MK3 A;  1VRS D;  3GST A;  4IKH A;  1GTU A;  3HA9 A;  4F03 A;  4KA0 A;  4CW9 A;  1QMV A;  4BWS A;  3TDG A;  4EO3 A;  4IEL A;  4HOJ A;  4OMV A;  1M9A A;  2DJJ A;  1B48 A;  5F0G A;  3G7I A;  1AIU A;  2C0F A;  3MSZ A;  1X9S B;  3HZ4 A;  4MJA A;  2C0G A;  1SK1 A;  1SEN A;  4KCA A;  2PBJ A;  2HXK A;  2FY6 A;  4G10 A;  2VLT A;  4NHW A;  3TRX A;  1K0C A;  3KTL A;  3L78 A;  2OBI A;  4FYU A;  1PKW A;  1HNA A;  4KDU A;  3J7Y b;  1JZD A;  3K8N A;  2VL2 C;  4MJB A;  4F9Z A;  2YWI A;  5B8B A;  2YV9 A;  4RQX A;  1FOV A;  1WJK A;  2JL4 A;  5HFG A;  1XWA A;  3UL3 A;  2CV4 A;  3TKR A;  4FYB A;  2H73 A;  3M8N A;  2RII A;  2CZ2 A;  5IOW A;  1MDI A;  2R6K A;  3QAW A;  3E0U A;  4YQV A;  3FYG A;  3LEF A;  3QAG A;  3VK9 A;  1H75 A;  3PR8 A;  2OAD A;  1K0N A;  4AGS A;  1OE7 A;  2AAW A;  1U87 A;  17GS A;  2GSR A;  3P90 A;  4ZB9 A;  1EEJ A;  3FHK A;  16GS A;  1PN9 A;  2LS5 A;  3F3Q A;  1FG4 A;  1OC3 A;  5HQP A;  3EUR A;  1C72 A;  1THX A;  1UN2 A;  4I5Q A;  4RUV A;  2H74 A;  1RQM A;  4POK A;  4RI6 A;  4V2N A;  2NDO A;  3H79 A;  2YV7 A;  4JZQ A;  1TP9 A;  4LMV A;  1NSW A;  1SKR B;  2IMF A;  3UIW A;  2L5L A;  3CMI A;  3I43 A;  4K1F A;  4MF5 A;  3VWX A;  5IMD A;  3QR6 A;  4ECJ A;  4GST A;  1X5E A;  3IK9 A;  4X0X A;  1AUC A;  3HJM A;  5IOX A;  3EWL A;  5EL8 A;  4HU9 A;  4K0N A;  2R3X A;  4WXT A;  2M72 A;  3FEU A;  5KN2 A;  2AB6 A;  3GTU A;  3KCM A;  3QAV A;  3DYR A;  2ON5 A;  3ZVJ D;  4XRD A;  3EYT A;  3M3M A;  3VPT A;  2FWE A;  3LG6 A;  4WR4 A;  4IBP A;  1SK0 A;  4EXJ A;  3IHQ A;  1M7T A;  4BA7 A;  2X99 A;  3SBC A;  4ECB A;  3QOU A;  2QKE A;  3V1W A;  1HQO A;  1AW9 A;  3FY7 A;  2FLS A;  4PX1 A;  2BJX A;  2LJR A;  1Z9H A;  3ZIV A;  3L9U A;  1F2E A;  3UJ1 A;  2IME A;  3FZ4 A;  4LA1 A;  1A2L A;  4TR1 A;  1ST9 A;  2P5Q A;  1R5P A;  2OKA A;  5ECM B;  3ERG A;  2H6X A;  4IQA A;  2JU5 A;  3PH9 A;  1FVJ A;  1Z7P A;  3GTU B;  4TR3 A;  5AIX A;  4O32 A;  2ES7 A;  3KJY A;  2H1B A;  4XS4 A;  3F3R A;  1VF1 A;  1PRX A;  2WJU A;  3VI5 A;  4E8H A;  1A2M A;  4Q5R A;  1V9W A;  5ECR B;  4RI7 A;  4DSS A;  2I3Y A;  4YAP A;  4AF2 A;  3VWV A;  1IYI A;  4D73 A;  1WRY A;  2H19 A;  1KEB A;  2P31 A;  2JZR A;  2K8V A;  4Q5N A;  4XS6 A;  4AJ7 A;  2WDU A;  3FK8 A;  5KN3 A;  3TGZ A;  3IAS 2;  5CP1 A;  2GT5 A;  5EPF A;  1AQX A;  4N0Z A;  2L5O A;  2FD3 A;  3G7Y A;  3KH9 A;  1X5C A;  2O85 A;  3IK7 A;  2MBS A;  2B7K A;  4XS4 B;  1KBN A;  2RUE A;  4TR4 A;  4IJI A;  1OE8 A;  1WWJ A;  5LCZ A;  1SK2 A;  2L4C A;  4DSS B;  5IO2 A;  3GH6 A;  5AIS A;  2GDR A;  4PUF C;  3LSZ A;  5IIZ A;  1XZO A;  4D73 B;  3U5R E;  3O6T A;  4IN0 A;  3IAM 2;  5DAK A;  2F8A A;  4YQM A;  1ZGN A;  2B1L A;  3O76 A;  2AHE A; 
#chains in the Genus database with same CATH topology
 5DCG A;  1VF2 A;  4Z2T A;  1F6M C;  1PL1 A;  3TOU A;  3GL5 A;  4TXO A;  4YKF A;  1DUG A;  3F4T A;  4TKY A;  1SD9 A;  19GS A;  3RPP A;  3MDK A;  1XWG A;  4GSS A;  2FA8 A;  2K9F A;  2K18 A;  2GSQ A;  3UBK A;  3IOS A;  1TI1 A;  5JWR B;  2ALB A;  2B1K A;  5DAK B;  3ZLP A;  2VL2 A;  3Q6O A;  5CO3 A;  2NBS A;  1XPV A;  1S3D A;  1T00 A;  5KOW A;  4YH2 A;  1E6B A;  4AJ8 A;  3EPT A;  2PMT A;  3HY2 A;  5LD0 A;  1XVW A;  2FHE A;  5HR0 A;  1U3A A;  1EEM A;  1SJI A;  2O89 A;  4FQU A;  4N0V A;  2E7P A;  1N2A A;  1AAZ A;  3R2Q A;  2HI7 A;  2Z9S A;  1S3A A;  3HCZ A;  3M9J A;  3MNG A;  3ZFL A;  2V32 A;  3UMA A;  3WT2 A;  1V2A A;  1T8E B;  2VCZ A;  1GTI A;  2E2M A;  3TKS C;  2R0P A;  3D4T A;  4BVY A;  2B3S A;  3TB2 A;  3ZML A;  1GUK A;  3VLN A;  3DRN A;  4FIW A;  4MF7 A;  4Z2U A;  2YJ7 A;  4MPF A;  3P8W A;  1XOA A;  1O7U A;  2DJ1 A;  4L0U A;  5AN1 A;  10GS A;  2WCI A;  1BYE A;  5B8A A;  2DJ3 A;  5HFI A;  5GAP D;  4Q5Q A;  4RQR A;  5ECQ B;  3G7J A;  4PXO A;  1XIY A;  1Y25 A;  1VF4 A;  4MLY A;  1XWK A;  2HT9 A;  1XW6 A;  1BX9 A;  4O5Q A;  5F07 A;  2LEG A;  4I2U A;  1KNG A;  2C3N A;  2V2G A;  4FYC A;  3APO A;  4JR6 A;  2WFC A;  3VWU A;  4ID0 A;  4BVY B;  2F3M A;  4TN8 A;  1OVN A;  4N30 A;  4P3Y B;  2NPB A;  2MYG A;  4ZXG A;  2HRN A;  1ERT A;  2H75 A;  3ED3 A;  4MJE A;  3H8Q A;  4LLR A;  5A5K A;  2TIR A;  1T7P B;  3WGX A;  3H1N A;  4EKZ A;  4GCI A;  1X0R A;  5GAN D;  2LRC A;  3P2A A;  1XW9 A;  4OD7 A;  2B7J A;  4HZ2 A;  3TKQ A;  2H1A A;  3L9S A;  3UBL A;  1A2J A;  3EMP A;  1A24 A;  4POL A;  1ON4 A;  5AGY A;  2IWT A;  2GZZ A;  1V98 A;  1OKD A;  5D9V A;  6GSS A;  3TOT A;  1V57 A;  4JR4 A;  5F06 A;  2H1D A;  1NM3 A;  1GUM A;  4XS1 A;  4GLT A;  4ZIJ A;  3GUR A;  2JSY A;  5IMV A;  2F9S A;  1RW1 A;  3ZYW A;  5IQY A;  3GKN A;  5H5S A;  2NTO A;  4PNF A;  4KDY A;  5ELG A;  2GQK A;  2N5B A;  2O7K A;  4GQF A;  3VI7 A;  1NHO A;  6GSX A;  3LJR A;  3WGE A;  4IP6 A;  5IPH A;  1MEK A;  1TJD A;  2V6K A;  4GXZ A;  1CQG A;  3H4K A;  7GSS A;  4ZBD A;  3HJP A;  4KF9 A;  3MIX A;  3KMN A;  2B5X A;  2E2G A;  1GSF A;  1EGO A;  2LUS A;  3KIJ A;  2LQO A;  5CNW A;  1GP1 A;  1FB0 A;  2H76 A;  1ZZY A;  2DC5 A;  2H70 A;  4J2F A;  2RLI A;  3DVW A;  2C1Y A;  5JCG A;  4O5R A;  3RHB A;  3DXB A;  2A4V A;  2OJL A;  3F4S A;  1G7O A;  3CTF A;  1EGR A;  2VO4 A;  5ECI B;  1Z5Y E;  1TOF A;  2LV3 A;  1YDK A;  5CRH A;  3C1S A;  5J9B A;  2VCX A;  2H6Y A;  2I9H A;  3HXS A;  1NW2 A;  2H72 A;  3W6G A;  4G2E A;  4IHU A;  4KND A;  3IBH A;  2OE3 A;  2REM A;  3KMO A;  4ZBB A;  2KLX A;  3N5O A;  3HD5 A;  4IQ1 A;  1UA5 A;  1JZR A;  5HR1 A;  2VLU A;  5D93 A;  1WMJ A;  1MDJ A;  4KAE A;  3GX0 A;  2C3T A;  4V2M A;  1SYX A;  4X1U A;  3A3T A;  2QC7 A;  3IC4 A;  1G6Y A;  3GL3 A;  1SL1 B;  3GNJ A;  2PVO C;  3FR3 A;  1F9M A;  3ME8 A;  1V40 A;  4L0W A;  2YOI A;  1M9B A;  2EIO A;  3VUR A;  2IMK A;  2H01 A;  1T3B A;  4HJ2 A;  1O8X A;  3EIN A;  2HLS A;  5GZZ B;  3GX8 A;  2LTK A;  5IMA A;  4IS0 A;  1Z3E A;  3UOM A;  1M2A A;  1ERW A;  1GNW A;  5D9W A;  3W8J A;  2YNX A;  4EL1 A;  1QK8 A;  3C7M A;  1GTA A;  1THO A;  3TKS A;  4MF6 A;  1ML6 A;  4HUA A;  2H66 A;  2CA8 A;  1T4Z A;  3E3E A;  4POM A;  3D6I A;  1PFO A;  1DE2 A;  3LGC A;  3LOR A;  4BIK A;  3CTG A;  3LYK A;  4YAV A;  4ZL8 A;  2FGX A;  3DWV A;  5G5E A;  5JWQ B;  1OKT A;  1SL2 B;  1EP8 A;  4WKW A;  2G2Q A;  2KHP A;  3UAR A;  2L57 A;  4WBR D;  5C00 A;  3F6F A;  2L6C A;  3ZIJ A;  1OC8 A;  3KEB A;  4BVX A;  1M3I A;  2HRF A;  3GKX A;  3LW9 A;  1EOH A;  4OWY A;  2OAC A;  20GS A;  4NPB A;  1S3C A;  3HKR A;  4YQU A;  3KD0 A;  5KN0 A;  2DBC A;  4G9H A;  5ENU A;  3IPZ A;  2VCT A;  2MMN A;  3LXT A;  1QGV A;  1T1V A;  1KTE A;  3FRC A;  4K8M A;  2XC2 A;  2C80 A;  4LL1 B;  2KP1 A;  4KB3 A;  5ABR A;  1N8J A;  3CXG A;  4E8E A;  3GRX A;  4QL9 A;  3ZTL A;  3UVT A;  2VD0 A;  4K5R A;  4BVX B;  2O87 A;  1ZYE A;  2VM2 A;  6GSU A;  2GLR A;  13GS A;  4PNG A;  1YEP A;  4G0K A;  2CVD A;  2H30 A;  2RM6 A;  2ZNM A;  2HRA A;  1YY7 A;  2N5F A;  2E0Q A;  1XBS A;  3BCK A;  3DIE A;  2ZUP A;  1B8X A;  4I8B A;  3H93 A;  1WOU A;  1TKD B;  1EV9 A;  5ELA A;  3KGK A;  3P7X A;  4J57 E;  1BG5 A;  4K9Z A;  2K6V A;  2QA2 A;  1GUL A;  2DJ0 A;  1O73 A;  5F8B A;  3Q18 A;  3ZRD A;  3BCI A;  3CSI A;  3C73 A;  2QSI A;  2DJ2 A;  4TR1 B;  2H0H A;  3GMF A;  2R2J A;  2A2R A;  4V1A p;  2GGT A;  1ZMA A;  5J9C A;  4PQI A;  4OFT A;  3ISO A;  3QFA C;  5G5F A;  5ID2 A;  3Q74 A;  3GSS A;  5DQS A;  4JBB A;  1SKW B;  5D8I A;  1GSE A;  4GWR A;  4MPG A;  3GYK A;  3IA1 A;  3I69 A;  5DJL A;  1EWX A;  1DBY A;  1JZW A;  5D96 A;  1LJR A;  5IM9 A;  4NV2 A;  14GS A;  2LRT A;  5AIV A;  2H71 A;  1JZO A;  5ECH B;  5GST A;  2CX3 A;  4WBJ A;  2VM1 A;  3GA4 A;  4MH3 A;  2G0F A;  2OE0 A;  2M80 A;  4PQ1 A;  3ZRE A;  2X64 A;  3US3 A;  4F0B A;  1GSQ A;  4NAX A;  1URM A;  3CRT A;  4I2T A;  3HZ8 A;  3TUE A;  3LFL A;  4HQZ A;  3DEX A;  4KH7 A;  1K3L A;  1Y6E A;  2LKU A;  2FWG A;  3M1G A;  2DMM A;  3HVS A;  3DKS A;  4DEJ A;  3Q19 A;  1A8Y A;  1G7E A;  1SD8 A;  3QD9 A;  2OE1 A;  3NOF A;  2B6M A;  2PVQ A;  5DBQ A;  3LYP A;  4KW6 A;  5IMF A;  3FR9 A;  4OFM A;  4HQS A;  3U6V A;  5EY6 A;  12GS A;  4TXO B;  1VGL A;  5GSS A;  4TW5 A;  1JHB A;  1SYR A;  4CY8 A;  3QPM A;  3APQ A;  1YEX A;  2N5A A;  1GSS A;  1K0B A;  3ERW A;  2MMZ A;  3I9V 2;  3NIV A;  4EUY A;  2IMI A;  2JZT A;  1M2D A;  5INY A;  2IPA A;  1X5D A;  22GS A;  1U6T A;  2CVB A;  5HFK A;  3DML A;  3GKK A;  3DVX A;  1PSQ A;  3LQ7 A;  3WD6 A;  2C8U A;  4K7I A;  3F0I A;  4K0G A;  1OYJ A;  3I6A A;  4WEY A;  2VIM A;  3ZMK A;  3CSH A;  1UC7 A;  2KOK A;  1TI3 A;  2YJH A;  2I1U A;  5DCH A;  5ECK B;  6GSW A;  1U88 A;  2WS2 A;  5G1L A;  1NHY A;  2L4Q A;  2X8H A;  1R7H A;  2C0D A;  3GIX A;  1JLW A;  3E9J B;  2JAC A;  4GRF A;  1IYH A;  4ZB6 A;  4CDO A;  1YJ6 A;  3IR4 A;  4A5P A;  4N10 A;  3S9F A;  2H6Z A;  2H8L A;  2VCW A;  1M2B A;  4Q5F A;  1G0T A;  2WB9 A;  2TRC P;  1SKS B;  3DGQ A;  3HJO A;  5HR3 A;  1ERU A;  3ERF A;  1FOH A;  1HYU A;  3VPQ A;  3IDV A;  1MD4 A;  1PKZ A;  2VAF A;  5IPG A;  4OCE A;  3TJB A;  4K7O A;  1HNB A;  3GHA A;  3L0H A;  2CX4 A;  2WZ9 A;  1QXH A;  2X8G A;  5FWG A;  5E59 A;  1YQ1 A;  11GS A;  2GS3 A;  4ECI A;  3HHV A;  3FZA A;  1TRV A;  1XOB A;  2EIR A;  1M99 A;  2DKH A;  4ZL9 A;  2GT6 A;  4AJ6 A;  4YKG A;  4KGI A;  2V6O A;  4ACS A;  1F37 A;  2XBI A;  2J9H A;  5IMC A;  3FZ5 A;  3TKP A;  2B5Y A;  4L8E A;  4IJ3 A;  1K3Y A;  2VUP A;  5G2Z A;  2F8F A;  1A23 A;  1TXX A;  4X4J A;  4I97 A;  1EZK A;  2WRT A;  1BED A;  1F3A A;  4K2D A;  1QFN A;  2CQ9 A;  2MMO A;  4Z2R A;  3IV4 A;  4HJM A;  2AYT A;  2O8V B;  5J41 A;  1ZL9 A;  1U3I A;  2GQL A;  4MZC A;  4K6X A;  4WET A;  2YZU A;  1HD2 A;  2ON7 A;  2YZH A;  4NHZ A;  3RDW A;  2PGT A;  2BMX A;  2LQQ A;  5ECO B;  3VFI A;  1GLQ A;  1EOG A;  4OO4 A;  5HR2 A;  2PUK C;  4HS1 A;  4ICY A;  1FB6 A;  1WIK A;  3A5W A;  1TTZ A;  1XCC A;  2BTO T;  4H86 A;  2HNL A;  2PN8 A;  2H0I A;  1B4P A;  3IE3 A;  1MD3 A;  5IO0 A;  5A4W A;  1R5A A;  5KN1 A;  2KUC A;  2X8C A;  2C4J A;  3CRU A;  3JCM L;  4MH2 A;  2GTU A;  1GSD A;  3D0Z A;  1YF0 A;  2P0G A;  4KSM A;  3RHC A;  1FO5 A;  1Q4J A;  2JZS A;  4HDE A;  3M0F A;  5DQY A;  5EVO A;  5H5R A;  4IP1 A;  4EDY A;  4TR0 A;  5G31 A;  4ZB8 A;  4EC0 A;  4ISD A;  3TJG A;  3A2X A;  3TJK A;  3AY8 A;  3F8U A;  1AC1 A;  5FHI A;  1ERV A;  3IC8 A;  2WUL A;  2DLX A;  2KP2 A;  2EC4 A;  2LJK A;  3IRA A;  3CQF A;  4PUA A;  9GSS A;  2CT6 A;  3HVX A;  1Q98 A;  4MNN A;  2HE3 A;  2X4A A;  1PMT A;  2DML A;  2XBQ A;  3TJF A;  3TRP A;  2DIY A;  2PU9 C;  5J3R A;  4K7N A;  4EVM A;  1AQV A;  3QMX A;  1RK4 A;  4MP4 A;  1PL2 A;  1DE1 A;  1Z6M A;  4MJC A;  1EP7 A;  4L5O A;  1ZCP A;  3BJ5 A;  1TRS A;  3BBY A;  2LRN A;  4POB A;  3UVH A;  2GSS A;  1Z6N A;  3OR5 A;  4JU5 A;  4EF0 A;  4G0L A;  3F63 A;  1MTC A;  1W89 A;  5L71 A;  4KE3 A;  1GRX A;  2GST A;  2VL3 A;  3EU4 A;  2QGV A;  2PPT A;  4PUR A;  5ECN B;  4F82 A;  1S3R A;  4NV5 A;  3ZL5 A;  3NZN A;  3FR6 A;  1T4Y A;  4L5L A;  2I4A A;  4DSR A;  2FNO A;  5IMZ A;  1GSY A;  3D5J A;  1TW9 A;  4ULX A;  1BQ7 A;  4MMM A;  1XVQ A;  4DVC A;  4MZW A;  1GTB A;  3EC3 A;  2IFQ A;  4LL4 B;  1AQW A;  1XWB A;  5A4U A;  1EV4 A;  4HI7 A;  3KP8 A;  3N9J A;  3KXO A;  5KOX A;  3DD3 A;  4QL7 A;  5F05 A;  4O92 A;  1GUH A;  4KUN A;  2FWF A;  5FT3 A;  2L59 A;  3CSJ A;  3D4M A;  3GN3 A;  2A4H A;  2K8S A;  1USB A;  4J56 E;  5CAX A;  4JED A;  3GV1 A;  1K0A A;  4MZB A;  2R5G A;  2V41 A;  1XW5 A;  1SL0 B;  3BOA A;  3PIN A;  2JAD A;  2IFQ B;  1GH2 A;  4TOP A;  3HVV A;  2XPE A;  4PTS A;  2X49 A;  1R4W A;  4KSO A;  2VLV A;  1V58 A;  3TCO A;  1QQ2 A;  4IGJ A;  3MAK A;  1JLV A;  1PQN A;  5J4U A;  2CAI A;  4EDZ A;  1SJ6 A;  2HFD A;  4ILF A;  3VWW A;  3APS A;  4FO5 A;  4EIP A;  2WGR A;  1ZYP A;  2VOC A;  5ECP B;  3CYN A;  2AV4 A;  1F3B A;  2XPD A;  1PX7 A;  1ABA A;  2RUF A;  3EU3 A;  2EIQ A;  2R4V A;  1FAA A;  3QCP A;  2YN1 A;  4ML1 A;  1YZX A;  1WPI A;  3QFB C;  4X43 A;  5H5Q A;  1AXD A;  1J08 A;  4G0I A;  4V1A g;  5D9T A;  4JRR A;  2IJY A;  3WYW A;  1B9Y C;  2D2Z A;  5CRD A;  6GSV A;  2AUV A;  1K3O A;  4K2X A;  4MA9 A;  1TU8 A;  3GH9 A;  8GSS A;  3C1R A;  3G9B A;  4EE0 A;  3BD2 A;  2IN3 A;  2HSM A;  1TU7 A;  3CBU A;  1GWC A;  4MDC A;  3KZQ A;  2OA7 A;  1X9M B;  1TK0 B;  2AJQ B;  2GZY A;  5J5N A;  1OC9 A;  3L4N A;  3L9V A;  1WE0 A;  5DVB A;  1W4V A;  1XXU A;  4OCF A;  1UVZ A;  3FW2 A;  1OAZ A;  2HZE A;  1A8L A;  5B6N A;  4BWQ A;  5COH A;  3A2W A;  1QUW A;  4WR5 A;  4GF0 A;  5ECS A;  1MDK A;  2TRX A;  3WGD A;  5CRG A;  3F9U A;  4TVE A;  3SWL A;  5B6M A;  4CHS A;  5D73 A;  3A2V A;  2F51 A;  3RAZ A;  3FZ9 A;  5ID2 B;  2YWO A;  1TRW A;  1TDI A;  2I81 A;  4XRA A;  1OC9 B;  4USS A;  1M3J A;  2HZE B;  1BAY A;  3FKF A;  5C04 A;  3WT1 A;  2HYX A;  1PN0 A;  4XCS A;  4IVF A;  2NVL A;  3GKM A;  4ZIL A;  2DKI A;  5E4W A;  5DDL A;  2ZCT A;  4GTU A;  3ME7 A;  1G6W A;  2FWH A;  2LJA A;  1DSB A;  5JCU A;  4TXV A;  2MMA A;  4MAB A;  2XHF A;  1TRU A;  1X9W B;  1SJZ A;  4ECC A;  2M46 A;  1HNC A;  2YWN A;  4K5S A;  2LNS A;  2MZC A;  5LNK e;  2GZP A;  2DSA A;  4BPY A;  1K0O A;  4WF4 A;  5BRT A;  1CQH A;  1SU9 A;  2CAQ A;  3UEM A;  2H0G A;  2VL9 A;  2H1G A;  2VCV A;  3TKS E;  1O85 A;  1TK8 B;  3C71 A;  1B9X C;  3F6D A;  3TRQ A;  2A2P A;  2YP6 A;  1R26 A;  3J7Y k;  2RM5 A;  6GSY A;  2YAN A;  4I6X A;  3RPN A;  2LNT A;  1GSU A;  6GST A;  5CYY A;  2C0E A;  2IMD A;  1ILO A;  1J0F A;  4MCU A;  5DJM A;  4NMU A;  2VD1 A;  4KX4 A;  1VF3 A;  1FVK A;  1K0D A;  4TRX A;  1E2Y A;  2GVP A;  2J23 A;  1YF1 A;  2P5R A;  1PA3 A;  3D21 A;  3M9K A;  1GL8 A;  1TK5 B;  1PGT A;  1A0F A;  1B4Q A;  1J9B A;  4LMW A;  1PX6 A;  4ZBA A;  3ZZX A;  4XIH A;  3W8S A;  1O8W A;  3R3E A;  3ZVJ A;  5G1K A;  4FH8 A;  3ZFB A;  3GFK A;  3EMX A;  1XWC A;  3F4R A;  2HSH A;  4ZL7 A;  5A4V A;  2V1M A;  5KEJ A;  2R37 A;  3D22 A;  1XFL A;  3IXR A;  2OBK A;  2IIY A;  3MYD A;  4KCE A;  5JWO B;  1YKC A;  2JSZ A;  5B7C A;  2FCH A;  2PWJ A;  4F0C A;  1H4O A;  5DAL A;  1GLP A;  1I5G A;  4OFN A;  2C3Q A;  1O81 A;  2B5E A;  4WF5 A;  3MWH A;  1YKA A;  3KM6 A;  1ZOF A;  3RBT A;  1I9D A;  2FUG 2;  1JFU A;  3C8E A;  3PGT A;  2YWM A;  3GUS A;  2A2S A;  1M0U A;  4KDX A;  5D9X A;  2YPM A;  2R0C A;  1Z7R A;  3HYP A;  4V2L A;  4Z7X A;  3ZIT A;  4XHM A;  2HZF A;  5G30 A;  5JCW A;  3TJJ A;  2VCQ A;  4QQ7 A;  4BL7 A;  4G19 A;  3EVI A;  1A0R P;  2DJK A;  4PQH A;  4NXI A;  4PGT A;  2CZ3 A;  5DAL B;  1K0M A;  3KTB A;  4IW9 A;  4HU7 A;  2FA4 A;  3HDC A;  1FHE A;  18GS A;  4DSQ A;  5ECL B;  2CVK A;  3KH7 A;  1GNE A;  1LU4 A;  4XTS A;  3KP9 A;  1FW1 A;  4GSN A;  1ZYQ B;  5CRE A;  4O7H A;  3UAP A;  1PD2 1;  4ML6 A;  4HEA 2;  3LXZ A;  4F2I A;  3LWA A;  1BJX A;  4N11 A;  2MBT A;  5CRW A;  4BL7 B;  2LST A;  4NWY A;  2GQM A;  4GQC A;  1LBK A;  1WP0 A;  2IL3 A;  4HZ4 A;  2PER A;  2L6D A;  2HSY A;  1ACV A;  3EE2 A;  4JE1 A;  2YCD A;  3QDN A;  1O6J A;  3O3T A;  4OO5 A;  2DIZ A;  4MK3 A;  1VRS D;  3GST A;  4IKH A;  1GTU A;  3HA9 A;  4F03 A;  4KA0 A;  4CW9 A;  1QMV A;  4BWS A;  3TDG A;  4EO3 A;  4IEL A;  4HOJ A;  4OMV A;  1M9A A;  2DJJ A;  1B48 A;  5F0G A;  3G7I A;  1AIU A;  2C0F A;  3MSZ A;  1X9S B;  3HZ4 A;  4MJA A;  2C0G A;  1SK1 A;  1SEN A;  2HRK A;  4KCA A;  2PBJ A;  2HXK A;  4O5U A;  2FY6 A;  4G10 A;  2VLT A;  4NHW A;  3TRX A;  1K0C A;  3KTL A;  3L78 A;  2OBI A;  4FYU A;  1PKW A;  1HNA A;  4KDU A;  3J7Y b;  1JZD A;  3K8N A;  2VL2 C;  4MJB A;  4F9Z A;  2YWI A;  5B8B A;  2YV9 A;  4RQX A;  1FOV A;  1WJK A;  2JL4 A;  5HFG A;  1XWA A;  3UL3 A;  2CV4 A;  3TKR A;  4FYB A;  2H73 A;  3M8N A;  2RII A;  2CZ2 A;  5IOW A;  1MDI A;  2R6K A;  3QAW A;  3E0U A;  4YQV A;  3FYG A;  3LEF A;  3QAG A;  3VK9 A;  1H75 A;  3PR8 A;  2OAD A;  1K0N A;  4AGS A;  1OE7 A;  2AAW A;  1U87 A;  17GS A;  2GSR A;  3HVN A;  3P90 A;  4ZB9 A;  1EEJ A;  3FHK A;  16GS A;  1PN9 A;  2LS5 A;  3F3Q A;  1FG4 A;  2R0G A;  1OC3 A;  5HQP A;  4CY6 A;  1ZYN A;  3EUR A;  1C72 A;  1THX A;  1UN2 A;  4I5Q A;  4RUV A;  2H74 A;  1RQM A;  4POK A;  4RI6 A;  4V2N A;  2NDO A;  3H79 A;  4EIQ A;  2YV7 A;  4JZQ A;  1TP9 A;  4LMV A;  1NSW A;  1SKR B;  2IMF A;  3UIW A;  2L5L A;  3CMI A;  3I43 A;  4K1F A;  4MF5 A;  3VWX A;  5IMD A;  3QR6 A;  4ECJ A;  4GST A;  1X5E A;  3IK9 A;  4X0X A;  1AUC A;  2QA1 A;  3HJM A;  5IOX A;  3EWL A;  5EL8 A;  4HU9 A;  4K0N A;  2R3X A;  4WXT A;  2M72 A;  3FEU A;  5KN2 A;  2AB6 A;  3GTU A;  3KCM A;  3QAV A;  3DYR A;  2ON5 A;  3ZVJ D;  4XRD A;  3EYT A;  3M3M A;  3VPT A;  2FWE A;  3LG6 A;  4WR4 A;  4IBP A;  1SK0 A;  4EXJ A;  3IHQ A;  1M7T A;  4BA7 A;  2X99 A;  3SBC A;  4ECB A;  3FMW A;  3QOU A;  2QKE A;  3V1W A;  1HQO A;  1AW9 A;  3FY7 A;  2FLS A;  4PX1 A;  2BJX A;  2LJR A;  1Z9H A;  3ZIV A;  3L9U A;  1F2E A;  3UJ1 A;  2IME A;  3FZ4 A;  4LA1 A;  1A2L A;  4TR1 A;  1ST9 A;  2P5Q A;  1R5P A;  2OKA A;  5ECM B;  3ERG A;  2H6X A;  4IQA A;  2JU5 A;  3PH9 A;  1FVJ A;  1Z7P A;  3GTU B;  4TR3 A;  5AIX A;  4O32 A;  2ES7 A;  3KJY A;  2H1B A;  4XS4 A;  3F3R A;  1VF1 A;  1PRX A;  2WJU A;  3VI5 A;  4E8H A;  1A2M A;  4Q5R A;  1V9W A;  5ECR B;  4RI7 A;  4DSS A;  2I3Y A;  4YAP A;  4AF2 A;  3VWV A;  4HSC X;  1IYI A;  4D73 A;  1WRY A;  2H19 A;  1KEB A;  2P31 A;  2JZR A;  2K8V A;  4Q5N A;  3A5I A;  4XS6 A;  4AJ7 A;  2WDU A;  3FK8 A;  5KN3 A;  3TGZ A;  3IAS 2;  5CP1 A;  2GT5 A;  5EPF A;  1AQX A;  4N0Z A;  2L5O A;  2FD3 A;  3G7Y A;  3PPU A;  3KH9 A;  1X5C A;  2O85 A;  3IK7 A;  3IHG A;  5BMU A;  2MBS A;  2B7K A;  4XS4 B;  1KBN A;  1XG8 A;  2RUE A;  4TR4 A;  4IJI A;  1OE8 A;  1WWJ A;  5LCZ A;  1SK2 A;  2L4C A;  4DSS B;  5IO2 A;  3GH6 A;  5AIS A;  2GDR A;  4PUF C;  3LSZ A;  5IIZ A;  1XZO A;  4D73 B;  3U5R E;  3O6T A;  4IN0 A;  3IAM 2;  2UZ8 A;  5DAK A;  2F8A A;  4YQM A;  1ZGN A;  2B1L A;  3O76 A;  2AHE A; 
#chains in the Genus database with same CATH homology
 5DCG A;  1VF2 A;  4Z2T A;  1F6M C;  1PL1 A;  3TOU A;  3GL5 A;  4TXO A;  4YKF A;  1DUG A;  3F4T A;  4TKY A;  1SD9 A;  19GS A;  3RPP A;  3MDK A;  1XWG A;  4GSS A;  2FA8 A;  2K9F A;  2K18 A;  2GSQ A;  3UBK A;  3IOS A;  1TI1 A;  5JWR B;  2ALB A;  2B1K A;  5DAK B;  3ZLP A;  2VL2 A;  3Q6O A;  5CO3 A;  2NBS A;  1XPV A;  1S3D A;  1T00 A;  5KOW A;  4YH2 A;  1E6B A;  4AJ8 A;  3EPT A;  2PMT A;  3HY2 A;  5LD0 A;  1XVW A;  2FHE A;  5HR0 A;  1U3A A;  1EEM A;  1SJI A;  2O89 A;  4FQU A;  4N0V A;  2E7P A;  1N2A A;  1AAZ A;  3R2Q A;  2HI7 A;  2Z9S A;  1S3A A;  3HCZ A;  3M9J A;  3MNG A;  3ZFL A;  2V32 A;  3UMA A;  3WT2 A;  1V2A A;  1T8E B;  2VCZ A;  1GTI A;  2E2M A;  3TKS C;  2R0P A;  3D4T A;  4BVY A;  2B3S A;  3TB2 A;  3ZML A;  1GUK A;  3VLN A;  3DRN A;  4FIW A;  4MF7 A;  4Z2U A;  2YJ7 A;  4MPF A;  3P8W A;  1XOA A;  1O7U A;  2DJ1 A;  4L0U A;  5AN1 A;  10GS A;  2WCI A;  1BYE A;  5B8A A;  2DJ3 A;  5HFI A;  5GAP D;  4Q5Q A;  4RQR A;  5ECQ B;  3G7J A;  4PXO A;  1XIY A;  1Y25 A;  1VF4 A;  4MLY A;  1XWK A;  2HT9 A;  1XW6 A;  1BX9 A;  4O5Q A;  5F07 A;  2LEG A;  4I2U A;  1KNG A;  2C3N A;  2V2G A;  4FYC A;  3APO A;  4JR6 A;  2WFC A;  3VWU A;  4ID0 A;  4BVY B;  2F3M A;  4TN8 A;  1OVN A;  4N30 A;  4P3Y B;  2NPB A;  2MYG A;  4ZXG A;  2HRN A;  1ERT A;  2H75 A;  3ED3 A;  4MJE A;  3H8Q A;  4LLR A;  5A5K A;  2TIR A;  1T7P B;  3WGX A;  3H1N A;  4EKZ A;  4GCI A;  1X0R A;  5GAN D;  2LRC A;  3P2A A;  1XW9 A;  4OD7 A;  2B7J A;  4HZ2 A;  3TKQ A;  2H1A A;  3L9S A;  3UBL A;  1A2J A;  3EMP A;  1A24 A;  4POL A;  1ON4 A;  5AGY A;  2IWT A;  2GZZ A;  1V98 A;  1OKD A;  5D9V A;  6GSS A;  3TOT A;  1V57 A;  4JR4 A;  5F06 A;  2H1D A;  1NM3 A;  1GUM A;  4XS1 A;  4GLT A;  4ZIJ A;  3GUR A;  2JSY A;  5IMV A;  2F9S A;  1RW1 A;  3ZYW A;  5IQY A;  3GKN A;  5H5S A;  2NTO A;  4PNF A;  4KDY A;  5ELG A;  2GQK A;  2N5B A;  2O7K A;  4GQF A;  3VI7 A;  1NHO A;  6GSX A;  3LJR A;  3WGE A;  4IP6 A;  5IPH A;  1MEK A;  1TJD A;  2V6K A;  4GXZ A;  1CQG A;  3H4K A;  7GSS A;  4ZBD A;  3HJP A;  4KF9 A;  3MIX A;  3KMN A;  2B5X A;  2E2G A;  1GSF A;  1EGO A;  2LUS A;  3KIJ A;  2LQO A;  5CNW A;  1GP1 A;  1FB0 A;  2H76 A;  1ZZY A;  2DC5 A;  2H70 A;  4J2F A;  2RLI A;  3DVW A;  2C1Y A;  5JCG A;  4O5R A;  3RHB A;  3DXB A;  2A4V A;  2OJL A;  3F4S A;  1G7O A;  3CTF A;  1EGR A;  2VO4 A;  5ECI B;  1Z5Y E;  1TOF A;  2LV3 A;  1YDK A;  5CRH A;  3C1S A;  5J9B A;  2VCX A;  2H6Y A;  2I9H A;  3HXS A;  1NW2 A;  2H72 A;  3W6G A;  4G2E A;  4IHU A;  4KND A;  3IBH A;  2OE3 A;  2REM A;  3KMO A;  4ZBB A;  2KLX A;  3N5O A;  3HD5 A;  4IQ1 A;  1UA5 A;  1JZR A;  5HR1 A;  2VLU A;  5D93 A;  1WMJ A;  1MDJ A;  4KAE A;  3GX0 A;  2C3T A;  4V2M A;  1SYX A;  4X1U A;  3A3T A;  2QC7 A;  3IC4 A;  1G6Y A;  3GL3 A;  1SL1 B;  3GNJ A;  2PVO C;  3FR3 A;  1F9M A;  3ME8 A;  1V40 A;  4L0W A;  2YOI A;  1M9B A;  2EIO A;  3VUR A;  2IMK A;  2H01 A;  1T3B A;  4HJ2 A;  1O8X A;  3EIN A;  2HLS A;  5GZZ B;  3GX8 A;  2LTK A;  5IMA A;  4IS0 A;  1Z3E A;  3UOM A;  1M2A A;  1ERW A;  1GNW A;  5D9W A;  3W8J A;  2YNX A;  4EL1 A;  1QK8 A;  3C7M A;  1GTA A;  1THO A;  3TKS A;  4MF6 A;  1ML6 A;  4HUA A;  2H66 A;  2CA8 A;  1T4Z A;  3E3E A;  4POM A;  3D6I A;  1DE2 A;  3LGC A;  3LOR A;  3CTG A;  3LYK A;  4YAV A;  4ZL8 A;  2FGX A;  3DWV A;  5G5E A;  5JWQ B;  1OKT A;  1SL2 B;  1EP8 A;  4WKW A;  2G2Q A;  2KHP A;  3UAR A;  2L57 A;  4WBR D;  5C00 A;  3F6F A;  2L6C A;  3ZIJ A;  1OC8 A;  3KEB A;  4BVX A;  2HRF A;  3GKX A;  3LW9 A;  1EOH A;  4OWY A;  2OAC A;  20GS A;  4NPB A;  1S3C A;  3HKR A;  4YQU A;  3KD0 A;  5KN0 A;  2DBC A;  4G9H A;  5ENU A;  3IPZ A;  2VCT A;  2MMN A;  3LXT A;  1QGV A;  1T1V A;  1KTE A;  3FRC A;  4K8M A;  2XC2 A;  2C80 A;  4LL1 B;  2KP1 A;  4KB3 A;  5ABR A;  1N8J A;  3CXG A;  4E8E A;  3GRX A;  4QL9 A;  3ZTL A;  3UVT A;  2VD0 A;  4K5R A;  4BVX B;  2O87 A;  1ZYE A;  2VM2 A;  6GSU A;  2GLR A;  13GS A;  4PNG A;  1YEP A;  4G0K A;  2CVD A;  2H30 A;  2RM6 A;  2ZNM A;  2HRA A;  1YY7 A;  2N5F A;  2E0Q A;  1XBS A;  3BCK A;  3DIE A;  2ZUP A;  1B8X A;  4I8B A;  3H93 A;  1WOU A;  1TKD B;  1EV9 A;  5ELA A;  3KGK A;  3P7X A;  4J57 E;  1BG5 A;  4K9Z A;  2K6V A;  2QA2 A;  1GUL A;  2DJ0 A;  1O73 A;  5F8B A;  3Q18 A;  3ZRD A;  3BCI A;  3CSI A;  3C73 A;  2QSI A;  2DJ2 A;  4TR1 B;  2H0H A;  3GMF A;  2R2J A;  2A2R A;  4V1A p;  2GGT A;  1ZMA A;  5J9C A;  4PQI A;  4OFT A;  3ISO A;  3QFA C;  5G5F A;  5ID2 A;  3Q74 A;  3GSS A;  5DQS A;  4JBB A;  1SKW B;  5D8I A;  1GSE A;  4GWR A;  4MPG A;  3GYK A;  3IA1 A;  3I69 A;  5DJL A;  1EWX A;  1DBY A;  1JZW A;  5D96 A;  1LJR A;  5IM9 A;  4NV2 A;  14GS A;  2LRT A;  5AIV A;  2H71 A;  1JZO A;  5ECH B;  5GST A;  2CX3 A;  4WBJ A;  2VM1 A;  3GA4 A;  4MH3 A;  2G0F A;  2OE0 A;  2M80 A;  4PQ1 A;  3ZRE A;  2X64 A;  3US3 A;  4F0B A;  1GSQ A;  4NAX A;  1URM A;  3CRT A;  4I2T A;  3HZ8 A;  3TUE A;  3LFL A;  4HQZ A;  3DEX A;  4KH7 A;  1K3L A;  1Y6E A;  2LKU A;  2FWG A;  3M1G A;  2DMM A;  3HVS A;  3DKS A;  4DEJ A;  3Q19 A;  1A8Y A;  1G7E A;  1SD8 A;  3QD9 A;  2OE1 A;  3NOF A;  2B6M A;  2PVQ A;  5DBQ A;  3LYP A;  4KW6 A;  5IMF A;  3FR9 A;  4OFM A;  4HQS A;  3U6V A;  5EY6 A;  12GS A;  4TXO B;  1VGL A;  5GSS A;  4TW5 A;  1JHB A;  1SYR A;  4CY8 A;  3QPM A;  3APQ A;  1YEX A;  2N5A A;  1GSS A;  1K0B A;  3ERW A;  2MMZ A;  3I9V 2;  3NIV A;  4EUY A;  2IMI A;  2JZT A;  1M2D A;  5INY A;  2IPA A;  1X5D A;  22GS A;  1U6T A;  2CVB A;  5HFK A;  3DML A;  3GKK A;  3DVX A;  1PSQ A;  3LQ7 A;  3WD6 A;  2C8U A;  4K7I A;  3F0I A;  4K0G A;  1OYJ A;  3I6A A;  4WEY A;  2VIM A;  3ZMK A;  3CSH A;  1UC7 A;  2KOK A;  1TI3 A;  2YJH A;  2I1U A;  5DCH A;  5ECK B;  6GSW A;  1U88 A;  2WS2 A;  5G1L A;  1NHY A;  2L4Q A;  2X8H A;  1R7H A;  2C0D A;  3GIX A;  1JLW A;  3E9J B;  2JAC A;  4GRF A;  1IYH A;  4ZB6 A;  4CDO A;  1YJ6 A;  3IR4 A;  4A5P A;  4N10 A;  3S9F A;  2H6Z A;  2H8L A;  2VCW A;  1M2B A;  4Q5F A;  1G0T A;  2WB9 A;  2TRC P;  1SKS B;  3DGQ A;  3HJO A;  5HR3 A;  1ERU A;  3ERF A;  1FOH A;  1HYU A;  3VPQ A;  3IDV A;  1MD4 A;  1PKZ A;  2VAF A;  5IPG A;  4OCE A;  3TJB A;  4K7O A;  1HNB A;  3GHA A;  3L0H A;  2CX4 A;  2WZ9 A;  1QXH A;  2X8G A;  5FWG A;  5E59 A;  1YQ1 A;  11GS A;  2GS3 A;  4ECI A;  3HHV A;  3FZA A;  1TRV A;  1XOB A;  2EIR A;  1M99 A;  2DKH A;  4ZL9 A;  2GT6 A;  4AJ6 A;  4YKG A;  4KGI A;  2V6O A;  4ACS A;  1F37 A;  2XBI A;  2J9H A;  5IMC A;  3FZ5 A;  3TKP A;  2B5Y A;  4L8E A;  4IJ3 A;  1K3Y A;  2VUP A;  5G2Z A;  2F8F A;  1A23 A;  1TXX A;  4X4J A;  4I97 A;  1EZK A;  2WRT A;  1BED A;  1F3A A;  4K2D A;  1QFN A;  2CQ9 A;  2MMO A;  4Z2R A;  3IV4 A;  4HJM A;  2AYT A;  2O8V B;  5J41 A;  1ZL9 A;  1U3I A;  2GQL A;  4MZC A;  4K6X A;  4WET A;  2YZU A;  1HD2 A;  2ON7 A;  2YZH A;  4NHZ A;  3RDW A;  2PGT A;  2BMX A;  2LQQ A;  5ECO B;  3VFI A;  1GLQ A;  1EOG A;  4OO4 A;  5HR2 A;  2PUK C;  4HS1 A;  4ICY A;  1FB6 A;  1WIK A;  3A5W A;  1TTZ A;  1XCC A;  2BTO T;  4H86 A;  2HNL A;  2PN8 A;  2H0I A;  1B4P A;  3IE3 A;  1MD3 A;  5IO0 A;  5A4W A;  1R5A A;  5KN1 A;  2KUC A;  2X8C A;  2C4J A;  3CRU A;  3JCM L;  4MH2 A;  2GTU A;  1GSD A;  3D0Z A;  1YF0 A;  2P0G A;  4KSM A;  3RHC A;  1FO5 A;  1Q4J A;  2JZS A;  4HDE A;  3M0F A;  5DQY A;  5EVO A;  5H5R A;  4IP1 A;  4EDY A;  4TR0 A;  5G31 A;  4ZB8 A;  4EC0 A;  4ISD A;  3TJG A;  3A2X A;  3TJK A;  3AY8 A;  3F8U A;  1AC1 A;  5FHI A;  1ERV A;  3IC8 A;  2WUL A;  2DLX A;  2KP2 A;  2EC4 A;  2LJK A;  3IRA A;  4PUA A;  9GSS A;  2CT6 A;  3HVX A;  1Q98 A;  4MNN A;  2HE3 A;  2X4A A;  1PMT A;  2DML A;  2XBQ A;  3TJF A;  3TRP A;  2DIY A;  2PU9 C;  5J3R A;  4K7N A;  4EVM A;  1AQV A;  3QMX A;  1RK4 A;  4MP4 A;  1PL2 A;  1DE1 A;  1Z6M A;  4MJC A;  1EP7 A;  4L5O A;  1ZCP A;  3BJ5 A;  1TRS A;  3BBY A;  2LRN A;  4POB A;  3UVH A;  2GSS A;  1Z6N A;  3OR5 A;  4JU5 A;  4EF0 A;  4G0L A;  3F63 A;  1MTC A;  1W89 A;  5L71 A;  4KE3 A;  1GRX A;  2GST A;  2VL3 A;  3EU4 A;  2QGV A;  2PPT A;  4PUR A;  5ECN B;  4F82 A;  4NV5 A;  3ZL5 A;  3NZN A;  3FR6 A;  1T4Y A;  4L5L A;  2I4A A;  4DSR A;  2FNO A;  5IMZ A;  1GSY A;  3D5J A;  1TW9 A;  4ULX A;  1BQ7 A;  4MMM A;  1XVQ A;  4DVC A;  4MZW A;  1GTB A;  3EC3 A;  2IFQ A;  4LL4 B;  1AQW A;  1XWB A;  5A4U A;  1EV4 A;  4HI7 A;  3KP8 A;  3N9J A;  3KXO A;  5KOX A;  3DD3 A;  4QL7 A;  5F05 A;  4O92 A;  1GUH A;  4KUN A;  2FWF A;  5FT3 A;  2L59 A;  3CSJ A;  3D4M A;  3GN3 A;  2A4H A;  2K8S A;  1USB A;  4J56 E;  5CAX A;  4JED A;  3GV1 A;  1K0A A;  4MZB A;  2R5G A;  2V41 A;  1XW5 A;  1SL0 B;  3BOA A;  3PIN A;  2JAD A;  2IFQ B;  1GH2 A;  4TOP A;  3HVV A;  2XPE A;  4PTS A;  2X49 A;  1R4W A;  4KSO A;  2VLV A;  1V58 A;  3TCO A;  1QQ2 A;  4IGJ A;  3MAK A;  1JLV A;  1PQN A;  5J4U A;  2CAI A;  4EDZ A;  1SJ6 A;  2HFD A;  4ILF A;  3VWW A;  3APS A;  4FO5 A;  4EIP A;  2WGR A;  1ZYP A;  2VOC A;  5ECP B;  3CYN A;  2AV4 A;  1F3B A;  2XPD A;  1PX7 A;  1ABA A;  2RUF A;  3EU3 A;  2EIQ A;  2R4V A;  1FAA A;  3QCP A;  2YN1 A;  4ML1 A;  1YZX A;  1WPI A;  3QFB C;  4X43 A;  5H5Q A;  1AXD A;  1J08 A;  4G0I A;  4V1A g;  5D9T A;  4JRR A;  2IJY A;  3WYW A;  1B9Y C;  2D2Z A;  5CRD A;  6GSV A;  2AUV A;  1K3O A;  4K2X A;  4MA9 A;  1TU8 A;  3GH9 A;  8GSS A;  3C1R A;  3G9B A;  4EE0 A;  3BD2 A;  2IN3 A;  2HSM A;  1TU7 A;  3CBU A;  1GWC A;  4MDC A;  3KZQ A;  2OA7 A;  1X9M B;  1TK0 B;  2AJQ B;  2GZY A;  5J5N A;  1OC9 A;  3L4N A;  3L9V A;  1WE0 A;  5DVB A;  1W4V A;  1XXU A;  4OCF A;  1UVZ A;  3FW2 A;  1OAZ A;  2HZE A;  1A8L A;  5B6N A;  4BWQ A;  5COH A;  3A2W A;  1QUW A;  4WR5 A;  4GF0 A;  5ECS A;  1MDK A;  2TRX A;  3WGD A;  5CRG A;  3F9U A;  4TVE A;  3SWL A;  5B6M A;  4CHS A;  5D73 A;  3A2V A;  2F51 A;  3RAZ A;  3FZ9 A;  5ID2 B;  2YWO A;  1TRW A;  1TDI A;  2I81 A;  4XRA A;  1OC9 B;  4USS A;  2HZE B;  1BAY A;  3FKF A;  5C04 A;  3WT1 A;  2HYX A;  1PN0 A;  4XCS A;  4IVF A;  2NVL A;  3GKM A;  4ZIL A;  2DKI A;  5E4W A;  5DDL A;  2ZCT A;  4GTU A;  3ME7 A;  1G6W A;  2FWH A;  2LJA A;  1DSB A;  5JCU A;  4TXV A;  2MMA A;  4MAB A;  2XHF A;  1TRU A;  1X9W B;  1SJZ A;  4ECC A;  2M46 A;  1HNC A;  2YWN A;  4K5S A;  2LNS A;  2MZC A;  5LNK e;  2GZP A;  2DSA A;  4BPY A;  1K0O A;  4WF4 A;  5BRT A;  1CQH A;  1SU9 A;  2CAQ A;  3UEM A;  2H0G A;  2VL9 A;  2H1G A;  2VCV A;  3TKS E;  1O85 A;  1TK8 B;  3C71 A;  1B9X C;  3F6D A;  3TRQ A;  2A2P A;  2YP6 A;  1R26 A;  3J7Y k;  2RM5 A;  6GSY A;  2YAN A;  4I6X A;  3RPN A;  2LNT A;  1GSU A;  6GST A;  5CYY A;  2C0E A;  2IMD A;  1ILO A;  1J0F A;  4MCU A;  5DJM A;  4NMU A;  2VD1 A;  4KX4 A;  1VF3 A;  1FVK A;  1K0D A;  4TRX A;  1E2Y A;  2GVP A;  2J23 A;  1YF1 A;  2P5R A;  1PA3 A;  3D21 A;  3M9K A;  1GL8 A;  1TK5 B;  1PGT A;  1A0F A;  1B4Q A;  1J9B A;  4LMW A;  1PX6 A;  4ZBA A;  3ZZX A;  4XIH A;  3W8S A;  1O8W A;  3R3E A;  3ZVJ A;  5G1K A;  4FH8 A;  3ZFB A;  3GFK A;  3EMX A;  1XWC A;  3F4R A;  2HSH A;  4ZL7 A;  5A4V A;  2V1M A;  5KEJ A;  2R37 A;  3D22 A;  1XFL A;  3IXR A;  2OBK A;  2IIY A;  3MYD A;  4KCE A;  5JWO B;  1YKC A;  2JSZ A;  5B7C A;  2FCH A;  2PWJ A;  4F0C A;  1H4O A;  5DAL A;  1GLP A;  1I5G A;  4OFN A;  2C3Q A;  1O81 A;  2B5E A;  4WF5 A;  3MWH A;  1YKA A;  3KM6 A;  1ZOF A;  3RBT A;  1I9D A;  2FUG 2;  1JFU A;  3C8E A;  3PGT A;  2YWM A;  3GUS A;  2A2S A;  1M0U A;  4KDX A;  5D9X A;  2YPM A;  2R0C A;  1Z7R A;  3HYP A;  4V2L A;  4Z7X A;  3ZIT A;  4XHM A;  2HZF A;  5G30 A;  5JCW A;  3TJJ A;  2VCQ A;  4QQ7 A;  4BL7 A;  4G19 A;  3EVI A;  1A0R P;  2DJK A;  4PQH A;  4NXI A;  4PGT A;  2CZ3 A;  5DAL B;  1K0M A;  3KTB A;  4IW9 A;  4HU7 A;  2FA4 A;  3HDC A;  1FHE A;  18GS A;  4DSQ A;  5ECL B;  2CVK A;  3KH7 A;  1GNE A;  1LU4 A;  4XTS A;  3KP9 A;  1FW1 A;  4GSN A;  1ZYQ B;  5CRE A;  4O7H A;  3UAP A;  1PD2 1;  4ML6 A;  4HEA 2;  3LXZ A;  4F2I A;  3LWA A;  1BJX A;  4N11 A;  2MBT A;  5CRW A;  4BL7 B;  2LST A;  4NWY A;  2GQM A;  4GQC A;  1LBK A;  1WP0 A;  2IL3 A;  4HZ4 A;  2PER A;  2L6D A;  2HSY A;  1ACV A;  3EE2 A;  4JE1 A;  2YCD A;  3QDN A;  1O6J A;  3O3T A;  4OO5 A;  2DIZ A;  4MK3 A;  1VRS D;  3GST A;  4IKH A;  1GTU A;  3HA9 A;  4F03 A;  4KA0 A;  4CW9 A;  1QMV A;  4BWS A;  3TDG A;  4EO3 A;  4IEL A;  4HOJ A;  4OMV A;  1M9A A;  2DJJ A;  1B48 A;  5F0G A;  3G7I A;  1AIU A;  2C0F A;  3MSZ A;  1X9S B;  3HZ4 A;  4MJA A;  2C0G A;  1SK1 A;  1SEN A;  2HRK A;  4KCA A;  2PBJ A;  2HXK A;  4O5U A;  2FY6 A;  4G10 A;  2VLT A;  4NHW A;  3TRX A;  1K0C A;  3KTL A;  3L78 A;  2OBI A;  4FYU A;  1PKW A;  1HNA A;  4KDU A;  3J7Y b;  1JZD A;  3K8N A;  2VL2 C;  4MJB A;  4F9Z A;  2YWI A;  5B8B A;  2YV9 A;  4RQX A;  1FOV A;  1WJK A;  2JL4 A;  5HFG A;  1XWA A;  3UL3 A;  2CV4 A;  3TKR A;  4FYB A;  2H73 A;  3M8N A;  2RII A;  2CZ2 A;  5IOW A;  1MDI A;  2R6K A;  3QAW A;  3E0U A;  4YQV A;  3FYG A;  3LEF A;  3QAG A;  3VK9 A;  1H75 A;  3PR8 A;  2OAD A;  1K0N A;  4AGS A;  1OE7 A;  2AAW A;  1U87 A;  17GS A;  2GSR A;  3P90 A;  4ZB9 A;  1EEJ A;  3FHK A;  16GS A;  1PN9 A;  2LS5 A;  3F3Q A;  1FG4 A;  2R0G A;  1OC3 A;  5HQP A;  4CY6 A;  1ZYN A;  3EUR A;  1C72 A;  1THX A;  1UN2 A;  4I5Q A;  4RUV A;  2H74 A;  1RQM A;  4POK A;  4RI6 A;  4V2N A;  2NDO A;  3H79 A;  4EIQ A;  2YV7 A;  4JZQ A;  1TP9 A;  4LMV A;  1NSW A;  1SKR B;  2IMF A;  3UIW A;  2L5L A;  3CMI A;  3I43 A;  4K1F A;  4MF5 A;  3VWX A;  5IMD A;  3QR6 A;  4ECJ A;  4GST A;  1X5E A;  3IK9 A;  4X0X A;  1AUC A;  2QA1 A;  3HJM A;  5IOX A;  3EWL A;  5EL8 A;  4HU9 A;  4K0N A;  2R3X A;  4WXT A;  2M72 A;  3FEU A;  5KN2 A;  2AB6 A;  3GTU A;  3KCM A;  3QAV A;  3DYR A;  2ON5 A;  3ZVJ D;  4XRD A;  3EYT A;  3M3M A;  3VPT A;  2FWE A;  3LG6 A;  4WR4 A;  4IBP A;  1SK0 A;  4EXJ A;  3IHQ A;  1M7T A;  4BA7 A;  2X99 A;  3SBC A;  4ECB A;  3FMW A;  3QOU A;  2QKE A;  3V1W A;  1HQO A;  1AW9 A;  3FY7 A;  2FLS A;  4PX1 A;  2BJX A;  2LJR A;  1Z9H A;  3ZIV A;  3L9U A;  1F2E A;  3UJ1 A;  2IME A;  3FZ4 A;  4LA1 A;  1A2L A;  4TR1 A;  1ST9 A;  2P5Q A;  1R5P A;  2OKA A;  5ECM B;  3ERG A;  2H6X A;  4IQA A;  2JU5 A;  3PH9 A;  1FVJ A;  1Z7P A;  3GTU B;  4TR3 A;  5AIX A;  4O32 A;  2ES7 A;  3KJY A;  2H1B A;  4XS4 A;  3F3R A;  1VF1 A;  1PRX A;  2WJU A;  3VI5 A;  4E8H A;  1A2M A;  4Q5R A;  1V9W A;  5ECR B;  4RI7 A;  4DSS A;  2I3Y A;  4YAP A;  4AF2 A;  3VWV A;  1IYI A;  4D73 A;  1WRY A;  2H19 A;  1KEB A;  2P31 A;  2JZR A;  2K8V A;  4Q5N A;  3A5I A;  4XS6 A;  4AJ7 A;  2WDU A;  3FK8 A;  5KN3 A;  3TGZ A;  3IAS 2;  5CP1 A;  2GT5 A;  5EPF A;  1AQX A;  4N0Z A;  2L5O A;  2FD3 A;  3G7Y A;  3PPU A;  3KH9 A;  1X5C A;  2O85 A;  3IK7 A;  3IHG A;  5BMU A;  2MBS A;  2B7K A;  4XS4 B;  1KBN A;  2RUE A;  4TR4 A;  4IJI A;  1OE8 A;  1WWJ A;  5LCZ A;  1SK2 A;  2L4C A;  4DSS B;  5IO2 A;  3GH6 A;  5AIS A;  2GDR A;  4PUF C;  3LSZ A;  5IIZ A;  1XZO A;  4D73 B;  3U5R E;  3O6T A;  4IN0 A;  3IAM 2;  2UZ8 A;  5DAK A;  2F8A A;  4YQM A;  1ZGN A;  2B1L A;  3O76 A;  2AHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...